K N 0 W A B 0 U T

MARS 8t MERCURY
Dr. Shanker Adawal
s. Titie
No.
Contents
Page
No.
Preface ......... ..................... ................................................. lot
1. Basic of Astrology ................................................. ................. 1
2. Mars - Indic!JtiOnsof Mars .... ............................... ............... 26
3. Mars In various Houses .......................................... ............... 53
4. Inftuence of Mars on Vasb.J - Child Birth & Marriage . .......... 108
S. Mars & Venus In Marriage ............................ ........ 123
6. Matrimony and Evils cl Mars (Kuja Oosll) .......................... . ! 39
7. kuja (Mars) Maha Dasa Phala ................................ ............. 1 58
8. Impact of Retrogade Mars ................................... ............. 167
9. Mars- Various Houses in Bhrigu Nacl .................... ............. 178
10. Mars & Nadi Astrology ........... ............................... ............. 190
11. Diagnosis of Diseases f\1ars .................................. ............. 210
12. Planets& Profession Mars ................................................ 217
13. Mars transiting the Houses .............. ..................... ............. 219
14. Ashtakavarga of Mars ........................................... ............. 222
15. Planets- Aries & Scorpio Ascendart. rul ed by Mars ........... 225
16. Impact or vMious Nakstltras ruled by Mars ............. ............ 232
17. COnjunc.tion of various Planl!t:s ruled t:1f Mars ......... ........... . 241
18. uapayos- MalefiC Mars ...................................................... 250
s. ntle
No.
Page
No.
19. Mercury - Indications of Merrury ........................ ............. 256
20. Mercury In various Houses ................................................. 2 78
21. Karkatatvas Lordship of Planets & Houses ......................... 321
22. Impact d critical understanding ........................... ............. 323
23. Retrograde Mercury ............................................. ............. 326
24. Ascendant Analysis ......................................................... 336
25. Mercury & Nadl Astrology .................................................. 357
26. Impact of various Nakshtras ruled bv Mercury ........ ............ 37 2
27. Buclho (Mert'"'f) Moho Dosho Pholo ...................... ............. 381
28. various Houses In Bhrigu Nadl- Merct..ry ........................... 403
29. ~ t a k a v a r g a d t-\errury . ................ ..................... ............. 414
30. Diagnosis & Q;seoses- Mert'"'l ........................................... 4 19
31. Mercury Transitrlg the Houses .......................................... 425
32. Merrury- t-1arriage & Sex ..................................... ............. 427
33. Merrury& t-1arital Affairs ....................................... ............. 429
34. Planets & Profession Mercury .......................................... 440
35. Conjunction d various Planets n.led by Mercury ................ 442
36. Upayas - Malefic Mercury ..................................... ............. 452
<Preface
Instinct. Freewil , Karma, God an:f Creation are the toPes which
are frequently discussed. from all W8lkS of life lean on these
words.
The two planets dl:scussed here are 'f.1ars' and 'f\1ercury' and In
one of the earner books we had talked d Jupiter and Sat...-n.
Jupiter Is a planet wt'kh sigrifles the Inherent potential d a person
and ea<:h i ndividual has certain propensities as is seen in our daily
interactiOns. Saturn iS the of the efforts and the ' NOW.
which determines the potential that can be tapped by work and free
will. A weak l.Jpiter and a strong Satum is perhaps an unlucky pel'$0n.
Mars ard Mtrcuy set the pace in life.
Mars is tM planet which govtrns strtngth, acti on and on the
extreme side I.e. war wNie Merwry Is Ule planet of intellect, trind and
mathematics in one's behaviour in al walks of life.
A strong Mars IT'I(Jy make a person aggressive, ha"ng
qualitieS an:l the will to do it - a man of acticf'ls; be.! if this iS
with a weak Merrury governing the calaJiatlons and heltea, he may
perform actions which are perceived as foolishty aggressive. A strong
Mars !Mth a strong f.1ertury brings forth a person who is balanted and
leads a gocxl life. Here again we need to hbVe a h::llistie approbeh as tht
PAlllA I.e. the vessel length and l>readth of IM>Ich Is governed by
.llpiter. The lJCiions a politician, btl'elluuat a businessman and for
that matter ev&y n:Jividual Itt on the play d
two planets - Mars iNld Merrury.
Mars, If wong, produces a Kshatriya (lighting lnstlr<:ts) and Merauy,
a Vaish (businessmaon), and perhaps the caste system cl today was in
the past more from the perspectiye d a person in a jX'Ofession
towards which he by his Inherent nature Is aligned with.
viN
In the present c:ontext, however, the morats and ethics have
changed, whiCh have to be borne: in mind studying a horoscopt.
A successful businessman today will peshaps a weak Mars and a
fairty stro1"9 r-1erQJry. This is be<:ause a weak Mars oonnetted with ttle
housed b.JSinf:SS or self makts him to be a master deceiver, tits from
Ule back and will not be straight forwar-d. These qualities are evident In
today"s but it l1"lolfY lead to problems in married life and perhaps
haW! relbtions outsidt marriage if Venus is not strong.
Hy book Is a collection of comp:>sed material avalable in fragments,
grotps and sets to give the reader an understanding d the two pt.lnets
In a hollsUc mamer.
variOus chapter"S on Ule impact of plall@ts, nat we, their transits
etc. should be Interpreted In relatJon to other planecs as written above.
I have written tl'lis took for a lbyman as well as ttle studfnts d
astrology and the pundits, as 1 believe, this compHatlon wll provoke
thoughts.
My thanks 10 my moth..- Or. KJ\shna Saks<na who has encouraged
me to write and has been a motivator. The freedom to ct> and spend
time caMot be possible witholt your wife's stpport al'd ffri gratitude
10 Renu and above all the srrlle of my daughte.; Vrinda- a Gudiya, is a
part of my enet9Y Invigoration.
I am thankful to all who helped In compiling, ecltlng, transcribing
and other a550dated activities with spec:ia;l thanks once again to Nagi,
Pinku and Tinku who have always me of and this
Is Important for me with the cancer and Mithuna R.ashl d mine.
Moon in Gemini gives a wavering mind.
Nart'ldet Sagar jl has always been a soute of Initiation and splrring
me into action.
Astrology is a combination of logic and statistical evidence, and like
any other sderce, is based on assumptions, ttle research of which will
be an eW!r OI"J90ing process. All that 1 pen down iS d-edicated to my
father late Shri Kallash 0\andra, a great contributor to tNs science In
his life time. My tshta St.'i Krisfvla's tlessing.s, mercy and arrangements
are above all and pray to hi"n at all times.
Cliapter 1
CBasic of ,ftstro{OBJ
A h;)roscope is si mply a IT'IaP of the heavens showing the exact
posi tions, M a given tif'n(!, of the Sun, Moon and planets within tht'
framework d the zoc: Uac In relation to a partlrulat place on Earth. The
mathematical process of casting a h::lroscope involves the science of
astronomy, while interpreting al the factors in the horoscope chart
involves tM art of astrology. 1 shall not txplai n t he ted'lni cal and
mathematkal pra<ess of calrulatlrq the aauat horosoope, but pro..tde
an scope of a particular c:l Zoclac sign and respective
house with suggestiY! There are twt!lve parts d the Zodiac
slgl called Rashls. Eadl slgl of llle Zodiac 30 degrees In extent The
Zociecal signs are talx.llated as below:.
Sign Extent Represented Number denoting
by
The sign
Aries 030 degrees Ram I
Taurus 3060 degrees &.AI 2
Gemini 6090 degrees Pair of lovers
3
Cancer 90120 degrees
Crab
4
Leo !21H50 d<9rees
Lion
5
Virgo
!50!80 d<9rees
Malden
6
Ubla
180.210 degrees
Balance
7
Soorplo
210240 d<9rees
Scorpion
8
Sagittarius 240.270 d<9rees
Bow
9
capricorn
270.300 d<9rees
Crocodile
10
Aquarius
300.330 degrees Pot 11
Pisces 3 30. 360 degrees Pair of fish 12
2
Group of Signs
The signs can be categorized Into three groups from Aries
onwards. They are termed as moveat1e or cardinal, fixed and common
or trv.Jtual, signs Indicate an energetic and d.,.,amlc
nxed signs, a tenacious and stubborn nature; common signs, a
changeable nature.
MOYeable Axed Common
Aries TMiru.s Gem hi
Cancer Leo Virgo
Libra
Scorpio Sagittarius
A<JJarius Pisces
Each si!J'I starting from Aries onwards Is also sOOsequentty termed
as odd (or male) and even( female). All odd signs are cruel and
masculine and al 59\s are mild and femlrine.
Odd Even
Aries Taurus
Gemini Cancer
Leo Virgo
Ubra
Scorpio
5agitl>tiJS
capriCorn
AQuarius Pisces
The Signs can also divided Into four groups, representing the basic
elements - fire, earth, air and water. Thus the sigls, starting from Aries
onwards are termed subS<uertly as F'.ery, Earthy, Airy and Watery.
Fiery Earthy Airy Wab!!ry
Aries Taurus Gemini Cancer
Leo Virgo libra Scorpio
Sagttarlus C.pricom A(JJarius Plsoes
3
Significance of the houses
Si gnificance of the houses: The twelve houses (as usually
understood) in the: horoscope sq.ify aspectS of a man's life as
gl"'n below:
First Personalty, body, face, appearance, health.
Second Wealth, speed!, family, neck, tiToat, right eye.
Third Brother or sister, courage, short joexneys, hands,
ear.
Fourth EducatiOn, rrother, Muse or land, general
happiness, matemal Uncle, chest.
Fifth
irtelligence, fall'll!, positiOn, love, stomach.
Sixth Diseases, debts, sorrows, injuries, notoriety, aunt or
oode, waist, enemies.
seventh MarTiage, desires, seJOJal diseases, lions.
Eighth Death or longevity, Sf!)Q.Ial orgal'l$, obstacles, uneamed
weatth, acddenl.
Ninth Fortune, character, religion, father, long journeys,
gondson, thighs.
Tenth Profession, father, rank, authority, honour, success,

Eleventh Gains, fulfil lmMt of desl..,., fr!Mds, left ear,
ankle.
Twelfth Losses, misery, expendture, contort of bed, sai"Vatlon
or moksha, feet, left eye.
Planets
The names of the planets in the Hlncll system, as well as the
westem system and their symbols are as follows :
RAYI SUN
0
CHANOAA r-100N ])
KWA r-1ARS
.,.
BUOHA
MERCURY
y
GURU JUPITER
21
SHUKRA VENUS
9
SANJ
SATURN
~
I NORA URANUS
...
VARUNA NEPTUNE
,.
The planets riAe aver the;r ass9led signs ~ d consequently while
they h a ~ ~ e great powrer in their own slgls, they are weak in others. The
assigned signs of the various planets are as follows :
ARIES MARS
TAURUS VENUS
GEMINI MERCURY
CANCER
MOON
LEO SUN
VIRGO MERCURY
LIBRA VENUS
SCORPIO
MARS
SAGITTARIUS
JUPITeR
CAPRICORN SATURN
AQUARIUS URANUS
PISCES NEPTUNE
Their exalted, strong and weak positions may be grouped as
follOwS :
Sign Exalted Strong Weak
Atles Sun
..
Sa tum
Tauru.s Moon
-
Sun
Ganlni
- - -
cancer
l.Jpiter
Mars
Leo
-
Sun
-
Virgo r-1ereury
-
Venus
Libra Saturn Venus Sun
Scorpio - -
Moon
Sagittarius
-
Jupiter
-
caprk:orn
Ma-s -
Jupiter
Aquarius
-
5atum
-
PIS<* Venus
-
Merauy
In the e.xalted positions, the planets are very powerful, and with
ex.perienoe one can specify the exact degree where the planets attain
their fullest power. Here are some examples:
Sun in Aries 19
Moon In "nlurus
1'
Mars in Cap-k:orn 28"
Mercury In VIrgo ts
Jupiter in cancer '1'
Venus in Pisces
27"
Saturn in Ubra
20
The opposite points in the signs d the ZOdiac are the degrees
where the planets are extremely weft..
Amongst the planets, there are compatible planets and
Incompatible planets. They can be termed as friends and enemies.
They are grooped as follows :

Planets Friends Enemies
Sun Moon, Venus, l.tplter, r-1a rs, Saturn
Nepb.me, MeraJry
Moon Sun, Mercury, venus, Mars, Saturn, uranus
Jupiter, Neptune
Mars Sun, satlJ"n Mercury, verus, Jupiter,
f'loon, Neptune, Uranus
Mercury Moon, Venus, l.Jpiter,
t-1ars, Saturn
soo, uranus
Jupiter Sun, f.1oon, Mercury, Mars, Saturn
venus, Neptune,. uranus
Venus Moon, Men:ury, Jupiter, Mars, Saturn
Neptune, Sun, Uranus
Saturn Neptune Sun. Moon, Mercury,
Venus, Jl.4)iter, Uranus.
The strength of ttle planets is in the following ascending orders:
Uranus, Neptune, Saturn, Mars, Mercury, Jupiter, Venus,
Moon and Sun.
The planets are strong while they occupy the houses of
e.xaltadol\ own houses or h::>uses of frlerds.
Particularty Mercuy and Jupiter are in the fust
house, the Moon and Venus are strong In the fourth house, Saturn In
tfle seventh house and the Sun and Mars in the tenth hwse.
Planets are weak, when they occupy the enemy houses.
Asterisms
The twelve Signs of the Zodiac are dMded into twenty seven
equal parts, starting from the first point of Aries. These are caled
Asterisms. ln the Hindu Astrology, they are known as 'NakshatrctS'. The
various planets Me m.Jd'l influenced by the position they are placed in
7
the Asterism.
In the Hindu system r$ Astrology the Asterisms in which the moon
i s plac::td at the t ime of birth is of great Signinc::ance. The term
'JANMANAKSHATRA" - Asterism of llfrth, Is actually tl'e p05itkln of 11\e
moon in the Asterism at the time of birth.
The Asterisms and their longituclnal de17ees may be tabulated as
folows :
Nakshatra Asterlsm Longitude
Ashwlnl Beta Ariells 13"20'
Bharani 35 Arietis
26'40'
Krittlka Ela Tl>url 4ri'
Rohinl AJde:baran
53"20'
Mr59ashlra Lambda Orklnls 6640'
Ardra ~ h a Orionis 80'<1'
Punarvasu Beta Gen*lorum 93'20'
Pushy a
Delta ca...:ri 106<10'
Ashlesha
Alpha Hyd 11>e
12ri'O'
Makha
Reguius 133'20'
Purva Phatgunl Della leools 146'40'
Uttara Phatgunl Beta Leonls 16o'O'
Hasta Della Corvi 173'20'
Chltra
SpiCa Virgins 186'40'
Swat! Arcturus 20o'O'
Vlshakho Alpha llbroe 213"20'
Anuradha Della Scorpio 226'40'
lyeshtha Antares 24ri'O'
Mula
Lambda Scorpii 253'20'
Purva Ashada Della Sa glttari 26640'
Uttara Ashada S9'na sag ittari 28ri'O'
8
COrtct .. !rem fMC 19t
Nakshatra Asterlsm Longitude
Shravana
Atpha Aquiloe 293"20'
Ohanistha Beta
30640'
Shatha 8hlsh19 Lalrbda AQuarius
32o'o
Purva Bhadrapada AIQha Pegasi 333"20'
Uttara Bhadrapada Gama Pegasl 3-46<110'
Revatl Zeta Piscum
36o'O'
The various Asterisms have definite influen-ce on the Jt!ysical and
mental characteriStics of the natives. It IMY be sunvnarized as folows:
Ashwlnl
Natives of Aslwtirj are usually bealtiful in aA)earanoee. They love
to be adorned in good je-wellery and dotMs.. They are Sharpwitted,
accompli shed and Usually tMy have a ca lm

Bharani
of Bhar3ni usually havt: an immense zest for life. They are
lntdlect\Jally Inclined, and ha"" a scienti fic bend ci mind. They enjoy
good health and prosperity. They have a steady mind, and they sddom
tel lies.
Krittllca
Natives of Krittika have a strong physique and they en;oy good
health and long li fe. Usually they have ins.atiable lust, and t hey are
greedy in their eating habi ts. As a rule they are very cunning and
deceitful. However, they are .-.dined to enjoy fame and soclal y they
In high cirdes.

Rohlnl
Natives ci Rohlnl usually have exPtlonally la<ge eyes. They are
honest and truthful in their dealings, a nd generally t hey are generous
and charit!lble. conversatiOnalists, they hbve an Lnperturbtd
mind.
Mrigashira
Natives of Mrigashira generaOy suffer from inferiority complex. They
are preservi"lg In nature, but love an easy way of life. Money COr'l"\eS to
lllem easily.
Andra
Natives d Andra are usually not very trustworthy. Generally they
are not very sincere. They are proud and often self-<:ertered. They are
given to quick temper.
Punarvasu
NMMs of rarely enjoy good health. They can eaSily
become addicted to ak:ohol and drugs. Though they are generally
polite and tac:tful, when aroused, they may easily loose control over
thtir tonguts. In buSille"S$ dealings are usualty clever and
cunning, if necessity arises.
Natives of Pushya usually have a calm mind. Highly intellectual,
they are usuall y dl.tiful, law abiding, and riglteous.. They are oobl e in
o<.tlook, and they are phllantiYoplc.
Ashlesha
Natives ci Ashlesha generally have a robust physique. 1hey are ci
a cheerful and they have a zest for life. However,
10
it is not unusual to find some of them insincere and cunning.
Gratefulness iS oot a CJ.18Iity assoCiated with the nativeS d AshJeshb.
Makha
Natives of Makha love an easy luxurious life. It Is rare to find
industri oos people among them. They love to surround themselves
with beautiful things, partiCularly nowers of colour and fragrance.
Pro-lty comes to tllem easily.
Purva Phalguni
Natives d Purva Phal guni are phl anthropic minded and noble
hearted. They are generally pleasant In their behavb.Jr, and tactful In
their speech. They have the knack to see ahead and therefore they
make very good businessmm. HONever, they sl.lfer from unsteady
rrind.
uttara Phalguni
Natives of Uttara Pfla,Sguri usually suffer from poor appetite. They
are inteUectualty inclined and healthy minded. Generalty, they are
sincere, truttlul and noble hearted, though
Haslll
Natives of Hasta are usualty brave and chivalrous. Besides other
noble: q.JalitieS, they are gr;!ltef\JI and Charitable. lielwever. at times they
can be merciless and stealthy. They are usually p-osperous In Ule later
part of life.
Chitra
Native of Chitra are especially dlstlnglished for their beal.tiful
physique. They are noted for their shapel y figure and attractive
features, particul arl y eyes. They are fond or good clothes and
ff
ornaments. Though they can be considered good-nah.red in
they are n usually Wrpwitted and bright. It is n Ulusual to ftnd
11\em being stingy.
SWati
Natives d 9.<1athi are well known for their diglified and polished
mamers. They are rttelllgent, scholarly aoo are able administrators.
Tactful In their beh.aviour, they have great self-contrd. Dutiful and
genetally law abking, they excellent dtizens.
Vishakha
Natives of Vishakha are well known for their jealousy and
stinginess. They are short tempered, but at the same time they are
god fearing and honest.
Anuradha
NaUves d Anura<lla are c:lstilguished for their beautiful hair and
eye lashes. Dutif1A and gocHearing they have g-eat for \tie
opposite sex. Thty will be prosperous and honoured by the great.
Howe-.er, nattves of Anuradt\a wit nnd themselves ludcler in a foreign
soil
Jyeshtha
d have very bad tfn'1)ers, C#Ving way to vkltent
outbursts at times. Generalty, they are not very prosperous, though
they are charitable. They have very ff:Ytl friends.
Mula
Natives of f\1uta are very proud peopte. They have bad tempers
and not favourably disposed towards relatives. They have a constant,
steady mind ard they love dlsdpline.
12
Purva Ashacla
NatNe:s of Purva Ashada stand o\A In a aowd because of their tall
stature. Generally they are proud and noble minded. Kind to people,
and generous to the poor and needy, natives of PurvaAshada are loyal
friends, blt dangerous etterries.
Uttara Ash ada
Nati ves of Uttara Ashada are distinguished by their majestic
appearance. Strong and muso.llar they usually have long nose and
chisel ed They have good dis<:ernlng eyes and they are
generally gentte and kind. Food of good food and good oompany, they
are always of a pleasant disposition.
Sluavana
Natives of Sh,.,.na dlstirgulsh themselves for their hi!P lr(ellect
and noble quali ties. They are generally of polished manners and
dignil'il!d behaviour. They have great enthusiasm for life.
Dhanishtha
Nati ves of Ohani shtha are well known for t hei r independent
nature and liberal ouuook. Highl y for their courage and
valour, native of Oharlshtha are also generalty fond of music.
Shatha Bhishag
Natives of Shatha Bisha possess hi gh i ntellect and vi rtuous
conduct !WdJys b"uthful and oocort1)romising, thty a.-e the beloved d

13
Purva Bhadrapada
Na!M>s of 1'\fia Bhadrapada are to melancholy. They
usually think lesser of themsdves, than they are actually worth. They
are intelligert, and are: usually gifted They easily tJve in to
jealousy and greed. Generaly they have very little faith In God.
Uttara Bhadrapada
Natives of uttara Bhac:tapada have a g-eat aptitude for arts and
science. Usually talkative they are argumentatiVe, but tactful and
diplomatic. They are 9'flerally charitable and kind.
Revati
Natives of Revati posses a perfect build and a robust constitution.
They are poP'Jar. heroic, and nave great attraction for the oppoSite
sex. Tactful and diplomatic they have a wandering mind. 81.4 seldom
they do anything blamewcrthy.
Each sign contains 2 '4 asterisms. And each asterism is 13 2fY
extant.
Each asterism is suiH:IW:Sed Into four equal parts called "Pada". Of
course each Pada is jJ 20' eJCtant.
When the moon is passing through certain "'Pada"' of some
particular Asterisms at birth, the effects can be VfSY harmful to ttle
child, mother or the father. [f, the evil effects are averted,
other benevolent planetary combinations, the child may live
upll> a ripe old age, and enjoy great prosperity and glory In lfe.
To mention In par1frular, M,._ I, Ashlesha Mal<lla I 0< Jyesl'tha 4
can be very dangerous to the fife of the ctild.
Planetary Aspects
The Benef"lc Aspects
Semi Sextile
Conn- one or several planets by an angle ot 3r!'. Slig,tly good.
Sex tile
Connects one or several planets by an angle d 6fP. Good.
Trine
Connects one or several planets by an angle of 121)). Very good.
Qulntile
Connects one or several p&anes by an angle d 7'fJ. good.
s, Qulntlle
Connects one or several planets by an ant;e of 144. Sligtl:ly good.
The Malefic Aspects
semi Squa.re
Connects one or se:ve:r.!ll planets: by an angle or 4s<' . Slightty bad.
Square
Connects one ()( several planets by an of 000. Bad.
sesqul Quadrat e
Connects ooe or seval planets by the angled nsO. bad.
15
Quincunx
COnnects one or several planets bv an angle d 1500. sr.gtl:ly bad.
The oppooltlon
Connects one or several planets by an angle c:J 1800. The planets
being opposed, their qualities are not able to be manifested freely.
bad. (In Hindu Astrology this aspect is howe...er considered good). I
tend to agree that opposition leads tn conflict.
These aspeas are caled malefic or unharmonious, because the
COMecting planets are positioned within the Zodiac signs with wtllch
they have no affinity at aiL
Now there are two other aspects that are important The Parallel
symbolized as "P'" and conjunction with the symbol "s"'. The conjunction
which has no angle at all can be beneticWtl, If the coupled p&anets are d
a similar nature such as:
Moon Jupiter
Venus Jupiter
Venus Moon
Sun Jupiter
Sun Venus
The coo)mc:tion is malefte, when the narure d the urited planets
don't agree. For exa"'1)1e :
Saturn Mars
Sun
Uranus Mars
The pbratlel, however, is of a different nat....e. In the
there is a <Xlft.mn with the heading whkh Is by
the So.tth or North of the celestial equator, in terms of Latitude ...men
the two planets are equidist21nt on either side d the C8!Stial
ttlen they are said to be situated In the same degree or declination.
,.
lmll"'((terial of their degrees in longitude, they attract or aspect one
another. and tnis aspect iS krown as the " Parallel"' aspect reprtsented
by the symboi"P". The effect ctP" Is similar to that cl conjooctlon "s".
Of the various beneftc and maleftc aspects the most powerful ones
are the Trine and the opposition. And the other aspects fan in this
of importance.
SpeaJium
The horo-scope ls oot oomplete wfthout a table of aspects formed
by the different planets in the hor05Cope. And ttlis is cal led "Speculum".
In order to c:afcu\Me tM speOJ1um, yre to conSider the planets
one by one, and count how many each Is apart from the
others. The distance then calculated, if they correspond to any of ttle
aspects are said to be formed.
However, tM difference in l ongit udes of planets may not be
necessarily lei', 4s<', 60', 90', or Uri'. They may vaoy by a f<Yw degrees.
Therefore, a margin cl ]0 Is generally known as the "''RB'" d Influence.
Bhavas
In the Indian system of Astrology, besides the effects of signs and
planets, the house positions h.ave also been taken Into cof"Qderatkln.
These houses are known as the Bhavas.
It Is already known that thete are houses compri:sed by the
twelve signs. The remains in one sign for abol.t a month in the
horoscopes or all persons born duMg a month. Ar'd wtlie: In that sign
he exerts an rtfluence peculiar to his tenanting that particular sign.
Various pia nelS, induding the 51.1"1 a I'd the r-1oon make different
with the Eastem horizon as viewed from the place of birth. And
this angle detetn*les the house position ol a planet.
Each house represents some part of the !'Iuman body,
relationships, friends, filaoclal positions and other depar1merts ciiWe.
And to diagnose a horoscope we have to take no consideration the
17
planet ownilg the muse and the plonets CX:OJPVing or aspec:ting ttle
house.
When different Signs rise in the eastn h::lrizon, t he subSequent
signs comprise subsequent houses. Thus if Li bra Is the rising sign,
Capricorn constitutes the 4tll house. Simitarly if Leo is the risil"9 sigl, the
fifth house will b@ sagittarius. T'hen Jupiter, th-e: ruler of S&gittarius will
be tile 1om of the fifth house.
The Sun and the Moon are the lords or one house each, as they
own one 59' each, but Heirs, Hero.ry, Jupiter, venus and SatLrn are
the lords of two houses because each d them own two signs.
Rahu and Ketu become the lords of any house as they do
not own any sign.
The house posi tions mi!ly be grol4)e:l as follows :
Angl es ( KENDRA): The fourth, seventh and the tenth
house are known as angles. Planets herein are deemed to have g-eat
influence on the native i n bringing him and fame.
Trines (TRlKONA): The first, fifth and ninth houses are known as
Trines. Planets in Trines are also considered g:>od and pov.oerlul.
Suocedents ( PANPHARA): The second, fifth, eighth and the
eleventh houses are known as Succeedents houses. Planets herein are
considered weak and they bring about Indirect results.
cade:nts (APLOKlMS): The third, sixth, ninth and the twelfth
houses are known as caderts.. The planets herein are considered weak.
and to some extent malefic, mai nly affecting the mental side.
All the departmerts c:J a man's life, health. wealth inteUi gence,
rrisery, happiness, friends, enerries, relations, trade and
travels etc. come l.llder some house or the other.
According to the Indian system, certain planets have certai n
aspects, which are very good. They are as folbws :
18
Sun in the Jt" House
Moon
In the .,,. House
Mars
in the and ttl! at"
Mef'Cir( In the :rn House
Juplter In the 5"', 7., and the <P House
Venus in the 1"' House
Sa tum
in the J td, 1"' and 111i" House
Rahu
In the .,.,. House
Ketu In the House.
These: aspects are considf!red to apply to the whc:ie house, and d
course they are neither good bad on their own, but depend upon
the p&CIInets in relation to one arother, an:l to the horoscope.
In the earlier chapters of the book, we have already diSOJssed
characteristics of the varioL6 planets in detail, arxl their inAuence on the
natives.
Yogas
Planets plaoed In certWI particular positions v.tlkh have remCII'kable
effects on their natives are cal led the Some of the spedal
Yogas are described below :
Raja Yoga
When the lords of the Ninth t.>use and Tenth h>use are situated
in one another's house or are in conjunc.tion with each other in either
of Ute above hou.ses, they produce "Raja Yoga - good l uck i n all
undertakings.
KesariYoga
When moon is in Kencta"' position to Jupiter. the eftects procl.tce
"'Cesarl Yoga", and the nattve is blessed with a keen lnteliect, Md a

c;apadty to speak in large assemblies. He wil ocx:vpy high position and
amass fame.
Lalcshml Yoga
When and the lord of the Ninth house Is ., Slh, tP' or In
positi on d "Kendra .. and at the same t ime in hts own place, " LAKSHMI
YOGA" is prodi.Ced. The natsve wi l be: bl essed with a luxurious life,
happy family, health, weafth and all the other comforts of life.
Saraswathi Yoga
verus, Jupiter and Mercury in the position d Kendra or Trikona or
In the 2f'ld house while Jupiter ocruples his own house, the effect
proci.Ked Is "Saaaswall>i Yoga". The native wUI be blessed wi th a keen
intenect, and wi sdom. He will be a good in poetry and
mathematics. He will also amass wealth and enj:>y a h3PPI famity ife.
Ruc:haka Yoga
When Mars occupies his own place and in the aspect d bine to
the Lagnb, the native will enjoy the effects of Ruetlaka Yoga. He will be
blessed with wealth, fame and vtctory.
HamsaYoga
When Jupiter is placed in his own touse and in the aspect of trine
to the l.bgna the effect i s "Ham.sa Yoga". 1l'lt natiY! will enjoy great
prominence r. SO<Iety, actnlratlon. and a commandeering position. He
will be envied even by his enemi es. He wil possess a beautiful body and
a Chariatble mind.
BhadraYoga
When Mercury is placed his own house, and is in the aspect d
trine to the Lagna, the effects are Bhadra Yoga. The native will enjoy
20
long life.. keen intellect,, wealth and prominence in soddy. He wil be a
goOd speaker in the: assemblies.
MalavaYoga
When Is placed In his own house and Is In the aspect d trine
to the l<qla, effect is Malava YQ9<1. The native is tiessed with g-eat
wealth, enormous property, large family, posh velides, sei'V3nts and
keen Intellect
VallakiYoga
All the seven planets, if they cx:cupy one house each, beginning
from Lagna, vallald Yoga is effected. The nattve will be
very talented In music, danclrg ard fine arts.
5asakaYoga
When Jupiter occupieS his own house and iS in the aspect of t:rint
to the Lagna, Sasaka Yoga is effeaed. The native Ylill be l*:ssed with
great wealth an::l al comforts in ife. &.rt he wil be a pel'$00 d easy
virtue.
DhamaYoga
When all the seven planets occupy signs consecutively from the
Lagna, Ohama Yoga, is effected. The native will be a very philanthopi<;
minded person.
Chamara Yoga
When a benefici al planet O<<uples the Lagna, whk:h Is weU
aspected, and t he lord cl t he Lagna is also well asped:ed, Chamara
Yoga, is effected. This is a hlghty deslrabte Yoga. The native will be
blessed with long life, great wealth and fame.
21
Dharldra Yoga
When the lotd of the 11
111
house In S'n, 12tt. or Is occulied
or aspected by malefic planets. Oharidra Yoga takes effett. The native
will be poor. deVOid of comforts in life, subSvient to others, and
possess awkward and uncouth behavbJr.
Chakat3 Yoga
When moon is in the flh or 12" house from Jupiter, Olakata
Yoga is effected. The native will misfortunes and various
dlsappolntmeru In life.
Khemudra Yoga
When there are no benevolent planets in or on either side of the
Lagna, or In the moon's place, or In thei r Kenctas, then the Khemudra
Yoga is effected. The native will in poverty, though bom rich, and
lead an undesiral* type d a life.
RajjuYoga
When all the In a horoscope ocx:upy the movable
Rajju Yoga is effected. The native will be famous, enjoy interrupted
fortme,s.
Dasa
Dasa system Is a vefY Important part of Indian Aslrology. EV<!IIts
are timed by the planetary periods called .. Oasas .. and transits caled

The oasa system divides a man's life into periOdS, subper1ods, and
which are ch.Macterfzed by the various planets.
Moon is the starting point in life. It is believed by the seers of Hindu
AstrolOgy that moon exercised the influen:::e man's lifl!.
22
There are two main varieties of Oasas, the "'ASHTOTTARI
OASA .. and .. VlMSHOTIARI OASA'". Here, we Shall dt.al with the
Dasa only, whictlls more popUar and considered to be more
correct. As per Vim$hottari Oasa the life time of man is 120 years and
thiS period iS di\lid! among planets in following manner:
Sun's Period
6 years
Moon's Period 10 years
Mars' Period 7 years
Period 18 years
Jupittr's PeriOd
16 years
Saturn's Period 19 years
Mercuy's Period
17 years
Ketu's Period 7 years
Vtr'l.ls' Period
20 yell"'
Total 120 years
These are the major periods for tMlich the planets hold sway and
they foUow a fixed order.
In order to fineS the Dasa at the time of a person's birth. we first d
all have to find ot.t the "Nakshatra'"' at the: time of birth. " Nakshatra"' are
actuaRy zodiacal divisions In argular dstanre of 13"20" each, and they
are a convenient order d calculating the longitudes of planets. Each
Nakshatra ts named after a brd, and a fixed point Mesha with
"Krittil0 .. Nakshatra. The NakshMras follows the order SU", Moon, Mars,
Ratu, Jupiter, Saturn, Mero.uy, and Venus respectively as t heir
lords, lnvnecUatety followtlg Krittika.
The angular dstilnce of each Nakshatra being 1J020", the full
cycte of 120 years Is covered by the nine periods- giving us 11'2t:r x 9
= 120 or one--third of the passage of moon over the full Zodiac.
Therefore, by the time the moon has c:overed 120 degrees the li fe
cycte of UO years can be assumed to have come to an end. On this
basis, the progressing of the moon by one degree, has been equated
to one year d life.
23
The Nakshatra of birt h known as "Janma Nakshatra"'- the
consttll ation in whiCh t he moal iS at bi rth - can be taSity
asoertalned from the table of Nakshatr.l divisions.
In order to calculate the Dasa as well as the balance Dasa period,.
at the ti me of a person's birth, all we have to do i s to refer to \tie
Raphael's Ephemtris aoo calculate t he longitude of fl'Oon, from tht'
time of birth, St.btraGt f rom It the Ayanamsa of the year of birth, and
ha\ling sec\l'ed the ex-act: position cl the moon ac;c;ording to the ln<ian
system, I>( refring to the table cl Nak.Sh3tra civiSions, we ascertain
the exact Nakshatra at bkth. And from the same table we know the
opening Qasa. N<m the only t hing remaining for us to find is the balance
of the Dasa period outstanding at tile time of birth. There is a very
method or finding t hiS o11.
We already know t hat the meastR d a NakShatra iS 1J020". This
being the case the total numbet of years of the opening Oasa Is
equated to I 3'20". Therefore, goes without saying thot the llQrlion
of the years that are proportionate to the degrees yet to the covered
by the moon, In order to complete the balance degrees In the
Nakshatra, wi D be the outstanding years d the opening Oasa. Once we
haY! foood the opening oasa, and balance period left in the opening
Dasa. the other Oasas will folow a fbced atder.
As an example we assume that moon has traveled ,044" in Re\0ti
Nakshatra. In order to f ind out how much of Mercury Dasa is
outstanding at the ti me d birth, we foiiON the steps as giyen
below :
The total measure of Nakshat.a = 11>20' subtracting ,044 from
13"20'. we get :-
13"20' - 640' = 640'
11>20' 17 years.
640' x 17
=
1320'
6"40'
8 years and 6 monthS.
Tile bal ance period d MeraJry Oasa at t:irth i s 8 and 6
mc:nths.
After the: Mercury Dasa Kttu foii O'NS for 7 years. Ketu iS then
foliowed by Venus for 20 years, Sun, for 6 Moon for 10 years,
Mal'$ for 7 Rahu 18 years, Jf.4)iter 16yeal'$ and Satum 19 years.
Transits
the influer-.::es of the planetary periOds and slbperiOdS are
of major ifrc>ortance arriving at an aurate analysis of the horosoope,
"'Transits'" are al so important to preci<:t the future eW!flts. "Transit"' is
Astrology the passing of a pl anet through a particular part cl the
Zodiac- In other words throut;jtl partialar sign. The birth chart, or the
horasoope is fixed one, giving us the location of the planets as they
M!re at the time of bkth. Howe\ler, the plane:ts are not statiOnary, and
they are al ways going round In their orbits. Therefore, when we
consider effect ol transits, we ac:tualty take into ac:court, where in their
respecti ve the vari ous planets are in the heavens, at a
particular part of the native's life for which transits are being
considered.
The method of transit In the Indian System cl Astrology is known
as "Godlara'".
The house of the moon at birth is taken as the first house, and
the transits of the variOus planets i s cala.Jiated from that starting point
In Indian Astroloqy the moon slgl is oommonly refened to as "'Janma
Rashi': while in the Western 9)1$tem. it is known as the "'Radical r-1oon".
And the positions of the variOus planets at the time of tranSit are
known as the "'transiting Sun"', "Transiting Moon': "'Trans!Mg Metc...-y"
and so on, in the lnclan system of Astrology as well as the Western
sy,..m or J>&rrAo'lf.
Suppose a person has the moon in Gemini in the horoscope at 1M
time of birth, and on the day he oonsults the Astrologer the Moon Is In
Sagittarius, then we say that the transiting moon is the seve"!th from
the Jarma Rasti.
25
When a parti cular pl anet transits some places f rom the Janma
Rashi, and if another iS transiting a aru, ttl@ efl'C!Cts d
ttle former's transit ate obstructed. These sensitive areas- obstructing
places - are known as "Vedh.e:" in Sanstrit
Now we go into the study of Mars and Merwry where these basics
are to to have an understanding.
26
Cliapter 2
9rf.ars
INDICATION OF MARS
l n Hindu astrology, Mars i s a first-class mal efic capable of
hanning any or al of itS associatiOns. It destroys by d aggri!S.SiOn,
violence, lmputslveness, acx:iderts, and It also, however,
gives energy, drive, determination, and the aOii ty to put one's petSQnal
deSires abOve of others. I f Mars i s weak or in a
horosoope, the petSOn will lack amtitlon and m<XIvatfon, whle success
rernain5 elusive.
Mars also rules oowage and bravery and an ml ltary functions.
Therefore, generals and commanders, as well as anyone who has the
dtsire to rule or le&d others, a strong or placed MarS.
TNs is also the planet of passions and desires, and has much to do with
sexual activi ty. Another function of Mars is that of mechani cal or
teChniCal ability. As suCh it creates surgeons, engineerS, mechaniCS, and
Ulose who exoef In the use of their hands.
The main difference regarding ,.1ars between Hindu and
Western aso-ology is that in the Hindu system Mars is the indicator d
brOthers nd ,;-. (e."Pt for tho! eldeSt) and lllnded property. Th>t
aside, the only point worth reiterating Is that In this eveM-orlented
systf!m of as.trology, a malefic such as Mars causes troubles, disputes,
and miseries: untess: it is posited in one cl the: 4 Upac:hay.!l, or growing.
houses (the )1'4, 6th, lOth, 11.,. ), where maleflcs produce good
effects.
Mars is i'l'\ilsculine, dry, ard fiery. It is best placed in the 10.,.
27
house, where it re<:eives Oik Bala, or directional strength. It operates
bf:St in OJpricorn, its exalted Sign, and worSt in cancer, its fallen
placement. It also functions wei In Atles and Scorpio, the 59'1s It rules.
The gem to wear to strengthen a weak or afflicted t-\ars is red coral.
Th! friendS who welcome Mars in the:ir t . > ~ . . ~ S t s are the Sun, Moon, and
Jupiter. Merct.ry Is ks enemy, while venus and Satum are neuttal In
friendship. The scriptures relate that t-1ars represents the 5 senses.
Another common name for MarS is Mangal.
INDICATIONS
Brothers and sisters (except the eldest)
Courage, bravery, heroic deeds
Sports
Property
Mechanical Of technical ability
8uiders, designers, engineers, $1J1'9eons, med'lanics
The military, soldiers, policemen, war
Generals, corrmarders, rulers
Acx:lden1S, violence, fires
Cuts, buns, bruises
Ambition, mottvatlon, desires
PhySical S1Jength, forcefulness
Temper, atgumetlts, fights
Weapons, guns, explosives
Energy, aggresstvetless
PassiOns, sex
t-1edlcal operations
The bk:lod, muscular system, bone: marrow
Tuesday
SOt.them direction
28
This is the truth about Mars
Blessed are tflose who have attained graotness l1y sacrificing tflelr
Nves t.o prote<t the honour of women.
blessed are those who have spe<>t tflelr lives struggling to
vhnqulsh those who oppress lh6 w(Mk and then ultli'nately have
saalfla!d their Nves In that strvggle. struggle """'nt that mN/ions
of people were freed f10m the oppression which marred their lives and
brought them peace and happiness. These people wiN go down in
IVstDry as those who were H N Katve.
Introduction
History over thousands of years has proved that all nations.
societies and individuals need a prector. In the ab5ente of su::h a
protector, that natiOn, SOCiety or in:tiviclJal i s put to great suffertng and
Instability. Heinous crfmes like murder, dacoltles, and general arson
become the order of the day and c.haos prevails. To prevent exactly
thiS kin:l of chaotic atmosphere and to ensure that soCiety is
was Invented the law and f Its enforcement. the pollre. The small
batr;n i n the hands o1 a poli<:eman, and his khaki \l"'iform are proof ot
society's control CNer crime.
Aft man's body developed, he developed a conscience because
he needed strength for protection and development. Slmllar1y when
ttle rUet and the peo'* become one as a nation, it needs strength to
prote<;t itself and a conscience to control h;)w that strength is used. Or
more predS.ely, to ensure that is: not misused. Jf man does: not
haw strength he Is akin to a CXJtPse - utterty useless. Sln-.arty a nadon
witho\A c.ourage is useless too. It cannot survi'Wie too long. This is why
tht police and armies are formed and maintained to k.ee:p ali ve the
nation.
It has been stated In earlier books too: If one visualises the
constellations as a body, the Sun is the body and the soiJ while
the moon is: t he mind. When the two come together to form the
human being, the protector they need Is Mars. l rYespedtve of whether
a man has like an eleJ;Ilart, he needs the knowledge ol how,
when, where and why to use it. Mercury iS reprt:sentative of irteltect
but that Is raw Intellect . Then Intellect Is not refi ned. Once that
intelli9enc::e becomes knowledge, i t siiJ1ifies the presence ol Jupiter
and the person uses hi s t o work. Tired with work,
conterled with tis ad'llevement. the man wants to rest and relax and
enjoy t he finer thi1"9S in rife, and there comes in Venus. Thus he comes
to the tnd of hiS days and those are ruled by 5ab.Jrn. l n all these states,
the power that a man has Is what Mats' role Is and that Is what Is
discussed in this book.
The physical features of Mars
In ancient lore, Mars is called t he son of the Earth. The Sun Is
viewed as t he father and the Moon, the mother. This i s why some
ct\aracterisUcs of the Sun and the Moon are atways seen In Mars. This Is
what the ancient astrologers had to say about Mars:
Acharya: Shareeralakslumah vakraha naal)'Uch)OU raktagiHiaha.
lt is never very exalted. lt is sl ightt y sitver-gold and more reddish. lt
appears to be a t:lend of the redness of the Sun and the sltver-gold
colouring of the Moon. Satvakunjaha - Its property Is Sa\Vil or pure.
Kslitisuto neta - lt is a general. lt iS very red. Samajjaa bhounaha - lt
lUes the head. Place- fire, Garments- bumt, Coleus- golden. Season
- summer, taste - bitter.
Kalyanavarma: Otetaha Kt111arahasenapatihl.
Direction - south, Deity - Karti'keya, Gender - maswline, caste -
Kshatriya, taste - bitter, place - fire, garments - shabby, metal - go'd,
time - day, season - summer, saiptures - samaveda, tt'us are the
characteristics d Mars.
Baldhyanaath : Satvam kujoneta, saraktilgauram,
taaragraho dharaasutaha. This planet i s simiar to a star. It is mostly
mal efic. Al most inevitably It appears f rom the rear. Kshmaajo
chatushpado. It square. Kujo shal/aat visancharontaha - it
nJes over mountains and j ungles. Baalo dharaajaha - It is a child -
30
aariNla shaiJkhaadhipaha - It is the lord of branches. Colour - pale
(bl oodless), - gol den, season - summer, place - fire,
location - from Lanka to t he Koishna o111e< (present day Sri Laoo and
Deccan plateau), caste- Kshatriya, property - tama or
- rn.?Jsculine, ttf'l1lo - fast. taste: - bitt, t ime d day - day. Its is
cast Shanlna mahlsuthaha. Mars Is atways defeated by Satum
in a dash.
The posi tions Is which Mars Is powerful: Aaraha swavaara
MeenlMiinkumbhllbhrigalumNtayam;.
neeshu. Vakte cha yaamyJishl raashlmukhe balaadadlyo. Meene
kulirabhavane cha sukhilm d(ldaati. On in the Ninth ph.ase, in
the ascendart, in Pisces, Scorpio, Aquarius, and Aries. At night, when it
is retrograde, in tht southern dirtion aM when it iS in the beginning
of a sign. It gives rooch happiness r. Pisces and Cancer.
The Illnesses brought on by Mars are: Peenabeejakafash
6Sfrapaavaka granthi 1YXJ91rina ditfidra jaamayaihi. Veerasho ViJ9ana
bhairaVMdiiXIirbhitirnM$hu dhM3SIAahlt.
Cough, suffering caused by the saiptures or fire. bois, eruptions
and pimples, tumoU's and abscesses, arthritis, aliments caused by
extreme poverty and possession by the demons that surround l.ord
ShWa in his form d Bhairav.
Parashar : Satva kunjaha, Neta gyeyo dharaatmajaha,
ralddbhaumo, bhaumaha- devata. Shadaana-naha,
bhaumrnaannarah(J, bha-uma-ha agnihl, kuja-ha kshatriyaha, aarah(J
tamaha, bhaumaha mauaa, bhaumavaaraha, bhaumaha tiktaha,
bhaumalu!l daksNne, kujaha nislwyyam baleenaha bhaumaha krishtte
cha baleenaha krooraha-. Swadlvasasamohoramasaparvaha
kaalaveeryakramaataha shakubugushu charaadhyaa vidhwito
veeryavat araaha. Sthoo/aan janayati sooryo durbhagaan
nsooryaputrakaha. Ksheeropetaan tastha chandraha katu
kaadhyaandharasvtaha. Vastram raktetchitram kujasya. Kujah(J
dhaatu aara v;gyjy.v dhaatu.
Gunakar: SaM bha!ITlft, net.v bhaumalla bhaumaha shonaha,
bhaumaha d&Skhlnaha, kuragraha kujaha, bhaumaha kshatrfyaha,
31
SiJCNTinaatn mahija, bhaumaha naraha, l:hautnilha sahotyaha, bhaumaha
SkJNidJih.!, vastram agnidugdh/Jm, t:.naumaha kaanch.!nm, bhoomaha
bhaumaha tlktam, bhdumaha dfnam, bhaumaha agn4
bhaumha tamaha lcshr:tmC18tanayaha.
Sarvaarthachintamani: Bhaumonarapaalya mukhyaha,
bhaumaha atirikt.tha, bh.tumllh.! agni, bhaumaha dlJskhiMfllJ,
bhusunoohu paapaha, kujaata narejyaa, bhauma majjaabheda,
devast/llt8na agni, vastra - kvjasyNgnihitam klinnam, hiranyiNTI tv
dharaasutashcha, raktam chitram, kujasy11, ritu - grishma,
bhoomisutasya tlktam, dinam kujasya, bhauma dhaatu graham, oo
dhwarhastthi, sen;Jf)atihi, kujaha, satvam kujaha.
Jayadeva: ANa kv)a - satvam. ksMijam
buvatesaranya,haarlnam. Madhyaanyaha bhoomijaihl, bhatJmaha
bhauma - dhaatu, bhauma -
bhauma - shesha, dasktinamtl<haaha, netaabhatmaha, mangalaha,
swami, swarnak.aaraha, kshitaihi wtraha, yuva kujaha,
prakrit)'aa dttwkhado nrinaam, aar.tha kshatraanaam, naktam Wlaha,
kujashcha baleeMha, devasthaana, agnl, vastm - vanhlttdha, dhatu -
meena, bhauma vidnm.
Mantreshwar: Chauramlaichha krish(Janyuddha bhoomi-
digyaamaya kujbSyodit1J. With thieves and k:lwly peopl e, at the fire
place, battlefield, soultlern direction, these are the places ruled by
Mao;. Bha(JmaomohiJilSlhoaniJ9iJtawddho bhri<swomalwrai k<Jkkuta
shivaakapjgraghraduttraalltta. Cooks, armed guards, goldsmiths, goats,
chickens, j ackals, monkeys, vultures and ltlleves are rul ed by Mars.
Deities, fire, jewel - coraL The person has a special mark or mo'e on ltle
side of the body. Mars is also the kud of thorny pi arts and bl.l5hes.
Its ge 16.
Punjaraj: I ts deity is the demon Guha, its colouring is like bk:lod,
its dlreaton Is south, it Is ruled by the samaveda, it Is auel In nature, Its
caste is kshiltriya, it is mascUine in gender, its taste Is bitter and its time

William Ul y: In the sequence of Mars is after It is
small in size and itgiows like fire. 1t comp&etes a revolution of the gala'/('(
32
in 686 days ard 22 hoi.I'S. lt is usualy at 431 latitude in the northern
ard at 647 in the southern It iS retrograd!
for about 80 days. It Is stabl e for onl y two or three days. It has
complete power (f'lf:r Cancet", Scorpio and PiSGeS - all three water 59'1s..
It is masculine in nature, dominates the is warm, cty and a fire like
planet. It is the creator of quarrels and conflict.
Now let us debate what these astrdogers have said:
satva - saamarthya: This planet has both physical and mental
courb9t. The COU!ilge needed by people in the military, polite, soldiers,
drierS is the d0f'l\3in of M3rS. The second type r:l couragt is
that by those who are involved in tM de:vetopment d the
nat:km- that is politicians and statesmen. And that too Is the OOmaln cl
Mars. These people want revolutionary dlan9f! and are willing to lay
down thtir l fl.tes for it. The merul courage of these peof* who flK:II!
adversity - they are extremely stubborn ls al so granted by Mars.
Those freedom fighte" who were in Indio 1908 were olso "'"""'ed by
Ma ...
Neta: (General in the Army): Almost au astrdogers have ascri>ed
!tie property of generalship to this planet.
Metal: All ancient astrologers have said that the element of the
brain is by ln my oJnlon this may be because the brain
element is dose to t he head on which Mars is said to have pcl't\ler. We all
know that body rat ts by Jupiter aoo Mars the Besh and
hence I that onty Mantreshwar Is right when he says that Mews
is the ruler of the and bones.
Place: Everyone has said that Mars is the rUer d the fireplac:e. Jf
one looks at t hi s pl anet from the naked f!(e it appears to tJON like fire
and 1 suspect that It i s MatS" ooburlng which makes peoJ* S<l'f that k Is
the ruler of the fireplace. The c:ordition of a person's kitchen can be
assessed by examining t he tocation of Mars in hi s horoscope. The
statemert that Mars Is the rul er or thi eves and the lowly appears
incorrect. These people should be ruled by Saturn btA the cor(enOOn
that Mars rules the batUefield if correct Net orly does Mars rule the
battlefield. the side It tilts Is the side wNch wins.
Gannents: Kafyanavarma and Parashar have described bright
col ourful garments. The others hbve sai d the person's dothes are
btlllt. Even people have a saying that clothes tear on f\1onday, get
burrt on Tuesday (the day oUed by Mor.;) and on Wednesday lhe day
nJed by Mera.ry they remain fine. This is wt'ft' peopte that one
should not wear new clothes on a Tuesday. Personally 1 disagree with
the point that Mars has any influence in a person's clothes being b11nt
Here 1 ten:l to agree with Katyan&varma. I believe, moreover, that Mars
rul es the clothes of pol oomen and soldiers and that Is why these
people have sturdy, cllrab5e uniforms..
Element: GolcJen. f\1ars and gold both haw: a colo11ing that is a
mix c;l yellow and red and hence people believe that Mars is the bd c;l
gold but thi s i s not correct. I n t his day and age gotd has much
Importance In matters pofitk:s and rulership and those are
subjects under the dcmain of t he Sun. Henc:e it is the 5\ll which is the
nJer of gold. In times d battle, it is iron which is importlml caoons,
weapons etc. are all made d ron Md hence it Is Iron which Mars rules
(l!ler.
Season: Sinc:e people suffer greatty from the heat in the days c;l
summer whiCh precede the rains, it is correct to assune that f\1ars iS the
r\Aer d this season.
Direction: South. The scr1pt11es say that Yama ts the lord d the
south since Mars like Yama i s one who rencJers a person lifeless it Is
correct to say that Mars is a ruJer of the South.
Good and Evil: Most people had branded Mars a malefiC planet
Since it ordinaril y b'lngs many trouble:s onto a person's head, this Is why
peopl e assume that it Is malefic. But that Is only one sided the story. lt
does have benefidal properties t hat have not been researched or
described adequately.
Deity: Lord Shiva's son known as Kartikeya, Sl0nda and also as
Shadanan was the general of Shlva's forces battle. And hence Mars
the"'"' of the battlefield 1\Jied by tom.
Gender. It Is a male planet.
34
Caste: Kshatri ya or wanior. Since r-1ars is a sitJ1ifi<:ator of battle
htnce the caste dtseription.
Taste: I di sagree with Acharya and Gunakar who s:ay f.1ars
lnftuences a bitter t aste. Some others ha...e said that Mats govetns the
chilli tastebudswf"lith I think is correct. Q'lillies are ordinarily red like Mars
and hence t his is th! inftutnced by MarS.
nme of the Day: Mars is powerful during the d!ly.
Scriptures: Mars is considered the signific.ittor of t he
but I bealuse this hoty book is a boW of ps.alms. And tht
coMection between the two is not explained by any one. While Mats
does have influerr:e on tone d 'o(lic;e it be considered to have
any swing on musi c. Hence I think we Should view Mars as t he
slgnlflcator of ltle AthaiVa Veda.
Sphere: Some astrobgetS have said that Mars Is t he ruter d the
etherwolicl where t he woricf's baser creatures dwell whil e yet others
say i t is the same as HelL I agree.
Rising: It rises from the rear.
Animals: It is a base an:l carnfvorous plarx!t, hence it is powerfi.J
CNer dogs, jackals, wolves, cats, cheetahs, lions, rec:Hac:ed &angt.rS, etc.
In fact that Is why MilfS has been described as a roor legged planet by
some astrologers.
Abode: Whi le some astrologers have sai d Mars' abode is t he
moootain ranges, other have sai d it traverses the st.y. I personally feel it
Is the mou'ltalns where Mars resides because most of the animals It
holds power Cflet live In the mouruins and jungles. N<:rle of them are
birds so t he possibility of Mars residing in the sky is oolikety.
Gem: Coral. The reasoring for ttis is not clear and I suggest that
one goes by expelience.
Once there was a boy who was very i1He"1)ered and o::wnmitted
many sins. He would frequM.Iy fall down and get hwt as a resutt d
which he always had one or the other bleeding injury. He frequently
sustained bums and oort.racted illnesses. An Iranian traveller gifted him
a caal d excellent c,..tality and the resul ts were Ob..tous from the Yl!ry
minute that It was tied onto his neck. He stopped l oWig his temper and
gave up his biKI habits. Consequently he stopped injlred, tv.Jrt
or burrt and there was: no further loSS: of blood either.
Element: Speed is: rUed by t he Sun but f'.1antrestrwar has placed
lhls .-. the domain of Mats. Punjaraj says Mats Is an Earth element while
other .strologoers say that it is a fire dement. r thin.k Pvnjaraj is fitlt but
Mars cotJd have s:ome coooection to fire also. Those who say it is an air
element or speed dominator are wrong.
Physique: Most peopt! have said that MarS' physique iS bLrly and
!his is aR)arent from the physical build or the people In professions that
it cbminates: soldiers etc. They always have to maintain and
erect posture without looking downwMds: even on::e..
Defeat: Ma.rs is: atways defeated by satum S1l'f most astrdogers
but In my experience It Is the exact opposite that happens. 1t Is
ine'llitabty Mars which defeats Saturn
Hour of Power: It has already been stated when r-1ars is
powerful. Parashar says that it is powerful during twilight hourS while
layadeva says it is powerful at 1 feel the latter is right He has also
mentioned that is at the zerjth of Its power at midnight. tn the
greater cortext of life cycles. the afternooo d a man's life is his earty
twet'lles when he starts becoming responsible, earning prestige and Is
generalty endowed with wealth, material pleasures and famil y sec\.rity.
So that is when Mars is strongest in his life.
Relationships: Relationships with friends are governed by Mars
but these we will discuss later.
caste and Creed: Ordinari ly MarS is a warria'. Jayadeva, however,
describes Its caste as goldsmith, a trader dass. Even In the book on
So'"'" ,,.,. is described os belf"9 goldsmith by coste. This is fact
because goldsmiths when forging gokj to U5e fire to purify it.
Birth marks: These are d two kinds. The first is motes, scarS and
birthmarks of a physlc:al nature. The second Is a person's rept.tation
36
being scarred by hi$ bad behalliour towards other people.
Face: It is SilkS that Mars fates the sot.them direc.tion but I cannot
find any explanation wtr,o.
Grain: Mars rules over split red l ertils called Masur Oat To appease
Mars r. a malefic state large (fJantfties of this lertll should be donated to
charity.
William Llty: It is called a planet of the night because its worlc
manifests fastest at night tt is a fire ruled planet and that is why people
call it dry or
The majn properties of Mars
Acharya : Kroor(Jhak tarunamoortirrudaaraha paitrlkaha
sudlhpalbha krishamMhyah!. His physique is sturdy and strong. His
appearance Is like a youth. He Is generous
1
d valha and
is corrupt His waist is slim. He is not tall bt.t i:s quite fair bt.t that is
already mentionM earr.er.
Kalyanavarma: VMaswah.J pingata/ochaoo hadda vapoordipt&>
agnikaantlshrachalo. MajjavaatYoonaambaraha patutaral shoorshcha
nlshpannavaak. HBSVBankuchita keshadiptiuoonaha pltaatma
kbStaamasaha. Shrudlandaha saahasiko vidhyaat kushalalla samraktD
gaurahB ku)aha. He Is short, red-eyed, <:A a SllJrdy physiq.,e and glows
like fire. He Is mischievous, favours red ckXhes, able, brave and speaks
welL His hclir is short and wavy. His body has abundal'( bone marrow
and his constitutioo is Pftha. Ht is charismatic tut cnRI, gi\len to sinfi.J
ways. At the same time this person Is brave and excellent at
acc:omplistli1"9 what he sets out to do. His C<:lf1l)lexion Is redclsh-gold.
Baldhyanath: Kroorekshanaha staroonamoortlroodaara
sheelaaha pitaatmakaha suchapa/ krishamMJhyadeshaha. Samrakta
gauranxhlraavayavaha pratJJapi kaami tamogt.mJratastu dhar&!tkul'nlt'-
araha. He has a burly physique, youthful appearance, generous nature.
He i s of pitha temperament, corrupt, slimwaisted, reddishgold
eotnplexlon<, has beautiful manners. He: Is brave., debauched and has
bad habits.
37
Parashar: Krooro raktaaroon<> bhat.mash<:hiJjJalodaaramurtikaha.
krodl'li kriWmMJhyatMJurdwiJJIM. He is muscular,
reddish compleldoned, generous, <i quid<
to anger an:t has a sUm waist.
Gunakar: Hinstro hrasvo shoorastyaagi
Ma})aasaaro raktagauro yuva syucha
shashrachchanda plngalaak.sho maheejaha. He is short and stocky,
charismatic and radiant like a fire is to moths, briWe, 9f'lerous, d pitha
temperament. d sinful habits, has abundant bone marrow in hi s body,
has a reddish..gold complexion, youthful, quick to anger and of a
youtttut appearan-ce.
sarva rthachl nt.aman 1: Kopagnlnetraha sitarak.ktagaarraha
pitatmalcashrachalabuddhiyuktaha. KrishanglfYUktaal7llJsabuctdhiyukto
bhaumaha prataapi rlJtikelilolaha. Hi s eyes are red like fire, his
complexion Is "* he is d pitha temperament, has a fickle lrird, his
behaviour is dry and tis nature is sinful. He is brave but debauched.
layadeva: AarosapyudHrospl ch peet8netraha krooreksha
nosase!u tarunaatmakashcha samraktagaurashchapafostihinstraha
pitaushmavaan majjk;Jyaasusaaraha. He ts g-enerous, has yellowish eyes,
has o ITVJSOJior physique, is yoothful, hos o reddisll"9Qid <0"1>1elclot1.
mischi evous temperament, very destructive, has a pithb and
dehyQated constitution. He has abu'ldart bone marrow r. his body.
Mantreshwar: Madhyekrlshaha kunchltadlptakeshaha
kroorekshanaha paltrlkaha ugrabudhihl raktaambaro raktatanur
maheejaha ASirandost)tJdbara starunostimanjaha. He has a slim waist,
wavy and glossy hair. mu.SOJiar physique and pltha constitution. His
lntdlect Is deviant and t'e has an excess d marrow In his bones. This
person is cruel but generous an::t
Put'!jaraj: Hlnstro wva paitrlkam raktagauraha plngekshano
prachantha, ShooropyodMraha satamaastrikono majjaadhaadhiko
bhootiN'Jayaha sagaravaha. This person ts destrudl...e., youtttul, d pitha
temperament, redclsh brown complexioned, with eyes like a flame, of a
miitant nature, brave, generous, arrogant and sinful. His face is
triangular and there is a lot of marrow r. his bones.
38
MahiMiev: Dushta flak krishamadhyo raktasitaangaga
paitriMWmcllllla dhemxJUrllhiJ prataapyiJarlll'lll. HiS physique: is
flawed. He Is young, reddish complexioned, of pltha oonstltutlon,
mischie\40us, genO'OUs, and has a slim woist
William lily: Those ruled by Mars are of medium and sturdy
physiqueS. They larg! bones and are: generllll y dehydratOO. Their
compledon Is reddish and that Includes a rust toned oolourlng ot hair.
Their physique is angul&r and sharp and their bearing is conftdent and
fearless. Such persons are hardwoOOng and ftMiess. II Mars is in
Eats, the petson Is brave, fair complexioned and tal . SI..Kh persons have
very hairy bodies. lf it is in the West the person's complexion is very red
and he is short. His is lliiiTOW and skin is smooth. Body hair is
sparSe. His hair i s yellowi$h and his manner is dry.
Si monlte: He has a good physique but i s Short. Hi s body is
dehydrated. His oonstltutlon Is strong. His colouring Is red and his
physique is He has a crooked nose, red arw:l rjossv hair. an
appearance that glows like the fire, a good fortheM. Thi s person is
lnduSb1ous, disease free and ambitious, these are the traits d Mars.
Now, referring to the properties bestowed by Mars on
its in the horoscope William LJy says: brave and valiant, one
who assumes that all others are fods, who ignore trends, self
conftdent. bony physique, alwll'fS ready for battle, one
who is forever gettirg into trouble, one will l"()t concede defeat on a"'(
count. one who praises himself all the time, one who bef".eves that his
are the acNevement b!.llmmerses timself In wortt at all h es.
If Mars is in a the person Is a chatterbox, has a poor
physique, quarrelsome, destructi ve, i s a thief and murderer, is
debauched and a shler. He Is fldde a gust of vMd, a da<:ok though
brave, cruel to the point d being lrtu,man, and one who cbes not fear
god. He does not cace for anyone, he is not tl\lst'Northy, is fearsome
and a terrorist by nature. Desaibing the benefits by Mars v.t.en
Is an a good position In the sky, Adla<Ya says: V/pul.>avlmilldmutti!V
kinshiJbshokavarnaha sfoota rvchira mayiJkhastaptataamraha
prabhaabhaha. Vicharati yadi maarge chotaram medineejaha.
Shubhakrldavanipaanaam haardkJashcha prajaanaam. This means his
body i s his COIT'C)Iexion red like the flowers of the Ashok.a or
KinSht.* tree, its rays are dean and pure, their coiOu" iS like that of
copper purified In fire. Our almanacs don't specify when planets move
to the eastern or western directions but thankf!Jiy Raphael's English
Alrnan3C has ttl! nectS'Sbry information convenientty arranged in a <laity
format.
Olscussk>n on what has been described above: Most of these
descriptions are based on the observations of sa91=5 but it ...,..,.st
be kept i n mind that they did not have access to modern day
Instruments like teiesa:>pes. Hence most of the desalptlons are based
on ob5ervations through the eve and for the most pact thev are
repetitive.
Youth: Mars has been described as youttlful because when seen
through a telescope it seems to tjow like fire. A person by
Mars appears to be 24 even when he Is 42.
Piercing eyes: Just as one cannot stare dlrecUy at a 1\re It Is
diffiQ.Itt to lock eyes with a person under the i rtluence of Mars. His
demeanour iS that of a dangerous man.
Generous: Mankird has reaped benefits from fire
since it was known to humanity. Since fire is a characteristic of Mars,
people ruled bv ltlls planet ore generous oncl selfless.
Temperament: Since heat is a property of fire, the attendant
warmth renders this person's consti tution as pitha whi ch is
characterised by heat In the body.
Corrupt: People d Pitha temperament are neceSSCW'ily corrupt
Slim waist: This trait is usually manifested in those who are in
uniformed jobs like those In the poiM:e or the: army.
Height: usualty those In the: uniformed forces are extremely tall.
But t-1ars rul ed physicians, chemists, butchers, tailors, goldsmiths,
ironsmiths, sweepers, barbers, cooks, cowherds, politM:ians, arms
dealers, arms manufacturers, and factory WOriters are quite short.
40
Colour: Mars appears to be a reddish gold colour even when seen
from the and hence Us colouring iS bestc:JWed Cll it
riAes.
COl our of eyes: Experience shows that the pupi ls are jet blact
and the whke portion surrounding it has little red 'Ieins rvmi1"9 all over
which make it seem reddiSh. The tyts are p;erong. Ther e are however
!hose In whom the whit e of the eye Is extremely white and the gaze
more like a jackal. Tile eyes are srt'011 and misc;hie'o(lus. This second type
of eyes are found in short
Radiance: There is a ractance bestowed by Mars on ttl! bodies d
those who are r uled by it.
Bone marrow: 5aying that the boot marrow i s in abundance is
!he same as saying that a person's l rtellect is strong. I n the ancient
times it was believed t hat the i'l'\iiOW was the source of nutrition for
the intellect And thiS is etddent from the fact that those influenced by
Mars Uke mathematldans, play wrlgtts, poets, writers and
all an abundance of if(ellect.
Btood red: Since Mars is red, t he clothes favoured by people nAed
by it are also usually red.
Brave: TNs appr.es orty to the first ategory d t-1ars ruled people.
Hair: 9lort:, red, wavy a nd glossy locks are applicable in the case
of men and for women it is long, t hkk. bl3ck and lustrous hair.
Impure: Since red colour denotes anger and impudence people
haw branded MaiS as one that brings Impure thougtts and an Impure
way of life. In t his c:ol'(ext It may be noted that tharitv ancllove are
white, shyness is pink., shame is green and grief is black.
Courage: Mars makes a person fearless in the face of the worst
calamities.
OeJtructlve: Mars makes a person destructive. This Is a
characteristic derived from fi re. But such people can also be reigned In
and utilised for the good r1 mankind just like fire is used to puify metal.
"
Debauched: The heat in the person's body wl*h is a p-iiT'Iary
characteriStiC of Mars takes the of lust in the person's character.
Vtolent: The perSon dOes not h3Ve any second th:)lllJht$ if
he Is committing mt.rder.
EXtremism: Since ti s Intellect Is twisted and sharp, the person
has radically views and his intelligence makes it easy for him to grasp
things very fast.
Triangular face: I have fourw:l no evidence thclt this description
by Poojbraj is correct.
William lity: describes the face as round. He is tntve and self
confident. He Is cl medium height. If ,.,ars Is In the east the person Is tall
and a hairy body. If it i s in the west. the person i s lean, has a small
head, is delicate and his nMI.I'e is to remain ak:lof from
Slmonite: swys the nose is crooked, the face is round. Both rules
to people of the second category. Their special charactertstk: Is
fearlessness and sdf..c;onfidence. They ewe easy to spot In society. lf
Mars is tilted either towards the west or the east, the person is of
me<lt.m height. The other clrectlonal properties are as descri bed by
William lly.
In relationship to zodiac signs: 1"1ars In career gtves very beneficial
resufts, ordinary ones in Scorpio and Sagittarius, sfightty malefic in leo,
bad i n Aries, extremely malefic i n Taurus, Virgo and capricorn and
reasonably good In Ubfa and
Mars as a Signiftcator
Kalyanavarma: RaktotpalltMmraswarnM.Jdhirapaaradlfm.!nllha
sNiaadhyaanam kshltlnrlpatanamoocflhaarpaitlkad!atraprabhbhilumaha.
R.ed lobJs, brass, gold, blood, earth, king, falling down, moustaches,
pitha constitutions and thieves are marifestations c:l Mars.
Baidhyanath: Satvam rogaggunaanvjaav;miripugyaatjncJharaa
sununaah&a. Courage, i"l!udMce, illness, virtues, .,ounger sibi ngs,
enefries, caste and land ate the domain of Mars.
42
Gunakar: SCihotlhha. Yol.llger btot.het:
Parashar: Sat\9 - sajhlr - bhooml - putTa - sheela - c::haf.I"Ya -
roga - brahmahabhraatri - parakrllmiJ - agni - saahasa -
raajashatrukaaraahaa kujaha. Courage, home, land, sons, nature, theft,
Btatvnins, brothel'$, defeat, tire, and enemies of the state are
gov<medby MarS.
Sarvarthachintamanl: P.!tkrama - vijaya sangrtJarm
- sadhasa - salt>aapatya - daflda netrltva - khadda - parashd!adha -
ktKlta - ki.XtM88ta - shataghni- bhindipaala - dhiJOOrba1i1- naipunya
- gluiri - klJarti - - kaatm - krodlla - shatruvriddfi -
aagrahaavugrlJhll - paralJpllviJadlJ - swattmtra - dhlJIJtu -
bhook.>atakaha - k.qaha.
Defeat and victory, glory, battl e, oourage, general ship, axes,
SWQrds and other weapons of war as well as the ability to use them to
adwnt<!lge, debauchery, angtr, weakness in foes, pleading, dedsia'ls,
humiiaUng others, independence, gooseberry trees Md land are In the
domoin of Ma ...
Mantreshwar: Satvam bhoophaHt;Jm s8hodar;,g1.1niNTI krourya
rlNiam saahasam vidhwesham cha mahaanasaaggikanakagyaat
yastrachoraan rl punu. Utsaahahm parakaaml nl ratl masatyoktlm
Dweerya chltasamuntratam cha blusham
sainaMhipatyam kshatam. Defeat, l and, brothers, cruelty, battle,
bravery, anger, kitchen, fr e, gold, caste, weapons, enemies,
enthusiasm, behaviour to olher men's wives, lying,
sin, development of society, general ship, wooods, are all subjects d
Mars. He has desaibed diseases In relation to Mars at great length.
Extreme thim, bleeding diseases, pitha oor&iwtion, fire, fear c0 being
poisoned, eye infections, appendicitis, fe..-er, itching, low
sperm count. 10\o\1 enerqy, low l ibido. In addition the person may incur
the King's anger, Mrassment by thieves and enemies, quarrels with
friends, relatives and siblings. The person could also be jX)ssessed by
evil demons. If Mars is maleflc any of these co\Ad come in conj unction
with of the upper body.
43
Vidhyaranya: Bhraatrisatvagunaanu bhoomi bhaumena tu
Brother, COLrbQI! and lan:l go...emed l:1f Mars.
Kalldas: Sllourya
vaveeryakshayaahaa. Shchoro yudhhavlrodhashatrava udaaraa
raktavastvpriyaha. Aaraamaadhlpatitvatooryaravanananpreetich
atushpunnrip;MhiM. Moorkhaha kopavideshaytMna ghritayo
dhaatrraagnfvaagvaada taahaa. 1. Pltroshnavranaraajasevan
adinavyomekshanahrasvahagg. Vikhyaatitrapukhandakunt
MlJchivlJShchlMnglJ!ootlJ twam manihi. SubrahlJnya)ape yuva katu
nrlpa.sthaa"' ku}<uvagrallao maasaat>shl paradoashanam rlpu}dstlktam
nish8ante balam. 2. Hemagreeshmaparaakrama rlpubalam
gaanbheeryltShourye pumaan. Sheelabrah"')iltashcha dhovanaparo
gr&mllMihinlJM.hMvma. Raa}alekA toora-stra-sw.,...
khalou. Mugdasthaanasti:Jhoojalle klishadlanurvidhyct-
ampraveenatvate. 3. Rqktam taamravichitravastrayamadigvako cha
t.t ch ikpriy 3h1J. KIJIJmiJk rod ha p/Jr IJ aapa vaadagrhiJSIJi nyt!shuha
Saamabl'l'aatrlk.cAhltridushta mrlg811eO'"atvaswatarura
grahahaa. Kshetram danda patitvanaagabhuvane vaakchitta
chaanchalyatu viJIJhiJIJrohiJrM raktadarshanamasriksanshosha
n.aanyenvam. Nyecha811e kasusangyakaa budhbairabhaumasyatuktaa
"""'
Kalidas has dul:tled several into one statemert and this
also covers f'.1arS' relationship with zodiac signs and other planets.
And In cortrast he has gtven only of the planet's etrects as a
significator. This orclnarity does not reflect well on any good other
astrologer as it is an u'1)rofessional approad'l to study of a planet
Strangely, despite this Kalldas Is qtAte famous In places like Mysore.,
Malabor and Madras (now Chemol).
Actordng to him f'.1ars cortrols: 1. Defeat, 2. Land, 3. Power, 4.
Acquisition of arms, S. Power over other people, emergence of
bravery, thieves, battle, connict,. enemies, generosity, fondness of red
garments, ownership of orchards, playing musical lnstrunents, love,
four-legged animal s, kings, fools, anger, foreign travel, courage,
gooseberry trees, fire, pitha consti tution, heat, wounds,
goverrvnent jobs, daytime, short hetg>t ard a physique that Is strong
onty on the upper half, cl$ease, glory, swords, ministers,, dear speech,
bells, gems:, Kartikeyb who is the genal of the deities, youtttulness,
bitter tastes, royal palaces, Insults, non vegetarianism, humiliating
others, vittory fl'ler enemies, chilly taste, strength at its peak at the
end of the night, gold. sunmer. the of b foe, gr11vity,
victory, masculinity, decent behaviour, Lord 6rahma, axes, forest
nomads, healtnan d the audiences with the king, urinary
infections, squbre face or physique, goldsmithS, wiCkedness, burnt
ruins, a fondness for good eating, dehydrated body, slim body,
excel'ence in wielding a bow and arrow, 9er, sayi1"9 bad
things bbout home, the Shataghrl which wM bn Meient
weapon not In use now, Samaveda, brothers, jU'Igle dwelling arimals,
supervision, independence, agriculture, general sl'lip, cobra's nests,
temperbment Md speech, horSe riding Md t:Kiod dotting.
Western Thought: Hot, dry, harmful, industrious, thirsty,
muculine, brbve, subStMces thbt boil, bcidic oil, shbrp htrbS,
gooseberrtes, hot foods, sharp tastes, Iron, steel, weapons, knl'Ves,
scissors, quarrels, theft, dacoits, acddents, prestige eiJimed in battle,
virility, lust, libido, brger, rtspect. fire, fevtr, febrfulntss, pestienc:e,
humiliation, pofice, Incarceration of a short duration, death, male
genitalia, doctors, surgeons, metallurgists, weapon manufacturers,
who work with iron mechanics, Mgineers, turners, titters,
lathe workers and factory those who make brass vessels,
ironsmiths, bangle sellers, dentists, biscuit manufacturers, scissor
mal'lJfacturers, butchers, bai iffs, executioners, watch makers, tailors,
barbers, sweepers, gamblers, forehead, nose, pltha constitution,
ailments of the pitha system. urinary disorders, premature e;aculation.
mertal il ness, smallpox, pox, measles, <l.lng, bleeding, cuts,
burns, bumt ruins, kilns, laboratories, battle fields, army camps,
armoury, zoos, abattoirs, siblings, happiness-grief c:yde. patemal uncle's
sons, steprelations and unpreced!!nted wisct:lm.
My Observations! PWO, land ownership, history, criminal law,
zoology, agricultural univerSities, survey divisions, the Sayler Act,
mechanical engineering, engineering colleges, dgarette and beedl
factories, factory workers, liquor shops and manufacturing units, food
inspectors, soldiers, wrestlers, motors and those who ate involved in
their mal"'..facture;, cyc.le and car repair mechanics, tanks, (TUisers,
torptdoes, bombers, planes, petrol, spirit, oil, phosphorus, iOdine,
carbon used to make etectr\clty. match factories, race., hOtSeS, jockeys,
trainers, fire brigade, major operations, urinary infections, prostate
gland problems, tonsillitis, m.Jmps, blood poiSoning, England, France,
Greece, Gennaf'Y(, ltaty, Japan, Punjab, Uttar Pradesh. Maharashtra,
Kamataka, Kutch, Salrashtra, Gujarat, Rajasthan, Nitric; Acid, Acetic;
Add, H)(Jrod'llori c Acid, arsenic_ fragra..- essences:, tht ability to ingtst
poison, hens, jackals, hyenas, e a ~ s . goats, Jigeons, sparrows, cats,
Olristians, Anglo Indians, Europeans, Sikhs, Marathas, Rajputs, Jains,
lingayats, and au general communities ethnic to Saurashtra and
Gujarat.
TM rtgular CharacteriStics, appearances, propertieS, colotxs and
traits In an ordinatlty good and benefk:lal horoscope ate lrtluenced by
each p i a ~ differently so let us examine that.
A powerful
1
divine horoscope
Sat (Mar)
FACTSANDMYlll
Btood red: Red talus, brass, and gold are in the domain of Mats
because d tMir reddish cdolring.
Mind: Its real signifk:ator is the Moon.
Stone: Stones are hard substances, wtlk:h come from the earth,
and that is why they are said to be under the influence of Mars. Adually
they are rUed by 5ab.Jrn.

Carriage: Vehicles like all'$ are made of iron ard steel and they
ru"' on petrol so there is an element of Mars
Land: Mars is b!fiewd to be the son d tht earth ard hence
connection.
Poslt5on In life: King. This Is a myth as ltlat is a Slbject under the
S.n.
Behaviour: Bad behaviour is generally considered a trait of Mars
because i t reduces a man to a lower status which is a property r:l Mars.
Burning sensations: This is due to the heat that is a natural
constibJMt body of IJI"ft' incUvidual ruled by t-1ars.
Pitha: It is the same reason as above.
Thieves: If Satum is teamed up with Mars then this applies oot
otherwtse.
Eleme:nt: COu-age like fire. In ttvs day and age people can ad'lleve
nvtl*>9 by opplyi"'l the use cj fi,. corefuly oncllntelli9ently.
Disease: Heat In the body produces many diseases and only
MantrestYNar has explored which ones these are.
Virtues: It is not clear whidl \firtues are being referred to.
Younger brothers: Though some writers Sif'f exercises a
beneficial influence oo the younger brothers d those it rutes, my own
experience is that it Is always detrimertal to the brothers. In fact if Mars
is in the Third fX the Ninth house. the person's younger brothers die.
Enemies: This Is evldentty In context d those who work In the
police. Besides them, none d the others have probtems of enemies.
Caste: Mars is tradilionalty viewed as Kshatriya or warrior planet
&.t it is underiable that its can be seen i n the d
Brahmins or Studras as well. ()ole wil h.ave to whether the
planet is capabte of temporarily shedding its own caste to take on the
propertieS of another, for the dilatiOn that it spendS in the horosoopes
of t hose who are not from the warrior castes. One stanza on the
subject goe,s: yad!t bMum/Jha Mh11Nne d'l6
/Jtalrnap<Aro )0dil joot.Jho so gild>hermlenchi1Jlho mandram. If Is
in the ascendant and the SVn in the Eiglth House it will erter those
houses where iS not an iSSlX! thc:ISe of r-tJSiims or O'lriStians..
Place: House. This is in cx:.lne<:tion with lbnd.
Sons: Od)' Pllrash.ar has referred to this and I do rot think he is
The onty places where Mars can inl\lence a person's sons are the
Fifth House and the Eleventh House.
VIrtuous: This Is correct.
Brahma: This connection is not explained anywhere.
Fire: Since Mars looks like tire the connection Is olwlous and it Is
correct.
Courage: Courage Is denoted by the colour red and t he
coooection i s otwious.
Enemies of the State: If the man holds a position of authOOty,
those below him war( to unseat htn. Hence astrobgers have laid down
that Mars In his horoscope renders him v\Jnerable to enemies of the
state.
Bravery: It Is the same as courage.
Victory: Is Incorrect as lt Is Sotum wllldl oortrols ..;crory. An
example is that the people in are dominated by Mars but the
emJ)bymert there Is all coMeCted to the Saturn ruled coal and Iron
factories, so they ate victorious in all they do. can only give a man
valour and courage but victory iS the of saturn.
Glory: Since a general's men are inspired by tis courage and valour
and themselves begin to ftght to the death, they bring glory to hi
name.
Struggle; A nation may oontii"'Je to be at war for many years and
the ups and downs of the battle have to be (X)f'lsidered keeping in mind
48
how Mars is placed i"l that co...-.tJy's horoscope. Similarl y, a rnaon's life
m&y alSo be with ttgal struggleS and it is Mars that wil if'll.....enc:e
the outcome.
Force: Similar to the tssue of battle, it Is MatS that determines how
armies a nation can muster.
Weapons: This is correct.
Grasping Power: This has nothirg to do with and is in fatt
subject ol """''Y
Prestige: Since Mars brings a man rjory it wftl naturally bring him
prestige too.
Sobriety: No <bubt thiS planet makes a person \'ery sober.
Increase in foes: TNs is apJ*able only if Mars is in the Sixth.
seventh or Twelfth House.
Pubfk: Honour or Disgrace: r-1ars determines whether a man will
be honoured or I>Jrrlllored In lhe Klrg's court II it ouspldous, the
person will benefit and Wit i s maJerte he will sdfer.
Humiliation by others: lf Mars is In the Fifth, Se'<enth or Twelfth
Houses, the person wil be publicty ti.Jmi liated by many people.
Independence: Those ruled by f\1ars have an independent
nature and many d them ta!l2 up jobs lgnortlg their family businesses.
Tree: Gooseberry tree. 1 cant underStand wtry this connection.
Cruel: The person Is auei and unkind. The conntton comes
from the fact that fire is when It Is destructive. But In fff'(
experience this oct\.J"S onty if f.1ars is under the d any malefic
planet and hen-ce this Is not something to be predicted without first
checking whether Mars Is under some lnnuence or not.
Greatness: This Is correct.
Enthusiasm: This is a spedal charac.teristlc ol peopl(! ruttd by
Mars.

Debauchery and relationships with other men's wives:
Since Mars is a plbnet wtliC:h generates excessiVe heat, the samt is true
of people ruled by It Md It tends to mat.e them behave In this mamer.
To be fair to this man, sin-ce his Jt!ysi qve is good and tales of his virility
and libidO carry far, it iS other men's wives who Chase him more than him
coveting them.
Lying: The man i s a lar If Mars is ftawed.
Loss of Greatness: Gotng by what has already been covered
above t hi s appears incorrect. Mars does have a say in the birth of
important men and IWers of a nation. If Mars is in tM Seccnd, Fourth,
Sixth, Eighth or Twelfth House the person's irtellect iS Sharp and if it is
In the ascendant. Th.,d, Firth, Seventh, Ninth, Tenth or Eleventh
House the person remains unstabl e even after graduation.
Sin: The astrologer from 8a1"19alore Subramaria Shi;lstri thinks that
it i s sin but I bttieve the references in Sanskrit to t he word kA/ush
suggests the same as humiliating and lnsuttrng others.
Wounds: The person has Injuries, boll s and erupdons.
Foreign Travel: It is worth examining whether this Is true or not
EXcellence In debates: It Is a special characteristic that people
1\.ied by Mors wi ll be victorious In debates whether these ""' held In
halls or in elsewhere.
Carnivorous.: Since Mars Is the ruler of the flesh, the tnaiTOW, the
ten:lons and the blood, this Characteristic i s attributed to it SLt then
there Is no dearth of Jalns, Ungayats and even Brahmins who eat meat,
hence it wouk:l be better to say that t-1ars ruled people eat a l ot of
chillies. However, if Mars i s in the Housed Wealth or in the Sildh House
In a tire sign, then one colAd say the person eats a lot d meat and
drinks heavily.
Good Eating: people lnfluenoed by ~ 1 i l r s eat wei ond like to do
so. They are unwilling to eat when there is no variety in the food on
offer.
50
Fickk!: Ma/'5 is a tickle planet. It is retrograde and cirec:t in q.Ji<;t
successi on and hence astrologS say that people rul ed by Jl.1ars are
tlckle. This trait Is most apparent when Mars Is In the ascendant,
Seventh or Tenth Houses.
Ability to control serpents; Since the mongoose, which
vanqliShes snakes is ruled bot Mars, hence this trait
carriage: Mars ruled people usually travel by riding on a terse.
Shape of face or body: Kalidas says the person has a sqJare face
while Poo)araj says the physique is triangular in appearance,
yet elsewhere he says that It is angular. Neither of them appears to be
rig"lt. The fi rst category that i s policemen etc. have tall, muscul ar
bodies the second category like goldSmiths and factory works
have round faces and are short In height.
There ts no need to go Into what t he western astroklgers have
said as they are right.
categorisation of signif"ocators
Those In the birth chart: Jl.1aj0r operatiOOs, gall stones, glanch.Aar
ptobl ems, appendicitis, cancer, J1eurlsy, urinary lnfectJon, tonsil/Us,
blood poisoning, in:tustry, courage, enmity, quarrels, t heft. dacoity,
accidents, glory in bbtt le, work, bnger. lust, arrogance, fever, fast
speech, harassment. lnsutts, death, flesh. bones, red marks or scars on
the body, measles, small pox, ct1icken pox_. bleeding, wts, burns,
younger siblings, rem requi ring unus:ual intelligence, happiness bnd
paternal uncle's children, a step mother step father's house,
mind, buming sensation, purity, metal, land, disease, enemies,
sons, habits, enemieS of the stbte., cMriSma, supeM:sion, notions, (ji:Jry,
sobriety, Increase In foes, grace and benefits from lt.
lrdependen<:e, cruelty, g-eatness, enthusiasm, relationships with other
men's wives, lying, sodbl wetfare, Sin, fooliShness, foreign trbvel,
debate, non vegetarianism, evil nature, gocxt food, fickle nature,
incarceration ol a short duration, dehydration, destructi\le nature.
Sf
Professlonal signlficators: PWO, police inspector, overseer,
pilot, agricultural s.ck!ntist, mechanic,
factotles, factory workers, pan sell ers, IIQoor selers, sales tax Inspectors,
wrestlers, dealer$ of cars or their spare parts, q4::le sellers and repair
meChanics, engineers, turners, fitters, lathe workers and factory
empk>yers, those who make brass vessels, lronsMths, bangle sellers,
dentists, bisc;uit manufacturers, scissor manufacturers, butchers,
bailiffs, exeOJtioners, watch m&kS, tailorS, barberS, sweeperS, th:>Slt'
who sell oil, those who make carbon for corrmercial use, doctors,
surgeons, metallurgists, and aU others that are mentioned in the
section titled My Cbservations in tt'iS chapter.
Median Astrology: Battle, fire-fighting, general ship, canon
makers, batUetields, army cantonments, armourits, weapon storage
rooms, orchance factories, battle k:Wing counb1es, warrtlg natfons, the
condition of the army, &\gland, Greece, Frarce, Italy, Germany, Japan.
Punjab, Uttar Pradesh, Maharashtra, Karnatakb, Kutch, Saurashtra,
Gujarat, RajaS1han.
Slgnlflcator.s for education: Geology, hi story, defence law,
police training, overseer training, forestry and survey divisions, Sayler
Act, tngineeri ng, atmospheric mtteorok:lgy, surgery, regimental dass,
motor driving, rait.vay driving, tailoring, dyeing, technology and mill
apprenticeship.
Useless slgntflcators: Substances at boiling temperature,
stinking things, destructive tastes, accidert sites, murder sites, spots
where quarrel s have taken place, wrestling ring, faling down,
characteristic. gooseberries, musical talent, cobra's nests, phosphorvs,
iodine, nitri c add, other acids, asafoetida, mental tension, fragrance,
dogs. lions, wol ves, jackals, cats, mongooses, hens, foxes, red
motAhed langurs, goats, pigeons ancl sparrows.
caste: OlrisUan, Anglo Indians, Europeans, Sikhs, Marathas,
Pathans, Rajputs, lains, Lingayats from l(a,rnataka:, and al those who live
in Guj.arat
52
Properties of Mars in a horoscope: Brave, cantankerous,
arrogart, stubborn, fearttss, industrious, S(f.Jandt'!rs money, one Who
sets up many different ventures, one who works for the common
good, sdftess, generous, loving, carefree, well-built, courageous, one
who doeS n gtt influenced IJf others, sin1lle. innovatM and forward
thinking, one who ltves by the rules, one who does not run after
women, one who protects widows and destitute women, a social
a fqtter by one whO iS not vain deSpite having
all that one needs In life, one who l oves his wffe, self-Immersed, one
who does not worry about the future, one who is defeated in deOOte,
one whOse hard workS l'n!lkes hi m infk.lence others around him.
A man whose horoscope reflects the presence of Mars, is one who
could stake his life to protect the honour of women and can stake his
propty and assets in totali ty for community good. He wil stake
to state oppression.
If Mars is malefk: Mars becomes matefic in tandem with the
Moon or venus. They bllng out ttle wo.st tendencies In a person. He Is
one who will seduce other men's ha'Je relationstil:ls !Mth women
of al castes and communities, M iS debauched to the extreme, and has
no compunctions about going to any extremes to satiate his lust He Is
ful of anger, ld habfts, quarretsome, and has tendercies to commit
murder. He loots the moMy of otherS to squander on wasteful parties
and orgies, harasses his wife, humiliates others, lnsUts others though
he i s himself capable of nottirg, greedy, lazy, one wh;) reduces \tie
enttu.15iasm d others, badty beNI...ed. noisy and boisterous, a loner who
is Inconsistent all his life.
Cliapter 3
9ttars in 'Various Houses
Mars in the First House
Garg: Gudarogi shlantham naabhau kandu shrullhatraabhaukandu
kuShtthaMJinaankitahJJ bhiJveth vyangaha savaachyo
lagn.me Jwje. AnyiiChha toousthaanasthlthe l>ha<Jine hashhtl bhlrvaa
vilokite. Lohaashtniladik.ritaa peeda krodhostyanta stanau bhaveth.
d'JIJ VMtlJriJktam tha k/Nitha
madhye cha grlho vaapl vranam bhaverh. Diseases affecting the
geritals, itching in the navel, abOOminal disorders (if Mero.uy is with
MarS), iron, stone related probl ems, excessi ve anger. childhood
bleeding disorders, vatha diseases, brain fever, these are the
choracteristics cl Mars in the First Hou$e.
Kashinath: Bhatme lagne lu.roopaslrha rogi bandhUVivarjt8ha.
Asal)<lwad' nlrrlrlN'fO } .. yare pat31ldaarikaha. He is disfogured, diseased,
frlendess, liar, p<Xlf and one who sedu::es other men's wM!s.
Narayanabhatt: 111pemanasam kalat:rMdhighMtMa shirooetra
peeda vtpaake falilanaam sadalvopasargaha. Mental tension, broken
relationsNps with women, diseases cl the brain and f:(es, ttvs person
always faces a tur<le even when his luck is on the better side.
Jeevanath: Pr3U13JSt3syaapi prllbhllv3U ella
samaha. He has <ignlty like a lion.
Punjaraj: sa krodhi jaayate noonam vyasani katu kapriyaha.
So! vld.Jgdhaha syaath tathaa pitena baadlyate. The person Is
qukk 10 anger, likes chilly food, gelS burrt frequMtiy and S<Jfers from
pitha diseases.
Gopal Ratnakar: A burty physicJ,Je, tendency to steal, redcish-
geid complexiCil, father sufferS when thi s person iS a child, great
prestige In old age.
Hlllajaatak: Pand>amesabdela!T'agatD 1>/laumesarlstllttwn karoU
val. The person suffers at the age c:l fi\11: (The same thing is SUited bv
Bfih3dyavan11 jaa t:ak also).
Yavanmath: He with enemies and people c:l hiS own faith.
He Is qllck to anger and Is argumentative. Dehydrated, deprtved of
women and ctlilcten. He travels a lot.
Paaschaatya Math (Westem Thought): He is b'ave. without
regrets, courageous, does not hatilss people, optimistic, ambitious, is
greedy, speaks ill of others, generous, quick to anger, extremely
arrogant. ln Aries. Leo and Sagittatlus - extremety cruel; In
Libra and AQuarius - a traveller 1M urtortunate; in Tal.l'\ls, Virgo and
capricorn - greedy, setfiSh, carries a grudge, popul ar with women,
quarrelsome and an alcoholic; In Cancer, Scorpio and Pi sces -
alcoholio;. peoe<ful and debouchecl.
Unknown: Dehe vranam bhavatl. chauraha
but:Jtookstitaha brihiJtr.Jabhilli raktapaanil'# shooro balvaan Moorlchlfha
kopavaan samaanashauryaha dhanvaan nettarogl, dur}an.aha.
Swochche swakshetre aarogyam raajasanmaanakeertlhl.
Papashaturyute alpuyuhu swalpaputravaan vaatashodaMirogaha
durmukhaha. Swochdte lagnrishe vidhyaavaan nettaVIIaasavaan. T.:Nra
paapayvte paapakshetre paapahasMtl yute netrarogaho. BahcJchlrta
uddheegaha sheerokshimukhapeeda nam. &8/yesapi rogi. Malinaha
d8rldrl kaamavashaha alasashcha. He has marks on his body, has a
smooth appeal'(lnce, thief, always htngry, has a large na\lel, bloodless
hands, brave, strong. fool, quick to anger, weal thy, ellil, eye infection,
these are the Characteristics of Mars in ascendant II Mars is in its
own hou.se or In an exalted position. the person is disease free,
respected by the ruler, and gets much rjory. lflit Is in a malefiC inf\..lence
or in a hoU5e ruted by a hostile planet. the person has few sons, suffers
from diseases d the vatha system and atso from urinary infections, he Is
al ways sad. If Mars Is in the ascendant, the person gets a good
education and has good eyesight. If it is in a mak!f.c: poSition. the
56
person suffers from eye irtections, extreme anxiety, head and face
acheS, ChildhOcd illlll!sses, poverty, extrelll@ lust an:l laziness.
Discussion on the properties listed above: Ordnarily Mars is
dry, hot and destruCUve. Ollkten face Its heat right from when they
are in their mother's womb. They suffer from measles, boils, ulcers,
de-hydrations, rapid 10$$ of milk etc. Hence, ft can be considered
!hat Mars has a say on childhood along with heat. Where Mars Is strong
in a h0f05(ope the person suffers from these ailments very and
if it is weak, the person does not sulfer muCh. It does not matter
whether Mars is.-. the ascendant or not. Therefore, what G.arg has said
in this regard is iiTelevant and blood c:lsorders appear to
I'T'Ianifest in Aries, Leo and Sagittarius. In Gemini, Libra and Aquarius, it is
a l ittle less while in other Signs theSe do not appear at an. Tht
same bglc shotJd be applied to what Kashlnath has said. What he has
said is applicable only to masci.Aine signs. has mentioned
rejection by women thiS is applicable oliy to signs her than Olnc:tr,
Leo and Asces. In Ge"*'t Libra and AQuartus, there ate hlldies even
when is trying to be benefiCial to the person. Jeevanath's
conttttion that ttl! person is as dignif'ied as a lion is applicable on in
Aries, Leo, Sagittarius, cana!t and Sootplo. Poojaraj's descrlpdon Is orly
applicabl e to masculine signs. Ramdayal's statement about being
unreligious ard developmental applies to Aries, Leo, sagittarius, cancer.
Scorpio and Pisces. What Mahesh has said Is r1gtt for Aries, Leo and
Sagittarius. Mantreshwara is right about the effects of Mars in a
masculine sign with lhe Sun and the Moon. Brihadyavanajaatak is right
about the person being Intelligent but Is seen orly In Alles, Leo,
Sagittarius, Gemini, Libra and Aquarius. There is a tendency to be
debauched, overty lusty and to have a mistress. What Jaageshwar has
said, Is again seen mostly ., Aries, Leo, and Saglttatlus and to some
extent in Taurus, VIrgo and Qlpric;orn. Absolutety no possibility in other
signs. Baidhyanath and Gunakar's statements hold true only for
masculine signs as is Aryagranth's statement about chlk:lhood llnesses
and dental problems. The rest of his description, howew!r, Is true for
feminine signs. Kalyanavarma's description is for feminine signs while
Jayadeva' s description is right for all. Gholap's statement that the
person is evil and thol9htJess is b'ues fa- Taurus, Virgo and caprlcom.
The statemert that he is arrogant and suffers from blood disorders is
ST
for Aries, LeQ and Sagittarius while the statement about gall bladder
infections and jaurdice is correct for cancer. SCOrpiO and PiSc:t:S. Gopal
Ratnakar's statement that the person is reci:Ush-gold oomplexloned,
has a burty physique, are applicable in the cases d Aries, Leo and
sagittarius wtlil! statement about ruler's patronage hoJds true
for Aries, canrer, Leo and Pisces. Hlllajaatak's statement is some1hing 1
leave fQr those more le&med t han me. My opinion i:s t hat these are orty
seen at the age d What Ya...anmath has said about f9\ting with
friends and foes alike and lack of wife Of chlktren is true fa- Aries,
Sagittarius, Gemini, Ubra and Aquarius. The descriptions that he is evil,
3r9Jmentative and deh)drated apply onty to feminine signs. The most
apt description the one given bv Western Thoughl
My Experience: 11 MatS is in the FirSt House the person has an
lntetest In erterprise but he is unable to stick oonslstentfy to anyone
and wants to start many ventures at the same time. This situation
continues: till the perSOn is 36. Thereafter ht beccmes: stat:ie in one
vent\le. These people have a tendency to believe that they are hlgtty
successft,d and all others are C0"1)lete faillres. As a of this
belief these peopl! tend to bulty others around them.
would make perfect vma.-.s In a ftlm. If Mars is In the ascendar'l a
doctor's horoscope. he does well as a surgeon while studyil"9 b.lt
few opportunities to operate on::e he begins worting. This placement
of is not good f doctors. Mars In the ascendant Is also not very
beneficial for lawyers, they get some opportunities to defend people
but virtualty no m:>ney. All they get is some inAuence in the courtroom.
Rlr pilots, mechanics, engine dtNers this is a good placement d
Mars as they have a good physl(f)e. The same Is excellent for Iron
smiths, carpeti:ers, goldsmiths, medlanks, ergineers, turners, fitters
etc. If Mars is in the ascendant in Taurus, v .. go ex capricorn the person
gets ltle best benefits. The person gets to SUNey land. 1n caprlcom,
the person's father suffers greatly and he himself is constantly 5-.tfering
from one or the other disease. tn Aries, l.eo, Cancer, Scorpio and
5a9\tzlrius Mars in the ascendant is good for policemM. Sudl people
are oorrupt and take many bribes but rarely get If Saturn Is
beneficial to They do not regard how their behaviour comes
across to other people
58
Mars in the asa:ndart is of two types. In Cilncer the person has to
wealth and success tl'l'ough his own hard work. I n Leo the
person can ortt sucx:eed due to dMne Intervention. In both the
pel'5on is generous. They are hospitable to their guests and often they
pl!y host to so many peopJe th8t t hty dO not bother to even keep
IJ"'ad(, But If Mars Is In Taurus, VIrgo or Caprkom. the person Is a riser
who grudges even a little extra eati1"9 by a hungry guest. They cheat
people. In Gemini and li>ra they are friendl y by nllture: and wili ng to
spend a bit on friends. But they too have the tendency to cheat
peQPte. tn cancer, S<;orpio, Aquarius and PisteS the person does not
make fri ends easily but once he does, he does: not give up the
friendshi p easil y. These people are greedy and setnsh and do not
consider that there is any difference between good arw:l evil.
On:flnary characteristics and properues d Mars: debau-ched, lusty,
tendency to l ook for faul ts in peopl e, taunting nat ure, abusive
behaviOur. quarrelsome.. In fninine Signs - puShing other peo!* to
the front, e)dremety auel, well bUid physique, wtlk:h In fact appecws
imposing to ctlikten. I n ctlilcllood, the pe!$00 suffeiS from disease. In
Thurus, Virgo, Capricorn and Aquarius, t he person has a tendtncy to
steal.
Mars in the Second House
Acharya: Ohanage kaclatraha. He gets Inferior grain.
Gunakar: The same as alxwe.
Baldhyanath: Dhuturvaadakrishlkrl)'aata naparaha kopl kuje
v}ttagre. Metal, debate, travel ancl anger are the j:X'Opelties
of Mars in the Second House. It ct>es not bring any wealt h.
Kalyanavarma: Adhananha kadashanatushtaha purusho
vlkritaan.ano dhanasthaano l<.ujanaashraya rudhire bhavati naro
vldJ>eyaa rahftaha. He Is poor, has to be satisfied with Inferior grain. has
a dstorted face, gives shelter to wicked and remains illiterate.
Brihad'favanajaatak: AdhaniJtaam kujanaashrayataam tathaa
59
vimatitaam kripayaasativiheenatilam. Tanubhritaam vidadhaanti
vircdhataam dhllnanikttNJagosavanindanMa. Poor, shelter to the
wld<ed, stupidity, unkind and great conflict are the properUes: d Mars.
Gaf9: Krlshiko 'r4krayi bhogl pravaasyaruna!AttaviMtl. Oha3tvvaadl
fniltx:naarsho dhutakaaraha kuje dhane. Dhane bha1.1me dhanahaarihi
pra]ya&!. ch!J netre tha bhamya3b/JndlxJ}MaJfli kA/ihi.
Agriculture,. suocess In enterprise, traveller, pink coloured
wealti'r,', metal work, stupidity, gambler, body adles, eye diseases,
quarrels with w;re and r&ti'W:s are the p-operties of Mars.
Narayanabhatt: Ptinaha sanmukham ko bhaveth vaadbllagmha.
People one after the oth k:lse arguments to him and stiJrt shunning
him.
Hantre:s:hwara: vachasi vlmukhaha. He does oot like to speak
Aryagranth: VAktame magnacl'ittaha krlshatartUsuk.habhaagl. He
is al wa'JS interested in victory, has a dehydrated bo(.tt and is happy.
Jayadeva: Cruet.
leevanath: Pralabctle vittepl swajanajanat8h1 kim falamalam. His
wealt h is protected (the meaning is net clear).
Kashinath: Kriyaaheenashcha jaayate. Deerg/Jasutri, satyavaadi
putravlJINlapi. He is not interested in works that promote unity, plans i n
advance. tl\thftJI and has many sons.
Jaageshwar: Dhane krcorakhet. Mukhe vaath netre tatha
dakshlnaanse tatha kamake vaa. dhaatapaat:Dsathava val
vran8m syaadhyadM saumyahashhtam na yuktam dhlJIIam chet. If
there Is a malefiC influence In the House d Wealth or there i s no
auspicious planet lni\Jencing Mars, then the face, eyes, right
shoul der and ears sUrer one or the other injury.
Parashar: Swe dhananaashanam. There is loss or wealth.
Hillajaatak: Dhanahaanirdwaadashosabdhe dhanasthshsrcha
mahisuthMa. There is loss of wealth at the age or 12.
60
Gopal Ratna kar: Harsh voice, unwarranted expenditure,
extreme anger, inherited wealth (onl y applies to cancer or Leo
astendant).
Yavanmath: Has no wife 01 sons. The person Is poet, tnve In
battle, anxious, disfigured and ugly, unkind, and forever in detx.
GhoLap: He suffers losses from trading in cows, horses, sheep and
vehicles. He has no sons, iS d isngured and Ns many illnesses.
Paaschaatya Math (Westem Thought): The person ac:qvites
W(!alth from building work., mi!lehine parts, trading in catUe, farming,
wood ex coal trade, as a medical p-actltloner and r. the navy. Jf Mats Is
benefiCial or in an auspicious inflve.-.::e the person gets great wealth. Jf
not the person suffers incredible losses and destruction and mental
tension. He also gets several diseases.
Unknown: Vidhyaaheena laabhavaan. Shashtaadhpena yutaha
timshthati cheta netra valpareetyam bhavatl. Shubhadushte
parihAarahA. Swochhe swakshetre vidhyaavatm netravilaas;. TC!tra
paapayut akshetre paapadushte netra rogaha. Kudantaha.
Nrlpav8flhlch.,..t bhayom. V<bha..,kshayaha kaamlnikas/lt;>m bhavatl.
paapayute paapakshetre paapltdrishtrekaaminiheenltha. He has
no education but IOCS of wealth. Jt Mars Is with the ruler of the Sixth
House, t he person has a flawless physique. But if any auspicious
inAuence is CMY Mars ttl is will not be the case. If Mars is in Opriccm or
Scorpio, the person has good and a sucx:esslu erucatlon. If
Mars is \l"'der any malefiC influence In a h05tile space, the person
suffers from eye dental J:roblems, tear of king, thieves and
fire, and his wife tjves him rruc:n suffering. If the nAer d the seoond
House Is mal efic, the person will not get a wife at all .
My Thoughts: Acharya, Gunakar and Kalyanavarma say the
person has to make do with Inferior food, t his Is true for maSQ.Ifine
signs. Similarly what Baidhyanath and Garg say are also applicab$e to
masculine signs. But Garg's statement about travel and wealth can
apply to f eminine signs as weU. Arya.granth, Jeevanath, Kashinath,
Jaageshwar. Hil la)Mtak, Yavanl"'\llth, Brihadyavanajaatak and Gholap's
statements al l hold true only for signs. The western Though

abo!.A cattle t!itder and tonstruction trade apply to Gemini,
libra and Aq.Jarius wh!reas the portions about maChinery, wood and
coal trade are to Aries, Leo ard Saglttatlus. The bit about
disease free, and medi<:al practise appl ies to Cancer, Scorpio and Pisces.
My Experience: If Mars is in Aries, leo and Sagittarius, the person
is fil led with a desirt to k'lstantaneouSiy acquire wealth and has a
tendency to gamble through stakes, lotteries or racing. They also
acquire money by h.a"lling extra-marital affairs btA k>se it to gambling.
'Th!se peoplt spend money first and later find the means to pay off
debts. If Mars is retrograde and the ascendant Is ruled by Aries,
cancer, leo or Pisces, the person loses au his inherited property. They
do not have even erough left to survi\le. They do not hcwe any people
in their li Y!S w;lling to help them, end up begging from LnC:hari table
people who I>Jmillate them. Gossip spreads about the penufY.
If is not retrograde there is some scope of getti ng sl.lf icient
to awid star.tation. A characteristic of t-1ars is t hat the
person eitt'ler gets a fanta:stk: sum of money al of a su:klen or gets
nothing at aiL The person i s qui te generous by nature and does not
ten:l to worry about hi s own survival . They spen:l hours debating over
mi nor expenses and then suddenly spend large sums wRhout a
thoug,t. If Mars is in its own 59' or in a fire sign. the person's wife dies
This too takes place in a Situation where the! impo\'erished
man, against the will of his sons I)Wides them with a stepmother who
they Take a look at these two horoscopes to see how this
manifests:
1. J V Joshi, writer or astrological books, born on 10 December 1884
- when he was four his paternal died an:l his father
cled six years &ater. He be9an travel and study of astrology at the
aged 15. He was first married in 1903 ar'd a )'l!ar l ater his vide
cled. Nine years later he married for the! sec:cnd time. He worked
In sevetal films and plays and also wc:rted at factories and printing
presses.. He was forever on a tangenti al thought process and
destructive by natll'e. He wrote several books on astrolo9Y. Since
MarS was in the House of wealth tis inherited wealth was
and he had to get tnaiTied twice. The ascendant in his horoscope
is In the 23'' ph ... and t his Is what Chal\bet had to say about this
- "at this time the sky is dear, blue and full d stars so such people
are full of virtue and talent. These people can't stay in any one
62
place for bng and are usually travellers, astrologers, sCientists or
legislat<n"'. ln Joshi's case most of the beneficial traits manifested
late while the problems wese apparent hom an early age.
If M!lrS iS in Virgo or capncom the wi fe does not
die but she does stay sick for a tong duratlon. The couple has a
harmonious relationship an:l both have enhanced la:>idos. If Mars is in
Gemini, libra or Aquarius, these: people prefer to save their m()n(!y in a
bali< Instead cl spendng It and whenever they have a tkly sum. they
purthase land to add to their dlildren's inheritance. In cancer, Scorpio
and Pisces there iS rapid gain and toss d But suCh people have
no roots and do not wOtJY about the future. Someone In the family
coul d di e in an acdclent Their marriages place I* and wealth
even later. They are and wear spectactes. They
brains that heat up easily and like chill y food. They are gluttons
and very llstfut. Their debavchery is to su<:h an extent that if they
cannot sati sfy their lust on a rtgular baSis - that i s if they're unl!lble to
find a woman - they are un.able to They are easily able to
Influence people, are d good nature but suffer because they take on
the responsibility d guarding other people's wealth. Their su:;c;ess and
progress comes only aft@r 21 1ong struggle. Thtse people: Should avoid
borrowing money or offering to safeguard another person's wealth as
ttis will certainl y mean the person will face humiliation. speak
harShly and are unable to tolerate arr,o one ttse's charismatiC nature.
Since they have loud vokes and often rel:J'ad from what they say with
ease, peopl e wi th Mars in t his position do well as l awyers. I t is
rosonabty gOOd for dOCtors too and eam a lot of wealth. Evtn work
ltley do In a rush is benefldal to their careers. This Is, a very
bad combination of p&anecs for aso-ologers as all the ma'efic t hings thev
predi ct, M i t death, illness or bankruptcy come true. And i n stark
contrast, all the good tNngs they predict a ltX of time to ocx:ur. As
a resul t peopl e believe that the person is a bl ack prophet and
inauspiCiOus. I had met sucn a per$0n once. Some ye.arS ago he was
travelklg from place to plaoo with some goods to sell . 1 had rerentlv
gotten married. He was selling something to someone when he
suddMiy s&w me and said that my wife would die within ttl! next four
years. Q1 I discovered that person is branded as a black
prophet and that people believed th.at all the ill omens portended bv
him came true soon. The same pel'$0n had told a millionaire a few
weeks: back that he woUd beggi1"9 for alms at the: age of 22. The
prophet's horoscope was thus - OOm In the month ct 0\altra on a new
moon night at 44-25 at 11.30 p. m. on 13 - 4- 18n. Sagittarius
asctndant in the: phase
...
("")
Chanbel has said about the 1 S"' phase of the asoendar< that - at
this t ime the telescope is focussed towards the sky. These people are
sc-Ientists or astrol ogers. Sagittarius ascendant Is the sign of
astn:>k)gers"'. In addition. the SUn, Moon, Merwry and Neptune are In
the Fifth House along with Mars in the House of Wealth. This means
whatever Ill omens the person I.A:ters wll come true. Nothing good that
he predcts comes true.
SUre enough, four after he delivered his prediction my vile
died ard by then the millionaire was as foretold, be9glng for al ms.
I n stark contrast was the case of Mr. Nevathejl where Jf.4)1ter was
the bd of the House d Wealth. good things he precicted
came true and whenever he predicted death or l oss of wealth it never
took place. Henre, astrologers should look at their own horoscopes and
deliver onty those predictions, which tend to come true in their case.
Now look at one examJ)Ie of Mars In the 5econd House orty
benefits IX> a person:
...

The Dub! of Yorlc. bom on 14-121895 between 3 ar:1 S a.m in
london.
MarS in a feminine sign is in the House: of We.altl\. Hence he got a
supertatl've title. Astrologer Ratrnath has said that If a retrograde Mars Is
in the influence of a malefic planet in the Secord House the person has
a vtry stroog libido.
Mars in the Third House
Acharya and Gunakar: Mativikramavaan tritiyage. The persoo is
Intelligent and brave.
Parashar: Agrajam prishtam ja hltllti sajaslhom dharaaStthaha. His
brothers - older ard vouf"Qer - die.
Kalyanavarma: Shoorobhavatyadhrlshyo mudaanvltaha
samastJJgunabhaa}anam khyaataha. He is brave, fearless, content,
virtuous, talented and dlgrifeed.
Aryagranth: Krlshatanusukhabhaagl tungabhaumo vilaasl.
Oll..,.S<Jdl..,.,.aheer>o neechapaapaarlpehe vasatl s"""/poome mandlre
k(Ksiteshcha. Lean body, hawines:s, lf Mars is exalted the person has a
lot of land and property and W not the person's wealth and happiness
are destroyed. He has a good house but a mean nature.
Baldhyanath: Ashattha mlttlrdurgashrlt:hkyayaate. He Is simple.
Jayadeva: Nrlpakripaha sul<havittaparaaktaml bhavayuto-
sanujadukhcryutaha. King's patron.age, happiness, wealth, valour are
ttle signs. The younger b'ottler dies.
Kashinath, Mantreshwara and laageshwar: The same as
Jayack!va.
Garg: tha kroorena nidhiJnam
bhraatrau dwau mritw shastraadbhlstathaa. He has two
beautiful sisters but ttley die soon. Two brother-s also die or injuries
from
Gopal Ratnakar: He is poor i'nd if Ral'v..t i:s wit h Mars then the
person l eaves ,iS own wife in pursuit or with other men's
wives. He Is bra\'e valiant. feared by foes and beloved of ,Is rel attves.
Shaunak: Purvlyerye khachare tritlyabhavane drfshte cha
purnesthava. Pashchaat putrasamudravo nigaditaha purva hi
saurikshetravinashtha garbhak.aranam vikhyll
atmantrlshwaram tiJatme. 11 there ts any malefic lnftuenoo .-. the Third
House wi th Mars or even if alone the person first has then
sons. If Mars is in the sign of S!ltum, the person's wife miscarries the
child. The petson is a famous minister.
Brlhadyavanajaatak: Ktttharathaha trayabdesajanuk
sNtisutonuja mrtchcha vishwe. M. the age d 13 the person's younger
brothel'$ begin sufferi'9.
Pur,jaraj: Kujo va tadaasthibhangam vishajam bhayam cha karoti
dirham. Fractured bone.s, poisoning and scars caustd
by serous bums.
Ramdayal: The same as Punjataj.
Narayanabhatt: Kuto baahuveerya kuto baahliakshml strlelyo na
chenfTI8mang;J/o bhraatavaanaam. Sahotthayathaa bhanyate kena
teshaam. Tapashrayayaa chopahaasyaha katham syaath. Extreme
valour, wealth, meditative skiUs and stJfering of hi s friends, is the
situation of a person ruled by r-1ars.
Jeevanath: The same as Narayanabhatt.
Gholap: M e>ccellent poet and one who descroys his enemies.
Yavanmath: He gets wealth, gems, clothes and a house.
Parashar: Vlkrame bhrutrlmaranam dMnalaabham sukham
yashaha. Brother's death, happiness and glo<y.
Hlllajaatak: Trayodashe bandhu saukhyaha, trltiyaha kurute
ku}aha. He gets the happiness of a brother when he is 13.

Paaschaatya Math (Western Thought): He is fearful or
vehicles, trains, and cars. He (f.Jarrets with neighbourS. He
fall s Into 1\Ml after signing on some legal document. He Is (fJarretsome
and argumentative by He is bt..t a coward. If Mars is in
this position i n any sign but OJprieorn, ti'W! per$0n can suff(!r from
psychotic aliments. If Mars Is In a malefic Wluence, the person is caused
much suffering by tis in laws and he 5'Jfers dt..ring tra\ltl. He can end
up becoming very poor.
Unknown: Sw.!Stra! vyMbhki)Mfini. nA dOshaha
anujaheenaha. Oravyalaabhaha. R4ahuk.etuht.Ae vaishyasangamaha.
8hrWrkJweshi k.leshayuktahiJ subhlfgaha afpasahodarah;J. Paapa)Ue
paapaveekshanena bhraatrin8asham utpaadh sadhonihitaha. Uhe
shubh.tyute v.ta bhraata deerghaayuhu
matldhalryavlkrarruwaan yuddhe shooraha. Paapayure mitralcshetre
ghritimaan. Nripamaanaha rip1.1naashaha nirankushaha nltyam
mahotsavahha. His wife i s deb!luetled but not if MarS has any auspiciOus
lnftuence o...er lt. He has no younger brothers blt l ots of wealth. lf Mats
is wit h Rahv the person has a terdencv to consort with prostitutes. He
has few brolhs, incli"S their ang, and is good looking. If Mars
is with arr., maSellc irtluence. the person's brothers are destroyed and
some even die at birth. In Qlpricom, Aries or S<:orpio or if it is in any
auspicious influence the person is capal* of unrivalled val our in war. If it
Is a malefic lnfkJenoo b4A k'l the house ruled bv a frlendty planet the
person is given to deep thoogl'i:, is capable of acquiring
powers. He is patronised try the king and hi s enemies are destroyed. He
cannot bear an'p()ne etse's su::cess and orfy does as he deems fit. His
house is cor(ent and peaceful.
My Thoughts: The Third House is the place for valour where
most astrologe-s have ascri>ed onty benefiCial things. Blt a lmost au d
them have listed the property d friends or broltletS getttng Injured.
\'\/hat Acharya, Gunakar and others have said is applicable to femlrine
signs. But unhappiness is a property seen only in mascuine signs. What
Hillajaatak, Brihadyavanajaatak, Punjaraj, Garg, Shaunak. Ramdayal,
Baidhyanath and Parashat said are also applicable to maswtrne signs. Let
us examine an exampl e of a horosc:ope where Mars is in the Thi rd
House.
67
of Windsor, born on 236-1895 at 10 p.m. in Lonck;ln.
Ma/'5 is in the Tlird House with Rah.J and therefore in pUI'$Uit of a
woman M abdicated th! throoe. Since l.Jpiter iS in the Fi fth House
with Influences d Vei'IJS and Neptune also played a role in It Mats
is in a water sign in this horoscope. An old poem 9QeS like this: If Mars is
in a feminine sign, the person's beloved ales get happiness. If it iS in a
masculine sign then It is his sisters who benefrt.
My Experience: lf Mais ls In a masculine 59l, the person's mother
dies and he a stepmother. If it is in any feminine sign except
capricorn, the broth!rs live. If it is in a masclfine sign the
person cannot have a younger brother at all. The mother either
miscarries or has a If a brother is born after the sister, he may
live. But thiS person's relationship with the younger brother win be
unhappy always. Thtre iS a diSpute t:Ner diviSion r:1 Ordinarity it
does not get to a stage v.t.ere they ha"Ye to approach a oo\rt but if
Mars is in a masculine sign then there is a bitter court room battle to
the issue of iMerited wealth and its di-Asion. In ArieS, Otpricom
or Scorpio, Mars In the Ttitd House rendeiS a person unstable f life.
Since he is brvtalty honest, he is disliked by most people. In femirine
sig\s, usualy the person iS selftSh and wicked. He has to give up his
property and has no oonc:ern f the wei being d his family.
Mars in the Fourth House
Acharya and Gunakar: V1sukhaha peedifamaansashrachaturthe.
He is urtlappy and St.lfers from anxiety.
Kalyanavarma: Bandhuparid'l e darahito bhavati chaturthe

sarthavaahana viheenaha atidukhaisampataha paragrihavaasi kuje
purustWth. Ht'! es not have a good family, lbCkS aoo vehides,
has to IM: W. other people's houses and is very unhappy.
Gaf9: Kuje bandhau bhoomyaajeewJnarahasada. He is a farmer all
his life bLt travels a lot
Kashlnath: Chattrthe bhoostJte krishnaha pitadhikyosarinirjitaha.
Vrir-hat no rmiiMkaami chll jlt6yate. He is dark, or pitha
constitution, and ls always defeated by his enetr*s. He travels for no
reason, has no sons but is very lustfi.A.
Sat:itatXne vldagrllam vibhagnam.. yada mangalo
tocry8bh88Vam prapatre suklum kim naraanam tatlta mitra58Ukhyam.
Katham tatra chinty.!m dhiya dheemat<Ja vaa param bhoomito
laabhatilaavam prayaatJ. His house Is In shambles. and can be bll'nt
down. He no friends and is unhappy. He is stl.4>id but beneftts from
land.
Baidhyanath: Streenirjitaha sh<JUryavaan. NeedWMMtoi kuje
sukhe syaadagrl ho narallit. He ts onty as brave as woman. He does not
ha\le a house of his own.
Brlhadyavanajaat.ak: D1.1kham suhrldav8ah8nataha
pravaasaaticalevare rugbalatlNJba.litvam. Prawti}<Mie kila manga/esminn
rasaataJastm f818muktamaadJyaJN. tie is uMappy with friends, vehicles
or travel. He is diseased anti weak. His brother suffers when the person
is eight.
Aryagranthakar: )ada matiratldeeno bandhusansthe
bhaume nabhavati kula aaryerbudhaheenoUdukhahi. Bhramati
nehasl!\0anuraktaha paravashaparadaare Jubdhachitaha
sadalva. Stupid, deprived, one who cannot get on with kinsfolk or
elders, unhappy, one who travels everywhere, serves the wicked,
keeps aloof d people and one who lusts after other men's wives.
Mantre:shwara: Vimaatrl. He is lrtluenced most by tvs mother.
Parashar: bandhumamnam shatruvriddhlrdhanav-
yayahit. His brother dies, foes Increases and he loses all wealth.

layadeva: Asukhavaahanltdhaanyadhano jano vikaladheehi
sMJ He does not get vehides, wealth, intelligence
"' happiness.
Vaslshtha: 8hatmaha suchlram chaturthe. His are good.
Punjaraj: Aaraha sabalashrutchaturthe pitajwaro vaa
vranarugjananyaaha. Shavetritaantah8 manujo vrinaartha
dahltllena If Mars is the mother
suffers from Ptha alknents. H'&S body Is ful of scars and Injuries especlalty
burns on the back. People in his mott-er's home suffer f10m
poisoning or by weapons.
Ramdayal: It is the same as Pun;araj.
Narayanabhatt: Kripa8Vastrab/loomirl8bhet bhoomipaataat. He
enjoys the King's patronage and gets dothes and land because of il
Gholap: He Sllfers geatty in a foreign land.
Gopa:l Ratnakar: His parents suffer illnesses ard a lso ftnaocial
losses. If Mars Is e:xatted, the person travels In man pulled vehldes.
Secrets from his house are not made He is a borw:Sed
and may injure a woman.
Hillajaatak: Olaturtho bCJdhahaanishcha haayane dutasta me
dhrwam. His brother dies when he is eight
Yavanmath: If Mars is weak the person will suffer greatly in old
age. The person tends to quarrel with t'is patetts and Is forever caught
up In domestic probtems. There is a fear that his house will collapse or
burn down. He is generous by nature and has long limbs. He is
victorious In war but ur*.ind and debt ridden.
Paasd'laatya Math (Western Thought): He travels a lot, Is
quarrelsome, Injures his parmts and Is unhappy. If t-1ars is in an
auspicious influence the person is happy his life. But even
then, tis life and behaviour are mar1<.ed by quarrels. He is aazed and
makes a lot of rristakes. He is !:rave but prejudk:ed.lf t-1ars is In a malefic
inftuerl:ial the person can have one or many ao:idents.
70
Unknown: Grahachiddram. Ashtame varshe pitririshtam
maatrirogi. Saumyayutt!
Kshetralleenah. Dhanadhaanyaheenaha jeemagrlhavaasaha. Ucche
swakshetTe shubhayut:e mitJakshetre vaahiNJ6Vi1iNJ kshtravaan maatri
deerghaayuhu. Neecharkshe maatrinaashaha
bandhujanadweshl swadeshdparllyaagl vastraheenaha bandi!Utahltaha
shauryavaan streebhirjitahil. There are IT'Iany stral"'}e incidents at his
house. When he i s his rath!r dieS and his m:>ther contracts all
manners of sertous llness. If Mars is with Mera.ny the person has to live
in other people's houses. He suffers from physical il nesses.. He does not
1\&ve wealth, homt or p-operty. He livt:S kl broken hLt. In Arie$, Scorpio
or C<lpricom, fn oonjunctlon with an auspicious r.ftuence, the person
has 'olehicles and some agriQJitural land. His mother may then live long.
In or in tht eighth phase d Aries the moth is certain to di!.
The brotherS and relatives suffer his anger and he l ives hi s home
country to travel abroad. He Is brave but lusts after women.
My Thoughts: Though Mars has been considered the ruler of
land, house and agricutture, its very loss is c-aused by Mars. This planet is
destructi...e. It does not have great irtelligtnc:e or its own. In samt
manner In which fire burn everything r-1ars doe:s not di f ferentiate
between I'T'Ian, .animcll or ttings. It just goes on destroving everything.
Ac::harya, Gunakar, Kashinath, Kalyanavarma, Jaageshwar,
Brlhadyavanajaatak, Aryagranthakar. Mdreshwara, Jayadeva, Puf'\taraj,
Ramdzlyal, Gholap, Gopal Ratnakar; Hill ajlat.ak, Parashcw", Yavarmath and
PM:Sc:haatya Math have au described destru:tive properties of Mars.
The few good traits that have been described by others applies only to
femirine signs.
My Experience: This person has wealth but not children. Those
chilct"en that he may have cause him suffering. This is especially true
from age 28 to 36. Thereafter he is happy. He tries his hand at many
professions. I n Aries, canc:er, Leo or Pisces ascendant means t he
mother will not die. This is because in sudl a situation r-1ars is in cancer,
libra, Scorpio or Gemini. In other S9's, there is e\ery possiljli ty of both
parert.s dying. There could be a stepmother too. The person Is II at the
8, 18, 28, 38 or 48. He Is l.llsucc:essful in his land of birth but is
successft.J once he sets foot on foreign soil. He has no
7f
inherited wealt h. If there i:s he i:s l.llable to make use of it in his lifetime.
He has to manage his t.;q>enses hiS own hard earned m:Jney. If
Mars Is In a file sign, hls house bums down. He lives with the de:We to
I'Tiake his own house and to die in peace there. If Mal'$ is in Cancer,
libra, ScorpiO or Gtmini, t hi s wiSh is futfllled blt ht still does not die in
his own house. For an exam'*, refer to the horosoope of Lok Marrya
Titak. If Mars is in the Fourth House, the person's first son is sure to
He getS prestige in courts, has many friendS from who ht benefitS.
benefits from association with women. His business ventures are
prosperous at the time of his death an:l he does not Slifer much at \tie
timt of death. His family and house are vi Sited by prd>k!ms
caused by t'is anrestors having offended a deity or ha\4ng seized wealth
and property from a poor person. These can manifest as the death c:l
hi s wife, mother, loss of property etc.
An example is the horoscope of r-1r. Bal\rant Ramchandra Gd<.hale.
born in Belgaon on 3 10 1890 at sunrise. He worked in the Department
of Posts. He was P<>O\ worshipped gods with dally rituals. His pa....,ts
died early and he himself wa.s married several times. The first wife's son
could rot suMI.It! for a more than a tew hours after birth. haS many
daugtters and evenbJaly one son. He did n<X have tis own household.
He was a 9QOd astrologer.
-
...
Mars in the Fifth House
Acharya and Gunaklr: Asc.to dtanavarjltaha. He Is d'llldless and
has n:) money.
Katyanavarma: Saumyaarthaputtamitram chapalamatriaplhl
panchame kuje bhav.Jti. PishunosnarthiJPraayaha khalashracha vD<alo
rro f'ltthaha. Hardy any wutth t:ut his sons aoo friendS make hi'n
72
very happy. Hi$ mird is fi<:kle. He is evil and his involvement with
something supremely deStru:tive Shames him pl.blidy.
Bal dhyanath: Kroorota vidharrma
bhogl dhanl ella yael panchatnage dllaraaje. He Is cruel, tJavels ... ell. Is
brave, corrupt, unreligious, is rich and attracts wealth.
PrArlJsth&n/JgatliShdlll putramaranam putrovaneryachdUJti . His son
dies.
Ga rg: R/puhashto rlpuk.shetre neecho vaa paapi.tSamutaha.
Bhocmij8ha /)'Arashok.aarti karoti niya(am !Yina(Jm. Jf it is an a h05tile
planets intk.len::e or in a sign ruled by a hostile planet his son is to
di!.
Jaageshwar: MMiije sute SllrudMllvMnkaphair-
vaatagulmalhi swayam peeda chyetsau. Param val kalatraata tittha
nitralr}spi bhaved dukhitosmitrat:ashrchaapj noonam. Yadaa mangataha
p.artehame vai naf6anlJttm tadtta santatipryaM naSilylJM va. He is
sUfers from Illness of the vatha and kapha systems and has pain
from cancer. His friends and fQes harm him a IiliA:, so does his wife. He
has children but they cie soon after birth.
Bri hadyavanajaatak: Kapharitavyaakui<Jta kalatraanmitraacha
putraadapl sa<J<hyahaanlhl. MatMmlomaa Viptlo )ayashdoa prasootlkaale
tan.ay8ai8Yasthe. d what he has said is the same as lngeshwar.
The only two new things are that the person's mind is inevitably against
the flow of tide In society and he is Imminently successful.
Shashtesagnibhee!irclharaneejaha. There a fear of damage or death
by tire when he is six years dd.
Ka shl nath: Panc.hmasthe dharaasunau kusantalJnaha
sadaarujaha. Bandhuvargaitviraktashdla muo buddhivivarjitaha. His
chiiO'en are not d good character ard he himself Is II all !he time. He
does l"()t want to malr(aln rel ationships with people. He is stupid.
Mantreshwara: Vlsukhotanayosnarthapraayaha sute
pishunosalp.Jdhehi. He is stupid and has no sons.
Aryagranthakar: Tanabhavansansthe bhoomiputre manushyo
bhavatl tanayaheenaha yael vartate
73
bhoomip(Xraha krishakamaniketam putramekam dadaanti. He has no
sons, is a Sinner. and hiS life is unhappy. Jf Mars is in Aries:, ScorpiO or
Ctprloorn, the person has one son who Is weak and siOOny.
Punjaraj: proktaadgeshu
mrit81)1jaast.hv bit81aam dukhitaha. His right foot sustains
injury from burns or His children die at birth and he is
unhappy.
Jayadeva: lt is !he same as Jaageshwar.
Jeevanath: Apatye kshamuputre bhlJvati jathlulJag
nlhlprabalataa. Na santaano jeevatyaapl yadl cha jeevatyapl gad/.
Sadaantaha santaapaha k.halvmatiranalpaadhanichaye. Kritespi
swargaarplimA h; }IJnivttMmMmnivMn. His appetite is Wge, hi! is
always hungry, tis children do not live, !hose who do manage to sur'IAve
are constantly ill, there is hatred and ermity in his heart, his mentalfty is
criminal and ht will never go to htaven.
Narayanabhatt: lt is the same as
Gholap: He is dart<, suffers imprisonmert, debauched, one who
has to flee abroad because d pollcal prolll<rns, red eyed, fool, keeps
the company of fools, suffers from ailments d the vatha and pltha
constitution, and his wife is not chaste.
Gopal Ratnakar: Unfortunate, unhappy because d the King's
displeasure, his Children are born dead.
Hillajaatak: panchamaha panchame vlNShe bandhunaashakaraha
kujahJJ. His friend cles when the eNid Is flv<!.
Yavanmath: He speaks less. His son, l&ck d wealth and lack d
professional success leave him unhappy. He has no status and he is
constantty angry as a resUt of which he suffers from acidty.
Paaschaatya Math (Western Thought): lf Mars is under aov
hostile Influence the person loses tis wealth In gambling. His son Is II and
there Is always fear that he may cles suddenty. He has wealth and a
good wife. He is a dnJnkard because d which there is ne\'ler any peace
in his family. He tends to SQI.Wider money. If Mars is under an auspidous
i nfluence t he winds monty in races, l otteries or through
gatOOIIng and travels a l ot. He suffers from Vatha, Pitha and Kapha
ailments.
Parashar: Panchame pitrihaanim cha dhanaiJ)'atisutaU yashaha.
His father dieS bLt M gets a k:( of W(!blt h, Chikten and gklry.
Lomash Samhlta: Arko r.tahuhu kuja saurilagne UshtaU
panchame p'taram maatatam hartl bhraataram ella sf'Jslr.m kramaataha.
If Mars i s i n the ascendant or the Fi fth House, the Sun causes \tie
father's death, Rahu causes his mother's death, Mars causes t he
brother's and Saturn causes hiS Children to <it.
Unknown: NirdhMalla putraabh&vafla ra}akopaha
shashta varshe aayudhena k fmchl chchanda kaalaha duNaasa
nagyaanvaan maayavaadi teekshnagheehl. Ucche swakshetre
putrasamriddhjf'j bvdhibhranshaadrogalla. pMpa)tJte pupi
veeraha. OartrapWayogaha. PttraartJ swajanalvaard udare
vyaadhilli. Pat11ikashtarn. He is poor, so,..ss, badly suffers ll>e
King'S anger. When he is six he sustains an injury from a weapon. He has
sinful thouc;ttts and habits. In Capricorn, Alles and Scorpio the person
has many sons, donates large quantities of to the poor, and has
authority. His enemies cause him suffering. H r.1ars i s i n any
lnltuence his chil dren are destroyed, his brain Is Infected with disease. l f
Mao; is enslaved by the l.o<d <0 the Shth House the pe""" is brave but
sinful. His son's death causes him grief and he has to adopt a son to be
his hei r. He quarrels with his own people, suffers from gastric disorders
and his wife leaves him.
My Thoughts: All t he mal efic properties mentioned by
astrologers so far apply to masculine signs. The 9ood trai ts mentioned
ap,:ly only to ftminine signs exa?!pting capricorn. It is worth noting t hat
except Parashar all have menUoned onty negattve traits of Mews In this
positi on. All \tlese negative things like loss in financial ventures, son's
death, son's destruction, son's illness, disco,.ert in the famil y, death d
father and brothers, childl essness, wife's miscarriages, stupidity,
wk:tedness, po..-erty, fear of fire and weapons, cruelty, trcwd,
corru .. i on, cana?!r. harassment by sons, stupidity, extreme hunger.
75
sinful nature, jail term, foolishness, keeping company of fools, loss ($
prestige, angry destructive nature, are all appliCable to
masculine signs and C.aprfcorn. The positive traits laid out by
Btihadyavanajaatak and Western Thou1lt are seen in feminine 59'1s.
ParaShar iS wrong when M predicts the father' death as the Fifth
House has no oomectlon to the fathet's life. He may have said this
me1y because from the Tenth Hou,., the Fifth Hou .. in i!le eighth
place which has a say oo the father's life but he is still wrong.
My Experience; Sons ate born and do remain alive in au feminine
signs except caprkx:lm and also In Gemini which is a masculine sign. The
first son, h::lwever, dies. In other 59'ls the mother miscarries, the child
is bom dead or altematety dies before the age of five. But this is
because of the sins committed by t he mothtr in a pre\'ious life. At such
tfmes the mothet's hOtoscope should be examined or she shouid be
asked what twe of dreams she has to be at1e to interpret why this is
taking plbce. She could be sul'fering from any one of thts!! probtetns:
pain during her menstrual periods, Irregular pertods, pain O .. ui ng sex etc.
If Mars i:s in a feminine sign, the person's wife has t hree sons 1M they
are wicked. If th! tlrst bom i s 8 will survive.. As f8r 8s what
Parashar has said about the father's destruction my experience is: if
there is a malefic influence in the ascendan;, in the House d Wealth.
Fourth House, Fifth House or Sixth House the father's dt8th i s likely.
Similarty If there is a malefic Influence In the Severth, Ninth, Eighth ,
Tenth or HQ..Ise d Profit the mother's likely. Another \lerse Paras""r has
written like this, the father's death Should be predicted after
checking what planet 1'\Ae:s the house which ts In fourth from the
SUn and mothe<'s deoth should be predicted ched<ing the rUe< <1.
the house nve places from the Moon, while friends deaths can be
predicted after checking the situation In the eleventh place. If Mars Is In
a feminine sign in the Fifth House, the person doesn't have wealth but
he does not want for prestige and honour. If i t is in Ari es, Leo or
his education n!lates to /Vrrrf, polloe, foresby, engineering.
aeronautical sciences, dri ving, technology etc. In Taurus, Virgo, or
Capri corn t he person's education relates to surveys, geol ogy,
overseeing, taitoring etc. In Gemini, LIJra or Aquarius t he pson's
career and stu:Ues ate In the direction of medicine, medcal practh:e,
defence law etc. In <:anw, Scorpio and Pisces it is surgery, histoty but
76
wit h an honoul'5 degree. in the Fifth House signi fies r..
Bhatt Buva and the l ate OadasaMb Khaparde are people whose
horos<:Opes are perfect examples or mars In the Fifth House. Their
manner is businesslike and their attitude friendy. Marriage CXOJrs late in
life. Their voices are sweet blt etrfminatl'!. In the horoscope of J N
Joshi, a renowned singer of a ftrm called .. His Master's Voice Mars was In
the Fifth House in Qtprk:orn, He was married late to a woman f rom a
differtnt In t hiS Situation. t hose who take bn"bes are caught
earty. They are well-dressed people who are well veiSed In skills required
in the bedroom. They do not have difftculty in pleasing women. They
are dominated by a desire to succeed and M ha'loured. Thty tend to
squander money and can be debauched. Now see an example d a man
in whose horoscope a mdoclous voice came built in.
Kumar Gandharva bom on 8-4
4
1924 on a Tuesday attemoon at
3.45 p.m. a( in the erstv.llile ""te of Songli:
""' -
.... '"'
Mars in t he Fifth House and Rahu in the ascendant gave his a
leaning towards singing. He had a perfect voice for singing and this
brought him prestige. Since Rah.l was In the fourth place f rom the
Moon, he reaped the benefits of good deeds done in previous fives. His
father was also a singer. Mars in the: Rfth House augurS b<!lvef.,
there is much foreign travel. It Is also good for doctors. They haW! to
treat people with appen<lcitis, li er or spleen disoltlers or those who
haVI! tonSillitis as alSO thOSe suffering from sexually transmtted
Such doctors get fame because ci the quality ci th<* treatment. If
Mars is in the Rfth House of a lawyer he ends up having to deal with
petty and abi.ISive dients. If it is in a rnasculiM sign the person
has more dealings with men and If It is a feminine sign the maj<Jtlty d
the person's dealings are with women. The l)ef$00 has a
nab.Jre and an excessive libidO. Doctas in whose hOrOscopes Mars iS in
77
the Fifth Pl ace are kind to poor and needy patients. Whether a doctor,
or a lawyer. the person grasps hiS subject with They are sweet
spoken. frlendty but am>gant . In this regard what Western Thought
says is '"'they are entl"a.lsiastic, hard working, edvc.ated ard willing to
try ... ThiS pl3net iS S)mbolic of powtr, expansiOn and vitality. The ptr$0n
values his Independence and cannot stand being Incarcerated f f!\'en
a minute. They are generous, brave and courageous. There is no ladt
of setf-confidMCe in work and ttl is help! them gtt g-eat honour.
have to against false bravado and anger because this makes
them recldess. They are arrogant, lose their terTl)er easiy and break
the pe.ace. They capable d doing mUCh work in a Short d1.ration
and with a ittle bit or dlsdpUne they can excel in anytNng they choose.
Mars in the Sixth House
Parashar: Shrastte ripusiJtrH1dhim ch jayam bandhusamaagamam
arthavrldhhim. He has many enemies but Is victorious. He gets on well
wit h his in l&ws but has no wealth.
Acharya: &JlaKJana shatrujitashradut shalruyaate. He is powerful,
strong and one who wins CNer his enerrie:s.
Gunakar: It is the same as Acharya. He: is the lord and makes his
servants wortc. He cannot work on his own.
Baldhyanath: Swami ripukshayakaraha prabalodaraagnlhl.
Shreemaanya shobalayc.tosvanije rifxlst/Je.. Powerful, one who destrovs
his enemies, wealthy and prestigious. He has a large appetites.
Ka lyanavar ma: Prabalamadanodaraaginilli sushareero jaayate bali
rudl'im SM'Ibhavatl nantha swabandhuvfjayati priJdhatJnaShcha.
He Is lustful, has a 1a<9e appdfte, good looking and one who wins <Her
hi s
Aryagranthakar: Rjpugrihagatabhaume sangare mrityubhaagi
sutadhanaparlpoornastungage Sllukhyabhaagl ripuganaparldushte
neechage kshonlputre bhavati Vl'talamurtilll kutsltaha kroorakarma.
ThoUilh the usage of the phrase "death in his dest.iny .. is used in ttle
78
context of battle but ttis is overall qlite debatatie. He has wealth and
sons. If MarS is exalted person is hbppy and if not he is we.ak.,
shamed and cruel.
Jaageshwar: Mahljo yada sllatrvgo val naraanaam tadaa
jaattharaagnirbhaved deeptatejaahaa. Sadaa malttufe dukhadaayi
prata/Jpi satam sangaUari kO!amllyuktMia. He has a l arge
appetite, his matemal uncles suffer, he is brave, friendly and lustful.
Brlhadyavanajaatak: Praaba/yam syaajaarha raagnervfsho
shaadro roshaaveshaha shatrvvargs.api shaanti. Sabdhlhi sango
dhaf'ITMbhUI!i syaatrarMmam gautre puny6Sy0dayo bhoomisoonliU.
ViShesllaat roshaveshaha. He has a f.ery temper, though his foes are
peaceful . He is spiritual and He helps his relattves prosper and
has a son at the age of 24.
Kashlnath: ShiJshte bhBUme sh8t:rvheeno nanHtthaiti paript:xlrl-
t!Jha. pus/tit deMilalla stu.IJI'Iach'tttsluamtJ }Myate.
has no enetries, he has lots d wealth, In feminine signs he has a frail
body but dies in peace.
Garg: Bilhudaal3ogn/punskaho swath sukaatyO balvaon kuje. He
has relations with many women, does good deeds and is powerful .
Jayadeva: It is the same as Kalyanavatma.
Punjaraj: Rudhiro yada.J p.JshJmaytJm chostjam. lf
Mars is strong in the Sixth House the person has to trade in catUe,
sheep, or camels. Aaro rlputilaavaSMistltaha shastraagrJhaatavaagnl-
dagdham. Karotl martyasya cha maatulasyiJ
vidushitam v.v. He and his maternal unde beth fear being poisoned.
Mantreshwara: Prabalamadanaha shreemann khyaaat.o ripoau
vijayi nripaho. He Is lustful, -.fttly, glorious, vlct<>'lous and king.
Jeevanath and Narayanabhatt: The same as Mantreshwara.
Gopal Ratnakar: One who is vanquisher of his foes,
serves the ldng, knowledgeable, he starts ambitious ventures but Is so
lost in his dreams of su::cess ltlat his business fails.
79
Gh olap: One who home happily, intelligent, one wtlo can
donate generouSly to the learned to t um them in hi s favour, lustful,
one with a large appetite.
Hlllajaatak: Putralaabhakaralla shashta shrhaturvlmshe cha
vat:s8fe. He has a son at age of 24.
Yav anmath: One who def eats hi s foes, be.utifut, peaceful,
wealt hy, generous, indebted and Clfl! who leads his kin.
Paasd'laatya Matti ( Westem Thought): He cbes not like li ght
work. If f\1&rS is in a stabt! loastia'l tht'! perSon fran urinary
Infections, audlac cl:sorders and r.testlnat tfSOtders. If It ts In a ctJat sign
the person suffers from dlest lmg infections. tf it is in a passive sign
the person suft'ers from fear of fire, baldness, and upset stoll'lbChs. His
servants are wicked and If Mats Is under anv malldous fnfluence there Is
a strong risk of the person dying in an acddert.. He has a capac:ity for
much work.
Unknown: Prasiddhaha karyasatnatthalla shatn.tutlltM putravaan.
Saptavlmshatlvarshe kanyaakaashrachaadltyta ushtravaan. PiJiJPiJrkshaJ
popoyvte popodrishr" pu-nafaloonl V88tashvlaadirogaha btxlhakshetre
k.UShtll rogaha. Shlbh.JdriSht:re parihaarllha. He gets glory cuxl has the
courage to achieve any task. His enemies ate destroyed and he has
sons. At the age of 27 he has a daughter and acquires camels and
horses. If Mars is malefic then an the U'llleasant traits manifest and if it
Is In Gemini or VIrgo the person contracts leprosy. lf there i s any
auspicious Influence the leprosy Is warded d f.
My Thoughts: Whatever Acharya, Gunakar, Kal yanavarma,
Baiclhyanath, Paras:har, Yavanrnath, Gopal Ratnakar, Hitlajaatak,. Garg,
K.ashinath, Jayadeva, Mant:reshwara, Narayanabhatt, leevanath, have
said Is applicable to feminine signs. 8l.t traits lustful, large appetite,
ennjty with the Aeamed, etc. appty to masculine signs. The first half d
what Aryagranth has said to masculine Signs and the second to
femlrine slg\s. Btlhac.tyavanajaatak's statement alx>l.t extreme anger Is
also applicable to maSQ.II ne signs. Silrilatly what Jaageshwar has said
about maternal uncle's suttering is atso applicable to masculine signs.
What says is oriy i f Mars a fire sign.
80
My Experlence: r-1ost traits are already mentioned. What is
significant is that the: maternal and aunt die as dO children. Tht
aunt couk:t be widowed and both the aunt and the uncle may be
childes:s. The person himself may not be even takes bribes.
us: look at an example d Mars in ttl! Sbth House:
William f.1arconi (the man who irwented the radio)- born on 25-4
1874 at RDme, Italy (latitude 4154, longitude 14) with lhe phase
of Sagittarius aS<:endant
'" -
Chanbel has said about the 25"' '*'ase that it is similar to man
ftying in a balloon the dOuds. The uses Sldence to detect
Ulat whk:h Is a mystery so far. He succeeds after great effort and gets
glory for it. Marconi was unhappy where women were con<erne(t His
wife divorced l'lim in 1910. Though his parerts warted him to be a
music maestro he insisted on studying and and
ultimately that brought him su::oess. Men In Vttlose horoscopes Mars is
in the sixth place have a very histllibido and are harsh in bed. They
have a few sons but they dies. The first or second son can be
Intelligent if he lives and dies just when he ls about to start earning.
There is a J:OSSibility that the wife may be sterile. Hil&ajaatak has said
that the man may have a son at the age: of 24. Since in some
rommmltles oow mani ages take place ony between 2S and 30, the
logic of this has to be ex.perienced before it can be taken as correct. He
very intensely h.Jngry especialy in mld-aftemoon. His libidO and
lust are high. The excessive appetite makes him eat excessive
quantities rJ klod wtich increase the heat levels in his boct,o and this
causes atl kinds d illnesses. His su<n:ss is d the degree but
comes only after persistent labour and repeated failures.
Mars in the Seventh House
Acharya and Gunakar: His wffe Insults him.
Kalyanavarma: Mrltadaarro rogaartosmaargarato bhavatl
dukhitaha paapaha shreerahitaha santaptaha shushkatanurbhcrvati
saptame His wife dies. He is ill., ill mamered, sad, siriul and
poor. His leaves him lean.
Baldhyanath: Streemodapravilaapako ranaruchihl kaamast/'ithe
bhoomlje. He has to struggle lOt a woman. He loves battle.
Parashar: Strlyaam daaramaranam neechasevanam
streesangamaha. Kujokte sustanaa kattmordl'fwakuchaa. His wife dies
and he satisf'tes his lust with lowly women. His wife's death is
Saravall: His wife's are: dried and smalL
Garg: Munigrahagatabhaume neeehasansthesarigehee
yuvatlmaranadukham jaayate maanavaanaam. Makaragrlhanljasthe
naanyapatnishchadhate chapalamativishaalaam dushta chintaa
vin:Jc:lpMm. If Mars is malefiC, his wife dieS and if it is au5piei0us he has
only one wWe who Is mlschlewus and lntellige<1t b.- wicked and ugly.
Mantreshwara: Anuchitahro rogaatorstesadhwagno
mritadaaravaan. He ls Ill mannered.. <iseased and a traveller. His wife
dies.
Bhoomiputre saptamage rudhiraaktospi kopiJVaan.
v/NlchakaShma nirgtnospi bh.tvennaraha. He has blOOd
disorders, Is atl'l'f, wort<.s as a servart, loots and cheats people and Is
not virtuous.
Brihadyavanajaatak: Nanaanarthavyarthachit:opasagaimbaifi.
daarrpaty.,n.tnttduhkh.tpr"t"pt.!m
daaraagaarengaarakrosyam karotl. He WOIes futilety about clsastets
that he has no control over. His enemies him. He is forever
worried about hiS sons. He has fear of fire when he is 17.
82
laageshwar: Yadaa mangalaha saptame syaatdaanim priyaa
mrityum3apno tyavltnshyam vranairvaa. Parllm
rogakrooraralshrocha rak.taadwlchaarya twlndam janmakaalestha
prashne. Sukham no naraanaam tatha no kryaanaam tathBa
paMJamushH Paraspardf'llJya
shattwargaat yadaam maNgaJo mangalaayya grihe syaiNh. His wife
dies. He has sc.ers and abdominal infections. He has blood disorders, and
all faults are seen in his birth Chart as well as horoscope. '* is
unhappy, unsu<eessM assauted and l)<blcly shMled, and harmed by
fighting IWs foes.
layadeva: Abalaagatagehansachayom roognarthosaribha
yodttyune kvje. His wife defeats tim. He has a good muse, but is a
de'structi...e man who fears his enemieS.
Punjacharya: narasy" samani
pltavranenaanvltadagdhaa va vishavanhltaa yadl tathaa vaa
bastirogaanivita. Bhoomiputredhyoonabhaavaopayaate kaantaa
heenaM santata/16 miJMaVlJha syaath. His wife i s not youthful and
suffers from pltha system or scars and WO!.I'Ids caused by
bums. She is certain to die.
leevanath: Kuje kaantag88fam janosteeva laghtt.aam.
Samaadhate yudhe prabafaripunaa sA kshatatanuhu. ntthaa
Kaantafhaati paravlshayavaasl khalamatirnivrittovaanljyaadapl
paravaghoorangavirataha. He is lacking in all respects and is defeated in
battle by his enemies. His wife dies ard he has to live abroact. He has a
wldted bent of mind ard avoids doing WOfk so that he can spend time
with women.
Na rayanabhatt: lt is the same as Jeevanath.
Gopal Ratnakar: His wife has body aches. 11 Nars is malefic the
wife dies. lf not the wife He himself suffers from diseases in
the stomCICh and arms. He has many and maternal aurts and
uncles. He is lrtelllgent
Vaslshtha: His wife's fidelity and the paternity of the children she
bea<s Is doubtful.
Gholap: What he has said is wrong.
Ram Dayal: 'l'cluwnaaddlry8 kujespihi.lf Mars is sttOf'9 the wife is
youthful, CJI.J!I, aook:ed and vy ordinary IOOki:lg.
Hillajaatak: 5apt.Jtrimshanmite vhrshe cha
saptamaha. N. the age of 37 ros wlfe cles.
Yavanmath: He gets very little time from his wife. He Is urtind
but prefers not to get into argi.J'!lents. His wife dies.
Paasctaaatya Math (Western Thought): His wlfe is harsh and
quarrel some and they do not have a happy marriage. He has to
constantfy remain on hi s guard for the next quarrels and the: is
frequent chMC:es of visiting the <XlUrts to solve quarrels his wife has
struck up with neighbours and others. The enemies are strong and
opM. does not benefit from partnerstlips. The behaviour d his wite
leaves him .,ritabte. lf Mars is in Caner or Pisces, the wife's behaYiour is
terrible and the i'l'\ill'l has to act against his better 1"0ture. He suffers
losses d his frequent defeats in court and his irtleritance gets
destroyed.
Unknown: Swadaarapeedaa paapaMhe paapayute swaMhe
swad88fahaarWhl. Shvbhayute jeevati apatyainaashaha videshavaa58ha.
Vigatatanuhu madhyapaanapriyaha ranaruchihi. Choranyabh
chaaramcolena ka/auaantaram dushta streesangaha. Bhagachum
bakaha. Mandayute hashtre shlshnachumbakaha. VandhY8araj8
salaastreesambhogi. T.ttra shatruylAe bahukaltranaashaha. AhanlaNJrih.
In a malefic infkJence Mars in the seventh House means the wile lives
but th8 children don't. They have to live abroad. HiS body Is lean. He
is a dl\lnkard and q1.0rrdsome. He hits affairs. If Mars Is
with saturn the man has sex with other men and is bisexual. He
frequents brothels and if Mars is hostile he marries many times and each
of his wives dies. He is arrogart.
My Thoughts: AI astrologers have preclcted only bad traits for
Mars in this position: ill tef11>erecl wife, ugly wife, defeat at
the hands d enemies, losses in business, illness, grief, sin, poyerty, etc.
These are seen in Taurus, cancer, Vlf90, Sagittarius and Pisces. In the
84
other signs it is the good traits of l'-1ars that manifest.
My Experience: The person is a jac:k r::l all trades but mastet d
non!. Frcm age of 18 - 36 he has some stability ard takes._., ont
of the prdesslons dott*lated by MaiS. In this situation his wife is good
but quarrelsome and dominates the ll.lsband. Jn Aries, Leo, Scorpio,
capricOrn and Aquarius there iS a dual influe!nce. In Taurus or Ut.-a the
person 11\tes tis wife a lot v.tlle In Vlf'90 or Aquarius the person person's
fate takes a tum for tile better after marriage. Jt even better
after hiS sond marriagt. In cancer C&prkorn the person has to
wortc very hard til the age of 36 and then the rest of his life ls easy.
Mars in the Seve:nth House brings these professional
opporturitles: In Alles, Leo and Saglt!Nlus - printing press, In Taurus,
Virgo or Qlpri(:om- building contractor, timber seller and agriculture. In
Gemini, libra or Aquarius cycle or car pilot or mec::h3nic, in
cance-, Scorpio and Plsres ascendMt - surgery and engineetlng.
See ttvee examples of Mars In the Seventh House .-. an exalted
position:
I. Dote of Birth ICI-5 1892 Tuesclay, latitude and longitude 15-
23.
-
He was married once, his wife was but their children
survived. He was a farmer.
2. Date of Birth 10--6 1892 on a Friday at 5.30 a.m. at sunri se on
the 13
111
meridian.
SUn, Mer
...
HI! was a ttarned professor and earned a good salary. He: had a lOt
of prestige, went abroad a few times and had a good IMerltance. He
did not get married as Mars was retrograde in the 5everth House and a
stable f.1ars was in tM ascendant where venus was retrogrlld4!.
Therefore the SUn and Merrury were In the seventh house from the
Moon meaning that there were tiTee malefiC influences in the sphere
or venus. He always wtte a distorted expressiOn Whk'h result! in him
needing an operation to cure It later. He was fever ill. He was of
medium heigtt and lean build.
1. Date ol81rth 13-71890 at Ratnagl ri at 5 a.m. local time. He
did not get I'T'IaiTied.
J( Mars is in Gemini, Virgo, 5agittarius, C8pric::om, SCors:io or Leo the
person's wife will have a tendetlcy depending upon aspects d Satum,
~ n u s and Rahu to sleep with other men to have a dlild. This mav be
haJ)I:)erWig 'Nith the husband's knowledge. The man Is quite intelligent
but arrogant and Ill mannered. In a feminine sign he tends to pank: in a
crisis but if it is a feminine sign the person is extremely courageous. He
has few frierds and not much happiMSS from women. ThiS is u s e
of sins commftted In an earner life. His wife loses a parent ecvly. Doctors
In whose horoscopes Mars Is In the Seventh House conduct post
mortems on accider( victims and also perform major surgeries wflich

bring them fame. They tra\lel abroad. Lawyers succee<l in appeals in
deftnc:e law. Therefore a lawytr who has Mars in the 5everth House
shoul d oot lose heart If he defeated In any case, also a good
placement for mechanics, engineers, tul1"ef"S, fitters and drivel'$. lf the
pason iS a policeman or an inspector in any department he Should
conduct elec.tfons to choose a female partner for professional pui'JX)ses,
this will bri ng him fame. Thi s is l"()t a good pl acement for people
working in offices as they end up frequentty quarrel li ng with their
seniors. ln Atles, Leo and Sagittatius the person gets honest servants
but the man himself will never be a very superior master.
Mars in the Eighth House
Acharya and GunaJcar : Nkl'tanagesalpasuto vikaleksh1iJhB. He
has few sons and bad eye-sight.
Parashar: Mrityau dhanlJIIMShlNTI paraabhavam. He has loss of
wealth and prestige.
Kalyanavarma: Vyadhlpntayosalpaayuhu
neechakarmakartaa cha. NfdhaniJSte kshltltanaye bhavati pumaan
nitysantaptaha. He is frail and ill, long ived, ill mannered and sad.
Bai dhyanath: Vineet aveshodhanavaan ganesho mahisute
r.!l'lghragate tu jaatMa. His clothes are sober, he Is wealthy and
prestigious.
Garg: Mritym gato mrltyukiW
va. Ku shta pranaasho grahlnlprapeedaanayatyadho naasha
kamaanayed!. He dies of being injured by weapons, or leprosy, or
gangrene, or bums. His wife suffers.
Kashyap: 1M perSOn dies in t he fol owing manner in Aries -
battle, caugtt st ealing cows, suicide, murdeted by enemies, stung by a
cobra, trapped urder a failing boulder. bettayal b'( a woman, drowning
in a well, trapped under a col lapSing wall, of sexuany transmitted
disease, by poisoning, attad<ed by thieves.
88
Narayanabhatt; Shubhast:Bsya kim k.hharaahaa kuryaranye
vidhlJlJMspi chedashta bhOOmisvnlJha. SukhlJ kim shatryutf!
satkrltospl prayatne krite tn:x>yate <hopasarge. If f\1ars is alone In the
Eighth HOU$e then other auspicious influences in other houses are
useless. HiS friends become: tnemies and no matter what he
does the result Is only devastation.
Gopal Ratnakar: He has few sons. He Sllfers from eye diseases
and lives only till middle a9t. His father ard paternal grandfather suffer.
His matfn"'81 uncle dies and the person viSits prostitutes.
Gholap: He i s unreligiou;, i nsulting, and suffers fran ailmerts d
the vatha system. He is a fool, coward. ill mannered, one v.t.o cannot
feed his wffe and ctllk:r-en. He is a sinnet, lean, spendtiYift, sutreiS from
blood disordeiS ard eye infections. He is afraid d his enemies.
Hillajaatak: Parn:havisho tath88 varshe mrityukartaasllta maha
He dies at the age of 25.
Yavanmath: dlseased, harassed by lis vm'e, anxiol, injured
by weapons. He is a good examiner.
Paaschaatya Math (Western Thought): He does not benefit
from If the Sun and the Moon are in a mak!fiC combination
the JX!rson dies suctlenly. If Mars is alone in this p&ace, the death is oot
earty. He could be shot dead. lf it Is in a water sign he could drown, and
if it is a fire sign he could be burnt alive. lf Mars Is In an air sign he could
die d psychiatric ailments. Good ludt comes ooty if Mars is an earth sign.
Unknown: He stlfers from ere diseases, lives till rri::lcle age. his
father dies, the persoo suffers from urinary infections, has few sons,
has gastric disorders, l>as a happy marriage, and will die by tile >ward. I f
Mars Is auspidous, the person wi ll be healthy, l ong lived and have a
hannonious life at home. If it is malefic the person is in great pain due to
uMary infection. If Mlii'S Is strong, then the person lives long.
My Thoughts: Barring Baldhyanath all astrologers have ascribed
only malefic traits to In the 8ghth House. These apply only to
masculine signs. The ones mentioned by Baidhyanath apply to ftrmifine
signs. Though Kashyap has listed twetve types d death nooe seem
sisflificart. to me. The matter d death and how it comes are
deatt wit h at length in rrtf bo(jo on Sattm.
My Experience: If Mars iS in a sign, the man's or
servants tend to publidse domestic matters to the
After marri age his father in law i s poverty stricken. The man i s a
debauCh. HiS f8Ce iS p_:,Ck marked. Mal"f)' astrologtrs dealt with tht'
issue of chlk:fren here, possltly because It Is In the f.tth plaoo from the
spaces reserved for the father and the mother. Ordi narily the 8ghth
House has oothing to do with children. There many be many c:hikten if
cancer ts a feminine sign. et Scorpio or Pisces dominate the Eighth
House. If it is in a sign there are neld to no dli ldren. ln Taurus
and Virgo there are f ew children ard none in Cilpric:om. Since this is also
Hou.se d Wealt h for tM man's so She is poor. This rn.?Jkes: it
very di fficult for the husband to manage finances. But Mars r. a
femirine sig'l brings him great luck. He gees a wife who is an excellent
speaker and loves him a lot But t his happiness does not llJst long. With
Mars In thls position the person can be an officer who does oot get
caught despite tating many bribes. The person has a habit of like
a gkJtton till the age of 30. In lat er he from Malaria, anaemia,
lmtK)tence, blood pressure etc. He dies in peaoo. tn cancer, Scorpio,
Sagittarius, and Pisces t he person practi ses yoga. ln Aries, leo,
589\tarius ascendarts is a poitici an. But long lite iS not a correct
prediction f or Mars In the Bghth House this oca.rs onty If its liri<s to the
SUn and 1'>1oon are flawed. In ttis placement of Mars the person has a
strong deSire f sex at 4 in the afternoon.
Mars in the Ninth House
Acharya: He is a siMer.
Gunakar: Dharmesampativaan. He iS wealthy.
Kalyanavarma: Akusllalakarmaa dweshyaha praanivadhaparo
bhavMnavamasa(lsthe. Ddhatmarahitostlpapo natendrakrilagauravo
rudfire. He does not exool and t his angers peop)e. He Is destructive,
violent. unreigious and sinful but still gets prestige from the king.
90
Parashar: PNabhavmanattha cha dharma paparoochikriya. He is
by people and commits acts of destruction and cte:vast!ltion.
Baldhyanath: BI'IOOSI.IlAu yMJi pitraniShtlla sJtmtrta khyalttaha
The Indecisive. The man gets prestige.
Garg: Kuje raktapatanaam hi bhavetpaashupajl vrlttihl.
8haagyaheettas4h satali:!m naraha pt.myagriham glJte. His 1.11fortunate
has a love f m11der and corpses.
Aryagranth: Navamabhavanasansthe Kshenipvtrestirogi
pingallha Sllrvadaiva. Bahu)anaparipurno
bh.lgyaheenaha kvcmiio v11<ol.>}'nasvveshl sileel.>>ldhyaaoorakraha. He
is very diseased, his eyes and body are redcish yellow, he is always
suiTOl:llded by people. He is ll'lfortunate. HiS c.lothes ar e Shabby. He is
talented but suffers many different allmeniS.
Jayadeva: Seemayuto bhoopatlmaanayuktaha sasvo vldharmo
naV(}me dharaaje. He has respectable strength, is revered by the king,
wealt hy but urYel igious.
Jaageshwar: Sabhaume vishttadhyagripeedaa. Kushee/aha
kuleelaha param bhagyaheenaha pade rakrarogl ktlshaha krooral0nnaa.
PrBtaltPi tapejjamakaale yadl sy8anmaheeje yadapunyabhaavam
prayaataha. He suffers from poison and f ire. He i s debauched, ill
mannered, unfortunate, auel, 'victorious, lean and one whose feet are
Infected with blood <lsorcSers.
Brlhadyavanajaatak: Hlnsavldhaane manasaha
pravrittirdh81a81]ate gauravatosapilabdhihl, KsheeniNTI cha punya
dravinam naraanMm punyastllithaha kshonisutaha laNoti. He is violent,
respected by the Icing, does not do good deeds, and has no wealth. At
the age or 27 his 9oocl lucl< begins.
Kashlnath: Oharmasthe dharanlputre kukarmaa
gatapaurushuaha. Neechaanuraagikroorashcha sankashtashcha
pra}aa)0te. He is cruel, wicked, one who keeps the CO"l)any
of lowly people, and suffers a lot.

Mantreshwara: Nripasuhridapi dweshyostaataha shubhe
jarghMt&Ah.t. He is th! King's f riend but peopt! hate him. He l oses
his father and hurts people.
Punjaraj: Aarau bhraatrlnaashapradau sthaha. Dwabhyaam
heenaha. Two brothers die.
Ram Dayal: AI.XesagnyHclivisha;m;it;Jha saSBhajaha. He suffers
from fire and poiSon but haS many friends.
Vaslshtha: Dharmasthithaa bhoomiputraahaa kurvanti
vim.ttim He is unrtli gious, stupid and ill
mannered.
Gopal Ratnakar: HiS fathet's happiness is destroyed. He has to
wort. for a living. He is cruel and travels in a boat to execlt:e his trade.
Gholap: He Is authoritative, a poet and has no enemies.
lllllajaatak: 8/loosv!D ,.,,.magashrachaturdashe vatsare
GatanMShnam. At the age d 14 his father dies.
Yavanmath: Respected by the king, famous, ooe who sleeps
with other men's wives, fortU'\ate and one who lives happily In his
>illage.
PaaSGhaatya Malh (Weste<n Thought): He Is harsh, amllitlous,
a liar, a traveller, suspicious, one who is harmed by his vfe's relatives,
has marginal faith in r eligion. l s sceptical about spiritual f'J\lltters. If Mars
Is mal efic the person Is arrogant and has no control t:Ner his mind. l n a
fire sign he is generous. In earth or water signs, the person has a
slightly good nature. If Mars is in the Ninth House in an air sign the
person Is a habitual law
Unknown: His father dies earty. He Is unfortunate. If Mars Is
auspk:ious then the person will have an extra mcwl tal affair with his
wife. His good fortune only begins in a foreign land. If Mars is
auspklous t he person does good deeds and he can rule. Here Is an
example of a person whose good kJc.k started once he went abroad.
92
Date of Birth 12-6-1896 at 9 a.m.
"''
This person traveled north and then his good luck began.
My Thoughts: Descriptions like sinful, cruel, ill mannered,
destructi...e, vioJent aoo debauched apply to onty Capricorn and Pi sces.
Those like King's favour, weal thy, famous apply to Aries, Leo,
Sagittarius, Career, Scorpio and Pisces. The brother's death occurs orty
in masculine signs. Learned but unretigious applies to au signs b.Jt Aries,
Leo, and taprlcorn. The law brealdng tendency ts seen In Gemini, Ubra
and A(J.Iarius. All the illnesses listed like sexually transmitted disease,
eye irtections etc. are correct. Suc:h persons want to gain at the
cost of causing great loss to otherS and a characteri stic trait is
about people beNnd their backs. They are cowards but
pretend they are very They are excellent in hatching
poli tical conspiraci es and love showing up peopl e. When t hey
themsetves face humiUatJon, they In public but carry a
Thou:Jh they acquire fame it i s not wise to trust them. These people
believe they are supreme in learning a nd will declare their teachers fools
without hesitation. They are ill mannered, arrogart, Ill tefll)ef'ed, and
people who ill treat cows. He may travel abrood and get injt.l'ed in a
figtt. In Ants, Leo, Sagittari us, Cclna:!r a nd Scorpio the person is active,
powerful, gene<ous, loving and friendl y. In A<!Ua<lus, Scorpio and Pisces
the person is selfish and in cancer the person gets good benefitS.
1.et us view two examples of r-1ars in the Ninth House:
1. Mr. Kashinath Sheth Gatwanakar. Bom on 25+1898 at Vasal
on a longitude of 15-25.
93
-
2. Galwanakat's brother Or. Sadanand Galwanakar lxlrn on 3-.11
1900 with 0-4.
He has been a senator In the university. Both had Mats In the Ninth
House so neitt.!r brother died but their four sisters died and both men
were married
My Experience: If Mars is in Gemini, Ubra,Aquarius, Virgo
or C1prlootn thete Is l ittle happiness. It Is ttle wife who dominates.
Yovng men who have r-1al'5 in the Ninth House are refonnists by nature.
There is a strong Ctlan:e that marry if they do,
are loving and affectionate to their wives. There Is a chance that the
wife may die and for want of someone to bri1"9 up hi s ctlik:fren ttle
person m&y marry a second men are debaUChed. They are
famous but not lucky. It Is an auspldous conjunction for doctors as their
general behaviour is virtJ..tous and they get fame. They do not want for
an)One. It iS a very ordinary cm)mction for lawyers however and the
onty lawyers for ...mom It wOtks are those who ate defencfng a client. lt
is good for tumers, fitters, carpenters, goldsmiths, ironsmiths. They
succeed and get fame. ln case of policemen.. success comes onty after
figtting with their seniors. They constantty race opposition from their
jullots as wetl. If Mars Is In a femlrine sign, the sisters die r.stead of the
brothers. If it is in a mascUine sign the re\4ef'Sie occurs. Their good ll-0

place between the age of 2728. For those who are of very low
caste t his t!lke:s plaCe at tM aot d 27. TheSe people can g!t fftcted
to the municipality, local board, assenilly or district board. They can
influence people and those who don't lk them are unable to say
anytNng to f&ctS. In canc:tr, Scorpio, capricorn, Pisces can
mean that the person gets stability after marriage and also good lld.
Some people become do<:tors, farmers or scientists. In Cancer the
temperament iS moody. In Scorpio it iS base aOO stubborn. They tend
to cause k>sses to people for their own gains. ln and Pisces
the P<f'O" is .,.;1, lies, is shametes. and b-ags endlessly.
Mars in the Tenth House
Acharya and Gunakar: Sd<ltash8Uryabhaak. He Is brave and
happy.
Kalyanavarma : Karmodhyukto dashame shoorghrishyaha
prtJdhaanOJjanasevl sutasaukhyayuto prataapabahubalaha
fXJmiJatl bhavali. He is hard wortmg, valiant. victorious, one who serves
great men, has sons and is very
Baldhyanath: Meshuranasthevaanije tu jaataahaa
prataapavit1Jprabalapraslddhaaha. He Is radiant, wealthy, strong and
famous. MaiJile kc.leerobh;Jvane ella svlmm If It In C.noe1;
the person's li ft i s happy.
Garg: lt is the same as Baidhyanath.
Jayadeva: Toshaavatamsopakrllaart/Jayuktaha. Happy, has many
ornaments, does good and is wealthy.
Jaageshwar: )eda/agnadtandrakhamadhye mahijastada saahasam
krauryarabhNiasyavrltti. Bhaved durvasaha kadachitraanaam tatha
dushta SB"ffaha param neecllasa"ffah;J. Dashamaslllo yadaa bhaumaha
shatruksheiTe stMasthada. BNyate tasya baalasya pita sheegram na
sanshayaha. If Mars is in the Place from tht!: ascenda..- or from
the Moon, the person Is brave, auel as a tribal, one wtw:> lves away
from his land of birth, and keeps the company of low born people. lf
95
Mars is in a hostie influence the father dies ei'rty.
Kashlnath: Shubhitkarmaaha suputri garvishtosapi bhavetraha.
He: dOes good deeds blt iS vain. He: has decert sons.
Bri hadyava najaatak: VisllrambhlNalt(Jrallptimatho. KshJtijo
bhavarshe shastraad He gets land. At the age d 2J he has
fear of weapons. The other t rafts are t he Silme as described by
Acharya, K.alyanawnna, Baidtyyanath, Garg and Jayadeva.
Mantres:hwara: It is the same as above.
Pur,jaraj and Ramdayal: It is the same as Jaageshwar.
Aryagranthakar: DashamltgatiJ ITI8hijedaimtilcah8 kosh8heeno
nijakufajayakaari kaaminichitahaari. Jarattha samashareero
bhocmljeevopakopi dwfjagurujanabhakto naitdneecho navyahasvaha.
Disciplined, poor, one wt-o works for the benefit d his tribe, belcwed of
women, frai as an old man, a farmer who earns his living from the soil,
one who respects Brahmins, sages and the ek:tetly, a man of medium
height.
Parashar: Dhanavyayam cha dashame dhanalaabham kukarma
ella. He gets wealt h but squanders it He does bad deeds.
Vaslshtha: Bhaumaha ki/a karmasanstho kuryaatraram
bahJkdcarmaratam kuputram. He is ill behaved and his sons are oot
decent.
Gopal Ratnak.ar: He works for the welfNe of his people, Is a
leader, uses his wealth wisely, is a head of a temple trust.
Ghol<lp: He has many vehicles, a 9oocl house, a sharp Intellect. He
is without enemies, is a poet and a talented artist
Hi llajaatak: sllada dhWe vimshatibhihi shastrabheetimuktu
diJstutmasthaha. There is fear of weapons at the age of 23.
Mahesh: It Is the: same as Brihadyavanajaatak.
Yavanmath: he is weal thy, virtuous, respected, kind and

genetOus. He can be a good land 0\o\'ner.
Paasd'laatya Mat h (Western Thought): He is brave, arrogant,
over anxiclus Md He can be a teller in a bank. He excels in
business and trade. But lis Is such that there ate constant ups and
downs. lf Mars is auspicious the person is brave and courageous and
sees: a rrix d happness and gri e( There is no stability i n his life
Unknown: Mnaval/abhaha. Bhaavadhipe balayute bhraata
deerghayuhu. Vlsheshabhaagyavaan dhyaanasheetavaan.
Gurubhaktlyutaha. Paapayute karmavighnavaan. Shubhayvte
shubhakshetre 10rmasiddllihi. KN'fipratishtthavaan. Ashtaltdasho Vi!rshe
dravyaar}ansamartMhll. Vyaapaarat bhoomi{MIJ0taha prasaadlJIJt
sahsaat vatilishastraat. Sarvasmarthaha. He ls popular. 11 the ruler of
the Tenth House is strong his brothers will be long lived. He is extremely
fortooate, meditative and t o hiS teacherS. If f'.1arS is with a
malefic .-.tluence the person will face hindrances al his life. If It Is
auspicious the person sucxeeds ard gains fame. At the age of 17 he
gets we&fth in trader, from the king or through his &CIS of b'avery. He is
courageous, chalismatk:, disease free, and has a strong physique. His
mentality, however, is like a t hief and his behaviour is ld. If the ruler c:l
hi s destiny and deeds is also wit h Mars in the 'Tenth House, the person
can beo>me the king. U It Is with Jupite< the person gets presUge to
seat him oo elephants and much &and.
My Thoughts: Some astrologers have ascribed ma'efic properties
while others have said auspicious t hings. The malef.c traits that have
been said are seen In Tl!lurus, Gemlri, Libra and Aquartus wtlle the good
thin!Ji are seen In Aries, Leo, Sagittarius, cancer, Scorpio and Pisces.
has contradicted himself ooe canoot relate to what he
said. women are attracted to either good l ooks, or weal th or
educati on.
My Experlence: lhe father tX the mother dies In chUdhood and
the person Is adopted. This is particularly true of Taurus, Virgo and
Gaprk:orn. Sons die. The person gets r.o glory. If Mars is in conjunction
with the 1'\Aefs of the ""th and tenth houses the person can beoome
the king. Though the unknown astrolog:er says that Mars In conjunction
wit h Jl4)iter brings t he person eoough prestige to t ravel seated on an
97
elephant, see this horO$COpe which proves that wrong: born in the
year 1817 on a WedneSday at lbtitudt 2330wittl an ascendant of So-2
39-30.
He spent hi s life working at a job that netted him Rs.. 30 per
moMh. The prediction about status sufficient to ride elephants applies
only to cancer, l eo or Pisces and then Mars - Jupiter In the Tenth
House. lf there is a ferririne sign in the ascendant the person can
suc:Hd bl1 only after great effort. lf M!lrS is in a masculil"'l! Sign the
person sua:eeds wfth no effort Some astrologers have
referring to sins corrmitted in an earlier life for the traits manifested by
Mars. lhey may be rightS. The man has Children b.rt oo wealth or he
has wealth and no children or he has b<Xh but oo presdge. Thete Is also
the question of whether Mars can descroy a man's lineage thus. In
some: cases itS tx'!haviOur is similar to tNt of MarS in the ascendant The
man wants to try his hand at many things but succeeds In none. At the
age c:l 23 there is S01'1"1e good luc;k and stabili ty at 36. The petSOn is filled
with a deSire to see: hiS own h.:Jl.!Se before he dies.
Here is an example r:l Mars in the Tenth House in the case of
noted singer Balgandharv:
The horoscope of the publisher of the noted publicati on Uday
which was out from Amravati .. Mr. Bamangawankar was also
98
si mili'r. Nei ther of them had any sons, onl y daughters While
831gMdha1'\121 was wed onty once Mr. Bamangawankar was wed twiCe.
Baidhyall3th has said thbt if MarS iS in the Tenth House in cancer it
gtves much happiness bl.t at this time t.ba is domlnatr.g the ascendant
and according to Laghu Parashari Jupi ter, Sun and Mors for the
asctndant are i nauspiCious. Though it conb"3dicts: both, it can be deal
with. What Laghu Parashar1 said is appropriate fa- the ascerdant based
horoscope. In such a situatio'l Mal'$ enSiles that the mother 01 father
dies and t hat the person's iMeritance is d!stroyed. ln contrast what
Baidhyanalh says Is appropriate when predldlng the Gland Path of Mars
which b'ings stability, prestige, inheritance and glory. The person
sua:eeds in what he tries but has a tendency to quarrel with people as
he makes his wtJy 4.4' in ife. see an exampl! or one SUCh:
The late ruler of Germany the Kaiser born on 27 1 1859 at three in
the afternoon In Bertin.
-
....
...
""'
....
-
In 1915 he started t he first World War becal5e cl Mars in his
Tenth House but because Moon was In t he Sixth House he was
defeated. Oue t o t he combi nation of t he Sun and Saturn in his
hot05Cope he had to give up the throne.
Ordinarily ,.1ars in cancer, Scorpio, Pisces, Aries, Leo and 5agittarius
bMgs good fruit. In Taurus, Virgo, capricorn, Gemini, Libra andAquaril.$
it Is ordtnary. In the Vidarbha COngress t he late ~ e r Veer vamanrao
Joshi was an exat11>le of Mars In caprlcom. He got much fame b\t had
no chik1ren. See another example. Acharya Atre, born on IJ.&-1898 at
sasawaad in the momlng at 7.30:
He Is a famous writer, playwright., poet, essayist and vlsuallser In
addftion to being t he publisher of a renowned paper. He got rruch
fame. At the age of 36 his good luck began. Since there are malefic
planets In the Foll'th House, the Aft:h House and the House or Profit he
travel ed a lot. Since the ruler of t he Seventh House Satum was
influenced by Harsha! or Uranus hi s wife was al ways t he domi nant
partner. Since verus was with Jupiter his wtfe was well--educated,
peaceful, -Idly wise and loiAng.
Another poet from Maharasttra Mr. SA Shukla born on 26-51902
at 10 a.m. in Kunhad:
Thanks to t-1ars In the Tenth House he got both fame through his
writing and al so wealth.
Doctors in whose case 1'1ars is in the Tenth House in Scorpio
beCome famous $Ur9!00S. Dr. Wblness or Miraj was ont SUCh ex!ill'l'lt.
TNs ~ a good positioning ror lawyers and partlcuarlv 11>ose v.ilo derend
dients. It is not good for ell'l'loyed people as t hey quarrel frequently
wit h thei r bossecs. Bai dhyanath says l f Mars i s in the Tenth or Fifth
House the maternal uncle ls promJ:(ty destroyed but I cannot find ant
connection between Mars in the Tert.h House and the matemal unde.
100
In the horoscope cl Uni on Minister Or. Panjabrao Oesf'lmokh Mars
was in t he Tenth House in cancer and in the horoscope of famous
sdefltist Sir C V Raman Mats was In the Tenth House in Sagittarius.
Mars in the Eleventh House
Acharya: LiHtbhe pr.1bhu. He has abvn::Sart wealth.
Gunakar: Has said the SiiO'Ie thing.
Parashar: Laabhe dhanam sukham vastram swamakshetra-
odls8ngroham. He has wealth, happiness, clothes, 9old, oncl PJOtSP<fS
from farming.
Baidhyanath: Aaayast.he dharaniStXe c:haturvaak kalJtni dhani
shaurytwaan. He Is an lntel igent speaker, and has both libido and
courage.
Kalyanavanna: Ekadashage dhonovoon priyasukhabh .. gl t-
bhavetshooraha. Dhanadhaanyasutahi samhitam kshititanaye
v/giltasl'lokasht3Ch!. He is wealthy, happy, brave, has many sons and Is
free from grief.
Vas.l$htha: K.sh/(_/jastuacha /lilarlm. He benefits from women.
Garg: Prabhutadhanavaan maani satyavaadl hadda vrat.
Ashrachaaddayoho geetasamyukto laabhasthe bhoomlnandane.
Vidheyaha fXiyavaak shooro cffanadhaanayasamarwitaha. t.aabhe kuje
mrito ma/Jd hat:ach.itr>gnit&SkN&hl. He is wealthy, respected, b\lthfut
di:sdpllned when fasting, a devoted server to his master, a lord of
horses, sweet voiced singer, one who dies disappointed. He suffers
losses from fire an:! thieves.
Jeevanath: maaheyaha samara.
Jayettyildwa sahturnapf sutavisha dfn vlkalaha. Ohanagraamaksho-
nk:.hap.a/ilturagaanandakridasai. PiNaarthvyifiiPilaraiJl kshatimatitara--
ametM IIJbhate. He struggles and d.efeats his enemies but sufferS
because d his son. Mars In this space brings him land, wealth, vehk:les
and happiness. He wi ll be destroyed if he tries to start any venture
II)!
using money given by others.
Narayanabhatt: ts the same as

vastraagamam sul.tlitatJni cha vaahanuni. Bhoopras11ada
saadasukrltuhalamnangalaanl dadhyaadavaaptibhavane hi
SiJdaasavaneya. He gets all manner of wealth - brass, silver, bronze.
copptr. SiY!r; gold, dothes and vehides. He al so enjoys the King's
patronage and gets fame because of lt. l..aabhe srljeth
jinovorshatkshmim. He gets -h at the oge of 24.
Jaageshwar: kujalkaadashe putrachlntaa naraanaam
bhavejjatthlJtam gulmaro9iJ8Ci;yuktam. Prat88PO bhaw.:th svf)evatasaya
noonM1 va" bhrMJast:a detle. He has to wrxry about his
son. He suffers from addity ard gastric disorders. He Is radiant and
C-harismatic like the son and his gl ory is like a king. He could be
obsesstre.
Kashlnath: laabhe bhaume bhoorii<Mbho nanapaptra
IJMkshillraho. Netrarogt blloopom .. nyp devadwl)itr81J> norom. He golns
a lot. He eats dirty rice, suffers from eye disease but Is honoured by tf1e
king. He worships godS and sages alike.
Mantreshwara: Dhanasukhayutosasllokhaha shooro bllavetttSrr
sheefaha kujehe. He i s wealthy, happy, free from grief, brave and
virtuous.
Jayadeva: It Is the same as Brihadyavanajaatak.
Aryagranth: Stra}Mahitakaarl chaayasansthe cha bhaume nrlpa
Iva grlhamedhl peeditilha kopapumaha. 8havatl cha yadl tungo
lomasaubhaagyayukto. Dl'ltNJiJkirananiyr.J<taha punyakaamatthalob!W. He
worships deities, works at home like a king, unhappy and angry. lf Mars
is exatted the petSon Is popi.Aar and if It shines many rays on hm the
person does good deeds, is wealthy and greedy.
Punjaraj: Evam bhocmisutesagnishastrajanito yaatradhanaihi
Sllahasalhi swarnarvaa manlbhooslutnaisu nltaraam dravyaagamaha
samved8ta. He earns fabulous wealth through though
102
through fire or weapons c:K" else from tradilg in '!fT'SI
Ramdayat: It is ttle same as Punj&raj.
Gholap: He is haPPV in the company c:l his master. His enemies
harass him. He lives in a gocxt is a good poet. has many vehicles,
is wealthy, chartsmatic and ts al wa)'S surrounded by friends.
Gopal Ratnakar: He ges a lot of land. He is a farmer, has marry
brother5 ard relative. He is hard working OOt cheats people.
Hlllajaatak: El0dal>o bhoom/S<Ao dhaMI4abhakaral>a sadaa. He Is
always gaining wealth.
Yavanmath: His dothes are silken. He has mart,' servants, horses,
cars and ...OOides. He is lustful, sufffsing frcwn aches and pains and is
truthful.
Paaschaatya Math (Western Thought): He has no friends.
The people he are his friends are the ones to cheat tim. lf
Mars is auspicious, he has friends who bring him rR.Jc:h material benefrt.
If Mars is in a water sign the person's friends being him destnJdion. He
has to put money to bail them out. In case d fi re signs he Is lucky In
lottery and gambling. Mars gr ants su::h peopte gr eat
My Thoughts: What has been sai d by Garg, Jeevanath,
Jaageshwar and Narayanabhatt appli es to masculine signs. What the
rest haw said about good tralos apply to f eriline signs.
My E:Kperlt:net:: I f Mars Is In a masculine sign Aries, Leo,
Sagittarius, Gem Ut:wa or then the person has no sons or if
any are born they dies soon after. If at all a son survives he quarrels with
his parents once he grown up. The person has many desW-es but
none are fulfilled. lf MiVs Is In a feminine sign there are three sons. He
gets prestige. lf he is an officer and takes a bribe he will be caught lf
Mars is In the Eleventh House In a femlntne sign the person has a
tendency to be ruthless in his acquisition ri weal1h and authority. This
person can send his wife to satisfy another man in bed, if it gets hin
what he craves though this may not always be: true for Aries, Libra and
Soorplo. lf Mars is r. a masculine sign, the person's wife wt11 have
100
extreme pain during menwuation and may suffer rRscarriel9tS Children
are also born with congenital l lnesses.
Thi s is a good conjunction for doctors. Thty as sur-goons or
gynecologists. This was the case with Or. Nadglr the late dean of the
Grant medical College, Mumbai. He was born on 16111880 at
Dhbrwad .
....
-
He gained recog'lltlon as an orthopaeclc surgeon. Since Mars was
in the Hol.l5e of Profit he progressed rapidty and helped the poor and
needy by treating them without charging a fee. He even set up a
cllalilable hospital In Hubll. He chol<ed IX> death In 1927.
This is a good conj.mctlon for lawyers too. They succeed In court
and get a lot of wealth. There is, however, a possibility that occasionally
they coul d l ose In Important cases. They have a tendency to take
money from both the prosecution and the defendant but tNs does not
usually them trouble. This conjl.l'lction is also good for engineers,
turners, fitters, driers, goldsmiths, carpetters and ironsmiths.
Mars in the House of Expenditure
Baldhyanath: virOdfV A rebl!l, poor
and has no woman.
Aryagranth: Paradhanaharencchuhu sarvadaa chanchala-
akshashrachapalamatihaari prachandaha. Bhavati cha
SUkhM:JI'Jaagi ch4 pllr4yw4tivitMSi SMkstil0ha
karmapuralla. He wal'(s to snatch money form others. His eyes are
mischievous, his nature corrupt and he has a desire to travel. He is
104
cheerful, of a hefty bl.ild, happy and one who has affairs.
He frequently appears in colllt$ as a witness.
Jayadeva: BandhaniJatyiJ yllyutosalpahagbalo mitr.!nut
kumalimaon laJ}asantyage. poverty whldl brings him to
death, eye infections, ovelty, weak boctt' and one who harasses his
friendS out of swpidity.
Mantreshwara; Nayanabikrit.aha vyll}e pishuno-
sdhamaha. He has eye Infections, lacks women, Is wicked, and
unrel'gious.
Punjaraj: Bhoomlputre chet vyayasthaanasansthe dravya
punS(Jam neeyate kshetriyastat. Gh88laha kmyaam daksh8Va8/T'Ie cha
pMde vaame karne tatstriyaa v6. PunyMdtikyudMpakam
tatrinaaryoho paapaadhlkyaachaadhikam vaa Utdangam. Dagdham
vaanchyam vanhlnaa vaasayvdhottham ghaatam yadaa sravanam
dt!erghkMilHTI. Kujo vu vy3}'ltSthithllshrachenmanujasya nocnltm.
ntdaa Ptrlvyo nldhanam prayaatl pitrlshvasaahatashta )'tto na sane/Mil.
He suffers losses because of theft and dzlcoity. His wife sustains an
injury on her left side - could be in the f!!.te, ear, foot hand. If Mars is
auspicious the WOU'Id heals and If not the wound festers. His father's
brother or sister's husband die.
Acharya: Pitit8Stttrihi fehe. He Is faitttul to his wife.
Gunakar: It is the same as Acharya.
Kalyanavarma: NayanaWkaarl Jtito jaayaghnaha sudlkashracha.
Dwaodoshage parlbhooto banclhiJflabhaak bhavati bhoopwe. He has
eye dsease, is faithfU, humiliated. He hurts his wife and has to go to
jal.
Gar g: Kopano bahubamaaddyacho vyango dharmasya
dooshakaha. He is angry, lustful, has no expenses, mOfalty CXlmJJ:(, and
hates his won friends.
Brihadyavanajaatak: Swamitravairam nayanaatibaadhaa
krodhaabhibhootlm blkalatwamange.
vyavasthabhaumo vlddhatl ooooam. He quarrels with friends, suffers
105
from pairiU infe<:tions in the eye, i:s very angry, has insUfident money
for t.lq)enditure., suffers toss of wealth, spendS time in jail and loSeS
speed. At the age II 45 he loses all weallll.
Jaageshwar: talhaa kam8kallthe paraa raklapeedaa jane nalva
tn.;l8nyaha. He has aches in his ear, tf'lr(l(rt and body caused by blood
disorderS. do not l*n.
Kashinath: AsM!ravyayi vyaye bhtlume naastiko ni$hthuraha
Bahwairl vldesN cha sada gadldtatl maan<Jvaha. He squandets
his wealth, is an atheist, harsh, witked, has many enemies and is
constantty travtUing abro3d.
Narayanabhatt Shatllaksho58pi tatsakshato lohaghataihi kujQ
nMSIIIN'n btoti. Moosh/Mm kimvMflMto bhayam
dasyt.Xo vaa kallhl paaradheehetud.Jkham vlchintyam. He has fear of
injury from weapons. Loses wealth, people spread rumours about him.
thtre iS fear of thieves an:l of quarrels whid'l <:alJSe him loss cl wealth.
Vasishtha: kshitiSt.to He sins all the time.
Jeevanath: Kujosapztaye yasya prabhavati yada janmasamaye
tadaa tAtaapaapam sapadl kt00te tasya satatam. Kdlanl<4prakhya3dm
pishunajanataslrachaurakt.Jiato. Bhayam V88 der(J{)i ripukritam
dukhamadhikam. He has speectt loss of wealth, he is falsely
by the wicked In almlnal matters, there Is great fear of loss by theft or
weapons.
Parashar. \l)'aye netrarujam bhratrlnaasham cha kt.rUte. He has
eye clsease, his brother dies.
Hlllajaatak! {){JI'IchlMXiemit.e varshe h881lido dw8dasha kJJjaha.
At the age of 4 5 he suffers losses.
Gholap: He undergoes a sentence in jaD. He is squanders, cruel,
quarrel some and mixes with wicked people when he has wealth.
There Is fea< of blad< magic, snakes and fire. He dies In jal.
Gopal Rab'lakar: He is poor, suffers from Vatha ailments, cheats
peop:e, has many enemies. His house bums down in a fire and his We
106
dies. If Mal'$ is aU5Pidous none of t his h.&ppetls.
Yavanmath: His voice is harsh, he is angry, grief stricken, travels a
lot, his e)'l'!S are destroyed d dryness and he may suffer from
cat:atact.
Paasd\aatya Math (Western Thought): There Is fear or secret
enemes. If Mars is in a malefic conji.I"'Gtion with Satum the person has
fear of ttjeY!s. He goes to jail. He is tnve but crazed. Jf Mars is malefic,
all this happens. He Is a gambler; unwell, vblent, antlsodal and an
enemy of the state.
My Thoughts: Barring Aryagranthakar all astrologers have
ascribed maSefte propert)es to Mars in the House of Expenditure and
thtse can b! tqU!IIIy in masaJin! and feminine Sig'ls..
affected ate Aries, Leo, Sagittarius, cancer and Pisces. In contrast
Gemini, Ubra and Aquarius are relalively tess affected. ln Scorpio and
capricorn there are very destructive results. Hilajaatak and Yavanjaatzlk
have said that the person l oses wealth at the age d 45 but 1 have
ne'oler witnessed ttl is. The good properties ascribed Aryagrart:hak are
seen in Aries, leo, Gemini, cancer and libra. Paiashar doos not
how he predicts the brother's death. 1t <XlUid be because It Is the third
pl ace from the space denoting the father.
My Experience: He Is a cjutton and lustful but gets very little
opporb.Jnity to interact with women. His first wife di es and he has to
marry a second time. He cannot complete education If he takes up
mathematics. He mana9(:5 to complete It If he up He
is entrepreneu-ial, truthful, generous, angry and self saaifiCing. If he is
a te.ader he Is a freedom fighter. t-is brother and chlkten die. The tribe
could end with ln the horoscope of Nagpur's philanthropist Ral
Baha<llr 0 lakshminarayan, Mars was In the House ol Expenditl.re in
libra. ln the case of the late Oeshbandtu Das it was i n Leo. In the case
of Lala Gangaram of Lahore it was In Scoi'J]io. All ttr'ee were the last d
thek" line. There are fe-N or no dllk:ten in sudl si tuations. And in case
there are children_ they are all These people like spicy fried
food. They travel abroad and have extra marital affairs. They are
reformists get on well with their wtves but quarrel in bed as they do not
get sexual sati sfaction. At the age of 26 they get fame. In the
101
hQfOS(X)pe of noted writer Mr. Khandekar of Mar$ was in
House of Expenditure in S&gittarius so he was kind and g(!nerous.
They can be angry and bl\rlt spoken. They are forever searching for
happiness. They incur debts but settle them d11ing their li\les. There is
of falling down, poi soning, accidents etc. They suffer from
headaches, cluster headaches, blood disorders, gastric aliments,
geriatric ailments etc. Though some astrol09ers have said the person
wishes hiS mother dead, all the ptople I have met with MarS in the
House of El<pencitt.re ha...e orly wished their fathers dead. They never
have money, either it is stolen, used to pay off debts or is just lost
Everya'le that it is an inauspcious
108 Cht.por 4: Jnluonce of Mtll$ on v.uru .. Chifd Birth & AJ.Iuril.tge
Cliapter 4
Influence of !Mars on 'llastu-
Cliif({ (}Jirtli e:l !Marriaoe
The Grand Path of Mars
E...erything written in the Grand PMh of the SUn sho\.Jd be kept in
mind while looking at the Grand Path of Mars In a person's horoscope.
In f\1riga, Olitra and Ohanlshtha stars the Path of t-1ars Is
from birth to age seven. U r-tars Is In the House of Wealth.
Fifth House, Sixth House, Eighth House ex in the House d Expemiture
in such a horoscope, the has many ailments throughout
chllchood. His matemal uncle, aunt or brother die. He can suffer from
measles or diarrhoea. Hi s mother surfers.
In RQhini, Hasta and Shravana, the Grand path is from age 10 to 17
during wNch the per-son can suffer from bOne marrow infectiOns and
other dlronlc diseases. He lacks concentration In studies, falls In
examinations, his father suffers.
In Kri ttika, Vttarashaadaa and Uttara the Grand Path is from age
17 to 24 during whiCh the mother a- father m11y <1!. Even the Sister
could cle. The person has dlfllculty In studying and lis body
with boils and eruptions.
In Bharart Purva and Poorvashaadaa, the Grand Path Is f rom age
33 to 43 dl<ing wtich the person has completed studies and is IOQIUng
to eam weatth. If he is married hiS wife cie:S and he has to marry a
sea:>nd time. These stars ate Influenced by the Grand Path of Venus at
us
the t ime of the person's birth and t herefore it has to be taken into
accooot how many cl tht traitS cl venus have: manifesttd t ill ltle aged
20. In the meridian of 8haranl lf the person was born In the 40"'
meridian of Venus then this plonet has its Path in his life till age six
and hen:e the Grand Path of MarS in his life is orty from 23 to 30. In t his
situation If the Gtand Path d Nars Is very auspicious for the person - it
is in the Third House, Fifth House, Sixth House, Eleventh House or the
House d Experdit ure - then the person getS supreme gJory. He gets
abundant wealth, travels abroad, Inherits property, wins In court
disputes. There is a dlilru of a civision of property with brothers and
of some dlidren dying.
In Astwtini, and r-1oo1a stars the Grand Path of Mars is from
agt'! 43 to 50 during which the perSon has to for p-operty and
his sons have ml.Kh b'oubSe. He has to act ao:ording to the wishes of
his wife am sons.
In Pushya, Anuradha and Uttarabhadrapaada the !1and Path is
from age 69 to 76 whiCh the orly propMy d Mars is death.
Regarding the Grand Path d Mars, astrologtn say - '"ll.Jshaad)u
sukhamaapnotl dashaante kashta maadfshet"'. This means the
beginning is haoppy but tfle end is trol.tllesome. No one has mentioned
how it goes in between so one assumes it must be otdnarily all right
One saying goes that In the beginning the petson suffers loss of peace
and wealth, in tfle midc:Ue and the end he haos to fear the goverrment,
fire and thieves. Here is an examJ* that makes it dear:
This person was bom on 269 1884 at 9.27 in the morning at
longludes 1935:
-
Oue to the hard working nature that Mars brings, t his person
1 JO Cht.por 4: Jnluonce of Mtll$ on v.uru .. Chifd Birth & AJ.Iuril.tge
fol.llded an English High SchooL The Grand Path of Mars was from 18-
2 1930 to 1821967. In the: peopt! in the: village t!eUed all
kinds of acrusatlons at him and he lost In a oot.rt case. He had to leave
the sch::lol and go away.
To look for a more in deJ:(h explanal)on of the Grand Path ot Mars
one should refer to texts by s.arvartha Chintamani, Brihat Parashari etc.
Thoughts on Vastu in connection to Mars
In this day and age peoJ* get houses made just on the basis of a
cont:tactor's p&an with no thought to vasru Shastra. They have no Idea
what Sdnd of effects the design and layoot of a house could make to
the person's rife. Mumbai is a classic exampe of the malefic effects d
maiOOg rise buildings without con.sldering Vastu laws. Since the
lords ot these buildings are constantly changil"!g, living there are
to have children. They end up donating their wealth to some
stranger when they die. Hence while making a house it is to
keep \Wtu laws in mind.
Acharya Varahamihir has written about this In his work the Brihat
Santi ita. There is also some thought in vasishtha Saml'lita.
The first step is to measure the length and breadth ot the plot
where the house Is to be made. On this Gunakar has said: clvide the
fig<.<e bv the answer Is named thus: 1. Banner, 2. Rotation. 3.
Homs or Lion, 4. Base or l owly, 5. Rain or Water, 6. Gadarbha, 7.
Bephant or mammoth, 8. Ohwaanksha.
For if a pot measures 95 OJbits in tength and 83 cutxts in
width. The area is 7885. If we divide this by eight there Is a remainder
of fie which Is the space for water. This is how the aayas are calculated.
ex these those aayas which are alike are considered inauspicious and
the ones which are not similar are considered auspldous. For Brahmins
the 01\waja, Lion fO< Kshatrlyas, Vrish 0< Watr:s fO< ValsiYtas ard Gaj are
considered good fc. Shudras.
Sin::e Mars is the lord of $Oil and earth tM'lie making a new house it
must be kept in mind and more particularty if Mars is malefic in the
person's horos<:Ope.
The appearance of the house affects those who nve In It It Is
ob\lious t hat a house where there are constant quarrels, people are ill,
doo't g.et food to eat, and sudden deaths occw cannot be a good
place to ltve. There are fo\6 types d houses where this takes p i ~ :
OOo<
There aore five corners called Panchaka. People wt-o live in this
house face peru.ry and constart il ness.
OOo<
This is called vyagram!J<hi. The pel'$on has no dlildren arv:l his
lineage ends with him.
1 J2 Cht.por 4: Jnluonce of Mtll$ on v.uru .. Chifd Birth & AJ.Iuril.tge
This is called tiranpangada or triangular. The person's pea<:e or
mind is destroyed, he is ill, debt ridden and forever defending hirnSetf in
court.
.---++-.:::Door
This is called Vartulamukha. There i s possibility or theft,
dtbauchery, negligence and all people living in this house
forever urtlappy.
If MarS is strong in horoscope then person may in
purchasing farmland a house. There are two types ot
Ooor
Srt. l - Gaumukhi Srl. 2 O>oturstJa
Now see an example of lfclstu
"' ....
Their house is Vyagramukhi and faces east. There were seven
deaths in 21 yearS in the spaced three each and only one was d
Illness. They had lots <:A wealth but hardy any child....,, In 1927 tile
pel'$0n sold the h;)t.15e and got married. Thous,tl he was left with little
wealth he had a son and dbughter and t hey li ved contentedty
thereafter.
It Is also Important to keep in mind the kx:adon and positforing cl
Saturn in a persont horoscope.
Thoughts on Olildbearing abilities i n relation to Mars
Women who are ll\able to bear chlkt'en or t\aVe d i l cYen that die
before the age of folr have strange dreams that show the impossible
taking place. They see ..;sions of snakes being killed. rut into
chllct'en snatched from mothers' laps, oolapslng houses, falling
trees, fruits falling off a tree, falling into a ri >Jer or pond, strvgging to
escape from drowning, widows etc. These are not actually dreams but
llashbacks <:A an earlier life. Only after they have repented suffldefltly
for these crimes of an earli er life can they have children. They wil have
to appease tM Sun, Ganapati, Snakes or the l ord of Snakes to ward of
theW preoAous Wis.
While predicting the possl)lllty cl children It Is Important to see
what exactly is the position In the spouse's horoscope also. For exat'll)le
if a man has had a vasectomy, it does not matter that hi s wife's
horoscope holds the potential for many, healthy children. See the
horosoopes of oouple:
40.
Husband - born on 2191911 on latitu:le 1550 and longitude 74
...
...
114 Cht.por 4: Jnluonce of Mtll$ on v.uru .. Chifd Birth & AJ.Iuril.tge
Wife- bom on 2191914 on latitude 16-48 ard longitude 75-40.
They were both very good looking. The wife had tig eyes wl"kh
were shiny like Venus and she hOO llsttous black hair. He was tall and fair
and very attractive. She l ost her l ooks because of having too many
miscarriages. For fear of her losing her looks, the husband had a
vasectomy. Thus It Is Important to see both horosoopes !09'ther.
In andent times, the manner In whkh young unmarried girls
worked and saved money i s also similar. That is the childbearing
poterltlal in the fifth and 5eer'th Houses have to be ignored given the
positioning d Mars. the Sevellth House can be an in<lcator d
whetf'ler she will be able to get selOJal satisfaction from men. In su:h
situations it Is atso good to check who Is ruling the House of wealth and
who Is occupying that house.
Thoughts on Marriage In connection to Mars
In India the JDcement of Mars in a hcroscope is considered v.t.en
horosoopes for a wedding. On:linatlty people with Mars In the
hotOSCOpe are considered suitable matches oriy tor others with Mars in
the horoscope. Alternately the l ocation and positioning of Sab.Jm and
Jupiter are oonsldered. It Is said that if Mars Is In the ascendant, Fot.rth
House, Seventh House. Eighth House or House of Expenditure. the
spouse will die. There is a contradiction too. If the ascendant is ruled by
Ari es, the House by Scorpio, the Seventh by capricorn, the
Bghth by cancer or the House of by Sagittarius then the
pe150n's possibility of a second is cancelled.
115
While seeing a girl 's horosoope one must keep in mind the kx:ation
or the 5411 and Mars are important as the Sun the strergth.
age, education, and love d the l"usbard. Mars lnc:lcates the
husband's age. enthusiasm, courage, status, professional progress etc.
If Sun is in a malefiC conj unctiOn with satwn huSband is old,
Infirm, diseased, auel, unkind, aocordng to Western astrologers. My
ex.perien::e is varied. In suc:h skletions the takes place and
that too Mter many atttmpts. The father is l).)verty stricken at tM
time of the marriage occurs after his death. The husbiwld Is
young arw:llcwin9- The girl's father prospers after the If Mars is
influMCJ by a malefiC saturn, the is a possibirtty cl second marriage,
widowhood, desti tution, childl essness, etc. tf she does not have
chilc*'en she will ha-Je a lot of wealth and if she has chilcten the family
will be bankrupt. Her huSband could be t3king a bribe and be
sent to jail. Or he may loSe hiS job. The hUSband or tht wife one may
comnYt S\Jk:lde In frustration CNer all the problems they fare. lfSatum Is
auspicious in the place of birth the woman will get a husOOnd who is
able, erthusiiJstic but who g& no wealth. He i s t ill
!tie age d SO and there Is every ctlance that he will marry a second
woman while the first wife is alive. But subsequentty the couple's ll-0
ch:anges. I f MarS is not i n the firSt five houses from the ascendart it is
not considered detrimental to marTiage. But It can harm the OO\.C>Ie If it
is imPCKted bv a malefic Saturn.
Example one
Wife born In 1833 on the fifth day of the Jn<lan calendar and
husband in 1824.
...
...
Wife
118 Cht.por 4: Jnluonce of Mtll$ on v.uru .. Chifd Birth & AJ.Iuril.tge
Husbord
He gave up a wife well respected in society to marry one who
commanded no respect. This is because S3tum was in the house
behind Mars In her horoscope and Saturn Is also present In his
horoscope. That p-otected him from death.
Example two
Wife bom on 71-1912 latiUide 1552 and 7'1-34
Husband bom on 1826 at 8 a.m. latitude 17 and l ongitude 7<11 30
They were married In Febtuary 1924 and her h.Jsband died she
years later. TNs because Saturn Is behlrd Mars.
Example three
Thi s: woman was born Wl R.Mnagiri on a Friday in 1836.
She was married b\A the matriage was n<X consummated and he
left her. This is because Sun and Mars were in the seventh pliKe from
5ab.Jrn whiCh was: with the Moon in the House.
Example Four
Wife born in 1847 in f.1umbai at latitude 1858
Husband bom in Ratnagiri in 1836 at latitude 1708
They were married in May 1939 but the husband went m ~ d
immediately t he-eafter ~ n d the !Mfe was unhappy throughout her
marriag.t!. Both has planets like the Sun, Saturn, M ~ r y or Sl.l"', Mars
and f.1ercury in their asc:endarts.
Example Five
Wife lx>m in 1836 latib.Jde 1610
1 J8 Chaper 4: Jnluence of Mt$ on v.utu .. Chifd Birth 8
Husbilnd born in 1826 latitude 1230
Since Satun i s in the seventh phase of the 541, Mars and f'.1ercury
they had no ctlldren and due to this the h.tsband was prosperous but
the minute they had a son they ran the risk d their being wiped
out.
ExampteShc
TNs woman was bom on a Monday at vade In Thana District In
1835
Her husband teft her fore\ll!r rtwnedately after marriage because
Mars was followed by Saturn.
.,.
Example seven
Wife OOm under Bhadrapa.da star and Husband born on 28-5 1919
at f\1umbai on a Wedlesday morning.
Wife
Husband
-
They wete married in r-1ay 1939 lxJt the husband became Ill
immediately thereafter and died in Jaruary 1941. Both had Mars in the
House of E)lpenditu"e where sevenlll astrologers have prediCted the
husband' s death. Since Saturn, R.ahu and Sun were r. the wife's
ascendant she was destined to be widowed. Vasisttha has said Rahu.
Sun or Mars in the iS a certain Sign of widOwhoOd. !o Since
the wife had three planets lnftuencW'Ig the husband's death and the
husband's horoscope had only one portending the wife's death the
wife's horoscope won out.
120 Chaper 4: Jnluence of Mt$ on v.utu .. Chifd Birth 8
E>ca mple El ght
Wife tx>m on 1511 1923 at sunrise. Husband born on 741916 at
4,20 a.m .
Wife
Husban:S
Here too astrologers sanctioned the match merely l1f matching
Mars. Should the astrologers of the time not have dlecked whether
the other houses had planets that are not detrimental to each other?
Their misfortune Is that they never could set up a house or have a
fomlly. Neither Is there any possibility oft his "'"'"ring In the future. The
bride sat at her parental house waiting for the husband to take her
home. T1is was such a combinatk>n of stars and planets In her
hOfOS<Ope that the minute she reached his house his temperature
abruptly rose to 104 degrees Celsius and he was bed ridden. The
min\A:e she lett for her maternal home, his health Improved.
though they were marrfed they could never live together. Who is
responsible for thi s? Not the coupl e but the astrol ogers who
irresponsibty sanctioned the match. While matching the horoscopes it Is
noteworthy that Mars in the wife's horosoope could not suoceed In
killing the h.Jsband but then the combine in her ascendant
should not have been miSSed by the astrologer who sanctfoned the
match.
121
Example Nine
M-s. Harigangabai Shaha, born in Surat at sunrise in 1811
Three mol'ths after she was bom, her father died and she: was
married vmen she was 13. Three months later her t-usbar<l died. They
had no chi lchn. This was al due to and t-1ars in a triangular
aligMlent In the ascendant.
Example Ten
A woman born on in the afternoon at Puna had Virgo
ruling the ascendant. Jupiter in the House of Wealth, Merct..ry and
In the Tenth House, Sun and Mars In the House of Gain, and
Rahu in Leo pkls the Moon in the House of Expendi ture. She was
married on 421941 and on 1031941 her husband died. He: was a
doctor and she was also studying medicine. The wk:lowhood was a
result of Saturn, Rahu and f'.1oon ccmbined with the Jupiter in the
House of wealth.
Example Eleven
Wife bom In 1829 at 3654 wfth Leo """""ant
Sot
122 Chaper 4: Jnluence of Mt$ on v.utu .. Chifd Birth 8
Husbilnd - born in 1815 at krtitu:te 27 on 4-91793
After marMge they were poverty stricken but had a harmonious
11"0rriage. They had a kX of child'en. Since Mars in the Eighth House is
followed by Saturn in the wife's horoscope, but in the husband's
horoscope Sun is In the ascendant with Saturn and Mars In the House
of wealth, they were not too bocly afflicted.
Example twetve
A woman was botn on 2121912 at Amravatl at 9 p.m. Gen*ll
rUed the ascendant. Moon In Virgo r. the Fourth House, Sun- f-1ars -
Merrury oomblne In the Fifth House, Venus - Jupiter combine In the
Seventh House, Neptune In the House of Fate, Rahu In the Tenth
House and Saturn In Ta1.111s in the House of Expenciture.
The husband's horosoope has ll.4)iter in an Aq.lari us ascendant,
saturn in the House of expenditure and Mars in the Tenth House.
tM Sun in Mr horoscope iS impacted adversely by Mars: she was
fortunate but had no Children.
From the above examples It Is clear that women who have either
Mars -sawrn combine ex Mars tnpacted by a malefic .,fluence In the
Fouth or Seventh Houses wll either never get married, or ha\'t an
unhappy marriage or be widowed early. To offset this, any of the
fol owing inauspi cious combines should be present in t he h.Jsban:t's
horoscope - Venus - Saturn or anything which indi cates a second
marriage. Then t hey 'lftll live happily but i n a poverty S1Jicken state. In
the same manner in which a malefic f-1ars can adversely affect the
husband, a retrograde venu.s In a male horoscope affects the wife. But
the two cancel out each other. Hence no astrobger shoukt consider
onty the effects d Mars when matches for marriage. This
must be done only after checking the placement of Sun and Saturn.
Cliapter 5
9ttars aruf 'Jienus in 9tta'f'riaoe
TOday in the western countries, one in three marriages is
said to end In divorce. Love, affection and loyalty appear to be
inconsistent or out of date with a gadget-geared, money-mad and
permissive sodety. In one of our viSit to u.s. two ytars ago, tots. X who
dr<We us from washington to New Yor1{ natrated her tale, which Is
briefly .. folows :- A lawyer by profession, Mrs. X, 28, had morried
another after "'krowing him weU" and had a son from him. Two
years d their married life crossed by (JJarrels,
clashes;" etc. resulted in divorce prcxeeclin95. The possession of the
child was given by the court to the father. The mother in Mrs. X
revolted and she becatne miserable. She was seekJng astrological advloe
whether she could marry another Attorney, who was In a similar
predicament ha.,..ng just then di\Orced his first wife:.
TNs case is typical of many American marriages. Mrs. X had met an
Indian lady and had been astonished to learn that in India most
marriages "were arranged" by pareniS, that the of dN'oroe
was and that the very idea c:l dM>rc:e was still repugnant to
the average Indian lady. And she had also been told that astrok:lgy
played a vtta1 rote In the selection of par1ners; all of which astonished
her so much that she began to study astrology and "'felt convinced'"
that Indian sodety had certain in,buitt safety varves which made
marriages stable; and that despite the free of sexes and the
permissive natl.r"e of man-woman relations In the west, astrology could
bed immense value in the selection d brides and tniegrooms, so that
the R:ldence of divorce could be reduced to some extent
Thanks to the Intellectual slavery of I ndians, some of the
"progressives are now clamouring for t he introduction of sex
edl.IC.&tiOn in SChools and colleges in Indib blincly Zlping the Westerners
and Ulmlndf\J of the jeopar<izlng of Ule moral basis and sanctity d
manwoman relations.
Paradoxicaly, it i:s now being felt in many western court.ries that
the so-called se:x-educbtion instead or being "enlightening"' by way d
Imparting "scientific tl\lths* and .. natural biological functions Is
completely devoid of moral guidaonce and has resulted in an improper
sensationlllistics approaCh on the part d yo111g students, because sex
is viewed from the Freudian point of view as a mere biological function
and l"()t from the lJngian point of view, as a vital force capable of being
directed thrQUgh creative ch.e;nnds.
Today the of tn:Ua appecw-s to be that Jncian people are to
be considered as guinupigs for experimtting with theori!s, once
fashionable In the west, and now bei ng Increasingly rejected as
influencing the stability of marriage ar:1 family life. America,
being a new nation with no trbdition, bumed for a time with a desire to
originate somethfng - new morganatic marriages of convenience
dissWble at wil and other freak$. They seem to be realizing gradually
that these experiments have proved a thorough faik.re cisrupting the
farrily and Increasing enormously the Incidence of children's cM\es,
Women in India who want to become " progressive can learn a lesson
from the of their unhappy sisti!rs in the west
At least in Indian parlance, marriage was and is regarded as a
sacrament comprehending the equality of the partner In respect d the
fo\l'fold goal of life, viz. Dharma (right conduct), Artha (the economic
aspect), Kama (sex relation) and t-1oksha (spritual progress), and is not
just a cMI contract terminable at the de:sk"e d either of the contracting
party. In fact, marriage Is the basis of the famity, and Is a matter c:J
interest to the comml.l'lity. Stable families make for stable comrTl.lrities
and stable communities make for a stabl e nation. Hence the
Importance rjven to marriage in the Indian Sodety. Pseudoratlonallsts
may wax eloq.tent on ptA:>Iic platforms flier interracial, inter-<:omml.l"'al
and inter'feligioL6 marriages with an eye on d'leap publicity in the Press.
But In actual practice, such marriages have not proved suoc:essful
because of cuttural and other ditreren::es. After a consideration
of all these: factorS, the andent Hindus had devised an astrolOgiCal
means of j udging marriage compatibility whereby the relations
between the coupl e could stand the strain of maladjustments.
Pseudo-sociologists are not wanting in India who are ready to
point out their finger of contempt at the SOUld and sensltlle Institution
of marriage developed by the Hindu after centuries of experiment and
experieoce. let us face fbCt:S as they are and not glOss over them in tht'
named '"modernism". The ma}ority of marriages are performed onty on
the basis of astrological consideration.
Recently an enterpri si1"9 ln::tian scholar had a German Professor c:l
Sociology as his guest. The German Prc:les:sor that he found
the inStitutiOn of marriagt' much more d a $UCCeS'S in I ndia and that ht
could feel the presence of a deeper harmony In domestic relations In
lt:tia thctn in any other civililed region he had so far \1sited. The Jnc:ian
Professor'S reply was that ttl is stability and harmony were probably due
to the system of matrimonial matching of horoscopes, Invariably
resorted to by parents prior to the settling c:l marriages. The Indian
Scholar started collecting case hiStori es of marrit'd couples and he
managed to get 603 cases for SbJdy. The age-gro\4) sel ected was 30
to 40. AU t he people concerned were born between 1931--40 and
married between 1955-60. The economic back-ground was mostly l"l.lral
and agricultural though 22% of the case histOtles ooncetned people
who derived their livelihood from commercial ar:1 industrial ocx;upations.
In most cases, the informants were males. It was that cl..orces
and separations were about 6% and deaths of husbands or wtves 10%.
The Sc:ho&ar's finding;s were that 47% was positive, 42% neutral and
11% negative. By positive he means very successful marriages. By
ne\Aral he means a f<* d hannony k'l domestic lives. And by
ne9iltive he means disharmonious famity lives. Hi s conclusion is that
these figures pro...e the efficacy d astrology in marital settlements.
The inter relations between t he planetary and stelar positions and
the sentirnerts of men and women are very intimate. Apart from the
other astrological considerations, mutual dispositions of Mars and venus
are to be carefully considered. It <:an not be a coincidence that di\IOrce,
separation and crimes of passion increase whenever there is a
126
conjl,l'lction of Venus and Mars in the heavens, espec.ially when ttle
constellatiOns i nvotved thoSe of rn.alefc planets. The Venus Mars
configuration coukt of course be one of the contributing factors.
Children born when t here is a VenusMars conjunction should be
brought up in a disciplined manner and Should be made to 31/oid
dissipating habits ol lnvn<late pleas..-e. The """'se elfects or 11\e
conjunctions could be l'n(tC!e to ex:press through constrv<.1ive c.hilnnd,
if Jl4)ite:r aspects the combi nMiOn or iS in quadrart thertfrom.
verus is indeed as:sociated with many fascinbting aspect of lift:.
rUes the wife, con\1!yance., set hannony and union, art, attachment.
family happiness, manioge in gen.,.l, fertii ty, physical beauty
and friendliness. Mars abounds in energy, aooressivenes5, fortitude,
driving force and in assodatia'l with venus, a tendtncy to excess of
sensual lt Is, therefore, necessaty that In the horoscopes
of the couple, MarsVenus c:onjunction or opposition should have a
benefic stW)ing effect of a dispoSition of Jupitt!r; or in tM
alternative the conjunct ion or opposiUon takes place In the
constellations of l.lpiter or Mercury 01 even Venus; Jupiter and r-1ercury
being more VenusMars disposition i s an i"llortant factor for
physical attraction. lkt, In the absence of Jupltet's or even Sattrn's
beni gn infl uence, real compatibility may be l acking. VenusMars
conjunction makes one fond of pleasure, demonstrative, and adds a
zest to one's sensual life. When venus Md Mars are Involved In adver'se
aspects, through excesses and trouble through marriage
follow as a matter of consequence. Venus in a good si gn or
constellation can temper the roughness of Mars, bot If Rahu Is also
involved, it makes one lascivious, lewd and wtc:ked. Whether in ttle
horOSO)pe d boy or a girl, association (or even mutual
aspect) Is not desirable unless the coosteUatlon Involved belongs to
Jupiter or Mercury or even benefiC Moon, though ttle last dro.unstance
might render the native's thinking sensual. KetuNernlSMars (or
Sawrn) denotes d:lnger of scandal.-. marriage. But if the 10"' 01 house
of Karma is weU disposed, the affliction becomes sornevd\at tempered.
Let us take the example of a person having venus Mars
conjunction in Taurus, the lagna being Scorpio, Venus, Ka&atrakaraka in
the 1" is not general ty fcrvoured by andtrt writers on the theory of
Karakobhavansaya as the indications of the 1f! are said to be inhibited.
Expsienc:e has, however, rtWaled thM this textual dictum is not qt.ite
valid. In fact Venus In the Is one d the finest combinations for a fairly
happy marriage, denoting affe<lion between the alUple. When, in the
case under rtferenc:e, verus is in Krittika ruled by the Sun and Mars, is
In Mr1gashi-cl, the 1"' house gains considerabl e strength and t he married
life will be happy thoUJh o-ossed by fre(J.Iert. emotional clashes. If su:h
a native is married to one who has Taurus riSing with venus ard t-1ars in
Scorpio, each wll constant1y try to appease the clctates of the other's
emotions and over-indulge in sensual pleasures to the utter ddriment
of their heal th. venus in 'Thurus is good, but in a constellation
(Krlttlka) it rise to stubbornness. In Rohk'li on the other hand, the
finer qualities of find expression. It is ah'lays better to look for
trinal or diSpositions of Mars from tte Lbgna or tte Moon,
no matter even i f t hey conj oin provi ded they are in di fferent
constellations. A simi lar disposi tion In the partner's horoscopes Is
desirable thoUJh essential.
In sel ecting partners for marri"91=, more than Kuta agreemert, it is
the basi c structure of the horoscopes t hat is i mportant. One may
possess outer-chatm but may have a stony heart. acute seffisMess and
selfaggranc:lsement. Generall y those who have a conj unction of the
541, Mars arxl Meta.Jry in the ascendart will be diSposed as above
unless there ate relieving features such as the aspect of Jupiter. we
....nth us a rumber of horoscopes in the Moon occupies a martian
constellation with the Sun and Satwn in the 12th therefrom. Many of
them have oortessed tMt their married have been beds of t homs.
When the lord of the 7lh is in the 6
01
with Venus i n t he constellation d
Rahu, ooe will be frigid, t hough attractive. It i s not the purpose d t his
artlcte to discuss the basic affinities which ate to be considered before
judging t he marri age adaptability but to emphasize the need for
assessing the structure d the hcroscopes and their inherent benefic
content.
Just for illustration, we give bek:lw a Chart wtieh is typical d a
broken matr1age. The native being a Hindu, there was no leqal dhlorce.
Lord of t he 7tn Mars Is ., the In oorrblnatlon with Rahu lx:lth In
128
""'
- I
...
'"
"" I"'
""
""'
""' .... Navamn
....
"'
....
"''
...
I "" ..
-
'"
.... 1-
-
the oonsteUatlons of Venus and aspected by Saturn posited in the
constellation of Rohini. venus Kalatrakara in tis tum is rruch atnicted by
association with Ketu, situated i n the constellation of Rahu and
ospected by Mao;. Both the lords of the 7"' and Venus h..., been much
afflicted. The nature married the daughter of a highly pl aced and
respected offiCer. Before marriage the girl's father had been advised to
reject the boy as the gift's married life would not only sutfet from untold
misery, as the natNe could become a debauchee blt she could be e\4en
rejected. The marriage took place. And to the amazement ol the wife,
she found that her husband was leading a proftigate life and never
loved her. All her attet'Jl)ts to wean him from his evi l wfiYS failed,
and frOtn sheer the lad,t returned to her house. The
sensual life led by the native resulted In his oortactlng dreadful veneteal
comp&airts.
One cannot dedde the or a persoi'H>oy or girl-merely on
the basis of the Moon's situati on, though one can gl ean a few
psychological facts. It Is the total assessment of each horoscope that is
to be considered before applying the tests for oompatiblllty.
In a oombef' of charts of husbands and wtves we have studied. the
folowing peculiarities have been frond.
When Venus, Mars and ll.4)iter in one horoscope is sitleted in ttle
other hOroscope in a trine or 3 and 11 poSitiOns, that is, if in the
husband's hosoope. '\knus is r. Taurus and In the wife's horoscope, In
Cancer or Virgo, it is a ravourable position. When the SUn and the Moon
haw similar harmon:ous positiOns, except 2 an:S 12 (dwirONadasa),
there is usually a strong attachment. Here again If the husban:S's Sun Is
in Cancer and the wife's in Virgo, the needed harmony ex-ists. When
the Sun and the are disposed as suggtsted abOve blt MarS in
129
one case is in a sign which to be the from Venus in ttle
other horoscope, exists, but there cannot be normal
happiness In tt\8" private llves. If Venus In one horosoope Is In a sign
ocOJpied by Satl.l'n in the other a serious and industrious partner is
indicated. MarS in ttl! 1'", unaspected l:1f ben(!fiiC$, incleatu frequent
quaets leading to misunderstandings. Saturn In the aspected by
Mars (especially or fl" house aspect), is not c:on:tuoCive to mutual
understandings. sarurn in the "1" conferS stability i n the marriage but
the husband or the wife manifests coldness and no wamth. A strong
malefiC in the 4111. affects married happiness unless neutralized by a
benefic aspect lf the Janma Rasi of tM wife (or husband) happens to
be the 1.ag1a cl the husband (or wffe), or If the Lagna of lhe wife (or
husband) happens to be the 7.,. (in the horoscope from the position of
the lord d ttl! 7,.. (in the other) the married life will be sU1tt! and build
on mttual understanding an:l affection.
When certain afflictions are in one horoscope, it iS said
ttlat they could be mltfgated by having the nati ve matried to a partner
whose horoscope has similar afflictions.
After satisfying on the basis of t he birth hO'Osoope about the
bride's (or bridegroom'S) Character. health, genal mtntlll sounchess,
!he agreement between the two horoscopes Is to be )Jdged.
The astrologer looks for the compatibility or terT1)eramert and not
its identity. Astrologi cally tiYee 'nat\l'es' are recognized vi;z. Deva (or
divine), Manusha (or human) and Rakshasa (or di3bolical or devilish).
The 'divine' (Oeva) represents piety, goodness of character and
gene<ous Instincts; the humon (Mai>Jsha) Is o lrixt._e of gocxlond bod;
and the devilish (Rakshasa) suggests hatred. contempt, meaMess and
nisctief. These dllffetent 'nattres' are supposed to be revealed by !he
birth CO"'stdi&tion. A c:lstast:e for piety and religious disposition cannot
easily mate with piety and religious nature. A difference in beliefs and
dogmas cannot always be balan::ed by sex COftlllltibility. Hence one
born In a d!Wie temperament is not allowed to marry a person botn In a
'devili sh' temperament is not allowed to t1"0rry a person born in a
'devilish' temperament. MarMge between a 'devii sh' man and a 'divine'
or a 'OOman' glri Is permissible under oertaln clrcumstYices. The befief Is,
130
marriage between ' prol'ibited natl.res, res!Jts in <lsh.armony,
and divorCe. ECJJ&Uy great prominen::e is gi...en to what is called Yoni
to j udge <Xlftlpatibl llty d sex. The the<ll)l behind t his conslde111don
seems to be that as the human embryo in the course of i ts
de:\4'!1opmMt passes various stages of evoiLtion su::h as thoSe
of mamnars, quadNpeds, etc. the 'urves" and 'tendencies' of certain
animals are supposed to gain dominan-ce in the nature of man. It is
supposed that e&eh degree of the zodi ac expresses degree of
evolutson of the rtc:Mdual <Xlf'lcetned. This Yonl-kLta takes lrto aocount
the se:Q.Ial aspects of marriage and indk:ates the sex affinities.
So f ar as the health compatibili ty is concerned the astrologer
classifies the h.Jman constitution, into vata (!Mndy), pitta (bilioos) and
slest\ma dfviSions. Thi s is atso tht ClaSSification ZKX:Ording to
Ayu"Veda or the tfndu system of medicine. A boy with a predominantly
windy or phlegmatic or bilious constitution should not marry a gill of the
same type. The girt Should belong to a differert
Acta-ding to the stanza current amongst astrological Savants "if'
Mars Is in the 211d. 4
1
", 7th and 8
1
,. houses (either from the
Ascendant, Ot the Moon or Venus) in the horoscope of the fema'e, \tie
death of t he husband will occur; simi lar si tuation of Mars i n t he
husband's horoscope causes \tie d-eath of the wife. It should be noted
that the streng\tl d the dosh in 2, lt 4, 7 and 8 is the ascending
order. In assessing the quantum d Oo:sha, Bhavas and not Rashis Should
be taken. The Dosha d Mais Is said to get neutralized minimized In
the folowing drOJmstances :.
Mars In the t'd is bad provided such house is arr( other than
Gemini and Virgo; in the 12th the dosh is produ::e when such 12 house
Is any cxher than Tcxrus and Ubra; in the 4,. house f\1ars causes Dosha
the house fals in any slg<l other than Aries and Soorplo;
the '?' i s other than Capric:Otn and cancer, the Dosha is given rise to;
and Mars gives bad eftects in the 8th, provided the S"' is any other than
and Asces. Jn Aquarius and Leo, Mars procltces no Dosha
whatsoever. The Oost'0 is counteracted by the conjunction of Mars and
Jupiter or Mars and the Moon.
No Kujo Oosha arises if Mars joins Rahu c:K" Ketu; c:K" is aspected by
5ab.Jrn or t-1ereury.
It wil seen that Oosh3, Simply because i t may exiSt, is not
absolute; [t can vlJIV not only aoc:ordlng to the above exceptions but
also according to the s9lfriendly, exalted, own etc. invQt\ed. We can
thtre, rate the afflictions as folowS, taking MarS as the went mak!fic,.
Sab.Jrn, Rahu ard Ketu as tess malefic and the Sun as et malefic. the
I'Tialeficenc;e being tile highest in debilitation and lowest in ex-altation.
8th and 7th 4th, 12th and 2nd
MaO'S Saturn Sun MaO'S Saturn Sun
Rahu Rahu
Ketu Ketu
Debility
100
7S.OO
so so 37.SO 2S.OO
Enemy
90
67.SO 4S 4S 33.7S
22.SO
Neutral
80
60.00 40 40
30.00
20.00
Ffier'd 70 S2. SO 3S 3S 26.2S 17.SO
Own
60
4S.OO
30 30 22.SO 1S.OO
Exalted so 37.SO 2S 2S 18.7S 12.SO
This w;ry tile Oosha for each horoscope can be worked out
according to the above valuation so that not ooty the OOSha r:1 Mars is
assessed but also the Dosha of al maleflcs, so that when matched with
the other hot05COpe, if the Dosha units are equal, or nearty equal or
the units in ttl! mal e h:)roscope are 25% more, the horoscopes can be
approved.
nus It will be seen that Kuja Dosha does not deserve that undue
importance wtich is now being given to it.
It is therefore essential that before marrib9es are seWed the
OOroscopes of the are carefully examined, inherent similarities
and lhe oompatlbiUty judged.
Mars -Marriage & Sex
1. Position and aspects r:l Mars are wsy ..,.,ortart, particularly in a
female nativity.
2. Mars in a female nativity represerts the desired congress with a
male.
3. U Mars Is In the t house In watery signs, It lndlnes one to low
OOR'1)any, wine and women.
4. Mars In the 4tll seriously dlst\Mbs home life, sfving rise to constant
disputes.
5. Mars In the 51t1 house gtves fondness for pleasures of life. A b!en
edge is imparted to the desire One is inclined to have
romance with the opposite sex and acts under great of
emotions in this direction. In a mare nativity this Shoul d be
Interpreted as inc.linlng to a rumbet of affairs, their success
depending upon benefic lnftuences, this planet may be receMng
and the frustration. on the evil aspects that it IT'IaY be fonning. In
a female natMty, if r. evil aspect, it to clsgrace.
6. Hars in the house gives, abundance of emotions and excess of
feelings..
7. Mars In the '1" house If afficted by-
(a) Sun- acts as adverse lnl\lence partk:ularty In a female nativity.
(b) Moon -an adverse lnnuence particularly In a male nativity.
(c) Meowy- there may be Indiscretion In writing love letters
(d) l'4)1ter the may be waste of vital force or squandering cl
money due to oW(I5ite sex.
(e) Venus - brings frustration and ruin through the opposite sex.
(f) Saturn - there may be frustration of desires, delay in marriage.
sorrows in love.
(g) Herschel - A$ a resul t of undue desire nature, foolish
infatuations are fOrmed, resulting in frustratiOn or diSgrace.
(h) Neptune - same as afnictlon or saturn. There may be some
illusion in regard to one's bdoved and c:onsequert. poignarcy
of ljl1ef.
8. If Mars Is much afflicted in the 50<1 house particularly by the bd of
the "P' and urmitigated b'f any benefic it acts as a
evU r.nuence. There may be separation with the husbanCVwlfe
and the parties may have to go a court d law, for o:mpensatlon/
divorce.
9. Mars in t he st" house in a male nativity inclines to IO'o'e affairs
particularty If forming aspects with the lord or the 1 or 'P'. In a
nativity if affliCted by lOrd of the 10"', it may lead to
disgare.
10. Mars in the 7" (rot in its own sign}. This is an evil ne
marriage Is unfortunate; there are constant quarrels with the
marriage partner, and if other indications confm1, there might be
prematl.l'e death of t he marrW partner (t<dt for other imications
for confirmation).
11. Mars In the "P' denotes a wife who is o:mbattve, aggressive and
tries to dominate. In a male: nativity, this Shows that it is the vl4e
who wears the trousers.
12. Mars in "P'. The P'\rtner is endowed wit h COUIQ9e and boldness
and much constructive energy. But he/she would be overbearing
and assertive to a fault If such Mars receiveS good aspects from
strong planets, this may lmlcate In a female nativity that the husband
may be employed In the or Pollee or follow some occupation,
falli1"9 umer Mars (surgery, dectric engineering, wort connected
with coloii'S, ooppet etc.) and this may not be taken as an ac:tverse
influence. if Mars is esstntially strong. But weak affliCted Mars
wol.ld Indicate that the marriage partnet would be quarrelsome,
urvuty and auel tl.lsbard/Wife. In a male nativity, this Is n.rely a
good influence unless Mars is in Aries, Taurus, Libra, Scorpio or
capricorn.
13. Mars in the "J''h house :
(a) II atrlic.ted therein, hlc:ates quarrels atd unpleasantness in
conjugal If more than once malefic afflicts and Venus
also afflicted without benel\c aspect or Jupiter to the seventh
house or marriage significators, home life may b'eak up and
thefe may be rue to the oooortrollable temper or
sexual c11nAng.
(b) Even when well aspected, it ts not a very good position bt..t if
forming good aspect with Moon in a male nativity or with SUn
134
in a female natfvity it i s not so bad. The marriage would
continue, and not disrupt particUarty if it has the sextie or
trine ct Juplte<
(c) The evlllrlluences emanating from 1111s poslllon ct Mars
be modified acccrding to the sq. it is in. if in hot and fiery sign
the partner may be fiery in tenper, if in watery signs, 1.-.:::lined
to Q-ink or lewd; in Aries and SCOJPio it Is not so bad, but
inclines to more than one marriage if other indialtions cortirm.
,.1ars WI <:aprloom In seventh: one marries wei and the sodal
position of the native is enhanced bot such an alliance.
14. lf Mars In the 1" house is moch afflicted by SUn or Moon ls In
conjunction with malefic panets or forms evil aspeas with several
planets, one's wife/husband is atways causing a jarMg note tn the
domestic life. Then'! i s rruch aggressiveness and uncontrol able
temper on the part of the partner and the peace and serenity of
life is Shbtttred. Also, there may be more than On@ marriage.
15. Mars In the 7
111
: the ls lndlned to ha...e IOYe affairs.
16. Mars In 8"', a disastrous Infl uence f or the husband, In a female
nativity.
17. Mars In 8
111
There mi!1f be financial diffictJties after marriage and it
is wift/husband may b! direc:tly or indirectly connected
with or be caused such financial dlfticu!Ues. One wil have to faoe
indebtedness.
18. Mars In lhe g'd'l- There may be losses relatives of wife/
hi.ISband. AJso gives rise to some friction mth relations by marriage.
Aspects of Mars
19. U r-1ars is afflicted a woman's horoscope marriage becomes a
p-oblematical affairs. Also, unless there are other fa..o .... able feattres,
malriage may be deried "' delayed.
(a) This Is partiQJiafly so If Mars Is afflicted by a strong Satum.
(b) U Hersdlel afflicts Mars, engagements made may be bro..,n.
The woukt be Inclined to have romantic attachments
and may have a number of affairs.
13$
(c) II is the afflic.ting plana there may be homo-sexuality
or some other sex perversion.
20. Ir MarS iS affliCted by strong venus there may be irrtg\Aar U'lialS.
Unless the lord of the t house ancl those d 4"' ard tp are strong
there Is url>rldled lkence and <isslpatlon. This woiAd be parti<IAaoy
so if these planets are conjoined in the 5"' or one of them is inS"'.
21. Mars in conj111ction with or in afftictioo by weak venus: the native
i:s too mu<:h addicted to wine, women, and wantonness. Self
W'lcl.llgence leads to dissipation cl vital energies. When venus Is
vf:r( weak debili tated in a male nati'ofty the nati ve has congress
with women of low status but In a femal e natfvlty this would be
so, partia.Jiafly if Mars be debilitated or otherv.ise weak.
22. When Mars Is afftlcted by verus and the former Is In el evation, It Is
a greater evil than if venus be in elevation.
23. Mars in good aspect to makes one indined to pleasures d
life and female company. In a female nativity it has similar effect
One may matry well.
241. lf Mars is very weak and is afflicted by conjunction or malefic aspects
d Neptune., Hoerschet and 5at1Sn (if not by all the three at least by
tw'o) the of !ewe affairs is beset with difficulties and dan91=f'S
before as wtfl as after marriaCJ! and may IW to sorrows and a
series of actions.
25. Mars in conj unction with or evil aspect to HerSChel is bad
sure that In case d aspect they are wfthln orbs).
26. If Mars be the Ruling pl anet in a horoscope and be in bad aspect
with Neptune It leads to l.l'lbridled licence. Passions are
marked and there is much emotional disturbance. The native seeks
sex gratifiCation, if l"(lt outside by setfindulgence. Also, there may
be some scandal and disreplte pertai'ling to some tow affairs.
27. Unless there are strong benetics In the 7"' house ex aspect:ing It, r
Mars be lord of "P house, it iS unfavourable for diSputes.
And the person wou d not be wdlact<lsed to go 10 a court or law
in coonectson with marriage suit ex <horce.
28. (a) Mars (represenUng the selCUal U'ge In female) W afflicted In a
remale nativity shows nonfulfillment d such craving.
136
(b) If be very weak and be In conjunction square or
opposition to an elevated Saturn d (saturn in rJrSt or the 7.,
house) the female may remain a spi nster. See also for
confirmation, whether barren signs are on the cusps of
and 111 house.
The sex outlook of the Signs l'\lled by Mars
ARlES
ArieS iS a rash, impetuous, and hebdstrong si gn, impulSive in lOve
affairs and marriage as In everything dse. It is passionate. At the same
time there is deal of idealism. Sewal indulgence is a matter more f$
suddfn impUse than of deliberate seeking. It iS a poSitive type whiCh
does not harmorise well with a positive partner. It tends to seek some
of a natl.re 'htlom it can i mpress W(h its masculine qualities and
can protect.
A man wnh Aries riSi ng is attracted by beauty and apparent
helplessness. He needs a wife content to remain In the background and
duty admire Ns powers and ability when It Is expected of her.
Normally Aries Is a better sign for a man than f a woman. The
Aries woman is too masterful, too muc:h of a v.tlirlwtnd in the house.
She: is capable, generous, easil y beco!'nes loud,
shrewlsl\, and " bossy afllictlon.
The Al1es nature Is an Intense one, capabte of sudden violence
and great With suitable afflictions, especially from Mars or
Umnus, a sadistic te:ndency can easily develop. By ilsetf', i t is too direct.
simple and P"'*l've a slg\ to lend itsetf readily to pervetsion.
It strtves for leadership, whether In man or wcman. Uriess the
partner is content to be led, constant friction wtl devek;lp. Partly for
this reason Aries marriages are often urtlappy though other factcn
contribute to cause disharmony.
138
There i s nothing of the "milkandwater miss'" about Scorpio
women. They strong charbCters, a keen, if sometimes: pecui ar,
sense of jusdce and Ule capacity for very deep and lasting loves and
hates.
A.s mi ght be expected f rom the extreme nature of the sign,
marriage can be t ither very happy or entirely the reverse.
A siously Scorpio tends to invdve tragedy and crime,
white l iability to brooding, fits of deep gl oom and depression, and
persecution mania are common to a greater or Sesser extent
according to the deg-ee of afftiction.
Scorpio itself is not speciolly subje<l to sex\101 perve<sion, but it>
sexual nature and its rul ership over the sex organs makes i t an
Important factor In cases of perversion, especially those of a
hcmosexval nature.
Cliapter 6
!Matrimony ant! tE:viCs of !Mars
( KUlA DOSH)
The Pi votal Role of M.arrlage- The Indian culture divides man's
life into 16 Sanskaras of wtli<:h marriage is the central. Aftl!:r marriage,
man erters into Grihasta Ashram which is the pivOt on whiCh rest an our
social Institutions and customs. A householder not oriy performs his
duties towards his family, he replies to all soc.ial debts ard keeps the
wheels of society moving. The married life is not only upholding
Individual Interests but on It also lies the burden of raising a worthy next
generation. All this is implicit in our familiar sti'U(;tur e.
Therefore, IT'I(Irriage in Indian customs is not a physical or sodal
contract alone, bJt a sanctified event. It iS witnessed l:1f the P&nch
Mahatlhuta, nine planets, thlrtyttwee Kotl Devas, Parl}an and Pt.rjan
and is bl e55ed by Lord SaptaJ)ildi through the chant ing of Vedic
Mantras.. So solemrized, the marriage' unites the and tM bride-
groom fa- seven births, both to help each other and share alike
the jQV$ and sorroW'S together.
It is sad to note these an:l several other aspects denoted by ttle
Indian marriage are getting dim. Yet one may take heart in the fact
that Indian people are resilient Perhaps the nti!W
life Is faded, we wll reinforce our own Wll'fS d life. At least lndlvkl.lally
we can subscribe to a view d life that eni)races modemism tut does
not leave its own virtuts.
MangaJ Dosh (Myth and Reality) - As a consequence of our
faith In Oll' highty de'oldoped sdenc:e d astrolog,o, Of even due
to creeping of superfi ciali ty in our outk>ok, our consultation of a
140 8: Mtrttimony tllld Evifs of Mitf$
horos.cope is guided by sheer negligence and ignorance. A cursory
deiTiition, a ruling by an astrok:lg and the iS set for bOy or girl. A
true pKtwe Is ne\'er presettted before parents to know as to what is In
store for their wards in future. Astrolo9er may take from few hours to
few days to plot his chart to koow about a particular erftct. Again
talytlg of a person's horoscope W'lth hiS/her prospective partner to
examine if or n:;lt they cancel each others eW influences is by no means
an task. This factor Sh>Ud M of a prime conSideration the
marriage., only to avoid problems or a series of problems whk:h the
coup'e have to fate after marriage. If this factor is not taken into
consideration at first instant then it often too l ate to do
anything about It
As for M3ngal Oosh aff'licting a couple, it may b! stated here that
ttlere are more m'r(hs ttlan reality pre\'31ent In this respect. often
unscrupulous, ilk>gical and immat...-e are passed resulting in
urtold turm::lil ancl anguiSh for the concerned person which is totally
wasteful. It must be kept In mind that if mathematics go
wrong, mischi evous or incomplete r:l available facts
figi.Xes "4)set the ertire forecaSting mechaniSm and give a comJ*tely
wrong picture. Instead of the malady being cured or mlnlmtzed a
pet$on is only lost in the ma:e of the problems.
It is, therefore, necessary t hat t he term Mangal Oosh be first
understood. Also known as Kuja Oosh because the planet Mars is
lnwlved, Mangal Dosh though resulting In unease and adversities is not
always fatal, as it is made out by n.m'lCrous astrologers and later day
theorists. There are proven remedial meaSIUres in the form of trymns
and chants that reduce, W not nullify, the Intensity r:l the evil In the Ide
of a couple. There are psychological explanations, wtllch we wtl clsc.uss
later, to clarify how and why these hymns prove effective in countering
the r-tangal Dosh. AI the sne as per our own wide, ranging of a
particlkr case of Mangal Oosh operating in a couple's life, except in
some severe cases, we found that it is rarely t hat it results in
deMh of a per500 or of t he spouse. FMarll'ty is not rUed out, but it iS not
a rul e with Mangal Dosh.
In fact, the five an<:ient l ncian autt>rit41tive texts on astrology do
not even take up a systematiC tre.atment d the subject and i t i s to
alatet day south lndiM Book to broach the topic In any definitive detai .
Tho1.9h these texts - the Brihitt Parashitr Hora Shawa, Jatak.a Parijata,
saravali , Phaladeepika and Prasna Marg - do discuss threadbare the
effects and Ills of Mangal Oosh, but it Is pasOOg alongwith several other
asttologi<:al fa<:tors goveming a person's life.
The of a <:onfusir9 stand on Mangal 005h is often, a non-
Mangali subject is dedarfld Mangali on the of the birth Chart
witho!A t aking .,to aoxn.r'lt related factors that may have reduced or
even totall y, canc:elled out the Oosh. The for a matthing
Mangali suitor begins with di storti on of the avail able facts whi<:h
becomes disastrous in the future. In the case of girt partia.Jiarly, this
plays a ha\Oc because she wll ha\'t fewer sUI:OtS to choose from. Then
the balan:::ing medlanism halling been distorted from the beginning,
wrong part:ner will be fi nally selected. ThiS is the teast oopardonabl!.
worst. someUmes, t he parents or the girl In desperaUon resort to
falsehoods in getting wrong horoscope prepared, oompounding the
entire probl!m.
In rests, therefore, with au those comec:ted with astrology as also
the concerned party/parties to carefull y ascerta., the parameters of
Mangal Oosh operating in a Pilrtiwlar case before layil"9 out t he <:ase d
an indMdual
This exact charting of t he Mangal Oosh pattern in all its
manifestation is the starting polrt of the preset'l Investigation.
Mangal Dosh :some Home Truths Mangal Oosh, as will be
dlsrussed later. caused chiefly by """""e positloi'Ong <A the planet
Mars, but other planets li ke Rahu, Ketu, Saturn an::l 54.1"1 also cause the
affli ction in c:M:ai n position. The net Mangal cbsh for any person is
defi ned by Mars, Saturn, Rahu, Ketu and Sun and by certai n
can<:ellations effected by f avourable planets and f avourable positioning
of certai n pl anets whi ch reduce the i ntensi ty of Mangal Dosh,
sometimes rendering It lnetrecttve. Nevertheless Mangal ()()s:h
onc:e discovered to be present In one's birth <: hart, lnvari&bty affects
the personality, the outlook and the destirrt d the person and th:>se
142 Chttpter 6: Matrimony tJnd Evifs of Mllf$
nearest to him. With the result t he person needs to PitY special
attention to this aftliCtiOn, t rain hiS ment-al affectation to counttr evil
emanations - Insti ncts - and mould his thoughts In pattems that
conform to successful living. This can be achieYed a proper
understanding of his own M:angal psychology, vdlieh is driving
him towards a partfc\Mr aggresslveard aggravated behaviour harmful In
the end, and oomparing himself with the psydlology of others
who IM! a benign but prog-essNe ife. eaSity surmounting the: diffteUties:
ltlat oome the wif!.
Mars, considered the most malel\c planet as far as Mangal Dosh Is
concerned, has been regarded by astrologers since the t imes
immemorial as the worst cul prit. Laterly, Mars is at its crudest when it
oc:a..,ieS: t.agna, 2"1t, 1" or house:. Some seh::llarS atso ackl the
8"' house In the list.
The predktlon In Bhava Deeplka of Kerala sajS :-
But scholars regard !his statement, that the spouse of a Mangall
native <les, wtth a salt. Large scale experienc:e also proves that
this is not properly interpreted. Another ShaJoka states :
If Ravi and Rahu are with Atmakatka i n the Navamsa chart and
they are also aspected by r-1ars, one bums his own house or helps
others to theirs
Kal<lasa explains In 'Uttara Kalarr<ita" lhat Kuja Oosh should be
consi dered from Lagna, Moon or Venus depending on wtich is the
strongest. Mantreshwara also holds the same view in '"'Phaladeepika':
Narlld Samhita mentioo thclt kuja Oosh should be considered for
the sign d MatS and reckoned from Ven.Js.
Jat:aka Parljata, Agastava 5amhita l'lrd Kuja Oosh present In 21'd, -11
1111
,
'?', Slh and 12
1111
houses.
Sarvartha Chlntall'0nl also suggests Kuja Oosh in 21'd, 4lh, 7"", Stl'l
and 12"' houses, whereas Narada Samhita takes Lagna al so i n
consideration.
Hart.reshwara says that Ketu shwld also be regarded as Mats. A
few &SSiCS like "Vachaspatyam"' sugg!St that Kuja OOSh stolid onty be
considered If Mars joins Sth house and nowhere el se. If Mars Is
debilitated. combust or ):>ins inimital si gn in 8th h<X.lse thet"e is no Kvja
CoSh.
If MarS ):>ins 2"', 4th, a 12th hwse in the horoscope of the
boy as well as the girt, Ku}a Dosh gets cancelled. position should be
reckoned from t.agna, Moon or Venus. This brings ll'lilrital
wealth, prosperity, healt h and friends etc.
This means that if Mars joins 1st, 2th, 4th, fP' or 12th house in
one of th! matdling horoscope and Satum occupies either of
houses In the other birth chart. Mars Dosh gets cancelled Mars, Satum,
Rahu, Ketv and SUn are malefics. For the GQI'lSicleration r:l Kuja Oosh
planets are to examined and rkooed from - (i) Lagna; (ii)
Moon; (li ) verus, the slgnlllcator.
Some more aphorisms whkh have been considered elsewhere In
this chopte< dll'ing cotegorizotion of the Cosh are quol<d below. Our
sages had deep vision and intuitive power, thouttl there are some
conttadlctlons In their eru.ndatlon on these aspects r:l Mangal Dosh. In
practice most of these aphorisms tum ovt to be true and re11eal deep
psychol ogical understanding of the subject affticted by different
positions ard various k1nds of of plan&, Lagna, Navamsa etc.
Today all we have to do is to grasp where these Pi)rticular aphorisms
apply and in which case they cb not hold good.
Should Mars occupy an adverse place with reference to Lagna,
Moon or venus, adversity during life is certain.
Should Mtlrs happen to rule at about the time of a contemplated
marriage, wisdom dictates that we put df the proposal till the Dasa Is
over. If it comes at old age or had already come In childtv:xxl, it may be
ignored.
Should in the natiWies d a couJ*, OCQ4)y the t, 2"', 4
11
,
rh, gto or the 1l.h house with reference to the and/or
equally (I.e. In both of the<n) the 0014>le will live for long, be
Chttpter 6: Matrimony tJnd Evifs of Mllt$
wealthy, b e ~ children and posses frierds. Should only one of them be
so, he iS often afflided with death. So $aYS great RiSI'Iis like Atri .
Should Mars cx:c-upy the 4
111
or the 71t1 house identical with Aries,
cancer, Scorpio or C.prloom, KuJa Dosh does oot arise. It Is c1 benefic
di sposition.
Should Mars ocxupy the 1'\ 'l'd, 4
1111
, 8
111
house in movable 59'1s,
then he becomes innoruous. In othtr signs he: iS a malef'ic.
Shoul d Mars occupy any of the above five houses but is
accompanied b'f th! Moon, Jupiter or Mercll'y the Oosh dots not arise.
Vv'hen aspected by the., one should not even thH< of any hann.
The unit d Dosh ooumed from Lagna Is I, from the Moon ~ and
hom Venus v.. Should Chey sync;hronse, then they sho<Jd be treated
from l.ag'la alone. So say the great Rishis.
Should the rulers or the 2,_, and the 7.,. houses be malefics, they
cause harm to the wife. Should maleflcs 00::'-4)y the 7" or h e ~ house
they hOfm the husband.
Mars In the 7
111
or the ff" !'>use fetches one full l.l'llt d Oosh for
women; for men one ooit in the second and the 1" frcm t.agna, ~
from the Moon and Yl from venus. Rahu sho\Ad be o-eeted at par with
Mao; (In the matler cl Oosh). Sat"'n and Gulika fetch 14 Oosh. The Son
there fetches 'h: Dash. Should Jupiter aspect them or be exalted, the
evil effects are o.rtaied to half.
Mars does not cooter Oosh, should it OCOJP't' (in those houses) its
own sign, Its exaltation, or own or exaltation Navamsa. It Is harmless In
cancer and Leo.
Others ~ that even as the 7"'- !'>use anti Verus are considered
for the tusband, the 8" and the Sab.Jrn too should be considered so.
Should the lord of the 7
111
or the Sun occupy a malefiC sign or
Navamsa, enjoined with or aspected by malefics, the wife wll be
pe.-ted and do slrlul acts.
A mal efc pl anet in the 7" house of the mal e chart, when
OCC'-Vfing own or exaltatial house and full rays bestows an
wife who belongs to a famlty and bears good character and has
quallfcations. However, if it is debilitated Ot is combust it gives a wife,
who iS a Rirt ard lackS c:t\!racter.
MarS, when debilitated or occupieS enemy house in the 71h, kills
!he wife and gtves seo:>rd marriage. Should, however, the house be Its
own, exalted Ot aspected by if gives a good and fortunate
wi ft:.
If venus or l.Jpi ter iS disposed in Lagna or the 71t1 house and Mars is
weak, Kuja OoSh becomes inetrtivt:. If Mars: iS placed in tht: sign
owned by Saturn, evil s of Mars get neutraliZed.
Authoritative VIews on Mangal Dosh The views of Brlhat
Jatak.a, Saravali, Jatak.a Parijlta ard PhalcK!eepika about the position c:l
Mars in 1 , 4t", at", ard houses are signlfant !J.!ides to the
endre mystery.
Mars in the First House
Brlhat latal<a The subject wtl have an lnj<.<ed !Onb.
Sa"'valllataka will be cruel, oourageous, dull, short-lived, egoistic,
valiant, will have injured bocty, otherwise good looking. if retrograde
wavei"W''g.
Jataka Parijata The person wil be cruel, daring. wandering, \ery
and sickly.
Phaladeepika The subject will have an injured limb, will be sh::lrt
lived. auel and
COmments By Lagna, a person Individuality, boct( oonstltutlon,
character, chilclhocd, health and vitality is dec.ided. taganasth Mangal
denotes angry nature, physical warmth, bl ood complaints, ac:Cident.
mental excitement confusion In ltloughts. Health Is affected and !he
I'T\illn has no control lover his stubbornness and arrogance. The 1" and
148 Chttpter 6: Matrimony tJnd Evifs of Mllf$
gtto h:)uses are also aspe<:ted bv Lagnasth Mars. As a result many harmftJ
effects are in indi'lfdJ&I's health, house, property
and age. Thus Mangal affects a man's ife with Mangal Oosh. lf
Mars is plac:ed wfth Moon c:K weak Venus, the same type cl afflictions
are to be expected.
Mars in the Second House
Brihat Jataka The person will eat food.
Saravali Poverty, bad food, deformed depending upon bad
devoid of knowledge.
Jataka Parljata- The subject wi ll be engaged In wandering In
pursuit of metatll.l"gy and agricutt\l'e, hot tempered.
Phaladeeplka The Jataka wll be ugly faced, devoid of leo<nlng and
wealth, will be dependent on bad people
Comments The thorough i nvestigation d family, countenance
Dakkhln Netta, eloquence, cause of death etc., Is doM by the
placement of Mars In the second house. Due to full aspect (Purna
Drishti) of Mars from second Bhava on fifth Bhava, there will be toss d
Dhan (finance) and progeny. Orishtl Nikshepe on 8
11
house ar'd gttl
house (Bha.a) causes damage to health and lock respectively. There Is
a saying in sanskrit:
The Seoond Bhavasth Mangat unusually dangers the health of life
partner and increase undesirable problems in the family. Generall y under
this position of Mars difference of opnlon between couple, family
quarrels and money problems prevail.
Mars in the Fourth House
Brihat JatakaThe slbjec:t will have no happiness ani wil be of
troubled mind.
147
Saravali devoid of relatives, garments, food ard h;)use without
unNipPf and will be living in other's house:.
Jatak.a Parijata The pe:rSon will have little connections wi th
relations and wi ll be a henpecked husband though valiant and
unc:orquered by women.
Pha:ladeepika The person is without friends, mother, lands,
happiness house and vehicles.
Comments In the matter cl marital aspect the 4
111
h:)use is called
Sukh Sthana (happiness) a lso. Pleasure objects like land vehict!,
household goods (ttensll:s and furritll"e etc.), mental hannony are an
accordance of \tlis Bhava only. Although fourth Bhavasth Mars is a good
disposition of immovable prq>erty, this posi tion iS malefic for the stability
of happiness and peace. From here MatS casts full aspect of seventh
Bhcl\'a on account of which it becomes irr1>ossible to establish proper
equation with the life Partner. Preceptors have expl ai ned harmful
effeas (Mars Oosh), caused by fourth Bhavasltl f-1aiS. Here evil d Mats
is onty 5%. So one having Mars in the 4 .. house is said to be a l ight
M.angali. Under ttlis position of f'.1ars, stubbornness, hot temperament
and lack of ability of adjustment with each other causes damage to
rr'l&rital ife.
Mars in the Seventh Bhava
Brihat Jataka - The subject suffers humil iation at the hands of
women.
5arcwali - The subject's wife dies, troubled by diseases, foii Cl'Mng
bad path, unhappy, sinful life devoid of wealth. Troubled mind and
chanrless body.
Jataka Parljata - lataka will be quarrelsome about women and
fond d war.
Phaladeepika - The person is born to do improper acts, suffer
affrlctiOn th'Ough clseases, wanders on roads Md loses his wife.
148 Chttpter 6: Matrimony tJnd Evifs of Mllf$
Comments - For rnorriage considerations this is the main Bhava.
Th! marital happinf:SS, hllrmony, physical nature, amorous
relations etc. of the partner ate deduced from this Bha\0. As a resUt d
this cortiguration fattors like, dedine in heatth of spouse, impediment
in marital happi ntss, unctainty of occupation etc., are mani fested.
Mars' disposal here lni\Jences Lagna ard Ohana Bhava on aCJ'X)Unt to fUI
aspect due to which finandal loss, deformit ies in fa mil y, dl.aracter
d<ine, accidents, boilS and pimpt!s ttc. occur. Spouse is of superb
beauty, blt of nature. Mars or Al1es, Soorplo, capricorn,
Aquarius Rasi enforce ttle possibility c:l second marriage. By nature
Gemini, Virgo, Sbgitulrius, Capricorn, Scorpio and lto RastiS tht
Mars native Intelligent, arrogant, grumpy, adulterer (mostly with
consent c:l the spouse) and unfriendly. peserce in the 1-" house
causes heavy Kuja Oosh where the eRect of M3tS is 100%. This d
M.?Jngali persons rrust rot igoore Mars wtile: matd'ling birth Charts for
ttle purpose of marital life.
Mars in Eighth Bhava
Brihat J.ataka - If In t he Nktlan Bhava, Jataka wll have limited
number d issues and will have ck!fective eye sigtl:.
sarcrvali - Diseased, shcrt:-lived, body, doer or bad
deeds, grief stricken.
Jataka Pari)ata - The native will be In attire, rich and possess
authority CNer a multitude.
fhaladeeplka - The person will have a deformed body, will be poor,
short lived ard ci.<Sed by people.
Comments - Since obstac.les, Impediments, cal amities, life
process, sorrow and cause of death are represented by this Bhava, this
position d Mars Is the uttmate limit of Mars Dosh. Total destru::tion d
mar ital happiness shoul d be understood f rom this Bhava position.
Agonies and maladies destroy physical appearance. There is a strong
...
possibility of wid;)wl"ood due to death or murder r:l the sp>use of the
person having eighth Bhavasth Mars. The native may have to endure
mental agony, wrath of fami1y and social contempt. If this Bhava Is
placed with or aspected by Venus and Jupiter, the problems bec:ome
more terrible. Mar's clsposftion casts Purllb DriShti on KlA:umb
Bha...a. Consequently, one has to bear the household and flnan<lal loss.
AocOtding to Parasara, there i s financial loss and defeat Mostty all
the Shastrakara have i nterpreted t his position as the most IT'I(IIefic.
Such native col ect illegal weatth_ are fond of eating good food and
from diseases like pneumonia, biOOO pressue, boils, cuts, Injuries,
accidents and have to undergo operations etc. Besides diseases, Melts
in the 8tt' house in the female horoscope damages Mangal ya
(salbhbgya) of a lady. Ortstructions are caused to or
death.
Mars in the Twelfth Bhava
This Bhava signifies ex;penditure, traveling, bedple.asure,
purchasing power, enjoyment, sleeplessness etc. Due to Puma Orishti
on seventh Shaw Mars becomes directly responsible for hindrance In
the marital happiness, heiilth of spouse and dissipation. Mentality to
oppose Banct'tu (brother, friend, relation) develops. There is decline of
control over sex life. The nati ve Intends cruelty, fault-find ing
contemptuousness, bl emish of others and co\ltS trol.tlle with others.
The natives of this Yoga are excessive eaters, short tempered,
rebellious and debauch. There is wealth loss and pOYerty a, life. There Is
excessive fury of agonies and maladies like occident, suicide, headache.
migraine, blood complaints and indigestion.
According to Kalyana Varma the native Is eye patient, corrupt,
diS9rated, rrurderer and a iminal. However. one is not
strong Mangau If Mars joos the 12"' house. ()lly SO% oosn of Mars
shoul d be taken Into aocooot while welg>lrq Kuja Dosh.
The number of malefic results are maximum In Scorpio and
150 Chttpter 6: Matrimony tJnd Evifs of Mllf$
Capricom. In Aries, Leo, Cancer and Pis<:es, the rate of
mal efic results ar e mt<lll'n and in Gemini, Lit:ra and Aquarius it is less.
Nullifying ill-effects : Some opinions
Before making a final decision of Kuja Oosh on native, the
disposition ond oon-l>lnotion (the Yo90) of oR planets, ond OrisM,
shoukS be studied thorcughty in detail. A minute negligence in the
study of the detail s will bring extremely fallacious pre<lictlons. I n
reference to t-1angal Dosh astrologer should always stu"r' deepty on the
folowing combi nations. lt is widely believed that i n these dispositions
there are no residU31 Mangal Oosh as they get cancel ed with t he
lnftuence of benefic in the birth chart :
(a) Jr Mars Is In fourth or seventh Bhava and Aries, Cancer, Scorpio
or Caprtoom sign fall In these houses.
(b) U 1an9011s v.ith strong Moon, llplter or Merauy In
Lagna, second, fourU'I, seventh, eiglth or twelfth Bhava.
(c) If Taurus or Ubra signs fall in severl:h or fourth Bhava having
Mors.
(d) U Gemnl or VIJ90 sign foils In the second house occupied by
t-1ars.
(e) For Leo Lagna, if Mars joins sevenltl house.
(f) II Mars of own sign i s in seventh, fourth, ei ghth or twelt\h
Shava.
(g) If Mars j:>ins the fourth house identical with Ubra Taurus.
(h) If eighth house Mars is in Pisces.
(i) If twelfth house Mars is in vrgo, Gemini, Taurus or Libra.
Special COmments based on our own experience- There are
so mai'Tf position of Mars, where the Kuja Dosh appears to be a-nceled
according to many research SChol8rS. 1l'lese views v8ry from SCholar to
scholar, but our experience Is that evils of Mats never get cancelled fully.
The evils may at the most get reduced or minimized If corrective
measures are undertaken. We observed r-1ars doing harm in all
151
positions. So it is ou- sincere that we should not Kvja
OOSI\. The intensity can and Shoukl b! proper-ly j.XIged and WC!:ighed.
For example, Mars In Leo In the 12'h house W'f l not be as harmful as Mats
in cancer in the 7th or sth house.
EWs of Mars f Kuja Oosh as diSQ.Issed earlier are often
understood by the common mao that if a oon-mangali married to
a mangall partner. he or she v.ill die as a resolt d that matriage. This Is
absolutety a false ard misguiding view. If any of the partner dies or
separation takes place, this does not mean that either of
the couple has Kuja Dosh. There are many other combinations of
planets leading to l.l'lt\appy married life, discord and disharmO'\y. We
cannot blame Kuja Do5h only for all cases of tliolgedy in marTied life.
Heiny writers have deatt with Kujl Oosh at let'9t:h as for
each ascendanl An essence of that iS prestnted in this chapter. These
two points sho\ld always be kept In mind :
First, the position of Mars, where this has been said to be
cancel'ed. net.traliled 01 becomes ineffective. If so placed r-1ars comes
in opposition to Jupiter or in assoCiation with l.Jpiter, the evis of Mars
should be treated as many times Increased. Several case studies have
pro"'!d it. This is dealt with in detail in the chapter-Re-1.1\derstan<lrg c:l
l.Jpiter in f'.1arital
The second point worth considering is the position of Satum in
opposition In asscxfatlon with MatS. This will also emance the evils d
Mars. Under such conditions, rules of neutralization c:l Kuja Oosh do not
hold good.
Mars - Fiery and Maleftc
It can tt-..s be seen that Mangal Dosh is generated by malefic
planets occupying certain posldons at the time of the birth of an
lndMdual. In this the planet Mars or Mangal Is t he most fiery and
and hence the most feared. Astrologers of the world over
see Mars as a heaventy body ever collision with other- planets
152 Chttpter 6: Matrimony tJnd Evifs of Mllf$
and thereby affecting the mertality and behaviour c:J the iOOivQial it
Such subjects are affec.ted in their inherent and in built
psychological and not only themsetves suffet In their life tlme,.
but cause in<:ai OJiable mi series in the life of those they are inti mate
wit h, ttl! for examf*, but othtr"S also. In Mrern! cases their
tendencies and evl lrtluence cause fatal Injuries re5!Jtlng In the death
of those who are in dose oof(att wi th them. This basis to
Mangal Oosh iS widely accepted as one impcrt.ant aspect d the malady.
There is an inttresting astronomical account as to how MarS ccVllt
to be considered the most fearsome of heavenly bodes. This study
was carried o\A by a Russian sdentist who anciert act0t.1nts
of cataclysmc; e...-ent on Earth and came to condusions.
Ac:tording to Immanuel Velikovsky in ''Worlds in Col lission" (1950)
the planet Venus whiCh had two cloSe b'uSheS with Earth in 2000 B.C.
and 14100 B.C. (approximatel y a few years plus or minus) made Its third
wayward \isitation in the orbit of Mars this time on Milich 23, 687 B.C.
MarS being one eighth d the size d verus was pUl ed ol1 d its orbit
Into a new path In direct confrontation wtth Earth. The Earth was titled
off its as, so much so that the ok:l calendar d 12 months of 30 days
each had to be redrawn into a 365 days ye.a,r. In Velikovky"s words :
Mars cld far l ess than venus had some se...en
centuries eartler, It now became a c:k>mlnant fierce god In the pantheon
on Man's heavenly force. Veliko'IISk'( stl.dying the Old Testament and
other texts, relates that in 687 S.C. the Assyrian King Senna Cherib
marched against Hezeklah, King or Judah, planning to capture
Jerusal em. On the eveni1'9 c:l March 23, the first right of the Betv-ew
Passover. Mars unleashed a tiast from heaven that, accordng to the
Book d Chronldes teft King and 185000 men or the wading army
deod.
That same the Chinese recorded a great cisturbance in the
sky. Stars fel l like rain, the Bamboo Books report The Earth Shook.
Accounts of these cMadysmic e\lents have been found recorded in far
away lands as Greece, Egypt, China, lrdla and MeXIco and appear to be
therefore authe,..lc versions.
153
Thus Mel'$ came to be as.soc:iated with war and for Romans, who
cel ebrate f'.1arch 23 as Mars ay ... it became the God of War. The
personality of petSOnS OOm when Mars Is In transit becomes war like,
hotheaded in<:lined towards collision and destruction.
Hence the astronomical !sis behind the concept of Man9"1 Oosh.
Mars and Venus in a particulbr birth Chart cause innumerable paSSion
related problem l eading to love matrlages, IYIJltHove affah:, demeaning
of character resulting in unhappiness, breakups d marriages and
sometimes death of the spouse. Sexual aberrations and mari tal
disharmony are the results or the evil ne.lOJs between Mars and
The above astronomical stucty relating to Venus confronting f'.1ars
seems to this theory.
In sexual matters, Mars represents pa55ion, creative force,
d rculation d vital force etc. denotes the actual pcepti on of
the selOJal act ard attalrvnent of pleasurable sensations. This seems to
be corroborated by the astronomical account of the historical
conjuoction between Mars and Venus as giVen above. ln contrast,
Neptune and Ketu cause coklness and Inactivity sexual matters. lf
they affli ct Mars arw:l Venus they cause resistance to sexual matters.
Mars in Eighth House for Females
Grave for Females : The position d Mars in a horoscope bears
considerable significance from many angles. The presence of Mars Dosh
may cause marital delay, dlsoord and disharmony, unl ess suitably
matched. SOmetimes some kind d Puja and effective " Mantras"' are also
f'e(J.Iired to cutal the e\llls of Mars. Presence of Mars Dosha in a female
horosoope Is as such not desirable. In our experietlce of Mats
In the house is the worst <lsposltion. Here rt a few cases illustrate
how Asttam Mangali girls fare poorty i n marital matters.
Dr. B. Surya Narain Rao has mentioned in "SI:ree Jataka .. that the
tt' house frOtn Lagna must be consulted for marital life and widowhood.
In a woman's chart t he at" house frOtn her Lagna reveal s sexual
passions, her husband's character, her fortune and general happiness.
154 Chttpter 6: Matrimony tJnd Evifs of Mllf$
Or. 8. v. Raman has also repeated ttlis fact i n "'tindu Precl<.tive
Astrology"' Chapttr XXX on Female Horoscopy, that marital happiness
must be adjudged from the 8
01
house. From ?til house passion, her
husband's and her own character and fortune shoukt be determined.
Or. B. V. Raman has pointed out following combinati ons for
widowhood :
1. Conjunction of the l ords of "f" and 8"' house with malefic
combinations..
2. Rai'IJ and Moon in the Slh house will evil aspects.
3. Lord of the "1" house with Saturn and aspedOd by MaiS,
4. Moon and Rahu in the ff!' house and the lord of the 'P' house
with Satun aspected by Mars.
s. The oof"dunclion of the lords of t and houses ... her 12 ..
house with a malefiC aspect of Mars on the rP' house.
6. The -,.. house and i ts lord between two malefic:s wi thout any
benel\clal aspects.
In the horoscope d males, presence ot Mars t'l the f!' house is not
so harmful as in the case of females, partiQ.Jiarfy in respect to the marital
happiness.
Before proceeding further it would be worthwhi le to enumerate
other resutts of Mars if It occupies house In any horoscope. This
position Is an such bad for longevtty and nabJral death. As Mars lends
aspect over the second house, so usually eye problems arise. Eighth
house represents the B" part of the body, so there will be Urinary
troubles probtems In reproductive pil es or fistula or boll In
anus may be expected. There is a fear of fire, injury or cut etc. There
will be innumerable physical complaints, rheumatism and often a
dlsbJtbed famlty life and only few ctwldren. One will usualy be devoid a
true friends, while many friends rrli1'f tum inimical. He will have to face
obstacles in his endeavous and success will be attained only after a
hald laboor. This not a good dsposillon cJ longevity as
house is from 9ttt.
It Is well known that the SO' house "Mangalya'" or marital
156
hawiness cl females. A !jrl be treated as $1rQngest 1'-\angali if
MarS is poSitialed in the: st
11
house d her horoscope.. As rt'!gardS the
Kuja Dosh In the female native, we have observed that presence of
Mars Oosh in Jt
11
and the Lagna mostly causes havocs. Severity
of MarS DOSh i s maximum when f'.1arS iS in fth house. ,.1:!1rS often causes
obstructions to a timely marr1age.
What does Mars do after A few d the probabilities
of presen::e d Mars in 8th house in respect to marital life are ljven
below :
1. There will be stparation from husband, if marriage has taktn
place aroll'ld 21 years. There wil be reunion or reoondliaOOn
around or. otherwise there will be a litigation after
marria9(! and wil bt finaliU!d arol.fld 28
111
year.
2. The husband may receive some injury due to accident or his
health may suffer seriously. Mental troubtes to husband are
most likfty to take: pt.ace.
3. The husband will expire soon after mamage in a tragic wiJy or
will U fer seriously.
4. There will be a seriol6 danger in very unbalanced marital life.
Elcact natllre of the sorrow depends: on the exact set up of
planets and needs st\.dy and practical experience.
Who will be harmed the husband or wtfe
4
Kuja Dosh
must be got balanced wfliSe matching the horOS(q)e. If t he difference
is aroU"Id 25%, the will be happy. There will not be: must 1\arm
even It 50% difference Is there. But In a difteren<e d more than SO%
of Kuja Dosh, marriage should not be permitted. lf a heavier Kuja Dosh
is presert in the hOrOSCC)I:)t of wife, the wife will sdfer mort. Sht will
ha"' to faoe ttagedles of life. If lhe I>Jsband has a heavier Kuja Oosh.
he will suffer more, GeneraUy one's Kuja Dosh harms the partner but
the tragedy is to be: suffered by the affec.ted person more heavily.
Many say that KUVJ Dosh WOrks only till ye:ar d age. 1 agree
with It but only partial Kuja Oosh gets reduced after 2ff" 'f"N of age.
Satum ard ll4)iter's aspect or as,sociation w;th Mars inaeases Kuja
COSh.
158 Chttpter 6: Matrimony tJnd Evifs of Mllf$
Kuja Dosh - Mars Affliction Affecting Married Ufe
f'.1ars in the 1" house, unless posited in Aries.
f'.1ars in the 4th, unless poSited i n Scorpio.
f'.1ars i n the 7'
1
' , unless posited in Capricorn or Pisces.
f'.1ars in the: ft", ooleSS posited in Qncer
f'.1ars in the 12#1, unleSS posited in S&gittarius..
Ku.)a Dosh, or Mars affli<;tion, is an condition wtlich
negatively affts a person's: marritd life and domestiC harmony. It is
also one d the few astrological terms familiar to the I n<ian pubic. It
oco..rs when Mars is in the 1, 411\, 11', or 12m house unless it is
in a Sign designated as an e:xcepdon for that partia.far house.
The reason kuja OOSh Is so well lncia is that neatly all parents
there consutt an astrologer before arranging a marfia9e for their ctwtd.
This is d::lne, to a great extent, in order to find out if the: condition
exists so they may take measures to neutralize ttle ptoblem before l
has a chance to create The effect d Kvja Dash Is to cause the
pel'$01"1 to be somehow victimi vxl in his marria9t. This can, of <:OUrse,
oc:rur in any number of ways, but utlimatel y one is l ikely to end up
divorced and generally t hrough no obvious fauh of one's own. The
pel'$0n will also have to endure hardsf"lips in the marri generated by
tht
The way out of this probl em is for tJ perSOn wit h Kuja Dofh to
marry another who also has it. A person with Kuja Dosll does not have
the nature to victinil:e his spouse, and therefore if both partners have
tht CCf'ldition, its is ntutraliled. ThiS i s a Si "l!l! procedure: in
India, where, until orly very recertly, all marTiages were atranged at an
earl y age. However, f or Westerners Kuja Dosh presents a major
obstacle because of the way t he conditi on works in relati on tour
culture, where a person chooses Ns own spouse. The med'lanlcs of
Kuja Dosh are sud'l t hat it causes a person to be attracted to a paortoer
who by hiS very nature cannot blend or f unctiCf'l compatibl y for any
great length d time with that pe""n. Therefore, one Is qiAte at
the mercy of his f ate. Yet perhaps the most sigrifk.ant problem is t hat
a person wit h Kuja Dosh will not fTUd'l pt'r)tsical attractioo or any
157
special chemistry for another who also has the condi tion. Therefore,
even with the of this Situation, a Vh!stemer is destined for
trouble U'lless he Is wise Of patient to find a mate who also has
K<a Dosh, even ti-e great ex<item.,... moot people see!< may
be: missing.
Kuj! Dosh (also known as MlMI}al Dash, sinc:e: MMglJ/ is Mother
name for Mars) Is a reliable astrological Indicator and often reveal s wtich
partner out of a divorced couple was most put upon, deceived, or

It should also be mMtioned that t here are astroJogers who
consider the corditiOn to OCCIX 'ldlen Mars iS in the r' hous;e rather
ltlan the 1. The author does not agree with this school of 1tiOl9ht.,
especialy si'lce r-1ars in the aspects the 7", wtlich is \tie
house d marriag!.
158
Cliapter 7
'l(pja (!Mars) !Malia CJ)asa q>/ia{a
SEVEN YEARS
1. In the !)e9ming of the Maha Dasa, financial gains from several
clrectlons and honoll'; In the lridcle of the Maha Dasa, fear from
fire, king. thieves and enemi es-; in th! end of the Maha oasa,
temporary sepa"'tk:ln from f a m i ~ members ard diseMeS like tumOI.5,
urinaiY diSOtders, fear from fire etc.
The ai>OYe phala wll rtalnly occur W Godlar KUlA also lrdia>tes
likewi se.
2. The foiOWing are tt'e Maha oasa Pl\ala with referen::e to foll OWing
Yogas or occupation of signs by Maha Dasa Natha KUJA :
a) KUlA in Alyutcha (highest exaltation): Gain of land; victory in
encounter/battl e; honour from k.lng/Govt's happy company
of relatives and a host of Subha Phala.
b) KUlA in Utcha (Exattation) : Friendship with king; agricultural
income, wealth, landed property; company of brethren;
a m ~ n g i n g religious sacrVidal rites and tr3"tt'els to other places.
c) KUJA in Need'la (debilitatiOn) : Opposition from wife al'd close
relatives and servants; Ha\1ng to take inferior or ilkooked food;
loss d quadruped; loss d stiferings to brother; fear from
king, fire and thieves.
d) KUlA in Mooltrikona: Sweet dishes and drinks, gain of dothes
and ornaments; hearing scriptures; c:ortrol c:l mind; prosperity
to brOthers; agrlcultu11!11 gains of a high order.
e) KUJA in Swakshetra (own house) : Gain of land and money,
attaining profeSISionally a high position; happiness and acquisition
of oomfortable conveyance; eatring a nid<. name (as a matter
of repliati on); well being of brothers.
159
f) KUJA In S8tru Ksheb'a (enemy house): ATI OUKHAM (bitter
grief); quarrels and misunderstandings; anger of ldng;
opposition from own people; loss of land, wealth and friends;
fear frOtn thieves.
g) KUlA in AU Satru Rasi (bitter enemy'$ house): Troubles as a
resutt of enoovnters or opposition with higl'iy placed persons;
fear d theft; rear from fire and ldng; dise3ses like stone in
kicheyfbladder; piles, boils etc.
h) KUJA in Mitra Kshetra (friendty house): Friendship and
acquaintance with a Wge nurrOer of people; fear from thieves,
fire and king; disputes; losses in the matter of landed property;
fall in agricultvral income due to ra\fa9e5 d nature; troubles.
i) KUlA in Ali mitra Kshetra (CJ'eat friend) : Gain d land tiYough
favour ol king; gain ol dothes, cereals; marriage; sacrifldal rites;
initiation in Mantra; travels; good ludt from foreign places.
j) KUlA in Sarna Kshetra (equal's house) : Increased number d
guests at home; comforts with wife and children; servants;
also troubles
k) Conjunction with a debilitated plant: Mental distress to wife
and son; taldng up an Inferior profession; having to take food
from oth-ers; sufferings to v.ife and children; fear from king,
thieves and fire.
I) Conjurr::tion with an exalted plant: Happiness now and then;
gain of dothlng; ungent1emanly character; service to king;
trolt:lle to and son.
m) Conjunction with malefic (s): Committing sinful deeds almost
f!'lery day; adopting a cruet attitude to learned people and
animal s; causing troubles to one's brothers; adopting a
questionable dlarac::ter.
n) Conjunction with benefte (s): Some tittle happiness; sufferings
to native resulting in shrii"Qge of boct,t; disputes in connection
with property; victory in encounters; debates or academical
discussions; change In environments.
o) Aspected by beneflc(s): Gain of land, wealth and gold,
with the Goc:har Phala at the time the Maha
Dosa runs.
p) Aspected by BAHU OUKHA KASHTAM (-ties of
a high order); being d;scarded or abandoned by own people;
160
being die to wrath ol king.
q) KUJA in Kendra: due to polson; fear from tlieve:s;
opposition from friends and a string d troubles.
r) KUlA with l.tchamsa: Fulf illment of desires; victory in encounter,
happiness; Intimacy wfth low class women and mald-'servants;
honours from king.
s) KUlA with Neechamsa : Evil deeds and consequential
uneasiness; k:ls5 of wealth; fear from king; O'Uel nature.
t) KUlA with Sthana Bala : Ft.ll happiness as a householder;
establishing professionally a status and enjoying happiness
thereafter; fame.
u) KUlA vnthout Sthana Bola: Loss of position;
character ancl adopting questionable tactics In profession/
business.
v) KUlA with Dig VtbytJ : Gain cl wealth king; valour in
battle; gain of WNS, land, cereals and clothes; fame.
w) KVJA wi th Kala Bala : Success In desired directions and
endeavors; great happi ness; gain of dothes and studded
jewels; agric:t.lt11al gains..
x) KVJANaisargika Bala :Gain in position professionally; upset d
PITHA (bile) Inferior food; adopting questionable tactics;

y) KUlA wUh Vakratwa (retrogrbde): Great fear; from
tNeves, rw-e and enemies; 1/Wig In fores t or hill station or
seduslon; loss cJ position. But W KUlA has DIG Bala, favo11 cJ
king; good luck; happiness from friends, brothet"s; gain of
quadruped, land, c-lothes and ornaments.
(Note: There is a provertJal saying among Kerala astrologers that
during the Maha Dasa d a papa Gtaha In vakra, the native will be going
"""" and round plocos comparable to Ulot of o pot-rnol<e<'s wheel).
z) KUlA with KROORA SHASHTIAMSA: Various t roubles;
lmprtsorroent or bordoge (If In the horoscope); loss
of all paraphernalia.
aa) KUlA with SOUMYA SHASHTIAMSA: Beneficial
happenings; marriage; initiation; ceremonial sacrifiCe
161
(YAGNA}, bene\()lence towards atl.
bb) KUlA In PARAVATAMSA etc.: Great happiness; gain of
land, money, cereal s and conveyance; marriage or
auspicious celebrntlons.
cc) KUlA In KROORA DREKJ<ANA: distress; rear of being
lettered or imprisoned.
dd) KUlA in utcte but with needlam5a - Death of brothers;
fear from king ani troul::'es due to poison.
ee) KUJA in Neec.ha with utc.hamsa - Increase of landed
property; happiness with opposite sex; financial gains and
a number of frien:ts.
ff) KUlA in AROHA : Happiness; auspicious results;
appreciation of properties; acquisition of coral and
pred ous stones.
gg) KUlA in AVAROHA : Great fear; troul*s from enemies;
mental distress; loss of position.
hh) KUlA In Trlkona : The native will readl professionally the
highest position destkled In the horoscope; Interest In
stwy or books.
i) in Oushsthana (6,8,12)- Loss of position; troubles;
k>ss of or sufferings to wife, quad"4)eds and ctllb'en.
JJ) KUlA conjunct with S...-ya : Fear. grief. bitterness with
wife; RAAJYA BRAHMSA.M (having to qlit hiS place) and
having to live r. other places on acoount of fear from
enemies.
kk) Accordi1"9 to MANTRESWARA -During KUlA Maha Dasa,
there will be pr<:lessJon (Qr the native comected with
Rre; or serAce to king; gains throuc;ta King's favot..r or
litigatiOn; opportunities of using earnings
ttyoujjl deceivtlg others and various kinds of crud or
questionabl e tactics; upset to health due to PITHA;
contacts with women of questionable character;
trismderstandings with wife and children; trolbles arising
due to his own behaviour; interest in other's property
with an elM eye.
I) Acoordlng 10 VARAHA MIHIRA- During KUlA Maha Dasa
there will be : Win over tnemies-; help from brotherS;
162
income through agricul b.Jrt, blankets; goats; enemity
with temale merOOers and learned people blood disorders;
fev<t, upset of pltha, falls from a height; Interest In women
other than wife; l rterest in AOHARMJC KRIYA; use of
harsh language; fearlessness.
3. KUlA Maha Oasa phala based on the Rasi occupied by KUlA in birth
chart are as folows : -
MESHA- Gain of money; Increase of land; heavy incne;
defeat of enemieS; BAHU KEERTI l..A.BHAM (gain on a wid!
scale)
VRISHA8HA- Defeat cj enemes; Increase of land and happiness;
vk:tory in encounters; honour and presents from kln9-
MITHUNA - Gain d clothes and pre'llk>us stones; respect from king;
acql.isition of corweyance and increase in the drde d friends and
relatives; k'lcreased agrtcolt\nl Income and Quadl\4>ed.
KARAAT - Fear from and enenies; loss In the matter d naUve's
hOuSeh::lld property; sufferings to Children; lOSS d happiness.
SIMHA- c0fr'4orts of a high order; satisfac.tiOn of king; enthuSiaSm;
Increase of lan::l and agncuttvral procl.lce.
KANYA - gain d several benefits; fluency in speech; knowledge;
gains from brot:htrS and COI'fC)any of r&ti\ffS.
TULA- loss d selfrMpect; sufferings to wife and d'lildren;
agri oJturallosses.
VRISCHIK - Monetary gains; friendstlip with king; help from own
people and friends.
OHANUS - Gain of money tiYough the help of king and
placed persons; innuence in higher circles; prosperity to brethren;
defeat of enemies; h.JI'J1) sum 9'1ins and sucxess in erdeavours.
MAKARA - lordship; honourable position In public life; vtctory In
encounters; suca!:SS ., all &"ectlons and in all endeavOtrt; he8Vf
9'1ins regarding produce and gain of ever,thing desired.
KUM8HA- various troubles; l oss of respect; wrath of king; quarrels
Vtith menials and servants.
MEENA - gain of precious stones and clothes-; increase ol landed
property an:l agria.Jtural proclJce; knowtedge; honour in public.
163
4, KUJA f\1aha Dasa phala based on the Bhava OCCI.4)1ed by KUlA in
birth chart are as follows :
l.agla - OOSHNATHWAM (excess d heat); KAHTI HEENATHWAM
(loss <i lustl!t); ttoubles like pooc. bolls etc. Aglicultu'al tosses.
'J!'d 8hava - Great happiness; gain of money etc. protecting his
own family; command of spee(h; honour from king; fame.
3"' Bha..e - Oefeatd enemies; agri a.Atural income and fame; kin!tr
paraphernali a; enj:>-,ments c:l a h9' order.
4th Bhava - RAJYA PHAlA PRAOHA (professionally a high status).
Increase d land and property; opportunities of set'!Ace under high
officiols.
9
11
Bhava - L05S of property; failure of c.rops; st.Arerings to dlildren;
!'eat distress; anger of king; loss d poslllon; change of resldenoe
or place.
61h Bhava - Defeat of tnemies; lustrous body; kingly status;
happiness from family.
Bhava - l oss of Of suffeMgs to wife and son; tosses In the
matter d prosperity; fever and boils-; pox; troubles; agrlcUtural
losses; chan9f! of residence to an inferior lo<;ality.
$ h Bhava - MRUlYV PHALA PRAOHA (fear of death); fever, cough,
heart attadc.s and tumour.
g.h Shaw- Charities; acqUsidon of money; agricultural Income of a
hig'l order; construction d wets, tanks etc. for public use; doing
good to brothers.
111" Bhava - Success In desired directions; respect among the
public; gain of preCious stones; kingty paraphernalia; corweyance,
hors,es etc. happiness from many directi ons; performance of
oerernonlal saailces; Increase of prosperity. Prolesslonally a high
position.
111t1 Bha-4- Increase of wealth ind uding landed property; in,.,ence
In higher drcles; of and precious stones.
12111. Bhava -Fear of death; SrCNl due to death d equals; loss of
p-ofessional status and from toog.
, ..
BUKTI PHALAS IN KUlA MAHA DASA
KUJA BUKn = 4 months It 27 days
(a) The rorlowin9 are the effects or KUJA BUKTI in KUlA Moho Oasa
with reference to variOus vegas :
i) II bukti 1'0tha KUJA is., Kenct-a, trikona from Lagna or conjunc.t
l.agnadhipha :
Comforts; indisposition and laziness in the beginning d
the bukll; and happiness at end or bukU. Also dealings with
relatives on paternal side; opposition from brothers; favoU'S
from king; inc.rease of weatth and cereals.
i) If bukti natha KUJA is in Kendra, Trikona, 3Jd or 11
1
ll from
Lagna, exaltation or own sign:
Contorts from employer/master; opportunities of ser'lllce under
high offiCials; gain of coral and predous stones, red coloured
dothes; APOOfNA VASlHU SAMPRAAPTI (gain or something
unusual); defeat of enemies; success in undertakings.
iO II bukti natha KUlA is in Oushsthana from Lagna or in rnalefte
signs or In Ne<:hha:
Attack of great diseases; Increase of enemies of his own
commU"'ity; loss ol properties ard cereais; fear from thieves,
fire and king; death of equals; temporary separation from
relatives.
iv) II KUlA. is in exaltation Navamsa or 01 Nawmsa, or conjunct
or aspected by benefic:
Increase of properties and quadruped; success in desired
directions and royal favour; rruch happiness.
(b) The rollowl"9 are the SPEOAI. EFFeCTS, In addition to those
mentioned abo'le, if buktl natha KUJA Is conjunct or aspected by :
SURYA Sotrow; fewr; King's wrath; mental dstress; change
of enWonments or transfer.
CHANDRA Great celebrations; great happiness; success in
underta!OOgs; of relatives.
BUDHA d scriptures/ancient literature; decorations to
house; company d women of qu(!St!Onable character-.
GURU
SUKRA
SAN!
165
Good health; finan.dal gains; ntiMion ~ worstip d
lord SHIV A; success in saaifiCial rites.
lncrease of land and conveyance; honoor amongst
e(Jials; gain of dothes and precious stones.
Sufferings from rheumatic pains and gastric trouble;
ab'upt quarrels; lose d equals.
(c) If bU<d natha KUlA Is lord cl2"' or 7., from L a ~ a :
PARALYSIS and mental agony will res!Jt. The shanty for warding
elf this Oasa phal a is SUBRAMANYA JAPA and ANAOWAHAM, after
wtlk;h the native will enjoy gcxxt health.
RAHUBUKTI = 12months& 18days.
(a) The follovMg are the effects of RAHU BUKTJ in KUlA Halla Oasa
with refertnce to \0ri0us Yogas:
i) II bukli natha RAHU iS in Kench, Trikona (from lbgna) 11
111
with strength or in 1d with benelics:
Intimacy with widows; worship cl goddess OURGA; good and
chari table deeds; sacrifieecs; pilgrimages; happiness and
auspicious happenings to employer/master; happiness from
wife; defeat of enemies belonging to his own commll'!lty;
good health.
i) If bukti Natha RAHU is in Kemh, t rikona, 3 or ttth from Lagna.
Bath in sacred waters or RAMESWARAM; cf'lari ties; foreign
travel; trouble to people in wife's family; fear from thieves
whilst on tr.wti; royal favour.
In th! beginring of bukti : mdcling resutts. At end d bukti :
Gain of desired erds & comforts.
iO If bukti nat:ha RAHU is in Oushsthana from L a ~ or conjunct
or aspected by malefic (s) :
Fear from thieves and wire; defeat In encounters;
imprisormert or bondage or punishment from king; clseases
like consumption and troubles from wind and bile.
lv) If bukti natha RAHU Is In Dushsthana from Lagna or In
debilitation:
, ..
Foreq, travels; abortiOn to wife; loss d or sufferings to sons;
losses in business; trol.ties from spirits and diseases like teprosy;
epilepsy and oltler bodily troubles.
In the beglmlng or dle buk11, plenty d h<lpplness and setlous
t.roOOies at end d buktL
(b) The following are the SPECIAL EFFECTS, In addiUon to dlose
mentioned above, if bukti natha RAHU is conjunct or aspected by:
SURYA Sorrow, quarrels, troubles & diseases in stomach;
deilflm.
CHANDRA sufferings in mother's family; sorrow; loss of respect;
k:ISSes and lOSSeS d land.
BUDHA
GURU
SUKRA
SAN!
Sufferings from wooods & ulcers-; failure in efforts;
quarrels and
Contacts with other's wives; benevokmce towards
brothers-; success in all enctt.awrs..
Studk!S; gain of finance and quadrupOO; enjOyment
with a pregnant woman.
Gain of clothes and conveyance; great happi ness;
celebrations like marriage etc. on a laf'9e scale.
Sufferings to brothers and reladYe:S; blxlily troubles;
Loss of position; fear frcm king.
(c) If btJ<.tl natha RAHU Is In Kendra, triltona, 3 or 11 from f-1aha Dasa
Netha:
In first 6 months of buld:i : Fear and loss of authority and sufferings
in the matter of ptOperty and finance. Thereafter : g-eat happines5,
favours from king: finandal income; tnlvel to west; success In
undertaking.
(d) Ir bulcti nal:ha RAHU iS in OuSh.sthana from Maha oasa nathb: or
oonjura maldk (s) :
Fa l ure in urdertaldngs; loss of parents & brothef:
(d) If buktl Natha Rahu is or from Lagna
Feat d death. The shanty fO< dlls Dooh phola Is MRUTYUNJAYA
JAPA and gWing lfWi!/'f of a b!Kk buffalo by Wi!l'f of 'DAN' after
wl\lch dle nalfve wil enjoy good health and prosP<tlty.
Cliapter 8
Impact of !Mars
A retrograde Mars, anywhere in a natal chart, indicates that the
Individual either lrisused or neglected the use of the energy which Is
always resident in the Mars influence.
The energy of Mars is usvaly directed Into either direct,
aggressive action in li fe, or into the areas d sexual gratificat ioo, te!'lller.
or vtoaence. The bcation d the retrQ9Clde Mars, acoording to house
position and sign. 'h'OUid differentiate what of r-1ars would be
emphasized and what qualities would be negated. Often, house
JXISitlon and sign lnwlvement tend to stress certain qualities of a planet
more than others, and this Is where correlati on and diso'imlnation enter
into the delineation of the planet, whether direct or retrograde.
Negative ch.aracter traits of Mars could Include an
an over-sensual character, a rash, violent temper.
Negattve Mats, retrograde Of direct, btlngs an offenstve natll'e to the
naHve of the chart.. who would also be prone to accidents. It
emphasizes coarseness, impatience and irritability.
First House: Retrograde Mars, negati vely asped:ed, makes the
Individual too aggressive, boastful, temperamental, subject to
emotional f\areups, and very combattve In his relationship with others.
Here, the sign wolld demonstrate the type of personality developed
through past incarnations. The personality represents the outer self;
here Is how the WO<Id views the Individual; thus, the retrograde Hats
tell s that t he personality, in the past, was misused in developing
negative personality traits which woul d exhblt themsel ves In this
lifet ime t hrough viol ent reactions, Impulsiveness of action, quick
, ..
resentment to what other people think and Sl1'f to the the
restloe:SS and, indiscriminate: W<!lste: r:l energy, whiCh could
be channeled lrto negative sexual drtve and practices.
All d the personal actions and reactions from past llfeUmes are
going to be repeated in t hi s lifetime, and t he tendency i s to be
in action. contiruously for the same thing that tM
lndtllkfual fought for befOte. Naturally, the same troubles, Identical
pef50na\ problems, and the same arguments will be repeated.
This energy of retrograde Mars couk:l be both e-reative and
proaeative. It could inclcate a ptrsonality that was vy muc:h ewer
sexed in the past.
Second House: Retrograde f.1ars sh:>ws the: laCk or development
of values In the past,. a tack cl al)p"eclatfon for things, for beauty. Too
much attention, in the past, was put upon the drive for security and
material possessions; the tendency to diSplay 'f'OLr su:cess to others,
often In a gau:ty, showy fashion. This couk:llndlcate a l ack of good taste
in the past
Uncloul:ledly, the nati\le r:l the chclrt with an afflicted, retrograde
Mars here cheated, and could have used mderhanded techniques to
obtain success ard aocunWte material wealth.
Mars posited in the r' house, direct or retrograde, scates that the
Individual has the abl ity to make money. Its aspects ard retrograde
conditions wotJd clarify how he made that money. A negative Pluto to
retrograde Mars would tell that the lndiiAOJal had been ln..olved with
criminal, syndicate activities In the past and woukt possibly be so
involved In tNs li fedme, whether consciously or unconsciously.
It also tells that l<90<les, in the past, ._ ..,used and, so, in this
lifetime, the subject wouJd be cheated out of tegades or deni ed
legac-Ies because of the negative qualities emphasized by retrograde
Mars. These (Jialftles would offend those who rrigl'i:, rormal y, lnc:l.Jde
the in a will but. because of the rastmess of tis personality, he
wouJd often rn:t himself elil'fllnated, or not mettloned In a will, or OJt
out of the will ertlrely.
...
The l esson of a retrograde r-1ars in t he 2"" house i s t he
constructive use of t he energy drives to ZtCquire mattrial sec:urily, but
vefY Important wi th tlis would be the pi'Oiosophy cl the use cl these
material possessions.
Retrograde t-1al'5 in the 2n1 house cautions the individual against
selfadvancemtnt M the expense of others. By concentrating on
security t hrough his own efforts and not by depending on other
or other people's needs, thev can be self-made successes.
Third House: Retrograde Mars shows there was a very poor
relati onship betwetn t he nati ve of the chart and his brothers and
sisters and other r&tiW:S. It Shows ttw! type: of indM<lJal who lacked
sel f-<ll scipl lne and, thus, was a probl em In any structured social
organilati on, such as the community or scl'>ols. This would be \tie
problem child i n pri mary and secondary school The person
would resent being told what to 00, would resent teadler supetVIsioo,
would resent any time schedule of wrork that wovlcl need to be done
at any spedriC time. Retrograde Mars Shows the l.aek of diSCipline from
the past,. whether it Is educaUonal, religious, social . This would be
the type or child .t1o would be the "holy terror' or the neighborhood,
reluc:tant Surday School student, the resUess trouble--maker in a
school system.
The retrograde condition also Indicates that the person did not
communicate well In speech or writing with brothers and sister s,
relatives, schoolmates, teachers, neighbors, etc. In this IH'etime, the
person woul d be In a constant sea of confusion and chaos, always
figtting wit h those around him. He used all these people in t he pa.st to
his own advartage and_ so, in this lifetime, would find that he would be
much disliked by relattves and others oltSide or the family orgarilation.
The lesson of reb"ograde Mars here revol...es around self-disdt-fjne,
channeling of the mind irto mental such as science, math, or
anytN'9 that anatysis or in-depth pursuit. The needs to
develop patience and djpomacy and shc:llld guard his wordS and what
he writes.
170
Fourth House: With retrograde f.1al'$ here, the negative
brOught from the: past woUd centtr around the f&et that the in:UviclJal
was a father Image in past lifetimes, but was dotraneerlng, aggressive.,
even O"Uel. The home ewironment would have been harsh, re$l:ril:tive,
dtspotically controUtd. The person was an autocratic ruler of the
home. with llttte or no consider atJon for the rights and privileges of
tt:>se within the home circle. He would not allow any differences of
opinion; he was a disciplinarian to the pOint d being unreasonable, he
wanted everything his own way.
Slru this squares the t
1
house of personality, the same
character trait demonstrated themselves wherever the person went.
He auric ftdd of this iMivic:klal would have been tharged with vibrations
of theSe negative traits and. ttus, anyone who into his sphere
of would react to ttlese traits ard/ suffer because of them.
Remember t hat our auric fteld ard our phvsical body represent our
"home" in this lifetir'n!.
The: native of the chart woUd be subject to an irate father (his
rettlbutlon), Insecure, unstable home conditions, and a home
en\licorment whi ch wo!Jd be chaotic and urilapp,'.
Since the Moon i s the natural rul er of the

house, the
retrog<Kie Mars relates to karmic debt d the native to the mother,
whom he neglected In the past, to whom he was ewn physically
crvel.
Tt'e lesson retrog'ade in the house obliges the native
to provide the necessary environment factors wtich would produce
good home conditions. These factors wouk:t Involve not onl y the
material features of the home, but al so the correct atmosphere for
happy home existence. This must be done, regardless cl whether
there is arr,t obvWs appreciation or not.
Fifth House: Retrograde Mars here woul d stress three p0rticular
affaitS of the house: l ove affairs, child rtf\ pleasure.
In l ove affairs, In the past, the in<lvldual used members of the
opposite sex p...-ely for selfgratifteation. The s..btle Influence of Leo, as
m
the natural rUer c:l the Sill house, i s felt here since Leos have to
dominate, the retrogradt Mars in the 5
111
hOuse assumes some d this
quality of dofflnance from the leo. In any love affair, the retrograde
Mars shows that the inclvidual had to be the dominart. one. lt squares
house, ruled by Taurus, $0 th3t the animaliStic nature cocJd also
be part: of the probtem carried rNer from the past. Be especiall y aware
of the planet aspecting retrograde Mars here, for this wovld condition
the type or sexual practices and/or perversions. Unusual sexual
practk:es, rape, homose.waUty, lesbianism. ctlk:l abuse sexually, can all
the determined by the planet aspecting retrograde Mars and the sign
on the cusp.
As far as children are concerned, the retrog-ade Mars did not
appreciate children in the past, was i n..,ati ent, t(!"l!tramtntal, and
cruel (ctild abuse). If retrograde Mars Is In a barren sign In the S"'
house. there would be problem in ha-Ang children in this l ifetime.
because of the lack of appre&tion a the ab.Jse of the ctlikten in the
past.
In the pursuit of pleasures, retrograde Mars In the house
showed a terdency to pursu-e those pleawes which were coarse and
common. marry or them related to sexual driveS. Since thiS positia'l d
retrograde Mars Is dire<tly opposite to the 11 house d friends and
social activities, they would center arourd these negative trai ts. The
woul d be attracted to of similar nature, woul d be
lntetested in siriar purswts as practiced In the past.
The te:sson to be leamed with retrograde Mars In the S" house Is
the proper channeli1'9 of the energy, In re&Mion to affairs, children
and pl easurable pursuits, consideration for ethers, sincerity or pt.Jfl)ClSe
and moti'Ve, and creative aalvlties, 'htlich should charac-tetlze the
attempt of the rrctive to this retrograde Mews i n the
house.
Sheth House: Retrograde Mars in the fJh house relates mainly to
health, the publiC. and working conditions.
Heal thwise, in the past, the indivicl.Jal enjoyed good constitutional
health, was physi cally strong. etc. It show that he dissipated the
172
enovv and neglected the health. The care of the txxtv represents a
province and obligatiOn given to us by the cosmiC, tor the should
evolves through the experiences of the physical body In life. It
rep-eserts a dla1'9t which we must handle well. In the past, this was
neglected, so the indivi dJal woukt suffer ill heatth and be acddent
prone In lffetlme (ched< lhe sign on the rusp).
Negative planetary aspects to retrograde Mars in the ff" house
would indicate what ailments the native would be sWje<:t to.
Publicwise, retrograde t-1ius tells that the individual was
contemptuous of public opini on, public needs, pubrc wants. Again, it
Shows that tl'le: person used a positiOn. or any position, for self
adancement. He lrdlvlcllal did not hold his oo-workers, or those who
wortc.ed for him in high regard and did not a healthy rapport
wit h either group. Again, the CJJ&Iities of negative retrogradt!! MllrS and
Indicate what type of relationship was established (temper, vtolence.,
etc.).
This c:otAd also be the incivi:klal who mistreated arimals in \tie
pasl
The lesson to be learned wit h retrograde Mars in the 6ltl house is
to be aware of the physical condition of the body, b!.l not to overdo it
(Virgo is the natural ruler of the 6-m house). The swing c:1 the pendulum
could bring the individual to the point or becomir,g a hypcx:honctiac if
he permits the VIrgo trait to Proper diet ard proper exercise
should be practiced. Tact and dipl omacy shoul d be developed In
creating harmonious drOJm.stances between t he nati ve and f'lis co-
workers, between the native and those who work under him.
Patience, respect for others, and servi ce wkhout hope for reward,
should be the clrection c:l retrograde Mars energy in the house.
Seventh House: Retrograde Mars here indicates t he native, i n
the past, u;ed any form d marriage, business or life itselt
for selfadvancement. My partnership had to revolve around the
petSon's will, desires, Interests. There was little or no consideration for
these quafities where to hers were concerned.
m
Marriage (X)Uk;t easily have been entered into purely from a ph)'$ical
anii'Miis-tie drive. TI'M! partner would Nlve been merely a vessel for self
gratification of t he natl\'t, The relationship wotJd have been violently
emotional, cwerpassiona(e, The aspects of plonets to
retrograde Mars: here could indiCate oousual sexual practiCes in the
marriage, urusuar marital utions (homosexual, tesblan, ao.Jitery).
Buslnesswlse. this petson would have been extremely aggressive
and domineering in a business and, again, depending on
the sign, migtt have not too honest reliable in partnerSNps.
1Ns person could easily have cheated a business partner, because Mats
does rule theft. ln this lifetime, disharmony wo!Jd exist in partnerstips,
bringi119 loss, rruwotion, disappointment.
The lesson to be leamed with retrograde Mars in the Jlh house is
consideratioo for othS, honesty, and sincerity in partnerships d any
kind, and that the physical In should be tempered with
kindness, consideration, and thoughtfulness. One's attitudes towards
life wot.Jd have to be revised and more attention focused on the search
for (Mars- So>rplo - 8th house affan).
Eighth House: The necessity for t he transmutations of
retrograde Mars qualiti es is especially pointed out by its location in the
fF house, for this is the natural position of Mars, since i t rules the k:rwer
octave of So>rplo, and So>rplo rUes the 8 .. house. The position doubly
emphasizes the affairs of the house wi ttl retrog"'de Milts. It stresses
the KMma involved. Since it is al so the house of regeneration, the need
for the transmutation of the retrograde Mars qualities Is doubly
stressed.
The retrograde Mars, f rom past lifetimes, shows t hat whatever
ended f or t he indi vidual, whether a job, a frienclship, or life i tself
(death) ended vi ol ent l y, wi t h much confusi on, resentment,
Impulsiveness, and emcxlon. In other words, the person, In a past
lifetime, would have ended a fri endship though an argument, would
have l ost a Job because of temper. wtlk:h resulted in inability to get
along with <Xhers, and dealtlltself could have been Involved with much
suffering and pain.
174
It shows, also, t hat in some activity of past lifetimes, he misused
other money. This could haY! been the conartist of the past.
cheatklg widows and children. using p!.bllc funds for tis own benefit. It
shows that the individual, in the dim past,. in\(ltved timsdf
i n a negati ve search for truth. Thi s could have i nvolved him i n
destructive orgarlzatlons such as "Satan's chil dren*, witchcraft, blact.
maljc, etc.
In this lifetime, the retrograde Mars woul d bring t he indMclual
simi lar txperi ences in the manner in which tNngs end ard the samt! in
life, friendships, jobs, ett:. There would be marry teff1)tatlons put In his
way to test his honesty ( Treasu-er of or9'1nizations, etc.). The person
woul d be attracted towards the ard phenomena aspects of
metaphysi cs, astrology, etc. and would have to exerci se much
dls<rlmlnation as to the soutte of tnth.
The 5esson of reo-ograde Mars in the Is the development
of respect. sincerity of motive, honesty. Throf..9h the use of tact and
dipl omacy, an t hings woul d end more harmoniously, and more
benefldally for the ln'o!Oivement in orgarizatlons whlctl are tn.ty
metaphvsical and constructive in their search for truth would transmute
all of the qualities of Mars, and e...en resutt in a protectiVe'
spiritual energy for the end of life.
Nl nth House: Retrograde Mars here oould Imply an ln<IW:Iual who
practiced reli gi on either so dogmatical ly t hat he wouk:l grant no one
else t he r i ght to his own opinion i n religi on, or was militantl y
Much here depends on the planets aspectlng it and the
signs in'o!Otved to determine which of these two it would have been. lf
i t were t he religious dogmatist, t hrough careful correl ation, the
delineation of thi s retrograde f\1ars coul d indicate a person who
religkx.lsly persecuted others, who oouk:l easily have sat on the Court
Bench of the SJ)i)nish Inquisition, t hus inlJosing physical violerce upon
who differed in religious beliefs.
The philosot.f\y of life was undoubtedly a strong, aggres.sNe, and
offensive approach. Again, the in<lvidual was self-<lentered, with ittle
considerati on for other people. It woul d show i mpati ence and
17$
impU:sivel'leS$ in any ed.lcational pu"SUit.
Siru it squares the 12
111
house, the retrograde Mars would show
that thl'! through impul Sive and irrational acti ons, was
confftd. Aanetary aspects and s9\s woukt de.&e whe(her ltlis was
prison, mental institutions, hospitals, etc. A negative Pluto to
retrograde Mars woukt involve the c.riminal act, resulting in prison
confinement. Negative uranus or Mercury could Involve mental
distvrbitnces.
Tile lesson of retrograde Mars in the tJh house i s to respect
opini ons and beliefs of others, to acquire a workable, practical
philosophy of life whiCh cotJd be: applied to tveryday to
broaden the person's perspecUve In educational pUI'S\Its, to tlnd that
balance between enlightened freedom and the rights of others, to so
conduct oneself t hat t here would be proper values mentally,
emotionally, physically, and moralty, thus averting any danger of any
type of confinemert. tt also irrc>fies the alignment of the energy of Mews
with the higher self, inwlving tht! ChriSt prirx:iple..
Tenth House: Retro!J'ade Mars here would indicate that, in the
past, lhe Individual flowed from job to job, did not assume the f\JII
responsibility d the job req,,Jiremert.s, misused any <Mhority grar(ed to
him in his job, stressed too much the material self-advancement of his
profession - In other words, net what he could do for the job, but
what the job could do for him. This could easil y have been a ml itary
person in the past, achieving honor in battle or in military affairs, but,.
tegardless of elthet being in the ml ln>ty seMAce or In a professlon, 1ne
violent temper, the impi.Asiveness, being sel f-opinionated, caused the
individual to l ose prestige and respect from those who were his
superiors. Honor was a supetfldal qualty, practiced onty extemaly. It
could in<icate thot lhe lndMdual was lnvol""" in govenment pooilions
where statistics mig,t have been irwotved, or analysis, military affairs
and supplies. He could Vf!lV easily misused these for his O'o\ln
advMtage, even to the point of thievery, wtile pretentlng to be a
paragon of virtue. This could be the COITUpt government offidal,
especialy if Nepb.Jre is negative to retrcqade Mars.
178
If this were in Scorpio, PiSGeS or Gemini - <xnJd tlis not be the
pottntiblly great surg(!On or physiCian who diSregarded philosophy
of the Hippocratic Oath, seeiOOg only sell-promotion and fame, rat her
than true service ? Very it would indicate the sadistic surgeon
who would witholt any anestheSia, etc.
The lesson of retrograde f'.1arS in the

iS oortinui ty of
effort, steadiness d purpose, honesty In mottves. Fame and honour
should be side dfects rather than the 9Q(IIs in the professional drive.
Advancement in position and r espect b'f superiorS will effect of
the ptaafce of au d the abo\'t.
Eleventh House: Retrograde f'.11JrS in 11" house sh:>ws that.
In the past, the enjoyed the friendship of Inferior types of
people, crude, coarse, unrefined. Perhaps too much attention was
on the extfmbl of friendS an:l socibl activities, rather
than the tMJe meani ng behind them. Again, depending what
planetary aspects and signs are there, the nature of the so<:ial activities
could be: dearly defined as to whMher they are sexU!II activities, wild
dM!Mg parties ell:.
Retrograde Mats r. Pisces would place l ittl e value on friendstip
itsdf. If it were in l.eo, t he retrograde r-tars would show that t he
individual d'lminated friendS, oontrolled friends, dictated to them and,
of OO!SSe, this raised resentment. If .-. Cancer, t he retrograde Mars
shows too much emoti onal involvement with f riends, too much
possessiveness where they were ooncemed, too m.Jch involvement in
ltlek' personal lives. l f i n SCOrpio, retrograde Mars Indicates the Individual
hek:l most rJ his fellow man in c:ontempt and was extremely snobbish.
The lesson of retrograde Mars In t he l l lfl, house requires t he
transmJtatkm of social activities and social irwotvement constructhely,
morally, spi ritually. It requires that the persoo ac(fJire true values where
people are concemed - to use frtends, not to abuse them.
A native with retrograde Mars i n the house should never
associate with inferior types of peopl e but, at the same time, must
understand that these people, too, are evolving in t hei r own way.
They oould very possibly need !tie direction that the person with a
m
retrograde Mars coul d provide, rel'l"'aining de<ched, however; from
dOse inv<Wfment
Twelfth House: Retrograde Mars Mre i ndi cates, from tM
viewpoint of healltl alone, since It is opposite the 6"' house. that the
individual was tis own worst ene'ITf in the past. He did not know how
to constrve his energy in the past and assl.llled mae than he could
properly handle. The tendency was to o...er-exhaust himself and go on
nerve energy, to the poirt. c:l near collapse. If l.eo were on the wsp of
the house, it stresses the arrogan::e of Leo, the puShiness where
the i ndividual has to be the center of attention, and these are the
inner drives and energies that we are involved with.
TNs Is the house of the true soul and a KiNtna. The purpose ot the
energy of Mars is to provide the power cc tile motor energy to
col'@ with li fe and to expience ard to evolve. It Shows that in the
past this enetgy was ft'ishanc:Ued and thus Karma was not out,
but more accumut.ated. The person failed to meet the challen9'!s of
life. He cld ntt use hiS know1edge and experiences in service to others.
In this lifetime, he would be Inwardly very Impatient, slifer many
personal frustrati ons and disappointments, and would find it very
difftcutt to acNe...e full s8fexp-essia'l.
The lesson of Mars in the 12th house is to learn tu.rnility,
to be of service to others without seeking retum, to correlate the
inner-self with the outer setr, as a unified whole.
178
Cliapter 9
!Mars - 'Jiarious Houses in
(}Jfzriou Nadi
Method of judging wife' s nature fro m male
horoscope:
Mars + Venus + Sun : Q J ~ e n like fortune, proud by nature,
does not expect rebufRng from anybody, Inclination towards
stvbbomnes5.
Mars + Venus + Moon : She will be intelli gent, interested in
traveling, her husband undergoes change of pl ace and enjoys
prosperity ttrough traveling, she Vtil have artistic nature, sometimes
adamant, she will have to encounter troubles through some elder
females in the family quarters, scmetimes her husband's b'other may
become a cause of trouble to the nattve, she will sen i/Wll'f one house
property and busy another one.
Mars + Venus + Mercury : She will be calculative, she can
control her huSband. she would not allow her husband to go in bad
ways (that Is she can control him), quite Intelligent, suffers In
educational career (but later on continues), wil have brother/sister,
generally she does not like quarrelling, but should it come to it, she
would not hesitate to expose others, she will be quite a fair looking
native.
Mars +venus + Alpiter : F looking, slmrlar type, if she starts
quarrelling she can swallow a battalion, adllmant., If she minds she can
,.,.
do a lot r::l sac::ri fice, otherwise she would l"()t offer even a cup of water,
at one stage d life: She: becomes dejected d ending her life:, She can be
helpful, but people who receive hefp from her hands may become
11ouble shooters tx> her.
Mars + Venus+ Satum: She wil have average fortune, average
eduGatiol\ sometimes a bit lazy, She: looSeS temper when advised and
she wi ll become further lazy, suffers due to excess of heat and its
problems.
Mars + Venus + Dragon Head : Generall y 9ood t\illtive, fair
looking, sometimes harsh in nature, suffers due: to tack of disaetion.
Mer marribge her husband ITIJst be carttu vdli! using vehicleS, her
husband sllfers obstructions In car-eer, she wffers from rheumatism.
Mars + Venus + Oril90n Tall: She will be short tempered,. an
angry type, bvt fair lookirg, she wil make a mess, if she is irritated by
her husband.
Method of judging husband's nature from female
horoscope
Mars + Sun + Jupiter: Regardllg his prosperity )1st average In
beginni ng, later on enjoys influencing factor (90vernment fields),
enjoys p-ospity, a man of pride (tgoistic), he wants to see that
nobody rebuffs him, short tempered, enjoys good status (than many
other members rl his family), likes tx> associate wf1h big people enjO'(s
respectabitity, honolr in social circles, thet"e wit be people for hi s service
at his back and call, tnjCY)'S vehiOJ!ar respect 8ders, if minds he
can help others to any extent (other'Yt'ke not).
Mars + Sun + Satum : Enjoys a good career with good eamlngs
(anyhow, upto 30 years of no si gnifiUtnt improvements of
prosperity), generally a fortunate:
Mars + Moon + Juptter : He: wil have artistic knowledge, he
enjoys prosperity after marriage after some change of place.
180
Mars + Moon + Venus : Generall y a 9QOd native, intelligent,
fortunate, wi l have artiStic nature, can be an architect, a financier or
dealing with luxurious goods, artides of beautification as career,
capricious by nat11e.
Mars + Moon + Satum : Although a good person, not a proper
duty-mirded nativt!, unfortunatety givt:S up r.w opportunitieS in life and
finally Involves In some sort of odd jobs, sUfers blemish oonecessary
accusations.
Mars + Mercury + Jupiter : Her husband wil be intel igent, will
have good edu::ation, enjoys respectable career, enjoys social status,
will have assoCiatiOn with l eam!d pJple, by natt.e an perSOn,
besides genetous and although there may be l\4)tures In family, be can
set right such problems with his capability.
Mars + Mercury + Saturn : Husband will be an intelligent
person. enjoys 23 sources of earnings, indintd towards commdi!ll
pursuiiS, enjoys prosperity.
Mars + satum + Jupiter : Husband can have his career either as
11"0nager a teacher, guide, engineer or such eql.ivalent career enjl7t' a
respectable career.
Mars + Saturn + Dragon Head: she will be a good
wife, stin he cannot en):>y slgnil'icant prosperity, some times he will be
lazy; sometimes, lnspite d haid woti<, no adequate returns, advisable
to perform every day meclcation of l ord Shfva.
Mars + Saturn + Dragon Tall: Husband will be a fair looking
one, generally good man by nature. But does not care for advice,
cannot enjoy any specifiC career will have knowl edge In tailoring,
weaving, but whatever he goes for work, he returns after qUilrreling
there, hence not guaranteed career to her hl!Sband.
Mars + Jupiter + Dragon Head : Her husband will have
activities In a tig concern he will be adamart by nature, ruptures In
forri ly affairs prevails.
Mars+ Venus+ Dragon Tall: Husband will be a fortunate one.
,.,
enjoys luck and luxury, enjoys vehi cul ar (c-or) gains, but rupture
bween huSband and w;re: in family affairS and Kuja Rbhu
Sha11thils a trust ror enjoying a rair, hOPPI' family lire, Maha Laksturi
Pooja is essential.
Mars + Saturn + Dragon Head: Husband will have aueer
to photography, computers, machinery sides etc., a
fortunate native In general.
Mars + Dragon Head + Dragon TaU: Note: Mars In a particular
sign wit h OragonHead and no planets in any successive signs upto
Dragon-nil, after for a period d 9 years her relationship with
husband not fair.
Mars + Dragon Tail + Sun: HuSband will have inclination toward
splr1bJal llberatJon, enjoys governmental lines.
Mars + Dragon Tall + Moon : Her husband will have spiritual
liberation mind, will have renl.lldation in li fe, capricious by nat\l'e and he
m&y ketp himself from family.
Mars + Dragon Tail + Mercury: Her husband will be intelligent.
will have literary knowl edge, her nature v.il be su::h that moon rays
be falling on her house orly.
Mars + Dragon Tall+ Jupiter : Her t'usband comes from a good
famity, will have indination toward$ divinity, helping nature.
Mars + Dragon Tall + Saturn : Her husband cannot enjw arrrt
signifialnt or specifiC career.
Mars + Dragon Tail + Dragon Head: Husband will have
Inclination the path of liberation and satvatlon.
Flat & Fortune of wife through male Chart
Mars +Sun + Venus: She will be generally good natured, wll be
a courageous one, will be egoistic {proud nature), t here will be
182
rwtures in famil y life, she will be in need of guidance '*'iloSQPiically.
Mars + Moon + Venus: She will be cap-icious by right
from tM beginning, but anytla.v, gfne1111 fcrtunts are just fair.
Mars + Satum + Venus : She invotves in tove affairs, later on
marriage, anyway no fair happiness In farrily affairs, she needs fair
gl.idcu-ce. if she is treated well, husband can enjoys some benefitS,
not. she wil have caretr earrings too, a selfboosting (!=fide)
narure, she may not be obedient to husi>Nid.
Mars + Moon + Saturn : (both male,ffemales cases), sht may
not have n"l.lch liking for her husband, although she is fortunate one.,
for such natives marriclge itserf is a difficult ta$it., if marries, no happiness.,
career (both male/ftmale) will not be satisfactory, alSo they wotJd oot
be prepared to accept anybody's advloe.
Mars + Mercury + Moon: (Mate/female natives), between
husband and wife no lildrgs, she thinks she need l"()t depend on her
husband and M ttir*s he need oot depend on his wife, anyhow but
both of them may be suitable to do social services, will have their
pleasures, happiness outside their family
Mars + Satum + MerciM'y : (Male/femal e natives). To put it
precisely marriage is not at all advisable for such combi nation, {better,
astrologers advlc:e h precisely).
Mars + Moon + Dragon Head : She can be a good wife, but
unfortunately, her t'l.lsbard will not have qualities to avail her gooc:hess,
he cannot maintai n her properly, but lnvotves In vices (liquors etc.),
besides, he will be cuH'ing and suspicious on her and make famiy life a
hell.
Method of Judging Husband's career though the
oomblnatlon of planets
Mars + Sun + Mercury: He will sportive by nature, will have
IBJ
traveli'9 career in commercial lines, connecti"9 governmerc..
Mars + Sun + Jupiter : He will be courageous, enjoys good
reputation, an able administrat or, reputation in govemment circle/
society.
Mars + Sun + Venu,s: Enjoys beneficial aspects through wife's
side, faWiooking, enjoys a luxurious life.
Mars + Sun +Saturn : He will hcwe a governmert. career, enjoys
benefiCial aspects throug-a governmer(al channds.
Mars + Sun + Dragon Head : He is generally good, but
behaves like a 'doo't care for anybody master'. A fearless
nattve., enjoys gatns In elearonk/electrk:al cateer.
Mars +Sun+ OrasJOn TaU: He hails from a divine oriented family,
enjoys profitability in governmental career, enjoys social and political
name and fame.
Mars + Moon + Sun: He will have career in g:>vernmer(al sides
In different places (subject to transfers), looks fair, enjoys respectability,
enjoys golns (profitollillty) in dlstont/differer< plooes.
Mars + Moon Mercury: He wll be a good. attractM! person and
a good speaker, does not believe t hat he has to depend only on his
wife, enjoy profitability through green lands, food p:oducts, a bit liar,
wil l have artistk: knowledge, will have Institutional powers, will have
forelgli:Javel in business activities.
Mars + Moon + luplbor : He will be lntdllgent, suffers
impediments in educational l ines, still a OOIIiad felow, enjoys opposite
sex enjoys forek)'\ honour.
Mars + Moon +venus : Gener&lly 8 good fellow, blt will have
suspicion on his wi fe, earnings through artistic lines, lux11lous materials,
does not care to work hard, but ma}(es money exclusively, will have a
little che&tlng nature, enjoys financ-Ial facilities through foreig n
transaction.
184
Mars + Moon + Saturn : Suffers due to bad association,
su.spi dous by nature, would to hiS wife, only vdlen he is
whimsical (not always), wolJd not care to wor1< properly/steadily In any
place, a wanderer, a rolling stone type, C}etlerally inviting (asking for)
quatrels, suffers accusations, h.&ving career in different/distant
places.
Mars + Moon + oras.on Head: His career connecting O'laya
(shade/photo) artistic lines are beneficial, will ha\le traveling aspects,
will have (connecting) career in machinery, tectwlical based career,
wishes to bum lhe nid nlgtt lamp (a late night worker). Sometimes
behoving very foolisNy.
Mars + Moon + Dra-gon Tall: He will be a 'brass cared' type,
indiscretionall y listening to others ad'-'te, not a steady mirded one, but
sti ll will have some qualities of righteousness (Dharrn..a-Karrna), enjovs
pllgltnages, he cannot enjoy S>Jftldent conjugal bliss through wtfe, In
fact, his itself will be a difficllt task, and the result of tnarrii19t
will quarreling on and often (no pe3Ce of mind. due to
restlessness), sometimes becomes a prey for opposite attractions,
sufferin9S to beneficial aspects.
Mars + Mercury + Sun : He will be respectabl e one,
inb!ll igent, before marriage involvement i n some love affairs, later on
marries.
Mars + Mercury+ Moon: Before marriage will have affairs with a
girt, later on marries, enjoys c:ommerdaVartistlc based career, attractive
speaker, soft spoken (before marriage due to IOYe affairs, suffers
accusations, l ater on the aspectfng d marriage come:s Into J)ieture). An
amorous type (Rasika), will have good grasping facul ttes, although
suffers breatc.s i n educationai iWles, still comes up wei by intelligence.
Mars + Mercury + Jupiter: AA educated one, etridency in
managerial posts will be good in accourn (Head Aa:ountant) will have
commercial based concern, will have opposite sex affairs, but keeps
them secret, en;oys p-operty, good financial positions In the sojoum of
life.
IllS
Mars + Mercury + Venus: He enjoys good financiol position,
enjoys l anded property, enjoys benefits through opposi te sex
lnwlvements (aspectlng financial one). He will have more affection on
sisterinlawS/other females, rather than on his wife. If the moon is
assoCiated with the above plbnets or if th! Moon ts in 'P', "'P' or 9"'
aspect to Mercury and venus, they will have some opposite sex
i nvol vements. He enjoys commercial c.areer based profitabili ties,
intelli gents, rupture between huSband and wife will be ine..;table ( but
anyhow they would oot fall to live together), and if Ns wife does not
treat him smoothly he wo\Jd not hesitate to have another adjustment
(so shf! must be careful and patient white Sl..tCh type: rltuSband), he
looks a pious one.
Mars + Mercury + Dragon Head: Generally an intflli gtnt one,
b4A a bit featfut afraid of opposite sex relations (he would not be
prepared to clle to such affairs), but sometimes darely
enjoys opposite sex relationS, b.Jt there wil be disappoirtments in life.
Mars + Mercury + Dragon Tail : He will have as: a
Oraughtsman, will have knowfedge/career aspects In law, .,telllgent.,
opportunities to become high level od""ristrating officer/lAS good.
Mars +Jupiter+ Satum: Her husband enjoys good position in a
large establishment and gains geat reputation in after marriage.
Mars + Venus + Saturn : Regarding career, her husband will
have normal fortl.l'le and aft:er marriage gains fatr positlon in his career.
Mars + + Dragon Head : The native's husband will have
attractive petSOnality and sometimes emotional. Regarding career gains
computers, irt:erior design wortc.s, he wi ll enjovs
valuable vehia.Jiar gains, besides luxurious good, possessing luxuriol
mansions.
Mars + Venus + Dragon Tall: Husband will attractive,
possessing secret t reasure of knowledge and quarrel s between
husband and wife would be inevitable, but such quarrels can well be
warded off through spirituality.
188
Mars + Satum +Mercury :Husband invoMng in business affairs,
an on!. lhtre will be buSiness activities with blood
and ther supporter Involvement pertaining to partnership type of
business activities.
Mars + Saturn + Jupiter : Husband will be able to OCQ.IPY a
resptctable post, being a master, more so a spirituaiSt. Sometimes
gainsome aspects In the fiefd d englneerlng/tectvllcal lines too. The
sec:on:l half of life will be full of fortmes..
Mars + Saturn + Venus: Minor quarrels will be prevalent.
Husband before marriage will have to encounter hardship, besides
imptclments in prosptrity and progress, but anyhow, after marriage
beneficial aspects v.ill be Illy good.
Mars + saturn + Dragon Head : Husband's famity condition
shall not be good during the fi rst of life ard later on ttlere will be
considerabl e degree of success and improvements and fortune.
Success will be In the life or transport/vehldes, also Indicates b'uhat
(Giant) chaya (shade), gas, photography or lines pertaining to such
ca,.....
Mars + Saturn + Dragon Tall : Husband will have to be
encouner tragedy quite often In his career, where galn.s wll be tess
compared to efforts, thus he suffers desperation. Anyhow after
marriage, wcuies may minimized.
Mars + Dragon Head + Sun: Husband wil be a fair looldng one,
besides being attractive, with good personality, but he will have to
encoU'Iter endangering situations (aocldents) cluing the eatly part of
life. Later on he would be able to enjoy gains through government lines
and by helping of influence through prominert persons.
Mars + Dragon Head + Moon : Husband by nature w;1 be
emotional and wil not have adequate power of direction. Anyhow after
some trne, gets opportunities for enjoying abroad travel.s and such
travels offers benefits. E will be qui te a knowledgeable one.
Mars + Dragon Head + Mercury: Husband d11ing the initial
181
stages suffers due to extreme h.ordship, lab:r on by intelligert shines
well in the f'ietd or comiTl(!n::e etc.
Mars + Dragon Head + Alpiter: HUSband IVJS to Cc::tnt up i n
lhrough hardships. In the beginning career wll be average, later enjoys
a good position as an officer. By nature hasty, besides stubborn nature.
Mars + OrttgOn Head + Venus: Husband will be tittle ancl during
first part of no success but after marriage enjoys
fortune, besides luxurious life.
Mars + Dragon Head + Dragon Tail: Husband will be a hard
worker. enjoys benefits through technkal Unes. Eatller hardship, In
future enjoy lordship.
Mars + Dragon Tall + Sun : husband will have good reputation
in government or political status. Gains spiri tual power during the
secord hatf d ure. In versions of Sanskrit Ohwaja Keerthl' Na Sandeho"
(i.e. with fail enj:>ys name ard fame).
Mars + Dragon Tall + Moon : Husband will be an hellectual
one, will irluitional powers and artistic qualities. During tirst part of
life, there will be frequent changes k'l career. Mer passing 30 (30..37)
enjoys good career either in foreign countries or distant place. The
nab.Jre d work would be connecting me<fical lines, psycho anal ysis or
pertaining to drawing and writing. He will ha\11!: attraai\11!: voloe and fast
person. A person ur:Ser dilemma.
Mars + Dragon Tall + Mercury: tt.Jsband will be good hearted
one, polite in nan.re, enjoys social status. Although talented will have a
calm nature. Attracted by his wi le, besides having opposi te sex
lnwlvements. career In acOJUnts, writing will be benetldal. In eatly part
of life wi ll have involvement with opposite sex, but suffers
disappointment.
Mars + Dragon TaU + Jupiter: A sairt ife will be better than
becoming servant of wffe (I.e. what this combination Indicates).
Husband wi ll not be suitable for marrl090 life.
Mat'$ + Dragon Tall + Venus: For tlis female native, ft will be
188
great a tas1c to discover a boy for marriage bt.t e'olen after marriage,
int:MSive CfJ&rreiS pre\QIIiiS/or for Sam! tir'n! (SCJrne yebrs), they will bt
constranect to Venus separately, as a prevertlve measure (to enjoy fair
in family li fe), it is advisable to feed 51.9ar and soj to black ants, which
offers some: relief.
Mars + Dragon Tall + Saturn : Husband will have an average
career. He will have to encounter with hatdshlps In car-eer. Anyhow,
breaks and inimical aspects would be inevitable in his career.
Nature of Wife through Permutation &
Combination
Mars + Venus + Moon : Wife will have artistic natlre, although
a good lady will have to suffer accusation through her husband
suffeslngs due to desperation is
Mars + Venus + SUn : She will be oourageous, for some time In
her life exerci se her power, sufferings due to health problems,
pertbining to c.ardac regions iS inevitabl!, intestinal diSorders.
Mars + Venus + Jupi t er: For some time she exercises
dlctatOtshlp, courageous, will ha...e adniristratlve capacity, fair k:Klking,
believes in fair justice, bit egoistic, she wlll have to encounter problems
during dtivery times, sufferings due: to heart troubl e iS int\lital* (may
ha\lf to undergo surgery too), blood pressure problems Indicative.
Mars + Venus + Saturn: Wife: will be a hard working type, sh!
would not bear aitidsms, hence Sllfers desperation, sufferings due to
excess to heat problems inevitable.
Mars + Venus + Mercury: Wife wil l be quite intelligent,
aJIOJI8tive:.
Mars + Venus+ Dragon Head: Her happiness is famity life oot
good, relationship between husband and wife will be adamant. She
suff"' due to e>a:ess or heat problefr6.
...
Mars + Venus + Dragon Tail: Her husband will be a quarrel
picking type, no harmoniOus rflatiOnShip betwe-en husband and wife,
husband aftet marriage wl l ha\'e career pertalrtlg to agricultu-e or will
have power looms (machineri es etc.), or in the trade of electronic
componeru, it is bdvisable he conducts business in his wife's n a ~ .
190
Cliapter 10
MARS:
Male planet - Convnancler - d nose - (Tn Sanskrit called
Trtclti) - also in Sanskrit is - "Dharani Gartha ambhootam" and
according to above verse. he ls OOm the womb d the. The goddess
Bhoodevi (wife c;l Lord VIShru) and hence, it cannot be considered
that ht iS the controlter of earth - - "'m is greater that
the mother". He appears on the surface of earth as Hill, Mountain,
Rodts - Mines - Metals (as merCioned above coUd not be the caUiative
planet or earth)- Bulttts, enemieS- egOism- hard substances- hard
materials.
HI! is also the causative planet of brother - foundatiOn stones -
blood/c.vdlac regions (I.e. SUIToundlng the heart portion). Flre-Sc:ISSS
- Triangular i n shape - Stone pilars.
Mars happens to be the causative planet r:l brother - foundation
stone-s- blOOd/cardiac (i.e. swrounding the heart portion). Fire
-Scissors- Triangular In shape- Stone pllars.
Mars happens to be the causative planet d IYJsband In female
hQfOS(X)pes. In IT'Iale it caled "Pot..rushatwa .. - Manliness or the power
of man, depictS Lord Suilrllmllnya - pow<r (Shaktti).
191
Friendly & inimical aspects of planets
MatS
1. Mars Is bom from the Womb of Goddess Bhoodevf, embroyh.n Ule
conc:eJ:( of the Lord Eswar8 (atso called Veetabhadra) & f\1ars Is the
go'olerning Panet of 'egoism' - also inc:licating power, besides having
the concept of 'Lord Yama'.
Now let us clscuss how MatS is considered as inirrCal planet to
Mertl.l"y, S3tum & OragonHW.
2. 'Egoism' cannot exercise proper Intelligence because of
stlbbomness, adamanUy, anger & 'egoistic' elemtntal fbetors of
the planet of Mars. It can also be observed that a man cllntelligenoe
caMot e)(press 'egoism' because of his Intellect and piousness,
besides patierr:e and \'irtues of good qualities. For instance, a man
d power (for example a wrestler) carnot express or exercise J)I'Oper
intelli gence, because men of intfjligMce and intellect fall under
the category of " VIdya Dadh.atl Vlnayam" aocOtding to San.skrlt

So It can be observed that Intelligence and egoism remains
cortroversial, but still, the aspect of intelligence and power cannot
be totall y Ignored. For Instance, If a person while exercising his
i"'telligence., if ht cannot or fail to enforce to put forward
himself as a leader, then his efforts may become a failure. Exercising
d lrtelligence along with power In any aspect to an extent is an
essential factor, which otherwise, no man can be cause of hefp
either to himself or can be a cause to service to the society. That
iS why i s Sanskrit it is properly mentiOned as Bhuddhi Shakthl
Intelligence & power), bvt whi le exerc.ising power an:l egoism,
ur1ess lhe person properly balances lhe weight d egoism. then
egoism dominates, intelligence fails, and efforts becomes useless.
Atrfhow, for reasoos diSa.Jssed abo!, Mars & Mt!rci.I'Y, in astrological
terms are considered as inimical planets.
3. Mars is as in inimical planet to 5atum, because a I)IYSOn
who Is In an offlce, while dkschar<Jing his Kam>a (d<.tles), W
expresses over ecolsm and becomes trouble maker and fl'1i)rass
his staff members, then the person wil have to a bad name,
and fl'1i)rass his staff metrbers, wt on the back wi l be blaning
192
and cursing the per-son may fall to get the office WOr'ks done
smoothly, effectively and satisfactorily. And sometimes, the
officers may even dedde to remove such a person from ltle service
& henoe i t Is an Indication that a natl...e of 'egoism' or '0\ler egoism'
may be asking fortrout1e an::l inlliting ptOblems in his work, besides
being a cause of obstruc:tkln for his self prosperity and success. A
man of egcism will not be able to discharge or do any specific
c:k.ltles for a long time, d11lng his sojourn c:lllfe. There could be no
significant achievements or success. There may be frequent
changes in career, because suth a person will be somehow
developing and building 'inimical aspects' because of his
nature and somewhere in some comer, something 'inimical' will be
causing him troubles Md problems. Due to these reasons 'Egoistic
Mars' is oonsidered inimical to 'Karmic Sab.Jm'. The planet of Mars is
governing spear and also Mars represetU Lord Yama.
There is a fT'I';'thological story that once upon a time Saturn and
LOtd Yamawere playing a bal Mid In spur of moment It so happened
thbt Saturn kicked LOrd Yama, and LOrd Yam11 become 13m!. So, in
a native horoscope, where'o there are miA:ual aspect of ,.1ars and
Si!ltum. SUCh a native may $U1I'tr from physical handicap particlMrty
in leg portion. Due to the reasons clscussed above, it deduced in
astrological terms that Mars and Satun are Inimical planets.
Mars as per Bhrigu Nadi System
The planet Mars comes ot.t (takes his birth) bursting the earth and
In Sanst<rlt version- "Dharanl Garbha Sambh<:XXham" and he 15 son d
Goddess Bhoodevi (the son of Goddess Parvathi) - indi cating Fire,
<:ak:ium, Egoism, lnduding Jataragni' (the aspect rl heat In lrtestinal
portions) - Spear.
Without power no work can be dooe, and without heat In the
body, food cannot get digested, but excess d heat (egoism) invites
troubles. He is also an inclcation of Wrheal aspect. In a small prOIX!rdon
Mars Is essential for Mercury and Saturn but hot In excess.
While boiling rice of grains, it must be to done proper proportions,
otherwise, when elCCess boiling takes the taste and food itsdf Is
destroyed. So, it is noticeable that Mars can feed power and taste to
, ..
food, OOt shoold not be in excess.
Any person whUe cise-harging Korma, when excets the limi ts of
egoiSm, k:lses his vah.Je and bomes a cause d trolble not onty to
himself, blt also for othetS.
lf we refer to History there are manv examples where persons
tried either to oonquer or become the absolute l'\llers were either
supp.ressed or kiled, of their a'ltregoism.
Ew::n a person cl extraordinary intdligence when ecels in egoism
becomes a a iminal, t hus becoming a cause of destruCtion to himself.
ether wise he wouk:t have been a very useful to humar&ty and more so
to himsel f. So, any native having excess egoism well be traced out
through birth chart.
As mentioned a man of power (extreme egoism) some:llly
or other must come down, because., when natives who are aspected
by Dragon-Head ( Kaala Purvsha) then such natives will certainly be
swallowed b( DragonHW thus causing el iminati on d egoism because
OragonHead ne\ler fails to swalbw. So, It can be obserwd, that any
native who is under the strorg irtluence of either MerOJry or Dragon-
Head wil one day lose his egoism. Now tel us diSOJss t hem through
various cases wtllle the native, either by fortt.r'le or t*fortune sUfers.
Olart - MA. 1:
.....
Mars in Is exalted and Jupiter In cancer. Jupiter is also
exalted who is Mars. Jupiter Is Ide and r-1ars is power. Ufe +
Power. When these two planets are exalted, In this c:onnec:don, Mars Is
not only exalted, blt also .-edominant and hence indicating su:h a
394
SAN!
Destruction or k:lss of clothes, con-..eyances aoo cattle;
separntionfrom relati...es and loss of servants and maid
servants.
(c) If bukti natha SURYA Is In Kendra, trii<Dna, 3 or U'" from Maha
oasa Natha or conjunct benefics:
Professional betterment or getting a new profession; ciscussions
and gain of knowledge; hearing Hari Katha/Ramayana; celebrations;
gain d new relations (as a result of marriage etc.); auspicious
celetntions; prosperity to wife and children and increased finandal
Income; daily charities of food to poor and opportunities of contacts
with placed otrocers.
(d) If bukU natha SURYA Is In Dushsthana from Maha Oasa Natha Budha
or conjmct malefic :-
Expenses; mental VIVAHE KALAHAt-10-IAtvA (quarrels in
or cl.lring marriage ceremonies); b'Oubles from ladies and quarrels
with relatives; loss of autl'>rity, tinarv:::e and cattle.
(e) If bukti natha SURYA is in 2ro or "jh or is con;mct another" Marta
Graha:
Feat of deattl. S a shanty, perlonnance of BHASKAAA PRARTHANA
and GO (cow) DAN are prescribed, after which the native will enjoy
good heo fth.
OIANDRA BUKn = 17 months
(a) The folioi<Ong are the effects of CHANDRA BUKTJin BUOHA MAHA
OASA with reference to various Yogas :
(i) If bukti natha CHANDRA is in Kendra, Trikona, 3 or 11th from
L.agna, in exaltation, OINI"' house. Navamsa In own ho....se or
exalted Navamsa, conjooc.t or aspected by Guru or Chandra is
otherwise strong and is nearing FUI t-1oon:
Lordship o...er land or a village; opportooities of using horse as
conveyance; honour and respect from a master; gain of
ornaments and stones; marriage of relatives; increase
In the cirde d friends; prosperity to master{ employer; ircreased
cattle holding; more servants or subordinates; greater
agricuttvral produce; suo::ess In undertakings; gain of articles
from others; prosperity to relatives on equal
(li) II buktl natha CHANDRA is waning or aspected by malefic: or in
inimical sign or in Dushsthana from
t-1ANAS CHANCHALYAM (wavering or mind or indecision); loss
or reputatlon; business losses; troubles from thieves; loss d
finance, cattle and agriclfhsal produce; tittemess with wife
and t roWi es; misunderstandings with m<XIler or matemal
r&tions; quarrels with relatives; failores in U"'dertakJngs in spite
of best efforts; King'S anger.
(b) The follOwing are the SPEOAL EFFECTS, in addition to those
mentioned W bukti natha CHANDRA Is conj"'ct or aspected
by :
SURYA
kUlA
BUDHA
GURU
SUKRA
SAN!
Aimless travels; monetary losses; professionally his
posibon gas shaky.
Auspicious fmctions like marriage; prosperity and well
bertg of near and distant relattves.
Study of Veda and Shastra (or reUglous books);
pilgrimage; buSine-ss gains.
Wort.shop d preceptor; chalttable deeds; initiation in
MANTRA.
Company of women other than wife; gain of
ornamtnrs and monty; success in U"'dertakings.
Quarrels with meni als; loss of money and
reputation.
(c) If b!J<ti natt\!1 CHANDRA iS in Ktnct"a, Trlkona, 3 or 11th from Maha
Dasa Natha or conju net benefic :-
Birth of son; gain d money and oonveyances; acqulsitk>n of gold
ornamerts; success in desired directions; opportunties of service
under h;gh officials; well being or wife and ag'iOJitural
gains; increased charities and wOrShip.
(d) If buktl natha CHANDRA Is In Dusl\sthana rrom Maha Dasa Natha,
BUDHA or conj l.llct :
Quclorrels and mi5'.1"1derstanclings with a of peo'*; ttoltlles
from relatives; mental urnst faih.res everywhere; change of place;
(JJarrets with iCJ\.\1 caste won-en; loss d clothes and having to put
an urtkt( appearance.
396
(e) If btAtti natha OiANDRA is in ?Ill Or 1"' from Lagna; arw:Jtor conjunct
lord of 2n:t or "P' :
OEHA li>!JYNII (bodly troubles); MANO RVJAM (Mental upsets and
worries); CHORA 1\GNI NRUPA 6HEE11<1 (fear from fe. and
t hieves); DU STREE SANGAMAM (contacts with women of
"'estlonable character); APA MRITYU (fear of death).
The shanty for warding off tHs OOSh Phala Is DURGA DEVI
and RAJITHA PRATIMA DAN (silver image of Dt.RGA), after which
the native will enjoy good health.
KUlA BUIO'l = 11 months & 27 days
(a) The following are effec.ts of KUlA BUKTI In BUOHA MAHA 0ASA
with reference to various Yogas :
(i) If bukt.i nad'la KUJA is in Kendra, trikona, 3 or ttlll from Lagna,
In exaltation Or own house or conj-unct brd of Lagna or In
great SWAVAAGA :
Gain of red-colOured clOthes, pearls and ooral s; VICHITRA
GRIHA NIRMANAM (construction of a decx>rated house); 90in
of landed property; favours from royalty; Auspicious
ocwrrences on Tuesdays; help from a favourably disposed
master; of relatives who were staying far away;
appreciatiOn of landed and househ:lld propertieS; birth d son;
success everywhere.
(II) If bukti natha, KUlA Is In Dushsthana from Lagna or In
debilit21UOn, debilitated Nav3mS& or in KROORA OREKKANA :
Loss of wealth, conveyance, agric-ultural produc:e and cattle;
troOOies to wife and quarrels wiltl distant relatives; temporary
separaUon from wife and c:Mdren. PAtTY A BRAMANA ROGADJ
GRAHJNI KSHAYA SAMBHAVAHA (giddiness due to upset of
bile, dysentery, consumption etc.). Bitterness with fav<>Urably
diSposed master-; fan .... e d triSSion in tr.wtl; abrupt quarrelS;
having to resort to borrowings; fall from a height, fear from
Uieves ard polson.
(b) The following are the SPEOAL EFFECTS, In addition to those
mentioned aoove, if bukti natha KUJA is conjur.ct or aspected by:
SURYA Favours and from a ,.1aharaja highly placed
person; success in encoootet"s; inoerea$e in powers
wiek:ted.
397
CHANDRA Enjl)(ing sweet diShes and costly foods; SWA 5rREE
SAYYA 9.JKHA PRAAPTI (enjoyments with own
and pleasure on cot); also oompany d women of
questionable ch&racter.
SUDHA Company of relatives; business gains; success in
undertaki ngs.
GURU Sufferings to children and financial losses;
forgetfUnes:s; developing krellglous habits; lnct..rring
dispteasure d
SUKRA Alx>rtion to vre; diseases blood
disorders to wife.
SANI Quarrels with loss of cattle and servants;
i n..,edments to perfoonance of religious
(c) Irb.Jkti nath8 KUJAi sin Kendra. trlkOna, 3 or

f'o\ahb oasa
Natha or in exaltation or conj.mct beneriC :
Presents from king; gain of conveyance and precious stones;
auSI)ic:lous funatons at home and &e<!Uisitlon of wealth and cereats;
tusiness in own name; reputation; gain of s ilk clothes and apparel,
scents and cosmetics; bath In sacred rivers; prosperity to one's
own master and succtss in undet"takings.
(d) If bukti nathi!l iS in Dushsthana from f\\aha Dasa Natha or in
debilitation or conjunct malefiC :
financial losses; quaels with rdatlves and tro\bles from fire and
polson; boc:hty troubles; Ill health to wife and ch l c:Yen; sufferings to
bekwed relatives; bitterness with equals and distal"( relatives.
(e) If biJcti natha KVJA is in 2f'CI or from t.agna or ld of these two
B""""s ard/or conjunct lord of soid Bhovas :
Feat of death. The shanty for warding df this Dosh Phola Is either
( i) MRITYUNJAYA JAPA and SkANOA POOJA or ( ii) SIVA
SAHASRAXA and GO DAN and SHOO DAN and HIRANYA DAN.
RAHU BUKTI = 30 months& 18days
(a) The followmg are the eWects of RAHU OOKTI In BUOHA MAHA
OASA with reference to the various Yogas :
(i) II bukti natha, RAHU, is in Ken<ta, trikona, 3 or from
Lagna, In exaltation, ecalted Navamsa, tl cancer. Virgo, Leo 0t
398
Thurus, or conj unct or aspected by a btnefic: :
COntacts with king/high oftidats; meeting a new offldat or
master; gain of quadrupeds; pilgrimages; good health; great
happiness; prosperity to the master of t he nati ve; acqt.isldon
of dress and ornaments; success in desired directions.
(ii) If bukt i natha Rahu is in Oushsthana from lagna or i n
debl itation, debilitated Ncwamsa, conjunct or aspected by
malef ic::
Fear from fr e, polson and thieves; misunderstandWlgs with
wife; diseases and fear d deatl'\.
(ii) If bukti natha RAHU is in Ousl'lsthana and at the same time in
cancer, Leo or Aquarius :-
Quarnls In connectlon wtth the status of the native; fear
from enemies and king; defeats in ercOLnts.
(b) The fol lOwing are t he SPEOAL EFFECTS, in additi on to those
mentioned above, rf bukti natha Rahu is conjunct or aspected by :
SURYA Diseases on head; Eye diseases; loss d relatives on
paternal side.
CHANDRA Loss of retatl...es on matemal side; 5\lferings to wife
ard misunderstandings wi th her; quarrels throughout
the b.lkti; financ:.ial tosses ocxurrirg sometimes
withOut tM knowledl)e of natiVe.
KUJA with diStart to
relatives and loss of relatives.
BUDHA lncMging in fooli sh utterances; loss of quadi'\C)eds
and servarts; n:reased borrowings.
GURU SUfferings to or loss of pre<eptor and chil dren; Boclly
mental oorest and financial losses.
SUKRA Company of wife an:l child-en and hawiness; gain d
conveyance and knowledge; auspldous functions and
bkth d son/daughter.
SANI Mental ul'lrt'st; tdlly trolbles; loss of (J.Iactupeds and
servart.s; bodily troubles to wife.
(c) bukti natha Rahu is in Tri b:lna, 3 or ut" or 6ttt from Maha
Dasa Natha, BIJOHA. or oonjooa benefic:-
APOORVA PRIYA DARSANAM (S-eeing SOr'l"ething Or per-son ligtiy
desired and not pre..tousty seen); happiness with wife an:l dlildren;
oorr.,art( of friends; success In all drectlons.
(d) If b\A<tl notha RAHU Is In ff" or 12" f rom Maha Dasa Natha "'
oonjunct malefic:
Bodily troubles; mentaly a confu;ed state d aft'airs; d
wo-nen other than wife; loss of rePVtation; quarTets with !Mdows;
urtimely meals, failres.
(e) If bJkti natha RAHU Is or ff()TI Lagna:
Fear of death. The shanty for wardWlg off this Oosh Is RUORA
SA.HASHAKA and OiHAGA DAN, after vdic.h nati..e will enjoy
prosperity.
GURUBUKTI = 27months&6days
(a) The following are the effects of GURU BtJKTl In BUOHA MAKA
OASA with reference to various Yogas:
(i) If bukti natha GlJRU is in Kendra, triiG::Ina, 3 or 11tn from tagna
Ot In exaltation :-
ISKTA VASTHU SAMPRAAPTI (gain d desired things); ATMA
SANDHU DARSHANAM (me<ting blOOd relaUOn). Increas.d gain
of money ar:1 cereals; falJOlJ"S from ki1"19; Olaritable lrclinations
including ertion of publiC char&s like gardens and resting
places; charities like erection of tEfl1)1es and sacrifidal rites;
Increase In po-. wielded by native and birth cl son;
to wife; gold ornaments like gold buttons, rings etc. for the
native; gain of precious stones, success in encounters; gain c:J
conveyances and initiatiOn in f\1ANTRAS.
(ii) If bukti natha GURU whO iS in Kendra, trikona, 3 or 11
111
from
Lagna ls oonjunct Budha :-
AcQUiril"'9 furniture, conveyances and other artldes which go
to Increase the natiVe's ccmforts.
(li) 11 buktf natha GURU who is In Kendra, trlkona, 3 Ot 11
111
from
Lagna is conjunct KUlA or KETU :
Quarrels and miSWlderstandings with a number d people.
(iv) llblkti natha Guru is in Oushs'thana Lagnaorindetilitation
Ot conjunct Rahu : -
400
Quarrels and loss of relatives-; fear from ar'd king;
to fath and mother; fever; diseases like ulcer/
wounds; S\lferlng losses In the matter of landed property and
cattle holdW!gs.
(b) The following are the SPECIAL EFFeCTS, In addiUon to those
mentioned above, if bukti natha GURU is conjl.llct or aspected
by:-
SURYA Gain of money through agriculture; of profession;
respect from k:ing.
CHANDRA auspic:iOuS functia'IS; gain d ClOthing; of
mind; prosperity to maternal relations..
KUJA VIctory In encounters; respect from king; special
fa..o\.rS on Tuesdays; gain of land.
BUDHA gain or clOthing and ornaments; company of k!amed
people and academical functions and entertaiM1ents.
SUKRA enjoyments with opposite sex; peace of mind;
reputation to master; gain ot ornamerts and dress.
SANI disorders kl ltlroat; loss of servants; In
performing prayer and worship.
(c) If buktl natha Guru Is In r.endra, Trlkx>na, 3 or

from f\1aha oasa

Natha or conjuntt benefic :
Gain d money, well being of wife; oneself established in
profession; prosperity to master or emptoyer; kin9J
important people on Thursdays; knowledge of philosophy or
shastras.
(d) U buktl natha Guu is Dushsthana fromMaha Dasa Natha or conjunct
malefic:-
Bittemess with children and leamed people; bodily troutles; blurred
intelligence; forgetfulnes5; quarrels; loss of position; Sl.lferin9> to
dose relatives and loss d quadrupeds.
(e) If buktl natha Gwu Is In 2td or "P' from L.a9"1a:
fear of death. The shanty for warding off this Dosh Phala is MAHA
MRUTYUNJAYA JAPA and KAANCHANA PRATIMA DAN (image mode
ci gold), after wtich the naU., wll enjoy prospelly.
SHANI BUKTI = 32 months & 9 days
(a) The folowing are 111e effects of SAN I BUKTI in BUDHA DASA
with reference to various Yogas:
(i) If bukti natha SANI is in Kencta, trikona, 3 or from t.agna
or in exaltatiOn
Pilgrimages al'd viSits to temples; trawls in 'M:!Stem directiOn
and meeting king; prosperity in master's fami ly; getting into
good books d king; Increased m.rnber of setVants and maid-
servants; favours from a master belonging to low caste; gain
of household property and acquisition of cereals; 9J)in of
preCiOus st()()(!S and cattle; pi'OSp(!rily to reladve:S.
(II) If buktl natha SANI is in Oushsthana from Lagna or In
debilitotion:-
Svfferings to dose relatives and quarrels and rnsuncterstancln9i
with relatlves; Loss of position In the own place and
having to go frcm place to place; loss d powers wielded by
the native; fear r. battle; especially on SabJrdays, quarrels
with menials atd incurring Ki'lg"s displeasure.
(b) The following are the SPECIAL EFFeCTS, In addiUon to those
mentioned above, tf bukti natha SANI is (X)I'ljunct or aspected bv :
SURYA Sufferings to father and loss of money; clseases on
head; quarrels; MAHAT SANGARA
( poSSi:Jility d the nM:tve partaking in a great battle: or
seNce In battte front}.
CHANORA to matemol relations; failUres
In U'ldertaklngs.
KUJA Unexpected adverse happenings; loss d tlnance due
to natiYe's foolislwless; diseases We to excess of heat;
fear from weapons ard poison.
BUOHA UPI VIOYA VISARADAHA (profldency In caiiigrapl'ly);
i nclinatiOn to help relative:s..
GURU SIAYerings to Chikt"en; forgetfulness; misooderSt!lndings
with learned and failures in undertakings.
SUKAA sum gains of money; good health for wife and
childrtn; acq.JiSitiOn d corrvtyance etc.
402
(c) If btAtti natha SAN! IS IN Kendra, trikona, 3 or 1111\ frOm f\1aha oasa
N3tha 0t conjunct benefic :
Auspk:fous celebrations and prosperity; satisfaction In many
clrectlon.s; exhibition of native's knowledge In au:flenoes; gain d
deeper knowtedge in Vedarl:a; happiness master/employer
belonging to a low caste; suce<ss In e<eSY direction.
(d) If buli natha SANT is in Oushsthana (6, 8, or from f\1aha Oasa
N3tha., BUOHA, or conjutw:t malefiC:
Bodily troubles; lOss of positiOn; toss d preptor and r&tivt:S;
quarrels arising due to king and toss of powers wielded by the
native.
(e) If I>Jkti nallla, SAN! Is In t" or 7"' from Lagna:
Fear d death. The shanty for warding off this Dosh Phala Is
MAK!SHA (I>JIIalo) DAN.
(f) If bukti natha SANI is lord of2"" ttl' and at the same time conjunct
with a malell<: 01 Sari Is conjt.ntt with lord of 2...., or 7th or stays in
7'" from Uqla:
Fear d death. MAHA MRUTYUNJAYA JAPA, KAPJLA OHENU, and
HA.HISHA DAN are p-eSO'ibed for warding off the malefic effects.
euDHA MAHA DASA - BUKTI PHAlA SAMPOORNAM"
Cliapter 28
'Jiarious Kouses in
<Bhrigu Nalfi - 9ttercury
Method of judging wife' s nature from male
horoscope:
Mercury + Venus + Sun : Genalty good in nature, intelligent.
lri'lgs honour both to birth place and marital home.
Mercury + Venus + Moon: Qui te Intelligent, she wil l be
knowledgeable in various artistic ..-ery active (she can make
a dumb/deaf to talk), ' Mookam Karoti Vachalam', will have good
grasping nature, social minded. wi ll have brother/sisters, ability In
business activities too, IA.tt her husband may mistake her because of
her social movemert (one of native's will be capricious, fickle
minded), the natl\le treats guests fairty, her husband enjoys transit cl
her fortune regardi ng land and gains/property and if her husband
suffers any toss, he gains compensation tiYoLgh some means (because
wife's fortune) Md lnsplte of all these., still her husband will be
suspicious of wife because of her smiling, social nature, she visits holy
pil grimages, she will be a natue lover, persor6 who help fran her
In fubJre will accuse her Met try to make her a scapegoat
Mercury + Venus + Mars: She wtl be cak:ulatlve, she can
control her hust>Md. she woukt not allow her husband to go In bad
w;,ys ( that is she can control him), qui te intelligent, suff ers in
education31 career (bot later on cootinues), wil have brother/sister,
generally she does not like quarrelling, but shoukt it come to l, she
404
would not hesitate to expose others, she will be a fair looking
native.
Mercury + Venus + Jupiter : SM will be a t3lenta:l one, fair
educational aspeas, she can become a gukte/teacher, pertly successful
in intell ectual lines, fair tooking, knowl edge in various spheres, she
respects elderS and intt'!llec:tuals, She will Nlve fair discretional p:wm,
family life fairly good, a sociable type.
Mercury +Venus + saturn : Educated, quite r.telligert, will be
a career girl, iodination towards commercial lines, a quietty behaving
type, her huSband brinos her dejection, she will troubles ttrough
her husband, mother-in-law's sid!s, hUSband enjoys prosperity ttroogh
her fortune.
Mercury + Venus + Dragon Head : Qui te Intelligent,
sometimes suffers due to a sort of her husband enjoys
prosperity through h fortune, she can enjoy a h.Jxtrf although
her h.Jsband may suffer due to .,.imlcal aspects, but because d his
wife's (the native) fortune, he can such problems.
Mercury + Venus + Dragon Tall: She will have inclination
towards the path of liberation, suffers nervous detiity, wil have some
more lntuiUonal power, husband en}oys prosperity because of her
fo<tune (benefit through cloth are indialted), she wii be a devo""' <0
l ord Vishnu, her name pertains to goddess S.vasvati, her husband
enjoys fortune and prosperity, pertain.-.g to green &ands, agrlcUtural
land etc.
Method of Judging Husband's nature from the
Female horoscope:
Mercury + Mars + Sun: Husband hailing from a 9ood
background. CJ,Jite intelligent, although Short wil have somt
discretional power, he wil have harmonious relationship with other
members of the farrity.
Mercury + Mars + Moon: He wil be a good will have
traveling auetr, enjoys IMCS gains (agrieullural etc.) can work in food/
grW.s departments or In such lines the peo.Jiiatlty is If he gets angry,
some other women will cajole him and he can have her as his
companion and if his wife him out of anger, dltre wUI b! no
dearth to for sexual pleasure.
Mercury + + OrA90n Head: Husband lntellgent, but
sometimes behaves a mad cap, regarding marriage he will c:ome
across bad si!uation and later on marries a girt and l ife gets settled.
Mercury + Mars + Dragon Tail: Here, regarding both male and
femal e aspects, before their marriage, they will encounter with an
affatrs with opposite sex, which may not matertallze and only later on
marria9f! takes place.
Mercury + Jupiter + Mars: Hvsband will be a respectable one.
iodination towards commercial lin!"S enj)ys social st.Mus, he will be more
lntelligetl than wife.
Mercury + Venus + Mars: Husband will be a good speaker,
enjoys soc.ial status and amicab'e (ad).lstable) by nature.
Mercury+ Mars+ Satum: Husband will have Iodination towards
business lines although prosperity may not be very high, general
aspects of fort<r>e can be enjo)'ed.
Mercury + Mars + Dragon Head: Her husband quite an
lntellgent native, blt husband and wife would oot trust each other,
and after some t ime she may ha""Je to find extra marital rdationsh., for
her pleasures.
Mercury + Mars + Dragon Tail: Her husband wil be intelligent,.
will have literary knowledge, her nature wi l be such that moon rays
roost be fali n9 on her house orfy.

Flat & Fortune of wife through male Chart
Mercury + Sun + Venus: She is generally an intdllgent native,
will have good education.
Mercury + Moon + Venus: This is a wonderful combination, she
will be: an ir'telligent lady, ar'd for olt.Side she will act like
a Penelope, (this combination is la<.e a Trlvent Sangam, because three
female planets are there) and even if her husband beats her, she would
not either care or change, but if he t reats her better, he can have
some: benefits through her, she will be social minded native, talents,
knowledge In roosic and dance prevails, she does not like inl>ositions,
but expects fair treatment and husband must make lot of adjustments
with her for his v!!fare and profiUibiides.
Mercury + saturn + Venus: She will have fair fortune, but
husband must be adjustable to her, Itself wdl be
some times he wil have to wag tis tail before her for his benefits.
Mercury + Mars + Moon : (Male/f emal e natives), between
husband and wife no l ildngs, she thiir.s She need oot depend on her
husband and he tNii<s he need not depend on his wife, anyhow but
both of them may be suitable to do social servi ce, wJI have their
pleasures, happiness outside family
Mercury + Saturn + Mars : (Mal!,lremale natives), to put i t
precisely maniage Is not at a1 advisable ror sudl combination (better,
Astrologer.; it precisely).
Mercury + Dragon Head + Verw.s: She can be a good wife,
after marriage husband can enjoy prosperity, but he rrust not either
constrai"' or impose on htr any b4x!Wl (for bOth maJe,ffemale natives
Indications or love marriage Is a possibility).
Mercury + Venus + Dragon Head: She will not have affection
on her husband, her mind will be working on external interests.
<01
Method of Judging Husband's Career through the
Combination of Planets
Mercury + Mars+ Sun: He will sportive be by nature, will have
traveling c.arttr in commdal lines, connecting
Mercury + Mars + Moon : He \WI be a good, at1Jactive person
and a good speaktr, doeS not believe that he has to dtpend only on his
wife, enjoy prolltabllity through green lands, food products, a bit llat,
will have arti stic krowledge, wil have intuitional powers, will have
foreign trlJvel in bUSiness activitieS.
Mercury + Mars + Jupiter: An educated one, eft'idency in
managerial posts wHI be good in (Head will have
commercial based concern, will have opposite sex affairs, bvt keeps
thtm secA!t. enjoys p-operty, good finandal positiOns in the sojourn of
life.
Mercury + Mars + Venus: He e$ys good finMdal position,
enjoys landed property, enjoys benefi ts through opposite sex
inwtvements ( aspecting financial one). He will have more affeCtion on
slsterh law'S/other females, rather than on his v.ife. lf the moon Is
associated wfth the above planets or if the Moon is in or 9"'
aspect to Mercury and Venus, they will have some opposite sex
Involvements. He enjoys commercial career based profltablllties,
lntelllgents, rupture between husband and wife Will be Inevitable (but
anyhow they would n::>t f ail to ive together), ar:1 if tis wife does not
treat him smoothly wotAd not hesitate to h&ve aoother adjustment
(so she must be careful and patient while such type of h.Jsband), he
generally looks a pious one.
Mercury + Mars + Dragon Head: Generally an Intelligent
one, but a bit fearful, afraid of opposite sex relations (he would
not tH prepared to bur accusation$ due to such affair$) but
sometimes dal'ely enjoys opposlt2 sex l'elatiOM, but there will
be disappointments in life.
Mercury + Mars + Dragon Tail : He will have career as a
Draftsman will have knowledge/career aspects In law, Intelligent,
408
opporturities to become high level actninistrating officer/lAS good.
Mercury + Mars + Jupiter: Edutational y a double-degree
hok:Jer, but egoistic l:r;' natiJe, proud/paSSiontd on!, will not have good
liking with brother rdaUOns.
Mercury + Mars + venus: Her husband wJI be active and
generous by enjoys great popularity in social cirdes. Eamin9>
will be pertaining to finanCial instruction/banking agendes etc.
Mercury + Mars + Satum: Husband invotving in business affairs,
an on!. lhe: will be business betivities with blood relatives
and thek' supporter Involvement pertaining to partnership type of
business activities.
Mercury + Mars + Dragon Head: Husband dl.l'ing the initial
stages suffers due to extreme hardShip, l at8' on by intelligert shines
wen In \tie fleid of commerce etc.
Mercury + Mars + Dragon Tall: A S$1t life wfll be better than
becoming seNant of wife (I.e. what this combination indicates).
Husb<lnd will oot be suitable for marriage life.
Mercury + Mars + Sun : Husband wil be an intellecb.Jal one,
dignWied, but sometimes behaves ke a bu"*'g fire (as If ash covering
the bumng ooal). Enjoys SUOJeSS In govemmental l nes.
Mercury + Mars + Moon : Husband wtl ha..-e artlstfc nature.,
enjoys soe-lal reputatb"'. Quite often will have sexual affairs.
Mercury + Mars + Jupiter: Husband will be highly able
knowledge, quick ani conb!mplation type. As fat as career is
concemed, enj)ys good fortune and actnlnlstratlve positions (like an
engineer, manager etc.). Sometimes his power of dlsaetion will be poor
and his wife will have to exercise lot of tolerance to be in peace with
her husband,
Mercury + Mars + saturn : Husband will be lrtellectual, besides
quite a hard wc:rtet.
Nature of Wife through Permutation &
Combination
Mercury + Venus + Sun: She hails f rom a good family
background. 1'1.4)ture betweM husband and wife iS
Mercury + Venus + Moon: Wife will have intuitional powers,
quite an intelligent one, will have arti sti c nature, huSbiJnd wll be
discordant, non co-operating one, he wil l have other female
involvements.
Mercury + Venus + Mars: For some t ime she exerci ses
dictatCf"Sttip, cour3geous, will haY! bdrriniStrative capacity, fair looking,
believes In fait Justice, bit egoistic, she wfll have to encounter problems
during delivery times, svfferings due to heart trouble is inevitatle (may
to undergo surgery too), blood presst.e problems indicative..
Mercury + Ven us + Jupiter : Wife will have special educatioclal
qualities, quite an Intelligent one, can extract WOtk from others nicely,
she can work as a teacher, a guide and she will be liked by all in social
cir des. She can attract like a magnet, ste nicely coils officers and gets
her work done.
Mercury + Venus + satum: Wife will be an lntet&gent one,
enjoys luxury, a fortune aspected one, she can ln'>lve fn trade activities
like business ett. (husband am do business in her name or enjoying
great fortune).
Mercury + Venus+ Dragon Head: Wife enjoys g:>od name in
society, quite an lntelllgert one, .-.'>tvement .-. secret affairs .,evitable
(wife's sister wi ll have some secret life).
Mercury + Venus + Dragon Tall: Wife will be a bluff master,
interested in making secret savings, although she has helping natue to
some extent still she would hesitate to exercise it., can caloJate many
things si tting at a place, she wi ll have capacity to judge others, she
exercises her intelli gence to gain her ends, enjoys green landed
property, there w111 be disorders In genital organs (may need surgical
operations).
410
MERCURY - Effects of various Houses as per
Bhrigu Nadi studies
Tile various effects produced by r-1ercury standing in the 12u.
houses in a horoscop! are as follows:
Mercury In Ascendant
learned, p-oficiercy in wi tchaaft and black sweet talk, kind
hearted, pilgrimage In his 2,..1"0r.
(a) U oonj<nct malefic or staying In malefic houses - Diseases
generalty leukotomy, excess of pre. I( conjunct or aspected
by or staying in benefit house- Good health, lustrous
bo<tf, knowledge of astrobgy, slight defect in any organ,
bitterness with gentleman, quarrels and misunderstanclngs
with brothers In his 11" year; deceitful.
(b) U exalted OC.Cl4)ying own house- Happiness with and from
brothers.
(c) U det>;litated or oonj aspected bv malefic:. Will go to hel alter
death, for sake comfortable IM!d, worship '"'Dustha Otita."'
(d) Conj or aspected bv Saturn. Tn:nble w left eye. In YQga
if conj lord of 6-. 01 debilitation - No such wasteful
expenses.
(e) 11 ccnj auspicious s;lanet. Olarities, prolidency in debating and
In use d arms, well built lxldy.
Mercury in 2nct House
Talkative, mmber d c:hildml, interest in ShaStras, cootented.
moneyed, praisewcrthy habits, acquires g:>od of educatkm
bv his 15"' year.
(a) 11 conj malefic or staying In malefic house or enemy houses
debilitatiOn - poor tducati on, Rheumatic and
diseases.
(b) If oonj or aspected by Jupiler - Prol\clency In mathematics
and astrotog:y, self
Mercury I n 3"' House
Gain of gold in his 1 sth year, praise INOrthy hai:Xts, financial prosperity.
(a) II disposition is s t ~ n g - Brothers prosper, coneyances.
(b) II disposition is weak - Sllferings to brothers, fear complex.
Mercury in 4ttt House
Courageous, brei'd eyes, happiness from father and mother,
knowledge, acquires money throuc1' questionable means In his
161h year.
(a) II conj venus or Jupiter - f'.1any c:owageous.
(b) II disposition iS strong - Caweyan:ts
(c) If conj Rahu/Ketu/Saturn - Loss of oonveyances, loss of
happiness, bitterness with relatives, ~ r i n g lies.
Mercury in 5tt1 House
Fear of death of unde, well being of mother, birth d children,
doubtful, intetigence, sweet tongue.
(a) II disposition iS st:rong .. Prosperous children
(b) II disposition iS weak - Loss of children.
(c) II f'.1ercury is debilitated ... The native wil be adopting a d'Jkj,
profldency In chanting MantraS/unchatitable deeds, knows how
to talk according to times.
Mercury in 6ttt House
Respect and preserve from king, obstacles in the direction d native's
edocatlon, showy and proud, lnnuence in t'igher drde: In his 30"'
year, will wri te or edit bookS.
(a) II statiOned in Aries or SccrpiO - Leprosy d blue cOIOw.
(b) II c:onj RMu or 53tum. Rheumatic ShOoting pairs:, quarrels with
distant relatives.
(c) II disposition Is strong -Prosperous nephews.
412
(d) 11 CIOn) Ketu - QJhtllnce/hltmacy w;th wklow and lnO<\etary
gains thereafter.
Mercury in 7th House
Happiness and well being of mothe<, charilllble broad
minded, very good reputation.
(a) 11 conjunct beneflcs. Ga;n ol conveyance and hooe In his
year, good wife.
(b) If disposition i s strong. Only one wire.
(c) If disposition is weak station in maleftt housed conjunct
,.'Iars, Saturn or Rahu. The yoga oo:!.l'rlng in the horoscope d
girts will res.Jt in l oss d hu.sl:end or the natiVe herself Sltfering
from Leprosy.
Mercury in 8th House
Nurrber cl children- 7, public his 25".
(a) 11 dlsposl\lon Is strong. The native wii.,JO\' ful span ollife.
(b) II disposition is conju...:t or is debilitated or in enemy
house. Po longevity.
Mercury in 9th House
Latge number of ch;ldren, highly leamed In !llastras and Veda,
proficiency In music, good amount of patience, charitable,
p-ofessional earnings through business, hates preceptor.
MerOJry in 10tt1 House
Good deeds, higNy courageous, reputed, highly prosperous, e:re
diseases In his 28'" year.
(a) II J)laced in exaltation, own house or conj Religious
charities/sacrifice.
(b) If combust retrograde or conj malefiC. Oppose religious
saalllces.
Mercury In 11 ttl House
Kind hearted, financial prosperity and birth d son in 27 .,.ears.
(a) II conj. Malefic. Loss of money through low dass people.
(b) II exal ted or occupying own house or conj benefic - Finandal
prosperity.
Mercury In 12tt1 House
Knowledge, valorous In bat*.
(a) 11 conjunct malefic . Focal minded. blttemess with h i ~ l y
placed persons including king.
II conj benefics. Exptnses on chari ty Md in ril;tlt direction,
meager erucatlon, sickly mothef.
414
Cliapter 29
of !Mercury
Unlike the shepherd, the gods do not use a cudgel to guard
the Mortals. Instead, they protect the chosen ones by
bestowing fine Intellect and wisdom upon them.
Mertl.l"y gNts the foltow;ng r&Jtts when it iSIJ$$0d3ltd wit h 8 to
0 blndus:
8 bin:lus
7 bindus
6 bindus
5 blndus
4 bindus
3 bindus
2 bin:lus
I blndu
0 blndu
Honour from the rul ers, al -round good luck.
Wealth. happiness, learning, wony.,less phianth'opic
llvng.
Success in au ventures, ability to comprehend
Intricate and complex matters.
New with Important people.
Lack of enthusiasm and focus in life.
Mental worries.
MiSunderstan:tings with family members, SiCkness
due to imbalance of VcJta .. PittiJ or Kap/18 (wind,
bile or pNegm
Enforced confinement, tormented by enemies.
Loss of property through enemy intri9)es, fear of
death.
Prominent indications of Mercury's
Bhinnashtakavarga
1. Mercury's transit In a Kakshya having a bindu in its own
Bhinn.ast-takavarga graru happiness and sweets (sunptvous meals).
The native engages himself In charitable deeds.
2. Metrury's transit In a blndu-less kal<shya quarrels, bad dreams,
urtimely meals and uneasy mtrtal state.
3. farrOiy welfare, maternal relations, equarilrity cl rrlnd should be
ascertained from the 4
11
house. literary talents and intellectual
pursuits from S" house and excdkn:e of speech from 2nd house
reckoned from Mero.uy.
Speech and artiOJiation
4. From Merary house sholt:l be strong to give p-oper
to one's thoughts by way of speech.
(a) If 2.t'd from f-1ercury does rot have been 1 blndu, the person
born may be <lJmb. ThiS principle will come true if f'.1ercury
and 2"' from Lagna are also associated with very low blndus
and In addidon have other affllctlon.s by maleflcs.
(b) U 2"' from Mertuy cootalns 1, 2 or 3 blndus, the nallve will
have unsteady and incoherent speech.
(c) If it (X)I"Itains 4, he will talk well 1M oriy when someone else
has Initiated the ciscusslon; If 5 01 6, his speech will be praise-
worthy and befitting ttl! oo:asiOn. With 7 ht will be a literary
giant capable of composing poems extempore.
S. If ?td from Lagna oontains 7 binc:l.lsin Merc...-y's 8hinnast-ak.avar911,
the natf ...e wfll be a brlllla rt orator.
Note: 2"' from MerQ.J)' will atways have less than 8 as
dOes not contrib\J:e 8 bindu in itS
6. In the from Mero.uy, If the bincl.Js are donated by malefics, the
native's wil be deceitful and arrogant In contrast, the
benefks gl"' harmonizing speech.
.,.
If the blndu Is O>ntrlbuted by:
Sun The speech is in the form of an il"f1)0Sing. wise COI.Ilsd.
Saturn The speech is deceptive, improper and at the wrong
time.
Mars The speech is vain-glorious and causes discord.
Mera.ary Sweet and clever speech.
Jupiter Distinct and wise speech, full of erudition and knowtedge
of proper
Venus Charming and delightful speech.
Moon Powerless Moon causes spe:h that iS sluggiSh and full
or doubts.
Stro"ll Moon wolld cause It to be just the opposite.
7. If t-1ercvry is posited in a h:>use having very IQ\v bindus, lack d
Intelligence and common-sense Is the resUt.
Note: MerCI.IY can never OCQ.Ipy a house having no blndus, since
(at least) Mera.y would c:c.'ltribute: z. bind.t in the firSt house from
itself.
8. Mertal lassitude iS the result of f.1ercury'S transit of a bindJIeSs
sign.
Prof"tclency in Astrology
Merc..y has always been assodated with proflclercy In Astrology
(alongwith Jupiter) due to its r!Jership d speech, disaimination,
fntelllgenoe Md knowledge <:A scrlptu-es.
9. If t-1ercury is in the 41h or 6t" from Saturn, wit h S or
more blndus and the from ... a is aspeaed or 00:'4)1ed by
the becomes an eminent astrologer.
10. If Ketu iS in a sign whiCh has at l east 3 bindus i n Mercury's
Bhimashtak.avarga and it is In Sll't t.>use or with SO' lord, the native
acquires great proficiency In all bran<hes (mathematical and
of astrology. KebJ is known to give a cert-ain awity to
the mind towards whichever pursuit the Intellect Is engaged.
417
Ex mpi#J. Let us e.l0mine the horoscope: of Mr. K.N. Rao, one of
the very weU kr.own astrologers of our times, who not uses
c:ifferent techniques for predictions, but also teaches
them. He Is also an exO!Iert orator.
Hercll'y Is exalted In his horoscope thouc;tl it has only 2 blndus In
its own Bhinnashtakavarga. Oef'iciency d bloWs brings Merwry's
exalted status a couple d notches down, yet Budhaditya Yoga
and presence d Ketu in tM yoga give it a certain ac(J.Iity. This
yoga is being aspeaed by Satrurn wtllch is the Sll'llord. There are
4 blndus in the 2"" from Mera.uy.
The other planet most closely related wi th astrology Is Jupiter due
to its spiritual and scriph.ral undertones . .l.Jpter here is involved in
a powerful Gaj Kesari yoga being in Kendra ) from the t-1oon.
Jupiter Is not only exalted, It also has 6 bindus In Its own
Bhinnashtakavarga. It has S bindus in Libra where the Moon is
posited. The Moon has redprocated ai>JndanUy by having 7 lllndus
in car.:er (its O't\ln house) where .l.Jpter is posited. Jupter is also
assodated with 38 Sarvashtatta bindus. But, the most. imJX)rtant
feabJre re&ated to prof'icienc:y in astrology Is Jupiter's aspect on the
2nd house from the Lagn.a and having 6 bindus there. 2n:t lord Mars
Is wei placed In Ulgla with Lagna lord Venus and 10'' IoRI
both beoefics. 2n:t house from has 5 bindus in
8hlm.ashtakavarga.
Thus, we see that the 2td house is very well fortified making
Rao an astrologer extraordfnalte and a speaker par excellence.
11. Mercury wel l posited In a Kendra or a trikona associated with 5
bindu.s or more. conjunct with or aspected 1>f Jupiter or satum,
makes the native learned in scriptures.
12. If MerOJry with 4 bindus is in Aries or Scocpio (signs of Mars) and
happens to be in the or Libra Navamsa (signs of Venus) and
is aspected by Jupiter. the perSOn is a bom poet_ ct"amatiSt or a
Uteraturer.
13. Mertll"y makes a person an inCiSive: log klan rf it i s aSSOCiated with
S bind us, Is conjunct with )Jplter and has an associated with Mars.
Exillftple : ).F. l(emecty was a prolifiC speech maker. His Mett\I'Y is
conjunct Mars with 6 bindus. Mars Is also his lord, the p&anet
responsible for giving him excellent personal relati ons and
418
c:ommunieatfons.
14. Find out the 59> that""' being aspected by Jup-er. Pick ovt ll>e
one whiCh has 4 or more bindus in Merwry's Bhinnashtakavarga. lf
edu::ation is started at the time when Mercury Is transitlrq sudl a
5tgn, even a "'k1tl..ey dull SllJdent prolldency.
IS. Fe< reMng ll>e blessings of lDrd Vlshoo, sho!Ad be
oone at a t ime when that sign is rising which contains the highest
birdus in the of Mercury.
16. Transit cl is used VfSY effectively bv astrologers advising
on stockrnarket ftuctuatlons and commodity-trading. All the feat\res
of Mercury's transit e.g., becoming direct,
combustion, change of sign are supposed to cause changes In
stO<kmarket trends on the shorHerm basis. Coupl ed with
Ashtakavarga binclls, the bazaarpt.ndits can add higher degee d
aocuracy to their precUction.
Moon's Ashtakavarga may indicate fluctuations on daily basis or
even within the day.
LOng term trends ate preclcted through the transit d slower
planets e.g, Saturn, Jupiter and Rahu, as also on the baSiS of
Chai .. a Shukla Pratipacla Chart.
Cliapter 30
(])iagnosis of OOeases -
9dercury
Diseases given by Men::ury are Chest, nerves, feve(
poison, nose, fever, itthes, f!ilcture c:l b<:rle, typl'v::lid, madness or
mental retzlrded, gall blbdder. !)Q!Iralysis, fits, indigestion_ cholera, mouth
and sldn clseases.
Now, MercU"Y Is also the ruler of tissues !\betS and cells and govem
lungs. Affliction to Merrury CNI cause pUmonary disease. f\rther, the
si!Jl of which Merc\IY is the lord, is c:omected with h,J''I9S
brord'lial and Similar troubles.
Pathogenic effects d M8'a.uy when posited in dtfferent sq.s are
as follows :
AriM : vertigo, neuralgi a, nervous breakdown, brain fever,
astigmatism, Insanity, hysteria. By renex action Into Libra; Plruitary and
functional disorders of the kidneys.
Taurus :- Speech Implements hoatseflf!S1:, parathyroid
stammering. 8y reflex ac:tion into S<xlrpio; nervous dislurbances of the
genito winbry fUlction.
Gemini: Gouty pains in the arms, hands and shoulders, deafness,
blood disorders, asthma, bronchitis, lntercoast!ll neuralgia. By reflex
action Into Sagitta<lus hlp and lhlgh pains.
Cancer : Stomach cramps, nc!rvous indigestiOn, flatulence,
alcoholism. and tendency towards colds. By reflex acUon Into
420
Capricorn, cofd5 and ooof/t, legs ard knees causing lameness..
Leo : Hoeart: palptatlons, Sow back pain, corM.tlslon, fainting spell,
By reftex action into Aquarius, tTfsteria, insanity, colds in the feet and
parjjysiS.
Virgo: Diarrhoea, dysentery, gastric ulcer, nervous debili ty,
asthma, shortness of breath.
Libra : RMal paroxysms, suppression of the urine, lumbago. By
reflex action Into Aries, blood disorders, breast and lung disorders,
nervous headache.
Scorpio : Neuralgic: pain the bladder and genitals, men:Strual
troubles, bowel disorders. By reftex action Into Taurus ruming pains In
the arms and shoulder.
Sagittarius :- Sciatica, neuritis, chronic coughs, pains In hips,
ttighs and knee joints, weakness in the back. By reflex action into
Gemini, nt/VOUS disorder-s.
Capricorn : Rheumatism, baCk pains, ame, melancholia, hysteria,
anxiety neurosis, mania. By reflex action Into Cancer nervous
indigestion, bowel dlsordS.
Aquarlu:r : G'o.llatory trot.bles, varicose veins, shootSng pains in
ll>e various parts of ll>e body, alle<gles, addosls, diseases inYOMng 11e!Ve
fluids. By renex action into Leo, Heart attack
Pisces : Phthisis, childlains, temporary amnesia, l assitude,
weakness in legs and feet. By reflex actiOn into Virgo,
bowel dl sordS.
MerOJry is cortn::cer of our nervous system. H! rules
order the brain nerves, nose-nervous, Intestinal nerves, lung-nerves
abdominal nerves. So ai'Tf affliction of Mercury by maleftc may procl.lte
serious and chroniC physical ailmtnts. soo the vital energy
Into our body and the Moon reg!Jates the flow d this vital enerqy.
By Mercuy can change the direction d this vital energy as well as
raise or k>wrer t heir vibratory force thereby causif9 serious physical
disat::mtes.
""
Various Diseases whid'l are governed by Mercury
ASHLESHA 9"' Star. 16-40' to 3rf'. Cancer Sign ruled by Moon
and Star by Mereu ry.
Diseases : Vitamin '8' defi ci ency, cold stomach, windiness,
windpres-;ing the claptwagm making it difficult to breathe, distillation d
rhetum, pains in knees and legs, drunkenness, phlegm, flatulence.
nephritis, hypochondria, hysteri a, dropsy, j aundi ce, nervous,
indigestion.
JYESHTA : In Scorpio 16-40' to JOO. Sign ruled bv Mars. Star
gowned by Mercury.
Diseases: Leucorrhoea, l:itedng. l'istt.fa, distemper
In secret parts, affliction of bowels, pains in am\S and shoulders.
REVA T1 : In Pisces 16.40' to 3d' Sign ruled by Jupiter and star
govorned by Mercury.
Diseases: Alxtominal disorders, troubles, deformities ol the feet,
intestinal uk"ers mostly due to drinkS and drugs, gout in the feet,
cra!ll'S Nephritis, lassitude, deafness, pus In the ear.
Significance of each Sub under Mercury
What each sub, under Mercury, indicates is given below:-
GEMJNI:
I. Hertury, Ma<s, MertUry : 0.()()-00- 1S320.
Injury In the sh:>Uder and defective weal cord.
2. Hertury, Hat>, Ketu: 1 5320- 2-40.00.
TIY(mus gland, oorrupted blood, fever, oollar bone.
3. Hertury, Ha<s, v.....,s: HOOO - 4 5320.
VOcalcon::l, throat. eatS, itches, disorders In secret parts, Inflammation
422
d periC!IIdium, SCiatica.
4. Hen:<.<y, Ma<s, SUn : 4-53-20 - 53320.
9\oulders Upper ribs, Arms,
5. Hen:<.<y, Ma<s, Moon : 533-20 - 6--4000.
Throat, gland.
6. Hen:<.<y, Rol-<l, Rohu : 6-40.00 - 8-40-0Q.
Septic throat,
7. Hen:<.<y, Rohu, Jupiter : 8-40-0Q - IQ-26-40.
septic throat, ear trouble, Mumps.
8. Hen:<.<y, Rohu, Sol\rn : IQ-26-40- 1233-20.
Asthma, Puss In the ear.
9. Hen:<.<y, Rohu, Merc<.<y : 1233-20- 126-40.
Hlc<XlUgh, ear b'ouble.
10. Hen:<.<y, Rohu, : 14-26-40 1513 20.
Septic dphtherla, jealousy.
11. Hen:<.<y, Rohu, 1513-20 1726--40.
Septic IJry cough, ear trouble.
12. Hen:<.<y, Rohu, Sun : 1726-40 - 18-06-40.
EoooopNWa, pain In the shc>IAder.
13. Hen:<.<y, Rohu, Moon : 1806-40- 19-13-20.
Ear puss In the ear. asUvna.
14. Hen:<.<y, Rahu, Ma": 191320- 2Q-OOOO.
Septic lnj<.<y In the shoulder.
IS. Hen:<.<y, Jupiter, Jupiter : 2Q-OQ-OO- 21-46-40.
9Nellng In the ear. pulmonary
16. Hen:<.<y, Jupiter, Sotum : 21-46-4() 23 53-20.
Injury In the shoulder blade, lrtlammatioo, paW! In the ear, loclne
infiltration in the upper lobe of the lungs.
17. Men:..y, Jupiter, Morcury : 23-53-20- 25-46-20.
Hiccough, asthma.
18. Men:..y, Jup;ter, Ketu : 25-46-20- 26-33-20.
Aeu-isy, PneurrtJnia, Pulmonary, apoplexy.
19. Men:..y, Jupiter, Venus: 2633-20- 2846-<10.
BronChitiS, Arins ciSOrder.
20. Men:..y, Jupker, Sun: 28-46-<10 - 2926-40.
Tl'r'oat affe<.ted. pain in the ear, bronchitiS EOSinophil'&.
21. Men:..y, Jupiter, Moon : 29-26-40 -
Aeu-isy, Pneunonla.
VIRGO
22. Mertl.I'Y, Sun, Rahu 000-QO- 11320.
careless about <let, abdominal diseases, intestinal tn::u,.,le, typhoid.
cough due to gas. a lltUe nervous debility.
23. Men:..y, Scn, Jupiter 1-13-20- 301>00.
Aatuence rever carefu about diet, defect In assimilation.
24. Men:..y, Scn, Saturn 3-0000 - 5-6-40.
Tapeworm, constipatfon.
25. Men:..y, SUn, Mercury - 7-()Q-OO.
Nervous breakdown, uloer in mouth due to tAcer k'regular
intake d food at short intervals.
26. Mertl.l"y, Sun, Ketu 7..(l()o00 - 7-46-40.
Food poisoning, cbrrhoea, spl"l..!.
27. MertLry, Soo, 7+46-40 - 1000.00.
Vitamin '8' deftciency and gas formation.
28. Men:..y, Moon, Moon 10-oo-oo - 116-40.
Trouble in the intestint and also in the breast. Hypochondrfa.
29. Men:..y, Moon, Mli<S 116-40- 115320.
Bleeding piles, irritation, uker In
30. Hen:.-y, Moon, Rahu 11-53-20 - 13-53-20.
Gastric lAcer.
31. Herart, Moon, )\.!)iter 13-53-20 - 15-4Q-OO.
Olanhoea, cancer in Intestines.
32. Herart, Moon, Saturn 15-'10-00 - 17-41>40.
causes constipation completely dries ....,, flat\lenoe, pain chronic
clseases gas formation.
33. Hen:.-y, Moon, Mercuoy 1746-<10 - 19-<Q-00.
Nervous breakdown, very poor digestion, very poor memory,
c:iSQ(der of bowels.
34. Hercuoy, 1oon, Ketu 19-<10-00 - 20-26-<10.
NeNOus weakness.
35. Herart, Moon, Venus 2Q-2HO - 22-<10-()().
Pain near sexual part.
36. Hen:.-y, Moon, Sun 22-<10-()() - 23-2Q-OO.
Gastric lAcer.
37. Hen:.-y, MO<S, Mars 23-20-00- 24-6-'10.
Ulcer in Intestinal part, ugbl aid needed, mO&tly duodenal ulcer.
38. Hen:.-y, MO<S, Rallu 24-HO - 26-HO.
Ulcer in intestine.
39. Hen:.-y, MO<S, Jupiter : 26-6-'10 - 275320.
Hertolly veoy 'IJid<. Good heoh. tr Jupiter, ll>e sub-lord, a
sigrlfiCator of 6" house, then only Cancer in old age.
40. Hen:.-y, Mars, Saturn : 27-SHO - 30-()()-40.
Health not good, worms in intestines, oonstipation.
Cliapter 31
9tlercury tfransitina tne Houses
1. Refrain from making statements that might be subject to
misinterpretation. A friend or neighbor may help you with
sy!Tl)athetic advice, and point out a way to eldricate yourself from
the disturbing oondltlons around you. A good way to promote
harmony with others is through cheerful correspondence.
2. A Shift in drcumstarcts may imprCJved financial con:titions for
you. lt may be necessary to make a determined attempt to dispel
clsagreemeniS that cause a rift with associates. Do oot albw the
situation to reach the breaking point Discord can be patched up
through a sympatheti c approach. Courtesy on your part shot.Ad
a c:c.-dial response.
3. A short vacation bip can prOYe Interesting and r&xlng, While )<)u
are on a short trip you may be able to acquire and impart a great
deal of worthwhile lnformaUon. A fawwable time to catch up on
t hat correspondence, visit relatives and make those necessary
telephone c.alls.
4. COl lect material for instructive articles en OJrrert events. Informatkm
that you need may come to you through \'lsitors to your home
a partnt may offtr excellent wl'lieh you shcu.ld ht< at this
time. An even greater possibility is a happy domestic life with a
tranqtM atmosphere surroundfng the home and farrity matters.
5. Aocwate judgement Is needed IX> cl fferentlate between dependable
and unreliable acquaintances so that you can decide whose
friendstip shoukt be retained Ot discarded. You may receive an
invit!ltfon to witness a ctamatlc speaacle. The memory of this
artistic achievement should remain with you fOt a long ....tlile.
426
6. A happy approach to your wor'k. Is indicated. Atterd to your jOb
with cheerful conftdence. The good reputation that you buik:l up
can bring lasting results. Watch that you do not overtax your metltal
capacity or let your mi'ld wander along supelfldal alms or impossible
attainments.
7. You may be able to remedy a difficult situation for an associate
wtllle there is favourab'e 'librations In this area of your chart. Your
mental awareness iS stimulbttd by partn!rShip matters and you are
at your best while dealing with partners in business affairs. Sign
oortracts, oorrespond, and do not be afraid to let yoU' opinions be
known.
8. Rlr rela:xatioo ready detective stories, mvstery thrillers and romartic
adventures. One c:l the best times to research your pet projec:t
besides you will find material on the subjed: easier to secu-e.
9. Pleasant comnv .. mlcatlons may reach you from a friend on a trip.
Also you may decide to contribute to funds whiCh are
to be used abroad or for tt-ose In institutions of higher !earring In
fact, you can promote goOd will on an international baSiS. It is
possible you may be asked to make some public awearance at a
peace forum.
10. Public opinion has to be considered In personal and business
arrangements needs further. What you do at present can affect
your reputation as well as your profession. The wortd is k>okWlg for
you to bring something of lmportan:::e out Into the open. Be sure
you are not stretching tht truth while the spotliglt is upon you.
11. EJO::eptional opporb.JnitieS for enjoyabl! experiences are all around
you. An unexpected award may be confe'red upon you for your
help In organiZing a successful sodal program for a club to wtkh
you belong.
12. A happy solution to penclng problems provided you keep your
aims high and are rtt trying to decei\'lt anyone. This is a tine to
prepare for personal action which will be taking place in the near
future. Test your plans, so that all tht quirks may M wort.ed out
Be ready, opportunity Is knocldng, you will open llle door provided
you have planned wtsely and well. Don't scatter your forces, have
a del'vlite goal and t.hen prepare.
Cliapter 32
1. MertlrY In the 511\ house fr amlcted by MatS or Herschel: there Is
some scandal or in repute pertairing to love alfairs..
2. Herti.XY in the house denotes much wordy warfare in the married
life and a marTiage partner who would be too talkative, critical and
argumtrtlJtiYe. Jf Merruryoccupies a good sign and iS well aspect eel
lhe partne(s talks would be fUI of wit and wisdom. But W oa:upying
a b!d sign ill aspected the woJJd be garrulous and
wookl talk mosttv nonsense.
Generally speaking, Merrury denotes a clevet wWe/husband who
may not always be relief upon if Mero.try is afflicted.
3. Merc...-y r. the house fl conjunction with or In se)llile aspect, to
Verus: the natm: is very fond d persons of young age and the
native may many or fall in love with a person muth younger than
l'lmsdf.
4. If there is no planet in the 7,. and Mero .. uy is the lord of the 1st or
and In conjurw::tion or sextile aspect to Venus and U'laspected
try any other t:'anet, the same effect as in No. 3 above.
S. MerOJry in 71t1 in conjurw:tion with or afflicted by Mars gives ttle
husband}Wife who Is quld<witted but sar<:astlc In speech ard hotly
argumentative.
6. HertLIY in 7tn in good aspect to Moon or Jupiter is a fa1o0urable
incleatiOn in a male nMtvity.
7. HerOJry in 71t1 in companv !Mth Sun would be ravowabl e ir ttle
&a.tter planet Is strong and lord of a good house.
B. Mertl.l"y in 1-" when it conjun:;tion with a planet takes the attrib..-es
of that planet and derotes a partner slgllfied by that other planet
428
This wo!Jd be: partlcUarty so if that other planet Is nl!ar the cusp d
the 7., house or if f'.1ercury be within otb of intkJence of that planet
(Also look to aspects It Is receiving).
9. MertLrY in 7"' house if unasptcte:l by any planet tjvf!S a husband/
wife who is lean and thin. young and very
10. Mero.ry In 1"' house may denote m.Jdl correspondence 01 traveling
in connection with mabimony. Tlis wot.*:j be particularly so if ttle
k:lrd d the house is in the 7..,.. or the lord d the 1" house is in
the third or there is some: aspect between the lOrdS of the Yd and
houses. If the aspect Is a favourable one traveling or
oorrespondenoo would resUt In success. But W the aspea be an
evi one, it would be otherwise.
11. If MereU!)' In 7"' Is not conjoined with any note carefully
the aspects it farms and the it ts in.
(a) 11 well aspected by Jupiter the wWeJhusband would be good,
de\lef, an:l progressive.
(b) If Mercury is afflicted in the .,.,., hoose the conjugal life d \tie
natm: may be: full of bickering an:f wranglng.
(c) 11 much afftk:ted and the lord r:J the 7"' house be not strong
it may tjve ri se to legal troubte in connection with marriage.
12. When there Is no planet W. the 7tt1 house and f-1erCI.IY Is the Ruler
cl the h:>roscope the native woiJd be wen ad!Ased to avoid litigation
because unless wei aspected by Jupiter such litigation, may result
urtaiJOurably for the native.
13. Mertl.rV in the house signifies worries pertaining to the financial
affairs of the partner. lt also denotes some quarrels In relaUon to
getting money from l'lu.sband/wife or their relatiOns. This would bt
partlcularty so 1r Hercuoy Is afflicted.
14. Mertl.rV in if in cancer; the natiVe: may be to irtenors.
1 S. MertiSV is a very volatile planet and easiy absorbs the good or bad
qualities r:J other planets In con)mctlon 0< In aspect with it. Its
p:>sition vis-avis other planets i s therefore very ir'r1>ortanl
16. MertiSV Is corts:ldered an eunuch and if thls planet be in a female
nati\Jity In the seventh house unfortified by any benel\c: and the
lord cl the sevtn:h is not strong, the ncrtive's h.Jsband may not bt
very virile.
Cliapter 33
9rt.ercury ana 9rt.arita{
The dualist MerOJry has a significance no tess than Jupiter bLt it is
neglected fX Is endowed with very l ittle as oo,._,ated to
hi m. 1'>1ercury rules fact.lty of brain, wisdom and intelligence, logic
and power of understarding. The mind is of the foremost imp;lrtlnce,
Being an Intellectual pl anet., Mercury can give highl y Intelligent,
ingenious and analytical brain ....t.ile affli ction of Hero.uy, on the other
hand. under certain speci fi c conditions, mean, loss of mental power
Into Insanity.
Age of Mercury according to sign under occupat5on -
Merc\.1')' behaves l b! a boy (Kumar Awastha) if It is posited In Gemini,
libra or Aquarius. It a desire of learning tiYoughot.t the
life, unexpresslbte enthusiasm and love and curiosity towards
knowledge of different subjects and thei r various branches. Such
persons have a powerful mental Inclination towards acquisition of
koowl edge and to understand the logic and ccwnplications. They are
also easily provoked to anger and passion, and talk too mu::h. They IJy
to 11"0ke other convinced bv their own views ard with logic.
In Aries, Leo and Saglttatlus, Merwry Is dealt as a youth {Tarun
Awastha). Natives having tl'1is posi tion of t-1ercury are most
knowledgeable: persons. They have a clear and wide t.nderstanding d
11"0ny They are mostly experts but such persons are also very
proud of their knowl edge, who do not usualy compromi se with the
circumstances. They are aggressive and can easily get Involved Into
430
quarrel and c;an create a dispute, as they annot tolerate their
oppoSition or even their criticism. They are very passionate too.
Mertll'y attains maturity in Praudha Awastha in Taurus, and
Q,prlootn. This is a good disposition d Mett\.I'Y as It provtdes balanced
thoug,ts and fvm ideas. The thoughts are not changeable and there is
no vaeillbtion d id!as. He 3dvises app-opri&tely and corrt!ctly. iS not
proOO of knowledge as such he never misuses his helllgence.
Mercll'y reaches Its okt age or vrld:iha Awastha In cancer. Scorpio
and Pisces signs. This is not a good dispositicrl of Mercury in general.
Tl'l!y mostly miSuse their brain power. They do not perform their dll:ies
in a manner. They have a tendency to criticize and try to find
fault In hers and are mostly expert In that They use their lrtelli genre
for the causes.
S'9nlflcance of Mercury - t-1ercury is the significator of speech,
intelligence, expression, discrimination, education, learning,
knowledge, mathematics, accounts, logics, medical knowledge,
profession, writing, publishing, l eafy trees, ability, trade, business,
pri nti ng work, composit i on, memory and remembrance, poetry,
swlpture, astrologer, aulhor. chief servant, clerk. teacher, nelgtt>ours,
advocate, broker, brai n, lungs, hancls, tongue, stomach, leprosy and
leucoderma, post and services, bank, insurance, translator,
mms, railway services and chartered accountant or accounts
offer etc.
The brand1es of education signified by Mercury - Mero.uy Is
the Karaka of education in general and i n part i cular it signi fies
mathematics, dance, teaching, medical sdenoe, astrology, grammar,
examk'latlons and tests, acts and law, pa.-nlstry, psychology, typing,
trigonometry, caloo1us, engineering Maths, expert. d finger prints etc.
Hen:I.I'Y also slgllfies atrbassadors cl t he w.ut:ry, policy
compromise, aa:Lmulation d wealth, minister and secret documerts
etc.
Professi on which come under the control of
Mercury
1. Writer, author. poet, Editor, 1'\CM!Iist and story or essay writer.
2. Teacher, lecturer, professor, research scholar and lrwentor.
3. Astrologer, palmist. expert .-. occUt sciences like numerolow and
face reading etc.
4. Trader, businessman and manufacturer.
5. Registrar, Pesnll<N vendor (reader to and seller.
6. Publisher, printer, cx:mpositor, p-oof reader and twist.
7. TaUor, engine, measuremtnt taker and stati stician.
8. Post master, cle11<:S, ser-AO!:S of posts and telegraph
9. artist, dancer, speaker and debater.
10. Logicians, Homeopath and Ayutveda
Role of Mercury In various fields of life - Merrury plays vital
role in the life of every native. It has a specific rde over certain events
or life which are mostly kept secret. In a few Charts when we come to
know about the ocrurTences that are outcome of the positi on of
Merc\1')', we 9f!l astonished and at times our views also ch.ange about
that partiwlar person. I am trying to draw t he attention of the readers
towardS follOwing aspects d life: wntre: Mero..ry has to play a key role:
1. Adopt i on of child 2. Ille-gi ti mate birthS 3. More than one:
marriage <.1, Concubine, keeps 5. Mental depression of Insanity. 6.
Btilliante, intelligence, ob$e1Vations, logi cs, power of expression and
inttrpretation. 7. Impotency. 8. Adultery. 9 . Affliction or nervous
system, brain hemorrhage, nervous disorders or even breakdown and
paralysis. 10. Skin i nfecti ons, sense or si ght, percepti on and
understanding. 11. Nerwus system, solar towels, arms, mouth
and tongue. 12. Traveling and joumeys, transfers and professional
promotions. 13. Teaching, writing, poetry, mails and correspondence.
14. Skill, methodical way of work. strong and retentive memory. logic
432
thinldng, researcl"es and profession etc.
0\A of all the nine planets, MetWry i s nearest to the Sun. The
of iS 3200 mik!S and it rewtves tht Sun wittlin
88 days. Mera.uy Is said to be an Dlegitimate d i kt of Moon. Sinre
Mercury i s a yomg, Prince the person born under ttle infl uenc:e of
Merwry generalty posses a yolthful a.pptarance. Mercury is ntutrat,
dualistic, ool d. moist. converti>le and eunuch planet tt Is oombust
within S0"30' of the S\1'1 and in no case Mercury is beyond 28" from ttle
Sun. It is said to bestow best results leaving tht! Sun.
9:roog and well placed f'.1ercury is a great asset to any horoscope.
That will providt immtn:Se astoriShing way of
of actions ard urdenaklngs, perfect logics, correct lnte<pretatlons and
art of expression, powerful speech and power of grasping t he
complications, Mercury provi des good skill and strong and retentift
memory, methodical way d wottOOg. acoount j(eeplng and systematic
mcuwlers.. Mercury is the chief planet to be considered f irst of all for
ech.ntion. An afflicted Mercury can aeat:e havocs. One may be a great
liar, cheater, oorrupt, mad d Insane.
The St..n and Venus are frtends while Moon Is Inimical to Mera.uy,
Mars, Saturn and Jupiter are treated as However, we have
observed that Mercury should be treated as an enemy of Mars. Mars is
Inimical to Mercury. Both show adverse inftuence when they oome In
contact with each other.
Here, we propose to deal with the role of Mercury over the
matters d the 7#1 house only. f\1ert:ury mostly exhitits its results in the
32rd year.
Mercury and the Seventh House - II Mercury is the lord of the
7"' house, I.e. when the Lagna Is ruled by Jupiter, Mercury wHI
automaticall y own the 7ft' house and in that case. if Merwry joins a
malefic, specialty Mars and obtains the Navamsa of its debilitation or
Inimical vargas or Merc..ry Is combust and It such an afflicted
Mertury fall In the 611\ or the 8"" house as the i"' lord and is al so hemmed
in between malefics forming Papkatari Yoga, the wife of the native kills
pathe:tkall y Inch by Inch and cause misery to the whole famil y.
Suppose HerOJry QV.'ns 71t1 house and it is conj:l ined vnth Mars in the 8
111
house, saturn jOinS J'."' house: Md Rah.J 8_.. house an:S Merrury obtains
ttle Navamsa d t-1ars. If such a combinati on Is J)'esert In the horosoope
of a native i t mil'/ be under5tood the actions of the wife will be
responsi ble for his uooatural an:S untimely death.
Mercury and Jupiter in t he house: show caljugal happi lle"SS
protAded they are related with the 1" or 2"" houses and are absolutely
unatrlkted. Meroory, Venus and Saturn, if in the
house, m8ke the native ad.Jlterous. In case Mertl.I'Y owns th! 7,. and
joins venus and Saturn, In one way or the other, the nattve will be
attracted towards wtves of others.
Merc...-y has a very spedlk: role to play kl the matters of the 'Ph
house. If Merwry joins the 7
111
house and the dispositor of Men::ury is
well placed, it provides the native the art to win hearts of women and
natural ability to cteverty lftl)ress and attract women and natural ablltty
to cleverly i fl'1)ress and attract women towards him. He will be
favoured by women of his own choice. Herrury in t he 7t" house
protAdes an Intelligence wife. She likes to be wei dressed and is well
qualifted. She mil'/ not belong to a h9l family bvt wil
nat .... e. Merrury in the 7"' house attracts t he nari...e towards other's
wtves. He gets lnsplrauon and st:tength to wOtk in the asscxlation of
females and loves t hem too, depending upon the exact situation.
Merwry OJrt.ails the longevity of wife, if posited in the 7"' house for
persons born under Scorpio ascendant Whenever Mercury Indicates
liaison with a woman in any horoscope, it wll be with a yo\l"'g woman
because Mercury is regarded as k...mar. It may also indicate p-ostitution
under certain specific afflictions. Placement of Mercury In the 7"' house
wit hotA affliction pro\lides an intelli9ert and good looking wife whose
breasts are well developed and proportionate. She al so begets goods:
nutroer of ctllk1ren.
If t-1ercury is associated with Jl4)iter in the J"h house, th! natiVe
will be fortunate to get a good wife and sex with a nlJ'nber cl
other becMJtiful women. If Venus i s accompanied with Mert\I'Y in the Jlfl
house, the native will be liked by iooumerable beauti ful females.
434
In m05( of the cases, presence of Mercury in association with Mars
in the house has p&ayJ havoc. If f\11Jrs and Mercury an!! present
anywhere In the horoscope, the result will be klauspk:lous. If Merc:ury Is
Markesh i.e. lord of the 2"' an:t J1"1 houses and j)ins the 1" house in
ass:odation with f\11Jrs, tht death of the: huSband by one way or the
other. will be In evtdence soon atter the marriage.
Mars and venus can Indulge one In deep carnal pleasure or love
affair followred by physical relationships. When Merc:ury afflicts this
combination, takes place as we have studied in a cases
desalbed here. l n the present case Mertuy's association created many
disharmonious problems in man1allife. The native got i'l'\ilffied at
around 25 years age. The wife of the native came to know about
one d affairs of her husband )Jst after a of years d
marriage. Serious nisunderstandlngs developed between the couple
and they stopped seeing each other. In spite of living in the same
house they have not t211ked to each other for laSt fifteen years. TM
nattve Is forced to take his meats and breakfasts olt.Side. The wife of
the threats him to disdose the affair of the native to the
husband of the woman wh:) was inwlved with him. ThiS thrt.at always
stops the native to seek separation for the sake of his beloved, whose
life will also be spoiled like him if he were. for separation. r-1ercury should
be held responsibk! for such tragedi!s in mariUII life.
If MertLJY is well in the 1" house without any affliction. the
nattve will be bestowed with al ldnds of happiness r. marital life. His wfte
will be beal.tiful, intelli9ert: and tactflJ. Sle wil be submissive and kind
hearted too, bl.t hot tempered. Similarty if a wel l placed and
unafflicted MerOJry owns the 7th house, same results should be
ex.pected. Unafflicted Meroory is as good as a"( <Xher benefic planet
afflicted Mercury creates disasters. In the ab()o.le examples. We
have studed !tie Mercury Is heavily afflicted by Mars and r-1000. Mars Is
the bitterest enemy of Mercury. Placement of Mars in the sign of
Merturv or Mero.lry's ocxupadon of f'f of the sign rul ed by Mars is most
undesirable. Conjun:tion of Mars and r-1ercwy in the fo.h house or in
respect to J1h house or its lord Is most adverse so much so that It can
even kill either of the partners or can depress one to the extent that
he or she may commit suiCide. Such a combination can ruin the marital
life. Multi'* marriage are also caused by the affliction of in
respect to the house:. we have obServed in the abOve illustrations
ttlat affliction d Merwry has resutted lrto more than one marriage In
nuni)er r:l ta$eS.
Herc...-y is also for ilegitimate relationships. If MerOJry is
asSOCiated with the knd of the Lagna or the 7tro house, the moral
character of the native will be questionable. O'le seeks pleasures from
persons ottler than tis own wife or l'l.lsband. This type of conjunction
of has been named as Mbdan Gopal Yoga which signifies IOtY
character.
MertliY provides a 9)od and wife, if it joins an odd sign in
the ,. house. The fact of the native will be long and will have
authoritative lto<*s. Her hair will be black and long but cky. She will often
quatrel with the native and may pass insulting remarks.. She will
strong and manly physique. Her voice wtl not be sweet and she will not
be but will be intelli9<nt, educoted and fond of logic, beoutif<.l
Silky black Shining hair. She will pay due respect ard honour to her
husband and also love hkn even It he Is l esser ec:l.lcated than her. She
will be prac:tk.al, be.cMAiful and attractive. Jr HerOJry CXQ..Ipies Aries or
V11r90 in the 'fJ' house, the rise d fortll'le of the will come in
evidence orty after marriage. He will have to undertake lot of travel.
Proper judgment of the position of Mercury Is most essential
before arriving at any conclusion with rf!911rd to the matters of the 7!1:1
house. An afflicted Mercury, if it influences the "!h house either be
placement or ownership, aspect or conjunction with the 1" lord etc. In
any way, wll resUt either into mul tiple: r1"01Tiages or camal relationship or
lack of bliss d married life and marital harmony, death d either d the
partner, cona.bine or kept, tenslonous married life, sepatation or loose
moral chatilCtt:r.
Herwry has only two enemies MatS and Moon. No other planet
can atrlic:t MerG.Iry as much as Mars does. In other WO'ds afflicdon of
Mars by Mercury is heavier than by any of the other planet. Placement
of MatS In the 7th house ts bad for longevity of the partner but It
becomes stronger If Met0.1ry afflicts Mars in the '?' house. Similarly ttle
436
goodness ol any house wil be curtai'ed if that house comes under ttle
of affliCted f\1(!rcury. In 41J'> or S'" hOuse it can result into
mental depression, hysteria or even lnSMity. In se' house It may hamper
the birth of dli lclren or may cause t he birth r:l illegitil'l"'ate eNid. tn latter
c.aSlt position of the: house Shoukl al so be looked into in respect d
moral character. We do not Intend to touch the ptospe<ts of the S ..
house here, btA in oomber of cases, we have found that a women
having an affWcttd 1" \M:nus or having a mutual bchange d
Navamsa of Mars and venus, Saturn and etr:. obtahs a child by
her lover provided S"' house is owned by Mercury and afflitted MerQ..Iry.
In the case d iUegitimate Child birth, position must also be
taken Into consideration. An unaffticted Jupiter havW'Ig an Influence
(!Ver Se! house Ot Meroory Ot Ovet" !)'l'l lord will never permit illegitil'l"'ate
birth. In that case possibility of an adopted Child will b! there.
If Melts and Mercury are in the st" house ror Taurus ascend&nt, one
m&y himself or herSelf be an 3dopttd child. There are so many other
conditions with one wlll be adopted bv others. Generally Mercury plays
a significant role in almost aU such cases. It is easy to Yite about any
planet-ary combinatiOn and i ts restlt but it iS real ty very touch task when
we face diftlrultles due to other planets and their varied positions.
When a combination come under the influence of rv .. unber c:l
other p&a.netary conjl.l'lction or aspect. and a few are malefic and oths
are benefic among them, the judgnent contains lots of oorluslons. So
the vast study or practical horoscope can enable us to at dle
correct j udgment without any confusion. The: subject stculd firSt be
sludO!d deeply and should be applied In nurrber of cases to Judge the
correctness of reSIJts c:l any oorrbination in the practical life. Jn two
horOSO)pes, the SCif'n! combination give different restlts due to various
other dfferent factors. Proper Judgment Is the test of our knowtedge
and sldl of ir(erpretation.
However, we conclude that r-1ercury is no less Important t han
Jupiter in its scope and f ield and equal importance must be
attached during interpretation of the resul ts of the house having
concem wfth. lt Is Mercury only which provtdes us ski ll of Judgment and
art of interpretation of any birth chart.. Witt.:>vt strong Mercury, one
can !>om! rich but not great, as Mercury is most essential in all cases.
The sex outlook of the Signs ruled by Mercury
The outlook of Gemini Is a purely mertal ooe. Sex Interests are
quite secondary so far as the sign itself is concerned, though other
positions in th! hOroscope may bring into
Gen*ll es""'tlally a cold-blooded sign, without affection and
morals. l t is a kind of living Nways seeldng to know ltle
reason for everytting. Atways, and reactions. PS)Chologic:al analysis is a
Gemlnlan habit, usually accompanied by extr emely, but quite
unintentional and unconscious, cruetty.
It WCirts to "see the wheels go rol.l'ld", is entirel y unmindful of the
effea d the process upon its victim.
The normal atti tude of Gemini to sex matters i s not only
experimental, b.Jt very largely cool, cala.Jtating, and setftSh.
It Is usually considered a fickle and changeable slgl\ often with
considerable justification, but actual y the fickleness arises not from
wandemg affections but from a desire to attain its theoretical ideal.
Unfortunately ttis aim, while always un.satlsfactory, Is for Geri'\1
entirely inl>O<SSible for achievement. The Ideal varies aaxmllng to tne
mood d the moment. and may swing from one extreme to the other.
Gemhl i s a difficult sign for most people to oodetstand, It is much
more lo9ical t han the others.
Its anal ytical nature produces a tendency to read between the
lines. to imagine that other people mean m..tCh m)rt than
tlley say.
The mertal ql.ickness also causes rapid changes cl thought which
leave the natives of slower signs plodclng along the road which Getninli
has covered in a single leap.
Slowness in others is a constant SOU"Ce d amoyance to Gemini,
which is, at the best of times, an Irritable and highly-strung sign.
438
The \We c:K" h.Jsban:l of a Gemiri native must never be mentally
dull or OOtuse if happiness is to be m8irtained.
Owing to his sensitive nervous system and mental nature, the
Gemini person is subject to sexual peNersions, pert\aops especialty to
sadism. on acx::oll'\t d the: natural crUI!Ity of the sign, and its lack d
emo<lon ard sympathy.
Under affliction, Gemini exhibits c.rimlnal tendencies. lts natives
readity develop into forgers, thieves and confidence men, where Cf.Jick
wits and nimble: fingeiS are essential to suc:O!:SS.
Bigamy is also in keeping with the Gemini natl.re;, though probably
less so than in the case of Sagittarius and Pi sces which are more
convendonal signs, and therefore set more store by the appeatance d
respectability.
The clJar.ry or the Sign, hOwever. rs u$U3Ify in sex matters.
Natlltes of Gemini often carry on two love affairs simt.ltaneously, and.
after marriage, run c:buble
VIRGO
Virgo Is the natural sign of Wgl nity, therefore does not really
favour marriage at all.
The Virgo is usually suffiCient urto to a or
lesser extent. and can usualty adapt himself qutte comrortabty to a
celiOOte life.
Tt'e sign is a very ci:SC....,..,ative and critiCal one that iS not at all
easlty satisfled. It Is fastidious, dislikes being touclled, has a deep rooted
tear d irtection, all d which dlaractetistics J;fay an important part in
the sex oLtlook of itS natiW.
In women, VIrgo produoe a form of homosexuality.
This Is more unusual In the case d men. r-1asochism is probatlly the
commonest perversion.
In marriage, Virgo is may be much more affectionate than
appears on surface, b t he shyness d sign prtvtnts
any eJChlbltlon of affection.
Virgo make a faithful partner, not usuall y an exciting one.
As a parent,. Virgo is not special ly successfuL The dry, matter-of
fact, critical and faddy or fussy manner is not to win the
heart of a child very reodiy. As a rule, there ro very deep love of
children.
They are apt to be too much of a nllsance, too untkty, too noisy
to be wel come in t he house. As mi ght be expected, Virgo nearty
always preftrs girts to boyS, &a.rgely for these reasons.
Neatness and tktiless are usually strong VIrgo characteristics, and
are by no means oonfined to the WQmen of the si gn.
This tendency is shown in style of d-ess, also in care lavished on
the home and posse,ssions.
to this general tidiness, however, are not un::ommon.
c:ne meets of Virgo who appear to be quite careless and u,.idy.
The cause is generaly to be foood elsewhere In the horoscope,
but. even in pronounced case of appaorent carelessness, a love of order
or method is somewhere in and affects some particular thing.
Virgo rarely praises anything, more oft:en grumbles and Critk-ltes.
TNs does not mean very traJdl, and Is a matter of habit rat her
than the expression d real disapproval.
The general efficiency of the sign its native to assume t hat
no one else can do anything so well, 50 neatly, 50 methodical ly as
himsetf, and he is therefore relucta,. to deputise work to others. lf
forced to cb so, a,sists on interfering with detailed as to
ll>e exact methods to be employed.
Under affliction. Virgo makes carping critics and turns its women
into Shrews and SCOlds. Normaly, it can make a su:cess d
marriage if the partner ts of a somewhat similar character.
440
Cliapter 34
ll'fanet.s afllf fProjession
- 9dercury
Mercury represents learning, writing, arts, sculpture, medical
profession, expertise. ministership, message, wit, devemess, duality,
fame, astrology, wisdom, chanting Vedas, priesthood, birds, fame,
literature, p:>etry, scriptures etc.
Mercury Indicates mathematicians, traveling agents, poets,
advocates, printers, publishers, orators, ambassadors, clerks,
astrologers, travelers, secretaries, interpreters etc. In Mythology,
Mercuy iS regarded as the god of eloquence and commerce. f'.1ercury
strong and fa\40U"ably placed, makes one an orator.
Hertll"y Is a qtAck moving planet. He thus represerls speed. It Is
also called as the winged messenger. Therefore, it represents traveling,
carrying messages, tetter's, mailing etr:.
Mercury is the planet of wisdom. Favorably posited it makes a
person very Intelligent, wise and studious.
Mercury I s changeful. It denotes changes, and lack. of
concentration. It makes a person un5teacfy and fond of changes..
Mert<.rY represents plurality. It is dualistic. It <jves Interest In many
subjetts.
Mercury is convertible. This is why, In Hindu Astrology, It Is
regarded as a benefic when it is combined with benefics. And it is
regarded as a malefi c, when i t i s combined with mal ef-cs. Thus ks
nab.Jre varieS as quality of the planet with wtic:h ft iS conjoined.
ThJs It does not act fldependentty but In a subordinate position.
Mercury renders Its subjects active, versatile and disposed to
business and commerce. It makes one weiJ..informed and in dle
pursuit of knowledge.
Uterary men, aa:ountants, SChool teaChers, secretaries, book
sellers, clerks, postmen, messengers, engineers, radio. Wireless,
post, letters, typing. press, paper, cotton. representative.
seaetary, agent, dk, astrologer. b"ade of foreign goods, import
export, thread, mcury, tin, accounts, audi ting, able lawytr,
commissioners, antlassadors etc., are all ruled bv Mercuy.
Mercury represents Mathematics. It Indicates lecturing too. As
Mars also is connected !Mth Mathematics, when these are combined or
connected one may be a ,..t!l thematics lecb.Jrer.
MertLrY denotes Astrolog( too. ,..1ercury in abi lity in
Asb'ology, Combination of Sun and r-1ercury can denote Astrological
Profession. (SI.Il is a Karaka d professiorl. Connection d Merwry with
4
111
, 101:t1, and house also can indicate this protession).
Satyacharya says that Sculpture, astrology, recitation and
composition d poetry, research worSe. dealing In cloths, and catching
birds and animals are also ruled by Mercuy.
442
Cliapter 35
Conjunction of Various
(]'fanets 6y ?dercury
Mercury Conjunct Venus
If MerclWY has conjl.llc.t venus, the person liveS a life of refinement
and oolture. He is delicate, sensitNe, and mentalty blessed. He is bright
and dleerf\1, optlrristk and humorous. Above all other astrological
aspects, t his conjunction indicates musical and poetic tal ent. The
person is expressive and his greatest fulfillment comes from sharing his
wonderful mental harmony with He Is and
often brilliant There is a marked dexterity to the irtetlea. His
mWld is In a state of restful alertn(!SS, ever ready to feel out, or
obJe<t""ly analyze, a Once he does ttis, he Is then able to
generate t he most predse and appropri ate response. Uke Paul
Newman and Robert De Niro, who have the conjunctiOn within two or
three degrees, the person can charm anyone. He knows which words
cause what effects in whom.
The person is drav.on to all of the arts. He is graceful, agreeable,
and lighthearti!d. he is also a creature of comfort He: crllves
luxuries and the good life. Unless Saturn is strong In the birth chart. the
pel'$0n has no patience for disdpline and responsibility. He detests hard
wortt. struggtt, an:t dirty handS. H4! may be lazy, ShallOw, and in:tulgenl
He powerf!Aiy dlscotnlnatlng, and knows art Mel beao.ty better than
anyone. He is appreciative. However, the person expects to receive
pleasure and be: treated well. He: avoidS <iffiCUtt d challenging people as
as stressful SituatiOns. He has no use for austerities, the nqged life,
or any variation of .. roughing it". The pei"5Qn may, at times,
friendS and l cwed ones with hi s nellrhedoniSm and urYtVil ingnes:s to
comfort adversity. I n this regard, the person may be selfish and self
centered.
Tile person i s IOnd, sympathetic, and fun to be around. He is
taelfU Md clpiOm.?Jtic. Women at elise wi th him. As
wnus rules the love life,. the person gets an lntelllgetl, COI'M'Iurkatlve
spouse, one who is youtttul and beautiful. Unfortunatety, the Ptner
m&y be fldde or emotion81y detached in the relationShip. The person is
very social. He wears rice clothing and has a youthful appearance has
entire life. He may be somewhat effeminate due to hi s grace and
sensitivky. He may also be accused cl vanity. Aside from music: and all
arts, he i s attracted to faShion or d!Sigl, drawing, and writing
(but not the tedious sort). If the conjunction is f)(tremely dose by
degree. the neNeS wil be too delicate ard the person suffers mentall y.
In ne.arly all cases, there is an occ:asioll81, but profound, stubborooess:
because the petson Is so enamored wtth his own logical and mental
process.
Mercury Conjunct Mars
If is conjunct Mars, lhe person iS mentaUy aggressive. He is
direct, outspoken and a good argument. The person Is talented
In mec:hanks and has great maooal dexterity. He is attract ed to all
technical ftelcls such as archite<ture, engineering, drafting etc. He is lhe
best troub&t-shooter and problem-sol\. The person Is competitive and
nothing but goal-oriented. He is successful, and cbes It takes
to obtain desired results. The person is ingenious and easily solves
puutes. He Is perfectionist and a great detail His IYW'Id is sharp
and al ert: he learns at lightning speed. There Is a magnificent
practicality to the person. He understands cause and effect better
than ar'T)Ione, and may a genius at manipulating drcumstances to
get wtlat he wants.
Tile r-1<ti'$Mercury conjunction is a fascinating one. AgC7essive
MarS benefits greatty from ass:oci8tion with inttUectu81 and senSitiVe
Mercury, whil e Mercury Is burnt by they fiery nature of Mars. The
person's peace of mind is definitety dist11bed. He may have a llot
temper or be on thl! side.
Thl! pers:on iS exdtable and M:s powerful h8s a heattby
sex drive. There may be an Indecisiveness caused by his wavering
confidenc:e. Because Mars rules sexual passion and is conjunct Merwry,
person is fascin11ted by intellectual, communicative lovers. (or
she) may also be extrerrely tal<.., b'( yootttul, fld<le types. The person
is stTon9-willed and has powerful blood. He is adventurous and active.
Mercury Opposite Mars
If Mercury is opposite Mars, the person is a professional u itic. He Is
perceptive and sees peopl es' flaws and imperfecti ons wlhout
sligttest effort. His mhd Is shllrp and and works too
for his own good. There Is great Impatience and nervousness. The
person may be irritable and have a short, hot temper. He may
problems d11lng chikllood with hyperacttvity or tantrums. The person
is a great problem-solver. Unfortu'lately, his morals are not the best., as
hi! consi dtYs life a wio-lose game where "the g:>od guy finishes last." He
is fall'ly selfish, and his first task in life is learning how to beat the system.
His SJ"eat est pleasure comes from circumventing or by passing the rules.
The person may li e regularty or fall to keep hiS w<Xd. He believes the
end ju.stlftes the means 8nd iS not partlculal'ly concerned with Integrity.
In e)(l:feme cases, there may be stealing, shoplifting or aimlnal activity.
The person clrect and blunt. He often speaks before lhlnklng
and may thereby offend others. He has the most energetic mind and Is
witty, sarcastic, and humorous. The person is as p-ad:ical as can be and
he: teams very quickly. The person must beware d headaches as well 8S
problems with the lungs, Intestines, and nervous system.
Mercury Conjunct Jupiter
If t-1errury is conjunct lJpitet; the person is exuberant.
He is excited, enthusiastic and wonderful ly expressive. He is broad-
minded and open to new concepts. The person lows words and excels
In any secretaria,, literary, or oommunicatlons career. There Is an
expansive quality to the person's mind and he is constantly cOfring up
with creative Ideas. He makes the best advertising agent or plbllcist.
He absohJ:ely lives in the mometlt and takes cMe of letters, calls,
and other organizational details without any apparent loss of energy.
The person is optimistic, hopeful, and does not get caught up in
df!t)re:sslon or the good word. He is generous In spirit and wants
evayone to enjoy the others feel genuinely uplifted. His greatest
happiness may come from supporting other peoples' projects. He is
popu1ar. well-l iked, and may be the life of parties. urtortunatety, the
person may be lazy.
Mercury Opposite Jupiter
If Mercury is opposite Jupiter, the person has no sense of mental
proportion. His thinking is too expanSive or exaggerated, and his
judgement may be dl.torted. He may gl\oe poor ad>lce to others. In his
great optimiSfl\ he is too certain of his opinions and does not consider
all the: facts and partiaJarS. is blinded in tiS beliefs and stuCk in his
convictions. He has a rich Imagination and fartasy life, and thinks In
grandiose terms. He may have his hands in too IT'I(Iny projects ttle
same time. Some individual with the hard MercuryJupter aspects are
fuzzy In their oonwnunk:atlons and amazingly unable to oome to the
point.
The person Is watm, generous and sympathetic. He Is good
natured and wants everyone to enjoy. He is charming and loves to
party and indulg(! in the senses. Because of hiS expanSive viewpoint,
the person does not rrind lying. He tells small fibs or white lies
constantly, whenever thev setve his interest without hurting anyone
elSe. is favored and the person gets great pl easure rrom
experiencing all that life has to offer.
...
Mercury Conjunct Saturn
If t-1ercury Is conjunct Saturn, the person lives a life of
concentrated His nW'Id is slow, but deep. There is logic
and reasoning power. The person Is cautious and serious. In the
beginning ct life cotmn.nlcative abi lty Is significantly lrhlblted. He
may even have a speech defect, lisp or stutter. As a result., the person
Is shy and self-consdous, and he works diligently to correct and
lmpetfectlons he feels he has. He may be a slow teamer In school and
find himself behind his peers. However, he patiently applies himself and
in the end may SLrpass all others. He is exacting and very careful to
avoid mistakes. Ji.S he gains In maturity he i s likety to be-come an
authority In his fldd. If the rest of the dlart Indicates a and
intellecb.Jal life, the person may be profoundly pen::eptive.
The person is practical and d:>wn-to-earth. He i s not easily fCIOied.
He is adept in math and science and enjoys facts and figures. He Is
object-.,, rational and detached In l'ls 1111nldng. He Is methodical and
systemati c, disciplined and responsible. Because Mercury rul es the
nervous system, and Is so harml!d by satum, the person may have
netVous problems or sl.lfer the most lntef"6e lack of confidence. He
may be fearful and have tremend<XJs ciffiOJity improving or overcoming
psychological compk!xes.. Health-wise, he must take care: of his kmgs,
lntestr.es and nei\I'Ous system.
Mercury Opposite Saturn
If Mercury is opposi te Saturn, the nervous system is under
continual pressure and the confidence is acNersety affectecl. There may
be: a deeprooted inferiority complex or a sober and solemn personality.
Eatly chik:lhood may have brought difficulties whi ch conditioned the
per$0n to e:.pea thin95 to tl.rn out bady during his entire life. There is
a great fear of and a itidsm. and tht person may find it impossi>le
to take risks. On the positive side. If the rest of the birth chart Is
powerful and indicates ani)ition, the pe1$0n may be cisc;.iplined and
Wl'!ll organized. tit'! capable of k:lgic, and predsiOO in his
work.
Because is the natural ruler of the t hird !louse, there will
be problems or discoid wi th Si:lings or relativeS.. some: individualS with
hatd MercurySatum aspects are sl ow In thought and have trouble
learning. In nearly all cases, there is a danger of narrow-mindectless and
an unwillingness or inability to open up to tht'! support d others. Tht
person is extremely sensitive and vulnerable, and ftnds It hard to
acknowledge tis limitatiO"'s and deal with them in a way.
He is strict and rigid in his t hinking, and unconsciouSly pessimi stic about
change and transformation, espedally In psychologk:al or emotional
areas. He would do wel l to QJiture a sensed experimentation, without
attachment to the outcome. If he is not careful he may become a living
example of dt'!nial. Tht'! person is cauti ous and tit'!
to culttvate hJmor, fund and ec:cltement.
Mercury Conjunct Uranus
If r-tercury Is conjunct Uranus, the person lives a life of
independent thinking. He is original, inventive, and higNy alert. The
mind works at lightning speed and there are continual nashes of
Intuition. The person may be brilliant or a genius. He will be talerted In
Astrology or any ocaJit art. He may be drawn to math or science. The
person may be high-strung and easlty excitable. He has difficulty
appredating lUes, regulations and the sluggish paoe of ordlnafY He
is geat annoyed by slow thinkers. The person a ife of incessant
actiVIty, and his body will eventuauy pay the price unless he l eams
lntdllgent restraint and the Important of taking care of himself. Hls rrlnd
may exceed his capabilities. Tht'! person i s elq)eri mental and entirely
unafraid d new endeavors. He may be Inspired, shrewd. ard insightful.
He Is also potentially st\Jbborn, self-willed. And Infatuated with his own
mind. He occasionally may seem fanatk:al. There is a need for patience,
di scipline, tolerance and hli'Tlility. The mind is dynamic, positive, and
outgoing.

any opposition. The person IT'IaY absolutely, even if quietly, disregard
wis:hts d ()(hers in order to follOw the clet3tes: of his own mind. He
may Ue and regul arly fall to keep his word: however, there Is no
I'T'Iali c;ious, or even purposeful, intent in su::h actions. The pel'$0n simply
has difficul ty asSOCiating form and stru::ture with the though process.
He forgets his prorNses and conmltments because he lives kl a world of
mental unboundedness and there is littl e connecting t hread from
moment to m::ment The person iS refined and cul b.Jred. His thinUlg is
sublime and traf\SO!f'ldental, and his consciousness moves unfettered
through different realms of ex-ist:enc:e. He loves meditation or any
disdpUrl! whiCh makes use of his limitleSs perctption. Astrok:lgy, occult
sub}ects and spiritual endeavors may all be vital features d the person's
life.
Mercury Opposite Neptune
If Mercury is square or opposite Neptune, the person Is mentally
unfocused. His t hinking i s douded by his feelings, and he is often
confused, scattered or diffusive. He lives by psychic not
rational thought. He does not create enough mental boundaries for
himself and is theret'tte an easy target d deception. He loves gossip
and other emotionally stimulating diversions. He is concerned with
sensations and abstractions rather t han details, facts and There
is a rich and vivid imagination, and the person may lfve a fantasy or
dreamlike exlstenre. There is a need for p-actlcality and realistic vision.
The person &acks conrldence in a major way and may be powerfUlly self
deluded. He may i gnore, or totall y deny, troublesome aspects d his
existence which he: is afraid to coriront He may nagrantly lie to himself
as well as others, t hough not purposefUlly or out of harmful lntent.
Decision maki ng may be a source of struggle. The person is
metaphyslcal y oriented and open to the occ-ult . He believes In
astrol ogy, the psychic workS and aU phenomenon of a non-physical
reality. Art, music, poetry and other sensual cUtural pursuitS are
highly fawred. The nervous system i s and the person must
avoid overwork and stressfU situations. He may be prone to such
illnesses as epilepsy, asthma etc.
450
Mercury Conjunct Pluto
If Mero.ny Is conjt.net Pll.to, the person lives a life of problrQ and
observing. He i s as a detective; he is curious, discriminating, and
determined. escapes his eye. He is the best analyst and
psychologist, and often makes accurate judgments wN"dl come for
more quickly than they sholld. The person k>ves knowledge, and is
computslve In his desire to kR:>w and l eam; ttis ba!Uiring knowtedge Is a
major purpose of Ns life. He has a deep, penetrating mind and wants to
get to the core of all matters. He may be particularty relentless v.i'len
pursuing an issue. Tl'ere is a $prib.Jality or profotl'ld wholeness, to the
perSOn's thinking. The person ts of profoll'!d concentratkm. He
may have easy access to his unconscious mind. It Is audal that the
person be extra sensitive to the effects of his mentality and
expressions. His thoughts carry enonnous power and his words
w-eat Impact on peopte's lio.es. He can gain more from affirmations,
positive thinking and aeative visualization than anyone. He is persuasive
and may live to disseminate knowledge. On the negative side, the
person should beware of the tendency toward manipul ati ve or
overbearing cornrn.mications.
Mercury Opposite Pluto
I f Mercury i s opposite Pluto, the person is too intense and
subjectm In his ttl"<lng. The nind Is attadled to the ego and the
emotions, and the person is stubborn and opinionated. There is a
possibility of p-ejudice, bigOtry, and deeprooted arrogance. During
childhood the person was maniP\Iated and dominated in his ideas,
concepts and phii05QPhy. The person is direct and bhsat He
chooses his words carefully, and knows exactly how to verbal y affect
others. He iS capable of extremt sarcasm and Because the
nervous S')IStem Is adverseJy affected, there may be resUessness and
impatience. Illnesses are caused by stress, strain and ovework. The
lungs and intestines are vlln!rabJe and there is susceptibi ity to asthma,
epil epsy and other nervous aliments. The mind Is analytical and
penetrating. The person i s acutely aware of peoples' flaws and
weaknesses. He is quic;k witted, worderfu1ty curious and interested in
secretive or ocaJt knowll!dg!. to l earn everything he can in
life and get to the oore of all mattets. Unfortunately, he may not be
QPe'l and trusting enough to benefit from the wisdom cl tis peers and

452
Cliapter 36
Vpayas - !Makfic !Mercury
Maltfic MerOJry causes loss d money, business, troutJes in s e r v ~
matters, heart, liver. digestt\.<e and circulatory diseases. Accident O.ut ng
journeys and food poisoning.
Before the odvent c;{ the period c;{ molefic M"""ry (Budho) doily
ren:lering for twenty one days, Sri Vishnu astothara sahasranama ( 1008
Names of Sri r-1aha VlsMu) In the m ~ g and before retiring to bed,
offering pan (betel leaf and nuts) fruit and incense is recommended as
an Astral Spirib.Jal retl'le<tt'. On the twenty tirst day nve persons should
be: given food, be:tel leaves, nuts, fn.tits and Oakshana (money). During
the twenty one days red, black. blue, violet etc. coloured dothes
should be avoided. Tulsi leaves or betel l eaves be used for pooja
(offering In worship) Sprouting green gram be offered as sac:rltlc:e
(Nivedan) and part given as Prasad to family members and the rest
consumed. If possible Sri Satyanarayana Vratha on the twenty tirst day
is all the more best.
MANTRA FOR MERCURY -to be chanted 4, 000tlmes.
Priyangava-guNkasyam ropena pratjmambudiJm
Sattn yam satm yagunopetam tam budJam JXIJillNTIINTIY a/lam
I'ROM.NaAliON
Preeyangava gul eekash yam roopeyna prateemahm budam,
sowmyam 50wmya goono-peytam tam boodam pranamahm mtaham.
I bow down to Bud<lla, ipd ($the planet Mertuy, whose face is
a fragrant gloM or the priyangu herb and whoSe
that or a lotus flower. He Is most gentle. possessing all attractive
qualities.
253
To avoid aU sorts of evil effects, mars is protected by using coral. I t
is availal:ie from sea. It savt:S persons from any type of litigation. I have
seen there ate certain veteran astrobgers who describe to the young
girts to use coral (red) for early settlement of marriage. Generaly, as per
astrology, if marS is affticted in RaShi Chart, is d&yed to t!lke
place. That Is from Injury, aa:ldent or anv sufferings coral may be used
in proportionate quantity.
To avoid aU sorts of evil effects, mars is protected by using coral. It
is availatle from sea. It saves persons from any type of litigation. I have
seen there are veteran astrologers ....t.o prescrl:le to the young
girts to use coral (red) for eal1y settSementof marriage. Generally as per
astrolo9y, if mars is afflicted in the Rashi dlart marriage is delayed to
take plac::e. That is from injury, accident or any sufferings, COral may bt
used In proportionate (fJantity.
EMERALD : Panna : Mari<at-
In Jyotisha mercury Is to be the il e)itlmate child d moon. It is an
emotional and satvik planet It is the smallest planet in the solar system
and always remains with 9a> dqee angle of Sun. Emerald Is a costliest
stone. Till now, It Is seen In Asia, f9ypt and Gr...,. AI. present, It Is
used in USA, Arabian c:ountries, Spain and China. The original emerald
colour wil be like lotu.s which is more sdentSI'ic:. Tis avatlable In
Rhodesia, Russia, India, Africa, USA and In Pakistan.
Whenever a person suf fers f rom stammering, wicked, thief,
insanity, mysterious, foolishness, cheati ng etc. and had trol.ble of heart
ailment, throat b'O...Cie, Hypertension, headache etc.
Real emeral d will have c1ittering atmosphere li ke stars, heavy
weight and attractive, deep green cobur. fragrance., fine. Mind and
heart will be peaoeful whil e touching the real gemstone, Panna
Emerald. light sparks and lluminates from t he Emerald. light
reciprocates Inside the Emerald whose reflection capacity is maximum.
Usualty Emerald should be used with brass on Wednesday mornklg after
having ball>.
256
If Jupiter is in t he natal (h.e;rt 01 debilitated i n the palm for the
point of view of mount, following dise:ase may anaemia,
ttlroat trouble, headache, consUpaUon, Gout. trouble r. hand and arm,
pleurisy, tuberculosis, Dropsy, intestinal obstruction, fever, heart
ailment, cirrh>SiS of teow! r, piles breathirg trouble, suctten t:lleeding etc.
Even l oss d prestige, finance, and trouble In business Is nctlo!d.
Following mMtra may be enchanted 108 time fa- the satisfaction
of Jupiter >
'"Bandabhutam Tdlokesang
tang nctnuJnW Brif18spMim"'
Instead of it, root of "'Samanhati"' tree may be used with yellow
colour on Thur'Sd&y. It is better to use yellow s.&whire in gold
rfn9 on Thursday.
White practice, we have noticed that persons bom In di tretent
moon signs are interested to ktlow whi ch gemstones should be \lied.
For t he conveni ence of t hem I am citing here the gemstones and
moon signs :
I.
Alles Amethyst
2. Gemini Agate
3. VIrgo
Sapphi re
4.
""'
COral
5. MetaJrv Emerald
258 Chapter 19: MeiCU}'
Cliapter 19
9rtercury
INDICATIONS OF MERCURY
HerOJry is the planet of intdlect\.01 and matters.
By itstlt it iS a purety benefiC inftutnc:e wtlieh itS asSOCiatiOns
and produces positive results. Howe'lef, because it Is a nettral, sexless,
and adaptable planet, it takes on the nature an:S quality of any pla.-.:!t it
is conjunct with or aspted by. Therefore it is cruCial to thorougtty
analyze its condition before lntetpredng Its effects In a house. It traJst
also be understood though, that if Mercury being conjunct with a
maletlc su::ta as MarS, iS thus spOiled and itself then
MaiS will have recel...ed a very beneficial energy and beoome powerfUty
enhanced. The house, must be delineated as being oocupled
by 2 malefiCs..
MerOJry governs intelligence, speech, education, and all mental
purSuits. It is responsible for creating writers, leetwers, and te.achus. Jt
also rules trade and commerce and will be prominent In the lives of
business peop'e. Other matters dependent upon the condition of
Merwry are the nervous system and confick!nce. when
ba<ly placed or affticted, Metc...-y Indicates a person who Is nervous,
overty excitable, conceited, and inseOJre.
Another point worth mentioning is that l'-1ero.Jry may, without
maicious harm in certain houses due to its superficial
nature. It has been labeled by the Hindu sages as being fickle,
faced, and often concl.tcive to detachment and an overly independent
Mture.
257
There is fittle difference in the treatment of this pl anet between
HindJ Md Wc&em astrology except t hat tht Hirdus consider f'.1 ercury
to be exalted In the fi rst 15 degrees of Vlrgo rather than the sign
Aquarius. It is also important to note that Mercury i:s not the only plonet
to govern the mind, since this assignment is shared with the f.1oon,
which rules memory and the commonsense aspect of the Intellect.
Merc<r( Is sexless, neutral, cold, and moist best plaoed In the
1 h;)use where it recdves dii< bala, or direc.tionill strength. It fu.-.::tions
best in the first half cl Virgo, where it i s exalted, and worst i n Pisces, its
fallen sign. It owns Gemini and VIrgo and prodoces very good resutts In
ei ther sign. Mercury is a very youthful planet and gi ves such an
appearance when it associates with a planet or house comected in
some wtty to tht phySical txdy (i.e. tht 1u h:)l!Se or its ruler). gfm
to wear to strengthen an aftllcted Mercury Is green emerakt. The
friends d Mert\IY are the Sun and in whose signs Mercury is
W(!lcomed. The Moon iS an entrny to Mereu!)', MarS, Jupter. and
Sarurn are neutral to it.
INDICATIONS

l ntelligerce

Education, learning, teaching

Speech, poetry

Confidence

Communiearfon

Writing, drawing

Books, paP<tS, publishing

Conscious mind, irtellect, al'\.illytical ability

Commeroe, trade, business

Humor, wit

Astrology, math

Nervous system, lungs, intestines

NeiVe dlsorde,., brain diseases, epilepsy
258 Chapter 19: MeiCU}'
Short
Writers, astrologers, seaetane:s, scholars, etc.
Northern direction
Wednesday
The four stages of Mercury
There Is a film. which states that there are ten stac)I!S to a human
life.
(I) Birth
(2) Chilchood in the first t2n years which is the stage for and frolic
(3) The neld ten years till the age d 20 are the stage of study and
character formation in Yltlich the youth is carefree, content and
even arrogant In his bliss Moe alll\e has to do Is eat ard live and
make merry with friend$.
(4) Thereofter till age 3Q comes tile stage where he hos 11> WOII< h<!rd
and tel to prove himself. In some cases, he could be marYied and
even have a child in this stage. Professionally, he ambitious and
self-rentered and wants to be a leadet.
(5) Then tin tt1e age c1 40, he h<!s some more cl1ildren. Professionally
he Is a bit spert and has ttamt that success and failure folbw each
other in the life cycle. He has spent some time in t he courts but
stll has not touched the wisdom tt1at old age ..
(6) And so on till death, five more stages are described.
From the scriptural point of view, there are seven stages to a
man's life: birth, childhood, adolescence, youth, age, ok:t age
and death. Ct these adolescen<e, youth, middle age and old age In
particUar bear signifteance. In adolescence an individual's personally
begins to dl!velop al'd people must take care to protect their children
from bad company or wrong Influences at this stage and Instead
chaMel their energes towards studY and teaming. And thus, the child
enters )<lt.th as a complete person.
259
This is the stage when his bodity urges emerge and it is therefore
a r<!SpOOSi bility to find an eligibk! spouse for youth and
effect a matriage. If tx>dlly urges are not channeled fl this mamer. the
child could blunder in the wrong clre<lion in pwsuit of physical pleasure.
This an have: the: went tood cl repercussions for later life.
lnddentaly, youth Is the stage at which the Individual has to start
worlting. In midcle age, the indvidual has to worry about providing for
his or her Children and also fi!ICes: unlimited opportLnitieS at work wit h a
nixed potenual for success and fallure.ln old age, the petson dlscovets
that his children hiWe become mature and are well able to
responsibility for themselves. Thi s is t he age for and
retrospection because of which many elderty peoJ1e are pensive and
sometimes materialistic.
In the planetary wOtld, Merc...y ocrupies the Fourth Place Mid it
has fo\1' stages. It influences Gemini, Libra ard Aquatius in adole.scence.
l eo, ArieS and Sa9ttarius i n youth, 'Thurus, Virgo and Capricom in
niddle age and cancer, Scorpio and Plsoes In old age.
Herary In ad:>lescence brfngs a ttlrst for learning, lnitlad..e and
entrepreneli'Ship the person's life. But the person's nature
is stli>bom, qlick to anger and lustful. I* has a tl!rdency to talk too
much but has a cal m
Mercury In youth renders a person matetlallstlc with a lust for
luxury, quarrelsome bl.( vet learned and wise, He i s arrogant in great
measure and resents any questioning of his koowledge or authori ty.
In mid<te age, Mem.ry brings a wisdom and maturity that was
lacking earlier. The person becomes good at advising others and a
special property of Mercury ruling a middl e-aged person Is his
unwitlirgness to mi suse his krlowledge and powers.
In old age, Merwry does the exact opposite. The person starts
misusing the knO'Medge acquired during the course of l rfe and even
having achieved nothing hh\self, this person devel ops the habi t of
others down.
nus, we haYe seen the four stages of Memry.
260 Chapter 19: MeiCU}'
The Shape and Features of Mercury
I n this <hapter, we will deal with t he col ours and physical
appearance of the planet Before we enter a debate on the properties
of MerOJry let us, exami'le what andent writers have said about this
planet.
Acharya: DuN8aShyaamo gyaha. Its colour is wheatlsh ike the
Durva C)'ass. H8ritaha - It is greeni sh tinged. It smells rotten and
dominates the pl ayground. Its el ement is skin and the season i t
dominat es Is monsoons. I ts main Interest i s friendshiP and it Is
predominant In ac:kllescence. Its presence is felt In seashetls.
Bai dhyanath: Slleerasagyaha. I t rises from near t he head. Gyau
vihagaswaroopaha. l t resembles a bird in shape. Budhaalcryagratt-
macharo gurugyltU. Merc...y and Jupiter are two planets, which are
oft en found dominant In t he homes or villages of the learned.
Shaakhadhjpo bodhanaha. It is blessed with manv facets. I ts OOmin.ant
deity i s H&ri (a form of Vtshnu), i ts gems are erMrakls or blue Lapis
Laz<JI, Its direction Is North, terrfiOry - from the V!ncllyas to the riw:r
Ganga, its caste is Shu<h though it possesses the properties and traits
of nJe:r ship and its gender iS emasculate.
Parashar : The ma)Ority of t he t raitS are Simil8r to t hose dtseri)ed
above by Baldhyanath. Besides, he says, Metrury Is tile lord of the sldn.
Drisllti kataaskshena indi.ISOOt'IOho. Its in""ence is aooked and not in a
directiOn. 11 it iS strong, it dominates all her planets in its area
of innuenc:e. Nature - tmndrliStutastu mlslrbh3. Its nab.ne Is trusting.
I t can onl y be defeated by Venus. The time of str engt h:
kanyaanriyugmabhavanne nijavaaravarge chilii{Je vina ravimCJharrisha-
minduSOt:JI'WJhu. cha bcmvaanapl rashimadhye lagne sada
yadl yashobalavrldwithaha syaath. I n Virgo and Gemini si gns, on
Tuesdays, in cases where Mercury rul es i ts own house or t he
asctndant; in Sagitt-a.-ius if it i s withcn.t the Sun at night or in the day;
In Taurus In the North In t he Clellb'al phases of the hosc:ope; these
are the places where ,.1ercury is strong. If Metwry is in the ascendant it
brings su::cess, wiSdom and luck. If i t is corrbi()l!(l with a malefiC Rahu,
Mertuy dispels all the evllnnuences d Rahu. But ,.1ercury Is weak In
the Fot..rth House.
Kalyanavarma: 8udhonNakalhiv8aSafWITI. MerOJry is the lord
of hell. It iS also th! lord of the AthaM Veda.
Ptatharbudhaha. Mercury Is strong In the momlng. The remaining
propert;es are as c.lescribed by Baidhyanath.
layadeva: 8udho graamc/laari.Jt i s a which roams around
villages. Budlyut }eevanchit.a. r-1en:ury is th! perfect guides for
on all matters life. Braahmanorohltibhavaha. liS caste Is
Btahmin. Shistu.Jhu som1yaha. Its stage i.s irlanc:y. Sh:xx:Jhradheesh
It lords over all Shudras. Jts clothing is and
forever dripping wfth wattr.
Gunakar: Its colow iS bll.lt, its e:lement- copper ard its place is
the playground.
Mantres:hwara: Its ooloU' iS wheatlsh, It rules o\ltr al forms d
grams and chidcpeas, its territory is the erstwhile kingdom of Magadh
now South Bihar, its d::lminance is til the of 20, ard usuall y people
riAed by Mercury have a marl< on the right side ol the body.
Ramdayal: B<AihovaJsilyaha. Its colo .. Is that of a valshya (dark).
sarvarth Chlntam.anl: V1d valshyaha. Wtstram haritam shyaamam
kshoumama. Its clothing Is greenish-yellow and sllloen In appearance.
Punjaraj: Gyaha tamashraha, tltyagbudhaha. Mercury Is the ruler
o1 hell and of bad habits.
KalidaA: Its clothes are nt!W but wet. It rules the winter. It rules
the throat and the Its territory is the playgrollld and also the
garden.
William Lily: Its colour i s sllvery blue and It shhlmers like
moonlig\L Its domnance Is three hours and 35 min.tes
in the SOuth and tfvee hours and 33 minutes in the North. It camot be
desaibed as either masculine or feminine: as it assumes these properties
depending on which other planets It aligns with. If it allg.s with a
masculine planet it takes on ma.scufine att.ribi.A:es and in conjunction
262 Chapter 19: MeiCU}'
with feminine planets its assunes feminine properties. It is dear, cty and
of a nbture. iS a planet, whidl can convert tven as
patace Wo a place of wortc. so lowering can its lnnuence be.
SUI no: Its dcmlnance Is Oer residential areas.
Diswssion of the features stated above
Colour: t-1ercury has been described wheatish In colour simllili to
the Durva grass bl.t this Is incorrect because when viewed wfth the
naked eye it appears to be blue-yellow in colour. Gunak'llr says it is bluish
In c()k)t..r while Western astn:>logers have described its cololJ' as being
closer to slate, pink or even
Skin: It appears incorrect to attribute the ruler ship of skin or
complexi on to Mercury since often there are cases when people
contract skin aliments but do not have a malefiC t-1ercury In their
horoscopes. On the contrary, when Mercury Is matefic ailments Uke
mental illness, epileptic fits and machess are more common. lf Mars the
ruler of skin Is In Aries, Leo, 5agil:tartus, Olprlcom or Aquarius, the
text<.<e diY and c;oa,..,. If Mars Is In Taurus or Salrplo the sldn Is tl>ldt
but delicate. In or Ubta, Mars teaves the skin is thin strong.
In cancer, Virgo and Pisces, It is thi'l al'd delicate. If Mercury is p&aced In
an ausP<Ious position bit Ma" Is blemshed, the person conuaas sl<ln
diseases. There are probleJM like boils, warts, moles, P:rrc>les, itcl'ly
rashes, .neasles al'd even leprosy. Hence, it Is Mars that rules skin and
not
Pl ace: Playground. This Is premised on the assumption that
Mertury is In the stage of irtancy but science has J;togressed a tot since
those days. And hence, it can be deduced that any place of wisdom is
also under the: lnnuencc or Merc...-y.
Ctothlng: This ts described as rotten and wet blt the reasoning
for this is not clear. Though Kalldasa did say that It Is new clothing,
which characterises f.1 ercury, this is not borne ol.t by observations.
Mineral : There does not appear to any concrete reasoning
among the: ancient astrologerS for stating thtse as conch Shells. In my
view, it Is graphite. which Is ruled by Mercury as tt\at Is used to prepare
writj"9 IT'Iaterials.
Season: Monsoons. Some said Winter is t he season ruled by
Ml:!rcuy but tNt is incorrect. It is monsoons, vdlic:h mark. the rerum or
spring, Md also ttrn fields al over the oountry side a vibrant green.
lrciderc.ally, green is virtualty acx:epted as t he colour of Merwry.
Taste: Piquarc.. Those ruled by Mercury like sour foods sudl as
curds, buttermilk, tamarind and pk:kJes. Western astrologers, h:lwever,
deScribe the taste d ruled perSons as Mutral.
Stage: Infancy. Mercury is the smalle-st of all planets in physical
appearance. It Is believed to be of royal descent and that appears to be
the case.
Rising: It usuall y rises from the direc:ti on of the head. The
specifiCs of planetary rising are disa.Jssed in Ravi Vdlar
life forms: It is widely believed that mercury assumes the form d
birds. astrologers cal it the vMged messenger. In !his day, this
wouk:l translate as showing Mercury's influence In radio, wi res and
works. It may be recalled that in the ages birds were
used as messengers In !he absence of wires.
Dwelling: It is correct that Merc-ury resides in the homes and
villages of the leatn<.
Shakhadhlp: This is obscure and the meaning Is not
traceabl e.
Detty: VIshnu. In my opinion, f.1ercury is the ruter of thougtt and
knowledge and therefore I befiiE!Ve that it is 5arasvati t he Goddess of
Leall'ing who should be 'M!wed as t he attendant deity for t-1ertury.
Gem: Though most say it is emerald or Lazuli, I belie'lle it is
opats that represent mercwy. I have Seetl the effects personally. There
was a boy who was irl:elligent yet refused to attend school. He wasted
264 Chapter 19: MeiCU}'
most cl his time. But once an OP\\1 was hung around his nedt. his nature
bame calm and he up dtvoting t he requir4!d time to his
studies. Not only that he was an excellent student and werl on to be
noted 5<1>olor.
Direction and Territory: Most experts sav Merwry's di rection is
in tte North and I am inclined to agree. Its territory iS from the Vindtrya
Range to the of the river Ganga. Though Maf'lreshwara has
said Mettt.IY rules Magadh, now Northern Bihar, I do not agree.
Caste: Most astrologers say Mercury's caste is Stuclra, Vaishya or
Brahman. These are contraclc:tory. Since f'.1ercury's sig1ificant trait is
I consider tNt its caste shotAd be seen as Brahmin.
Traits: It has the characteristi cs of a rul er. In case Mera;ry is
Independent , this appears correct. But In conjunction with other
planets, it assumes traits irtluenced by them. Punjzl raj says it is ma'efic.
Gender: Most believe that it is emasculate or neutral. In trrf
opinion, they are detinirefy wrong. Merrury may not be rufing the ability
to have a son but It undoubt edly rul es knowl edge, wisdom and
petSf!\letal"(:e. These are n the traits d neA:ral From a workly
point of view, it is the son wh:) is the final mark of a man's maSOJTinly
but it Is equal ty possible for a man to father a son who dies later. The
son If l"()t destroyed could still be a wastrel who brings shame to the
father. Hence, academically though it i s t he birth of a son, which
dot*lates this trait, 1 that Mero .. uy Is gender neutral . The &ate
Apte o f Maharashtra, Gokhale, Bhandarkar, Govind Agarkar,
Nathmadhav, West Bengal 's noted poet Rabindranath Tagore and
noted scientist Sk' C v Raman were all famous. None of them acquired
this fame for their ability to father a d'lld.
Element Earth. Though evetyone lists this as Earth, 1 do not
think this is correct In my oprion. it Is Satum who rules earth an::l air
that is ruled by f\1ercury.
lnfl uenoe: I ts inftuence is not straigtt in direction. It is aooked
but there is no Hsted e.xplanatlon for ttis.
Strength: It is constantly strong.
Temperament: Mert\I'Y is c:J mixed temperament and very royal
in itS influence.
Vanquisher: f'.1ercury is usualty varqLished by u s .
Adverse influences: When Mera.Jry is in the fourth place, it is
believed to be adverse. 1t Is not, however, clear whether ttis reference
is to fourth place from the ascendant or the fourth place from the
moon.
Kingdom: 1(9yanavanna suggests that mertvry is the Lord r:l Hell.
Some others described Mercury as the rultr d the King:lom bekwi the
EMh but 1 believe that Metru.y Is tre ruler of the Kingdom that of 1ne
deod.
Veda: Most astrologers agree th.at Mercury rules the Atharva
~ a . However. there is no explanation for this reasoning.
Time of day in relation to strength: It is generally believed to
be strong In the morning hours. For two hours before sunset r-1en:ucy
am be seen with the n a ~ d eye and hence I believe that Is when it Is
strongest.
Guidi ng factor: It makes a man anXious. Under the influenced
Merwry a man starts asking questions at the t ime of his daughter's
weddi'lg whk h he would ordlnatily be asking If his friend was on a
deathbed.
Grain: Allldnds of green lentis and chlckpeas. There Is no logic
stated for this ded.K:tion by the ancient writers.
Ancient writers and Western astrologers do not appear to have
taken into acCXMJnt the Sl..n sq,s when describing the properties and
features of t-1ercury and hence there are not onty inconsistencies but
al so inaccll'ades in their wri tings. One example is: one writer says
Me:reuy rules the monsoons wttle another says it Is winter while )'l!t
an<Xher says that if r-1errury Is in Gemini It is winter and if lis In Virgo it
is monsoon. The Westem astrologers describe traits like dry, dear,
266 Chapter 19: MeiCU}'
playfl.A and quick to angry I bdieYe are c::orre<.1 if Mercury is in
Gemini. But in Virgo, f'.1errury can render the person cowardly, excitable
and kJsty. Mett...-y In Virgo Is a sign d baser Instincts while In Gemlri It Is
pure and noble. In this manner, different signs influen<:e plants
difftrenUy and 1 this should atso be given due impor121nc:e
while exan*ling the traits of any planet.
How Mera.ry affects various aspects of human ure
Kalyanava.rma: ShrtAHikNtdShilpadlaityiJflaipu'l)0mamartrldootha
hilasyanaam
saumyah!. lt rules the sciences which are written or told,
wisdom, the of the mind, wit, potential to rise in tile: rUing
classes, ht.rnOUr, glory. nature and generally good habits.
Bal dhyanath: Vldhyabandhuvlvekamaatulasuhyadvaak-
karmakridh bodhan8ha. It influences perseveranc:e, glory, prestige.
friends a !\:I professions where a person's voice makes a
difference.
Parashar: Jyotlrvtdhyaaganlthakaaryanartanavaldhyahaasa
bhikaarako bi.Jdhaha. Astrology, mathematics, dance, medicine,
comedy ard wealth are governed by t-1ercury.
Sarva rth Chi nta man I: Santatishaantivinayabhaktimatijaati
gotrasammrlddhlpragyaavedaantakaarako budhaha. Mercury Is the
signlflcator of offspri"9, peace, 90od ""'""'"' wisdom, caste, relotions
with inlaws, knowtedge and spirituality.
Vldhyaranya: Pragyavat karma vlgyaanam budhhena tv
vidJintayet. Those who are kxlking for wisd:lm or g.Jictar.ce in carrying
out great wotks of public good, should look towafds Mercuty for
guidance.
Gunakar: Maatrlbandhu. The maternal uncle's fate is governed by
merOJry.
Jeevanath: Pravarakaacyapatutvam vinodakalakaadikam
pravarbodhamanaha shuchimaglsllot. Those who excel In poetry, arts
and crafts those who have knowledge are people who
look to MerOJry for guidance.
Mantreshwa ra : Paandhityam suchavahakalaanipunatam
vidhyutstutim m.t.ttulam vukchaaturyamupusanaadipatutallm
v/(#))WSU yuktl mat/. Yagyam valshnavai<Nma sarya\0Chan.am shakt1m
vihaarasthalam shilpam baandha\0')0uraaj{asutiJridastadabfwgineyam
budhy.tM. Priestl'ood, auspicious speech, in arts, mastery
aver the muses, praise by tl'e learned, mother, witty speech, devotion,
knowledge, wisdom. dedicated pt,ust.it of religious ""'tters, devotion to
l ord ViShnu. trutf'lfulness, Shells, pl.&)grounds, sculpb.Jre, brother. royal
ancestry, friends and boastfulness are all govemed by r-1ercury.
KaUdasa: VtdhylllldtiSI'IMtJJrlJnl}llkOSII gyMnitlld vMky!Jdwi}Mh!
paadaanta llpllekhya praasaadak#araa teerthayaatraasuchavaha
praasangadevaalayaaha vaanijya varabhooshanam mriduvano
vedaantamut allmahaahaa. Duhuswllpnam cha vairaagyavichitrtr
hamyaarbhlshajaha iJbtjchaaraa vlnayo gyaatirtilaya nartanaha bhak.tiN
shama naabhirgotrasammrlddhimisha padhaarthinl aanghreebha
liShitlldhip<Jha. Bhllashli!ChllmatakUr<Jta karma gopuraguhau.
Satpuraanl ka shoodrashaastra - sumahaarat nadisanshodhakaha
vldlwa8n mantTayantrasumahaantatraadi/caahaa sat.m)etaha.
The knowtedge, l':>rses, acquisition of wealth, g-ammar,
Brahmanism, footsoldie's, trade, writing, calli graphy, skY"
scrapers, pUgrlmages, good saytngs and proverbs, temples, sweet
words, Vedanta, horrifiC nightmares, rivalry, beautif\J houses, medicine,
magic, grace, caste, fear, dance, devotion, peace, navel, cordial
sweet-meats, Andhra Pradesh, Telugu language, magical
words, the spires atop tetll'les (in Ma<h..ral in Sovth lrdla and in some
other towns, temples have large gopurs or spires around them),
seaets, good speakers, sh.Jdra professions, phonetic, gems, tegislators,
scientists and P""titb'lers d occult should all medtate on Mercury.
W1111am Uly: Allhors, metallurgists, mathematldans, astrologers,
traders, workers, wri ters, sculptors, poets, spealcers, lawyer, teachers,
financiers, attorneys, royal messengers, cali 47aphers, accourtants,
solicitors, occasional thieves, those who are too talkative,
grammatic-lans, tailors, peons, currency exchangers, are also
inftuenced by Mercury.
268 Chapter 19: MeiCU}'
Mercury as a significator of Illness: Grihhayyodaraadrishya-
shoo/agrahani rcogaadhyai. &Jdha
adlvlsllnuprlyadaasabhootalrateeva dufkJkha shashljaha karotl. Illness
affed:i1"9 the ITI(I rrow, gastric disorder$, leprosy and ailments relating to
system d air in the b:)ct,o. MMdlJllgrW or lack of appetite, k!thargic.
tormented by Sangrahanl and other ghosts who attend LOtd Vishnu,
are characteristics of Mercury. On this subject William Lily says extreme
inertia, giddiness, m&dness, limited brain functioning, train diSeases,
disease In the tongue, extreme ego, hallucr.atlons, difficulty In
concentration. heavy or cracked voice, respiratory aikneru, asthma,
cough, sore thro-at, dry throat, muteness, nightmares,
depression, chl dhood llnesses diZziness are some of the aliments
caused by Me<Wry.
My observation; EXM1inatlons (both oral and written), scholars,
department of posts and telegraphs, Raitway, share bautar, emp!Qvees
of bankS Md insurar.:::e companieS, big fifms, correspondents, seioenc:e,
Immunol ogy, account s, mat hematics, Evidence Act, Stamp Act,
registration Aa, essil'f writing. study of mother tO'lgues, irt.erpreters
of anci ent l anguages, nnger print experts, environmentalists,
metalhsgy, psychologists, word pfay, debati ng platfonns, classrooms
and universiti es, law and j.lstice departments, typists, graphologists,
astrorcmy, art d rebding faces and foreheadS, calc-ulus, accourts and
paper factors are governed bv MerCU'\t
Debate on Anci ent schools of thought: A lot of what
Katyanavartn(;l says can be discarded safely as it Is useless. Sci.Apture is
signirteated by Venus whid'l with its colouring is the ruler of
weal th and hence Mercury cannot even be considered a factor.
Bal dhyanath's observations have been borne out by my own
experi ences. Thought, speech and l earning t hese seem guided by
Mertuy. The reason he's aooorded 59'11Rc::ator status to Mercury vis-a
vis relationships with in-laws, children's in-laws and siblings Is because in
neU:ral t.)rosc:ope.s, it i s wtic:h i s the brd d the Third House
and these lie there. Similarly in a neutral h:lroscope, the Sixth House is
also rUed by Mera.uy and hence matemal aunts and urdes, as well as
foes are closely connected to the influerce of Mercury.
Tile debates of scholars (that are published so frequently in
newspaper and magazill4! cOlumns these days) and war strategy are
also the domain of MercliY as Is the ten of wke as this Is a part of the
properties d the Third House in a neutral horoscope. A bachdor is
nMd by MarS in Aries whk a spinster is: ruJ,ed by venus: in Taurus and
hence their third counterpart Gemini is ruled by Mera.uy. A rated co-
inciding of the male and the female is the be9etter of voice. Malefic
Mercuy iS bLt a pieCe of the Sun and hence it could be' treated as: a
prtloo among planets sh::e we take the Sun to be the king. SW'Ioo evil
deeds ace also the resutt of brain activity, it is generally considered that
Mercuy is a signifcat htre too.
Though Parashar has ascribed Mercury as a significator for
as:trok)g,o 1 believe ti'W! refererw::e iS m ~ apt for astrooomy. Swayam
Vyankatesh Shasb1 Ketkar, Nava.teji, Raphael, Vasudev Shastri Khare
have all acquired great glory because of Mercuy. H o w ~ r . those who
haW! malefic Mercury lnlvtrSing their ho.sc:q>es w;1 get no s:uccess in
astronomy no matter how hard they try. MerOJry grants masculine
blessings if it is reflected tiYough a masaJiine sign and sirnilarty grants
feminine blessings if it iS reflec:ted ttwough a feminine signs. To suo::eed
In astrologk:al sdences It Is necessary that mercury's Influence Is
supported by the much stronger Neptune wtich is the ruler of all inner
knowledge and sixth sense.
In mathematics, the pure sdence of mathematics, trigonometry
and calrulus are governed by Merrury; it also governs dance and
choreo!J'aphy. H o w ~ r . the logic for both these is specified nowhere.
My own theory is that since dancers and choreographers in andent
times were Inevitably eunuchs and the then prevalent theory that
Mercuy is a gender neutral planet could have led to this belief. In fact
the Mahabharata narrates a tale where Arjun posing as a eunuch
taught dance at the court of a king so perhaps the ascribi ng of
Mercuy's lrtluence over dance and related fdcls c;an be fo\.l'ld here.
Doctors and humoll' t\ave been listed as being rUed by Mercury
because in a nel.tral horoscope the Sixth House which covers ill hea.lth
and also good humour Is ruled by Merctsy. Overal wealth caooot be
considered the dcmaln of the Thht Ot Sixth House so on the wealth
270 Chapter 19: MeiCU}'
front t believe that onty the number of "'ttl e a man owns can be
consider! to be inftutnced by Mercury
Sarvarthachlntamanl: He: says t hat inlluences chid
beating v.illch Is right K yoo conside< that this In the domain of the
llird House bt.t since it is ttis very writer who asserts that Mercury is
gender neutral I t he connecti on cannot be clearl y establ i Shed
between Merrury and progeny. On the other hMd since peace
and c.levotion are all subjects vested in the Third House t feel it is ql.ite
all rigl't to concede the ruler Ship of Men::uy <M'!r t hese. SimiLarly Since
caste Is In the arena d the third house, Mercury has a large oonb"ol o\lfr
ttis too.
Pragya: The Intellect that devotes IISelf to medltadng aver God Is
termed Pragya. tt would be wrong to suggest that this is rl.ied by
MerOJry as this planet actually controls the mbterialiStic and wortcly
aspects of Intel lect. However. In Gemini and In the Thkd House
can be a factor inflvendng those wl') are ex.perts in
and ether saiptures.
Vklhyaranya: This has mostly been discussed above. Mercury is
the slgniflcator for epistemology, philosophy, met aphysics, logk:,
psycl'v::llogy and pure sdence.
G.unakar: r-1ost d what he said is already covered in the debate
on Baicl'lyanath.
Jeevanath: Poetic talent and mastery f:Nf!r the muses and arts is
all the domain of the Thl'd House and hence It is apt to conctude that
these are ruled by Mercury. Howeve( t his works only if r-1ercury Is In a
harmonious alignment with Neptune. If Mercury is alone in t he
ascendant, Rfth House, Seventh House or Nirth House the person is
courteous. lf Merrury In Gemini Is tn t he Third House the person excels
in arts and is atso capable d e.-.lghtenment.
Mantreshwara: Everything he has said has been covered In the
debates or other writers and I suspect much of what he has laid down
has been inftuenoed by the Jataka Parijata scriptwes.
Kalldas: Of all his wri tings 1 believe what merits debate is
Mercury's inf\Jtnc:e: on matemal grandmother, nightmares, speech,
oratory, the unusual , thought, rear. sweetmeats, and linguistics or
Andhra Pradesh, magical langua9f!S, legislative ability and occul t
sci ences. Mercury's connecti on to the grandmother hbs not been
explained. I n trrf view sh::e the mother's place Is ttle Foorth House, her
mother would be influenced by the Fo\l'th House from the Fo\l'th
House which astrologically Shouk:J be the Seventh House. In a Mutral
horoscope this space Is dominated by venus though some astrdogets
assert that the House is ruled by Ketu. Though I do not find
any truth in Mera.uy's inOuence thiS could p:>ssibty bt
correct as there are scrne suggestions to Indicate that MerOJry might
an influence c:l sorts f1lel' the Silll.h House.
Slnre does dominate it would be correct to Sll'l that
it i nfluences trade, it is atso undear why MerOJry's influence over
an::hkectural marvels or skyscrapers is mentiontd but Merrury in the
Fourth House ccdd be a slgnlflcator ror house ac(fJisitlon. Most ln<ian
doctors are born under the signs of Gemiri, Lba or Aquarius and c:l
these the most common is Gemini but alternative medi cine i s the
domWI of the Sixth House and so Is fear. 1t Is oorred to ascribe ttle
influence of Merci.JY in its ruler.;hip of the Third House to being dle
si gnificator for sweetmeats, magi cal languages, ancM!nt saiptures,
shodra professions and legislation.
William Uly: Most d lhe subjects he ascribes to the NlersNp of
Merc\1')' are indeed the dot1"0in of the Third House. The exceptions are
tr.Kk!rs, thieves, couriers and servants wto are tM domain d the Sixth
House. I disagree with tim that Merc\I'Y has any lnl\lence over grain or
clothing as dlese are neither covered by dle Third House nor the Sixth
Hou se. Regarding what Indian wri ters have laid down about the
lnAuence of MerOJry on l lness, I have not observed anything so far to
bear them otA as correct. Only Lily is right on that fn::ut.
272 Chapter 19: MeiCU}'
The characteristics of a slgnlflcatO< (In this case Mercury)
Characteristics Inherent In the horoscope or birth chart:
Season, saipt, 17ace, elegance, probability of becoming a minister,
courier, humour. l earning. k:nowl tdge, glory, chari table
dispensation, evil deeds:, danre, medcft, prestige, children..
peace, good manners, nobili ty, devotion, knowledge of Vedanta,
aptitu:k! for poetic: ability, artiStiC talent. pe&ee
of mind, priesthood. odes, oratO<Y debating ability,
truthfulness, good luck, pilgrimages, chances of becoming a
grMctnother, likelihood d getting a sweet masttry over
languages, nightmares, phonedcs, behavfour, fear, grammar, wordplay,
gems, legislations, O<:Cult., metallurgy, mmerolo9Y, astrology, traders,
chief servants, grammaticians, 13\\!yers, writers, ttac:hers,
financiers, currency exchangers, attorneys, commissioners,
accounU.nts, alligraphers, solicitors, se<:retari es, thieves, tailors,
coolieS, pedest:rtans, money lenders, wiSdom, acquaintances, friends,
neighbours, telephone, servants, a ground floor residence, cordial
relationships, excel lence higher education, book publishing and
selling, commooity relations, re9$1Jar, broker, commurity servk:e and
social service, spouse, posts and telegraphs, bankS, insurance
com paries, railway, mi ls and clerks and In large finns.
Charactertstks relevant to education: Mathematics, Dance,.
Medicine, Metallurgy, Teed'ling. Astrology, Solicitor, Grarrwnar, Oral and
Written Ex.amination, Depar tmental I mprovement Examinations,
Elemental Sciences, Pure Mathematics, EVfdence Act, Stamp Act,
Aerodynamics, Psy<hology. Typing, Grapl"o>lo9Y, Palmistry, Mathematics
as required in E1"9ineering, Algebra, Geometry and calculus.
Characteristi cs useful in geographically ca l culated
astrology: Royal messengers, posts and telegraph cenSOts, mHsters,
wealt h acquisition, seO'et messages.
Characteristics relevant to profession and questlons of
Importance: Succ;ess in edt.J;ation, writers, metallurgists, teachers,
success in astrology, patni stry as a profession, mt!dk:ine, traders,
lawyers, gem traders, financiers, publ ishers, currency exchangers,
clerks, sculptors, engravers, idol-makers, solidtors, tailors, dance,
27.1
nightmares, registrars, masseurs, debating platforms, ctassrooms and
univerSitieS.
Characteristics whkh have no relevance: Enlightenment,
ornithology, na.t...-e, knowledge, potential of Gotra, shells, foot soldiers,
abode of gods, navel and sweetmeats.
Zodiac Signs and their relevance to Mercury: Ari es, Leo,
5a9\tzlrius are auspidous. Taurus, Virgo, capricorn are ordinary. Gemini,
Libra, Aquarius are excellent. Cancer, Scorpio and Pisces are
inauspicious.
In-depth Study of the External Manifestations
of Mercury
Acharya: satatahaasyaroovirgyaha pitamaaroot:aka-
phaprakriliSI'Ichll. Mek:ldi!Ws vOiCe and a dispositiOn oomplising a
blend of Pltha and Kapha are the cllaracteristlcs of this planet.
Kalyanavarma: Ratkaantaayatalochano marlluravaak. doorvalt-
dalashyamalaha twaksaarotirajotikaha sfootavachaaha sfeetastrido-
Shllatmllk.!ha. Hrishto madhyllmaroopavun sunipunovrittaha
sheerat/Jistataha sarvasyaanukNotl veshavachanalhl paalaashwaasa
budhaha. Sharpvision and bl oodl ess, mel odious voice, wheaten
complexion of a Shade similar to Ouva grass or hay, dense Skin. ra,oal
dear speecll, of a lllend of Vata, Pltha and Kapha,
muscular physique, handsome, artistic, a tendency to ape others'
dressing and mamerism.s and a tendency to exp05e birthmarks on ttle
bOct,o; these are the characteristiCs of t-1ercury. Gunak.ar also says
virtually the same tl*lg.
Bal dhyanath: Durvadaladhyvtlti)lluhu sfotvaak. k.tfsllaangahit-
swaami rajogunavataamatihaasalolaha. Haanipriyo vipulapltaka
ph&niiMtrMIJ sadhylJ ShliShijlJShcha vidhwiJIJn.
Complexion of a hue resembling Durva grass, dear voice. dry body
constitution, royal bearing, leader amO'lg men with a .sense of humour,
one who causing and d!struction to oths, disposition is a
274 Chapter 19: MeiCU}'
blend r:l Vata, Pitha and Kapha, trave and and learned: such is
of Mtro.Jry.
Jayadev a: Anci ent wr iters have specially sai d:
Drlsht atvaksaaranaaddachyaam sthoolodhwarjaha sthoola
nakhoushtthadantaha. Dry sldn. coarse hair, big teeth and nose.
Parashar: Vapuhushreshthaha klishtthavaakyo
f.1uSOJ1ar physique and industrious disposition.
Mantreshwara: Everything he said has already been covered
above.
William Ul y: Ordinarily tall, dry disposition, broadforehW,Iongish
face, long nose., shapely eyes which ate neither black nor brown, small
lips, hairy forehead but sparse hair on the face, yellowish -dark
compl exion, long hands and fingers, cdoll'ing olive or chestnut; these
are the characteristics bestowed by Mercury.
If Mero.uy Is In the Eastern part of a horoscope, the person's
compl exion is like honey and he is not too tan but is still muSOJiar. The
eyes are small, sparse hair and the voice is sligl"tly strained. If Merosy is
In the West the person's face Is yellowish, body lean, small and delicate
limbs, eyes are reddish but stinlng and the boc:tf dehydrated.
If Mercury Is In an auspicious Influence, the person Is wise with a
sharp intellect the person is a good administrator and excels in debate
and discussions. When he argues, it is reasoned and convindng. He is
Interested r. sec:retlve matters, lost treatises and ditferent types of
l earning. He does not always depend on a teacher to acquire
koowledge and has a constant desire for knowledge. He has a yearning
for travel and is capable d aocomptishlng virtually Impossible feats with
his skills and knowtec9e. He Is forever searching for enllghtermert. lf
he is a trader it is <ffficutt to rnte him as the best, however, he is still on
the constant took out for shortruts to wealth.
If Merrury Is in a malefic tntluence In the horoscope, the person Is
of a clJII and cfmlnlshed lntetle<t He then, tencls to use his knowted90
and ski lls to cause destruction to others. He is of a mean disposition. He
21$
squanders his wealth and wastes lis time. He has a tendency to lie and
to brag e:xaggeratedl y about his own achievements. He tal ks
lncessantty and tries to master black magk to cause damage to others.
He is a fool and is qt.Jite unwise about trusting people ttlat he does not
know well enough. HiS mind iS in::onSiSte..- and h! findS it difficul t to
remain In one place for MY considerable duration of time. He cheats
peopl e wherever he 9QeS and often steals by intimidating others.
Though ht lbCks any real knowledge M fakes ft. bot making excuses for
his Inadequacies of nature and knowledge. He Is a n.mour monger and
a coward. Sudl people ofttn pose as saints and hermits merety on their
skill ed speech and chariSmatic appearances. He i s immature and
disillusioned earty.
My Thoughts: Those ruled b'f Mercury are of two types. One
type is those who are t3D, have a l ongish face, broad forehead., medium
sized torso, long arms and limbs, thin betty, thidt waist, and a reddish-fair
compleXion. They have big and aggressive eyes and are cte.arty
discriminatory. Their eyes are q\Ate reddish as If they are Mink but
these people have deli cate looking teeth. Sudl people do not laugh
loudly, speak leSs but with great fanfare, and onl y speak if it means any
direct benefit to them. Their voices are harst\. Their hair Is delicate and
shiny and these people are ordinarily charismatic. They can be trusted
over money matters ard there is no fear that they will Sit pouring out
their woes to the world. They have hardl y any friend. Some are quite
ru:le b\( will always be willing to help fOt any 9ood work.
Some are quick to anger, quarrdsome but teamed. They are
arrogant and do not recognise the ri ghts of others. They
Increased They eat sparingly but they are fond of good food and
eat several smal meals a day. They are knowledgeable in the matters d
women and are personally well dressed too. They usually have aavini)S
for various types d food. These squander their Inheritance and
lose most or it Then too they do not take any useful emplo'Jfllent
They try their hands at rt'00Y trades but do not succeed. Usually they
remai n unstable t hrough life but are posse.ssed by the desi re for
wealth. They remain stable orty If they have some wealth and m:>st d
theW friends are doctors Ot astJoiQ9ers.
276 Chapter 19: MeiCU}'
Other types of people: They are not very tall, have a round face
and big Shoulders. They have: pot bellies, big and small chins. Big
black eyes which are uneYenly sized (the lett eye Is usually smaller),
hairy foreheads. They have small hands with short, stubby fiBJers.
Th!y have thiCk feet, a sn.sb nose and a large- prorri:'lent mouth. 'TI'Ieir
faces ate '*""" Inevitably dleerful and these people laugh out aloud.
These people are not reliable when it comes to finandal matters and
are they willing to t rust otMrs. He likes pl ta$3nt,
peaceful and Is quite enthJsiastic about ife rn general. They are cheats
by nature and be cheated by anyone. They no dearth c:l
vehicles or servants. Peaceful, peacr-lovif"9 and a pleasant
telfl)elament. devoid d anger. They are stable In thougt'( and have no
worri es on the famly front. Tho1.9h they have worries about their
career, there is nothing external in their to indicate this.
Th!y try th!ir han:ls at many professions on a scale. They eat
a lot but are not partiOJiatly coocemed about the quality <A food. They
do not enjoy deep sleep but they are al so people who can manage
wi th tess Sleep than others. They a tendency to use ancient
pro'ltrbs, Sanskrit grammar and <haste grammatically correct l anguage
in their speech. They are \1\wiling to respec:t women and are generally
unstable. Their mission in is religious activity.
The:se words of the: ancient astrok:lgers that l h3Vt depicted
above d these: the father's death, skin cok:lured like dartc wheat.,
broken sentences, humour, dangers, disgui se, dental disease are
correct b the 'Other twes or people' category. Fore the earf.er types,
disorders cl the blood and marrow, medium height. graciousness,
dehydrated appearance, teaming, pl easant and good
behaviou- are applicable.
The ancient and modern desalptions of Mercury: t-1ercury is
the governing pl anet for students and schol ars. Let us examine
therefore the changing facets of I ndian schol ars vis a vi s the
movements of Mercury, over centuries. tn t he age of the Rarnayana
and the Mahabhllrnta (BC 2000 to 1400) students wore deer skin.
They had but one garment, a loincloth and a sacred thread. When they
grew ok:Ser t hey grew their hair. They rose earty, exercised and then
thems:ef'lts with a bath before reporting to their teacher's wife
277
for orders to <XlfTipl ete their household chores in the GlnJkul. They said
praytrs: th"ice a day, rested once aft k.J...:h and in th! they
repeated all the chores they had performed In the morning. TNs was
the cJail y routine. There were separate Gurukul s created for royal
chil dren where they were taught the of war fares and
mantras that dealt with weaponry.
In the era d Lord Buddha (500 6C) India had tiYee mammoth
unWersities- Kasl'i in North Inda, Ti!kshila: in Punjab (now Afglanistan)
and Na&an:Sa in Bihar. O'likten sent when they were about eight
years old to study there. Before being sent to the university, an
UP81llt)'Bn ceremony was conducted to bestow on them the sacred
thread an:t the secrets of the Gayatri Mantra. Their were shom
before the sacred threbd was slipped on and they were told to
lead austere lives. Thereafter begging for akns as is laid down In the
scripture, the stud.,.. mode his way to the unill<fsity where he studied
for aboLt 12 yearS. There M was taught Vtdas, VtdaMa, phi loSophy,
poetry, grammat and other subjects. On completion they earned
like philosopher, poet or scholar. It was imperative to
practise: Brahmacharya or celibacy in Thi s may be tM
reason why ancient astrologers have branded Merrury a gender neutral
planet.
In the nineteenth century, there were dramatic changes in the
life of Indian students because: of the advert d the British into India.
Schoofs were set up In each village or town and colleges k'l big cities.
There was no longer any need to go to Kashi, Takshila or Nalanda and
students after the Upanayan ceremony began getting admi ssion to
village schools. With the Bc'ltish advent, SbJderts al so adopted Westem
styles c:l attire. They began growing their hair an::l using pomade and
other products to groom it. They began using tal w m powder and
many males started sporting moustaches. The dressing style changed
to shirts, coat, jacket, pant, boots and collars. 1'>1any students began
wearing spectades as their bad vision be9'1n to be detected by the
doctcn available in village. Bllldt gowns and hoods became the
vogue for graduation convocations and th.Js came the mange in In<lan
student life.
278
Cliapter 20
9ttercury in 'llarious Houses
Mercury in the First House
Acharya and Gunakar: Scholar.
Ka lyan avarma:
BkliBvyagartagyaha. AtimadtMJrachaturavaakyo deerghaa,Wu syaad
budhe lagne. The person is disease free, well versed In all
the arts, knowledgeable in the intricacies of poetry and mathematics,
well-dressed, intl'!llectual and speakS well. ThiS person has a long if e.
Baidhyanath: Vidhyavitapasvadharmanirato lagnasthithe
IJO.dl't.aM. This person studi es early Wl the momi"'g. is Wl!alt hy, has a
tendenc:y to be medftative and Is devoutty religious. He lives life as
dictated bv the 5Qiptures.
Garg: SmdtifX)rnBhashaanto medhaavi cha priyamvadaha.
Vidhwllan dlJyaaluratyartM vina kroora budhe tanau. He i s good
looking, clever, peaceful, and speaks mefliflJousty, learned
and is very kind hearted. That is, these attributes can be seen i f
Mercuy is not in c:cmbination with any rn.?Ji eriC planet.
Daivagyavilas: l1Jnau buddhe
Streesukham madhyabhaage cha vaatapeeda t anau bhaveth.
Visfotacrdibhavam dt.llukhamashokosthltdlosthavaa. GulmodN vikaaro
vM S'W3/pMhltMOSpi }MyMe. are mai'Pf hoeS visibl e on tlis skin.
gees married only In lridcle ag-e. He suffers from vata aliments and also
bois and skin ulcers r:lvarious kinds. He is forever sidcty. He has
ITiillny warts and moles on tl is body. He tlas digestive ailments and has a
poor
21!1
Brihadyavanajaatak: Shaanti vin;,ati sutarramudilat'O naraha
Vidwauna, vipufatmlJjlJShru
sheetaashusunau janane tanusthe. He is peaceful, orderty, gentle,
decent, learned, well versed in the arts. He has IT'I(Iny sons. Clansha
bud:1h)O yad'tel'lati. He starts atq.Jiring prestige and hlme from
ttle earty age of ten.
Jayadeva: There are only two thi'lgs different from what has
already been stated atxwe. He has no dearth c:l women in his life and
he is generous to the needy.
Kashlnath: Lagne ella nishpupo
Roop!gyaanayashoyukt.!ha praglJ/bho maanavo
bhavetll. He excels In music. he is noble and avoids sin, he has prestige
from .,. time or birtl>, he is knowtedgeoble, good looijng, glorious and
has a sharp irteUect.
Vaslshtha: Haanti doshashatam budhaha. t-1ercury i s the
destroyer of many mateflc Influences. Shashtosshtamastaeha mrltau
janrnalr.>ale yodo bvdhaha. Chortvrthovorshe mrilyushfiJ yadl rokshati
shltnktNaha. However, if t-1ercury is in the ascendant. the Sixth House or
lhe Fourth House, the child dies at age four.
Jaageshwar: Shaved vanshacheta bhavechchilpak.aaraha.
&Kihej)ou vi/ogne sthithCCJ """dhipou chet biollshtaham voded vattvtom
vedakonam. The person's entire lineage is destroyed. He can be a
saJiptor. He has a strong alld burly physique.
Aryagranthakar: TIJnugathashashlputre k.aantimalH'Ishchaatih
rishto vlmolamo!Mshaalaha pandltostasyaagosheelaha. Mamrldrlsh:hl-
bhooshl sotyavoO<f, vish .. N, baMINilsukhabhaogi s;woka4/opravoosi.
Radiant. beaLtJful, de1w minded, le!wned, selfsacrirldng, a man d feN
words, soft spoken, contented and has a reasonabty welt built
physique.
Narayanabhatt: &Jdho moort:igo ma8rj8dirtyarlshtham varlshto
dhiyovaikhareevrittibhajalla . .Janaadivyachaameekareebhootadeha.
ashchlkitsaavldo dushchikitsyaa bhavantl. des-troys
The person Is wise ancl given to reading and writing a lot. The person's
280
body glows like 901d and tis knowledge is to a teadler. tr ttle
perSOn contracts any form d ailment. it is difficul t to treat them.
Jeevanath: he said has been covered ab:)ve.
Punjacharya: Yada lagoagate saumye yuv.!i b.Uiaayate kiWn.
Chandraputre dta tatrasthe sa narastuvaraprtyalla. Even as a mM he
looks like a dlild. He is fond of yellow lentils.
Gholap: Law abiding, always immersed in thatitable deeds, has
many friends and loving pareru. He enjoys and is industrious.
He has no tnemies.
Gopal Ratnakar: Mercury is a great planet that has great
significance In a person's life. It dispels the possibility of demons
possessing the person.
Hlllajaatak: Dashamevatsare k8811titxr:lho yacllchatllagn89aha.
The person's body develops attracti ve attri>utes at age ten.
Yavanmath: If f\1ert:ury is in a Fi re Sigl the person is hasty, has a
sligtt tendency to anger, enjoys theatre and the person is a good
orator an::l excels In mathematics. In Sagittarius, t-1ercury bestows 17eat
valour. l n Taurus, Virgo or Capricorn, Mercury makes t he person
&ITogant and a cheat In Gemini, libra and Aquarius, the person Is
extremely intelligent, knowledgeable in the arts and studious. In
Scorpio, the person i s interested in t he sci ences, can become a
scientist. is setfrsh and the U'ld who an intimidate others into parting
with t heir property. I n cancer or Pisces, the person Is unstable,
inrerested In writing, excels in scholarly purSI.its. In conjunction
wit h Satwn can prove very malefic,. howewr.
Agyath: Kshami saptaavinshativarshe teerthayaatraayogbha.
Paapakshetre dehe rogaha pltapaandurogaha. Angaheenaha.
Sajjanadheshl, netrarogl, vanchakaha. Saptadashavarshe
bhraatrinaamanyonyakalaham. Angaheenaha. Shreshtalokam
gai>Nshyatl. Paapayute hrishte n!Chllri<she padp8/ci<JJm gamlshyltti.
ShayyosvkhaVOijltaha. KshoodradevitlO/i!SOkilha. Paapamandaclyute
vaamananetre haanihi. Shashtheshayute needleshayute doshavaan.
Apaatravyayavltan. Paapamlltlhl. nlsMhayena
28!
dhandhaallr;ladimaan, dhaarmikatwdhi, astraatit., tarkashaastraanvifa ..
This person is forgi ving, he undtakes a pil grimage at
ttle age of 21. lf Men:ury Is with a malefic flfluence or In conjunction
wit h one, the person suffers from ailments c;l a chroti( nature. He
does no good d!eds ard harasse:s hiS ffllow men. He contracts f!ye
disease. At the age of 1'1 he quarrels wtth his brother. He does not
enjoy happiness for a b'lg time. He is a devotee of lowly deities. lf
Mercury i s in conjunctiOn with 5atum or othtr mal efiC planets, tht'
person co!Jd be blind In the l ett eye or lose It In an He squandets
his wealth. Hi s tendencies are evil. Jf Mercury is with an auspicious
inOuMCe then the pers:on i s wealthy, spi rib.Jal, happy, learned and good
at debating.
My Thoughts: Wl'\!lttver the andfnt wri ters have said so f ar
appear to have been based on the premised that ,.1ertury Is the sole
planet in its space. &.t MerQJry is inevitably ahead of or behind the Sun
wit hin a rn.?Jrgin d 30 degrees:. It ri S6 and sets both from t he
by lhe Sun. Simlarty Is also Inevitably dose to Mertury In
the initi al phases and sometimes later as i t t ravel'5es tiYough <XIler
houses too. There are many instances f'.1ercury is i n conj unction
with other planets. Therefore It Is next to to describe the
traits of MerOJry in i solation since i t is never dear which attributes have
really been bestowed by other planets. Most writerS have
attributed all the beneficial traits to rnascU_,e 59'1s and malefic traits to
feminine signs. The reference of Brihadyavanajaatak and Yavanmath
that there are many children is only possible if Merwry iS in a feminine
sign. Jaageshwafs cl a long lineage does not apply to any
sig'ls except Gemini, Sagittarius and Aquarius. (n Aries, l.eo and libra
there a coupled sons. l f Mercuy i s in a feminine sign then the
person d"""lops a tendency to gluttony 1111 age 32 and Ill.., gra<I.Jally
loses hi s appetite. Brihadyavanajaatak. says the person gets gbry and
prestige at age tM. These days music_ dance and cinema have opened
the doors for children to get status and prestige at a young age.
Examples are Maharastltri an singer Sal Gandharva and Master Barve.
Hirlajaatak has sai d ten is the age when a person ruled by Mercury will
experierce of his I diSagree with VasiShtha t hat
the age of four has a potential of death. MetOJry has no role In a
person's c:harr::es d death. lt is irresponsible to link Merwry and death
282
seen in one or two horo5('.01)e5 to del iver a general verckt thJs.
Here I provide an examJ* of one such horoscope wtlerein it is
easy to be fooled into assuming that it is whi ch iS
for the death of the person.
Sot
'"'
Narayanattuttt speakS muCh of til! ability to I n those days
ttlere were no newspapers or magames so In those days this coli<! not
g-anted a person much benefit. But now this has value. An
unknown astro)Og!r has mentiontd thbt at the age of 17 there is a
chance d all brothers rnherlting great wealth blt that seems unUkety In
most cases so I wo'-'d disregard this advite.
My EXperience: In the first IS phases d Aries, Leo, Saglttanus
and Gemini the presence d Mercwy then the pel'$00 falls in categoty
one as deScribed above. lf thiS occurrena'! iS in the rorthern phase: d
v<go or Plsoes Is partla.larly true. The se<or<l category d physical
features is oriy seen if MerOJry is in the soLthem phase of these signs
or el se in t he northern phase of Taurus, C-apri com, Gemini and
Saglttatlus. tn cancer or Libra, Mercury makes the petson's body
dehydrated but he is tall. The person has small eyes and t he
complexion is txtremely fair. If Mera.Jry in a masOJiine Sign tM
person's edu<ation Is <Oif1)1eted rapidty and the person can be an
author, publisher, printer or writer. In Virgo or C&pric:orn, dle
person is a trader or an emplo'(ee in a mammoth firm. In cancer, Scorpio
or Pisces, dle person can be a CClf'llKIUnder, a proof-reader or In some
similar semiderical profession. In a masc\Jine sign. makes dle
person benefit greatly at the age or 36 and he prospers as a writer. In
Ulurus, and caprb:lm, Men::ury renders the person shy, a loner
and of l owly thinking. He has tendency to despair at t he smalest
problem and speaks ill of others all the time, He i s selfish. a Cheat and
28J
stingy about his money. He <bes l"()t help others. In and S<;orpio
person is harsh and spe.tJkS nastily. In sagittarius, perSOn is
hone.t but has no other good attributes. In Alles, l eo and Sagittarius,
the person has o tendency to ape oltlers.
Mercury in the Second House
Acharya and Gunakar: Wealthy
Kalyanavarma: Bvddhyopaarjltavibhavo; dhanabhavanaga
tesnnapa nabhogi cha. Shobhanavukayahasunayaha shashitanaye
maanavo bhavati. This person acquk'es wealth th'ough the use of his
wits. He has ro dearth d food or material lulOJries. He speaks well and
thinks noble thoughts.
Bai dhyanath: Budhdhachyopaarjitavitta sheelagunavaan
saadhuhu kutumbe This person has sot.nd prtlc.,les, he Is
noble, virtuous, and earns much weatth by using his wits.
Kaalachlntamanl: Budhe Ohane vNokite va dhiNlaaddachyo
raajapoojitaha. PatvtXtaashi dhane nashte pwaranyacha Jabhyate. This
person Is weatthy and endowed with roval prestige. He: Is an excellent
orator and one who can get rich even If he loses all his wealth.
Garg:: Twagdosham kuroote nityam somaputraha kutumbagaha.
His person is always sui'Jering from skin ailments.
Uday Bhukar: H8ribudho yadi va ghatavaakpatml vapfJShlhf tat
purushtrayajam dhanam. Sammridu chedhwanabhetyaadhika
b/0..-et.h. If f\1ercury is in Leo or
)Jplter In Aquarius; OOOJP'flng the Housed Wealth the person Inherits
the wealth of three generations. He is soft. spoken, enjoys power and
has many servants. His wife also brings in a lot ol wealth from her family.
Brihadyavanajaatak: guruv3tS/IIMa
kalitaarthamalltvaSt.Jkham. V1pulakaantlsamunnatlsamyuto dhanMike-
tanage shashinandane. A man of pri nciple, one who worships his
teacherS, able, does oot lack for wealth and riChes this man is
284
industrious and gets the reward for it. He gets in-credible wealth at ttle
age of 36.
Yavanmath: sadaiva. He i s a
ITIIIbnaR.
Ka shlnath: Dhanabhaave chandraputre dhanadhaanya
dip()()tbha. ShubhakariTilJsvkhi nityam raaj8Poojyashcha jaayate. He
has wealth and rid'lts, does good deeds, is happy and b'f tht
state.
Jeevanath: Vidlyoho putre pravaram/Jtirltgyopl kritNUJlJm
samaa)astho vaachaspatlrlva sadaa bhaasat Ill. Prataapl geetagyo
bhramar iva bhogl kshatitale mahodaar shashvat suratruruva
Even i f incognito, he glows like the moon
when he enters the colf1)any of s<:holars. He Is glor1ous, one who
enjoys the company of the learned, he eats and h.as the
wisdom of a Banyan tree: thllt reaches out it many directions.
Narayanabhatt: Dhane budhim.Jan bodhane baahutejaithlJtJ
sabhasangato trlaasate vyaas eva. PrlthoodiJatataa ka/pavrlksllyasya
tadrit blldhoirbh.>nyare bhogatoha shatpadoyam. The mearl19 is ll>e
same as JeevanatJ1's desCJ'ii:tion
Aryagranthakar: Bhavati cha pitribhaktaha susthitaha
paapabheeroommridri tanu khararomadeera ghkeshostigauraha.
Ohanagatash8Shisvnau satyavaadi vihaari bahutaravasvbhaagisarvtJ<-
kaalapravaasi. He is dewb!d to his father, has a delicate physique, very
fair complexion, truthful temperament, peace-loving, extremely
wealthy and a frequert traveller. He has klng but dry hair. He Is happy,
noble, wealthy, virtuous atd friendly with all.
Jaageshwar: DhiJne bodhlN'Ie v8kti tri(JiJdltJryamishrlH'Il dlanam
sa bhogi. BhaW!tasansadi sinfxlhJyaha sa vald'aa
vad:1anyastadt.tam na vyartha virodd'ltJm. He speaks sweetly but has
no wealth. He Is radiant ard has no dearth d foll owers. When he
enters a room, all eyes are turned i n his direction. He is sober and rarely
speaks without pwpose.
28$
Punjacharya: Gye vaagmi sa 5}-8a(h wrushaha saumyavaktraha
S)'ltlld budaddheyoparjiMSV3M I<AvirllmMvllthM VMdhimiS/Itunntr
bholctaa. He Is a good speaker, has a pleasant face, eatns wealth
through his wits, eats a k>t c:l sweets and speaks f lawlessl y.
Ramdayat: Everything is the same as Punjarafs description.
Vasis:htha: He gets wealth.
Gholap: He has many friends and remains ilaPPr' all his life. He is
feiicitated publicly by all. He is supreme in whatever he chooses to tty
his hand at He is an important man and txcels in a l wblkS of is
Intelligent and shrewd. He seMS his teachers with devotion, Is brave
ond o good poet.
Gopal Ratnakar: He has many sons, is knowted9'!able the
scriptures, speaks softty, one who does not strny from his mission,
weal thy, earns wealth through his hard work, has much land and
property, and his wealth.
Hlllajaatak: Shadavimsho vatsare chaiJndrlrdhananaasham
dwitiyagaha. He suffers los:s of wealth at age 26.
Yavanmath: He speaks sweetly, donates sparingly, is i ntelligent,
softspoken, devoted to his family, law abiding and wealthy. His frter'lds,
howevet are not good people.
Paaschaatya Math (Western Thought): If r-1ercury Is In an
auspicious Influence then It can be very strong and vetY beneficial. Soc:*
writing, joornalism, travel, poetry, essay writing, brokerage, calligraphy,
accounting are atl professions where the person can do Vf:IY well. He
excels in studies rJ the scriptures, analyses of trade and fin&nce and
also d eclJcation. The person is l a-w abiding, principled, introspective,
spiritual. Industrious, and just. t-is pace of work ts fast and he has
lud< wi th money.
Agyaath: Koteeshwaraha, t>hogl, vaachaalaha,
shaastrivlchakshanaha, dhani, gunaaddachyaha, sadguni,
panchadarshvarshe budhMdhyavaan dhanavaan /aabhapradaha.
Paapayute paaapakshetre arineechage vfdhyaheenaha, krooratvam,
288
p;;rvanavyaadhifW. Sh.lbhayutiveeks/Janaa. Oadhividhyaavaan. Gtuvyvte
vet!kshite va gMJ;tMIastrMJhikrMIJ S/Nnp/Jnna. He iS a millionbire: and
does oot lad< for fen*line attertlon he is well versed In the salpbJres
and is virtuous. At age 15, he acquires immense knowl edge and
The person's stuci!s do rot p-osper if Mercll"y is mblef'IC in its
Influence, Is In an Inauspicious house, In conjunction with an
inauspicious planet or in a hostile space. The is then cruel and
suffers from ailments of the Vatha system. II it is in an auspidous
lnftuence the reverse holds b'ue. If Mercury is with )Jplter then the
pef5Qn is an excel!lert. mathematician.
My Thoughts: The ancient writers have asc::ribed al beneficial
properties to masculine s9's and influences. Brihadyavanajaatak has
referrtd to wealt h gained at the: b9! of 36 and I ftnd thiS is bome out
by own obsetvatlons too. All unknown writer has said that at the age
of 15 v.-ealth and learning are acq.Jired but J do not find this the case.
Similarty, Hill3ja3tak also a pptarS to b! wrong. In reality, Mtra.Jry has
nothing to do with weafth. And In any case, In India writers and those
in related professions hardly eYer p10sper. J find that merwry is in dle
House of wealth in t he horoscopes of most trbders and they do
prosper as a result In the f.ek:l d eclJcatlon, principal s, professors,
scientists and are wrel so perhaps from dlis point or view
one can s:ry that there iS a pctertial to acqlire we&tth.
My Experience: Ordinarily Venus and Saturn are the planets,
which bring lnOtdlnate wealth. venus gc:werns llqUd cash and Satum
immovable assets. any other planet in the House or
Wtafth cbes certainly impact a person's ludt with money. In all signs
except Gemini and Cancer, even If the planet ruling the House of
Wealt h is distorted, Merc..,.y even If in an auspicious lnftuence, dle
person ends up in dire poverty. If there iS a masculine sign in the
asoendant and Merct..ry In the House of Wealth In a feminine sign, and
assuming that the planet ruling the House d Wealt h Is not distorted,
dlen dle person gets great wealth and is su<:eessftA life. His
education faces frequent di sruptions but does get completed. His
speech ts clear and althor1tatlve. His behaviour is n<X servile. They are
intelligent and often good writers. They uave f or good food with much
variety d taste. They get mUCh fame after death and all t hi s i s because
281
of their intellectual prowess. If the planet ruling the Hot.l5e of Weatltl is
distorted kl innuence it casts, the person getS leSS wealth and few
or no children. Though he In not very well read. people tend to view
him as a Hi:s ife is generally unsucx:essful but he 91!tS presUI)e
after d!ath. These newr worried atx>ut the spiritual aspect
of life.
Mercury in the Third House
Acharya: Prakhalaha. The person is very elAL
Gunakar: DutjMitha. The person is corrupt by nature.
Kalyanavarma: Shrvtinirataha parldJnastrltlyNaashau budhdhe
bhavati jaataha. Nlpvnaha sahajasamero mayabahulo fliNilshcha/itaha.
The person is immersed in study of the scripb.Jres, qliet and sober in
temperament, courteous. poor, has many frierds, Cs very charismatic
and also very Inconsistent.
Baldhyanath: Mayakarmaparostanostlchapa/o deenosnujasthe
budhdhe. The person is charismatic, a travener, he is shrewd but poor.
Garg: Budhdhescha saha}asthaane drishtibhirvaa vilokite.
BhratriMam bhaagineenaam cluJ sukham tasya mahad vadet.
8hraataram pancham vldhyanet shatrudrlshtachyaa mritim vadet.
Chatastraha panchavaagyeyaaha swasaaraha shubhalakshanaaha.
KCXJ}lNI ShaniMa drishtt taassam vandtlylltVamishyate. 8udho v4 tab'a
swasribaahuly4ntaam msya kcxvarti ba his sanshayaha.
BudhiJ<I trltaye. Budhashcha shataaclhlpaha. The person gets !'eat
affection from his siblings. He has at least five brothers and five sisters.
If r-1ercury Is OYet"looked by venus, the per-son's brothers In case of
sisters, their death is caused by the lrtluence d Mars or Saturn. This
person has many frietlds.
Vaishnavatantra: Lagnaat tritiyabhavane yadi somasuto
bhaveth. Dwou putrou kMyakAastiStro jaayante naatra SNJsh4y4ha.
TNs person has two sons and three daughters.
288
Brl hiKiyavanajaatak: chit parivaraarajiNialtddachya-
SIIrlttJIShtXJdf)irahito hMM&JI<hyblla. MMnavltha kuS/JalhvMn hitkattM
shee!abhaarotarojesnujasanSlhe. Ttis person Is brave and has a large
famity. He is not of good charatter and he is forever oohappy. He is
and crafty. At tht age of 12 M $Uft'ers toss d
Aryagranthakar: The same as Brihadyavanajaatak.
Vasishtha: Rid:Jhim, anyaMitim. This person is selfsufficient but
fears others.
Kashlnath: Tritiyasthe budhe }Uthaha praShastho bNidhu
manithaha. Oharmadhwajee yasllMwl cha gunxJevarchako bhaveeh.
llis person has a good physique, many dear friends, he is religious,
radiant and one who respects hiS teachers and deities. SwajanyukA
jadadheerbahusaahasaha kumalataa kumanaaSlrlgate budhe. This
pe150n has many friends, is ol dull intellect, he is brave but hismird is floAt
of evil thougtn.
Narayanabhatt: VtMikamitrataapany;JkridolritNsi'Jttali vasllil'Vam
dhtyo durvashaanaamupaitl. VlneetoSlltitcgam tilajeth sanyased va
triteeyesbujairaashrito gye latitBViJ't. This person benefits from trade
and from making friends with trnders. He uses his wits to rule others.
He is soft spoken. He mtJrf either be very Industrious or end up as a
hermit He will have to his brothers in the same manner In
which a tree Sl4)ports its branches.
Jeevanath: What he says is the same as Narayanabhcltt.
Jaage.shwar: Budhe budhdhlmaan vlkrame dharmasheelo
bhavelleelaya rogabhaak sarvMaalam. Swasaaro bhavanti dhruvam
pancha khetatastha saahasi chlltashi.K.Ihd'lit vtheenahit. This person Is
intdligent, forever Ill but brave. He has frve sisters and all c:J
them are of easy
Mantre.shwara: Shourya shooraha suhasajsaMtaha sashramo
d8kr(ayuktaha. He Is brave, of tridcle age, has decent brothers, Is hard
WOI1<lng and frien<ly.
Gholap: The person's profession recJJires him to use arms. He Is a
289
patriot and full r:l He has good, decent sons, he is a poet. He is
also f ull of pride, radiant, virtuous, endowed with property has good
brothers and a beattlful wife.
Gopal Ratnakar: This person is happy and wealthy. He has many
siblings and the relationship is hannonious with them.
Hillojaatok: Triliyodwadosho vat>/le. The 1J<1S011 gets wealth at
the agt d 12.
Yavanmath: This person is brave, rich, kind, and is the beloved c:l
friendS and many women. He is atways peaceful and content.
Paasdlaatya Math (Western Thought): lf r.1ercury is in an Air
sign the person Is rnrustrlous. He excels In salptures, astrok:lgy and the
occult. In cancer or Pisces signs or if t he person is and there
is no inOufnct d Saturn, the is unstabte and a coward but
excels In oratory, written or oorrmunlcatJ\o'e si<Jis. l f Jupiter eJIOI!rtS Its
influence, the person can do well in legal supervisory fields and may
make a good j udge. II Mars emts its influence I>MefiCially, the person
bec<>mes a brilliant geologist He ts generous and charitabte and travels
a lot
Agyaath: 8hraatritn8an, bah1J58tlkhy8maan. Panchadilrsharshe
kshetraputraytaha, dhanalaabhavaan, Bhaavaadhipe
balayute deerghayuhu. Dhalryavaan. Bhaavaadhl pe durbale
bhrBtr}peedaa bheetimaan. Balayvte bhraata deerghayuhu. He has
brothers and they are happy. At the age d 14 the person inherits a
large amount of agricultural property and soon begets cHidren who can
Inherit It from him. The man Is wealthy and virtuous. lf the ruling
the Ttird House is strong the person is b'ave and enj:>ys a lo"9 li fe
span. lf the planetary innuences are weak, the person is a coward and
does not enjoy a harmonious relationship with his brothers. Only if
MerQ.Jry's influence i n t he Third House is strong, do the person's
brothers live a long li fe.
My Thoughts: l n a neutral horoscope, MerQJry is the rUer of the
Third House. Therefore. andent astrologers have deplaed benefits as
mentioned above. Since t he Third House lies in the domain of
290
there are two catet]Ories of benefits from the planetary influence too:
masculine and For debaters, poets, astrologers and writers it
Is Imperative that this house has a benetlclal l "'uence exerted over it as
their lives and livelih:xx:ls depend on being able to correctly ex;press and
communiCate: their thoughts. In my opinion, thiS House porterts doom
for the lnfklence of beneficial pl anets as a rute. These benefici al
attributes awibed by the ancient astrologers ac:cordi ng to me are
applicable: onty in Arie$, Leo, libra, Virgo, tht' southern phases d Gemini
and Sagittarius, and the northern phases or Virgo and Pisces. ln the
Northern phases of Gemini ard and in the So\Ahem phases
or Vlf9:> and Pisces, in teminire Signs and also in other signs not
listed above, the attributes d Mercury are q.Jite detrimental. Hillajaatak
says there is great inheritance of wealth at age of 12 arw:l YiWanjaatak
says there is great loss of wealth at t he same age. r fird the latter is
correct This is bec:ause Sin:::e the Soo prececte:s Ml:!rcury in t he House
of Wealth It destroys the possibility of ancestral weal th Inheritance.
Even an unknown astrologer has mentioned that at the age c;1 1 S the
perSal will ha! sons, vdldl to my mind iS ridiculous, not to mentiOn
unlikely. 1 do not rule out the possibility of lrtlerltlng agrtcuttural land
t feel this depen:Ss on the prevalent planetatY innvences at the
timt:. Overall, 1 must say this may happen in exceptional cast:s but will
not be the usual norm. Slmilarty, 1 feel most d what c:l Gholap has laid
down appear to be Ul'l'ealis6c.
My Experience: If t-1ercury is in a maSQ.Jiine sign the person's
educ:atiOn is com!*(ed. The person is peaceful and a poSitive thir*.er.
He de:W>tes his attention to hard work and progress. His slgnat"e Is
incllc:ative c:l lis clarity of thought. He writes fast and ex:presses noble
thoughts his writing. However. if Mercury is in a sign_
the opposite happens. A corrblne like Merct.l'y In the Third House,
in the House of Wealth and Sun In either one of these houses
teCIO'led with an aSCMdant of Sagittari us, Clna!!r or Virgo, the person is
bound to excel as an astrologer. If venus rules the T1*d House and
Mert\.I'Y the House of Wealth. then too the same hok:ls true. This is an
auspicious combine for doc:.tors and jldges, as they have to deal with
otherS' problems keeping their own sel ves calm and unbi ased.
Merrury's lnUuence also helPs hone their skills. This
comtine also benef its writers, etdlers, artists and publishers. They,
however, halle to oonstantty keep changing their place or residence. lf
Ml:!rcuy's irlluenc:e: iS strorg, these pee>!* get thfir Share of l UCk
at the age ci 24. If It Is only moderately wong, they get It at age 36
and if MertliY is infl uenced by ITI(IIeflc the person 9t(s not
great Share d good fortune.
Merrury in the Fourth House
Ac:harya and Gunakar; Panditaha. They are scholars.
Kalyanavarma: Panditamahuhu subhago vahanyukto
budhehlbukasansthe. Suparlchchadaha subandhurbhavatl naraha
paarr:Htn nilyam. He scholar, good looking, has marY)' vehicles an::lls
born in a good family.
Baidhyanath: Bandhusthe shashije vibandhurmalgyaani dhani
paanditaha. tie iS not a man given to self-centere-d behaviour. His
knowledge Is pure. He Is wealthy and learned . .balD >ldhya>lnayachalu
shrandrasunau balishtthaha. llis persoo is knowledgeable, col.lteous,
Intell igent and strong.
Garg: Bahumitro bahudhllno bandhou PlflJpam vinll budhlJ.
Naan...,.asav/Wsl cha sapiNJpe tvayanyalho fa/am. Chltram buc1t>ed!a
vigyeyam budhe swama grihe tasya. Bandhushra sarvakaaryeshu mitro
mlshrafalapradlllla. f\1ercuy in this place bestows great wealth on a
person If Is not lrtluenced by any malefic planet The person also
makes many friends and gets a vi vid experience of many unusual
aspec.ts of life. lf Mercury is in a malefic influence, the opposite
happens. But In any he gets to stay In any ur'l.lsual places. It
sho\Jd never be for90tten that Mercury Is the signlficator for many
good friends.
Baadarayan: chaalpasutatvam. He has few sons.
Yavanmath: Budhastu patyaahitabandhusaukhyam bandhou
par3/1VIIllsal<rita He has a devoted wife and many good
fri<ndS. Howeve; If tllere any malefic planet In the orbit of the Folrth
House. the person en:ts up having to stay at other people's houses.
292
Kasllinath: Chat<Kthe chancJ-apuiTe cha balubhritya-shomitaha.
Atuvaakyo satyav&d; cna He has many
servants and has a l ot of prestige. He speaks wisely. Gyo vittahaa
yamayamaihi. He sutrel'$loss of wealth at age 22.
SaukhY8f1vitam cha dhanam. He is wealthy and happy.
layadeva: Sadhanavaahanageetagunostano grlhasukhaha
SUkllllg4giJ shMIIijo VJJshahif. He has wealth, vehicles, iS an excellent
musician, travels a kX and acq .. .llres much glory away frcm the house.
Narayan abhatt: ChiJturthe chiJrechMdrtJ)IJshchlJarumitro
vlslleshaadhlkrld bhoominaatho ganasya. lekhako Jikhyate vaa
tadf.Jktaantaad8aShaapi;tfiJihi paitrik8m no dhanam efta. He has mcuT)'
fritnds, is usually a king or a minister or holdS some olhtr very important
position. He Is a writer or one whose words are written down by others
aroun:l tim. He h(;ls no ancestral wealth inheritance.
leevanath: Everythirg he has said is the same as Jeevanath.
Jaageshwar: Budhe tooryage vaibhavedlshtikiJadhyiJihl
pitutbhaagymean smdar. His father's genes making him good lo<*ing
and fortunate.
Mantreshwara: SSt:lktJyavaan chaatuvaakyaha. He is an exceDent
mathematician ancl speaks well.
Aryagranthakar: Bahutarad'lat'f)umo bhrattlhartaa cha paape
bahutaritbahupatnl poornllgihe swatunge. Taralitmatirlajjaha
ksheenajandhaha lwshaangaha shishumvayamsi cha rogi
bandlvsansthe He is very wealthy. If MerOJry Is In a malefic
Influence, then the person's brothers are destroyed. If It is strong In
an exalted position the person has many wives. His intellect is sharp and
his physiq..te Is lean ard fit. He is shameless and oontracts many diseases
at a yourQ age.
Ghol<lp: Good look/'9, has many vel*:les, f riendly with the
nJer. this person lives in a good locality. He enjoys power ard is brave.
He Is wealthy and has conwnand of many differett skills and sciences.
Hillajaatak: Owa8Vimshe chathllthagaha putram cha. He has a
son at the! age of 22.
Yavanmat: Hi s body i s His son causes him much
unhappiness. He does not complete wort that he begins and that
c;auses him muc;h unhi!lppiness. He is friendly and speaks sweetty. He,
however, iS a man whose wordS and bet:ions are rbdicalty differert. He: is
not reliable and often forgets prorrises he made. He Is very lazy.
Pa.asctaaatya Math ( Western Thought): If Mercury Is In Gerniri
or Vif9o then the person's fife is good towards old age. He has marrt
concems. His inner voice i s strong and hiS abi li ty to concentrate is
excellert. II Saturn is in a malefiC inftutnce with mercLry the per$0n
could be cheated betrayed into losr.g his wealth. His parents are
good people.
Agyaath: Dhalryavaan, visttaalaakshah, maatripirtisU<hcwuktaha.
Vibhooshaayoshaangam pravarturagaanaam. This person is
knowledgeable and happy. Shodashavarshe dravyaapahaararoopena
Mavati. Gf.lrushulcrashaniyvte aneka vaahana8Vaan.
Bhaavadhipebalayute aandolika praatihi. Raahuketushaniyute
vaahanarlshtavaan kshetre sukhavdljl taha. Bandhukuladweshl. He Is
brave, happy and wise. His eyes are large ard attractive. His parents are
good people. He has good ornaments and women. He has mafrt', fire
horses. He benefits greatly at age 16 by receMng wealth from others
outside the famity. If is in cont>ination wtth Jupiter, or
5ab.Jrn, he! gets many vehides and if it is combination with Rahu, Ketu
or 5ab.Jm then he Is scared of mOW"ing vehldes. He has no land and
exerts his power unfairly and with anger his servants.
My Thoughts: Though some astrologers have said t hat the
person will be l earned and il'(elligent. J have not seen this trait in any
sigl so far. What Yavanmath says about unhappiness pertaining to sons,
whe1her It be their death or bad beha\llour, this seems to be true orty
if the SUn is p-esent in the Fifth House. However, if the SUn is in the
Third House the exact takes place. W'hat Yavarmath says about losing
wealth at age 22 and Hllla}aat:ak's observations about the birth ot a son
at the same age are correct. One astrologer's observation that
is extremely weak in the Fourth House appears incorrect to me unless it
294
i s in combination wit h Taurus, Vi r90 or Capri corn. The unknown
astrolOger's ObServations are an incorrect There are next to no chances
of a 16-year-old acquiring wealth from a stranger. In short. the
beneftdal traits astrologers speak dare all seen in masculine while
the maleflc effects are in t he feminine
My Experience: II Mero;ry iS in a rM:Seuline sign, then there is
some scope for studies but with any Werroptlons.lf It ts In Aries, Leo or
Sagittarius, t he person is qu-=k to anger, a loner but one who likes
people. He cbes: not enjCI'f a harmonious relationship wi th his mother
and he has a lot of false pride. He does not help others and Is Yety
stingy. In Gemini, L.ib"' or AQ1.0rius, the presence c:l means the
person does l"()t enjoy a 9ood relationship with the father. He is full d
pride about his knovdedQ! and learning and has a t:Mdercy to 8S$U!Tle
ttlat everyone around him is a fool. His education remains Incomplete. lf
Mert\I'Y is in a feminine sign, there i s SOI'l"''e wealth ac:qlired from trade
but he has frequent quarrel s wit h other t raderS around him. This
person does get some wealth and pt operty,
Mercury in the Fifth House
Acharya and Gunakar: He Is a ninister or an adviser.
Ka lyanavarma: Mantrabhlchaarakushalo bahutanayaha paflCIMme
soumye. Vici'Jyaasukhapabhaavaihi samanvitD harshasanyuktaha. He
excel s In scriptures and occul t practises. He has many sons. He is
l earned, happy and lnnuential. He Is contented and peaceful.
ChandraslJte sanjttate ravigehe daarikaa bah!Jaha syaath. If Merti.IY is in
Leo the: person has mar'r;' dalljhters.
Ga rg : PanchambSthash<:handraputralla santaanam prakaroti hi.
Astangataha shatrudrishtashchotpannas-yll vlnaashakllha. Maatulaa
nashyantl. Saumye chaalpusutatvam. Mercury In the Fifth House
signifies that the person has children at an early age. But ff the panet is
matefic or retroverted or by atty other malefic planet the
chllcten die early. The person has few SOI"6 and his maternal uncle Is
destroyed.
Baldhyanath: Mantraabhichaarakushalaha sutadaaravJttasuta---
maravifM vidhy&yaShobalbyuw.tJ He excels in the
occUt. He has many sons, many WOmetl, fTIJch wealth, learnng, <jlory
and power.
Brihadyavanajaatak: The prQPerties of Mercury in the Fifth
House are Simi&ar to those in the Fourth House.. nwtuhu
kshayam. The mother dies when the person is !We years ott.
Kashlnath: P;mchame rohlnfpurre putrapoutrasamanvftaha
StJbudhi satvasampannaha StJkhl bhavatl maan8vaha. He has many
chikt"en, is powerf\J and of shllrp i nteltect and generally remains happy.
Vasis:htha: &xldhashdta swa(paatmaojetm roojam. The person has
few chikten ard many diseases.
Jayadeva: Mitnputrasukhayuk shubhasheelou mantrasha
astratAdasou sutage gye. He has many friends and sons. He Is brave and
he is sidled and knowledgeable about the scriptures.
Narayanabhatt: Vayasyadime (XItritgarbho t'JiJ tishstth bhiJveth
tasya medhaatthasampaadayitri. Budhairbhanyate pandutme rohineye
klyitd kaH.Nasyaatillchaaram. In later life, he does not have
sons, onty daughters. He wealth by using his wits. He is skilled
with the occult arts.
Jeevanath and Jaageshwar: The same as described by
Narayanabhatt.
Aryagranthakar: Tltnayamandirage shashinandane sutakala--
trayuktaha sukhabhaajanam. Vikachampakhltd'laarumukhaha si.Jchi
StJtagJ.Jf(Jwijabhaktiyr.Jktaha shucNhi. His vre beatS many sons. He Is
happy, has and noble thoughts, worships gods and sages alike. His
facets beautiful like a lotus In fuD t:toom.
Mantreshwara: The same as described by Baidh)0nath.
Punjaraj : samaa. Xartyapatyaha. He is of average
and has only daughte,..
296
Suryaj..atak: Sh.Jbhamatihi. His intelec.t is pure and uncorrupted.
GhoLap: He is worshipped by all. He is pure, l"()ble, 9QOd loc:*.ing
and has prt:Stigt:. U f'.1ercury is in capricOrn or Aquarius, ttl!! ptrscn will
ha\lf daughters even It there Is no malellc lnl\lenc:e.
Gopal Ratnakar: The person's matemal uncle dies soon. His
father suffers but his mother prospers. He has several diseases and
ailments. He iS honoured by tht!! king. He iS interested in clothes and has
an extensive wardrobe. He Is learned, popular and extroverted.
HIUajaatak: SNd8vimSfr:J maatrihM panctwno budhW. At the
age of 26 the person's mother dies.
Jaatakaratna: Vidlyou vivaahato nashtaha. The person dies as
soon as his son gets married.
Agyaath: Savmye swakshe<ragati: ponchamapvtra bhaagbhaViltl.
Simhasthite pi chaivam navame vaa tritiyabhaaryaam. Himasuto
gart>hatwnl kNOll bhaavaacl\/pe paapayvre baldh"""" P<Aranaashahd.
Api.A.raha dittapVtriJPraatiN, paapakarmi. lf Meroory is in its own house,
the person has sons, even if Mercury is in l eo, in the Third House or in
the Seventh House. 11 the planet ruling the Fifth Hou.se is weak or In
combination with a tnilfelic planet the person's sons get c:lestroyed and
his wife if pregnant can miscarry the child. He ends up having to adopt
a son because he cannot natually beget any. He carries out many evil
and cruel acts In his frustration over this.
Yavanmath: The person g-ets wealth and has children. H-e Is
brave, happy, and works hard. He pestig:e early in life and this
remains with him consistentty.
Paaschaatya Math (Western Thought): The person has
c-hildren, glory and learning. He has a leaning towards gNnbling,
lotteries, valour and peaceful activities. If Meroory Is in a sign when that
sun sign i s in its destructiVe phase then the P'!rson's entire clan is
destroyed. In Cancer, SCOrpio and Pisoe:s, the perSOn's children go mad.
If Meroory fn this place Is in conjunction with Satum or f-1ars or both.
then the possibility of ctlitdren going mad is If or Satum
or both cast an auspicious lrtluence over Merrury In this place, the
297
person is lucky wtlen gambling. If Mercury is benefited by an auspidous
Moon, the person gets benefits. However, this ccmbint brings
with It an a19Jmentatlve nature.
My Thoughts: Though Katyanavarma and some others have
referred to the person's irterest in the OCOJit, J believe that this i s a
subject dealt wit h by Ve:nus. What Mercury can do iS bestow t he
power to dispel the lnnuences or other planets. Just about every
andent astrologer has made scme reference to a person's ability to
have children and this proves that it iS incorrect to brand f.1erOJry a
gender-neutral planet Some astrologers have made references to the
person's dying but d'lis appears very bilarre as a person's
influence on tjs maternal unde's life is perned in the Sixth House
from wh.rn the Fifth House iS actually in tM twetfth place. it
is absolutely inOJect to ascribe a property like death or destruction to
a plcwlet Mercury, which is among the most auspicious and beneftcial
planets. Yavanmath's reference to t he mother's death whfn tht'
peiSon is five years old Met HIUajaatak's contertlon t hat the person's
mother dies when he i s 26 are pro\led i rcorrect by simple observation.
In hlc:t, the mother's death is something that is not considered
when e>0min.-.g the lnfluetloo of any planet In the Fifth House. The
onty ciramstarce in whi ch this could ocx:ur is if the SUn is in the Fot..rth
House when Mercury is in the Fitth House. The benefits ascribed by
astrologers In tJis space are seen only In mascUine signs while the
traits are visible in feminine sigls. The of having
daugtters Md no sons are usuall y seen when the planet is i n or
Ubra.
My Experlence: 11 Mert"Y Is In the Fifth House In a
si gn, t he person has a mel odious voi ce and a sharp intell ect . He
completes his edu:ation rapkly often as earty as 20 to 23 years d age.
The person can be a success(\; writer, poet, dramatist or essayist. He
writes on science. tn Gemi ni, Libra or AqUBrius, the person has no
chil dren or o.-.y a few at the most. If he is a writer, he settles for
viewing his works as hiS children. He is powerful in lis comrrunity. He is
soft spoken, chartsmatlc and an introvert. If Merc\.I'Y Is in Aries, Leo or
Sagittarius, the person has a bit of a temper and i s stubborn. He is
attracted towards law and )Jstice matters. He i s sober and commooity
298
oriented. If is in Tat..rus, Virgo or Coprk:om the person is r:1 a
bent of mind. His is incomplete and he is
quarrelsome by nature. He can pk k up an argument on Imaginary
issues. He is 9iven to taurting people. He hitS few dlidren and they are
equally tvi in n11ture. He iS practical ancl to keep himself in tht
background pushing others ahead of hlmsef In any wor1<. If Mercury Is In
C1<:ef", Scorpio or Pisces the person has many children. The first three
or rrve and last is a son. He is rot reliable or trustworthy. He dwells
on other people's shortcomings. Jf Mercury Is In Aries, Leo or
Sagittarius, the person excels in mathematiG, law,
astrok)g,<, dance, phrenology tHe. In Taurus, Virgo and capricorn, the
person does well In elemertal sciences, study of the Evidence Act and
in graphology. In Gerrini, Libra and Aquarius, the person does well
meteorology, medidne, community hearth, teaching his own mother
tongi.J!: and in 8emMal scien::ts. He well dealing with the Stamp
Ad., grammar and oral examinations. In canoor, Scorpio or Pisces, the
person does well in typing, ex-amination, maO'ology, and
wol18y. MerOJry in an exalted position iS essential for a person to
suo:eed In his career.
Mercury in the Sixth House
Acharya and Gunakar: Ashatrohu. He has no enemies.
Kalyanavarma: Vaadavlvaade kalahe nltyajito vyaadhltaha
shaslte budhe. Aataso vinashtakopo patil*ootliDa.
He Is constantly defeated in arguments and debate. He Is atways Ill, lazy
and free of a"'ler He speaks harshly and Is always bei"'II>Jmlliated by
others.
Baldhyanath: Vldhyavlnodakalahaprlyakrld vlshaa/1
bandhupakaararahitaha shashijesriyaate. He is leamed, tak!nted,
quarrelsome, cowardly and one who does not help those In need.
Parashar: shasl'iestivrldd'llmcha. NaabHshu. His
enemies Increase cons tartly. He has a scat or a birthmark near the
novd.
Vasishtha: SlaBOitli.Jabham indujau mativiheenamiNJalparogam. He
getS a lot of land. He: is of dJII intell ect aM forever ill.
Garg: N!JriJ(J!J!Jiasya Shatruhu. sany.vsam.
Rii>'I'IB vljayete saumyaha. Neechdslldtaastavak.rashcha shashtarshe
ripurishtakrit. Kanyaptayosthamaatulaha. He opposes the king. If
M4:!rcuy is in a malerte influence or in a SpbCe ruled by a male:rte pJantt
the person renounces the wor1d and becomes a mendicant. He Is
victorious his enemies. If rt i s in a retrograde or malefic sign his
enfmies hamss him cx::.'lstartly. His maternal unde only has dalllJhters,
no sons.
Brlhadyavanajaatak: Sant!Jtichittaha. Saptatrike saumyaha
sllatrobhayam. He Is al ways youthful. M: the age of 37 he starts
worrying about his enemies.
Kaslllnath: S,.shte bvdhe IVishiNisashd>a virrxlli sorvabandhu.
10atn1Jparo ..;d/'JwlNNlaapi bhavenaarMa. He iS crutl,
greedy, debauched but
Aryagranthakar: lf Mera.uy Is ret:tograde his enemes prosper, if
it is directional, his enemies are destroyed.
Jayadeva: Vaad8Vit: He excels i n debate and Is
virtuous.
Narayanabhatl:: VJTOdhi janaanaam ripunaam prabociJiyatinaam
cha rodhosni/aanaam. Budhe sadvyaye vyavahaaro nidhinaam
bdlaadharthakrlt sambhavechchdtr ubhaave. This person opposes
everyone 1-e comes acrQS.$. He is victorious (JII(!r hll$ enemies. He Is
koowledgeable enough to share leaming with sages. He p13ctises Yoga
and Pranayam. He spends hi money on works that benefi t the
in general and eams much wealth throuljl hiwd work.
Jeevanath: prabhavatl vlkaarospl Varaanaa.
Ratnaanaam vyavahritti rativaartha janani. He suffers from gastric
ail merts. He prospers as a trader of gems. He oJ)poses the ki'lg. I f
Mercury is In a low pocs:ition or In a House nAecl by a hostile JMnet the
person ends up renomcing the world and becoming a mendicant He
defeats his enemies wi th ease. If MerOJry Is l owty posit ioned or
300
retrogade or malefic the eneries harass him.
Mantres:hwara: It is the same as Jaageshwar.
Gholap: He serves He has a rigid posture and is tormented
by long Lasting ailments. He is unhbppy, poor, a sinner, de:bt-ridden, cruel
and grief sto1cken. He Is tormented by evil people and also by thieves.
Punja raj : Shatrustho gyaha poonsaanaam noonam swapa
mrityc.m. He dies earty and after a life-threatening ircidel'(.
Gopal Ratnakar: His moltler dies. He is of an evil bent d mind.
Hlllajaatak: Shastrasakaashaanmrittimarlgye dwittfvacsare. He
dies at the hands of his enetnes at the age d two or three. T1is could
also M as the age r:l 23.
Yavanmath: He is tired of t he world, of a cruel nature and
quarrels unnecessatlly.
Paasd'laatya Math: He is harangued by lazy servarts, suffers
from respiratory ailments and spondylitis. He has a weak. chest and
from emotional He dies d anxiety and tension. He
does not prosper., self-erTl)byed vertures. He Is a rudear scientist or
a writer. He has some interests In a printing p-ess. If Mercury is In
combination with a malefic influence of any kind, there is a possibilly
that the person may go mad and may commit suicide.
Agyaath: Rajapujyaha vidhyaavighnaham. Daambhikaha.
Trlshadvarshe bhavatl. Bahushrutahalekhabha.
Kunjarshe neelakushttaadlrogl. ShiNJlrafklketvyute vaatsllulaadrogl.
Gyaatishatrukalaha. Bhaavaadhipe ba/ayate gyaatiprabalaha.
Arlneharsh. Gyaatikshayaha. He Is respected by the lUers, and an
excellent writer. He excels In his edu<atlon too. He beoomes fast friends
with the rUer. If r.1ercury is in a sign rUed by Mars then t he person
conttacts diseases l1ke leprosy. lf Mero.ry conjunction w1th 5atum,
R.ahu or Ketu the person oortracts irtectlons. He fights with people d
his clan. If the pa.net rUing the Sixth House is auspicious the person is
born In a high caste. If the Lord d the Sb4h House Is base, the person's
clan Is wiped out.
My Thoughts: In this space, the good attributes of are
seen in masculine Signs and the bad trai ts in feminine Signs. It is
debatable whether the person's maternal uncle can haYe only
daughters. I have seen seYeral horoscopes of people whose uncles
haY! h3d sons. Whbt Gholap says abolt brg laSting ailmeocs is apt t'or
Mercuy. It Is not clear how Gopal Ratnakar says the person's mother
will die as the Sixth House is rot an indicator of a person's mother'
death and inCidentally Mercury is not a planet that brinOS death.
I think this is Incorrect. I suspect what he meant is that If Mercury Is In
the Sixt h House and the Sun in the Severt.h House, there may be
some pottntial t'or the perSon's moth!r to die. Hillajaatak's confusion
over age two or three or alternately 23 Is misplaced. There Is a
possibility that the infart. may inj.lred seriously by a Q rdessly left
SCisSor or knife and in case of the youth hi! m&y cie att:er gelfilg injurtd
in a t;gr.. At the age of 30, the unknown astrolOger says that hi! may
make friends with the king but this cannot be ascribed as a benefit
accruing soldy from Mercury in the Sixth House.
My Experience: I have not seen many horoscopes where
Mercuy is in the Sixth House. lf it i s in a femini:l! S9l those who
are writers suffer from mental a.,ents. 'Nh\le wrltlng or speaking If the
person is not cautious he Q n err. His writing is popular and is the
subject of much d!b.!lte. His eating habits are excelent till middle age.
Then he de...elops aliments and loses Interest In food. He gets
sudden success in important works.
Mercury in the Seventh House
Acharya and Gunakar: Dharmagyaha. He is knowledgeable
about ret lgion.
Kalyanavarma: Praagyaam sudlaaruvesham naatikufeenaam
cha klllahasheelaam cha. Shaaryaamllnekllvitllm dhute lllbhate
mahatva, dlil. wife ls wdl-dressed, or an ordlna<v family
but quarrelsome. He acqlires wealt h throut;l marT)' means an1 h<:*:ls a
hlg h position.
302
Baldhyanath: Vyanga shilpakalaa vinodachaturastaaraa
If Mercury is retrogrbde the person's physique is
powerful. He Is oourteous and a good sculptor.
vaslshtha: Budho bahuputrayuktaam roopanvl taam janamet-
noharOOpashee/aam. Pdn. His wife is beautiful and artistic. She
has mMy sons. He sufftrs from bOct,o belles.
Parashar: sati paraa}ayam. He iS defeate:l in argumerts
and debates. He keeps the o::mpany of prostitutes.
Garg: bhavaN chancM!lNnlldhya
narlkstlihltApulavanshabhava pramadaapatifl f sa cha bhavatl sh.Jbhage
shasNvanshaje. His eyes appear misc:hie\IOus. His wife's father has marT)'
children.
Aryagranthaka r: His description is similar to Garg.
Bri h ady avanajaatak : Churusheelavibhavairalamkrita
satyavaaksu nirato ndtO bhaveth. Kaaminl kanakasunoosanyuklaa
This person Is talented, wealthy,
truthful, has many sons from his wife. Shasllijah.J klllatte stryaapt.im. He
gets a wife at the age of seven.
Kashlnat h: 5aptamasthe somaputre roopavidllyadl'iko naraha.
Sushedaha l<aarnashoastregye naarirnaanashdla jaayate. He Is good
looking, leamed and talented. He i s a skilled lover and bel oved of
women.
Mantreshwara: PrMgyoste charuveshaha sasakalamaahimaa
yaltlf bhaary .. sat4t3MI. This person Is Intelligent, holds a high position,
dresses well and marries a rich woman.
Narayanabhatt : Sutaha sheetagoho saptamesham yuvatyaa
vidhyate tatha tuchaveeryam cha bhaage. Annastagate hemavat
dehashobhaa na shaavanotl tats1Jf7l'8'*' vaanuktrtam. If f\1ero.Jry Is
rdl'ogade the person does not get a wife. II Is retrograde he does
not get a wife blt is inordinately brave. His body i ke gold and he
possesses untold of wealth.
leevanath: It is the same as Narayanabhatt.
layadeva: Dharmavitsvvachanaha shubhasheelaha
kMminikArMkJtSaukhyayutosste. He: undstandS religiOn. He: speaks:
wen. ls talented, wealthy and has no dearth of women In his life.
Punjaraj : EershachdlyaiNfW neelavatnaa bcJdtle baalda. HiS wWe
is elderly and has a ~ u i s h oof't'1)texion.
laageshwar: Bhavetkaamlninaam sukha sundaraha syah
anangotsave kaamininaam kuveeryaha. Kraye vikraye laabhato
lulxhahito yadaa chandrid&Jehandraa ll.!n&gehag&mi. He has a
good wife but is a coward and is not physically strong. He does well as
a middle-I'T'Ian in trade. He is good looking.
Gholap: He excds as a writer. He i s fortunate and has a fair
complexion. He earns tremMcb.Js wealth t hrough his valour and bnlve
deeds. He Is respected by learned scholars. He is a polltldan. He
acquires luxurious possessions. He is wealthy and good at his wort. He
does rot get mu:h haR>intss from hi s wife or sons.
Hillajaatak: TiJthaa saptadasho varshe stree saukhyam kuroote
budhaha. He gets a wife at the age d 17.
Yavanmath: He is wealthy, truthful, Intellectual, charit:at:Jte, good
looking, leamecl, crafty and talented.
Gopal Ratnakar; His rrt:lther gives Nm much happiness. His body
is h.ard. He gets women and wealth. He has many thoroughbred
horses.
Paaschaatya Math (Western Thought) : There are many
quarrels when he Is to get married. He does not trust his partner. He
benefits from tta..e. If he is a wrltet his work suffers for a fixed period
of time. 1f Mercury is in combinatiOn with any maleriC influence, the
person suffers greatly.
Agyaath: Udaaramatlhl. 0/gantMshrotai'i!ertihl. llltra shubhayd
chatu vlfshatlvarshe aandoNkaapraatlhl. Kalatramltlhl. Abhaksllya-
bhakshakalla. Bhaavesho balayute ekadaara vaan. Daaresho paape
304
poaparksl>e kujaadiyvte
My thoughts: lh>1.9h Ach.arya and Gunak.ar have said that ttle
perSCI'I iS religiOus, I believe: that r eligion is in t he juriSdk:tial d the Ni nth
House and ltlis Is Incorrect. Baldhyanath says that the person's
body is diseased but I tNr*. that even if there is a malefi( influence in
tM 5evtnth House, this will not occur. How t his can take place i f
Mertuy is retrograde ls not clear. Briladyavanajaatak and Hllla}aatak
hae IT\iKie references to the person gettjf"9 married at an age.
This may wd have been true in earlier times when child
!he nOI'fl1 blt these traits are In this day and age. Slfrilarly
the beneltt of travelling in a carriage should also be understood in
context. In earl ier times, only the gentry c:K t he vetY learned c:o\ld
travel in a hand lifted tarriaQ! so this could be: considert'!d M attribute
ttlen. Kalyanavatma says the wWe Is from an fafflly, this orly
serves to prove that there were inter '"(:l ass marriages then too.
Narayana bhatt ard Jaageshwar both said t hat the person is not
brave txA then 1 find it diffiOJit to understand how the person can be
beloved of women if he i s not brave. Garg's statements can be
interpreted in two wllyS. The first, that the person's wife has many
children and secondly that her father has many children. AU the
astrologers have ascribed positive attributes to masc:uline signs and
negatiVe attributes to feminine signs.
My Experience: lf Merrury is in a masculine sign the person's wife
Is beautiful and good. Her race Is aOJthoritatlve and sllghl!y elongated.
Her hair is b*k, long. ttick, lustrous bl.t rky. Her ptt,<sique is wiry and
sligttly masculire. Her wice is heavy. She is educated, a debat er,
b!.l not very respectful to her husband and can be quarrelsome. l f
Mert\.1')' is in a feminine sign., the wife's tac:e Is round. Her hair Is wavy,
long and silky. She speaks sharply but her voice is mel odious. She is
respectful to her husbard and Iewing to peopte. Even If she is more
educated t han her hJsband she t reats tim with respect She i s well
behaved, attr active and worldly wise. If MerOJry i s in Gemini, Ubra or
5a9\tzlrius the is usually a teacher, a scholar, a school prindpal, a
lawyer. a book sener. a publisher ett:. 1n Taurus, Vlf90 or caprk:om, the
person becomes a t rader, a caerk 01 a typist. In cancer, Scorpio, or
Piscts, the person is a compol.l'lder a clerk in a govenmert office. In
Aries or Virgo the person is fortunate and $table. He has to travel a lot
Mercury i n the Eighth House
Acharya and Gunakar: Vishurtugwakhyaataha. He is famous
because d his wtue.
Kalyanavarma: Vtkhyaatltl1aamasaarashchfranjeevl kuladharo
Shashitanaye bhavati naro nrlpatisamo dandanaayako
vaaspi. He is glorious, long lived, of a good li f"'eCC9e, as Wlfluential as a king
or a general.
Baidhyanath: Vinatibaahulyagunaprasiddho dhani
su:JhrastmistAesshtamasthe. He Is courteous, soft-spoken and re'JC:red
for such habits. He is weatthy and famous.
Vasl shtha: Sarve graham dlnakarapramukhaa nltaantam
mrityusthithaa vitanute kiladushtabuddhim. Shaastrabhighaata
paarlpeedtagMtrayltShtf SltUkhyavairviheenamatirogagunaitoopetam.
lrrespectlve of which planet is In the House there is only one
outcome: he is of evil temperament, diseased and devoid of happiness.
If he ventures near the he sllfers from body aches. This
astrologer has also described one m:>re benefit - gained
wealth.
Parashar: Mrilau bandhultiheenatvamcha bandhanam. He has no
friends. He has to under"go a prison sentence.
Garg: Karoti mrityum nk/hasthito budhaha sukhena teerthe
sukhiJdft niraavlltt. Shoo/aghrajanghodarar(19apettdaa paiJpaha
pigha<lyaantakaro na,.anaam. He dies as a place or plgrlmage and he
di es peacefully. If Mercury is in an inauspicious irlluence, the person
suffers from infection In his stom&e:h or tt'igh.
Brlhadyavanajaatak: BhocpaprM8ad&ptaS8mastltSiddhirnaro
vlrot;l)/ sut:araam swavarge satVaprayatnalhl patataaparahiNitaa ranghe
bhavechchandrasutaha prasuto. He strives to help others who are
sufferinO. MartVaddakMi dhiMIJ All hiS wt'atth is
306
desiroved at 09< 14.
Narayanabhatt: ShantajeevinQ ranghrage raajaputram bhanbha
deShlJant.are nkJhaanam nripaM vikrayalld v&J
yuvatytbltdavam kreedanam !Xatlmantaha. He lves a hllldred years,
travels domestically and abrood, he earns his wealth through trade
which the patronage of the king. He gets moch from
women.
Jeevanath: His description ts the same as Narayanabhatt
Jayadeva: savirodhoSIInyOJklJJNM/Jhito
vldl rang/Ire. He Is prestigious, patronised by the king, generous though
he opposes people all the time.
Kashlnath: Bvdhesashtame kritaghnBshru kubudhihl
f)6aradtw1kaha. Kaamururosasatyava.!di rogoyultto bhavennMrah!. He
is Indebt. of evil bent d nind. debau::hed, lustf\.1., a lar and atways Ill.
Jaageshwar: His description Is similar to Jayadeva.
Aryagranthakar: NldhMave-shamanl saryayutaha shubho
nkJh8n8dosatit.him;Jndana eva cha. Ylldi cha pa81]ayvte rlpvgehage
madanakaamyaj.wena patatyadhaha. He is tnA:hful but not respectful
to his guestS. He cles comfortably. If MerCI.J'Y Is In oonjt..netlon with a
malefic planet or in a House inftuenced by some other hostil e planet,
the person bec:omes weak and ill as a resUt of debauchery.
Mantreshwara: Vlkhyaataashrlraayuhu kulabhrldadhipati-
gyeoasashtame dan-dalletaa. He has prestige, a tong life and is born in a
good famly. He Is powerful, either a general or an mportant official.
Kasllyap: (J..rakaottam) - 11 Me<OJry In lhe Elgrth House Is In
Aries the person cles d fever, in Taurus, the person dtes of severe
cough, in Gemini of vatha ailments, in cancer d --, in Leo d some
serious ailment, In Virgo d the betrayal 1>1 a 10\'ed one, In Libra of
tension, In Scorpio ct f:'/f! disease, In Sagittarius ct an aliment of lhe
respiratory system, in d suffocation, in Aq.Jarius of stomach
ailments ard Pisces of gangrene in the foot.
Gholap: This person is so brave t hat he is radiant. He is wea.tthy
and charitatie.. fit'! is brave and has no enemk!S. He is of a pure and
noble characte.; he Is learned, a poet and generally behaves decently
to people. His behaviow earns him respect from all quarter5.
Gopal Rat nakar: He is lo1"9 lived and has a k>t of prestige. He
benefits from matters concerning land and has fe-w sons.
HiUajaatak: It is the SCime as Brihadyavanajaatak.
Yavanmat h: he is l ong lived, good boldng, arrogar(, INes like a
king, and a man who to ensure hiS own gain.
Paaschaatya Math (Western Thought): He suffers from
aliments of the forehead and nerves. Hls powers of ooncentration are
good. When he dies he does so aware that he is dying. He exc:els in
occUt Sden::es. fit'! suffers f inancial losses if he is invotved in partnSttip
ventures. lf Mero.uy Is exalted or in a very auspi cious lrtluence, the
person gets a g"eat gain '* weatth.
Agyaath: Laabhaha aayuhu kaarakaha. Saukhyavaan
bahukshetravaan. SatpiAravaan. Pramaadaha. PINidlavimshati varshe
aneka pratishthaslddhihl. Nrlparaajakrlpaahaa. Rlpukshayaha.
Kritlprasiddhaha. Bhaaalaw<e poomoaytJiwJ. If Is ll>e
person gets much land and h<IR)iness. He has seven sons. IU. the age
of 24, he gets a very unusually prestigious post.
My Thoughts: When Yavanjaatak and Hillajaatak refer to a
person's wealth being destroyed at the age d 14, it mJst be kept In
mind that USUil lly children do n<X p05Se5S wealth at that age. Henc:e,
this must be interpreted to mean that the person's ancestral
Inheritance getS destroyed. Where Gopal Ratnakar talks of many sons,
an unknown astrd()9er savs the person has seven sons. The first Is tl\le
of feminine sq.s and the other in masculine signs. All the benefiCial
traits are seen the masculine signs and all the negative ones In
femlrine signs.
My Experience: Mercury Is not a pl anet whh:t. brings death.
Hence. the most it can do at its worst malefic state is to bring some
308
chronic aitment. Therefore what Kashyap says that there are twelve
types d horrirte death SignifM!d I>( Merrury. iS abSoh..tely meaningleSS.
The Westem Thought ine whkh speaks d aliments of the forehead
are correct. That is because this person's leanings are towards ancient
leaning. could be an astrok>ger. HiS iS good tl.Jt speakS too
much. She Is, however, peaceful and lives happily with her husband.
She does not ciscuss family matters with outsiders. She is somewhat a
sperdttl rift. These are the: trai ts when Mercury is in a masciJint'
sign. 1n a f etrir*le sign, the wife Is not a good person and tends to
diSOJss personal famity rncttter5 with outsiders. The person's study or
script .... es is incofllllete ard he can eli! of ai mMS atrecting
head. Some astrotogetS do descri>e things fike ltle King's patronage.,
glory, ""ppines5 etc., b.lt these are not in the domain ot Merwry when
it is alone. If mercury is t he Eighth House and the Sm in the Seventh,
Ei ghth a Ninth Hoi.!Se, then itS properties atso atrect t he propties of
Mero.ny.
Mercury in the Ninth House
Acharya and Gunakar: OhiJtme suthaartha stJkhabhiH!k. He has
chikt"en, wealth and happiness.
Kalyanavarma: Navamagate bhavati pumaanat idhana
vidhyaayutaha shubhaachaaraha vaashlshavarosatinlpurnom
dharmishtho somaputre hf. He Is very wealthy, learned, virtuous,
disdpined, a debater and gracious.
Vasishtha: Budho dharmakriyaasu njranta kurunjam. He is
interested in WOr'ks conceming religion. He suffers from many illnesses.
Ga rg : Mandabhaagyo bud he pa;tpe naro budhimadaanugaha.
Bhaagyavaan dhaarmiko vMpl shubht! saumye tu If f\1c!rcury
Is Inauspicious, the person Is not very fortunate and has much false
pride in his own wits. If it is auspicious, the person is fortunate and
<iglous.
Baldhyanatn: dh1JrTJ'139aM tu dharrnadhani1011a sh/Jastrf
shubhaachaaravaan. He Is religious, wealthy, virtuous and lives
according to the
Brihadyavanajaatak: Budha upakritidhaataa chaaru
jaataadaroyosJJnuchara dhanasupoo trairMrshttyukto veiShesh.Mt.
Viktltlyu tamanask.o dharampunyalkanishttho hramritak.iranajanmaa
punyabhaave yadaa syaath. He is c:haritabl e. knowledgeable, good
looldng, has many servants, peaceful, has good sons, religious,
and forever In wortc:s that benefit the oommunlty. His mother
dies when he is 28 and his good fortune begins at the age 32.
layadeva: It is the same as Brihadyavanajaatak.
Narayanabhatt: Budhe dharmage dharmasheelosatldhlman.
Shaved deekshitaha swardghuneesnaanako va. Kuladhotakrld
bhaanWid bhoomipMIUt ,xataapaadhiko bMdhlJko dmnulcJl,U naam.
He Is reigious, h elllgent.. seeks learning, bathes In the Ganges and
generally brings prestige to the name d his dan. He has more fame
thM a U'lg and is victorious over all evil men who oppose him.
leevanath: It is the same as Narayanabhatt.
Aryagranthakar: Navamo saumyagrihe shashinandane
dhanai0Jatrayutena samanvitaha bhavatl paapayute Vishayasthltaha
shf!Jiim8fldkarahiJ shiJS/"ijodlryml. He has !jOOCI wire d good
house. I f MerOJry is with any malef"te i nftuence. the person takes to bad
ways. He Is ol the scrlptwes and wayward.
Kashlnath: Dharme budhe dhaamikashcha koopaaraama
l><flaaroki>hiJ. Satyaval><f chiJ d08fltashm )aayte pltrtvtsaruhu He Is
religious, digs wrel's f or a living, ttuthftA, in control ol his senses and
respects his father.
laageshwar: Bhaveddharmashee/o dhiyaa yogalee/alha
shrutasmaatarkamkarma kartaa dhanaaddachya.
krltasushtthuvakta yada syaalh budhaha naraanaam
visheshaat. He i s religious, intelligent, practises Yoga, li...es accctding to
the scripbJres, a debater and he goes on many
Mantreshwara: Vic#lyaarthaachaaradharme saha tapa$/ budhe
syaath pra>eenostasatlvagml. He Is knowledgeable, wealthy, religious
310
and excels in debate.
Gholap: He gains a lot of wealth. He has no dearth of women.
houses, Chikten an:l material wealth. He is gracious, brave, Ms many
friends:, a good poet, devoid of anger, one who thlr*s of the common
good, prosperous, and correct
Gopal R.at:nakar: He has many sons, loves music, clance, and
thtatre. Travelling in the southern directions is good for him. '* i s a
debauch.
HiUajaatak: Ekon8vilnshatim n.tvamo mMtririslltham kf!roti elM.
His mother dies ...men he Is 19.
Yavanmath: He Is generous, good, virtuous, religious, thlr*s d
good like a ldrg woiAcl and is
Paascha.atya Math (Western Thought): He is corrupt, excels
in develops his OV\In intelligence, interested in new and
unusual tNngs. If Metcuy Is malefic, the person CM go mad. If It Is
benefiCial the person e:els In all a ianC}.Iages that he cares to learn and
can acquire fame as a nu:tear physicist.
Agyaath: Bahuprajaasiddhaha. Vedashaashtravishaaradaha.
5angeetapaathakaha. Daak.shinya vaan dhaarmlkaha prataapavaan
bahulaabhavaan. Pitrldeerghayuhu . Paapayute paapakshetre
paapaveekshanaat pitrinaashaha pitrikieshakaraha. Gurudweshi
mandabhaagyahiJ budhamataanug<Jha. Bh<Javadhipe b<Jiayute
pltrldeerghaayuhu. Tapodhyaanasheetavaan. Bhaagyavaan.
Dhaarmibha. He has many chi ldren. He i s well versed with the
scriptures and teaches music. He is winner, reli gious, brave and
fortunate. If Mero.ny Is malefic ex In conjunction with any mateflc
planet, the person's father c:ortracts leprosy or dies. The person ends
up as a mendicant. He can become a Buddhist. II the pl anetary
lnftuence In the Ninth House is strong, the person's father enjoys a bng
life. He Is meditative, foOJssed and mentally strong.
My Thoughts: In the Ninth House, all the beneficial traits are
seen in masculine signs and negative ones in feminine signs.
Yavanj&at.ak and Hillaj&atak. are right about the mother's death but the
unknown contention about the father's death is wrong. As
SMum the Ninth is a possibil ity of the mother
dyi ng. Yavanjaatak has made a reference that the person's good
fortune begins at the age of 32 but the position of the Sun in relation
to Mercuy ITIJst be checked when maUlg predctions of thiS sort.
My Experienc:e: If Mercury is i n Gemini, libra or Aquarius,
person's good fOI'tule begins after marrt.age and he also acquk"es great
stability an::t consistency thereafter. He does well in his career and his
Siblings are wi ling to help tim. He could M a puWSher, editor, writer or
other emplo'fee .-. a newspaper. He could be a teacher or In a similar
profession. BasicaUy his involvement is wi th professions where the
process of l earning c:cn(inues i fe long. If Mercury is in Aries, Leo or
sagittarius person could a mathematician, astrologer, teadltr,
clelt( etc. In Taurus, VIrgo 01 caprtoorn the person Is a trader Is
empbyed by one. tn cancer, Scorpio Pisces the person is employed
in the postal or tt!lephone departmMts. Thty are excel lent elemental
sdenUsts.
Mercury in the Tenth House
Acharya and Gunakar: SlJkhashauryabhaak she. He is happy and
brave.
Katyanavarma: Pravaramatikatmhestthaha sakala;uambho
vlshaarado dashame. DhetJraha vlvfdhaakalankaara
satvabhaak saumye. He executes works that require supertatlve
intdligence. He is trilliart in initiating works and pro)!'cts. He is brave
and industrious, powerful, strong, and wears many different types of

Vasishtha: RoopMnvl tatvam budhaha. He Is good looking and
happy.
Garg: Oheem..., dl..,., dhatmachesro dharmvrlllytutah
5aatvik.aha karmage saumye nanaatarbararavaan. He is of 5t.t>reme
brave. religious, lives acoording to the and weans
many types d clothes and ornaments.
312
Baidhyanath: Vyaaparage chandrasute samasavidhyaayashcr
vil11vinodashee01)3. He is ltarned, prestigious, wealthy and talentOO.
Narayanabhatt : Mitam samv.tdan no mitam sal.tmbMt
prasaadaadlvalkaarl sauraa)avritlhlbudhe karmage poojaneeyo
visteshaat. sanpado neetidandaocl>ikowaat. He speaks leso but
benefits gready. H@ iS a rO'(al employee. He gets great prestige from his
father's wealth.
Kashlnath Acharya: budhe jaato dhanadha
anyashonvitaha. BahubhaagyashchiJ vijB)'i Jraantiyt.Jkt(lshchB maanavaha.
He has wealt h and He is victorious in all he does
and i s l3w abiding.
B r I had y a van a ja at a k : G yaat lJlJst yanta shresht th aurm a a
manushyo naanaasampatsanyuto rajamaanyaha. Chanchala
leela8V88g'lilaasaadtishaali ITI8anasthaane lxx:Jhane vattamaane. He is
knowl edgeable, excels in everything he does. He coltcts curios and
possessions of many kinds, is respected by the MJiet; Is mischievous and
a good speaker. Vldehl gokvshiNandanam ella. He gets wealth at ttle
age of 19.
Jaageshwar: Budhe kaavyavidhyaa tatha shilapkditvaa sada
v.tahanalmartrlsaukhyo naraha. He is an excellent poet and sculptor. He
has a k:wing m<Xt-er ard Rliii'IY vehicles.
Aryagranthakar: QJrujanere hlte tVrato baht.Jdhano diJshame
shashimtndane nijabhujaarji tavit turangame bahudhanairniya
to.samitabhaashan.am. He looks after the welfare of the el derly, Is
wealthy, eams wealth hard wOfk. has many horses and speaks
lot.
Jayadeva: What he said has been covered above.
Punjaraj: Saumye kaabyakalpaavldhlnaa shllpena llpyaa
vaniklouk.!ihilcli bajanajrtllanachayam yatsaahasaisoodharnaifi. He i s a
poet and a sculptor bt.i: gets his weatth from writing, trade or valour.
Gholap: He has friends, wealth family and a relationship
with his mother and the king. He studies the saiptures and lives
313
according to them. He is a vWtuous IT'I(In, l earned, respe<ted, a poet,
hc:.loured by the ancl one who devotes himself to and
splrii!Jal works.
Gopal Ratnakar: He Initiates auspicious works. He sees each
project through to completion. His behaviour is not gracious and he
suffers from diseases.
Hi Uajaatak: Digislssth6htJ SIJptlKJasho. He gets at t he agt
of 17.
Yavanmath: He iS horoured, wealthy, and respected like a king.
Paasdlaatya Math (Westem Thought): He in trnde and
languages. His powers d concentration are high. His dk:tion Is e.:ellent
as his mathematical ability and !1amf't\CI{. He performs well as a broker,
writtr or grocer. These, are au applicable only if Mtrwry is
exalted or In an auspicious
Agyaath: Ashtavlmshatlvarshe netrarogavaan. Arlmuddapa
apayvte Jcarmavighnava811 dvshtak.riti anHcha8raha. He gets eye
diseases at the age of 28. If MerOJry is adversely affected by any
malefic influence, the person finds hindrances In f!!tlery work he
attempts. He does wrong deeds and .,.;1.
My Thoughts: All anc.lent astrologers have ascribed very
beneficial attributes to MerOJry in t he Tenth House. Yavanjaatak and
Hillajaatak's references to getting great weal th as a teenager seem
Impossible, It Is more likay that the person may IMerit this rather than
eam it. Jaageshwar"s contention that the person gets a very k;lving
mother is worth observing. T'h! references by an astrologer
to eye disease could develop as a consequence of reading too much.
And he says t his OCC:I.J'S at age 28. At t he age of 28, In a person's life,
Mars becomes very proactive and hence i t is likel y that eyestrain
caused by excessi\11!: brain actfvity couk:l well result In the person getting
eye infections. Otherwise there is no connection between eyes and
the TMth House. All the beneriCial properties of t-1ercury are in the
masculine signs and the negatiVe ones in the feminine s9ls.
314
My Experience: Assuming that Mercury is al one in the Tenth
House, I describe the folk:lwing properties: In Aries, lto, Sagittarius,
the person's Is a clerk In departments where mathematics, writing,
teaching, engineering are taught. In Gemini, l ibra, Aquarius, the
can be: a clerk in the survey department, public workS
department or postal department. l n Taurus, VIrgo or taptloorn, he
could be a linguist, a trader, c:ommi:ssion rt,. travel agent In Cancer,
Scorpio or Pisces the person can be a publiSher, reporter, printer or
financier. He may also do well as a stationery shop owner Of a )KIIdal
stamp vendor. They spend their lives after retirement drawing a
comfortable pension. II Merrury is benefiCial in the Tenth House, the
person has a loving mother.
Merrury in the Eleventh House
Acharya and Gunakar: Laabhe prabhutad'UN1avaan. He gets a
lot or wealth.
Kalyanavarma: Dhanavaan vldheyabhrityaha
saukhyMal'lvitaha. Elcaamsho budhe sthaane &lne)Vhu khyMlimaan
prushaha. He Is wealthy, has many setVarts, is kMwledgeable, enjo'(s
all mamer d happiness and success, is long lived. He ls a perfect man.
VcJshishtasaumyo visheshasubhangaha. He i s knowledgeabl e and
fortunate. Sau.khyama saukhyavaan. Valdhyanaath saumye
laabhagrlhagate nlpunadheevldhyaa yashasvl dhanl. Garga
streevallabhotigunavaan, maumaan, sarvajanaprlyaha. Laabhage
somatanaye mandagnl samapadhyate. He Is beloved of women,
virtuous, has a poor appetite and popular.
Brlhadyavanajaat.ak: Bhogaasaktosatyantavlto vlneeto
nltyaanandashchaarusheelo ballshtthaha. Nanaavidhyabhyaa
sakrinmaanavaha syaa/laabllasthaane nandane sheetabhaanoho. He
tries many dfferent types of food. He Is Vf:1Y wealthy, courteous, soft:
spoken, taleniecl. powerful, strong, well "lrsed In monv sciences and
arts. Curious about knowfedge. Gya panchavede dhanam. He gets
wealth at the age of 45.
315
Narayanabhatt and leevanath: Vrnaa laabhabhaave sth;rhe
na IUbhO na IIJIJvMyamaMrinyamuti. Kritaha
kanyalcodwailhadaanam ch deyam kham bhoosurastyaktatrlshnaa
bhavanti. If MerOJry is not in the Eleventh House. the House cl Prof
he wUI neithtr weatlh, not good tuCk, nor good lookS nor freedom
from debt. Vv'here will he tlnd the money to perform Ns daughter's
wedding? This man gets nothing in life if MetWry is not present in the
Eleverth
Aryag ranthaka r: ShrutiJmatirnijavanshahitiJhiJ krisho
bahudhanaha pramadaa janavallabhaha. Roochlraneelava
purgunakxhano bhifvati chaayagate shashije I'I(N'aha. He is of Sl.4)erior
intdl ec;t, wortc.s for the good of tis t lan. He has a dehydrated body, is
extremel y ri ch, bel oved of women, has a dartt compl exi on and
attractive eyes. Everytht'l g el se Jayadeva said Is sWIIar to other
ostrol09<"
Kashlnath Ac:harya: laabhe bvdhe nltyalaabho neerogashcha
sadaasukhi jan!anuraaga vrittiShdUJ keertimaa,_i jyate. He has
many gains. He Is free of disease,. is always happy and rmc:es wen wlth
He gets a l ot of honour.
Mantres:hwara: &vhaiJ)'UhtJ SBlYBsanciJo. He is b'lg i 'oled and
truthful.
Jaageshwar: His desaipti ons are the same as other astrologers.
Punjaraj: Shashije kanyaapragyaha S)9ath tDthaa. He has only
daugl'ters. Punjaraj has listed the same career prospects here that he
laid down for the Tetlh House.
Gholap: He completes all his projects with the King's hel p. He Is
brave, stole. radlart, charismatic, virtwus, noble, teamed, popular, and
one who gets endless pleasure from women.
Gopal Ratnakar: He i ncreases hi s ancestral inheri tance of
agricultural l and. He Is well behaved, flexibl e and excellent at
mathematics. He 5\lfers from eye-disease.
HIUajaatak: The same as Yavar!laatak.
318
Yavanmath: He is weafthy, has many good sons, is intelli9f!flt and
belOved of .,. king.
Paaschaatya Math (Western Thought): If f\1ercury iS strong
!he person much and if It is weak. the person suffers many losses.
Its influence in \lilrious signs is \tlus: Aries - Taurus - I I
mannered, Gemini - corrJ.4:1t. Cancer - his friendS: are l owly, l> - his
friends are affluent. VIrgo - teamed and skilled, Libra - frienc:ly with
ta'er(ed people, Scorpio- a quarTelsome cheat, Sagittarius - arrogant,
Gaprica'n -a che-at and unrefiatt!, AqU!Irius- has trustworttYy friends,
Pls<:es - a gossip who has many 1.1\fulfllled desires.
Agyaath: BahumangalapradMa. Shilpalet<hanacyapa3rayogs
anekaprakaarena dhanavaan. Ekaanvlmshatlvarshaarduparl
kshetraputradhanavaan dayaavilan. Paaparkshe paapayvte
dhaM/opaha. sarvakshetre shubhayute
shJbhamooletla dtanavaan. This Mera.uy Is benetldal and the person
gains m..tdl wealth from sculpture, writing and trade. At the age of 19
he gets land, inheritance, wealth and chil dren. If Mercury is in
conjunction with a mal etlc planet then the person bses his weal th
through OOd habits. If i t is exalted, or with beneficial planets, then his
wealt h inaeases of his good habits.
My Thoughts: Most astrol ogers have l aid down benefi cial
properties for Mercuy In the Bevenlh House. &A even it Mercury Is
exalted and in conjuncti on with other benefici al planets all these
benefits cannot be reaped because Venus and the Sun are inevitably
dose to r-1ercury In this l ocation. Their malefte traits cannot be
overtooted. Some astrologers have said 17eat wealth is trait of r-1em.uy
but then they have said that in er.my house. This camot: be possible
and if It were 1NefY Individual In the world who has MerctY anywhere In
his horoscope wotJd be a millionaire. It is Important white preclctirg the
influence of a planet in a partio.llar house. to keep in mind what that
part i cul ar house rul es over and al so where t hat planet has i ts
jll1sdiction. It Is incorrect to merely attribute eo.<erytNng In this fasNon
to MerOJry. For example it is nf) to impossible to take a"f benefit from
Mertuy if it is in the House of Profit i n the sign of li>ra. Nor are there
any beneftts If the Sun Is In the Tenth House, Vetl.ls In the Ninth, a
317
retrograde So turn in the Third House and Mats in the House of Wealth.
It is impossible: in CirOJms-tances: to get arr,o from Mercury.
My Experience: Men:...y in Arie$, or sagittarius m!MS tht'
petson wi ll have only one or two sons. The person's elder brother
suffers. He is a writer Ot a clerk. In Taurus, Virgo Qt capricorn, ttle
is an artiSt, a sctJptor or a to,>iSt. In Olnctr, Scorpio or Pisces,
!he person is a busr.essman. l n Gemini, Ubra or AQuarfus, the person Is
a teacher or a Those who have Merwry in the Eleventh
House benefit from t racing in stocks and Shares:.
Mercury in the Twelfth House
Acharya and Gunakar: PatitJJstu rihile. He is destroyed by the
actions he comrrwts whk:h are already destlne<l for Nm.
Kalyanavarma: SugrlhHtavaakyaamalasam parl bhootam
vaagmitam vaagmlnam talha praagya. Wayagaha karotl saumyaha
purusham deenam nrishansam cha. He is intell igent, speaks well and
listen to him with attendon. He Is poor, auel, l azy and always
humiliated by others.
Vaslslltlla: Chiii!O'iJongajo pataclliNiam. He loses
his weallh.
Garg: Nripapeedanamsantaptam paravaadena peeditam.
Nrishansam purusham chundrihikuraote vyayaraas/Wgaha. He suffers
because d the King's ire and people ht.rniliate He Is cruel.
Brl hadyavanajaatak: Dayaavi heenaha swajanairvibhaktaha
satkdaryadakshovifttarlpakshahilha (2) . Dhoorto nftaantam mal/no
naraha syaad V)'3)0papanne He is ca.,us, stays away
from his own people, defeats his enemies, does good deeds and Is
genetall y the worst kind of human being.
Narayanabhatt: Na ched dwadaslle yasya sheetaashujaataha
katham tad'Jriham bhoomidevaabhajanti. Rane viWino bheelimaayaanti
kMmaad hirMyaadikos/lam shataha ka&Sanabhuyaat. He iS
318
donating alms to SC19t5 and terrorises his enemies on the battlefield. His
inl'Mmtance remains l..lldisturbed.
Aryagranthakar: cha vyayt'ga
vlkalarnoortidharo Parakalatradhane dhanadtitavaan
vyasandu-aratha kritkaha sadilil. His Jt!ysiQue is frail. He is poor and has
to work for a living. He ccwets other wealth and women.
Jayadeva: Satsangakarmaapagltosadayashcha dhoorthaha
sapaapo mall'no vyayasthe. He keeps away from devotional programmes
or good deeds. He is l.l'lkin:l, setfish, evil and corrupt.
Kashlnath: Budhe vyaye vyayt Joke rog bandhUSdmanvltaha.
Papasaktaha paraadheenamaha parampakshee cha jaayate. He
squanders money, is clseased, a SiMer, in:febted to others, is defeattd
easlty and h.Jmbles himself fn front d others.
Mantreshwara: Deeno vldhyavfheenaha parl bhavasahlto
SclllYantretre nrlshansosalas8shcha. He is poor, \l'lec:l.tcated, humiliated.
cruel and lazy.
Jeevanath: He carries out big Y3gyas and goes on pilgrimages.
The rest is to Narayanabhatl
Jaageshwar: Budhe vaaramuk.hyaa dJanam val bhajanti dayaa
taS)0 !vtastaataviNp.,.. SVakiye cha varge bhaveddataheenaha panJm
shatruv;ugam jayetatra leeno bhaveddhoorthadhaama yadaa
dutandrirantye. He sq.Janders his wealth on prostitutes. He does oot
snare his wealth with his near and dear ones. He is oowllling to help
those In need. He defeiltS his enemies. He Is unkind, e"l t:x.rt speaks in
a poliShed manner. His father does oot li ve well.
Punjaraj: Gye vyayabha8vasansthe pitd'Ju slr:JtthaW scMhinaha
tadaa syuhu. Budhena vlpdaa dharitree. Hl:s father's brother's give him
rooch happiness. He inherits a lot of land from them.
Gholap: He Is cl evil bent of mind, crabby In natl.l'e, to
anger, powerless, devoid of victory but a travelller. He suffers after being
bitten by a scorpion, a snake or a similar creat .. e. He coold conb'act
leprosy or btn:1ness.
319
Gopal Ratnakar. He is knowledgeable. debouched, and has a
to live i n other peoplt''s houses.. He has sons. His
mother dies soon. lf Mercury Is In combination with the S..n, the person
has a trusting nature.
Hillajaatak: Chatvshchatt.llu dwa6dasho haanidaha striyaha. At
age- d 44 hiS dieS.
Yavanjaatak: Vyayayc::hand-aj.Jha dwnvimshat. l oses wealth
at the age of 22.
Paaschaatya Math (Western Thought): He: speaks dearly and
is victorious In all his verlures. In caprk:om or Scorpio, the person has
many covetous enemies. He is brave. Jf Mercury is an auspicious
influence, the person has introspective k.nowtedgt, is well
with ocOJit and with black magic practises. Metc...y can also bestow
great power.
Agyaath: Gyaanvaan swatungage vlttavaan. Vldhwaana
bahuvy3y8M. NripAat bhayam. Paapayute chanchalitaha
nrlpajanadweshl. Vldhyaaheenaha shubhayute dharmamoolena
d>anaV)0)01>8. l.tche swokshetre lokilllhoorinaha 10aryo10rtH cho. He
is leamed and if Mercury is exalted he is wealthy. He money.
He feats ltle king. lf Mercury Is In oonjunctlon wiltl malerte planets the
petSOn is mischievous b'( nature and rebels against authori ty and tfle
king. He is devoid of knowl edge. If MerOJry i s in conjuncti on wi th
beneficial Influences, the person spends his money on religious
projects. lf it is ex-atted In its own House. t he person can be a leader or
a official.
My Thougtlts: All astrologers have ascribed beneficial properties
in the masculine signs and ones in the feminine signs. Broacty
every lh;ng tl'oey'W said oorrect.
My Experience: If rnero.Jry Is In a masctJine sign In the Twelfth
House the person's ec:k.Jcatk:>n Is completed, he Is content and war(S to
spend his mooey on reli gi ous projects. He succeeds in whatever he
attempts. PeoP'e like him and they anow him to Wluence them. His
Intellect Is sharp and he does not misuse It He suffers losses when at
320
some point in his life, lllclertaking a big task he seeks the acMte f$
those: belOw him. He: is a good manager and a good politician. rr f'.1ercury
Is In a feminine sq., the person Is Introverted, ignores <Xher people's
beha\1our, laly and content to stay at home. He is intolerant of arry
diScomfort. His ed.tcbtion iS incomplete.. He t'I\IU'\119(!S to attempt a n
lntetmecUate examklatlon and abandon's educati on after falling It He
does not trust anyone. If f'.1ertucy is in oonjunction !Mth the t-1oon. the
persc::.l - irrespecti ve of whether theSe are in a or
femlrine sign- Is full of f alse pride. He donates to charity only to show
off to others and goss\?s about others. He is unkjnd, evil, cruel,
unforgiving and ul"6,)ving. He liveS to ebt. Hi s li fe cyde iS au about wining,
dining and fathertng a few sons.
Cliapter 21
.Cortfsliips of
lPfanets e:l1fouses
It Is lmJX)rtant to know the Katakatwas, In Minute details, of the
12 houses and all the induding Rah.I/Ketu and Gulika. Planets
Mars & f'.1ercury as by Sage SUKRACHARYA, for tht pla.nets, are
given bel ow. The writer has found, from e.xperlence, that the
Karakatwas, as gWen by- Shri 1'>1ANTRI LAKSHMI NARAYANA SHASTRJ
- are more exhausti ve t han others; accordingly, the same are
,..,..o<luce<l below for lhe b<fleflt ci readers :-
SUICRACHARYA SHRI M.LN. SHASTRI
MARS
Truth, land and fort diseases,
wounds/ul cer, val our, f i ghting
equlpments or arms, fire,
dignity, higher knowledge,
brothers.
Brothers, happiness through
brothers, posi tiOns like
Command or Heir Appatent., bile,
heat, strength c:1 native's hands,
cour.'Jge, stre:ngth of native,
quarrels, atguments, sua::ess In
encounters/war, goats, red
leprosy, sacrificing live animal s,
getting lost in deSertS, having to
live in hill stations or mourtalns,
women, copper, gold, coral,
rub(, stamp of authority, fetters
or Imprisonment, punishment,
322
corrct ... '""" tast
MARS
nature, friends Ot followets, fort,
Ot armour, poisonous
creatures, bamboo, catechu,
lions, tigers, valour.
MERCURY
Mathemat i cs, hand work,
literature, astrology, education,
matemal uncles, trc.elllgenc:e and
intellect
Happiness through children,
ul ti mate knowl edge, intell i
gence, business, deceivi ng
others, prof ici ency i n writing
dipl omatically, mat hemati cs,
literature, handlaafts, weaWlg;
sexual enjoyments, travels
water. vegetabk!S, fire,
Ianning, parrots, coloured
shows, betel leaves, cages,
grass, inciting quarrel s,
prosperity, arOOassador1al func-
tions.
Cliapter 22
Impact of Critica{
Vnaerstanaing
How to herpret the benefits d a Mahadasa grand period d a
planet has already been dcwified in Ra<A Vithar. The same ruSes apply
htre too.
If the person's birth star is Astlle$ha, Jye$htzl or Revati : Mera.uy's
Mahadasa is from birth to age 17. At this time the person does n<X get
much personal benefit but the person's father's life sees some
improvement. If Mercury is in Aries, Taurus, Gemini, l.eo, Ubra or
5a9\tzlrius, the person's teeth erujX soon. He starts speaking tarly in
life and Ns Interest is In playing and sports. In VIrgo, Caprlcotn
J41arius the person's teeth erupt late and he does not start speaking
very early in childhood. In Cancer, Scorpio and Pisces, the person's
speech Md er\4)tlon d teeth ate even more delayed. If r-1ercury Is not
impacted by malefic S.turn, the person's studies !JOI off to good
start and there is no possibiity of faik.Jre. He has younger brothers.
stlllts prepartlg IO< cole!JO ard he mal<es many good friends. II merauy
is the person Sifters from chllchood ailments, is dehydrated,
and suffers clseases in the liver, spleen ard coton from eating mud. He
fa1ls repeatedty but evertually oompletes his stutles.
In F\.lshya, Anuradha and Utt:arabhadrapada: The Mal\adasa Is from
age 20 to 37. He completes his education and gets married. He has
chilct"en and begins his His mother or father may die. II ,.1ercury
Is malefic the person rema.-.s unei'Yl)loyed throughout the Mahadasa.
His education is lnco01>1ete. His senses are lost He has to suffer a prison
324
sentence f or havi ng bome fal se wi tness or for havi ng written
something wroog and defamatory. He does not get manitd and has to
wander around aimlessly. He suffers from headaches, madness and
other ailmerts of the head.
In Puncuvasu, VIShakh.a and Purvabhadrapada: the 1'>\ahadasa is
from 36 to 43 yearS of &ge. In t his M.?Jhadasa the person gtts stability,
chlld"en, wealth, glory, prestige, friends and happiness from the wife.
In Aardaa, SwaU and Shatataaraka: the Mahadasa last from 43 to
60 years of age. The person's sons grow up and manage the house.
This i s the age for irtrospection. His rern&ins ShMp till the end.
All his wishes betn futfiii(Nj and the person dieS a SObtr death.
Irrespectr.e of whi ch sign of tM zodiac Merrury is in, if it is oot
malefic or Impacted by any evi l Influence, the person's life Is very
ordinary and peaceful. There are no radical developments i n the
persoos life. BIA if Mercury is iltllacted by Mars, the person's life is ful of
upheaval . There are constant ups and downs. The person remains
unemployed and seeks shelter from others. He contempl ates sl.icide
because of the upheavals in his life. Som! of them do actually commit
suldde.
In this Mahadasa of Mercury the Antardasa or sub-periods of
Saturn, Sun, R.ahu, and Ketu are good. The bad sU> periods are
those ruled by Mercury itself, or the Moon, t-1ars or Jupiter. If t-1ercury is
In the ascendant, the House of Weatth, the Fifth House, the seventh
House, the Ninth House, t he Tenth House, the House of Profit or the
House of Expendi ture, its Mahadasa i s good. In other pl aces the
Mahadasa Is bad.
Rlr the zociac signs, ordinarily, the following traits apply: Ari es -
ordinarily good, Leo- superlative, Sagittarius - even better Ulan Leo,
Libra - good, Aq1.0rius - ordinarily good, Taurus, Virgo, capri com -
bad, cancer, Sccq>io, Scorpio and Pisces - very inauspicious.
This is what the anciert astrologers said about the t-1ahadasa:
Baidhyanath: Paakadau vifalam Sat'\0 shubhamarte prayachchati.
The b<grtlklg ;, not good btJ: lhe end Is beneficial.
32$
Pa.rashar: Dashaadou dhanadh(Ja(Jya chit vidhyaalaabho mahat
sukh.!m. sanmltllrge dhtNMfUbhAkritafla.
Madhye narendrasanman mance duk.ha bhav!shyati. The beginning of
this pet"i od is marked with 9f!\ting great weal th, completion of
edu::ation, birth of and good char3Cter. In the middle: phase
tile l)<tS()fl gets honoured by the ldng but the last phase Is unhappy.
They both (X)rltraclct: each othef' so It has to be observed who Is
f9lt. In my opinion Yitlether this period is beneficial or not depends on
the influerce of f'.1ars. If is in a bener.dal influence in Mars, the
Mahadasa ts good and W not then the reverse h(jds true. In effect it Is
the position of Mars which should be obsetVed when predicting dle
effects of Mohodoso <$. Mer<>Jry.
The Final Word
Ordinarity Mercury affects the state of a person's When a
person gets admission to college, it ends but there are people
even after graclJating contirue with their pursuit d education. They
do go on to get doctorates and other su::h high degrees and these
people's lives are clearly go...erned by Mercwy. Layers, teachers and
dertcs are always deperw:lent on knowledge and hence their lives are
1\Jed by Mercury.
Though astrotogers have said it i s a gender neutral pl anet I
disagree.
One more feattre is that Mero.sry is greatly infk.len::ed
by the other planets or lnftuenc:e:s it Is In conjunction with. It Is like the
ok:J saying .. How come the water shows 13 <ifferent col ours? The
answt:!r is that it shows tht:! colour that is mixed into it'". Similar is the
condition of Mercury. J, h::lwever, believe that MerOJry does have some
properties <$. its own. If It Is retro!'ade, It can destrov mankind but
ordinaril y r-1ercury is a very signifont beneficial planet.
326
Cliapter 23
9dercury
a retrograde MOJry is in a chart, the native will find
that the manner In which he c-Ommunicates to others and the
tendency towards having an impractical approach to life are being
from a past lifetime. The retrograde Merwry will also bring to
!tie lrdlvkl.lal a net\Ous condition. a restlessness, as a carry fNer from a
past lifetime; a tendercy to go on not oriy nerve energy, bl.t also to
react in a nervous manner to all facets or This would bring about
the quality d worry or fear. Every item or detail In a person's life would
be worried CIVet, l'ussed about, etc.
It stows that the petWl's thought, opp-ooch or thinking p-ocess
in the past. by being impractical, rash, resulted in confU5ion
and chaotic condidons In past ldetlmes. If repeated now, the life would
be characterized by the same confusion and cha05.
1t should always be remembered that the higher octave of
Mertury prefers precision. orderliness, perfectic)'l. The lower octave of
Mercury couldn't care tess, so that the person leam to work
ttwouc1' the higher octave of f-1erOJry now. This Is vmere the foOJs
should be oncl whot the person shoiAd ottempt tn ochleve.
One of the things to watch, with a retrograde r-1e1tury, is that the
person might strive, in overcoming this, to become too perfect,
bMglng upon himself f rustration, Mce few can reach perfection. The
no live c<>Jd verv eosly be !ailing short cl his 900is oncl would be subject
to disappointment. There would be a tendency to evaluate others
according to their degree of perfection. In an ordinary tusewife, with
revogrode Mercury, she would be fuss-budget, everything would
311
it$ place an:t have to be there - in drawers or neat lfttle piles, etc.
She co!Jd bl! woman in tht T.V. commerCial who enters a room and
says, "'My, you have caiS, don't ?,. She would be very quick to
criticize wllere others are concerned, since Mero.uy, as the ruler of
V.-o:>, bases it all up:m her" own stbf'ld.ardS.
In attempting to transmute retrograde Mercury, you could also
Invite additional katma bv overoorring a rertaln trait and by swfnglng to
the opp;>site polarity. The irdivic:l.lal could transl'l'l.lte O'le and bring up
something negatiVe on the other end. Care should be used when
converting negative qualtles or retrograde planets .,to something
positive.
with a retrograde Mercury, you fright have been a
writer in the past- it does rules the written as wdl as the oral word -
if in Scorpio, you probably wrote tx:lok such as the MarqliS de S3de -
pornographic lltetabJre.
Many times, a person with a Merrury doesn't care that
he or how he says it, what he writes or how he writes it, especially
true if t his MerOJrial condition is posited in l eo. Leos are very blunt.
direct and fr<rit., anyway. It woukrl't be the most constructtve kx:adon
for a retrograde Mercury, since ten the t.eo certainty would use the
power of the word to push people around.
In Aries, the retrograde MerciiY would enhance the bossiness,
the lade. d patience with others who can't do a Job as weU as the native
does it:. In other words, it: woukt bring In that if11>atient q1.0lity or &ack c:J
tomnce for people who are not as dever as the Arians. Also, some
people can really verbally lash ot.t at others. Aries does no do this as
much as VIrgo. Geminis can put people In their place very nicely.
Attt.:>ugh Aries are bossy and pushy, they are not as Virgos and Leo&
are.
With a retrograde Mercury, it is quite possible that the person
wrote In the past and would, In all probability, write the same thing
again. This Is because there Is a tenclency to repeat action from the
past, nor only in character, but also in action. Rememtx!r, too, that
Mercury always deals with the mundane, the practical, so that the
328
retrogade MetWry wouk:llikewise be so involved. The person's mental
interests could be: ide,.ieat from the !)l!lst and the same: mamer d
expression.
Always to be remerrbered, with Mercury, is the seNfoo aspect.
From the viewpoirt of service, the person would be thrown
into the same situMiOn where service wouk:J demanOOd of him. and
It would be In the same type or servtce as gtven the past. For
example: lf you were a teacher in the past (there can be an abuse in
teaching), the! tendency wotJd be to be ttrown into the same areas d
teactllng. There Is a subconscious element (remerrber Virgo is the
noturol ruler or the 6 .. house, .mich is opposite to the 12"' house), so
the pel'$0n might have a subcol'l$Cious reaction to stay from that
in which he did not in the past 1M tend<cy would be to
come Into this life wi th au Influences channeling you Into the
instructional field, and the retrograde Mercury woul d cause you to
attempt to avoid it. Remember, Mercury iS the: nMural ruler d
rules the 6,. housed It opposes the l'l" house of the
subconscious and - it all ties in.
Tile lesson to the l earned i n this lifetime, with a retrograde
MerOJry, regar<less d where it is located in the chart. is to conduct
oneself ln the rlgtt manner and for the right reasons - motives are vety
important when it come to a retrograde MerQ..Iry in a chart
First House: Retrograde Mercury in the 1 house would Indicate
that the person would find it difficult to make decisions, for it sl ows
down the thHdng. Normal ty, Merrury Is a very fast planet and causes
one to tl"ir* fast, speolt faSI, eoch fast; evel)'thlrg is done quld<ly, "'"'"
to making snap dedsions. The negative condition d a retrograde
Mercuy In the 1st house states that the lrdlvkl.lal should not speak fvst
and thlr* afterwards.
A retrograde Merrury In the t house wo!Jd brt'lg abo!A negative
quality tra.its ard indicate that the person would have to 'earn patience,
the proper use of discri mination, not to judge too quickly, to
conmunlcate constructively with peopl e and, or course, to be of
service to others.
329
It brings a restlessness and neNOusness to the personatity f$ the
indi vidual - a l bd< d contim.ity in effort. Ttl@ peson would tend to
Initiate many blt a:>mplete r&t:tvey few.
If, at the person's birth, Mercury was retrograde, and ten days
later i t went direct., it woukl mean that in the tenth year the person
would be Stbject to Change. This would be his potential at that tim!.
1Ns ts based on the theory of a day for a year when doing progressions.
All rett(9'ade planets are foc;al points in the chart, so that, in this case,
it the native's tenth year importart fran t he viewjXlirt or the
Mercuy qualldes.
Second House: This l ocation wotAd make for a raSh. impulSiVe
type of spender. a petSOn whose values wo\Jd fluctuate according to
moods and events in his life. d;Jy by daly. Since r-1ero.uy does emphasire
the trundane sine dlife, too much attfntion was placed on mattrial
seo.Jrlty In the past, with little regard for the higher qualities d life.
Observe., here, that retrograde Merrury k'l the 2rc1 house opposes
the house of higher va-.,es and higher leamil"9 in the search for
truth, so that the l esson, with a retrograd! Mercury in the 2,., house, is
to exerd:se proper discrlrrinatlon as to what ts reall y l,..,ortant and what
is not irTl)ortant, not to attention on the external features d l ife
as being the center of being.
Third House: Retrograde t-1ercury here i s emphaSized since
Gemini ts the natural nAer of the yf house and Mercury roles Gemnl.
Probably the most i mportant quality to be considered, wit h a
retrogade Meta.Jry in the 3
1111
!'louse, is that of communication. What it
Indicates Is that the Individual, In the past, cld not convnunicate too
well with others, mainly because of the combination of the qualities c:J
Gemini and Virgo. The indi\1cllal tended to discriminate improperly in
that if somoone were not intelligent the native did not e...en
bother with him. lhts is a nonnal Gemini trait anyway, for If Geri"'ls feet
you are not interesting, t hey don't want to be bothered - t hey are
snobbish onty i n an intel lectual manner. They demand peopl e be
Interesting - mental ly.
330
Retrograde Mercury in t he 3"' house tell s the irdividual th.at he
must corrmunicate With people on all loevttS d thought, for giving in
communication Is as lmportart as rec2tvlng. Third house Mercury enjovs
being stimulete<l but must learn t hat it, too, must
stimllate.
In a minor way, this: location of a rttrogrMe Ml:!rcury shows a poor
rel ationship with siblings and ot her rel atives and neighbors. To
transmute d'lis would require the native assuming a more democratic
and realiStic appro&Ch in relationships with oths.
Four House: Tlis shows that t he ptrson was responsible for
much disharmol"f)' around him, since t he 4"' houSe defines: how
lnltuence others by Olr pe.sonallty development (our home is not orVy
the physical structure of the house, but also the auri c field in which the
phy<icl!l body is "'""'d).
Retrograde f.1ercury i n the 4'"' tells t hat the in<ividual was
far too restless, lftl)Ustve., rash and oft:en offensive In speech (especially
if in Taurus or Scorpio) to those who came wit hin hi s sphere of
influence.
Perhaps the esoteric iderpretation of t he glyph d Mercury is the
best example for the In retrograde Mercury In the " "
house. The crescent represents the personality: the circle represeru
the divinity or divine spark wittin; the cross is the aoss of matter. In this
gtyph, Mercury represents being the Instrument of our spk'ltual and
mental Too often, we crucify the spiritual within us on the
cross d Ttus, the retrograde Mero.Jry demands that the
Individual presert himself poslttvely and more splritualty In his oontacts
wit h others. Esotericaly, represents the bi-polar quality; CI9CIIn
the need for b*ce which was not achieved in a past
lifetime. This balance demonstrates itself through our auric field.
Fifth House: Retrograde Mercury here could easity sOOws that
the person was rather lrdlscreet, careless, and untn.thft.lln love affairs.
The person did not discriminate very wdl , not communicate well, with
those with whom there had been any romantic entangl ements.
tl"<! Individual did not prefer the responslbli tles lnvollll!d In
33!
raising d'lilci'en, an:t coukt very easity ha..-e paid too mudl attention to
the light hearted pleasures of living, with littl e regard to t he
responsibllltks lnvol...ed In li fe Itself.
Leo, being the natural ruler d the 5
111
house. could Imply that false
pride a ctlminating characteristic of the past, ard the retrograde
Merwry emphasizes that t hiS qUblity was the chamel through wtlich
the Individual COI'Mlunlcated his petsonality to others.
The l esson, with retrograde Mer<:\.IY In the house, Is that of
proper motives in romantic aff<Mrs, the assui'J1)tion cJ responsibilities of
those in our care, and the proper <:iscriminatioo in pleasures.
Si xt h House: Retrograde Mercury in thi s positi on focuses
attention on the nervousneS$, restt!ssness, and impatitnce on the
past or the ln<iW:Iualln a past lifetime. This person wo!Jd have lad<ed
discrimination and certainty woukt not have been one who enjoyed
being of service to others. The inditdclJal certainly cld not relate well
with public needs or public Interests, having little no respect for the
iWef"age being. The tendency would ha\le been to be far too
critical, e\18'1 to t he poi nt of being sarcasti c, of public trends, those
with whom he wori<ed, 01 who wot!(ed under him. There would have
been an inability to comml.l'lialte properly wit h arPf of these because of
a lack of r.lfJPOrt. All this is further emphasized by the fact that Virgo is
!tie n.at11al ruler of the 6'1' house and has ctmlnlon
and serviced. Therefore, t he retrograde would bring in t he
qualities of being negatively discriminative, of j udging too quickly, and d
being too Impatient.
It could vetv well be, atso, that a degree of mental snobbishness
of Gemini would be in'-'Oived here, indicating that. in a past life, !tie
person hdcl his fell ow man in contempt.
The lesson to be l earned, wfth retrograde Mercury In the
house, is patience, understanding, respect for social trends, to be of
service where public needs .are concerned, without hope for personal
reward.
332
Seventh House: This would indicate that, in the past, the
individual was the cause of the di:ssoh.tion d any partnership, be it )ob,
or marTiage. Undoubtedly, the Important features ooncerned were,.
with retrograde Mercury, that of being over ty critical, much too
impatient, improper valles, W'lrelibbili ty, and, very
possibly, not orly to others, but seW-deception as well (opposite
the t hoose of self).
Tile person wit h a retrograde Mercury in t he house wootd
certainly have not ertertaintd the best of motives in any partnsttip
established In a past lifetime, nor woul d that person have
his ideas properly and conectly.
Retrograde Mercury In the 'fJl house requires that the lndMdual be
sincere, have proper IT'Otives, ard rationalize c.arefulty before ertering
into any partnetstlip, be it m3rriage or Job.
Eighth House: Here, too, t hi s position Shows that the person
entertained low, materiafistlc values In the past., was superfl dally
int:erested in the search for truth, was the cause d tis own undoing
when it was with how things ended, whether it be a job, a
pro}ect, or a friendship, or life Itself. The person's Impul siveness,
rashness in both speech and action, caused all things to end regatr.-ely.
This could also ha..-e been the false prophet of t he past.
The lesson to be teamed here is to be more ratiol"01 in tt-cught
and action, so that all things are comJ:Iemd positively and completely,
nothing Is unOOne, and there are no reperrus:slons. 1t requk'es t hat
the person be si ncere In t he searc.h for t ruth and how he
communicates this to others, how he disseminates knowl edge In a
correct way.
This person must be very <iscriminati ve as to what grol4)s he
becomes lrwolved with - should avoid witc-hcraft groups, folbwers d
Satan, seances, etc. Truth sh:>ul d be understood and dari fied in a
practi cal, downto...earth manner. By being an example of truth, he
could transmute retrograde Mera.y the 8'" house In the finest
Ninth House: Here, the ra$1vless c;l Mett\I'Y is also emphasi:ted.
Th! person with retrograd! Jl.1ercury in the 9"' hOuse could eaSily Nve
been a tumble-weed In life, going from here to there, with no
direction. no p\ll)C)Se, no plan. Similar to a retrograde Jupiter, it could
indicate the indivklJal who ms a religious fanatic or bigot in the past.
tok!tatlng no one else's opirj()n except his own. Improper speech and
action in religious belief$ or phlo5ophy caused animosities and enemities
in the past (it doeS square the 12"' house of secret enfl:nieS).
Here, again, you have superficial knowledge Md a lack of
application of knowledge to actual living condfUons. The person,
undoubtedty, was involved with negative groups, whose activities
broLght him into conflict with accepted situations and/or the law. An
afflicted M:!lrs to retrog-ade M!rcury would indiCate that the person
spent some time conflnemert because of his actions and beliefs.
The lesson to be learned, with retrograde Mercury In the 11"
house, is a true search for higher knowledge and ti!l'er self, to live
from the OYist center within, to see truth in and its variable's, to leam
and apply this learning to all ateas of life In a practk:al, c:k>wn-to-earth
mamer. This person should respect all rel igions and all philosophies,
even tOOugh contrary to tis cmn. Despite his own beliefs, there
to be a respect for law and order and for established lnstJtuUOns.
Retrograde here also shows that the person ""st respect the
and freedoms of others.
Tenth House: In so far as the person's profession in the past was
concerned, there was a tendency on the part of the person to be
rather indecisive, irresponsible, perhaps shifUess, and so these q.Jlllities
caused him to lose favor with tringing about a k:tss of p:li:Sition
and a lack of advancement. These same qualities prevented the
individual from ac:tjeving any degree of recognition In whatever field he
chose to follow. It would be safe to Si1'f that there was a degree of
craftiness and deceitftlness involved in not only the job, but also in any
go\lerrvnental atrahs. This person oould easily have been a minor offldal
in some position and use his authority and position for self
advancement materiaty.
33$
Tile lesson c1 retrograde Mercury in the

is in being
diScriminati ve in selecting friends, in being a Sinctre friend, and i n
evaluating people property, Soci al actMtles should center around
mentally stimulating ones, and the ability to conmll'licate with
on all k!vels Should be developed.
Twelfth House: Primi!lril y, retro47ade Mercury in the

shows that the lnc:lvtdual did not work out any d his karma In a past
lifetime. It tells that the subconsdous sotA qualities were neglected and
not demonstrated in the person's journey through life. Impulsive
speech, rash actions, false discrimination developed many resentments
and secret enemies. Being opposite to the 6
1111
house, the native
refused to ac:.c:ept the ('.Qil<:ept <:1 $ei'Vice to other$, and tl'l.ls retarded
hiS own Spiri b.JIJI
Here, t he retrograde f\1ercury's ttsson i s that the outer Should
reflect the Inner. than the soul quali ties must be devel oped and
demonstrated in serv;ce to others. Selfawareness shoul d be
deW!Ioped and coupled v.;th group awareness as an cwer-al direction in
life. Again. a sense d discretion should be developed where speech
and action are involved in relations with others. Since MetOJry is always
inwlved with diScrimination and judgements, anyone with a
Mercuy In the house must Cl..l'b the tendency to judge too quickly
and to evaluate others. Much attention shoul d be pl aced on being
aware of Karmic detts and working these out in ewryday facets of
IIW1g.
336
Cliapter 24
.Ascentfant - .A na{ysis
Planets have dual nature. Jupiter. Venus, full t-1oon and well
assodated Merrury are beneflcs by nattre, while the Su-I, new Mooo,
Mars, Saturn, Rahu and Ketv are malefic:s by nature. But natural
benefiCS become bad and banefU by virtue of the houses thf!y own.
For Instance, MercliY lord of the )fd and g.h for Arlesascendart Is bad,
generalty, while Venus lord of 31d and ff' for Plsc:es and Jupiter lord of
and 6th for li>raasc:endant becomes banefi.J and e-.41 for the respectiVe
Ugnas.
Simllatly, Mars, generally evil by nature, is an exoelletl Mangla and
Mangalakaraka (causing all auspiciousness) fOt cancer-ascendant as the
splendid lord of set' and lOih, and Satum is a brilliant Yogakarka for
'nlurus as lord of 91t1 ard td", and for libm as the unsullied lord of -4"'

SO, predictive astrology has to take note cl the dual natll'e of
planets, firstly l7f nature and seconcly and specially t7)' lordship. For
instance, for Aries ascendant. f\1era.try lord of Jrd and is weU
relegated to (debility In Plsoes); ll>en, his Karakatwa namely
Vidya (education) and Vak (speed>) will also be a little reduced, as also
courage by the JI'CI house, so that a Kerata Astrologer once told
me that Merauy In Jfd In his own house as lord ot 3'
0
(avoiding
rooch of ll>e ew of an kleal positloo. reooncillng the strengll> of
matters like memory with the minimizing, though not entire elimination
of the evil of the 6,. lordship, like Mei'CI.J'Y debility, In Thus, for
every Lagna, Sage Parasara has classified planets as benefics and
malefiC$.
337
But, before I poceed to address myself to the expert
dassification d planets as an:l malefic for eaCh Lagna, I Should
pause for a moment to point out two Items of fundamental
importance. Firstly the condemnation of planets like the lord d the 11 ..
for a cardinal sign or the lords d the 7"' for a dJal Sign or tM lords or 2ro:1
for Leo and AQuatius ascendants and S!.bhas beneflcs)
owning Kendras or quadrants as evil has relevance only to Maraka
(deathinflieting nature) and n prosperity in life.
fa' Merrury lord of -r' and 11
111
for leo asctndant, for inStance,
when wei placed In the 'J!'41n Vi1'90 or In 11"" In Gemini in the 10 ..
Taurus of ascendant especially with the s.tn lord of the ascendzlnt or
can and does give prosperity an:l wealth. especially if his
(Mero..ry's) oasa runs in the life of the In fact, for sh!er wealth,
ttlere is nothing so conducttve as a g.ocx1 2NI and 11"' lord or a good
combination of the lords r$ 2'"' ard 11"" - for exafl'1)1e of Venus and
5ab.Jrn in ut"' in libra for one born in S&giltarius, when th@ 6"' k:udstlip
of venus does little mischief since venus is in the better house 11t11 (6llfl
from 6"'):
For, See : Dust"->naP11$1hodhith<Na swagrihasthasthihasr:het
Swakshetrll bhltvlJ{JIIlJINnevll karoti mnyM
Meaning, that if a J;lanet owns two houses, one of which is a
Dushsthana (6" or fJ" 1211\) but is In his own house (that is house
other than OUshsthana) gives only the effects 1t>e hoU5e, .tlere he
is placed so that Jupter in the Sagittarius, for Aries-ascendant is
placed .-. a capital position as kltd d the 9" In 9"". and the e'JU of 12"
lordship is minimized and Venus in for Pisces, functions as lord
of 31t1 mainly, avoiding the evil of the fF' lordship as far as possible.
Secondly, Athlpat)<am or Irrelevant In Adhll<)ga, for lnsYnoe,
formed by Mercury, Venus and all the th'ee natural, beneflcs,
being in J#:1 and fP' from the 1"1oon or L.agna. The Oasas of ttle
pl3nets causing Adh;yoga prosperous reStlts : for the diCtum is :
"'Yasya )09.15)9 yahkarta, balavan jitadrigyliha
Adhiyogodlyogeslxl swaditSay.om phaidpradiJh.>
338
Simil arty, the evil cl lordstlip is minimi ted by a oonjunc:tion or
oppoSition d Jupit and the t-1oon. For instMCe for Ubra, i f Jupiter lord
of )Ill and 6t", alone In 911\ or lOf'l, works harm and havoc; but the said
Jupiter with the Moon is found to gi ve affluence and prosperi ty.
Si milarty, while the f'.1oon lOrd of the ff' for AquariJs, i n the 4th i n Taurus
is bad and baneful If alone, is found to give fak' prosperity though not
very high prosperity, if and when with )Jpiter; the Karaka for wealth
and wealthgiving lord rl2rd and u th.
With the! above a nd prefatory remarks, I shall, now,
dls<uss Stl Parasara's classltlcatfon, Lagnawtse.
Aries - Ascendant
fer' Aries, he says, Saturn, Merc..ry and venus are malefk:s; and,
the SUn and Jupiter are benefi cs. The corrblnation c:J CJ" and lOih lords,
Jupiter and Satum, does not au..R Raja')093; in fact, satwn {an enemy
of Mars, lord of the asoendant and the baneful l ord of 11"' for a
sign) taints Jupiter by conjooctlon or aspect and mars the Ra)ayoga,
ren1ering Jupter a Papi {malefic). Venus lord d Z"' and Jlh may kill or
lnftlct l rtense misery, unless she Is In the: CJ" or espedaly 9111; but
Me rtury and Saturn are worse Marakas.
In this, there is ro mertlon of the Moon or of Mars, as benefic
mal efic. The Moon lord of 4t" and a friend of r-1ars must be regarded as
a benefic, espedall y If full or If she is In own house (C&ncer) or In
exaltation In 2,., in Taurus. Mars is predominantly the l ord of the
ascendant, as Aries is hi s Mooltrikona and not SCOrpio the Actuall y,
Mars is benerte, if in U9'a in Aries, or in SCOrpio in the: 1h from
Moon or In the 10"' in exal tation or in 1fh or t/" with or in the,. ..
with Jupiter, especially with or In opposition 10 ll>e See Bhavarth
Ratnakar:
Mestre jatasya Moumastu gurunacha samanvilaha !
Osaturthastho yad bhavedyOgato bhclvatl dhrovam !!
OtMrwiSe, despite the dctum that the lord of the though
very evil, becomes a gi ver of good, If also l ord of ascendant, the
339
mischief of the l ordship does come in to ha\OC. Jupiter and
5ab.Jrn are Oharmakarm3CI'IipbthiS and do cause Rajayoga if, say, they
combine In the In Sagltta<lus or W In the 'J" aspects Sat"n In
7" or if strong Jupi ter powerful ly aspects Satl.l'n. uni laterally - for
example SMIXn in Pi sces aspecta:i by txaltJ Jupit. Jupit though
lord d I.tll is mainly the lotd d He shoukt be strong rather than
weak. For the lordsNp pedomin&tes and 'A'tlen a natural benefic
owns 12
111
and iS strong, there iS affluence though t he native, in the
language d Sa!Yklel Johnson may only "II'Ve rich"' and may n rich'"!
F Atles ascendant generally makes the natl\le poor e-.en In cases
of fair prosperity because d liberal and lordly spending and meager
savings, as Jupiter lord of 9" is also the lord d t21h and hence does not
conduce to conservation of by any savings, unleSS: iS with
or opposition to the Moon wt'ich case Gajakesari Yoga and
Rajayo90 due to the and 'J" lords override the evi of Jupitefs
lordShip.
NM:ives born in Aries:-ascend!lnt generaly prosper in the oasas d
the Sun lord of the Moon lord of Jupiter lord of 'P and Sa tum
lord of tr:P' an::1111t1. The Oasas c:l Venus an:l Mercury are very sdclom
good for Aties born, unless Vtnus and f'o1ercury are in Adhi yoga
configuration, unless Mercury, for exMnple, Is In debility In the 12d'l
is i n trine, espedilly 9d'l.
The period Satum gi ..-es suo::ess but marred by calamity if it Is
the 4#1 Oasa, with special juri sdiction to kill. I n the case of f'o1r. S.
Doralswam,t I)'er of the Madras Bar, )Jplter Ntd Satun In debility In Aries
ascendant made the native rise to the topmost rank of the Madras Bar,
throw away a lucrative prnctice, and a good dlance of High Court
Aldge:shlp, by rer'l.lr.::tation, Md rrigratlon to Sri Awoblndo's Ashram In
Pondlcheny, an ll ustratlon of dlct\Jm r"9"fdlrg yoga-bharga,
whereas another native wit h Aries ascen::Sant with l.Jplter and Satum
(Badhaka in 'P becoming Sadhaka) in tj.h in Sagittarius good for both,
rose to the topmost position as the an-I ndia f'.111itary AccountMt
General.
340
Gemini -Ascendant
MALES or females bom In Gen*li9eneraliy have quick wits, vM!city
and versatility, usually characteristic of Mercury lord of Lagna or
Ascendant, pro>Aded Mercury is not weak by su1y In the f1" or thee" or
ll>e 12 .. or In Needla- Rasl (without Neechabha09a) or afflicted by a
malefic, particularty Mars, the enemy d t-1ercury and lord of the 6*" and
the u" b- Gemini,
Mercury in the Ascendant with venus, lord of the (and the
12*) causes good Raja-Yoga, provided the cornbinadon Is free from the
affliction of t-1ars tJ,o combination or aspect, and Veros is n<X combust
within 11of the Su'l. Mercury in the 41t1 in is very good, especially
when with venus, even if in debility, having Neechabhanga. In the
December 1967 Issue, I have given a horoscope with Mercl.l'y and
in the with saturn tord of the CJ'I whose native occup;es a
high position.
The Moon lord d tN- 2f'd is import!lnt for famity al'd f...anc:e; and it
would be wrong to say she is a maraca and hence may be aippled In
det;lity or weak in the 1d or the 6*" or the 8th or the tl" though as
New-Moon she Is better in the 'P or the 11
111

Thi! Sullord of the Jld iS good, Wl the Y" or the 11t11, when in own
house or exaltation.
Mars, the baneful k>rd or the 6
111
and the n"", is raUler bad for
GemlnlpeoJ*!, and mars any Yoga or combination rcw- prosperity and
success. BU:, she is very good in the 11
11
in Aries tis Mooltrikona house,
in view d the: realistiC dk.tl.l'n of f\1antJestrwara PhaladeepikA, that
when a planet owns two houses, one d which is a OushS1hana or bad
house, viz. ttle st' or ttle 8
111
or the but occupies the other house
own< by him, he gtves the tlftS of the house or 81\ava ht
Is posited and not the effects ci 11>e lord-<hlp also cia Oushsthana.
Here Is a horoscope (Chart No.1) to l lustrate my point:
The native, now no more, had imited general education, but
passed G.B.V.C from the Veterinary Colle9f! (os, then, there was no
Veterinary CCUege at Madras) and service in tM Veterinary
Coll ege, on Rs. 30 per month (though the value of the Rl.l)ee
was, then, much hi gher) . tit'! rose to a rank as a DistriCt
WterlnafY Offla!t, and ronaly aded as the Pmclpal, Madras Veterinal'f
Coll ege, on Rs. 900 Rs. 1000 per month. And, even after rd)rement,
he was the Olai rman of the Committee to setect candidates for the
8.V.Sc. Course, after the advert of the 8.V.Sc. Degree, to replace the
G.M.V.C. Oiplom&. Martt the Moon lord of the td in the lrl' i n Pisces, a
waty planet in a watery $9l, and f'.\arS Mllplaced in iSolation in tht
11 \tl In (]Nfl house. He was In the gocxt books of his European Heads cl
the Departmert an:t no ill-wisher or erw:my c:o\Jd touch him. See Mars
lord of the fJh and the 11
111
, in the 6th from th! fP', in the 11
111
in O'Nn
house.
RasiSo Dustha 8haVC!JSy3 Ourb!llam! Swa OOCha Mitra
Swa Raslsthe
Bhavapushtlm Vadet 6uc:l'lah !!
Though the t , the and the 9"' lords are comtM-Ied onty In the
Cha.rt 1
... ,
12\tl house yet they ate fairly strong, as Venus lord of that house Is In
O'Nn house. See: )l.l)itf!r was in l.aiJla though in combustion within fl
of the Sun, and aspected the 9tt1, the house of fortune. True, t he
etf.cacy d Jupittr's aspect will depeni on hiS strength; for, the author
of Vttara Kalamn'ta says an aspect Is good and powerful only .men ille
a.specting planet is in own hou.se or in exaltation. At the same time,
NIJdi attributes effacy to Jupiter-'s aspect. even when he: is in
debility. or In combustion, as In this case; for. It says, though Jupiter may
be bll'nt up in combustion by the Soo, tis e','eS are never burrt and his
aspect has good Ht died just before he was 60.
342
fQt Gemini Ascendant, Saturn lord of the tJ" (and the at"? may be
in the as lord d the fl". The late l.Jstice: K.S. KriShnaswamy
was a Gemiri nattve with Venus In the In Libra but Saturn In the
his SUIXeSS and prosperity as a l.ldc)e of the Madras Hi gh Court being in
oasa d lord of the the 12tt'') exc:tll entty placed in the
'5" wfth Mertuy, Jupiter bertg In Lagna. Jupiter f Gemini Lagna is l ord
of the 1"' and the tot". As a lord of QJadrant5, he has KeR:fradhipatya
Dosh. But, I should pause: for a moment, to point out, the
Kenct'adhlpatya Dosh or the evil of ownership cl quadrants camot and
does not affect Yoga or prosperity; for, the evil relates to his Maraka
powers (or death-infli Ciing powers) when placed in the -r' or the 1', or
any other marakasthana, like the or the 6"' or the 8\tl or the As
lord of the 7"' ror o duol sign (Utll>oyo he becomes o bonef<.l
Badhakadhipati, so that some say that h! iS good when weak or i n
debili ty, and wi t h instances like the horoscopes of l ate T.V.
Muthulo'lstnler of the Madras Bar (one of whose sons passed the J.C.S.)
and the late A. Lak.stminarayanaief; a gi ant d the Madurai Bar, who
(both) had J._.:)iter in d!bility in the g!h for Gemini ascendant I do not
have the full horoscope of the first gentleman. But, the l at e A.
Lakstvninarayanaier had Bacflra Yoga, due to Hero.ry l ord of the and
The 4tn in Virgo, aspecting the lot", OCQ)pied by the Moon lord c:l
the?"" and by Saturn lord d the fJ". When the lord of the 2"" is in the
even a lowlx>rn becomes prtncety and rich. Ard, when Men::ury
lord d the Ascendant (and the 4"'), and so the ruling pl anet is in a
l(.endra from the house causing BNdraYoga, the nati...e comes up i n
and speaks well In assemblies or coons. The forensic eloquence d the
late A. Lakshminaravanier was remalit.ab'e. ()'I a smatler scale. The late
5a<l'lu Ganapathi PantukJ, a leadi ng lawye- of Tlirunelveli, had Jupiter
and Mercury in the <.1 .,. for Gemini Lagna.
The late v. Nadlmuthu Pilla! who Inherited crores from his
grandmother and was the main of Pattukottal and one of the leading
men in Tanjore Distri ct, was a Gemini-native, with Mert\IY in the .qlh in
own house and Venus in own house in the S"' and l.Jpi ter in the g!h in
delilll)< He got a son, late in IWe, through a second wire.
But, ll4)1ter in the 'P' ot 111" In own hou.se Is found to be good for
Gemini. t-1r. 0. Kristlnaswamy lyer. a leading lawyer c:1 Vellore, is a Gemini
nattve. But, Jupiter as l ord of tht lQif'l in tht t1" iS even better; for. a
natural benefic like Jupiter or Venus ownng a Kendra and In the
51" or is extdled oriy bv a natural benefic owning a time (the S ..
or the 9#1) and in a tce:ndra (quadrant). I give bel ow two
hotosoopes to il ustrate my point:
This Is the horoscope of a t-1adras M.LA. who got lakhs by
He is a large-hearted gentleman, who was also In the election
in 1967 for a second time on the COngress tidtet in spite c:l the general
COnC)'ess d<!bacle in Madras, on bCOOLI'It d his personal popularity. He Is
generous to a fault and is loWig portions of his vast properties, bv sales
to liquidate liabilities, largely incurred due to his s,Yeat generosity. Mars
and Ketu in the 2rd are not good; nor iS the aspKt of MarS on the 9"'
good. But, Mercury in the 4t11 giving BhactaYoga and )Jplter lord c:l the
10tt> in the tJh aspecting Saturn lord of the cJ" (and he a"') in the 1 are
towers or strength.
Chart l
.. .,
Chart No. 3 is the horoscope c:l one who passed the old F.C.S.
examinatiOO (now Indian Auclt and Accounts 5erviee) and rose to be
Accountant-General on Rs. 3,000 per month. And, even after
retireme,_, he was appoired as the Rnancial Adviser to a (pri'lcely)
nattve State. Mark the excellent 9" and to" Yoga, due to J._.,itt!r lord
of the 1<1"' and Satvm lord ol the exchanging places and r-1ero.uy
and in th! 11
1111
is also Chandra Mangla Yoga, good for
finance- 333.
Virgo or Kanya-Ascendant
KANYA Virgo Is the 6
1111
house of the zodiac. Its lord Is Merwry,
who, alone among al the planets, is exalted in (the first part d
his own house.
MertLrY. lord of Lagna and the tot' is a very important planet,. and
Yogakarka natives born k'l He ts best Lagna or
the 1<1" his own house, forming Bhadra Yol}a but must be preferably
free from the affliction of Satwn lord of the fJh (Moottrikona) ttyough
atso of the 5"-, and espec-Ially Mars, the worst p&anet for VIrgo
ascendant., as the baneful k:lfd of the oyd anti the
VellJs lord ct the 2"' the ls a brllllart Yoga-Karaka. /lrd,
and Venus, together, in a good house, the 1 , the 4", the J'ih or the
10
1111
or the S"'or the C?, partlaAarly the 1w or the 10", or the.,.. or the
2"' <j<fs YefY high Raja Yoga.
Chart No. I below Is the hol1lscope of Or. S. Radhakrishnan, the
philosopherstatesman d India, who is an orator and who was Vice-
ard thon the President (afrer Babu Rajencl'a Prasad) of the
lrdlan Rtplbllc.
I
....
Mark the unsullied combination of Mercury and Venus in the
Ascendant, the former being In own house and the latter having
NeechabhiNJga- Raja Yog<t. The c;oni;)in&tion is atso responsi:l'e for his
oratorical powers - see Venus lord of the r' with Mercury lord of
eloquence, in Lagna or the Ascendant, whe-e Mercury has Oigbala.
Also, note that bad Mats (lord of the Jld and the Slh) is plared In a
capital or ideal place in the 3"", as lord of the 3n:1, avoiding the evil of the
fF' ton:IShijp, apart from lord of the fF' being good in ti'W! 3"', for
longevity and for oonquering enemies. )Jplter lord d the '1"' and the
1", also Badhakadhipatj as the lord of the 'P' for a dual sign, is in the '1
a hid:len hoi.!Se, aspecting the 1" as lord of the 7'
11
He prospered both
In the British regime. and In the Conwess regme., thoug"l he was not a
who never wert. to jai. In the free<bm struoole.
By of contrast. t give here t he horoscope of tile late Mr.
Muti'IJ R.amalinga Thevar, who was a bachelor, ard a great orator in
"Dimil but who was detained in prison, t ried in a seSSions case and
acquitted. and who died at S3 or 54. lf only he had confined himself to
speeches on Hindu Rel'gion, he wotJd been a great sucxess in life.
See the debiltulted SUn in the r:' house; and mark the excellent
combination cl Mertlf"Y arxl Venus (lords: d the 1 ll ard the 10"' and
the and the 9"') In Lagna, marred by Mars lord of the 3
10
and the 8"'
and the aspec:t of Saturn lord of the
Chart 2
... ,
In an earlier issue, I have, I believe, a COPf of the horoscope
of the late Ml.thu Ramallnga Thevar, as an Instance d Yoga
4
bhanga or
marred Yoga. He also a goeat scholar in Thml and a fiery orator, thanks:
to f\1ertury-Venus In the Asa!ndant..\llrgo. He was also a bachelor. But,
his life j:r'Oved to be a failure, though he was a setri-God among all
Thewws, since the eccellent combination of ard l ot" ard (t'l' ard)
rJh lords in Lagna was marred, by the worst lord of "5" al'd 8"' (Mars)
joining It and satun, brd of 6"" in 1
11
aspeatlg lt. Sun ?"d In debility
also made him use words without weighing them, thereby incurring the
348
severe wrath of th:)se in power.
r h.ave already given, in an earli er issue of this Magazine, the
horoscop! of th! Mr. P. GO\Iinda Menon who was a Judge of
Madras High Court. and later. a Judge or the SUpr<me Court, In wtkh
capacity he d ""
Tn Chart 3 Marte the d the lord of the l't ard the lOe.
hol.JSt!! and the brd cl the t"' and the 9"', and the arxl 6th lords in
!he 21'1d house where Venus Is In Swakshetra, and Adtj-Yoga from the
Moon, thanks to all the 3 benefiCs being in the 6rn a,_, the 8"' frcm ttle
Moon. Note, too, that Jupiter {lord of the "'P' 83clvJkasthana) and Mars
(lOrd c1 the sth) 1W"e relegated to the
Ql.lrt 3
....
The late Shrl s. v. Ramamurthl, J.C.S. who acted as the Go""'nor
of Bombay, after a bril iant career as a highly independent lC.S. Officer
had MetCl.lry and venus In the 11" for Virgoascerdant, aspected by
Jupiter from Soorplo (the 3"') from Lagna and In the 7., from Jupiter.
Now, I give a horoscope, presenting a ticklish problotn to
st\ldents or astrolo9'f.
Mon. Mar
...
....
""'
a ......
... ,
Very rew can expect this (Chart No. 4) to be the horosoope or a
Bratvnin, who, from very humble passed the r.c.s. and
has risen to be a Higl For, after all, the glll an:t tOih lords,
Mercury and venus, are combi ned, onl y in 6l
11
; and, even t he
presenoo of Jupiter In the 11
01
rendetlng t he 6"' an Upachayasthana
(instead of a Oushsthana) in this case, giWig rise to Vasumathi Yoga,
to all tM 3 benefics in Upachayas (6th and lllh) can e.xplain
prospe<lty or wealth, but not position. The furnished by a reading
from Chandra Ygla, as Chandra ... a is more powerfU than Janma
Lagna, Chandra (Moon) and Guru (Jupiter) havi ng wellexchanged
places and Jupiter aspecting the Moon In Jl4)iter's house. And, Mats
and Saturn, b.xl and bilneful from the Ascendalnt., become the l ord c:l
and ri" fran CNindra L.agna, and lord d t he 11t11 rf:Spectively,
And. Merrury, as lord of the 1'-
11
(a Badhaka) and venus. IOtd d the 3
111
and the f/' from the Moon are well rdf!9ated to the from Olandra
Lagna. Of course, the f.1oon afflicted by natural mafefi cs, though
aspted by Jupittr certain ck!fects; and, t he end of the
Moon's Dasa or t he beginning of Mars Dasa may cause a very altlcal
illness to the native which may be diffiC'-'t for the native to tide over
and
iS another hcroscope ( Chart No. 5), Ymh Virgo-ascendant:
...
The native's father rose from an Aml n' s pl ace to a DiStrict
Jl.dgeship; And, the native entered setVice, as a 015trict Munslff but
rose rapi dly to a High Court Judgeship. Mark that lord of the t and the
tO" is in the f1
11
, whose lord is exal ted in a Kendra, aspected by
Alpiter from Lagna-Kendra, Simhasanacl'lfpatl* In
modern parlanoe, a High Court J..SgesNp. The 10" Is by Mars
and aspected by satwn, t hough Sa1urn, as lord of the 6" in the st
11
i n
debility, with Neechabhanga Is good. The due to the success, In some
su-dl cases, is, that pl anets oiXaln more t il(;ln 6 dots, and
even 8 ctlts, in Ashtal0varga.
348
I now give the horoscope (Chart No. 6) of a m(ln of Puri tanic
Rigour. who iS a p-ofound SCholar in the Vtda:s, inelJding samaveda,
and shastras b\t, who, despite ordinary conditions, revels In a rigorous
life of \Qiuntary poverty by refusing to any fees for astrologi cal
opinions and rtactings, though he is a expert in Jyothi st\!1.
c .....
.. .,
"'
....
Marl< the exchange d krds of the t' t and the fPt contJibuting to
l:leergh&yus but Kashtayus; and Hamsa Yoga due to Jupiter In the 41" In
his own house (thoug, Is only lo<d ci Kendras) aspectlng and
purifying in the 12
111
(Yiflo is good as lord of the 6-. in the


He is estMmed and honoured t:J,o His Sringeri 5al3da
Pltadhipatl S........,harya Samlgal and Is going strong. despit e a fnlll
physical frame and spare body, at 74:1 or 75. Martt Jupiter and Veros,
strongly posited, on either Side d lord d Lagna, f\1ercury. \Vhie lesser
mortals with only a fraction of his profound scMiarstip ,.1int money, he
is highty contend and believes that hono!S is the highest wealth, and is
held, l:ft' ever)(lnt i"'duding who Mm Brahmins and revile thn
In highest regard. Venus, though strong In the In own house, is a
but spoiled due to Mandi in the ro rendering Venus, the baneful QJika
And, what is more, venus does oot bl ess the lOrd d
the Ascendant, by ron).mctlon. And Jupiler's strength In the

makes him a Vldya Kesari (a lion among Vldwans) but is not so

conductvt to prosptrity, as Ji.4)itl'!r is not the lOrd o f a Kona (or time) in
a but is lord or a Kendra In a His good wife is iterally, a
Ri shi Padhi. Such persons of rigorous purit ani<; habits, avoiding
P3rannam Or fOOd in another's house) ror. ht cooks his own food. t'l.'en
In another Brahmlnts house) are rather rare. even among the Vedic
scholars, in t hese days, and rerrind one of the late !amerced Pandit
Madan Mohan Malaviya.
, ..
Scorpio or Vrischika -Ascendant
Scorpio or Vrisllchlka is the 8., sign of the zoclac, a tixed sign, the
negatiVe house of r-1ars, and a Keeta (insect) Rasi Great men are not
born in this Lagna or Ascetdant, as frequently as In Tauus, cancer, Leo
or Virgo or Libra. For, very strong oonflguratlons are required to lift one
both in this keeta Rasi (insect
4
sign) Sllfering from the handicap that its
owner Is more the lord of the 6th than the tord d the Asc:endant,
Aries Is the positive sign and of Ma"' lord of Lagna.
The best planet for this Ascerdant Is Jupiter owni'lg the and
11>e S"'. Alone among the different signs, Scorpio Is the only one fO<
which Jupter is in unadulaterated benefic, owning two good h:>uses,
the 2"'6 and the S"' - let alone the 1!'4 lord who badly placed and
afflicted becomes a maraca. For Aries J\4)lter ls, though maklty and
predominantty lord d the al so the lord of the tl"'. For cancer, he
owns not only the 9th blt atso baneful For Leo he Is the lord not
only of the S"' house but also of the house. For other Lagnas,
except perhaps Pisces and sagttanus, he suffers from
Dosh or the evil of or he owns evill\ou.ses
the for the 3fd and the 12"" for capricorn and the 3
10
and
the 6th fc. libra. Only f SCorpio the best benefic and Karaka f
wisdom and wealth owns the "J!Id or hoUS-t!: of wealth and the of
Poorvapunyasthana. Such a Jupiter In the

lifts a native In a
spedaoJar fastlion for he is k:lrd of the 2rd and the s*" (trine) in
a Kendra. Even at the: risk of repetitiOn, 1 shoutd illustrate my point by
citing the follcwMg hc.oscope of the &ate Sir, T. Sadasfvier v.t.o rose
from a place to the position of a of the ,.1adras High
COurt and whose issues too were (mark the lord of the
In the 10"') a son was a I.C.S another I.E.S., and a son--lnlaw started
as a and retired as a District Judge.
Owort1
....
350
Hark Jupiter the excdent benefic for Scorpio oa:;upying the 10"'
with f\1ars, in the 7ft' from the f\1oon (lord of the 9th). Of course, the
unique success of this sel f-made gertl eman d study Independence
was due, l"()t merely to Jupiter in the tOih with the l ord of Lagna
(canceling the evi l of the 6th k:m:lstlip d Mars) but al so to two important
Yogas. The :
(i) The presence of Gajakesari Yoga We to Jupiter i n the from the
Moon and Adhl Yoga, on account of Jupitet .-. the .,. and venus
and Men::ll'y in th! 8th from the Moon and
(i ) A rather rare Yoga de:scrbd as 'Isttttpala Yoga' in This
is caused by the association c:l the lord c:l the l.agna or Asc:erdant,
with the two trinal lords d t he Sth and or the 9th in a Kendra
other than the J'lf!. See Mahadeva's .btak.J Dttwa
Dh8ffTiapatyapov dhyocnomakendra Ugnal)'uto
rajldhirajaha
meaning, t hat if the '"' and the lotds are associated with the
lord of Lagna in a quadrant other than the 7'
1
' , a king ot bom.
Sage Parasara and Bhi1Vi1 Kuthoohala have made statements to the
same effect lf fact. while Sage Parasara declares that
Sutheswaro dharmapadamyutas cheth
l.tlgneswarZtMPI yuto
Sc.he at/lava ,... grlhilsyat rajyabhlsNI<to
yadifajya --
Orly lhe author of Bhava Kulhookala has g..,n out ll>at W the lords
of the t , the stt. ani the 9th are together or in Samasaptama in a
the 1", the <11th or the lOth Raja Yoga resutts. This is a rather
rare, If not oolque Yoga. as already lndkated. For, wf>lle the lord of
Lagna combining with the lord of the sth or the tord c:J the 9th is fairly
commoo. the assCidaUOn of the lord ol Lagna with both the trinal lords
of the 5th and the 9th and that too, In a Kend'a Is uncommon. Under
LagnaVtdlara V (leo) I have, r believe, dealt with the horoscope
Lyndon JoMson, President of the U.S.A., born in Leo with the Sun
(lord of ll>e !"). Mars lord of the 9th and )Jplter lord of the In ll>e
Ascendant, making l'lim occupy the coveted White House. Despite ltle
35!
New Moon lord fA the 12'
11
joini ng ttle combination sho!Mng "seo-et
enemiecs"'. I t hink t he abOve formi dabt! combination, coupled wi th
Satum ld of the 6th In the 8th, wl l enable him to weather many
storm>.
Let me nf!N rewm to the Scorpio As<:erdart without any f\lther
ado or digressiOn. Mars, though k:lrd of t.agn.a is not good as his 6"
lordstlp Is likely to be dominant unless Chanda-Mangla or
Yoga him on account of (the l't and the SC") or (the 1
11
and
tM 9"') combinations conducing to Yoga, despi te Lagnadhi pa being
also the 6th lord. In faa. there are case where MatS In the or In
Neech.abhanga have been found to be good to ScorpioAscendant
natives.
Jupiter lonj or 1/le ?"and the S"' hamg been alreodv stated to be
the beSt benefic generally (except, say in a where for
)Jplter Is very weak In the <yd and In debility), I shal proceed to oonskSer
the other planets.
Saturn. as the lord of the 3"' and the 4"', is ordinary and not good
or bad for Scorpio. His 4'1'11ordship is good, but. he is far from a from a
ti1end or the lord or Lagna, Mars. Hence, he Is oot well disposed. B<t, In
the r in his own house, and in the 11
1111
a good for to
oa::upy, M is good generall y. In t he 6tn in he arfects the
native's mother and atso nati'Ve's health, even when there Is some
Neechabhanga. And, he WOI1c.s hci\QC wtlen in the ff" in debility in Aries
wit h Rah.J or ketu.
lord of the 71t1 and 1 2"' is irnportlnt for one getting a good
wife and enjoying life. Blt, on account d kenchdhlpathya Dosh of
(due to tt>e 1" l ordship) and V10yadhlpatya Oosha (or lordship or
the 12"'), Vel'l.ls is not good for Scorpio-Ascendant.
Hert'-"Y Is the baneful lord or t he f1" and the II"'. And tl>e planet
is also an enemy d Mars, the lord d L.agna. But, when placed in the
11
111
, or In Lagna with Mars In the u tn, his evil of the lordship Is
minimi zed, thou!jl not completely elinWlated. I n all other cases, he Is
evil as l crd d the sth and the Itt". l n fact, there is a dictum that while
the association or oombinatlon d the and the 111" lords causes Raja
352
Yoga, Slh and the 11 lh lord joining the same mars the Raja Yoga. In fact.,
thiS was verified in the case or a backwaltldaSs gertlel'nan. M.A., Who
rose, In the Revenue Department to be a Deputy Collector. Blt, then
on some c::honges, he was dismissed; and his suit in a Sub-Colltwos also
dismissed. The case v-as a great to me; for. N116 had
predld:ed that he woul d become a '"'Niyadhathlpan* or lakhl er on
account d the combination of the <?, the and the ll'd'l lords in the
11"', aspttd by Jupiter. But, he hbd an unerwiable
FrankJy, I do not see, why hiS career was so spoiled. ooleSs the
of Mars and J""lter, the position of the lord of
the tt" (though a natural benefte) in the and t he rJh a,_, the
combination in the 11
111
being married by the lord of the t-" and the 11 ..
(though in the 11
1
"? cocJd explain .
....
I have rrry own serious doubts, even now whether the given time
and Lagna were correct, and whether. perhaps, it was a case of Libra
Ascendant.
Nlyway, Mercury, he sheds his stO'og of the rJ" lordsi"Op and
functions as loro of the only, Is banefl'.
The Moon lord ct lhe 'I" auspldous, though some say she Is also
Badhakadhipathi and cite the case of the Moon in the 8th having a
father 90 year old. M(way, the ful .,oon, as the lood of lhe <P, rrust
be regarded as auspicious Indeed. I give beiow the horoscope or a
na!M! who though B.A. I!.L, started In Judicial Ministerial SeiVice as a
derk on Rs. 40 per month. EW! n tht!n, I confidertly predicted his rise to
a Gazetted Officer's grade and high preferments for him. I banked on
the Neechabharqa Raja Yoga of Mars ruler of the Ascendant due to
exalted Moon lord d the 9" in the tt', and on the Sm lord of the 10"
placed ;n the S"'.
-
...
-
353
1 am glad to say that no only cld he: rapidly rise to a Sheristedar's
post but he was drafted to the lawSecretariat.. wherefrom after
selection on pa.per as a District f.t.Jnshiff he was wafted to the Central
Law drawing a four digit pay, mue:h SOOI'll!r than M could
done If the was In regular Judicial SeM'oo, Now, I think he Is In
High Jucldal Ser'Ace Wl Goa. Lord of the tO'" in the Slh is very good; and,
in this case, the Sun lOrd of the to" is in the rjh from the ruler d the
Ascendant, In the 9th with distinct Neechabhanga Raja-Yoga. Verily,
the Sun and the Moon (lords ol the 10'1!1 and the are the most
important planets and Yogakarakas for Scorpio. Jupiter comes very
dose next Subha.
In an issue, J believe 1 gave: the follOwing as an
Instance of Uchabhanga I.e. a marred Yoga :
Sun
"""
Chwt4
The native is a congenital cripple (lame) of sturt.ed growth, who
amoot write and could oot benefit by tuition. t-1ars la'd d the t (and
lhe 6.,) Is exalted but has UChabhanga due to lhe banefu aspect of
Satum. Mere Rahu in the tt"' carnot and does l"(lt cause
lameness. The e-AI octopus is detilit.ated Saturn aspecting the stn lord
of Lagna and Rahu. He is want., being a son of an otrlcer. Matk
)Jplter from the S
111
aspectlng the and the 1. But 1 am afraid the
Dasa of Saturn i n the Gt" with Ketu and Venus luckity causing
354
Shandatwa or impotency and alerqy to sex in the lame native aftet" the
expiry of J'-4)iter"s periOd Jupiter's oasa Rahu SlC>periOd m.?Jy kill
ttle nattve who has symptoms of pulmonaty tuberculosis.
Another case of less marred Yoga, though for better than the
above, is the horo5(ope of a male. given below:
s ..
"'""
The natt.e Is the son c1 a respectable rather (a gazetted
officer) and is good-looking and tall. The exchange d the pt and ttle
U lf'I Jords is good; and, so the first Dasa of Mero..ry, pl&Ced with the Sun
lord or the tO'' In Lagna (Ascendant) llrted the ratner rrom a lawyer's
place to a position in the Judiciary. But., thanks to Jupiter and Venus in
the 2rd being eclipsed and poiSOOI!d by Rahu, in degree (Venus
being debilitated r. Navamsa In the batgaln) and to Saturn In the <4lf'l
debilitated in Navamsa, though in own Rasi or sign, he was wayward
and not C))Od at studieS ani refustd to t3ke a B.SC. degree, dtspite
ttwee chances. So, the parents sent him for a job In a company In
Calcutta owned by a relimve. There he passed B.Com. But. thanks to
Venus lord of the 1'2!" in the r' and also in Na*'lsa, he
could not prosper In Venus Dasa, being also the bad ld d the
1d and the 8ltl from the Moon. For Scorpio-Ascen:lant, Jupiter in the 2rd
in own rouse aspecb!d by MarS from tht 11
1111
iS a great Ohana Yoga.
64A, In this case, Rahu In the tr' has spoilt the broltl, much more than
But, one may expect the native to pi'05pet" well, in the Oasas or
per10dS of tht Sui\ the Moon and at leaSt one-half d Mars.
!tie remaining period d Vetlus, a maraca, In the will be a rather
trying one, Indeed.
TNs artlde, 1 am afraid, Is beoorrilg long. I shall wind It up with
reference to the horoSCQPe of a prospero.Js and successful ddiverer of
oratorical religious discourses on Stimath Ramayana, Srimath
356
Bh"!!"vatha and Mahalilaratha considered tobe !lie lif!ll (5111) Ve<lo :-
The native's physical f rame is not quite 9ood or enviable, thovgh
he does: not feel t he sting of any virulent di sease, indicated by a
debilitated p&anet In Lagna and Satum aspedtng the lord of Lagna,
Mars, thanks to aspecting the t.agna, and the lord ol the 6
111
being relegated to ti'M!! 12"'. The key points and sotreign merits of the
horosoope are., that there is Sarasvatl Yoga and Jupiter, powerful In the
ospects the Sun (lord of ll1e 10111) and Mei"Qiry (lord of !lie II")
in the r/h, and the cJh lord the Moon placed in the Asctndant;
and,. ltle best Oasa have been those of the S..n and the Moon. l.lplter
in Pisces in the 5tr1 indicates Poorvapunya and has given the native
Mantra 9d:thi, as the Putrakarak.o is in the 9" he has only a
daughter and no son, and has had to bdopt one of th! sons of the
daughter. The nattve had a very hJmble start In PraYachanam but Is
now an ac;knowtedged master of the art c;l giving religious disc:oorses in
a moving and oratorical manntr and is going strong at 65.
Cllart6
-
,.,
The fad:, that the Sun and the Moon, the King and Queen d the
planetary Logos, are the Yogakarakas fact or Scorpio-Ascendant, as
lords of the and the 9'.h respectively Is ampty Illustrated, In the
horoscope or C.R. wl') was the first I ndian Governor-General and is
BharataRatna, wit h Sun lord d the tott. in Scorpio-Asc:erdant and
the full Moon lord of the 91h exalted In Ulurus In Kendra (the 71") lJplter
is in the 3"' in debility; blt, he has excha1"9ed places wit h Satum wt.) is
in Pisces. From (natal f'.1oon), whi ch is stronger as the
Moon Is exalted In the ,.,. (a Kendra), Sat\.rn is lord of the <'J'h and the
very good in the lttn in Pisces; and, it is good, that Jupiter as the
bad lord d the {&nd the iS in the 9"' in debility. Even when
neatlng 90, C.R. Is metlalty alert and actlvethe Moon being strong and
aspe<Xed by Jupitet
358
By way of <:()l'll)arison and contrast, I shall give the horoso:lPe of a
nattve, with ordinary Yoga, but contended and happy.
OW.rt '
-
""
The native, a B.A., entered Judicial Ministeri al service as a Clerk and
gradually rose to be the Shenstedar d the!: District Court and draws a
pension d R.s. 100 per mooth only- Mark lords d the 1
11
, the 9th and
the lOth in the 12"'. But, as the only son of his parents, he inherited a
good dweiiWlg-house. (t-1ark Saturn lOrd of tM 4
111
in the haVing
Olgbala aspected by Alplter). He has two sons and one daughtersee
R.lllu In the S" aspected by AI pile< Alplter, In Lagna with Dlgbala as lord
of the rd and the 5
111
, is a divine asset and blessing, P'otecting one
ttwoughoot life, aoo conferring calm dlK! to contentment. Verily, as
stated by Jataka Parlj8ta, Alplter strong In the especially, "'
in the 4"', tjve5 generally a life.
Cliapter 25
Mercury:
The embodying concept of Lord Vistmu - indicates Forehead
(HM131a) - intelligence - intellect Because: Sun is the soul, f)OWI!r d
Sun on Mercury, and according to Script"es Sanskrit "Bhudhe
Oeat Budd hi Hi':
Mercury i s t he reflection of Sun, where Sun i s t he l ord,
Mythol ogically speaking f\1l'!rcury i s the son or Moon. Moon by
cunnlng"tess en)>ys the wffe of Sage 8ruhaspatactrya - the resulting
product being r-1ercury (al so In Sanskrit called '"'Taara Chandra
Sai'T'f'V09ai and hence when Mercury is alone, He is consi dered to be a
planet too.
Mercury i ndiCates friend (of bOth sexes) and in Chart a
friend. Mercury the errbodylng concept of l!le Lord Mana Vlshlu -
where The lord Maha Vishnu assumes 'Mohini' Roopa (a female form
during "Samudra MantNna'" (chuming or the ocean)- t-'k!rcury is
ttle govemment planet d GreettS - Maternal uncle - )()\llger sister -
younger brother - mOO walls - Skin - Crops - irtormation - soft -
attrac:.tion.
358
Friendly & ini mical aspects of planets
Meraary
Merrury i s irteUed/irtelligence. Sun iS the soul power, Venus is
wealth, Sun Is atma, (The soul ), fo'lercury Is Intellect and Mercury
encircling Sun (Soul) - SUn is alpervading (being Atmakark.a) - Sun is
the Lord Mercury i s Bhoodevi and VMuS i s Sridevi and hence for
Mercury Soul & venus (wealth and Lakshl mlkaraka) are friends.
Mythologicalty speaking, Merct,.ry and Venus are of lord Maha
Vishnu. Merwry is femal e (when alone) being tM embodying concept
of Lord Maha VistYiu (LOrd Maha VIshnu assumes female- Mol*'ll Avtar
during the Great churning of the Ocean for the destruction of
Demons). t-1ercu-y i s by Soul, Sanskrit version .. Bhode Dat
Hi.
MeKUry as per Bhrigu Nadi System
E...,.y person needs intelligence either for small or big issues and
besides intelli gence i s extremely important. Even for eating a
fruit, It requk"es some lrtelllgence. If mh:t is depressed (Moon), even
then inte119erce can be made to exerci se. Mero.uy is the only planet
which is exalted i n his own Mercury is t he embodiment/
entwfned concept of Lord Haha VIshnu (The Saviour). So, the Lord,
being himself The Saviour of all the universe, need r()t go to some
other house to exhibit his exaltation. That is why in versions d Sanskrit
It is said - "Mukhe Vlshoohu". And whatever is in mind (e\1!f'l In physical
aspects) the same appears on the face. Face Is the index of rrind and
also because, the Sa\1our is all in all.
So, MerOJry governs intelligence and intell ect and man by irtellect
and Intuition would be able to know as forethought many t hings of
fut ure.
....
....
359
Merc..ry is in Virgo with Soo. In 8f'Y)' if there is f\1ercury
with Sen k1 the same degree (what called In San<krlt 'Mtangata), then
power of Mercury reduces to some extent. The native may be
intelligent, philOsophical, but varies in and more so the
Intellect.
MY2
Mett<.ry Is e><alled In Virgo and Is wfth Inimical planet Mars. So by
nabJre, the natNe will have quarreling aspects. The native can be quite
c.alcliative. Meroxy is Intellect. Mats is egoism and hence free-tlow d
expression of Intelligence becomes cheered rue to conjunction of
Mars. Hence, such a native may not fare well in domestic affairs and its
hatll'iness etc.
In female charts she has to have an affairs with another man,
besides her husban<l. Because, she camot stay with her husband for
substantial t ime. The same remains for a male chart al so.
Common to both male/female chart: The native's brother/
brothers wil not have harmonious relationship among them.
In case if SUl is in Leo, the two planets Mero.Jry and Mars comes in
SX)nd to Sul. Then the natfW!:'s father will be courageous, ca"=tJatJve.
who eams well through buslnesstcorrespondence/acooU'ltancy field.
360
MercLrY i s exalted who i s with enemy Or3QonThil where Dragon
Tall Is the controller and hence the native cannot express his
intell 90nce/intellect
The native will be quite knowledgeable pertaining to legal
matters. Such natives may lose strength in t he psydlological facilit ies
like ears, sight (eye earlier when compared to other nattves and
auric powers m;sy get suffered.
Mercwy governs greens, agriculture. One d the native's younger
brother/sister may not fi nd happiness during their of fife.
Male native: At ages of 18 and 36 there wil be litigational aspects
and prior to such ages there wll be involvements In opposite sex. same
for female charts also.
Mercll'y r. Virgo who ts with Moon and Oragon:r:,u, where mk'ld Is
Moon and Dragon-Tail, the wireless, thoughts/c&a.irvoyarce are
of SUCh n3ti...e. Su::h native can gather kn:>wtedge with less efforts will
have poetic knowledge, literature, news/communication etc. In
Sanskrit versions It Is said "6udc:lll kafmanusartnf' - l.ey to say, even
their rild will be wortc.ing accordingly to meet the above ql.l&lil)es.
Intellect and intuitional powers are extremely important, because,
361
a tind can be more useful than a man with eye-sigtt, besides he
could be more pcwmful too.
Mert'-"Y and hiS attachment with worldly alt'airS just s.,mtxllic.
Even sclentlflcaly, If a man holds some mercli'V his palm, Mercury
does l'Qt stick, but it will be working rnen:Lric. Also, Mercury alth:)ugh a
male planet, when is a female ptantt and ptople of Single f'.1ercury
cannot a'IIOid Involvement with opposite sex affair's. It Is like tlis. If a
woman wears saree, then it called a saree. tr a man wears Dhoti, then
Dhoti resembling a saree can be use either as Dhoti or a
(depending on the
Also it can b! noted here that t hree planets, who are gentrally
considered as male planet are also female planets.
1) Mercury (al ready discussed above)
2) Moon - Male (for ladles), female (for men)
3) Dragon-lOll - The projection part <:1 genital organ of man and fO<
female the Clitoris (the vaginal portion d woman is divided in the
form of a line, the clitoris Of from t he next of cervix) and this
di\tding portion indicating Or3gon Thil.
Also, Merrury i s the governing planet of Hoty Watt:r {pertaining to
Lord Maha ViShnu, in Sanskrit called "'VlSIHIJ Thi rthb"' and it indiCates tht
nattve was born In plaooo where there was Holy Fond/Holy water/Holy
River, pertU'Iing to the con:::ept c;l Lord Maha Vishlu (because r-1erauy
is tht entwined embodim<t concept d Lord Maha VisMu as ci:Scussed
In previous paragraphs).
Regarding health: Such native must take regarding problems
pertainil"9 to Tonsils and growth c;l flesh in nose !XIrtion (which
may some minor surgic.'JI operation - depending upon the
degree).
TM grand of the native wil be qlite intelliglent, beSides
having charitable nature. Some for nati'Ve's younger sister In her family
life suffers due to accusations and she may not 9f!l a suitable husband.
And one of the of family will be quite intelligent. but
often suffers breaks In efforts.
362
MYS
Mercl.rV is ex:atted with DragonHead and Mars, hence irtelligence,
<:Ner intellect and egoistic Mars inch.ding OragonHead (aggressive)
nature aspects and hence the native's suffering due to
egoism, andadty ett.
One of nat.ive's grand father (maternal side) will have nghtiRJI
quarreling nature: due to aggressiveness and one of 1'\btive's brother,
eitho friend or vehicles suWe<s ln)Jries.
Common (male and female natives) - Involves In l ove affairs,
leading to some problems.
Mercury In Vlf90 and there are friendly planets of Venus and
Dragon-Head. Native speaks sweetl y, quite a sociabl e type can
convenientty trap opposite sex for his gains, enjoys extra marital affairs
(besides wife) and atso the grandfather also having secret female
relati ons and the grand f-ather wil be wealthy, wil possess landed
property.
Native's wife qui te and intel igent, one having relation with
opposite sex, and one of native's maternal uncle (for both and
female chart) Invol ves In l ow cfass love affairs (here Venus Is
debil itated).
363
NotNe enjwslarded property Mert"V island, Verus (tl>e ....,bolic
re:prtstntatiVf:S of wealt h, in sanSkri t caned Gruha L.akshmi") and
native enjoys/owns mul tistory properties (aUeast a two-st oried
building), here 0'"9Qn-Heod (indicating storied builclng).
Jupiter and Mercury is in Virgo, fl>terQ.Jry i s exalted, indicating
special intelligenc:e. Jupiter, the gt*:le in Sanskrit called aspect d "VIdya
Guru*.
Here, the peOJliaiity ts that a Master/Guru need not WOtry about
marri(t9e at all, because either he or she will have affection and
adjustments (between Master and pertaining to above chart.
The native will be pdite, pious, attr.lctive and sociable.
MN
....
.. ,
Mercury and saturn In Virgo, who are friends. Native Is an
intellectual one. idealistic, Interested In pursuits besides
commercial field also.
One of younger brother/sister, alth:>ugh can be WlteUectual but will
be lazy lethar9c, stow in eclJcational aspects.
364
Exalted MerOJry is with Moon and Jupiter, Merc...-y i s the son of
Jupitttr (in sense) and this combination denotes a sei:ret affairS
regarding the native's birth. In the nat lve's house there lies some
secret hi story. ( Re9(1rding t he birth of Budha and according to
Mythobgk:al reasons in Indian verSiOns it is so.)
Although the native iS havi"'g i"tellt, bl( beCause of Moon, tht
Intel lect Is covered by Moon (OJnnlngness). The native Is a good
hearted person by nature, but he has to pose like a guide (because d
Jupiter and anyhOw the status-quo of cooningness iS thl!re.
For native he comes aaoss a female (a friend) who could be a
teacher or involving in mlical profesSiOn.
For chart al so the abOve indiCations r<mlains
There will be wide traveling aspects. The native enjoys social status.
MYlO
-
Hell'$ is in the h:>use d Mercury. Mercvry is in the house of mars.
On account of interchange wi th MarS who goes to hi s own house
then Merrury gets exallatlon status.
Mal4!; native: Fa-stly, he will have some opposite sex relations, but
later on he camot rncmy that girl, but marries some other girl.
365
Female chart: for her, a boy wil be fixed up for marriage, but fails
and marries another boy.
MYH
.....
DT
Hercll'y Is In Ubra w1lh his enemy Dragon-Tail and this .-,cleating
Merc\1')' loses his strength. but he is retro in ttlis chart, indicating dle
native of thiS Chart was undtr control with an opposite sex and when
she hetsetf the native can see some bright light and also
the female who abandons also enjoys great prosperity after she
abandons tM native (i.e. duMg the period he was undtr the oontrol
he will be a dlilard). The native durtng lritlal stages of lite will some
sufferin9S Q.le to starrmering prol:'ems, besides auric problems in ear
hearing etc.) which require attention.
The native win ha>Je knowledge in law. One of the maternal uncles
of the native suffers due to disputes, restlessness, unhappiness in
family life.
The nattve will have to encoumer with some disputable aspects,
pertainlrg to landed property bJt later on the property gets clsposed.
M'fU
Herary in Sagittarius, Jupiter in Virgo, But MerOJry is exalted -
how?
Jupiter iS in the house of Mercury. f'.1erctsy is in the hOuse of
)Jplter. According to lrterchange Mercury comes to his own house due
366
to interthan9t MertlrY comes to his own house due to interchange
with Jupiter. is the nati ve, Mero.Jry rs intdt and hen::e it iS an
Indication that the native will have to go to dstant plares for galr8ng
knowledge and Silgittarius is the sign c;l Teacher, where
Ml:!rcuy goes to that partia.Jiar house for gaining
The native is highly k:oowledgeably and the native will have 13ndtd
property In two places. The nattYe during the ages d 39-'10 or 50-51
in\Oives in a female affairs.
The natNe is a good clever one.
Sa tum Is In Virgo, Motrury In Aqua.-.s, In 11\ls chart Mertwy not
exalted, but though the interchange with friend saturn, he comes to
VirgO. MerOJry indieati"lg business(tr'tellect, where SM11n is the Karma.
The natlve will have beneficial aspects In traveling, by changk'og places.
Let us di SOJSs how t-1ercury becomes debilitated ?
Jupiter in Virgo, Mercury in Pi sces. l n this chart MerOJry is
debilitated according to position of planets. But they are having
exchange ot their positions. When MerOJry comes In his own house
(Virgo) due to Interchange wi th Jupiter then Mercury becomes
exalted. Therefore it need not be considered as debi itation of ,.1ercury
and t he native, although in material aspects rn11y look a bit but his
3ffl
and prosperity during his so,jot.l'n cllife are tremen<bus
and by he can daim a greater deglt'!e of importarn and this
Is because of dlred aspect betweerl Mercexy and Jupiter who are In 7?11
sign to ottler. Therefore he can att"'d the public. because of his
knowledge too. Anyhow, the: nl!ltive w;a have to go to diSUtrt places
for galnng knowlEdge (ba...,l<lg
MYl5
Mercury is in Pisces with his friends Dragon-Head and exalted
Verus. Merrury Is really debilitated In Pisces bt.t because ol his two
friends combination debilitation rec:t.Jres to some extert.
The nattve Is quite an W'ltelllgert one and although boks on the
surfaoe, a bit dul, Inside he qute lntelli9ent and he can rise to arry
occasion. He enjoys wealthy aspects, having attractions. live in
a two-storied house and will have e.xtra marital affairs.
One of the sisters of the: native suffers due to difficulties,
unhappiness in her family life.
In the previous cNrt f'.1erouy was with VM.Js and Dragon-Head.
In tNs chart Sah.rn Is also .,duded and the native can eam a lot
in business dealings, besides storing money and also having enjoyments
through variOus means.
368
-
MerOJry is debilit21ted in Pisces. Lord of is in Genwtl with
Satum and Dragon-Head. As it Is. Mercury Is debilitated, but by
interchange ,.1ercury gains mudl support by association with dose
frieOOs S8tum and Or3gon Head. native durW'Ig tM initi ZII st21ges
cannot show his Intellectual abilities, Won subseqJent sojourn d IWfe.,
while coming acrOS5 a Guru (a learned Master), pick$ up his inteltec;.1Ual
abiity for furtMr prosperity and gakls. EnjOys good profitabili ty in
business affairs, beoomes a tyooon, quite a knowledgeable one, and
eams a lot.
The native has to come across a female attraction near a sea sore
or bank d ri'oler {Pi sces is the sign d water).
N.B.: If Moon is at:so in Pisces, the native has to meet an
oppoSite sex near a seaShore or bankS of river a in any water bOund
areas.
Mercury is debilitated, Jupit<!f' i s exal ted, satum is in Scorpio
(ao:on:Urq to directional aspect) there are t-1ercury + l.Jplter + Satum.
In tti:s connection Mercuy cbes not klse his strength but he will have
more than strength (bc:Cording to trin111 aspects).
389
The native is an educate done, enjoys good status in professional
f.eld. One of the young brothers of the llbtive will be quite a
knowledgeable pe!$on, who enjoys good status .
....
''"
MY l9
..,..,
or
Mercury in Pisces, Jupiter and Dragon Tail in Cancer, Mars i n
SCorpio. ln this conntc.tiOn Dragon-Tal and l\1ars are in trinal aspects.
Hence, t-1errury will have to overcome major (two) Inimical planets
OragonTail and Mars and hence it is an indication that the native's
intellect cannot wotk tvtn though Jupiter iS e.x.Mted In the same north
direction. Because Jupiter Is Retro motion, the native's knowledge
and intellect goes down. Anyh.Jw, at some time, during his sojoum d
life, while coming across a Guru (a teamed Mast), tht and
prospetlty ci the native romes to surfare.
One the vounger brother/sister of the native enjoys hawlness,
but sometimes some litigation awears on the surface, but due to some
cooperation and influencing fbCtors, pn::bltms gets solved w teacing
to prospetlty ard happiness.
Neat the birth place of the native thel"e wll be an old temple,
pertainil"9 to the l.ord Wrd Sl'liva ancll.ord Vinayaka.
It*' Sun
SotDH
370
Mercury i s debili tated, but he is retro in positi on. When he
becomes rttro he wil have the: rear aspect towards Aq.Jari us, where
Aquarius Is OOC\4liod tr; Satu'n and Dragon-Head. They are close friends
to Mercury and hence t he strength of Mercury does not 90 down
completely.
The a t i v ~ enjoys good profitabil ity in buSiness affairS. one d tht
younger brother/sister of the nath<e v.ill have bad association
........
... OT
Jupiter. Sun and Dragon--Tail with debilitated f\1ercury and hence,
the nat ive, atthough in the Ini tial stages of life may have bad
associations, but subsequent periods of life Improves, changes,
becomes quite a prominent person, besides having some poUtical
inftuences too. At his ages of 35-36 IX 54 (here ages are considered
according to Transit of lJpiter).
Near the birth place of the native, there will be an old temple
(pertaining to the Lord Maha Vishnu) where some OMne radiation still
exiSCS. The native hails from a repLtabte family.
M OT
HertliY is Pisces, v.tJo is wit h Drago..,.. Tail and l'-1oon in Virgo with
OragonHebd. Here., Moon hbs to sulfer resulting in disturbances in
mental racultles/hallucinatlons (Moon is mind) and Metrury Ule planet d
intdlect is urder the control of Dragon-Tail (Ota9:>n Tail is Ule enemy d
Mercuy) so, on one there is desttu:tion of irtellect an:S on the other
side, mind is under the control of Demon. Power (Dragon Head) and
hence mind and Intellect, both fallklg In theW functions. .. As is the
mother, so is the native."
....
DT
MY2l
Moo
-
Mert\IY in Pi sces, Moon and Mars in cancer and Dragon - T&il in
Sc:er,::io. so, Mercury and Mars, both are: debilitated. Those folr planets
are In North aCXJOrdlng to cifectional aspec1S.
Therefore Mercury + Moon + Mars + Dragon-Tall the native's
mental tortures, U'lhapplness, debilitation d Intellect all teadlng to the
native suffer a tragic li fe.
One of the sist:er/ b'other of the native also suffers tragic life.
OT
-
Mercll)' Is exalted, Dragon-Tall In cap-lcorn &. Mars In Tauus. All
three pl anets are in south. So, Mercury + DragonTail + Mars
combWIUOn. Mercury even though Is e.xalted is not helpful to native,
because or obstroctlon/impedlmental aspects.
372
Cliapter 26
Impt of tllarious !NaiJiiatras
f(pfea 6y ?dercury
HASTA (VIRGO)
1. Notable Personality bom on this star :
KUCHELA. Swamy Vivekananda, Mikado (Japan),
Pandit Madan Mohan M31bviy8.
2. Characteristics of bom on this star:
arrogant; habitualy helping & protecting others-; Wl'!althy;
likes of 'f'OOOQ ladies; generosity comparable to that of a
kklg; dewdon to God and learned peo!*; keen Intellect;
upper hand in duels/a19uments; suffers some arncxJnt of sorrow
on of wife; cl.rtih.A sons; strong build; li<.ed by the fair sex;
o:uxageous, good k:loking, dominating.
3. The: following are the adcftional characteristics d natfve bom In
this: star but in :
F'.-st quarter, wtich is called KROORAMSA:
Sirtul in aetials; strong & healthy; benevolent; devotiOO to God;
over-sexed.
Seoond Quarter, whicl> is called MUKTTAMSA:-
Goodnatured; Interest in reading moral literature; famous;
w;tnout enemies.
Ttim Quarter, whkh Is called PANO!TAAMSA:-
Aeasureseeking; bUSiness blade.; nobl! mind.
Fourth Quarter. which is DtW-IAAMSA:
Engaged in professions connected With Govt/King; honoured;
slightly quick tempe'ed.
4. General Indications for one born on this star :

b.
c.
d.

f.
g.
h.
I.
j.
In the first year d birth, fear fran
In the 2!'" year, loss of wealth;
In the Y" year. from enemies and expenses;
In the 4t11 year, loss of wealth;
In the 6"' year. fear of ife;
In the tel" year. fear from enemies;
In the 2r' year, fear from blood disorders & bile complaints;
In the

year. happy company of relatives & auspicious

celebratb1s; diseases on head;
ln the year. fear from enemies/Weapons; upset of
ln the year )fear Of death, which if the native SUIVIves, Of
60
11
) wil enjOy upto so
5. Birth Marks:
Birt:hm.?Jrk resembling a FISH anywhere on bOdy.
6. Pub<rty:
A girl attailing puberty on this day will be blessed with ctildren.
7. For EVERYONE, this day Is good for :
ROOTHU, PUMSAVANA.. m.?Jrriage, earboring, starting educatiOn
for children, reli!jous stvc:ies, oi l bath, wearing reN dothes and
ornamerts, shaving, processions, bll)ltlg cows and quact'upeds, all
agricul bJral operations, buying precious stones, starting medical
treatment, digging wellS/tanks, religious sacrifices, ooronatlon,
meeting important people, all auspic-ious functiOns including erectiOn
<I new houses.
8. Fever/Diseases:
Fever starting on this day will trouble the native for 7 days.
9, ))Lrneys:
Journeys i n an may be Lndertaken aft consuming
sesamum powder.
10. VISHA NADI :
After 21 ghatikas or 8 hours and 24 mi nutes from the
oorrmencemer'l d the star.
CHITRA (VIRGO)
I . -le Personality born on Ill is ""' : UPAJEfVA
2. Characteristics of nati\'le bom on this star:
adored by women; enjoying aU kin:Ss of prosperity; Oersexe<l;
kflowtedge r:l sexology; brlgl"t eyes; large feet; sweet tongued;
irterest in tastefully; larger drcle of friends; good looking;
pleasure seeking; fame.
3. The foll owing are the addtlonal characteristics d native born In
this star but r. :
Flfst quaner, which Is called NRl.PAAMSA:
Forceful personality; restless; auel disposition; tactful; cumrtg.
Seoond Q.Janer, wtlldl Is called NAPUMSAI<AAMSA:
Oewted to austerity; sweet tongued; Interest In medtadon.
n om Quarte; whldlls called ABHAYAAMSA:
Wise, likes wise-men and learned people; famous;
leader of opprossed.
Fourth Quarter :
valorous; clever in cheating.fstealing; courageous; aggessive.
4. Genual Indications for one bOrn on this star :
a. In the st" year. fear from
b. In tht 8"' yt'!ar. fear from quadrupedS;
c. In the 2(Jh year, fear from implet'nt'!nts/weapons;
d. In tht 25
111
yt'!ar, fear from thrones and the like;
e . II the native suvives the abo...e, 1\e wi l enjoy longeVIty upto
so years.
5. Birth MarkS:
A dear mole fishlike mark on the left side.
6. Pub<rty:
A girt attaining puberty on this day will have chil dren and enjoy life.
More sons and less daughters will result.
7. fQt EVERYONE . this day is 9QO<I for :
Enjoyments opposite sex, NAMA KAAANA. ANNA PAASANA.
UPANAYANA, earboring, shaving, marriage, starting Sb.Jdies, oil
bath, wearing new clothes and ornaments, use of oorweyan:::es,
pairting _.ks, Slart>'lg medical obsequies ell:.
8. fev<r/Diseases:
Fever starting on this day will last for 11/15 days.
9. Journeys:
NOT good ror journeys. But after 14 ghatikas (5 hours 36 minutes)
from commencement c;l the star, journeys in Southern & Western
clrectlons may be undertaken alter food) .
10. VISHA NAAOI :
Mer 20 ghatlk.as or 8 hours from the oonmencement of the star.
ARDRA (GEMINI)
1. Notable Personality bom on this star :
Ruc:lra Sharma, President Coolidge (USA), Presidert F. D. Roose\4elt
(USA).
2. Characteristics of natl...e bom on this star:
Religious-minded; knack In sales and purchases (businessman);
P'Oud; and unchari table in actions; mg-atefU; long
life; selfish and shameless but clever.
3. The following are the adcftional characteristics c;l native born in
this star but :
376
F'.-st quarter, which is catted KRUPAAJ.1SA:
Good condu::t; deow!r and happy.
second QJa<mr, wllldl ;s called TASKAAAAHSA:-
Quarrelsome; stealing habit; piping VOic:e:; thirsty.
n-ord Quarter, wllldlls called OOGRAA1SA:-
Untidy in appearance; in the Mbit d gMng b&d M..tce; mldocre
financial status; sinful in deeds; clfficllties.
Fourth QJarter. which iS called llll-IKRlSHTAAMSA:
God-fearing; religious-minded; one who \l"'derstands and picks up
good polrts from othess; pleasing personality.
4. Genetallnclcatfons for one OOrn on this star :-
a. In the month of the year d birth-fear of death
accident;
b. In the 16"' year, fear from rheumatiC pains and
c. In the 2-f"' year. fe3r from poison or snake--bite;
d. In th< 42"' v-. rear from q.Jadrup<d<;
e. In th! 61 year, fear of death;
II native SUNiWS thiS juncture, then he will tnjoy lOngevity
for 70 years.
5. Birth MC!iks:
None.
6. Puberty:
A girt attaining on this day will face a mlltitude c:J trol.bles.
1f puberty occurs In the 3od of 4th quarter of this star. then a
Shanti is prescribed ..
7. For EVERYONE, thiS d&y is good for :
Exchanges with enemy; undertakings connected with fire.
and weapons; charting hymns; performing obseqt-'es;
establiShing tempt.! ol LOrd Shiva; starting educatiOn or studieS; all
works connected with machinery.
377
8. Fev/Diseases:
Ir fever starts on thiS day, there will be fear of death or there will
be relief 3 months. If the presalbed Shant! Is perlormed,
there will be relief after one month.
9. Journeys:
TNs Is NOT good for Bot journeys maybe undertaken
after 14 ghatikas or 5 hours and 36 minutes from the
commencement d tNs star and after consuming sesanu,m powder.
10. VISHA NAAOI :
After 21 ghatikas or 8 hours and 24 minutes from the
d the: star.
PUNARVASU (GEMINI)
1. Notable Personality bom on this star :
Surabhl, President Theodore Roosevelt (USA) (3) General U.S.
Grant.
2. Char3Cteristics of natiYe bom on this star:
Taste for sweet dish; truthful; gentlemanly; enthusiastic; generous
to the extent of comforts; strong and weatthy;
tuxnorous; pi ping lo(liee or talking k1 low wiSe; thirsty.
3. The following are the adcftlonal characteristics d nattve born In
this star but in :
r.-st quarter, wlich is called lfTHAMAAMSA:
Devotion to God and learned people; personality a bit repUsive;
reddish at times, auel mentality.
Seoond Quarter, whid> is tolled BHOGYAAMSA:
Stylishty dressedup; liking for ornamerts; Interest in sweet cfshes;
wealthy.
TI'Ood Quarter; wi'Och called SOUMYAAMSA:
Learned; a bit oversexed; posseSSing health yet
long lived; miserly.
378
Fourth Quarter, which is called OHANAAMSA:
Lustrous; liked by all; riCh; fame; high poSiliOn professiOnally.
4. General Indica1fons for one born on this star :
a. 10 days after birth but before 3 years or age, troubles;
b. Mer 3 years of age., stomach troubles;
c. In the year, fear from enemy;
d. In the year, b'Ot.bles to mother feat of death;
e. In the 16
111
many miserie:s and ditriOJttie:s;
f . In the 25'
11
' year, fear from polso,Ysnakes
g. In the 43'
6
year, trouble from quadrupeds;
h. In the 52..., year, death of son;
1. In lhe 811" year. trolbles rrom thorns;
j . On the day after New Moon/Flll Moon, Surday, after 4
ghatikas after sunrise, death due to smallpox. If this jmcture
Is seen through, then longevity upto 96 years.
S. Birth Marks:
None.
6. Puberty:
A girl attafning puberty on this day will tum olt to be a bad character,
at the same time wasting money.
7. For EVERYONE, this day Is good for :
PUMSAVANA, NAMA KARANA, SEEMANTHA, ANNA PRASANA,
KARNA VEDA.. CHOULA, UPANAYANA, Shaving, furriShing bed room,
occupying houses, journeys and other auspicious furctions Including
marriage.
8. Fever/Diseases:
Fever starting on this da:y will troublt! the native for 7 days.
9. Journeys:
Good fOr journeys provided journey is commernd after bath.
379
10. VISHA NAADI :
After 30 ghatikas or 12 hourS from the: d the
star.
TRANSIT EFFECT
MEROJRY
1. When MERO.IRY in transit passes ttvough Moon sign i n birth chart
- Unsteady mentally; bitterness in househ::lld, untimety meals,
company d oodesirables; knotty problems to sotve.
2. MERCURY BUSiness gains; gain of ornaments; enj::lyments;
90od health; gentlemanly company.
3. MERQJRY in 3"' - I.OS$es; fear; enmities with distal"( relatives;
mentally indeci!SM!; troubles from enemies; Incurring displeasu-e d
bosses.
4. HEROJRY in - Happiness with mother maternal relations;
happiness general y; financial & agricul tural gains; success in
endeavors; defeat of enenies.
s. HERQJRYin stn- Upset of health&: pain all over boctv; bile disorder$;
abrupt quarrels; want d finance.
6. MEROJRY 6
111
- Gain of new clothes, money and cereals; courage
cl oorwidiOn; studies In general & pardOJ1arly study of novels;
academic and other ent:ertainmerts; ornaments.
7. HERQJRY in Jlh- UJ lla:k; financial k:lsses; ino.mi"9 displeasure d
bosses or s..,.:>ertors; llltk:IY appearance on the part of native; general
il health; weakness; financial gains occasionally.
8. MEROJRY in g.-11- 111 health; sorrow; restriC.ted diet; lllQ@nUemal'ty
actions; success in desired directions oa::asionalty.
9. MERQJRY in gth - Loss d int::ertive; diSreSpect; doing bad to otherS;
losses; having to take ill oooked or food; bile complaints.
10. MERQJRY in 10th - Unwarranted blame being tt.own on naive;
family worries; delays; happiness now Md Ulen.
380
11. MERCURY in 11 .. - Good health; monetary gains; happiness;
compMYy of retativg; reputation; contentment
12. MEROJRY In 12'" - Upset of health; mental WOrries; unexpected
adverse happenings; want of happiness in the matter of food;
(Jiarrels everywhere; want of I'Vlance; various troubles.
Favorable Signs ...... 2 4 6 8 10 II
Corresponclng 1/l:OHA slg\s
s 3 9
I
8
12
When MERQJRY goes through 2. 4, 6, 8, 10, II from moon slgn,
the respective auspicious results quoted above will materialize, provided
no planet transits the cOrTesponding Vedha sq-. at that point of time.
On 11\e other hand, some say that W Moon the Veclla sign ""<n
Mercury is passing through 2rd etc., the benefidal results will then
materialize wittut rail.
Cliapter 27
(}Jutflia (:Mercury )
:Malia CDasa q>fia{a
SEVENTEEN YEARS
1. During the Maha Dasa of BUOHA. there will be gain of wealth,
cereals and prosperity Wl the beginning; honour by king during th!
middle cl the Maha Dasa; owosiUon from own peq>te in the last
one-t.,..d portion of the f-1aha oasa.
2. The folowing a<e the effects of BUDHA MAHA llASA with referenoe
to wrlous Yogas or OCOJpatlon of signS/houses.
a) Budl\a with Positional Strength Reputation; professional
elevation; courage; great enthusiasm; in YAGNA;good
deeds.
b) Buctla devoid d Positional strength. Great fear to wife and
son; foreign travets; 3fround troubl!s; defeats in several
d lrectlons.
c) Bu<lla with directional strength. Gain of wealth from va<lous
dirtioos; friendship with noble-men and king. use
of seem and cosmetics.
d) Bu<lla with Kala Ba&a. Bodily comforts; prosperity to wife and
children; bath In Ganges or pilgrimage.
e) Budha with Naisarglka veerya. Good and c-haritable deeds;
academk:al debates; opposition by own people; separation
from mother or fear d death for native.
f) Bu<lla with Vakratwa (retro!l'ade). Good kid< In tf1e matter
of wealth, wife, chikt"en, finance; enj:)'ying Hari K.atha or hearing
mythological texts; cha<lty; Initiation In sea bath or
382
pil grimage.
g) Budha wilh Nalsa<ga BIJia.Al peacewilhalandsundoy; enjo)lng
jokes with and oompany d women; professional elevation d
high order.
h) Budha In KROOI\A SHASHTIAMSA. (great
fear). l f Maha Das3 Natha BUOHA is wit holt a good aspect or
yoga - losses from thieves, fear from rwe and king will result
i) Bu<lla in MRJOWAr-1SA SHASHllAMSA.
or high order; doing good to every one; ga;n or agricultu'al
procl.tte and wealth; birth of son.
j) Bu<lla in VAISHESHlKAMSA. Honour and respect from high
and tow and everywhere; seem, oosmedcs, garlands and other
academical deb!ltes; acquiring deep knowtedge
in certain branches.
k) Budhaln KROOI\A OREKKANA fear from fire. thle\'es and king;
loss or pos;tlon; MAHAT BHAYAM (great fear).
I) Bu<lla in ATYUTCHA (eldreme exaltation). OESA AOlPAlYAM
(t.ordsl'ip of CX>Jrtoy or highest I>Qfesoional elevation); Gain
of conveyance and having a nurrber of setVants under him;
academical gain d precious stones; increased
househok:l and landed properties; agrloJitural income.
m) Bu<lla In Exattatlon. lrw::rease of wealth; heating scriptures,
Gita, Purana etc.; enjoying fun; help(tJ attitude to relatives; A
great drde of a<:quaircances and friends.
n) Buclla in debilitation. Foolish behaviour on the part of native;
lncuning displeasure of relatiVes; loss of position; oppos1tk>n
by brethren; foreign t ravels; mfntally a state of affairs
due to stay In klnely plaoes or foreS1S.
o) Budha In Parama Neecha (extreme debilitation). Loss of
positi on; f inandal losses; alrot.nd troubles; opposition from
relatives; sufferings to family members; mental unrest and
poverty.
p) Budha conjunct with an exal ted pl anet Great happiness;
wealth of the goes on increasing comparable to that d
waxing moon; business gains and inaeased monetary Income;
knowl edge of God.
q) Buclla conjooct with a debilitl!lted planet Great ciStress; loss
383
of position; loss of relatives ard loss of profession; mental
unrest.
r) Budha with Exalted Navamsa. Birth of sons and gain of
ornaments; mentaly a happy state d affairs; pleasures of
association with women; enthusiasm; valour; bath in sacred
waters.
s) Bu<lla with debilitated Navamsa. Hand to mouth livi1"19 by any
means; adopdng (J.Iestionable means; being J)Ut to shame.
t) Bu<lla In e.l01tation but with debilitated Navamsa. Professional
elevation, great fame, and hapPness but loss of these
abrupUy.
u) Bu<lla In debilitation but with exalted Navam.sa. Inauspicious
results in the beginning of the Maha Dasa but auspicious results,
happiness and prosperity in the end d the Maha Oasa.
v) Bu<lla In TRIKONA. Gain ci weallll; birth of son; lui
comforts as a householder; of landed and
househok:l properties; agricult11al income; BAHU BHCX>SHANA
RATNA IABHA (He""V gain of predous stones and ornaments).
w) Bu<lla In own sign. Great happiness; Affection and 00"1'01\Y
of brothers; Workshop of LORD VISHNU and Brahmins;
happiness from King.
x) Bu<lla In an lrtlmate friend's Acxlualntance wiltl king;
prosperity and happiness to wife and children; Increase Inland
holding, cereals and weatth; fame; AOHJKAAA LASHA (gain ($
authority).
y) Budha In frierd's house. Increase of agrlcultwal
financial gains; busin!SS gains; gain of q.Jbdrupeds, dothesand
predous stones.
z) Bu<lla In an house. Little happiness; little gains; even
health net vef"( satisfactory and some tnn.bles.
aa) Budha in enemy's house. An KASHTAM (great troubles);
wpaiition by own people; devoid of mental peace;
bb) Budha in bittef' enemy's house. Forsaking famity rustoms
and religious rites, In other words, getting .,religious, great
troubles; mental agony; fear f rom king; opposiUon by
close relatM!s; fear from ki'lg; loss of position aM cattle.
cc) Bu<lha In quadrants (Kendra) Incre.ase of refatlves;
384
happiness due to birth of son; making charities tNefV
day.
dd) Budha in Dushsthana (6,8,12) . Conf'iscation d native's
property or severe losses; loss of position and loss of
equals.
ee) Budha in benefic signs. Great fame; en)o'(ments of many
kinds, hono\r by kind withot.t fail; lustrous body; valour
and fa.ne.
ff) Bodha In malerte signs. Loss of conveyance; opposition
by relatives; ttOUbles to equals.
gg) Budha conjunct benefiC. Great happiness; prosperity;
happiness from wife and children; oompany of relatives;
happiness at home.
hh) Budha conjunct matetlc. loss of agricultural produce;
opposition by brethren; foreign ba""ls; loss or position;
COR1)any d women or questionable character; quarrels
and t.rinary disorders.
i) Bodh<l with 9-Jbho Orishli. MAKATI>lCHA KJRTI I (greot
reputation); respect from king as a result of academical
achk!vements d the n a t ~ ; beauty; splendor and powtr.
jj) Budha with maltfic aspt. Separatiocl from relativeS; kiSs
of agricultural produce; foreign travel; change of
environments; servitude; quarrels re:suttfng In troubles to
native.
kk) BUOHA MAHA DASA PHALA, will be os follows, if BUOHA
is conjunct or aspected by other planets as Indicated
below :
SURYA
i) Budha inMOUdya. VMDHAPADAM MA.NO OUKHAM varl01.5
troubles and mental unrest); enemlty with king and
relatives; eye or ear diseases; financial losses and blurred
intelligence.
ii) Budha conjunct or aspected by Surya. Death ex troubles to
mother.
38$
CHANDRA
Bodha conjtl"'c.t or aspected by Chandra. U1.11e happiness
and littte gains.
K\JJA
Conjunct or a:spected by KUJA Ois4!1a:Se5 arising ttrough
woundS/ulcers.
GURU
Conjunct or aspected b'f Guru. Birth of son; quarrels or
litigation over landM property; gain of various things and
prosperity and toss of same before the end d the Maoha
oasa.
SUKRA
Budha conjunct or aspected by Suk:ra Diseases to W'ife.
SAHI
Conjunct or aspected by 5anl. Grief; loss of relati'ves;
quarrds and misunderstandings.
RAHU/KETU
Budha conjunct Rahu/ Ketu. ANJSHTA PHALA PRAOHA
effects)
GUUKA(or MANDl)
Thefi; mental upsets; fOtgetfooess (derangement <:1 brain
in extrb:ne: cases); sldn diseases; troubk!S from blemies.
I) BUOHA MAHA OASA PHALA according to VARAHA
MIHIRA:
Monetary gains from various sources lndudlng through
(10 Brahmins or people (ii) OOOTHA KARMA
{messengership); being praised by Pandits and leamed
people; celebrity; gain <:1 gold, horses, land, happiness
prosperity; cleverness in witty talk and in business or
profession; growthoflntelli9enoe; charitable deeds; vulgar
talk; bfing fettered; mental agony;
due to upset or Pitha, llatha and Slestrna.
mm)Generaly in a favourable BUOHA MA.HA DASA, there will
be feasUng in honour; respect from cultured people;
388
blessings from preceptor; diplomacy in talk; eagerness to
help others; PATIABHISHEKHA (Coronation for kings -
for ordnary folk. prdessional elevation); contentment
on the part d wife and children due to good actions d
ac:tlievements; wealth. These benefits and auspicious
effects will occur accordi'lg to strength aoo benefic
nab.Jre of t-1ERCURY.
nn) Budha i n AROHA (proceeding;, tow<1rds exaltation)
Professional elevation; gain of a house.
oo) Bodh.a: in Avaroha (proceeding towards debitital)on)
KASTHA PHALA PAAOHA (MalefO< res>Jits); loss of posi tion
and quatrels and misunderstanding with relatives. These
without doubt.
3. BUDHA f\1AHA DASA PHALA iS as follows, according to tM Sign
occupied in birth chart :
MESHA Gain of land; honOtX by relati...es; acquisition of precious
stones and ornaments; happiness from wife son and
caste-fellows..
VRl SHABHA C011'1>any of actors; enjoying songs, jokes etc. gain
of kl"()wfeclge; wieldlrg authority.
HITHUNA pl easures of l ear ning; prof essi onal elevati on
comparable to that of a commander of an Army;
interest in music and songs; enjoving humour and
witty talk; family life as a householder; fame;
gain of land and agricultlxal produce.
kARKAT Enemi ty with relatives; loss of lustre; company of
Brahmins and learned people; 1055 of position and k:ts5
of authOrity.
SlMHA LordShip of a town or e(!Uivak!nt prOfessiOnal elevation;
roaming in f orests anti forts; from a
hlgtty placed person.
kANYA Comforts; f ame; R.AJYA LABHA ( professional
elevation); gain of costly cl othes and ornaments;
prosperity to wife and chikten and blood relations.
TULA Gain of conveyance; ac:qualnt:anre with king; house
decorated with pairtings; contacts with a woman of
VAJSHYA communi ty.
381
VRISCH lKA Troubles; opposition from blood relations; l oss of land
aM possibly a
OHANUS Happiness; defeat of enemies in encounters;
professional elevation; prosperity 10 master, gain of
gold and clothes; frequent gain ot money; talks and
regardng and knowledge.
MAKARA Success in undertaki ngs; company of brethren;
happiness due to academical achlevetl"ents; valour In
honour inau<fences; company of friends.
KUMBHA Gain of servants and conveyance; gain of large
quantllles of clothing and gold; enjoying tlgh class
food; musie-minded.
MEENA disJ:Ieasi.R of own peoJ*, sufferings to or l a5s of
wife. and dlildren; loss of position; troubSes of a serious
nature,
BUDHA MAliA OASA PHALA Is as foiiONS, according to the Bhava
occupi<d by BUOHA in bi"" Chart.
t.agna Good health; increase: of fame; good and witty taj(;
various gains; acquisition of academical de17ees;
honour by king.
Gain of wealth; IOOki"'g 21fter family affairs; diplOmatiC
talk; alround politeness-; freedom from debts.
Yd Bhava Knowledge of musi c; acquisiti on of or naments;
marriage d brothers; In encounters; honour
by king.
4th Bhava Additions in relative's family, increased agriOJltural
gain d well decorated house; respect in audiences
compriSklg of and actorS.
sth Bhava Additions to family; increased wealth and knowledge;
success In MANTRA OIKSJiA, acquaintance with king;
plgrimage; gain d costly clothes and ornaments;
6th Bhava Various diseases, Increase In the circle of enemies;
sufferings to rel atives; (Jiarrels, anger d king, toss of
position.
Bhava Happiness; a series d auspicious happenings; helpftJ
attitude to relatMs; APOORVA PRIYA OARSANAM
(.seeil"9 something never before seen).
8'
11
Bhava LOss of tC!U-*; great distress; loss d position; b'Olbles
from thiews, fire and enemies.
'1
11
Bhava Religious-minded ness; knowledge; oompanyofleamed
people; charitable Inclinations; appreclatlon of
properties, oorweyance and paraphernalia; increase
of powers wielded bv the well being r:J wife
and children; politK;al stabJs ror naUie'sfather.
10111- Bhava KEERTI VARDHANAN Reputation Increases); Gain of
wealth on a large scale; abundance of cereals at home.
Bhava BAHU LABHAM (great gains); appreciation or
properties; increase in powers wielded by ltle native;
increased ag-icUtural gains.
12th Bhava Having to reside in U'lhealthy places; l oss of relatives;
suffering l055e5 in the matter of p-operty and cattle;
various troubles and having to live In foreign place.
BUKTI PHAlAS IN BUDHA MAHA DASA
BUDiiA BUKTl = 28 monl!ls 27 days.
(a) The following are the Bukti phalas r:1 BtJOHA BUKTI in BtJOHA
fo\1\HA OASA, wtth reference to various Yogas.
I) liBukti natha Budha In Kendra; trikona, 3 or 11., from Lagna
or in exalt!ltiOn :
l'o12uriage: of rel atives and auspiciOus funCtions; gain d money
ttrough saAes; Gain of money from overseas; gain d vaus
kinds of precious stones. Increase In powers wielded by the
native and gain or decorated house; gain dknowtedge; listening
of Harl Kal!la or salprural tead11ngs; dally charities of rood;
oompany d relati...es; happiness from wife and birth of a son.
i) II b..._t i natNI Bucl\b in DUShsthana from Lagna, debilitatiOI\
conjunct malefic or KlOA :
Troubles to wife and d'lildren and other relatives; mental
worries; faih.res in unc:IMalcings; grief; having to reside outside
his house; King'S anger; irreligious p-act ices; company of women
In menses; unUmety meals.
(b) The following are the SPEOAL EFFECTS, in addition to those
mentioned If natha BUDHA IS oonjunct or suspected
389
by:
SURYA Command of a fort or equivalent professional
prosperity to paternal relations; satisfaction
of king without doubt
CHANDRA Happiness with wife and birth of son; acquire costty
abundance of cereals at home.
KUJA lncrease of enemies in battle; with distant
relatives; reverses in
GURU Birth cl son without doubt; meeting highly placed
persons or preceptor; seeing something
unprec::edented.
SUKRA AcqLisition of colourful <tess and conveyance;
of authority or lnaease In powers wielded by native.
SAN! Anger ri king; degradation to the extMt ri being
in..,risoned; bitttrness with rt&Mi\lts.
(c) If buktl natha BUDHA iS of or posittd in ?Ill or 7'" from Lagna:
Fear of diseases for native or his wife or blood
relations. The shanty for warding off this Dasa phala is VISHNU
SAHASRAXA and LAXMI NARAYAN (golden Image) DAN,
the native wll enj:)y prQGPerity.
KETU BUKTI = 11 months& 27 clays
(a) Tile foUowif'9 are the effects of KETU BUKTI in BUDHA MAHA
OASA with refertnce to variOus Yogas :
i) II buktl natha KETU is in Kendnt, trik.ona. 3, 6 or 11\tl from
L.agna in t)aftatlon :
Defeat of enenies In OOttlefield; increase of reputation and
status; oostly presents from king; Increase ct conveyances
and BHAGINJ VAMSA VRIDHI (add lions i1: Sister's
ramly); acquisition or cereals; gain of money tiYough women;
see:ing something Guru or
preceptor, success in desired directions;
i) If bukti natha KETU is in Oushsthana in debilitation or
debilitated Navamsa, conjunct malefic or lrimlcal planet:
CHANOALA KAL.AHAM (quarrels with Chandala CK low caste
390
peope'); financial losses or wastefiA expenses due to
foolishness; big fear; service under unclestable masters; quarrels
with nephews and distant relatives; l oss of cattle and
agricuttural produc:e; c:hange., profession or tnlnsfer or change:
of environments; obstacles to undertakings; sufferings to

(b) The following are the SPEOAI. EFFECTS, In addition to those
mentioned atxwe, rr buk.ti nathb KETU is conjunct or aspttd by:
SURYA Big rear; on head; ui)St'!t of pith& (bile); Fear
from fire, thieves and king.
CHANDRA Mental agony; l oss of money; ur(lmely meals; finandal
losses.
kUlA Sufferings to brothers; fear from weapons, fire, thieves,
and poison and poisonous creatures.
BUDHA Prosperity to relatives; auspicious functions like
marriage at home; success ., ll'ldertaklngs and gain
of money.
GURU Sufferings to children; anger of preceptor; in::lJrring
of fao.ourably-<lispo&ed offiCials; sufferings
to equals..
SUKRA MiSunderstandings with wife and fWlancial
losses and loss d conveyance.
SANI Sufferings to wife and ctlitdren; Sllfering losses in the
matter of household and landed property; agricultural
losses.
(c) lf buktl natha KEl\J is In Kendra trlkona, 3 or U
1
"' or 6t
11
from Maha
Oasa Natfla, BUOHA, conj un::t benefic:
Finarcial gains; gain d particularty horses; happiness
from wife and eornpanyof relatMlS; academical gains and rej:)UtatiOn;
success in undertakirgs.
(d) Ir b'*ti natha, KETU, i s or li" from Maha oasa Natha, BUDHA
Ol oonjunct malefic:
ATI (Great MAANA BHANGAM (being put to
shame); loss of reputation; sufferings to equals; Sllferings to
and (fJarrels with relatives; SAMASTHI\ VASTHU NASAM (loss d
everyth;ng) and loss of quadrupeds.
(e) If b!J<.tl natha KETU is in 2"" or Jt"' from Lagna:
Finarcial lo5ses, bodily troubles and fear of death. The shanty for
warding off this Dosh Phal a iS eitMr(i) MAHISHA DAN or(ii) OURGA
JAPA and CHHAGA DAN (polclen Image of after wlllch the
native will enjoy good healltl and success In lndertaklngs.
SUKRA BUKII = 34 months
(a) The following are the effects of SUKRA 8UKT1 in BUDHA MAHA
OASA with reference to various Yogas :
(i) If bukti n.atha SUKR.A is in Kendra, 3 or 11
1
t. from
Lagna 01 in exaltation :
Auspldous functions llkemaniage and P"llj)hemalla; 1'\JAA
NAYAKATWAM (assuming the position d head or town or
PresldMt of Mgaglng servants; aoqulsltlon of
conveyance; increase in powers wielded by the nati ve;
happiness through the help or fa\'Qurably disposed offiCiats;
additions to family; happiness with wlfe; GRIHA LABHAM
VI CHfTRAKAM (gain or a decorated house); VIOIITRA
VASTAA LA8HA (gain of cosUy and colourful dress); aoqlislllon
of ornaments, predoL6 stones and cereal s-; res-pect and hooour
on fridays from Wng and belov<d relaU..,,
(II) U bukU natha SUkAAisln Oushsthana fromlagna or In neecha:
failures In undertakings; brooding CM!t a<MYsitles; bitterness
with relatives; sufferlng.s to children aM separation from w1fe
ten"C)orarity; ino-eased borrowings; loss d finance.
(b) the following are the SPECIAL EFFECTS, i n addition to t hose
mentioned abOe, If bukti natha SUKR.A is conjunct or aspec.ted
by:
SURYA Anger d king; lOSS of weal th; failures in ll"'dertakings;
change in en>Aronments.
CHANDRA Mental unrest; sufferings to mother; failure to realize
artlcipated profits; failures In undertakings.
kUJA Quarrds arising due to ladles; bodlty and
troubles to wife; bitterness with a brother.
BUDHA Charitabl e i nclinations; gai n of knowl edge i n
mathematics and laterab.lre;
392
GURU
SAN!
Birth of son; C)WI of money; freedom from diseases;
reputation; success in ll'ldertatUngs.
Misunderstandi ngs and quarrels with brothers;
suffering losses r. the matter of landed and household
properties; financial and <9'i0Jituralloss.es.
(c) l f buldl natha SUKAA. Is In Kendra, tritona, 3 or ut" from Maha
Dasa Natlla, BUDHA, or coo)unct benEfic :
AcQLisition of costty things and ornament5; ligh das5
<tess lndudWlg robes; increased cattle hoking and income;
d marri<lge; help from a favouratf)t disposed master/
employer; daily charities of food to poOl'; helpiU att!tu:!e toward
relations.
(d) l fbuktfnatha SUKAA isfn Oust&hana f rom Dasa natha 6UOHA
or conjunct malefiC or in debilitation :
ill health an:f troubles to wife; sufferings to equats; failure of mission
in travel; re-ceipt d unpleasart news from a dstant plaoe; abrupt
quarrels.
(e) If bukti Nbtha SUKRA iS lOrd d 2rd or "P or conjtl"'c.t with
the lord of these two Bhavas or is staying in or ?' :
Feat of death. The shanty for ward01g o" this Dosh Phala Is DURGA
LAXf.U JAPA and MAHISHA DAN (golden image) according to tM
procedure laid OOwn by YAMILA, after which the native will enjoy
good health and prosperity.
SURYABUKTI = 10 months&6days
(a) The following are the effects of SURYA BUKTI in BUOHA MAliA
OASA 'Hith reference to various Yogas :
(i) If bukti n.atha SURYA is In Kendra, trik.<rla, 3 or 11
1
h from
L&gna or in or own :
Through the gr11c:e of t-181'\araja or highly plaCed per-sonalities,
the native would become an owner of conveyances;
PRACHYAM PRAYANAH (travel Eastern direction); defeat
of enemies; well being of wjfe and children; prosperi ty to
paternal relations; initiation in MANTRA; Workshop of SURYA
and SHIV A; getting oa"""n ol planning pUg""-s;
meetings with and company of Mahatmas and realiZed so\Js;
success in battl es; gain of precious stones; company of
rdatt.es.
(II) U bukU natha SURYA Is aspe<ted by KUlA (Mats) :
of land.
(10) U bukU natha Sl.I\YA Is coojunct lord of Lagna :
Happiness and fflanclal lnoome In the beginning of buktl.
Troubles and news d death dll'ing the middle and end of
bukti.
(iv) If bukti natha SURYA is conjunct or aspec;ted by RAHU or
malellcs:
Woll'\ds on body; grief and ral hses in u ndertaklngs.
(v) II buktl natha SURYA is In Dush.sthana from Lagna or In

Trotb'es from eneiDes all1l05l daity; vari<XJS upsets; financial
losses; fear from enemies; loss d qua<tupeds; death on the
paternal side; expenses dl..l! to hi!fler offiCials; quarrelS with
son; failure In undertakings; being fettered Of restrictions on
nattve's movements; respiratory diseases and upset of pitha
(bile).
(b) The following are the SPEOAL EfFECTS, in addition to those
mentioned abOe, if bukti natha SURYA i s CO"'junct or aspec;.ted
by:
CHANDRA ACXJJ:iSiUon of ornaments and precious stones; costly
dress and ornaments; well being of preceptor and
chldren.
kUJA Gain or precious stones and ornaments and red
colotn!d dress; gain or conveyance.
SUDHA lncome of money from vari ous directions; marriages
amongst company of women of questionable
character.
GURU Birth of children; good health; finandal Income;
collection d various ttin95.
SUKRA lncrease of oonveyance and cattl e; gain of gold
ornaments and mabimonlal ft.u-r:tlons.
394
SAN!
Destruction or k:lss of clothes, con-..eyances aoo cattle;
separntionfrom relati...es and loss of servants and maid
servants.
(c) If bukti natha SURYA Is In Kendra, trii<Dna, 3 or U'" from Maha
oasa Natha or conjunct benefics:
Professional betterment or getting a new profession; ciscussions
and gain of knowledge; hearing Hari Katha/Ramayana; celebrations;
gain d new relations (as a result of marriage etc.); auspicious
celetntions; prosperity to wife and children and increased finandal
Income; daily charities of food to poor and opportunities of contacts
with placed otrocers.
(d) If bukU natha SURYA Is In Dushsthana from Maha Oasa Natha Budha
or conjmct malefic :-
Expenses; mental VIVAHE KALAHAt-10-IAtvA (quarrels in
or cl.lring marriage ceremonies); b'Oubles from ladies and quarrels
with relatives; loss of autl'>rity, tinarv:::e and cattle.
(e) If bukti natha SURYA is in 2ro or "jh or is con;mct another" Marta
Graha:
Feat of deattl. S a shanty, perlonnance of BHASKAAA PRARTHANA
and GO (cow) DAN are prescribed, after which the native will enjoy
good heo fth.
OIANDRA BUKn = 17 months
(a) The folioi<Ong are the effects of CHANDRA BUKTJin BUOHA MAHA
OASA with reference to various Yogas :
(i) If bukti natha CHANDRA is in Kendra, Trikona, 3 or 11th from
L.agna, in exaltation, OINI"' house. Navamsa In own ho....se or
exalted Navamsa, conjooc.t or aspected by Guru or Chandra is
otherwise strong and is nearing FUI t-1oon:
Lordship o...er land or a village; opportooities of using horse as
conveyance; honour and respect from a master; gain of
ornaments and stones; marriage of relatives; increase
In the cirde d friends; prosperity to master{ employer; ircreased
cattle holding; more servants or subordinates; greater
agricuttvral produce; suo::ess In undertakings; gain of articles
from others; prosperity to relatives on equal
(li) II buktl natha CHANDRA is waning or aspected by malefic: or in
inimical sign or in Dushsthana from
t-1ANAS CHANCHALYAM (wavering or mind or indecision); loss
or reputatlon; business losses; troubles from thieves; loss d
finance, cattle and agriclfhsal produce; tittemess with wife
and t roWi es; misunderstandings with m<XIler or matemal
r&tions; quarrels with relatives; failores in U"'dertakJngs in spite
of best efforts; King'S anger.
(b) The follOwing are the SPEOAL EFFECTS, in addition to those
mentioned W bukti natha CHANDRA Is conj"'ct or aspected
by :
SURYA
kUlA
BUDHA
GURU
SUKRA
SAN!
Aimless travels; monetary losses; professionally his
posibon gas shaky.
Auspicious fmctions like marriage; prosperity and well
bertg of near and distant relattves.
Study of Veda and Shastra (or reUglous books);
pilgrimage; buSine-ss gains.
Wort.shop d preceptor; chalttable deeds; initiation in
MANTRA.
Company of women other than wife; gain of
ornamtnrs and monty; success in U"'dertakings.
Quarrels with meni als; loss of money and
reputation.
(c) If b!J<ti natt\!1 CHANDRA iS in Ktnct"a, Trlkona, 3 or 11th from Maha
Dasa Natha or conju net benefic :-
Birth of son; gain d money and oonveyances; acqulsitk>n of gold
ornamerts; success in desired directions; opportunties of service
under h;gh officials; well being or wife and ag'iOJitural
gains; increased charities and wOrShip.
(d) If buktl natha CHANDRA Is In Dusl\sthana rrom Maha Dasa Natha,
BUDHA or conj l.llct :
Quclorrels and mi5'.1"1derstanclings with a of peo'*; ttoltlles
from relatives; mental urnst faih.res everywhere; change of place;
(JJarrets with iCJ\.\1 caste won-en; loss d clothes and having to put
an urtkt( appearance.
396
(e) If btAtti natha OiANDRA is in ?Ill Or 1"' from Lagna; arw:Jtor conjunct
lord of 2n:t or "P' :
OEHA li>!JYNII (bodly troubles); MANO RVJAM (Mental upsets and
worries); CHORA 1\GNI NRUPA 6HEE11<1 (fear from fe. and
t hieves); DU STREE SANGAMAM (contacts with women of
"'estlonable character); APA MRITYU (fear of death).
The shanty for warding off tHs OOSh Phala Is DURGA DEVI
and RAJITHA PRATIMA DAN (silver image of Dt.RGA), after which
the native will enjoy good health.
KUlA BUIO'l = 11 months & 27 days
(a) The following are effec.ts of KUlA BUKTI In BUOHA MAHA 0ASA
with reference to various Yogas :
(i) If bukt.i nad'la KUJA is in Kendra, trikona, 3 or ttlll from Lagna,
In exaltation Or own house or conj-unct brd of Lagna or In
great SWAVAAGA :
Gain of red-colOured clOthes, pearls and ooral s; VICHITRA
GRIHA NIRMANAM (construction of a decx>rated house); 90in
of landed property; favours from royalty; Auspicious
ocwrrences on Tuesdays; help from a favourably disposed
master; of relatives who were staying far away;
appreciatiOn of landed and househ:lld propertieS; birth d son;
success everywhere.
(II) If bukti natha, KUlA Is In Dushsthana from Lagna or In
debilit21UOn, debilitated Nav3mS& or in KROORA OREKKANA :
Loss of wealth, conveyance, agric-ultural produc:e and cattle;
troOOies to wife and quarrels wiltl distant relatives; temporary
separaUon from wife and c:Mdren. PAtTY A BRAMANA ROGADJ
GRAHJNI KSHAYA SAMBHAVAHA (giddiness due to upset of
bile, dysentery, consumption etc.). Bitterness with fav<>Urably
diSposed master-; fan .... e d triSSion in tr.wtl; abrupt quarrelS;
having to resort to borrowings; fall from a height, fear from
Uieves ard polson.
(b) The following are the SPEOAL EFFECTS, In addition to those
mentioned aoove, if bukti natha KUJA is conjur.ct or aspected by:
SURYA Favours and from a ,.1aharaja highly placed
person; success in encoootet"s; inoerea$e in powers
wiek:ted.
397
CHANDRA Enjl)(ing sweet diShes and costly foods; SWA 5rREE
SAYYA 9.JKHA PRAAPTI (enjoyments with own
and pleasure on cot); also oompany d women of
questionable ch&racter.
SUDHA Company of relatives; business gains; success in
undertaki ngs.
GURU Sufferings to children and financial losses;
forgetfUnes:s; developing krellglous habits; lnct..rring
dispteasure d
SUKRA Alx>rtion to vre; diseases blood
disorders to wife.
SANI Quarrels with loss of cattle and servants;
i n..,edments to perfoonance of religious
(c) Irb.Jkti nath8 KUJAi sin Kendra. trlkOna, 3 or

f'o\ahb oasa
Natha or in exaltation or conj.mct beneriC :
Presents from king; gain of conveyance and precious stones;
auSI)ic:lous funatons at home and &e<!Uisitlon of wealth and cereats;
tusiness in own name; reputation; gain of s ilk clothes and apparel,
scents and cosmetics; bath In sacred rivers; prosperity to one's
own master and succtss in undet"takings.
(d) If bukti nathi!l iS in Dushsthana from f\\aha Dasa Natha or in
debilitation or conjunct malefiC :
financial losses; quaels with rdatlves and tro\bles from fire and
polson; boc:hty troubles; Ill health to wife and ch l c:Yen; sufferings to
bekwed relatives; bitterness with equals and distal"( relatives.
(e) If biJcti natha KVJA is in 2f'CI or from t.agna or ld of these two
B""""s ard/or conjunct lord of soid Bhovas :
Feat of death. The shanty for warding df this Dosh Phola Is either
( i) MRITYUNJAYA JAPA and SkANOA POOJA or ( ii) SIVA
SAHASRAXA and GO DAN and SHOO DAN and HIRANYA DAN.
RAHU BUKTI = 30 months& 18days
(a) The followmg are the eWects of RAHU OOKTI In BUOHA MAHA
OASA with reference to the various Yogas :
(i) II bukti natha, RAHU, is in Ken<ta, trikona, 3 or from
Lagna, In exaltation, ecalted Navamsa, tl cancer. Virgo, Leo 0t
398
Thurus, or conj unct or aspected by a btnefic: :
COntacts with king/high oftidats; meeting a new offldat or
master; gain of quadrupeds; pilgrimages; good health; great
happiness; prosperity to the master of t he nati ve; acqt.isldon
of dress and ornaments; success in desired directions.
(ii) If bukt i natha Rahu is in Oushsthana from lagna or i n
debl itation, debilitated Ncwamsa, conjunct or aspected by
malef ic::
Fear from fr e, polson and thieves; misunderstandWlgs with
wife; diseases and fear d deatl'\.
(ii) If bukti natha RAHU is in Ousl'lsthana and at the same time in
cancer, Leo or Aquarius :-
Quarnls In connectlon wtth the status of the native; fear
from enemies and king; defeats in ercOLnts.
(b) The fol lOwing are t he SPEOAL EFFECTS, in additi on to those
mentioned above, rf bukti natha Rahu is conjunct or aspected by :
SURYA Diseases on head; Eye diseases; loss d relatives on
paternal side.
CHANDRA Loss of retatl...es on matemal side; 5\lferings to wife
ard misunderstandings wi th her; quarrels throughout
the b.lkti; financ:.ial tosses ocxurrirg sometimes
withOut tM knowledl)e of natiVe.
KUJA with diStart to
relatives and loss of relatives.
BUDHA lncMging in fooli sh utterances; loss of quadi'\C)eds
and servarts; n:reased borrowings.
GURU SUfferings to or loss of pre<eptor and chil dren; Boclly
mental oorest and financial losses.
SUKRA Company of wife an:l child-en and hawiness; gain d
conveyance and knowledge; auspldous functions and
bkth d son/daughter.
SANI Mental ul'lrt'st; tdlly trolbles; loss of (J.Iactupeds and
servart.s; bodily troubles to wife.
(c) bukti natha Rahu is in Tri b:lna, 3 or ut" or 6ttt from Maha
Dasa Natha, BIJOHA. or oonjooa benefic:-
APOORVA PRIYA DARSANAM (S-eeing SOr'l"ething Or per-son ligtiy
desired and not pre..tousty seen); happiness with wife an:l dlildren;
oorr.,art( of friends; success In all drectlons.
(d) If b\A<tl notha RAHU Is In ff" or 12" f rom Maha Dasa Natha "'
oonjunct malefic:
Bodily troubles; mentaly a confu;ed state d aft'airs; d
wo-nen other than wife; loss of rePVtation; quarTets with !Mdows;
urtimely meals, failres.
(e) If bJkti natha RAHU Is or ff()TI Lagna:
Fear of death. The shanty for wardWlg off this Oosh Is RUORA
SA.HASHAKA and OiHAGA DAN, after vdic.h nati..e will enjoy
prosperity.
GURUBUKTI = 27months&6days
(a) The following are the effects of GURU BtJKTl In BUOHA MAKA
OASA with reference to various Yogas:
(i) If bukti natha GlJRU is in Kendra, triiG::Ina, 3 or 11tn from tagna
Ot In exaltation :-
ISKTA VASTHU SAMPRAAPTI (gain d desired things); ATMA
SANDHU DARSHANAM (me<ting blOOd relaUOn). Increas.d gain
of money ar:1 cereals; falJOlJ"S from ki1"19; Olaritable lrclinations
including ertion of publiC char&s like gardens and resting
places; charities like erection of tEfl1)1es and sacrifidal rites;
Increase In po-. wielded by native and birth cl son;
to wife; gold ornaments like gold buttons, rings etc. for the
native; gain of precious stones, success in encounters; gain c:J
conveyances and initiatiOn in f\1ANTRAS.
(ii) If bukti natha GURU whO iS in Kendra, trikona, 3 or 11
111
from
Lagna ls oonjunct Budha :-
AcQUiril"'9 furniture, conveyances and other artldes which go
to Increase the natiVe's ccmforts.
(li) 11 buktf natha GURU who is In Kendra, trlkona, 3 Ot 11
111
from
Lagna is conjunct KUlA or KETU :
Quarrels and miSWlderstandings with a number d people.
(iv) llblkti natha Guru is in Oushs'thana Lagnaorindetilitation
Ot conjunct Rahu : -
400
Quarrels and loss of relatives-; fear from ar'd king;
to fath and mother; fever; diseases like ulcer/
wounds; S\lferlng losses In the matter of landed property and
cattle holdW!gs.
(b) The following are the SPECIAL EFFeCTS, In addiUon to those
mentioned above, if bukti natha GURU is conjl.llct or aspected
by:-
SURYA Gain of money through agriculture; of profession;
respect from k:ing.
CHANDRA auspic:iOuS functia'IS; gain d ClOthing; of
mind; prosperity to maternal relations..
KUJA VIctory In encounters; respect from king; special
fa..o\.rS on Tuesdays; gain of land.
BUDHA gain or clOthing and ornaments; company of k!amed
people and academical functions and entertaiM1ents.
SUKRA enjoyments with opposite sex; peace of mind;
reputation to master; gain ot ornamerts and dress.
SANI disorders kl ltlroat; loss of servants; In
performing prayer and worship.
(c) If buktl natha Guru Is In r.endra, Trlkx>na, 3 or

from f\1aha oasa

Natha or conjuntt benefic :
Gain d money, well being of wife; oneself established in
profession; prosperity to master or emptoyer; kin9J
important people on Thursdays; knowledge of philosophy or
shastras.
(d) U buktl natha Guu is Dushsthana fromMaha Dasa Natha or conjunct
malefic:-
Bittemess with children and leamed people; bodily troutles; blurred
intelligence; forgetfulnes5; quarrels; loss of position; Sl.lferin9> to
dose relatives and loss d quadrupeds.
(e) If buktl natha Gwu Is In 2td or "P' from L.a9"1a:
fear of death. The shanty for warding off this Dosh Phala is MAHA
MRUTYUNJAYA JAPA and KAANCHANA PRATIMA DAN (image mode
ci gold), after wtich the naU., wll enjoy prospelly.
SHANI BUKTI = 32 months & 9 days
(a) The folowing are 111e effects of SAN I BUKTI in BUDHA DASA
with reference to various Yogas:
(i) If bukti natha SANI is in Kencta, trikona, 3 or from t.agna
or in exaltatiOn
Pilgrimages al'd viSits to temples; trawls in 'M:!Stem directiOn
and meeting king; prosperity in master's fami ly; getting into
good books d king; Increased m.rnber of setVants and maid-
servants; favours from a master belonging to low caste; gain
of household property and acquisition of cereals; 9J)in of
preCiOus st()()(!S and cattle; pi'OSp(!rily to reladve:S.
(II) If buktl natha SANI is in Oushsthana from Lagna or In
debilitotion:-
Svfferings to dose relatives and quarrels and rnsuncterstancln9i
with relatlves; Loss of position In the own place and
having to go frcm place to place; loss d powers wielded by
the native; fear r. battle; especially on SabJrdays, quarrels
with menials atd incurring Ki'lg"s displeasure.
(b) The following are the SPECIAL EFFeCTS, In addiUon to those
mentioned above, tf bukti natha SANI is (X)I'ljunct or aspected bv :
SURYA Sufferings to father and loss of money; clseases on
head; quarrels; MAHAT SANGARA
( poSSi:Jility d the nM:tve partaking in a great battle: or
seNce In battte front}.
CHANORA to matemol relations; failUres
In U'ldertaklngs.
KUJA Unexpected adverse happenings; loss d tlnance due
to natiYe's foolislwless; diseases We to excess of heat;
fear from weapons ard poison.
BUOHA UPI VIOYA VISARADAHA (profldency In caiiigrapl'ly);
i nclinatiOn to help relative:s..
GURU SIAYerings to Chikt"en; forgetfulness; misooderSt!lndings
with learned and failures in undertakings.
SUKAA sum gains of money; good health for wife and
childrtn; acq.JiSitiOn d corrvtyance etc.
402
(c) If btAtti natha SAN! IS IN Kendra, trikona, 3 or 1111\ frOm f\1aha oasa
N3tha 0t conjunct benefic :
Auspk:fous celebrations and prosperity; satisfaction In many
clrectlon.s; exhibition of native's knowledge In au:flenoes; gain d
deeper knowtedge in Vedarl:a; happiness master/employer
belonging to a low caste; suce<ss In e<eSY direction.
(d) If buli natha SANT is in Oushsthana (6, 8, or from f\1aha Oasa
N3tha., BUOHA, or conjutw:t malefiC:
Bodily troubles; lOss of positiOn; toss d preptor and r&tivt:S;
quarrels arising due to king and toss of powers wielded by the
native.
(e) If I>Jkti nallla, SAN! Is In t" or 7"' from Lagna:
Fear d death. The shanty for warding off this Dosh Phala Is
MAK!SHA (I>JIIalo) DAN.
(f) If bukti natha SANI is lord of2"" ttl' and at the same time conjunct
with a malell<: 01 Sari Is conjt.ntt with lord of 2...., or 7th or stays in
7'" from Uqla:
Fear d death. MAHA MRUTYUNJAYA JAPA, KAPJLA OHENU, and
HA.HISHA DAN are p-eSO'ibed for warding off the malefic effects.
euDHA MAHA DASA - BUKTI PHAlA SAMPOORNAM"
Cliapter 28
'Jiarious Kouses in
<Bhrigu Nalfi - 9ttercury
Method of judging wife' s nature from male
horoscope:
Mercury + Venus + Sun : Genalty good in nature, intelligent.
lri'lgs honour both to birth place and marital home.
Mercury + Venus + Moon: Qui te Intelligent, she wil l be
knowledgeable in various artistic ..-ery active (she can make
a dumb/deaf to talk), ' Mookam Karoti Vachalam', will have good
grasping nature, social minded. wi ll have brother/sisters, ability In
business activities too, IA.tt her husband may mistake her because of
her social movemert (one of native's will be capricious, fickle
minded), the natl\le treats guests fairty, her husband enjoys transit cl
her fortune regardi ng land and gains/property and if her husband
suffers any toss, he gains compensation tiYoLgh some means (because
wife's fortune) Md lnsplte of all these., still her husband will be
suspicious of wife because of her smiling, social nature, she visits holy
pil grimages, she will be a natue lover, persor6 who help fran her
In fubJre will accuse her Met try to make her a scapegoat
Mercury + Venus + Mars: She wtl be cak:ulatlve, she can
control her hust>Md. she woukt not allow her husband to go In bad
w;,ys ( that is she can control him), qui te intelligent, suff ers in
education31 career (bot later on cootinues), wil have brother/sister,
generally she does not like quarrelling, but shoukt it come to l, she
404
would not hesitate to expose others, she will be a fair looking
native.
Mercury + Venus + Jupiter : SM will be a t3lenta:l one, fair
educational aspeas, she can become a gukte/teacher, pertly successful
in intell ectual lines, fair tooking, knowl edge in various spheres, she
respects elderS and intt'!llec:tuals, She will Nlve fair discretional p:wm,
family life fairly good, a sociable type.
Mercury +Venus + saturn : Educated, quite r.telligert, will be
a career girl, iodination towards commercial lines, a quietty behaving
type, her huSband brinos her dejection, she will troubles ttrough
her husband, mother-in-law's sid!s, hUSband enjoys prosperity ttroogh
her fortune.
Mercury + Venus + Dragon Head : Qui te Intelligent,
sometimes suffers due to a sort of her husband enjoys
prosperity through h fortune, she can enjoy a h.Jxtrf although
her h.Jsband may suffer due to .,.imlcal aspects, but because d his
wife's (the native) fortune, he can such problems.
Mercury + Venus + Dragon Tall: She will have inclination
towards the path of liberation, suffers nervous detiity, wil have some
more lntuiUonal power, husband en}oys prosperity because of her
fo<tune (benefit through cloth are indialted), she wii be a devo""' <0
l ord Vishnu, her name pertains to goddess S.vasvati, her husband
enjoys fortune and prosperity, pertain.-.g to green &ands, agrlcUtural
land etc.
Method of Judging Husband's nature from the
Female horoscope:
Mercury + Mars + Sun: Husband hailing from a 9ood
background. CJ,Jite intelligent, although Short wil have somt
discretional power, he wil have harmonious relationship with other
members of the farrity.
Mercury + Mars + Moon: He wil be a good will have
traveling auetr, enjoys IMCS gains (agrieullural etc.) can work in food/
grW.s departments or In such lines the peo.Jiiatlty is If he gets angry,
some other women will cajole him and he can have her as his
companion and if his wife him out of anger, dltre wUI b! no
dearth to for sexual pleasure.
Mercury + + OrA90n Head: Husband lntellgent, but
sometimes behaves a mad cap, regarding marriage he will c:ome
across bad si!uation and later on marries a girt and l ife gets settled.
Mercury + Mars + Dragon Tail: Here, regarding both male and
femal e aspects, before their marriage, they will encounter with an
affatrs with opposite sex, which may not matertallze and only later on
marria9f! takes place.
Mercury + Jupiter + Mars: Hvsband will be a respectable one.
iodination towards commercial lin!"S enj)ys social st.Mus, he will be more
lntelligetl than wife.
Mercury + Venus + Mars: Husband will be a good speaker,
enjoys soc.ial status and amicab'e (ad).lstable) by nature.
Mercury+ Mars+ Satum: Husband will have Iodination towards
business lines although prosperity may not be very high, general
aspects of fort<r>e can be enjo)'ed.
Mercury + Mars + Dragon Head: Her husband quite an
lntellgent native, blt husband and wife would oot trust each other,
and after some t ime she may ha""Je to find extra marital rdationsh., for
her pleasures.
Mercury + Mars + Dragon Tail: Her husband wil be intelligent,.
will have literary knowledge, her nature wi l be such that moon rays
roost be fali n9 on her house orfy.

Flat & Fortune of wife through male Chart
Mercury + Sun + Venus: She is generally an intdllgent native,
will have good education.
Mercury + Moon + Venus: This is a wonderful combination, she
will be: an ir'telligent lady, ar'd for olt.Side she will act like
a Penelope, (this combination is la<.e a Trlvent Sangam, because three
female planets are there) and even if her husband beats her, she would
not either care or change, but if he t reats her better, he can have
some: benefits through her, she will be social minded native, talents,
knowledge In roosic and dance prevails, she does not like inl>ositions,
but expects fair treatment and husband must make lot of adjustments
with her for his v!!fare and profiUibiides.
Mercury + saturn + Venus: She will have fair fortune, but
husband must be adjustable to her, Itself wdl be
some times he wil have to wag tis tail before her for his benefits.
Mercury + Mars + Moon : (Male/f emal e natives), between
husband and wife no l ildngs, she thiir.s She need oot depend on her
husband and he tNii<s he need not depend on his wife, anyhow but
both of them may be suitable to do social servi ce, wJI have their
pleasures, happiness outside family
Mercury + Saturn + Mars : (Mal!,lremale natives), to put i t
precisely maniage Is not at a1 advisable ror sudl combination (better,
Astrologer.; it precisely).
Mercury + Dragon Head + Verw.s: She can be a good wife,
after marriage husband can enjoy prosperity, but he rrust not either
constrai"' or impose on htr any b4x!Wl (for bOth maJe,ffemale natives
Indications or love marriage Is a possibility).
Mercury + Venus + Dragon Head: She will not have affection
on her husband, her mind will be working on external interests.
<01
Method of Judging Husband's Career through the
Combination of Planets
Mercury + Mars+ Sun: He will sportive be by nature, will have
traveling c.arttr in commdal lines, connecting
Mercury + Mars + Moon : He \WI be a good, at1Jactive person
and a good speaktr, doeS not believe that he has to dtpend only on his
wife, enjoy prolltabllity through green lands, food products, a bit llat,
will have arti stic krowledge, wil have intuitional powers, will have
foreign trlJvel in bUSiness activitieS.
Mercury + Mars + Jupiter: An educated one, eft'idency in
managerial posts wHI be good in (Head will have
commercial based concern, will have opposite sex affairs, bvt keeps
thtm secA!t. enjoys p-operty, good finandal positiOns in the sojourn of
life.
Mercury + Mars + Venus: He e$ys good finMdal position,
enjoys landed property, enjoys benefi ts through opposite sex
inwtvements ( aspecting financial one). He will have more affeCtion on
slsterh law'S/other females, rather than on his v.ife. lf the moon Is
associated wfth the above planets or if the Moon is in or 9"'
aspect to Mercury and Venus, they will have some opposite sex
Involvements. He enjoys commercial career based profltablllties,
lntelllgents, rupture between husband and wife Will be Inevitable (but
anyhow they would n::>t f ail to ive together), ar:1 if tis wife does not
treat him smoothly wotAd not hesitate to h&ve aoother adjustment
(so she must be careful and patient while such type of h.Jsband), he
generally looks a pious one.
Mercury + Mars + Dragon Head: Generally an Intelligent
one, but a bit fearful, afraid of opposite sex relations (he would
not tH prepared to bur accusation$ due to such affair$) but
sometimes dal'ely enjoys opposlt2 sex l'elatiOM, but there will
be disappointments in life.
Mercury + Mars + Dragon Tail : He will have career as a
Draftsman will have knowledge/career aspects In law, Intelligent,
408
opporturities to become high level actninistrating officer/lAS good.
Mercury + Mars + Jupiter: Edutational y a double-degree
hok:Jer, but egoistic l:r;' natiJe, proud/paSSiontd on!, will not have good
liking with brother rdaUOns.
Mercury + Mars + venus: Her husband wJI be active and
generous by enjoys great popularity in social cirdes. Eamin9>
will be pertaining to finanCial instruction/banking agendes etc.
Mercury + Mars + Satum: Husband invotving in business affairs,
an on!. lhe: will be business betivities with blood relatives
and thek' supporter Involvement pertaining to partnership type of
business activities.
Mercury + Mars + Dragon Head: Husband dl.l'ing the initial
stages suffers due to extreme hardShip, l at8' on by intelligert shines
wen In \tie fleid of commerce etc.
Mercury + Mars + Dragon Tall: A S$1t life wfll be better than
becoming seNant of wife (I.e. what this combination indicates).
Husb<lnd will oot be suitable for marriage life.
Mercury + Mars + Sun : Husband wil be an intellecb.Jal one,
dignWied, but sometimes behaves ke a bu"*'g fire (as If ash covering
the bumng ooal). Enjoys SUOJeSS In govemmental l nes.
Mercury + Mars + Moon : Husband wtl ha..-e artlstfc nature.,
enjoys soe-lal reputatb"'. Quite often will have sexual affairs.
Mercury + Mars + Jupiter: Husband will be highly able
knowledge, quick ani conb!mplation type. As fat as career is
concemed, enj)ys good fortune and actnlnlstratlve positions (like an
engineer, manager etc.). Sometimes his power of dlsaetion will be poor
and his wife will have to exercise lot of tolerance to be in peace with
her husband,
Mercury + Mars + saturn : Husband will be lrtellectual, besides
quite a hard wc:rtet.
Nature of Wife through Permutation &
Combination
Mercury + Venus + Sun: She hails f rom a good family
background. 1'1.4)ture betweM husband and wife iS
Mercury + Venus + Moon: Wife will have intuitional powers,
quite an intelligent one, will have arti sti c nature, huSbiJnd wll be
discordant, non co-operating one, he wil l have other female
involvements.
Mercury + Venus + Mars: For some t ime she exerci ses
dictatCf"Sttip, cour3geous, will haY! bdrriniStrative capacity, fair looking,
believes In fait Justice, bit egoistic, she wfll have to encounter problems
during delivery times, svfferings due to heart trouble is inevitatle (may
to undergo surgery too), blood presst.e problems indicative..
Mercury + Ven us + Jupiter : Wife will have special educatioclal
qualities, quite an Intelligent one, can extract WOtk from others nicely,
she can work as a teacher, a guide and she will be liked by all in social
cir des. She can attract like a magnet, ste nicely coils officers and gets
her work done.
Mercury + Venus + satum: Wife will be an lntet&gent one,
enjoys luxury, a fortune aspected one, she can ln'>lve fn trade activities
like business ett. (husband am do business in her name or enjoying
great fortune).
Mercury + Venus+ Dragon Head: Wife enjoys g:>od name in
society, quite an lntelllgert one, .-.'>tvement .-. secret affairs .,evitable
(wife's sister wi ll have some secret life).
Mercury + Venus + Dragon Tall: Wife will be a bluff master,
interested in making secret savings, although she has helping natue to
some extent still she would hesitate to exercise it., can caloJate many
things si tting at a place, she wi ll have capacity to judge others, she
exercises her intelli gence to gain her ends, enjoys green landed
property, there w111 be disorders In genital organs (may need surgical
operations).
410
MERCURY - Effects of various Houses as per
Bhrigu Nadi studies
Tile various effects produced by r-1ercury standing in the 12u.
houses in a horoscop! are as follows:
Mercury In Ascendant
learned, p-oficiercy in wi tchaaft and black sweet talk, kind
hearted, pilgrimage In his 2,..1"0r.
(a) U oonj<nct malefic or staying In malefic houses - Diseases
generalty leukotomy, excess of pre. I( conjunct or aspected
by or staying in benefit house- Good health, lustrous
bo<tf, knowledge of astrobgy, slight defect in any organ,
bitterness with gentleman, quarrels and misunderstanclngs
with brothers In his 11" year; deceitful.
(b) U exalted OC.Cl4)ying own house- Happiness with and from
brothers.
(c) U det>;litated or oonj aspected bv malefic:. Will go to hel alter
death, for sake comfortable IM!d, worship '"'Dustha Otita."'
(d) Conj or aspected bv Saturn. Tn:nble w left eye. In YQga
if conj lord of 6-. 01 debilitation - No such wasteful
expenses.
(e) 11 ccnj auspicious s;lanet. Olarities, prolidency in debating and
In use d arms, well built lxldy.
Mercury in 2nct House
Talkative, mmber d c:hildml, interest in ShaStras, cootented.
moneyed, praisewcrthy habits, acquires g:>od of educatkm
bv his 15"' year.
(a) 11 conj malefic or staying In malefic house or enemy houses
debilitatiOn - poor tducati on, Rheumatic and
diseases.
(b) If oonj or aspected by Jupiler - Prol\clency In mathematics
and astrotog:y, self
Mercury I n 3"' House
Gain of gold in his 1 sth year, praise INOrthy hai:Xts, financial prosperity.
(a) II disposition is s t ~ n g - Brothers prosper, coneyances.
(b) II disposition is weak - Sllferings to brothers, fear complex.
Mercury in 4ttt House
Courageous, brei'd eyes, happiness from father and mother,
knowledge, acquires money throuc1' questionable means In his
161h year.
(a) II conj venus or Jupiter - f'.1any c:owageous.
(b) II disposition iS strong - Caweyan:ts
(c) If conj Rahu/Ketu/Saturn - Loss of oonveyances, loss of
happiness, bitterness with relatives, ~ r i n g lies.
Mercury in 5tt1 House
Fear of death of unde, well being of mother, birth d children,
doubtful, intetigence, sweet tongue.
(a) II disposition iS st:rong .. Prosperous children
(b) II disposition iS weak - Loss of children.
(c) II f'.1ercury is debilitated ... The native wil be adopting a d'Jkj,
profldency In chanting MantraS/unchatitable deeds, knows how
to talk according to times.
Mercury in 6ttt House
Respect and preserve from king, obstacles in the direction d native's
edocatlon, showy and proud, lnnuence in t'igher drde: In his 30"'
year, will wri te or edit bookS.
(a) II statiOned in Aries or SccrpiO - Leprosy d blue cOIOw.
(b) II c:onj RMu or 53tum. Rheumatic ShOoting pairs:, quarrels with
distant relatives.
(c) II disposition Is strong -Prosperous nephews.
412
(d) 11 CIOn) Ketu - QJhtllnce/hltmacy w;th wklow and lnO<\etary
gains thereafter.
Mercury in 7th House
Happiness and well being of mothe<, charilllble broad
minded, very good reputation.
(a) 11 conjunct beneflcs. Ga;n ol conveyance and hooe In his
year, good wife.
(b) If disposition i s strong. Only one wire.
(c) If disposition is weak station in maleftt housed conjunct
,.'Iars, Saturn or Rahu. The yoga oo:!.l'rlng in the horoscope d
girts will res.Jt in l oss d hu.sl:end or the natiVe herself Sltfering
from Leprosy.
Mercury in 8th House
Nurrber cl children- 7, public his 25".
(a) 11 dlsposl\lon Is strong. The native wii.,JO\' ful span ollife.
(b) II disposition is conju...:t or is debilitated or in enemy
house. Po longevity.
Mercury in 9th House
Latge number of ch;ldren, highly leamed In !llastras and Veda,
proficiency In music, good amount of patience, charitable,
p-ofessional earnings through business, hates preceptor.
MerOJry in 10tt1 House
Good deeds, higNy courageous, reputed, highly prosperous, e:re
diseases In his 28'" year.
(a) II J)laced in exaltation, own house or conj Religious
charities/sacrifice.
(b) If combust retrograde or conj malefiC. Oppose religious
saalllces.
Mercury In 11 ttl House
Kind hearted, financial prosperity and birth d son in 27 .,.ears.
(a) II conj. Malefic. Loss of money through low dass people.
(b) II exal ted or occupying own house or conj benefic - Finandal
prosperity.
Mercury In 12tt1 House
Knowledge, valorous In bat*.
(a) 11 conjunct malefic . Focal minded. blttemess with h i ~ l y
placed persons including king.
II conj benefics. Exptnses on chari ty Md in ril;tlt direction,
meager erucatlon, sickly mothef.
414
Cliapter 29
of !Mercury
Unlike the shepherd, the gods do not use a cudgel to guard
the Mortals. Instead, they protect the chosen ones by
bestowing fine Intellect and wisdom upon them.
Mertl.l"y gNts the foltow;ng r&Jtts when it iSIJ$$0d3ltd wit h 8 to
0 blndus:
8 bin:lus
7 bindus
6 bindus
5 blndus
4 bindus
3 bindus
2 bin:lus
I blndu
0 blndu
Honour from the rul ers, al -round good luck.
Wealth. happiness, learning, wony.,less phianth'opic
llvng.
Success in au ventures, ability to comprehend
Intricate and complex matters.
New with Important people.
Lack of enthusiasm and focus in life.
Mental worries.
MiSunderstan:tings with family members, SiCkness
due to imbalance of VcJta .. PittiJ or Kap/18 (wind,
bile or pNegm
Enforced confinement, tormented by enemies.
Loss of property through enemy intri9)es, fear of
death.
Prominent indications of Mercury's
Bhinnashtakavarga
1. Mercury's transit In a Kakshya having a bindu in its own
Bhinn.ast-takavarga graru happiness and sweets (sunptvous meals).
The native engages himself In charitable deeds.
2. Metrury's transit In a blndu-less kal<shya quarrels, bad dreams,
urtimely meals and uneasy mtrtal state.
3. farrOiy welfare, maternal relations, equarilrity cl rrlnd should be
ascertained from the 4
11
house. literary talents and intellectual
pursuits from S" house and excdkn:e of speech from 2nd house
reckoned from Mero.uy.
Speech and artiOJiation
4. From Merary house sholt:l be strong to give p-oper
to one's thoughts by way of speech.
(a) If 2.t'd from f-1ercury does rot have been 1 blndu, the person
born may be <lJmb. ThiS principle will come true if f'.1ercury
and 2"' from Lagna are also associated with very low blndus
and In addidon have other affllctlon.s by maleflcs.
(b) U 2"' from Mertuy cootalns 1, 2 or 3 blndus, the nallve will
have unsteady and incoherent speech.
(c) If it (X)I"Itains 4, he will talk well 1M oriy when someone else
has Initiated the ciscusslon; If 5 01 6, his speech will be praise-
worthy and befitting ttl! oo:asiOn. With 7 ht will be a literary
giant capable of composing poems extempore.
S. If ?td from Lagna oontains 7 binc:l.lsin Merc...-y's 8hinnast-ak.avar911,
the natf ...e wfll be a brlllla rt orator.
Note: 2"' from MerQ.J)' will atways have less than 8 as
dOes not contrib\J:e 8 bindu in itS
6. In the from Mero.uy, If the bincl.Js are donated by malefics, the
native's wil be deceitful and arrogant In contrast, the
benefks gl"' harmonizing speech.
.,.
If the blndu Is O>ntrlbuted by:
Sun The speech is in the form of an il"f1)0Sing. wise COI.Ilsd.
Saturn The speech is deceptive, improper and at the wrong
time.
Mars The speech is vain-glorious and causes discord.
Mera.ary Sweet and clever speech.
Jupiter Distinct and wise speech, full of erudition and knowtedge
of proper
Venus Charming and delightful speech.
Moon Powerless Moon causes spe:h that iS sluggiSh and full
or doubts.
Stro"ll Moon wolld cause It to be just the opposite.
7. If t-1ercvry is posited in a h:>use having very IQ\v bindus, lack d
Intelligence and common-sense Is the resUt.
Note: MerCI.IY can never OCQ.Ipy a house having no blndus, since
(at least) Mera.y would c:c.'ltribute: z. bind.t in the firSt house from
itself.
8. Mertal lassitude iS the result of f.1ercury'S transit of a bindJIeSs
sign.
Prof"tclency in Astrology
Merc..y has always been assodated with proflclercy In Astrology
(alongwith Jupiter) due to its r!Jership d speech, disaimination,
fntelllgenoe Md knowledge <:A scrlptu-es.
9. If t-1ercury is in the 41h or 6t" from Saturn, wit h S or
more blndus and the from ... a is aspeaed or 00:'4)1ed by
the becomes an eminent astrologer.
10. If Ketu iS in a sign whiCh has at l east 3 bindus i n Mercury's
Bhimashtak.avarga and it is In Sll't t.>use or with SO' lord, the native
acquires great proficiency In all bran<hes (mathematical and
of astrology. KebJ is known to give a cert-ain awity to
the mind towards whichever pursuit the Intellect Is engaged.
417
Ex mpi#J. Let us e.l0mine the horoscope: of Mr. K.N. Rao, one of
the very weU kr.own astrologers of our times, who not uses
c:ifferent techniques for predictions, but also teaches
them. He Is also an exO!Iert orator.
Hercll'y Is exalted In his horoscope thouc;tl it has only 2 blndus In
its own Bhinnashtakavarga. Oef'iciency d bloWs brings Merwry's
exalted status a couple d notches down, yet Budhaditya Yoga
and presence d Ketu in tM yoga give it a certain ac(J.Iity. This
yoga is being aspeaed by Satrurn wtllch is the Sll'llord. There are
4 blndus in the 2"" from Mera.uy.
The other planet most closely related wi th astrology Is Jupiter due
to its spiritual and scriph.ral undertones . .l.Jpter here is involved in
a powerful Gaj Kesari yoga being in Kendra ) from the t-1oon.
Jupiter Is not only exalted, It also has 6 bindus In Its own
Bhinnashtakavarga. It has S bindus in Libra where the Moon is
posited. The Moon has redprocated ai>JndanUy by having 7 lllndus
in car.:er (its O't\ln house) where .l.Jpter is posited. Jupter is also
assodated with 38 Sarvashtatta bindus. But, the most. imJX)rtant
feabJre re&ated to prof'icienc:y in astrology Is Jupiter's aspect on the
2nd house from the Lagn.a and having 6 bindus there. 2n:t lord Mars
Is wei placed In Ulgla with Lagna lord Venus and 10'' IoRI
both beoefics. 2n:t house from has 5 bindus in
8hlm.ashtakavarga.
Thus, we see that the 2td house is very well fortified making
Rao an astrologer extraordfnalte and a speaker par excellence.
11. Mercury wel l posited In a Kendra or a trikona associated with 5
bindu.s or more. conjunct with or aspected 1>f Jupiter or satum,
makes the native learned in scriptures.
12. If MerOJry with 4 bindus is in Aries or Scocpio (signs of Mars) and
happens to be in the or Libra Navamsa (signs of Venus) and
is aspected by Jupiter. the perSOn is a bom poet_ ct"amatiSt or a
Uteraturer.
13. Mertll"y makes a person an inCiSive: log klan rf it i s aSSOCiated with
S bind us, Is conjunct with )Jplter and has an associated with Mars.
Exillftple : ).F. l(emecty was a prolifiC speech maker. His Mett\I'Y is
conjunct Mars with 6 bindus. Mars Is also his lord, the p&anet
responsible for giving him excellent personal relati ons and
418
c:ommunieatfons.
14. Find out the 59> that""' being aspected by Jup-er. Pick ovt ll>e
one whiCh has 4 or more bindus in Merwry's Bhinnashtakavarga. lf
edu::ation is started at the time when Mercury Is transitlrq sudl a
5tgn, even a "'k1tl..ey dull SllJdent prolldency.
IS. Fe< reMng ll>e blessings of lDrd Vlshoo, sho!Ad be
oone at a t ime when that sign is rising which contains the highest
birdus in the of Mercury.
16. Transit cl is used VfSY effectively bv astrologers advising
on stockrnarket ftuctuatlons and commodity-trading. All the feat\res
of Mercury's transit e.g., becoming direct,
combustion, change of sign are supposed to cause changes In
stO<kmarket trends on the shorHerm basis. Coupl ed with
Ashtakavarga binclls, the bazaarpt.ndits can add higher degee d
aocuracy to their precUction.
Moon's Ashtakavarga may indicate fluctuations on daily basis or
even within the day.
LOng term trends ate preclcted through the transit d slower
planets e.g, Saturn, Jupiter and Rahu, as also on the baSiS of
Chai .. a Shukla Pratipacla Chart.
Cliapter 30
(])iagnosis of OOeases -
9dercury
Diseases given by Men::ury are Chest, nerves, feve(
poison, nose, fever, itthes, f!ilcture c:l b<:rle, typl'v::lid, madness or
mental retzlrded, gall blbdder. !)Q!Iralysis, fits, indigestion_ cholera, mouth
and sldn clseases.
Now, MercU"Y Is also the ruler of tissues !\betS and cells and govem
lungs. Affliction to Merrury CNI cause pUmonary disease. f\rther, the
si!Jl of which Merc\IY is the lord, is c:omected with h,J''I9S
brord'lial and Similar troubles.
Pathogenic effects d M8'a.uy when posited in dtfferent sq.s are
as follows :
AriM : vertigo, neuralgi a, nervous breakdown, brain fever,
astigmatism, Insanity, hysteria. By renex action Into Libra; Plruitary and
functional disorders of the kidneys.
Taurus :- Speech Implements hoatseflf!S1:, parathyroid
stammering. 8y reflex ac:tion into S<xlrpio; nervous dislurbances of the
genito winbry fUlction.
Gemini: Gouty pains in the arms, hands and shoulders, deafness,
blood disorders, asthma, bronchitis, lntercoast!ll neuralgia. By reflex
action Into Sagitta<lus hlp and lhlgh pains.
Cancer : Stomach cramps, nc!rvous indigestiOn, flatulence,
alcoholism. and tendency towards colds. By reflex acUon Into
420
Capricorn, cofd5 and ooof/t, legs ard knees causing lameness..
Leo : Hoeart: palptatlons, Sow back pain, corM.tlslon, fainting spell,
By reftex action into Aquarius, tTfsteria, insanity, colds in the feet and
parjjysiS.
Virgo: Diarrhoea, dysentery, gastric ulcer, nervous debili ty,
asthma, shortness of breath.
Libra : RMal paroxysms, suppression of the urine, lumbago. By
reflex action Into Aries, blood disorders, breast and lung disorders,
nervous headache.
Scorpio : Neuralgic: pain the bladder and genitals, men:Strual
troubles, bowel disorders. By reftex action Into Taurus ruming pains In
the arms and shoulder.
Sagittarius :- Sciatica, neuritis, chronic coughs, pains In hips,
ttighs and knee joints, weakness in the back. By reflex action into
Gemini, nt/VOUS disorder-s.
Capricorn : Rheumatism, baCk pains, ame, melancholia, hysteria,
anxiety neurosis, mania. By reflex action Into Cancer nervous
indigestion, bowel dlsordS.
Aquarlu:r : G'o.llatory trot.bles, varicose veins, shootSng pains in
ll>e various parts of ll>e body, alle<gles, addosls, diseases inYOMng 11e!Ve
fluids. By renex action into Leo, Heart attack
Pisces : Phthisis, childlains, temporary amnesia, l assitude,
weakness in legs and feet. By reflex actiOn into Virgo,
bowel dl sordS.
MerOJry is cortn::cer of our nervous system. H! rules
order the brain nerves, nose-nervous, Intestinal nerves, lung-nerves
abdominal nerves. So ai'Tf affliction of Mercury by maleftc may procl.lte
serious and chroniC physical ailmtnts. soo the vital energy
Into our body and the Moon reg!Jates the flow d this vital enerqy.
By Mercuy can change the direction d this vital energy as well as
raise or k>wrer t heir vibratory force thereby causif9 serious physical
disat::mtes.
""
Various Diseases whid'l are governed by Mercury
ASHLESHA 9"' Star. 16-40' to 3rf'. Cancer Sign ruled by Moon
and Star by Mereu ry.
Diseases : Vitamin '8' defi ci ency, cold stomach, windiness,
windpres-;ing the claptwagm making it difficult to breathe, distillation d
rhetum, pains in knees and legs, drunkenness, phlegm, flatulence.
nephritis, hypochondria, hysteri a, dropsy, j aundi ce, nervous,
indigestion.
JYESHTA : In Scorpio 16-40' to JOO. Sign ruled bv Mars. Star
gowned by Mercury.
Diseases: Leucorrhoea, l:itedng. l'istt.fa, distemper
In secret parts, affliction of bowels, pains in am\S and shoulders.
REVA T1 : In Pisces 16.40' to 3d' Sign ruled by Jupiter and star
govorned by Mercury.
Diseases: Alxtominal disorders, troubles, deformities ol the feet,
intestinal uk"ers mostly due to drinkS and drugs, gout in the feet,
cra!ll'S Nephritis, lassitude, deafness, pus In the ear.
Significance of each Sub under Mercury
What each sub, under Mercury, indicates is given below:-
GEMJNI:
I. Hertury, Ma<s, MertUry : 0.()()-00- 1S320.
Injury In the sh:>Uder and defective weal cord.
2. Hertury, Hat>, Ketu: 1 5320- 2-40.00.
TIY(mus gland, oorrupted blood, fever, oollar bone.
3. Hertury, Ha<s, v.....,s: HOOO - 4 5320.
VOcalcon::l, throat. eatS, itches, disorders In secret parts, Inflammation
422
d periC!IIdium, SCiatica.
4. Hen:<.<y, Ma<s, SUn : 4-53-20 - 53320.
9\oulders Upper ribs, Arms,
5. Hen:<.<y, Ma<s, Moon : 533-20 - 6--4000.
Throat, gland.
6. Hen:<.<y, Rol-<l, Rohu : 6-40.00 - 8-40-0Q.
Septic throat,
7. Hen:<.<y, Rohu, Jupiter : 8-40-0Q - IQ-26-40.
septic throat, ear trouble, Mumps.
8. Hen:<.<y, Rohu, Sol\rn : IQ-26-40- 1233-20.
Asthma, Puss In the ear.
9. Hen:<.<y, Rohu, Merc<.<y : 1233-20- 126-40.
Hlc<XlUgh, ear b'ouble.
10. Hen:<.<y, Rohu, : 14-26-40 1513 20.
Septic dphtherla, jealousy.
11. Hen:<.<y, Rohu, 1513-20 1726--40.
Septic IJry cough, ear trouble.
12. Hen:<.<y, Rohu, Sun : 1726-40 - 18-06-40.
EoooopNWa, pain In the shc>IAder.
13. Hen:<.<y, Rohu, Moon : 1806-40- 19-13-20.
Ear puss In the ear. asUvna.
14. Hen:<.<y, Rahu, Ma": 191320- 2Q-OOOO.
Septic lnj<.<y In the shoulder.
IS. Hen:<.<y, Jupiter, Jupiter : 2Q-OQ-OO- 21-46-40.
9Nellng In the ear. pulmonary
16. Hen:<.<y, Jupiter, Sotum : 21-46-4() 23 53-20.
Injury In the shoulder blade, lrtlammatioo, paW! In the ear, loclne
infiltration in the upper lobe of the lungs.
17. Men:..y, Jupiter, Morcury : 23-53-20- 25-46-20.
Hiccough, asthma.
18. Men:..y, Jup;ter, Ketu : 25-46-20- 26-33-20.
Aeu-isy, PneurrtJnia, Pulmonary, apoplexy.
19. Men:..y, Jupiter, Venus: 2633-20- 2846-<10.
BronChitiS, Arins ciSOrder.
20. Men:..y, Jupker, Sun: 28-46-<10 - 2926-40.
Tl'r'oat affe<.ted. pain in the ear, bronchitiS EOSinophil'&.
21. Men:..y, Jupiter, Moon : 29-26-40 -
Aeu-isy, Pneunonla.
VIRGO
22. Mertl.I'Y, Sun, Rahu 000-QO- 11320.
careless about <let, abdominal diseases, intestinal tn::u,.,le, typhoid.
cough due to gas. a lltUe nervous debility.
23. Men:..y, Scn, Jupiter 1-13-20- 301>00.
Aatuence rever carefu about diet, defect In assimilation.
24. Men:..y, Scn, Saturn 3-0000 - 5-6-40.
Tapeworm, constipatfon.
25. Men:..y, SUn, Mercury - 7-()Q-OO.
Nervous breakdown, uloer in mouth due to tAcer k'regular
intake d food at short intervals.
26. Mertl.l"y, Sun, Ketu 7..(l()o00 - 7-46-40.
Food poisoning, cbrrhoea, spl"l..!.
27. MertLry, Soo, 7+46-40 - 1000.00.
Vitamin '8' deftciency and gas formation.
28. Men:..y, Moon, Moon 10-oo-oo - 116-40.
Trouble in the intestint and also in the breast. Hypochondrfa.
29. Men:..y, Moon, Mli<S 116-40- 115320.
Bleeding piles, irritation, uker In
30. Hen:.-y, Moon, Rahu 11-53-20 - 13-53-20.
Gastric lAcer.
31. Herart, Moon, )\.!)iter 13-53-20 - 15-4Q-OO.
Olanhoea, cancer in Intestines.
32. Herart, Moon, Saturn 15-'10-00 - 17-41>40.
causes constipation completely dries ....,, flat\lenoe, pain chronic
clseases gas formation.
33. Hen:.-y, Moon, Mercuoy 1746-<10 - 19-<Q-00.
Nervous breakdown, very poor digestion, very poor memory,
c:iSQ(der of bowels.
34. Hercuoy, 1oon, Ketu 19-<10-00 - 20-26-<10.
NeNOus weakness.
35. Herart, Moon, Venus 2Q-2HO - 22-<10-()().
Pain near sexual part.
36. Hen:.-y, Moon, Sun 22-<10-()() - 23-2Q-OO.
Gastric lAcer.
37. Hen:.-y, MO<S, Mars 23-20-00- 24-6-'10.
Ulcer in Intestinal part, ugbl aid needed, mO&tly duodenal ulcer.
38. Hen:.-y, MO<S, Rallu 24-HO - 26-HO.
Ulcer in intestine.
39. Hen:.-y, MO<S, Jupiter : 26-6-'10 - 275320.
Hertolly veoy 'IJid<. Good heoh. tr Jupiter, ll>e sub-lord, a
sigrlfiCator of 6" house, then only Cancer in old age.
40. Hen:.-y, Mars, Saturn : 27-SHO - 30-()()-40.
Health not good, worms in intestines, oonstipation.
Cliapter 31
9tlercury tfransitina tne Houses
1. Refrain from making statements that might be subject to
misinterpretation. A friend or neighbor may help you with
sy!Tl)athetic advice, and point out a way to eldricate yourself from
the disturbing oondltlons around you. A good way to promote
harmony with others is through cheerful correspondence.
2. A Shift in drcumstarcts may imprCJved financial con:titions for
you. lt may be necessary to make a determined attempt to dispel
clsagreemeniS that cause a rift with associates. Do oot albw the
situation to reach the breaking point Discord can be patched up
through a sympatheti c approach. Courtesy on your part shot.Ad
a c:c.-dial response.
3. A short vacation bip can prOYe Interesting and r&xlng, While )<)u
are on a short trip you may be able to acquire and impart a great
deal of worthwhile lnformaUon. A fawwable time to catch up on
t hat correspondence, visit relatives and make those necessary
telephone c.alls.
4. COl lect material for instructive articles en OJrrert events. Informatkm
that you need may come to you through \'lsitors to your home
a partnt may offtr excellent wl'lieh you shcu.ld ht< at this
time. An even greater possibility is a happy domestic life with a
tranqtM atmosphere surroundfng the home and farrity matters.
5. Aocwate judgement Is needed IX> cl fferentlate between dependable
and unreliable acquaintances so that you can decide whose
friendstip shoukt be retained Ot discarded. You may receive an
invit!ltfon to witness a ctamatlc speaacle. The memory of this
artistic achievement should remain with you fOt a long ....tlile.
426
6. A happy approach to your wor'k. Is indicated. Atterd to your jOb
with cheerful conftdence. The good reputation that you buik:l up
can bring lasting results. Watch that you do not overtax your metltal
capacity or let your mi'ld wander along supelfldal alms or impossible
attainments.
7. You may be able to remedy a difficult situation for an associate
wtllle there is favourab'e 'librations In this area of your chart. Your
mental awareness iS stimulbttd by partn!rShip matters and you are
at your best while dealing with partners in business affairs. Sign
oortracts, oorrespond, and do not be afraid to let yoU' opinions be
known.
8. Rlr rela:xatioo ready detective stories, mvstery thrillers and romartic
adventures. One c:l the best times to research your pet projec:t
besides you will find material on the subjed: easier to secu-e.
9. Pleasant comnv .. mlcatlons may reach you from a friend on a trip.
Also you may decide to contribute to funds whiCh are
to be used abroad or for tt-ose In institutions of higher !earring In
fact, you can promote goOd will on an international baSiS. It is
possible you may be asked to make some public awearance at a
peace forum.
10. Public opinion has to be considered In personal and business
arrangements needs further. What you do at present can affect
your reputation as well as your profession. The wortd is k>okWlg for
you to bring something of lmportan:::e out Into the open. Be sure
you are not stretching tht truth while the spotliglt is upon you.
11. EJO::eptional opporb.JnitieS for enjoyabl! experiences are all around
you. An unexpected award may be confe'red upon you for your
help In organiZing a successful sodal program for a club to wtkh
you belong.
12. A happy solution to penclng problems provided you keep your
aims high and are rtt trying to decei\'lt anyone. This is a tine to
prepare for personal action which will be taking place in the near
future. Test your plans, so that all tht quirks may M wort.ed out
Be ready, opportunity Is knocldng, you will open llle door provided
you have planned wtsely and well. Don't scatter your forces, have
a del'vlite goal and t.hen prepare.
Cliapter 32
1. MertlrY In the 511\ house fr amlcted by MatS or Herschel: there Is
some scandal or in repute pertairing to love alfairs..
2. Herti.XY in the house denotes much wordy warfare in the married
life and a marTiage partner who would be too talkative, critical and
argumtrtlJtiYe. Jf Merruryoccupies a good sign and iS well aspect eel
lhe partne(s talks would be fUI of wit and wisdom. But W oa:upying
a b!d sign ill aspected the woJJd be garrulous and
wookl talk mosttv nonsense.
Generally speaking, Merrury denotes a clevet wWe/husband who
may not always be relief upon if Mero.try is afflicted.
3. Merc...-y r. the house fl conjunction with or In se)llile aspect, to
Verus: the natm: is very fond d persons of young age and the
native may many or fall in love with a person muth younger than
l'lmsdf.
4. If there is no planet in the 7,. and Mero .. uy is the lord of the 1st or
and In conjurw::tion or sextile aspect to Venus and U'laspected
try any other t:'anet, the same effect as in No. 3 above.
S. MerOJry in 71t1 in conjurw:tion with or afflicted by Mars gives ttle
husband}Wife who Is quld<witted but sar<:astlc In speech ard hotly
argumentative.
6. HertLIY in 7tn in good aspect to Moon or Jupiter is a fa1o0urable
incleatiOn in a male nMtvity.
7. HerOJry in 71t1 in companv !Mth Sun would be ravowabl e ir ttle
&a.tter planet Is strong and lord of a good house.
B. Mertl.l"y in 1-" when it conjun:;tion with a planet takes the attrib..-es
of that planet and derotes a partner slgllfied by that other planet
428
This wo!Jd be: partlcUarty so if that other planet Is nl!ar the cusp d
the 7., house or if f'.1ercury be within otb of intkJence of that planet
(Also look to aspects It Is receiving).
9. MertLrY in 7"' house if unasptcte:l by any planet tjvf!S a husband/
wife who is lean and thin. young and very
10. Mero.ry In 1"' house may denote m.Jdl correspondence 01 traveling
in connection with mabimony. Tlis wot.*:j be particularly so if ttle
k:lrd d the house is in the 7..,.. or the lord d the 1" house is in
the third or there is some: aspect between the lOrdS of the Yd and
houses. If the aspect Is a favourable one traveling or
oorrespondenoo would resUt In success. But W the aspea be an
evi one, it would be otherwise.
11. If MereU!)' In 7"' Is not conjoined with any note carefully
the aspects it farms and the it ts in.
(a) 11 well aspected by Jupiter the wWeJhusband would be good,
de\lef, an:l progressive.
(b) If Mercury is afflicted in the .,.,., hoose the conjugal life d \tie
natm: may be: full of bickering an:f wranglng.
(c) 11 much afftk:ted and the lord r:J the 7"' house be not strong
it may tjve ri se to legal troubte in connection with marriage.
12. When there Is no planet W. the 7tt1 house and f-1erCI.IY Is the Ruler
cl the h:>roscope the native woiJd be wen ad!Ased to avoid litigation
because unless wei aspected by Jupiter such litigation, may result
urtaiJOurably for the native.
13. Mertl.rV in the house signifies worries pertaining to the financial
affairs of the partner. lt also denotes some quarrels In relaUon to
getting money from l'lu.sband/wife or their relatiOns. This would bt
partlcularty so 1r Hercuoy Is afflicted.
14. Mertl.rV in if in cancer; the natiVe: may be to irtenors.
1 S. MertiSV is a very volatile planet and easiy absorbs the good or bad
qualities r:J other planets In con)mctlon 0< In aspect with it. Its
p:>sition vis-avis other planets i s therefore very ir'r1>ortanl
16. MertiSV Is corts:ldered an eunuch and if thls planet be in a female
nati\Jity In the seventh house unfortified by any benel\c: and the
lord cl the sevtn:h is not strong, the ncrtive's h.Jsband may not bt
very virile.
Cliapter 33
9rt.ercury ana 9rt.arita{
The dualist MerOJry has a significance no tess than Jupiter bLt it is
neglected fX Is endowed with very l ittle as oo,._,ated to
hi m. 1'>1ercury rules fact.lty of brain, wisdom and intelligence, logic
and power of understarding. The mind is of the foremost imp;lrtlnce,
Being an Intellectual pl anet., Mercury can give highl y Intelligent,
ingenious and analytical brain ....t.ile affli ction of Hero.uy, on the other
hand. under certain speci fi c conditions, mean, loss of mental power
Into Insanity.
Age of Mercury according to sign under occupat5on -
Merc\.1')' behaves l b! a boy (Kumar Awastha) if It is posited In Gemini,
libra or Aquarius. It a desire of learning tiYoughot.t the
life, unexpresslbte enthusiasm and love and curiosity towards
knowledge of different subjects and thei r various branches. Such
persons have a powerful mental Inclination towards acquisition of
koowl edge and to understand the logic and ccwnplications. They are
also easily provoked to anger and passion, and talk too mu::h. They IJy
to 11"0ke other convinced bv their own views ard with logic.
In Aries, Leo and Saglttatlus, Merwry Is dealt as a youth {Tarun
Awastha). Natives having tl'1is posi tion of t-1ercury are most
knowledgeable: persons. They have a clear and wide t.nderstanding d
11"0ny They are mostly experts but such persons are also very
proud of their knowl edge, who do not usualy compromi se with the
circumstances. They are aggressive and can easily get Involved Into
430
quarrel and c;an create a dispute, as they annot tolerate their
oppoSition or even their criticism. They are very passionate too.
Mertll'y attains maturity in Praudha Awastha in Taurus, and
Q,prlootn. This is a good disposition d Mett\.I'Y as It provtdes balanced
thoug,ts and fvm ideas. The thoughts are not changeable and there is
no vaeillbtion d id!as. He 3dvises app-opri&tely and corrt!ctly. iS not
proOO of knowledge as such he never misuses his helllgence.
Mercll'y reaches Its okt age or vrld:iha Awastha In cancer. Scorpio
and Pisces signs. This is not a good dispositicrl of Mercury in general.
Tl'l!y mostly miSuse their brain power. They do not perform their dll:ies
in a manner. They have a tendency to criticize and try to find
fault In hers and are mostly expert In that They use their lrtelli genre
for the causes.
S'9nlflcance of Mercury - t-1ercury is the significator of speech,
intelligence, expression, discrimination, education, learning,
knowledge, mathematics, accounts, logics, medical knowledge,
profession, writing, publishing, l eafy trees, ability, trade, business,
pri nti ng work, composit i on, memory and remembrance, poetry,
swlpture, astrologer, aulhor. chief servant, clerk. teacher, nelgtt>ours,
advocate, broker, brai n, lungs, hancls, tongue, stomach, leprosy and
leucoderma, post and services, bank, insurance, translator,
mms, railway services and chartered accountant or accounts
offer etc.
The brand1es of education signified by Mercury - Mero.uy Is
the Karaka of education in general and i n part i cular it signi fies
mathematics, dance, teaching, medical sdenoe, astrology, grammar,
examk'latlons and tests, acts and law, pa.-nlstry, psychology, typing,
trigonometry, caloo1us, engineering Maths, expert. d finger prints etc.
Hen:I.I'Y also slgllfies atrbassadors cl t he w.ut:ry, policy
compromise, aa:Lmulation d wealth, minister and secret documerts
etc.
Professi on which come under the control of
Mercury
1. Writer, author. poet, Editor, 1'\CM!Iist and story or essay writer.
2. Teacher, lecturer, professor, research scholar and lrwentor.
3. Astrologer, palmist. expert .-. occUt sciences like numerolow and
face reading etc.
4. Trader, businessman and manufacturer.
5. Registrar, Pesnll<N vendor (reader to and seller.
6. Publisher, printer, cx:mpositor, p-oof reader and twist.
7. TaUor, engine, measuremtnt taker and stati stician.
8. Post master, cle11<:S, ser-AO!:S of posts and telegraph
9. artist, dancer, speaker and debater.
10. Logicians, Homeopath and Ayutveda
Role of Mercury In various fields of life - Merrury plays vital
role in the life of every native. It has a specific rde over certain events
or life which are mostly kept secret. In a few Charts when we come to
know about the ocrurTences that are outcome of the positi on of
Merc\1')', we 9f!l astonished and at times our views also ch.ange about
that partiwlar person. I am trying to draw t he attention of the readers
towardS follOwing aspects d life: wntre: Mero..ry has to play a key role:
1. Adopt i on of child 2. Ille-gi ti mate birthS 3. More than one:
marriage <.1, Concubine, keeps 5. Mental depression of Insanity. 6.
Btilliante, intelligence, ob$e1Vations, logi cs, power of expression and
inttrpretation. 7. Impotency. 8. Adultery. 9 . Affliction or nervous
system, brain hemorrhage, nervous disorders or even breakdown and
paralysis. 10. Skin i nfecti ons, sense or si ght, percepti on and
understanding. 11. Nerwus system, solar towels, arms, mouth
and tongue. 12. Traveling and joumeys, transfers and professional
promotions. 13. Teaching, writing, poetry, mails and correspondence.
14. Skill, methodical way of work. strong and retentive memory. logic
432
thinldng, researcl"es and profession etc.
0\A of all the nine planets, MetWry i s nearest to the Sun. The
of iS 3200 mik!S and it rewtves tht Sun wittlin
88 days. Mera.uy Is said to be an Dlegitimate d i kt of Moon. Sinre
Mercury i s a yomg, Prince the person born under ttle infl uenc:e of
Merwry generalty posses a yolthful a.pptarance. Mercury is ntutrat,
dualistic, ool d. moist. converti>le and eunuch planet tt Is oombust
within S0"30' of the S\1'1 and in no case Mercury is beyond 28" from ttle
Sun. It is said to bestow best results leaving tht! Sun.
9:roog and well placed f'.1ercury is a great asset to any horoscope.
That will providt immtn:Se astoriShing way of
of actions ard urdenaklngs, perfect logics, correct lnte<pretatlons and
art of expression, powerful speech and power of grasping t he
complications, Mercury provi des good skill and strong and retentift
memory, methodical way d wottOOg. acoount j(eeplng and systematic
mcuwlers.. Mercury is the chief planet to be considered f irst of all for
ech.ntion. An afflicted Mercury can aeat:e havocs. One may be a great
liar, cheater, oorrupt, mad d Insane.
The St..n and Venus are frtends while Moon Is Inimical to Mera.uy,
Mars, Saturn and Jupiter are treated as However, we have
observed that Mercury should be treated as an enemy of Mars. Mars is
Inimical to Mercury. Both show adverse inftuence when they oome In
contact with each other.
Here, we propose to deal with the role of Mercury over the
matters d the 7#1 house only. f\1ert:ury mostly exhitits its results in the
32rd year.
Mercury and the Seventh House - II Mercury is the lord of the
7"' house, I.e. when the Lagna Is ruled by Jupiter, Mercury wHI
automaticall y own the 7ft' house and in that case. if Merwry joins a
malefic, specialty Mars and obtains the Navamsa of its debilitation or
Inimical vargas or Merc..ry Is combust and It such an afflicted
Mertury fall In the 611\ or the 8"" house as the i"' lord and is al so hemmed
in between malefics forming Papkatari Yoga, the wife of the native kills
pathe:tkall y Inch by Inch and cause misery to the whole famil y.
Suppose HerOJry QV.'ns 71t1 house and it is conj:l ined vnth Mars in the 8
111
house, saturn jOinS J'."' house: Md Rah.J 8_.. house an:S Merrury obtains
ttle Navamsa d t-1ars. If such a combinati on Is J)'esert In the horosoope
of a native i t mil'/ be under5tood the actions of the wife will be
responsi ble for his uooatural an:S untimely death.
Mercury and Jupiter in t he house: show caljugal happi lle"SS
protAded they are related with the 1" or 2"" houses and are absolutely
unatrlkted. Meroory, Venus and Saturn, if in the
house, m8ke the native ad.Jlterous. In case Mertl.I'Y owns th! 7,. and
joins venus and Saturn, In one way or the other, the nattve will be
attracted towards wtves of others.
Merc...-y has a very spedlk: role to play kl the matters of the 'Ph
house. If Merwry joins the 7
111
house and the dispositor of Men::ury is
well placed, it provides the native the art to win hearts of women and
natural ability to cteverty lftl)ress and attract women and natural ablltty
to cleverly i fl'1)ress and attract women towards him. He will be
favoured by women of his own choice. Herrury in t he 7t" house
protAdes an Intelligence wife. She likes to be wei dressed and is well
qualifted. She mil'/ not belong to a h9l family bvt wil
nat .... e. Merrury in the 7"' house attracts t he nari...e towards other's
wtves. He gets lnsplrauon and st:tength to wOtk in the asscxlation of
females and loves t hem too, depending upon the exact situation.
Merwry OJrt.ails the longevity of wife, if posited in the 7"' house for
persons born under Scorpio ascendant Whenever Mercury Indicates
liaison with a woman in any horoscope, it wll be with a yo\l"'g woman
because Mercury is regarded as k...mar. It may also indicate p-ostitution
under certain specific afflictions. Placement of Mercury In the 7"' house
wit hotA affliction pro\lides an intelli9ert and good looking wife whose
breasts are well developed and proportionate. She al so begets goods:
nutroer of ctllk1ren.
If t-1ercury is associated with Jl4)iter in the J"h house, th! natiVe
will be fortunate to get a good wife and sex with a nlJ'nber cl
other becMJtiful women. If Venus i s accompanied with Mert\I'Y in the Jlfl
house, the native will be liked by iooumerable beauti ful females.
434
In m05( of the cases, presence of Mercury in association with Mars
in the house has p&ayJ havoc. If f\11Jrs and Mercury an!! present
anywhere In the horoscope, the result will be klauspk:lous. If Merc:ury Is
Markesh i.e. lord of the 2"' an:t J1"1 houses and j)ins the 1" house in
ass:odation with f\11Jrs, tht death of the: huSband by one way or the
other. will be In evtdence soon atter the marriage.
Mars and venus can Indulge one In deep carnal pleasure or love
affair followred by physical relationships. When Merc:ury afflicts this
combination, takes place as we have studied in a cases
desalbed here. l n the present case Mertuy's association created many
disharmonious problems in man1allife. The native got i'l'\ilffied at
around 25 years age. The wife of the native came to know about
one d affairs of her husband )Jst after a of years d
marriage. Serious nisunderstandlngs developed between the couple
and they stopped seeing each other. In spite of living in the same
house they have not t211ked to each other for laSt fifteen years. TM
nattve Is forced to take his meats and breakfasts olt.Side. The wife of
the threats him to disdose the affair of the native to the
husband of the woman wh:) was inwlved with him. ThiS thrt.at always
stops the native to seek separation for the sake of his beloved, whose
life will also be spoiled like him if he were. for separation. r-1ercury should
be held responsibk! for such tragedi!s in mariUII life.
If MertLJY is well in the 1" house without any affliction. the
nattve will be bestowed with al ldnds of happiness r. marital life. His wfte
will be beal.tiful, intelli9ert: and tactflJ. Sle wil be submissive and kind
hearted too, bl.t hot tempered. Similarty if a wel l placed and
unafflicted MerOJry owns the 7th house, same results should be
ex.pected. Unafflicted Meroory is as good as a"( <Xher benefic planet
afflicted Mercury creates disasters. In the ab()o.le examples. We
have studed !tie Mercury Is heavily afflicted by Mars and r-1000. Mars Is
the bitterest enemy of Mercury. Placement of Mars in the sign of
Merturv or Mero.lry's ocxupadon of f'f of the sign rul ed by Mars is most
undesirable. Conjun:tion of Mars and r-1ercwy in the fo.h house or in
respect to J1h house or its lord Is most adverse so much so that It can
even kill either of the partners or can depress one to the extent that
he or she may commit suiCide. Such a combination can ruin the marital
life. Multi'* marriage are also caused by the affliction of in
respect to the house:. we have obServed in the abOve illustrations
ttlat affliction d Merwry has resutted lrto more than one marriage In
nuni)er r:l ta$eS.
Herc...-y is also for ilegitimate relationships. If MerOJry is
asSOCiated with the knd of the Lagna or the 7tro house, the moral
character of the native will be questionable. O'le seeks pleasures from
persons ottler than tis own wife or l'l.lsband. This type of conjunction
of has been named as Mbdan Gopal Yoga which signifies IOtY
character.
MertliY provides a 9)od and wife, if it joins an odd sign in
the ,. house. The fact of the native will be long and will have
authoritative lto<*s. Her hair will be black and long but cky. She will often
quatrel with the native and may pass insulting remarks.. She will
strong and manly physique. Her voice wtl not be sweet and she will not
be but will be intelli9<nt, educoted and fond of logic, beoutif<.l
Silky black Shining hair. She will pay due respect ard honour to her
husband and also love hkn even It he Is l esser ec:l.lcated than her. She
will be prac:tk.al, be.cMAiful and attractive. Jr HerOJry CXQ..Ipies Aries or
V11r90 in the 'fJ' house, the rise d fortll'le of the will come in
evidence orty after marriage. He will have to undertake lot of travel.
Proper judgment of the position of Mercury Is most essential
before arriving at any conclusion with rf!911rd to the matters of the 7!1:1
house. An afflicted Mercury, if it influences the "!h house either be
placement or ownership, aspect or conjunction with the 1" lord etc. In
any way, wll resUt either into mul tiple: r1"01Tiages or camal relationship or
lack of bliss d married life and marital harmony, death d either d the
partner, cona.bine or kept, tenslonous married life, sepatation or loose
moral chatilCtt:r.
Herwry has only two enemies MatS and Moon. No other planet
can atrlic:t MerG.Iry as much as Mars does. In other WO'ds afflicdon of
Mars by Mercury is heavier than by any of the other planet. Placement
of MatS In the 7th house ts bad for longevity of the partner but It
becomes stronger If Met0.1ry afflicts Mars in the '?' house. Similarly ttle
436
goodness ol any house wil be curtai'ed if that house comes under ttle
of affliCted f\1(!rcury. In 41J'> or S'" hOuse it can result into
mental depression, hysteria or even lnSMity. In se' house It may hamper
the birth of dli lclren or may cause t he birth r:l illegitil'l"'ate eNid. tn latter
c.aSlt position of the: house Shoukl al so be looked into in respect d
moral character. We do not Intend to touch the ptospe<ts of the S ..
house here, btA in oomber of cases, we have found that a women
having an affWcttd 1" \M:nus or having a mutual bchange d
Navamsa of Mars and venus, Saturn and etr:. obtahs a child by
her lover provided S"' house is owned by Mercury and afflitted MerQ..Iry.
In the case d iUegitimate Child birth, position must also be
taken Into consideration. An unaffticted Jupiter havW'Ig an Influence
(!Ver Se! house Ot Meroory Ot Ovet" !)'l'l lord will never permit illegitil'l"'ate
birth. In that case possibility of an adopted Child will b! there.
If Melts and Mercury are in the st" house ror Taurus ascend&nt, one
m&y himself or herSelf be an 3dopttd child. There are so many other
conditions with one wlll be adopted bv others. Generally Mercury plays
a significant role in almost aU such cases. It is easy to Yite about any
planet-ary combinatiOn and i ts restlt but it iS real ty very touch task when
we face diftlrultles due to other planets and their varied positions.
When a combination come under the influence of rv .. unber c:l
other p&a.netary conjl.l'lction or aspect. and a few are malefic and oths
are benefic among them, the judgnent contains lots of oorluslons. So
the vast study or practical horoscope can enable us to at dle
correct j udgment without any confusion. The: subject stculd firSt be
sludO!d deeply and should be applied In nurrber of cases to Judge the
correctness of reSIJts c:l any oorrbination in the practical life. Jn two
horOSO)pes, the SCif'n! combination give different restlts due to various
other dfferent factors. Proper Judgment Is the test of our knowtedge
and sldl of ir(erpretation.
However, we conclude that r-1ercury is no less Important t han
Jupiter in its scope and f ield and equal importance must be
attached during interpretation of the resul ts of the house having
concem wfth. lt Is Mercury only which provtdes us ski ll of Judgment and
art of interpretation of any birth chart.. Witt.:>vt strong Mercury, one
can !>om! rich but not great, as Mercury is most essential in all cases.
The sex outlook of the Signs ruled by Mercury
The outlook of Gemini Is a purely mertal ooe. Sex Interests are
quite secondary so far as the sign itself is concerned, though other
positions in th! hOroscope may bring into
Gen*ll es""'tlally a cold-blooded sign, without affection and
morals. l t is a kind of living Nways seeldng to know ltle
reason for everytting. Atways, and reactions. PS)Chologic:al analysis is a
Gemlnlan habit, usually accompanied by extr emely, but quite
unintentional and unconscious, cruetty.
It WCirts to "see the wheels go rol.l'ld", is entirel y unmindful of the
effea d the process upon its victim.
The normal atti tude of Gemini to sex matters i s not only
experimental, b.Jt very largely cool, cala.Jtating, and setftSh.
It Is usually considered a fickle and changeable slgl\ often with
considerable justification, but actual y the fickleness arises not from
wandemg affections but from a desire to attain its theoretical ideal.
Unfortunately ttis aim, while always un.satlsfactory, Is for Geri'\1
entirely inl>O<SSible for achievement. The Ideal varies aaxmllng to tne
mood d the moment. and may swing from one extreme to the other.
Gemhl i s a difficult sign for most people to oodetstand, It is much
more lo9ical t han the others.
Its anal ytical nature produces a tendency to read between the
lines. to imagine that other people mean m..tCh m)rt than
tlley say.
The mertal ql.ickness also causes rapid changes cl thought which
leave the natives of slower signs plodclng along the road which Getninli
has covered in a single leap.
Slowness in others is a constant SOU"Ce d amoyance to Gemini,
which is, at the best of times, an Irritable and highly-strung sign.
438
The \We c:K" h.Jsban:l of a Gemiri native must never be mentally
dull or OOtuse if happiness is to be m8irtained.
Owing to his sensitive nervous system and mental nature, the
Gemini person is subject to sexual peNersions, pert\aops especialty to
sadism. on acx::oll'\t d the: natural crUI!Ity of the sign, and its lack d
emo<lon ard sympathy.
Under affliction, Gemini exhibits c.rimlnal tendencies. lts natives
readity develop into forgers, thieves and confidence men, where Cf.Jick
wits and nimble: fingeiS are essential to suc:O!:SS.
Bigamy is also in keeping with the Gemini natl.re;, though probably
less so than in the case of Sagittarius and Pi sces which are more
convendonal signs, and therefore set more store by the appeatance d
respectability.
The clJar.ry or the Sign, hOwever. rs u$U3Ify in sex matters.
Natlltes of Gemini often carry on two love affairs simt.ltaneously, and.
after marriage, run c:buble
VIRGO
Virgo Is the natural sign of Wgl nity, therefore does not really
favour marriage at all.
The Virgo is usually suffiCient urto to a or
lesser extent. and can usualty adapt himself qutte comrortabty to a
celiOOte life.
Tt'e sign is a very ci:SC....,..,ative and critiCal one that iS not at all
easlty satisfled. It Is fastidious, dislikes being touclled, has a deep rooted
tear d irtection, all d which dlaractetistics J;fay an important part in
the sex oLtlook of itS natiW.
In women, VIrgo produoe a form of homosexuality.
This Is more unusual In the case d men. r-1asochism is probatlly the
commonest perversion.
In marriage, Virgo is may be much more affectionate than
appears on surface, b t he shyness d sign prtvtnts
any eJChlbltlon of affection.
Virgo make a faithful partner, not usuall y an exciting one.
As a parent,. Virgo is not special ly successfuL The dry, matter-of
fact, critical and faddy or fussy manner is not to win the
heart of a child very reodiy. As a rule, there ro very deep love of
children.
They are apt to be too much of a nllsance, too untkty, too noisy
to be wel come in t he house. As mi ght be expected, Virgo nearty
always preftrs girts to boyS, &a.rgely for these reasons.
Neatness and tktiless are usually strong VIrgo characteristics, and
are by no means oonfined to the WQmen of the si gn.
This tendency is shown in style of d-ess, also in care lavished on
the home and posse,ssions.
to this general tidiness, however, are not un::ommon.
c:ne meets of Virgo who appear to be quite careless and u,.idy.
The cause is generaly to be foood elsewhere In the horoscope,
but. even in pronounced case of appaorent carelessness, a love of order
or method is somewhere in and affects some particular thing.
Virgo rarely praises anything, more oft:en grumbles and Critk-ltes.
TNs does not mean very traJdl, and Is a matter of habit rat her
than the expression d real disapproval.
The general efficiency of the sign its native to assume t hat
no one else can do anything so well, 50 neatly, 50 methodical ly as
himsetf, and he is therefore relucta,. to deputise work to others. lf
forced to cb so, a,sists on interfering with detailed as to
ll>e exact methods to be employed.
Under affliction. Virgo makes carping critics and turns its women
into Shrews and SCOlds. Normaly, it can make a su:cess d
marriage if the partner ts of a somewhat similar character.
440
Cliapter 34
ll'fanet.s afllf fProjession
- 9dercury
Mercury represents learning, writing, arts, sculpture, medical
profession, expertise. ministership, message, wit, devemess, duality,
fame, astrology, wisdom, chanting Vedas, priesthood, birds, fame,
literature, p:>etry, scriptures etc.
Mercury Indicates mathematicians, traveling agents, poets,
advocates, printers, publishers, orators, ambassadors, clerks,
astrologers, travelers, secretaries, interpreters etc. In Mythology,
Mercuy iS regarded as the god of eloquence and commerce. f'.1ercury
strong and fa\40U"ably placed, makes one an orator.
Hertll"y Is a qtAck moving planet. He thus represerls speed. It Is
also called as the winged messenger. Therefore, it represents traveling,
carrying messages, tetter's, mailing etr:.
Mercury is the planet of wisdom. Favorably posited it makes a
person very Intelligent, wise and studious.
Mercury I s changeful. It denotes changes, and lack. of
concentration. It makes a person un5teacfy and fond of changes..
Mert<.rY represents plurality. It is dualistic. It <jves Interest In many
subjetts.
Mercury is convertible. This is why, In Hindu Astrology, It Is
regarded as a benefic when it is combined with benefics. And it is
regarded as a malefi c, when i t i s combined with mal ef-cs. Thus ks
nab.Jre varieS as quality of the planet with wtic:h ft iS conjoined.
ThJs It does not act fldependentty but In a subordinate position.
Mercury renders Its subjects active, versatile and disposed to
business and commerce. It makes one weiJ..informed and in dle
pursuit of knowledge.
Uterary men, aa:ountants, SChool teaChers, secretaries, book
sellers, clerks, postmen, messengers, engineers, radio. Wireless,
post, letters, typing. press, paper, cotton. representative.
seaetary, agent, dk, astrologer. b"ade of foreign goods, import
export, thread, mcury, tin, accounts, audi ting, able lawytr,
commissioners, antlassadors etc., are all ruled bv Mercuy.
Mercury represents Mathematics. It Indicates lecturing too. As
Mars also is connected !Mth Mathematics, when these are combined or
connected one may be a ,..t!l thematics lecb.Jrer.
MertLrY denotes Astrolog( too. ,..1ercury in abi lity in
Asb'ology, Combination of Sun and r-1ercury can denote Astrological
Profession. (SI.Il is a Karaka d professiorl. Connection d Merwry with
4
111
, 101:t1, and house also can indicate this protession).
Satyacharya says that Sculpture, astrology, recitation and
composition d poetry, research worSe. dealing In cloths, and catching
birds and animals are also ruled by Mercuy.
442
Cliapter 35
Conjunction of Various
(]'fanets 6y ?dercury
Mercury Conjunct Venus
If MerclWY has conjl.llc.t venus, the person liveS a life of refinement
and oolture. He is delicate, sensitNe, and mentalty blessed. He is bright
and dleerf\1, optlrristk and humorous. Above all other astrological
aspects, t his conjunction indicates musical and poetic tal ent. The
person is expressive and his greatest fulfillment comes from sharing his
wonderful mental harmony with He Is and
often brilliant There is a marked dexterity to the irtetlea. His
mWld is In a state of restful alertn(!SS, ever ready to feel out, or
obJe<t""ly analyze, a Once he does ttis, he Is then able to
generate t he most predse and appropri ate response. Uke Paul
Newman and Robert De Niro, who have the conjunctiOn within two or
three degrees, the person can charm anyone. He knows which words
cause what effects in whom.
The person is drav.on to all of the arts. He is graceful, agreeable,
and lighthearti!d. he is also a creature of comfort He: crllves
luxuries and the good life. Unless Saturn is strong In the birth chart. the
pel'$0n has no patience for disdpline and responsibility. He detests hard
wortt. struggtt, an:t dirty handS. H4! may be lazy, ShallOw, and in:tulgenl
He powerf!Aiy dlscotnlnatlng, and knows art Mel beao.ty better than
anyone. He is appreciative. However, the person expects to receive
pleasure and be: treated well. He: avoidS <iffiCUtt d challenging people as
as stressful SituatiOns. He has no use for austerities, the nqged life,
or any variation of .. roughing it". The pei"5Qn may, at times,
friendS and l cwed ones with hi s nellrhedoniSm and urYtVil ingnes:s to
comfort adversity. I n this regard, the person may be selfish and self
centered.
Tile person i s IOnd, sympathetic, and fun to be around. He is
taelfU Md clpiOm.?Jtic. Women at elise wi th him. As
wnus rules the love life,. the person gets an lntelllgetl, COI'M'Iurkatlve
spouse, one who is youtttul and beautiful. Unfortunatety, the Ptner
m&y be fldde or emotion81y detached in the relationShip. The person is
very social. He wears rice clothing and has a youthful appearance has
entire life. He may be somewhat effeminate due to hi s grace and
sensitivky. He may also be accused cl vanity. Aside from music: and all
arts, he i s attracted to faShion or d!Sigl, drawing, and writing
(but not the tedious sort). If the conjunction is f)(tremely dose by
degree. the neNeS wil be too delicate ard the person suffers mentall y.
In ne.arly all cases, there is an occ:asioll81, but profound, stubborooess:
because the petson Is so enamored wtth his own logical and mental
process.
Mercury Conjunct Mars
If is conjunct Mars, lhe person iS mentaUy aggressive. He is
direct, outspoken and a good argument. The person Is talented
In mec:hanks and has great maooal dexterity. He is attract ed to all
technical ftelcls such as archite<ture, engineering, drafting etc. He is lhe
best troub&t-shooter and problem-sol\. The person Is competitive and
nothing but goal-oriented. He is successful, and cbes It takes
to obtain desired results. The person is ingenious and easily solves
puutes. He Is perfectionist and a great detail His IYW'Id is sharp
and al ert: he learns at lightning speed. There Is a magnificent
practicality to the person. He understands cause and effect better
than ar'T)Ione, and may a genius at manipulating drcumstances to
get wtlat he wants.
Tile r-1<ti'$Mercury conjunction is a fascinating one. AgC7essive
MarS benefits greatty from ass:oci8tion with inttUectu81 and senSitiVe
Mercury, whil e Mercury Is burnt by they fiery nature of Mars. The
person's peace of mind is definitety dist11bed. He may have a llot
temper or be on thl! side.
Thl! pers:on iS exdtable and M:s powerful h8s a heattby
sex drive. There may be an Indecisiveness caused by his wavering
confidenc:e. Because Mars rules sexual passion and is conjunct Merwry,
person is fascin11ted by intellectual, communicative lovers. (or
she) may also be extrerrely tal<.., b'( yootttul, fld<le types. The person
is stTon9-willed and has powerful blood. He is adventurous and active.
Mercury Opposite Mars
If Mercury is opposite Mars, the person is a professional u itic. He Is
perceptive and sees peopl es' flaws and imperfecti ons wlhout
sligttest effort. His mhd Is shllrp and and works too
for his own good. There Is great Impatience and nervousness. The
person may be irritable and have a short, hot temper. He may
problems d11lng chikllood with hyperacttvity or tantrums. The person
is a great problem-solver. Unfortu'lately, his morals are not the best., as
hi! consi dtYs life a wio-lose game where "the g:>od guy finishes last." He
is fall'ly selfish, and his first task in life is learning how to beat the system.
His SJ"eat est pleasure comes from circumventing or by passing the rules.
The person may li e regularty or fall to keep hiS w<Xd. He believes the
end ju.stlftes the means 8nd iS not partlculal'ly concerned with Integrity.
In e)(l:feme cases, there may be stealing, shoplifting or aimlnal activity.
The person clrect and blunt. He often speaks before lhlnklng
and may thereby offend others. He has the most energetic mind and Is
witty, sarcastic, and humorous. The person is as p-ad:ical as can be and
he: teams very quickly. The person must beware d headaches as well 8S
problems with the lungs, Intestines, and nervous system.
Mercury Conjunct Jupiter
If t-1errury is conjunct lJpitet; the person is exuberant.
He is excited, enthusiastic and wonderful ly expressive. He is broad-
minded and open to new concepts. The person lows words and excels
In any secretaria,, literary, or oommunicatlons career. There Is an
expansive quality to the person's mind and he is constantly cOfring up
with creative Ideas. He makes the best advertising agent or plbllcist.
He absohJ:ely lives in the mometlt and takes cMe of letters, calls,
and other organizational details without any apparent loss of energy.
The person is optimistic, hopeful, and does not get caught up in
df!t)re:sslon or the good word. He is generous In spirit and wants
evayone to enjoy the others feel genuinely uplifted. His greatest
happiness may come from supporting other peoples' projects. He is
popu1ar. well-l iked, and may be the life of parties. urtortunatety, the
person may be lazy.
Mercury Opposite Jupiter
If Mercury is opposite Jupiter, the person has no sense of mental
proportion. His thinking is too expanSive or exaggerated, and his
judgement may be dl.torted. He may gl\oe poor ad>lce to others. In his
great optimiSfl\ he is too certain of his opinions and does not consider
all the: facts and partiaJarS. is blinded in tiS beliefs and stuCk in his
convictions. He has a rich Imagination and fartasy life, and thinks In
grandiose terms. He may have his hands in too IT'I(Iny projects ttle
same time. Some individual with the hard MercuryJupter aspects are
fuzzy In their oonwnunk:atlons and amazingly unable to oome to the
point.
The person Is watm, generous and sympathetic. He Is good
natured and wants everyone to enjoy. He is charming and loves to
party and indulg(! in the senses. Because of hiS expanSive viewpoint,
the person does not rrind lying. He tells small fibs or white lies
constantly, whenever thev setve his interest without hurting anyone
elSe. is favored and the person gets great pl easure rrom
experiencing all that life has to offer.
...
Mercury Conjunct Saturn
If t-1ercury Is conjunct Saturn, the person lives a life of
concentrated His nW'Id is slow, but deep. There is logic
and reasoning power. The person Is cautious and serious. In the
beginning ct life cotmn.nlcative abi lty Is significantly lrhlblted. He
may even have a speech defect, lisp or stutter. As a result., the person
Is shy and self-consdous, and he works diligently to correct and
lmpetfectlons he feels he has. He may be a slow teamer In school and
find himself behind his peers. However, he patiently applies himself and
in the end may SLrpass all others. He is exacting and very careful to
avoid mistakes. Ji.S he gains In maturity he i s likety to be-come an
authority In his fldd. If the rest of the dlart Indicates a and
intellecb.Jal life, the person may be profoundly pen::eptive.
The person is practical and d:>wn-to-earth. He i s not easily fCIOied.
He is adept in math and science and enjoys facts and figures. He Is
object-.,, rational and detached In l'ls 1111nldng. He Is methodical and
systemati c, disciplined and responsible. Because Mercury rul es the
nervous system, and Is so harml!d by satum, the person may have
netVous problems or sl.lfer the most lntef"6e lack of confidence. He
may be fearful and have tremend<XJs ciffiOJity improving or overcoming
psychological compk!xes.. Health-wise, he must take care: of his kmgs,
lntestr.es and nei\I'Ous system.
Mercury Opposite Saturn
If Mercury is opposi te Saturn, the nervous system is under
continual pressure and the confidence is acNersety affectecl. There may
be: a deeprooted inferiority complex or a sober and solemn personality.
Eatly chik:lhood may have brought difficulties whi ch conditioned the
per$0n to e:.pea thin95 to tl.rn out bady during his entire life. There is
a great fear of and a itidsm. and tht person may find it impossi>le
to take risks. On the positive side. If the rest of the birth chart Is
powerful and indicates ani)ition, the pe1$0n may be cisc;.iplined and
Wl'!ll organized. tit'! capable of k:lgic, and predsiOO in his
work.
Because is the natural ruler of the t hird !louse, there will
be problems or discoid wi th Si:lings or relativeS.. some: individualS with
hatd MercurySatum aspects are sl ow In thought and have trouble
learning. In nearly all cases, there is a danger of narrow-mindectless and
an unwillingness or inability to open up to tht'! support d others. Tht
person is extremely sensitive and vulnerable, and ftnds It hard to
acknowledge tis limitatiO"'s and deal with them in a way.
He is strict and rigid in his t hinking, and unconsciouSly pessimi stic about
change and transformation, espedally In psychologk:al or emotional
areas. He would do wel l to QJiture a sensed experimentation, without
attachment to the outcome. If he is not careful he may become a living
example of dt'!nial. Tht'! person is cauti ous and tit'!
to culttvate hJmor, fund and ec:cltement.
Mercury Conjunct Uranus
If r-tercury Is conjunct Uranus, the person lives a life of
independent thinking. He is original, inventive, and higNy alert. The
mind works at lightning speed and there are continual nashes of
Intuition. The person may be brilliant or a genius. He will be talerted In
Astrology or any ocaJit art. He may be drawn to math or science. The
person may be high-strung and easlty excitable. He has difficulty
appredating lUes, regulations and the sluggish paoe of ordlnafY He
is geat annoyed by slow thinkers. The person a ife of incessant
actiVIty, and his body will eventuauy pay the price unless he l eams
lntdllgent restraint and the Important of taking care of himself. Hls rrlnd
may exceed his capabilities. Tht'! person i s elq)eri mental and entirely
unafraid d new endeavors. He may be Inspired, shrewd. ard insightful.
He Is also potentially st\Jbborn, self-willed. And Infatuated with his own
mind. He occasionally may seem fanatk:al. There is a need for patience,
di scipline, tolerance and hli'Tlility. The mind is dynamic, positive, and
outgoing.
448
Mercury Opposite Uranus
If Meici.I'Y is opposite Urarus, the person is a rewlutionary thlri<.er.
He is eccentric, perceptive, and extraordinarity experimental. He loves
to arouse, Incite, al'd shock those arol.l\d him. He: always watU to tty
ll>e new and lasdnaUng. The perwn does not enjoy 1\Aes,
traditions, and conventkln. And he is a thorn in t he side of the powers
that be. Most certainty, he will not be told what to do Or think. The
mind works too fast and the person is as mentaly impatieft as they
come. He needs a great deal of stimiJation and is easily bored. He may
speak without due forethought and thereby ctrend others.
his spontaneity Is essendal to creativity and lrwentiveness.
The person Is intuitive al'd by Instinct He is impulsive and
unpredictable. He is too restl ess and may suffer from nervousness and
irritabil ity. Above an, he must take responsibility for tis i ndependent
nallJre, and stop delencing himself-a tendency he may have de"'loped
during rebello<ls childhood l'l"" There Is, most likely, great lrtelllgenoe
or genius. But ttle person may be only too aware of the fact. He may
fancy himself a gitl: to the worfd and make a pest ol himself to others.
The person is Inspirational and exci ting. He Is honest and di"ect.
Howe.<er, he may also be o\.tSpOken, blunt and tactless. He team ttlings
fast but may be too in hiS jt..dgements.
Mercury Conjunct Neptune
lf Mera.ry Is conjooGt Neptune, the person Is t he most
of all people. His reality is entirety oonceptual and he lives in his visions
and inspirations. He is a <teamer in both the best and worst sense.
There are no bourdarieS to his trin:l ard M is comfoltab* wit h the
myst5cal side of life. He Is i"ltuldve In a profound wlfrl and gets his
i nformation from sources that are hi dden even from hi s own
understanding. 'T'h! per$0n is sensitive, delicate: and tspially artistic.
The person suf fers In his personal life because of an Inability to
distingui sh objective real ity from w;$hful thinking. He is powerfull y
idt'!alistic lll:out his ideM and conceptS, and dings to them in the face d

any opposition. The person IT'IaY absolutely, even if quietly, disregard
wis:hts d ()(hers in order to follOw the clet3tes: of his own mind. He
may Ue and regul arly fall to keep his word: however, there Is no
I'T'Iali c;ious, or even purposeful, intent in su::h actions. The pel'$0n simply
has difficul ty asSOCiating form and stru::ture with the though process.
He forgets his prorNses and conmltments because he lives kl a world of
mental unboundedness and there is littl e connecting t hread from
moment to m::ment The person iS refined and cul b.Jred. His thinUlg is
sublime and traf\SO!f'ldental, and his consciousness moves unfettered
through different realms of ex-ist:enc:e. He loves meditation or any
disdpUrl! whiCh makes use of his limitleSs perctption. Astrok:lgy, occult
sub}ects and spiritual endeavors may all be vital features d the person's
life.
Mercury Opposite Neptune
If Mercury is square or opposite Neptune, the person Is mentally
unfocused. His t hinking i s douded by his feelings, and he is often
confused, scattered or diffusive. He lives by psychic not
rational thought. He does not create enough mental boundaries for
himself and is theret'tte an easy target d deception. He loves gossip
and other emotionally stimulating diversions. He is concerned with
sensations and abstractions rather t han details, facts and There
is a rich and vivid imagination, and the person may lfve a fantasy or
dreamlike exlstenre. There is a need for p-actlcality and realistic vision.
The person &acks conrldence in a major way and may be powerfUlly self
deluded. He may i gnore, or totall y deny, troublesome aspects d his
existence which he: is afraid to coriront He may nagrantly lie to himself
as well as others, t hough not purposefUlly or out of harmful lntent.
Decision maki ng may be a source of struggle. The person is
metaphyslcal y oriented and open to the occ-ult . He believes In
astrol ogy, the psychic workS and aU phenomenon of a non-physical
reality. Art, music, poetry and other sensual cUtural pursuitS are
highly fawred. The nervous system i s and the person must
avoid overwork and stressfU situations. He may be prone to such
illnesses as epilepsy, asthma etc.
450
Mercury Conjunct Pluto
If Mero.ny Is conjt.net Pll.to, the person lives a life of problrQ and
observing. He i s as a detective; he is curious, discriminating, and
determined. escapes his eye. He is the best analyst and
psychologist, and often makes accurate judgments wN"dl come for
more quickly than they sholld. The person k>ves knowledge, and is
computslve In his desire to kR:>w and l eam; ttis ba!Uiring knowtedge Is a
major purpose of Ns life. He has a deep, penetrating mind and wants to
get to the core of all matters. He may be particularty relentless v.i'len
pursuing an issue. Tl'ere is a $prib.Jality or profotl'ld wholeness, to the
perSOn's thinking. The person ts of profoll'!d concentratkm. He
may have easy access to his unconscious mind. It Is audal that the
person be extra sensitive to the effects of his mentality and
expressions. His thoughts carry enonnous power and his words
w-eat Impact on peopte's lio.es. He can gain more from affirmations,
positive thinking and aeative visualization than anyone. He is persuasive
and may live to disseminate knowledge. On the negative side, the
person should beware of the tendency toward manipul ati ve or
overbearing cornrn.mications.
Mercury Opposite Pluto
I f Mercury i s opposite Pluto, the person is too intense and
subjectm In his ttl"<lng. The nind Is attadled to the ego and the
emotions, and the person is stubborn and opinionated. There is a
possibility of p-ejudice, bigOtry, and deeprooted arrogance. During
childhood the person was maniP\Iated and dominated in his ideas,
concepts and phii05QPhy. The person is direct and bhsat He
chooses his words carefully, and knows exactly how to verbal y affect
others. He iS capable of extremt sarcasm and Because the
nervous S')IStem Is adverseJy affected, there may be resUessness and
impatience. Illnesses are caused by stress, strain and ovework. The
lungs and intestines are vlln!rabJe and there is susceptibi ity to asthma,
epil epsy and other nervous aliments. The mind Is analytical and
penetrating. The person i s acutely aware of peoples' flaws and
weaknesses. He is quic;k witted, worderfu1ty curious and interested in
secretive or ocaJt knowll!dg!. to l earn everything he can in
life and get to the oore of all mattets. Unfortunately, he may not be
QPe'l and trusting enough to benefit from the wisdom cl tis peers and

452
Cliapter 36
Vpayas - !Makfic !Mercury
Maltfic MerOJry causes loss d money, business, troutJes in s e r v ~
matters, heart, liver. digestt\.<e and circulatory diseases. Accident O.ut ng
journeys and food poisoning.
Before the odvent c;{ the period c;{ molefic M"""ry (Budho) doily
ren:lering for twenty one days, Sri Vishnu astothara sahasranama ( 1008
Names of Sri r-1aha VlsMu) In the m ~ g and before retiring to bed,
offering pan (betel leaf and nuts) fruit and incense is recommended as
an Astral Spirib.Jal retl'le<tt'. On the twenty tirst day nve persons should
be: given food, be:tel leaves, nuts, fn.tits and Oakshana (money). During
the twenty one days red, black. blue, violet etc. coloured dothes
should be avoided. Tulsi leaves or betel l eaves be used for pooja
(offering In worship) Sprouting green gram be offered as sac:rltlc:e
(Nivedan) and part given as Prasad to family members and the rest
consumed. If possible Sri Satyanarayana Vratha on the twenty tirst day
is all the more best.
MANTRA FOR MERCURY -to be chanted 4, 000tlmes.
Priyangava-guNkasyam ropena pratjmambudiJm
Sattn yam satm yagunopetam tam budJam JXIJillNTIINTIY a/lam
I'ROM.NaAliON
Preeyangava gul eekash yam roopeyna prateemahm budam,
sowmyam 50wmya goono-peytam tam boodam pranamahm mtaham.
I bow down to Bud<lla, ipd ($the planet Mertuy, whose face is
a fragrant gloM or the priyangu herb and whoSe
that or a lotus flower. He Is most gentle. possessing all attractive
qualities.
weaknesses. He is quic;k witted, worderfu1ty curious and interested in
secretive or ocaJt knowll!dg!. to l earn everything he can in
life and get to the oore of all mattets. Unfortunately, he may not be
QPe'l and trusting enough to benefit from the wisdom cl tis peers and

452
Cliapter 36
Vpayas - !Makfic !Mercury
Maltfic MerOJry causes loss d money, business, troutJes in s e r v ~
matters, heart, liver. digestt\.<e and circulatory diseases. Accident O.ut ng
journeys and food poisoning.
Before the odvent c;{ the period c;{ molefic M"""ry (Budho) doily
ren:lering for twenty one days, Sri Vishnu astothara sahasranama ( 1008
Names of Sri r-1aha VlsMu) In the m ~ g and before retiring to bed,
offering pan (betel leaf and nuts) fruit and incense is recommended as
an Astral Spirib.Jal retl'le<tt'. On the twenty tirst day nve persons should
be: given food, be:tel leaves, nuts, fn.tits and Oakshana (money). During
the twenty one days red, black. blue, violet etc. coloured dothes
should be avoided. Tulsi leaves or betel l eaves be used for pooja
(offering In worship) Sprouting green gram be offered as sac:rltlc:e
(Nivedan) and part given as Prasad to family members and the rest
consumed. If possible Sri Satyanarayana Vratha on the twenty tirst day
is all the more best.
MANTRA FOR MERCURY -to be chanted 4, 000tlmes.
Priyangava-guNkasyam ropena pratjmambudiJm
Sattn yam satm yagunopetam tam budJam JXIJillNTIINTIY a/lam
I'ROM.NaAliON
Preeyangava gul eekash yam roopeyna prateemahm budam,
sowmyam 50wmya goono-peytam tam boodam prana mahm mta ham.
I bow down to Bud<lla, ipd ($the planet Mertuy, whose face is
a fragrant gloM or the priyangu herb and whoSe
that or a lotus flower. He Is most gentle. possessing all attractive
qualities.