Sie sind auf Seite 1von 393

Albrecht W e z l e r a n d Shujun Motegi YuktidTpik

Alt- u n d Neu-Indische Studien herausgegeben v o m Institut fr Kultur u n d Geschichte Indiens u n d Tibets an der Universitt H a m b u r g

44

Franz Steiner Verlag Stuttgart 1998

The Most Significant C o m m e n t a r y on the Smkhyakrik

Critically edited by

ALBRECHT WEZLER and SHUJUN MOTEGI

Vol. I

Franz Steiner Verlag Stuttgart

Die Deutsche Bibliothek - CIP-Einheitsaufnahme Yuktidlpik : the most significant commentary on the Smkhyakrik / critically ed. by Albrecht Wezler and Shujun Motegi. - Stuttgart: Steiner, 1998 (Alt- und neu-indische Studien ; 44) ISBN 3-515-06132-0

ISO 9706 Jede Verwertung des Werkes auerhalb der Grenzen des Urheberrechtsgesetzes ist unzulssig und strafbar. Dies gilt insbesondere fr bersetzung, Nachdruck, Mikroverfilmung oder vergleichbare Verfahren sowie fr die Speicherung in Datenverarbeitungsanlagen. Gedruckt auf surefreiem, alterungsbestndigem Papier. Gedruckt mit Untersttzung der Deutschen Forschungsgemeinschaft. 1998 by Franz Steiner Verlag Wiesbaden GmbH, Sitz Stuttgart. Druck: Druckerei Peter Proff, Eurasburg. Printed in Germany

Table of

Contents VI VII IX-XXIX XXX-XXXII XXXIII XXXIV-XXXVI XXXVII

1. Preface by Shujun Motegi 2. Preface by Albrecht Wezler 3. Introduction 4. Signs and Abbreviations 5. Facsimile of K..., 6. Facsimile of D 7. Facsimile of B 8. The Text of the Yuktidipik (a) Prathamam hnikam (b) Dvitiyam hnikam (c) Trtiyam hnikam (d) Caturtham hnikam (e) Pancamam Ahnikam (f) Sastamam hnikam (g) Saptamam hnikam (h) Astamam hnikam (i) Navamam hnikam (j) Dasamam-Ekdasam hnikam 9. Appendix I: Bibliography

1-56 57-108 109-142 143-166 167-186 187-200 201-220 221-238 239-254 255-270 271-277

10. Appendix II: The Text of the Smkhyakrik as attested in the Yuktidipik within the commentary to the corresponding verse 278-285 11. Appendix III: The Text of the Smkhyakrik as found in contexts other than those of Appendix II 286-290 12. Appendix IV: Index of Words of the Smkhyakrik as attested in the Yuktidipik and the Marginal Notes of the Kashmir and Delhi Mss 291-307 13. Appendix V: Index of the verses quoted or at any rate found in the Yuktidipik 308-320 14. Appendix VI: Pda Index of the verses quoted or at any rate found in the Yuktidipik 321-333

IV

YUKTIDIPIKA

15. Appendix VII: Index of the prose passages quoted or referred to in the Yuktidipik and in the Marginal Notes of the Kashmir and Delhi Mss. according to the sources 334-342 16. Appendix VIII: Index of the prose passages quoted or referred to in the Yuktidipik and in the Marginal Notes of Kashmir and Delhi Mss. in alphabetical order 343-346

For Masaaki

Hattori,

the great authority on Indian Philosophy

Preface The first time I encountered the text of the Yuktidipika edited by R.C. Pandeya was in the spring of 1971 in the office of Prof. Masaaki Hattori at Kyoto University. As a beginner in Sanskrit, I found its Devangari script so mysterious that I was convinced that the text contained yet unknown truths of the world, and even of life itself. Wanting to unravel its secrets, I decided, a few years later when I was an M.A student studying, thanks to a grant of the General Cultural Scholarship Scheme of the Government of India, for two years at Benares Hindu University, to go through the text under the guidance of Prof. K.D.Tripathi. Following my return to Japan I continued despite the fact that I had not discovered the truth which might have led me to the highest goal of life to work on the Yuktidipika, and after some time I came to realize the necessity for a new edition of the text. As I knew that Prof. A.Wezler had already announced in his 1975 article "Some Observations on the Yuktidipika" his intention to prepare a critical edition of the text based on the newly discovered manuscripts, I contacted him and offered to work with him on the new edition. I must admit that I did so with some hesitation, for I was not sure that I had the requisite experience in collating manuscripts, and I had also, due to other demands, been away from Indological research for some time. Nevertheless, he was generous enough to accept my offer, and we decided to undertake a joint project. Five years ago, with the financial help of the Japan Society for the Promotion of Science (Nihon Gakujutsu Shinkkai) and the cooperation of my colleagues at Shinshu University, I was able to stay in Hamburg for an entire year. This year proved to be most pleasant and fruitful. Prof. Wezler's wide-ranged and deep knowledge of the Indian classics was a constant help and inspiration, and I gained much from his expertise, although, I am afraid, I took too much of his time. And now, much later, we have come to the final stage of our project (as regards the first volume of the edition). It will be my real pleasure and pride if this joint work is able to contribute even a little to the splendid history of Indian Studies. Space being limited, I am not able to thank all the unforgettable people who helped my wife and me in various ways in Hamburg. Nevertheless, we would like to express our heartfelt gratitude to Mrs. Monika Rieger and Mr. Gnther Kahl who kindly provided us with a calm, comfortable and well-equipped flat at Jungfrauenthal. Without their help our life in Hamburg would have been quite different and certainly much more difficult. Last but not least, I would like to thank Mr. T.Tomabechi, assistant at the University of Lausanne. I owe much to him for the layout of the present edition. He was so cordial as to give much of his time to adapt the computer software to the needs of this edition, with the result that he was able to mysteriously call into existence all the elements we came to need. Without his invaluable assistance this edition would not have attained its present form. Nagano, September 1997 Shujun Motegi

Preface It was long ago that I realized the need for a new and fully critical edition of the Yuktidlpik, took the decision to prepare it myself, started to microfilm the available manuscripts and announced my intention publicly! Nevertheless the publication of the present edition does not give me an opportunity to quote the German saying "Gut Ding will Weile haben" (= "good things take time"). Rather I do very much feel that an apology is due for the unusually long delay, for keeping in suspense fellow scholars and all those interested in Smkya philosophy for so long a time. I realized quite early, in fact immediately after the publication of my first article on the YD in 1975 (cf. "Bibliography"), that I had gone one step too far in my "Observations", viz. by drawing the conclusion that the "Vrttika" and the "Bhsya" go back to two different authors; and this did not, frankly speaking, really fill me with enthusiasm for a work demanding no little self-denial. In passing only I should like to mention here that I told Shinkan Murakami about this revision of my opinion about the authorship of the "Vrttika" and the "Bhsya" when I met him in Japan in 1983, and that he was kind enough to report this in his article "Yuktidlpik Yakuch (I) ( "Yuktidlpik Translated into Japanese with Critical Notes", published in the Annual Reports of the Faculty of Arts and Letters, Tohoku University 33, 1983, p.42 (cf. "Summary", p.251)) just as Johannes Bronkhorst a little later (cf. his article "Vrttika", WZKS XXXIV, 1990, p. 123 n.l). The main reason for the delay, however, is that I simply did not have the necessary staying power, even though I was once granted a special sabbatical term by the "German Research Council" (DFG) for this purpose. I was too short-winded, and almost exhausted my strength in writing articles: It was thus much easier to give my self-esteem what it direly needed, viz. regular confirmation by work finished within a relatively short period of time. There was perhaps also a deceptive idea of being thereby able to clear the way for the more demanding work of the critical edition. In any case, it was an extraordinary piece of luck that I finally came into contact with Shujun Motegi who had himself already started working on a critical edition of the YD, and we got along with each other so well that it was but natural to decide to join hands and to prepare the edition jointly. I do not want to describe our cooperation in any detail, but should like to state at least that Shujun Motegi did by far not only take on the tremendous job of putting all that is printed here into the computer overcoming too the various and partly very intricate difficulties of the software used (which was in fact changed two times; cf. "Introduction", fn.12). Suffice to say that had he not come to my assistance I would still not have been able to finish this work. I am deeply grateful to him also for the composure with which he took my occasional outbursts of temper and his sympathetic approach when I was going through a difficult period and it looked as though I was down and out. We have certainly taken the seven steps of Pnini 5.2.22! Hamburg, September 1997 A. Wezler

I n t r o d u c t i o n

T h e N e e d for a N e w

Edition'

When in 1967 Ram Chandra PANDEYA published his edition of the "Yuktidipika. An ancient Commentary of the Smkhya-Krik of Isvarakrsna"1 it was no small step forward: in contradistinction to the editio princeps by Pulinbehari 2 CHAKRAVARTI in 1938, based on just a single manuscript from Poona, viz. our P, PANDEYA was able to use a second manuscript from Ahmedabad, viz. our A. To be sure, the number of passages, i.e. parts of sentences or whole sentences or even consecutive sentences, left out because of aberratio oculi etc. in either of these two manuscripts, is amazingly large; however they are also, fortunately, distributed in such a way that the two manuscripts supplement each other, at least in most cases, so that a much more complete text could be constituted by PANDEYA. But his edition stands out for other reasons, too; not a few quotations from or references to other texts have been identified, an attempt has been made to further the intelligibility of the text by dividing it properly * A critical edition as such clearly calls for no justification, and by no means only in a discipline like Indology. A. AKLUJKAR'S statement (in his review of W. RAU, Die handschriftliche berlieferung des Vkyapadyaund seiner Kommentare, Mnchen 1971, OLZ 71 (1976), p.286): "If misinterpretations and wrong leads are to be avoided, studies of ancient and medieval works must, as far as possible, be based on critically presented texts" is only too true, although this is equally true of "modern works", a very instructive example being many of the various texts written by L. WITTGENSTEIN (cf.e.g. Wittgenstein ber die Seele. Herausgegeben von Eike VON SAVIGNY und Oliver R. SCHOLZ, Frankfurt 1995 (Suhrkamp Taschenbuch Wissenschaft 1173)).
1

Yuktidtpik, An Ancient Commentary on the Smkhya Krik of varakrsna, edited by R.C.Pandeya, Delhi-Varanasi-Patna, 1967. Yuktidpika, edited by P.Chakravarti, Calcutta Sanskrit Series No.23, Calcutta, 1938. Note that editions which are not directly based on (the) MSS like e.g. Rmasankar TRIPTH, Ivarakrsnaviracit Smkhyakrik Rmasankara-Tripthiviracitay Tattvaprabhkhyay vykhyay ajntakartrkay YuktidTpikvykhyay vivrty ca vibhsit ..., VrnasT 1970 have been ignored by us.

YUKTIDIPIKA

into paragraphs, by means of an improved punctuation, by many emendations 3 and last but not least by various "Appendixes" and "Indexes", the most useful no doubt being the "General Index" (though it is by far not complete, not even as regards the references given under the entries included). 4 Nevertheless PANDEYA'S edition did not come up entirely to the expectations which nowadays are justly placed on a critical edition, even in Indology: his edition is not based on all the available manuscript material, 5 his information about the actual readings6 is not always reliable, the text as constituted by him is at places clearly wrong for various reasons reaching from simple printing mistakes up to misinterpretations or failure to understand a passage. Therefore a new and fully critical edition of the Yuktidpik is clearly a desideratum, especially in view of the extraordinary significance this text has, and by far not only for the history of Smkhya philosophy.7 Characteristically for Indian studies, it may be noted at this point that we have already a summary of the contents of our text 8 and at least one complete translation, so-called.9 With all due deference to our predecessor(s) our critical apparatus bears
3

It is not, however, always possible to determine whether a particular reading is an emendation proposed by PANDEYA or else actually found in one of the two MSS used by him. His main interest seems to have been to state time and again that CHAKRAVARTI reads x "against Pn" (our MS P). It should be noted that this is just a brief characterization of intended to be a comprehensive appraisal of his achievement.
PANDEYA'S

edition, and not

Even if the number of MSS of a particular text like e.g. the Mahbhrata or the Manusmrti is very large indeed, a selection can be made only on the basis of criteria which have at least to be made explicit and after checking the critical value of each and every MS.

As should be well-known in the meantime, already the mere act of reading a MS is at times intimately bound up with interpretation, i.e. implies decisions which, even if all of them are taken consciously, cannot, at least not always, be expressly stated. Unfortunately, manuscriptology, and the corresponding branch of palaeography, are rather undeveloped in Indian studies; not even the knowledge accumulated so far has been gathered and made easily accessible in a publication. See, however, K.L.Janert, Bibliographie mit den Berichten ber die mndliche und schriftliche Textweitergabe sowie die Schreibmaterialien in Indien (Berichtszeit bis 1955), Bonn 1995. The significance has already been recognized by E. FRAUWALLNER; cf. Geschichte der indischen Philosophie, l.Bd., Salzburg 1953, p.287 and 475. Viz. by RaghunathaSHARMA, Dayanand BHARGAVA, and Shiv Kumar SHARMA in : Smkhya. A Dualist Tradition of Indian Philosophy. Ed. by Gerald James LARSON and Ram Shankar BHATTACHARYA (Encyclopedia of Indian Philosophies IV), Princeton 1987, pp.227-269.
KUMAR and D. RAKAMI'S translation

Shiv

N. BHARGAVA, Yuktidpik, vol.1 Delhi 1990, vol.11 Delhi 1992. MU(for which see "Bibliography"), appearing in installments and not yet complete, is of quite different a quality. Edeltraud HARZER in the USA is presently working on an English translation.

INTRODUCTION

XI

ample evidence to this 10 we feel justified to claim that we have brought matters further to a considerable degree, and in many regards at that: 1. we have been able to use three more manuscripts, though one of them (B) covers only a small portion of the text and another (D) is a modern transcript (cf. 2 and 3 below); 2. thanks to this additional material we are able to offer a slightly more complete text, though as regards the longest 'new' portion, viz. pp.150.22154.5 of our edition, we disagree with each other, M. being rather inclined to regard it as secondary while W. thinks it is genuine; 3. with the help of this additional manuscript material we can edit also a Tippan (aThe Marginal Notes..."), a kind of subcommentary, though it covers only approximately the first third of the Yuktidpik (cf. 5 below); 4. many more emendations are proposed by us, and our text is certainly more intelligible than that printed by CHAKRAVARTI and PANDEYA; 5. we have succeeded in identifying quite some more passages as quotations and references, although we have not always been able also to discover their sources; 6. for the first time an attempt has been made at marking off the vrttikas (cf. "Preface" by W. and below 4) from the rest of the text; 7. we have tried to verify the cross-references within the Yuktidpik as far as possible and for the readers' convenience we have added the reference in each case; 8. the layout, the typographical features, and the critical apparatus 11 have been given a shape that should facilitate reading the text and ensure precise and full information, in spite of the fact that we had to put up with certain constraints due to the software used;12 9. the various indices forming the "Appendix" are, we trust, a further improvement (it should however be noted that the present edition will be supplemented by a second volume containing a word index to the whole of the Yuktidpik) ; In not a few cases we simply state that "we follow Pandeya", or "Chakravarti", or "Raghavan" (for whom see "Bibliography"). When we finally realized that a positive apparatus criticus is to be preferred, it was too late to change our edition accordingly.
2

The software used by us was "Techno Mate" in the beginning, then we changed it to "AMS IfejX" and this in its turn, finally, to "WT&L2".

XII

YUKTIDIPIKA

10. last but not least we are able to offer some new arguments of palpable significance for dating the Yuktidpik. Notwithstanding, we are, of course, fully aware that our edition is also far from being perfect. We do not, in this connection, mean the fact, highly deplorable though it is, that we, too, were not able to discover a single manuscript containing the whole of the text, and hence to fill the gaps already there in PANDEYA'S edition, viz. the commentary on roughly SK11-12, 60-63, 65-66; what we have in view is rather the possibility, nay, probability, that sometimes we, too, have overlooked a lacuna not marked as such in the manuscripts (one of the most intricate problems one is confronted with when editing a text), or have not recognized a quotation or reference as such, not to mention other mistakes, e.g. choosing the wrong reading, misunderstanding what the author actually intends, etc. Even simple printing mistakes were still there when going through the penultimate and even the final proofs a work we were most kindly assisted in by Dr. Harunaga ISAACSON, whom we should like to thank very much indeed also for drawing our attention to other mistakes and problems. Hence there are reasons which would speak in favour of postponing publication. But we think that we should not make our fellow scholars wait any longer for this edition which after all was announced quite some time ago. In addition, after working on this edition for a number of years now, both of us have gathered the impression that we run the risk of moving round in circles, i.e. of discussing for the third or fourth time a problem, be it a real or an alleged one, simply because we don't remember that, and why, a particular decision had already been taken by us earlier of which we could not, of course, always keep a full record or even keep minutes. That is to say, we very much need the detachment to be gained only by publishing away, as it were, our joint work in order then to be able to take a fresh and critical look at it which our readers will certainly also take, whose criticism, suggestions and remarks will be most welcome: as in the case of other philosophical texts, too, colleagues specialized in other strands of the rich Indian tradition can solve problems, and sometimes quite easily, with which the editor(s) has/have tackled in vain: non omnia possumus omnes, to quote the apposite Latin proverb, or to say it with Udayana, 13 bhrnteh purusadharmatvt.

Description of the

Manuscripts14

As the descriptions of the two MSS of the Bhandarkar Oriental Research Institute, Poona our P and of the LlbhT Dalpatbh Institute of Indology,
13 14

Viz. Nyayakusumnjali 3, 13/14. Note that the descriptions are by and large based on prints made from microfilms, not on the manuscripts themselves; cf.fn.17.

INTRODUCTION

XIII

Ahmedabad our A respectively as given by PANDEYA 1 5 are very brief indeed, more detailed ones are being given here. Yet we don't deem it necessary to publish again facsimiles of these two MSS, but confine ourselves in this regard to the new material. P The manuscript forms part of the collection of the Bhandarkar Oriental Research Institute, Poona, Maharashtra. (For the catslpgue(s) concerned see below p.XVIII). A paper manuscript written in Dev&ngar, it has 118 folios and measures 34x 15.3cm. It is paged on the verso, on the left margin, below the indication of the title, viz. sm. yu. dt, also on the right margin at the bottom, but the page number is lacking in some cases (e.g. folios 1, 12, 19, 70, 99, 100-103); upon folio 53 follows a single one carrying the numbers 54, 55, 56, 57. The text is written in a rectangular area with margins of appr. 4 cm to the left and right and appr. 3 cm at the top and bottom. There are 12 lines to a side, except for folio 74 verso which has 13 lines, folio 97 verso which has only one and a half lines, folio 98 which is entirely blank, folio 119 the recto of which has just 4 lines and a few words at the beginning of the 5th line, while its verso has only a few words, and folio 122 verso which contains only the colophon (cf.p.270). The number of aksaras per line is on the average 50. The manuscript contains no date; it covers the text of the YD from the beginning up to the end, but it is not complete. Lacunae in the text are indicated by blanks, with or without dots/dashes. The MS has not a few corrections on the margin, by at least one other hand. A The manuscritpt forms part of the collection of the Llbh Dalpatbh Institute of Indology, Ahmedabad, Gujerat. The manuscript, written in Devangari, carries the number 173; it has 47 folios of old paper, and measures 11.5x26cm. It is paged 1 - 47 on the bottom of the right margin of the verso, and there are no title indications. The text is bordered on the left and the right by two vertical lines; there are no similar horizontal lines above and below the body of the text. There are 15 lines to a side except for folio 47 verso which has only 12 lines. In the middle of lines 6-10 each side has a roughly rhomboid blank area in the center. The remaining lines, viz. 1-5 and 11-15, usually have between 35-45 aksaras. A number of folios, viz. 14 verso, 25 recto and verso, 28 verso, 39 verso, bear on the right or left margin the oval stamp "Llbhr Dalpatbh Bharatiya Samskrti Vidyrriandir Jnn Bhandar", which is, however, unfaded (almost) and legible only on folio 47 verso where it is there on the right below the body of the text. The manuscript contains no date; it covers the text of the YD from the beginning up to almost the end of the commentary on SK10. It starts with <bhale symbol>16 // Om namah kamaladalatnpulanayanbhirmya
15

Cf.

PANDEYA,

op. cit., Introduction, pp.xi-xii.

16

As for this symbol, cf.Chandrabhl TripthT, Catalogue of the Jain Manuscripts at Strasbourg

XIV

YUKTIDIPIKA

narayanaya // // snganesaya namah // (cf. p.l,fn.l), and breaks off with bhtstah prvasamsthnahnitah tadabhvd asiddho syai vise (cf.p.134.18). The intermediate colophon on fol. 37 verso, line 7f. (cf.p.107.14) is coloured and thus marked off from the text itself. At several places there are gaps in the text left blank, viz. on folios 12 verso, line 4 (appr. 6 aksaras), 17 recto, line 4 (appr. 7 aksaras, the gap being additionally marked by five dashes), 17 verso, line 12 (appr. 6 aksaras), 19 verso, line 3, 19 verso, line 12 continued into line 13 (altogether appr. 9 aksaras), 33 verso, line 8 (appr. 4 aksaras), 35 verso, line 14 (appr. 2 aksaras), 39 verso, line 4 (appr. 3 aksaras), 43 recto, line 12 (appr. 3 aksaras), 45 verso, line 15 (appr. 2 aksaras), 46 recto, line 1 (appr. 3 aksaras) and line 3 (appr. 4 aksaras) and 46 verso, line 10 (appr. 4 aksaras) and line 14 (appr. 4 aksaras). There is an ink(?)-spot on folios 3 recto, line 5 in the middle and on folio 17 recto, line 6 and 7 on the left which is visible also on folio 17 verso, lines 8-10 on the left. The MS has only a few corrections, apparently by another hand 17 . K The most important of the MSS not yet used by PANDEYA is K, i.e. the Srad manuscript deposited at the University of Kashmir, Srnagar. This MS is registered in the catalogue of the Sanskrit Manuscript Library in the Centre of Central Asian Studies of the University of Kashmir under the number 805 18 : A (Indologica Berolinensis Bd. 4), Leiden 1975, p.39, as well as Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute, compiled by Hiralal Rasikdas Kapadia, Vol.XVII: Jaina Literature and Philosophy, Pt.II: (a) Agamika Literature, Poona 1936, p.12 and Appendix II.
17

Several letters which I sent to the director of the LlbhT DalpatbhT Institute of Indology requesting him to come to my help regarding the exact description of the manuscript, were not answered. But Dr. N. M. Kansara who happened to be working at that time at the Institute as visiting professor and got in touch with me in another matter, was kind enough to give me the necessary information. In a personal communication dated May 27th 1997 he writes me (W.): "Dr. J. B. Shah had entrusted the work of locating your Ms. to the person in charge of the Ms. Library at the L.D. Institute here. But since, after going through all the old and new Catalogues of Mss., of the L.D. Institute, the Ms. of Yuktidpika could not be traced at N. 173, he could not send you any letter. After receiving your letter, I took up the cudgels anew in company of Pandit Amratlal, who is in charge of the Mss. Library of the L.D.Institute. In spite of all our efforts from various angles, we could not locate the Yuktidpika Ms. at No. 173 or any other number. We are sorry for our failure. As regards the entries of "le.sam.17 Sa" in the edition of R. Ch. Pandeya, "LE." stands for "LEKHAKA" (= 'scribe'), "SAM." stands for "SAMVATA" (= 'year') and "17 SA." stands for "17 SATAKA" (= 'century'). These are the usual abbreviations used in the Mss. by the scribes."

18

The description of K owes much to Prof.Shinkan MURAKAMI'S Yuktidpika Yakuch (I) (Yuktidpika Translated into Japanese with Critical Notes (I)), Annual Reports of the Faculty of Arts and Letters, Tohoku University, vol.33 (1983) p.40. He has been so kind, and selfless, as to come to our assistance by supplying copies of

INTRODUCTION

XV

paper manuscript, it is written in Sarada, measures ca. 13x 18cm, and is bound like a book. The MS consists of two parts, each written by a different hand. The first part has 7 folios, our siglum for it is KP, and it covers the text from the very beginning up to the upodghtah, p.8.16 of our edition. It starts with a symbol often found in the beginning of a manucript. 19 The first six folios are written on both sides, and each of the fifteen or sixteen lines has 18-23 aksaras. On the verso of each folio, on the left margin at the bottom, is given the page number below the title indication yukti dt . 20 The seventh folio is written only on the recto with six lines and, below this, five lines in smaller letters, this latter being a note on the term namas (cf.p.l,fn.(2) of our edition). Between the seventh folio and the first folio of the second part, there are four small slips of paper inserted. What is written on these slips are "The Marginal Notes....". We call these slips Ks.l, Ks.2, Ks.3, Ks.4, respectively.21 The second part, which is the main part of the MS, has 135 folios. Every folio is written on both sides, the number of lines being 22 or 23 with 20 aksaras on the average. As in the case of P, K is paged on the verso, on the left margin at the bottom, below which is the indication of the title as in P, that is, sm. yu. di. The page numbering is continuous from 1 to 105. The numbers 49 and 50 are missing though the title is there. On folio 105 a lacuna in the 16th line is indicated by dots and the text breaks off at this point (cf.p.224,fn.l). Then follows a blank folio, upon which we find a folio numbered 194, beginning with sr ganesya namah. Thus this folio corresponds to the first folio of our MS B which too begins with the same salutation. The numbering thereafter is continuous to 223 which is the last folio. As a whole K has the same lacunae as P. The most conspicuous feature of both parts of K is that they carry notes or comments anywhere, on the margin, or between lines, and that the number of these mounts to nearly 300 (cf.5). The notes usually set in at the point on the margin which the scribe considered to be nearest to the word(s) of the mla concerned, and there is no referential marking of any kind. Almost all these notes and comments are found in the first four Annikas. individual folios, and even of a whole MS (see p.XVII and fn.32 below), whenever we realized that our own material was incomplete or of too poor a quality. The full text of the registration is as follows: NO.805 Sankhya Yukti Deepika No.of copies one Script sharada Paper country Price 15 Date 27-X-56 Remarks 257
19 20 21

See above fn.16.

Only the first folio has the title indication rh yukti dt naturally enough. For "The

See p.8,fn.(2)-(3); p.9,fn.(l)-(5),(7); P.10,fn.(l)-(2); p.l8,fn.(2); p.68,fn.(l). Marginal Notes..." see below 5.

XVI D

YUKTIDIPIKA

D is a paper Devangar MS of the National Archives in New Delhi, the Serial No. being 3001 and the Acc.No.833/52; it has 361 leaves; its size is 34.5cmx 21cm. The leaves are numbered 1-298 on the right margin at the top the count 232 has been left out by mistake and thereafter 22 1-64. All the folios are bound like a book, and they are written only on one side. 23 This is evidently a very modern transcript of K2A made only after Independence, when, most probably for reasons of safety in the wake of the Kashmir imbroglio, a number of MSS were brought down from Srinagar to the National Archives in Delhi to be returned only later to their rightful owner (s). D is particularly noteworthy in that, on the margin, it quite often gives the readings of a kha-pustaka, called Dkha by us which is often in agreement with A , and at least twice also of a ga-pustaka25 showing that the copyist had access to two more MSS 26 and was scholar enough to note down the variants he found in them. As the result a folio usually consists of the main text and footnotes, if any. The footnotes are of two kinds. First, beneath the main text, the marginal notes of K are numbered in order to be able to identify the word(s) in the main text referred to. 2 7 Second, beneath the marginal notes again, if any, the variant readings of kha-pustaka are written with the line number of the main text added. The usual formula when indicating variant readings of kha-pustaka is pam number khapu.... iti pthah. But quite a few readings of kha-pustaka are written on the side margin too. In doing this the scribe evidently regarded the manuscript which he was actually transcribing in full as cka-pustaka\ One of the variants of Dkha was known also to the author(s) of "The Marginal Notes ..."(see p.H8,fn.9,(4) of our edition). The identity of both kha- and ga-pustaka, however, remains an open question. On the whole it is possible to say that D has a more ordered appearance than K. In this connection it should be pointed out that, in addition to the above mentioned characteristics of each folio, all the Ahnikas, except the 9th, begin on a fresh folio and generally the verses are set off from the prose. The sandhi rules are ignored more often than not and corrected on the margin,
22

The serial number 299 has been changed to 1. This is the point where K gives the serial number 194 after a blank folio and, at the same time, the point where B begins. Sometimes the marginal notes taken from K are written on the verso (cf.e.g.the leaves of serial number 9, 10). D sometimes uses a comma for punctuation (cf.p.80,fn.l7, p.l63,fn.2). See p.99,fn.7, p.212,fn.6. In addition, on the top margin of folio 45 we find the note gapustake 'pi, in small letters, though it is not clear which word is intended by this note.

23

24 25

26

The - theoretical - possibility of his referring to unknown editions can safely be ruled out. Corrections secunda manu in D, however, often agree with B so that one wonders whether the scribe of D had access to 5, or its original. In a few cases a mark is made in order to identify the word (cf.p.3,fn.(l); p.4,fn.(l)).

27

INTRODUCTION possibly by a different hand. B

XVII

The MS given the siglum B by us is the most fragmentary one, containing as it does only a small portion, i.e. appr. one fifth of the text, viz. pp.224270 of our edition. It forms part of the manuscript collection of the Library of the Benares Hindu University; its Serial No. is 3A/2194, the Accession No. C4083. "It consists of 29 leaves of about 14x23cm (leaves numbered 1-22, 25-27, three blank leaves and a final leaf unnumbered) written on both sides except l a (cover), last leaf (cover) and three further leaves; the whole is bound (or folded) as a booklet, each page contains 21 or 22 lines of 22~25 syllables in rad." 28 In the very beginning of the main text, upon "om namo nryanya", there is again the bhale symbol. 29 Only the page number is written on the left margin at the bottom of each verso without any indication of the title. Folios 23 and 24 are missing. 30 The texts of these missing leaves corresponds to a lacuna of the other MSS. Hence the lacuna is marked in B only by skipping the numbers 23 and 24. Actually B lacks even a few more lines which the other MSS have, just before and after the lacuna (see p.264,fn.l8). It should be noted that B is a paper MS, the paper giving the impression of being rather modern, but as regards the size of the pages and the arrangement of the lines it evidently follows the tradition of Kashmirian birch bark MSS ('copy book'). Finally the MS called "K2" by MURAKAMI 3 1 has to be mentioned, a xerox copy of which we have kindly been given by him. It contains the text from the beginning up to p. 107.1 (prayunj-) of our edition but is quite obviously a very modern 33 Devangar transcript of a part of D, 34 as it includes "The Marginal Notes ...", too. In our view this MS is of practically no critical value and has therefore been ignored by us.
32 28

Shinkan MURAKAMI, Benares-Manuscripts of the Yuktidtpik, JIBS vol.35-2 (1987), p.1019.37. See Descriptive Catalogue of the Government Collections of Manuscripts deposited at the Bhandarkar Oriental Research Institute, compiled by Hiralal Rasikdas Kapadia, Vol.XVII: Jaina Literature and Philosophy, Pt.II: (a) gamika Literature, Poona 1936, p.12. See above fn.16.

29

30

See Shinkan MURAKAMI, op.cit., p.1019.8-10. See his article mentioned in fn.28.

31 32

Of all the other MSS we used microfilms, taken by W. in 1972, 1974 (D) (in the latter case with the help of Michael WITZEL, who it was who actually discovered this manuscript, and
Balaram CHITRAKAR), and 1982 (B).

33

The paper sheets used have a headline "NOTES" and to its left "Form No 12A/ Mis."!

34

Cf. also MURAKAMI'S remark (op, cit., p.1020) that the MS "of the National Archivs, b&w* Delhi, ... is said to be the original of K2".

XVIII 3 Stemma

YUKTIDIPIKA codicorum

P forms according to "A [Consolidated] Catalogue of the Collections of Manuscripts deposited in the Deccan College [Poona, from 1868 to 1884]",35 as is also quoted by PANDEYA,36 part of the "Collection of 1875-76", was "purchased from Kashmir" and its "material" is "bhrja". In fact, however, P is, as already stated above, a Devangar paper MS. One possible explanation for this discrepancy is that P is but a copy of the original birch bark MS, and this is not only confirmed by the authorities of the BORI, 37 who rightly refer to G. BHLER,38 but also by typical misreadings of the Sarada original 39 by the scribe who made the Devangar copy. Yet, one is still faced with the problem of the present whereabouts of the Sarada original of P: was it really purchased by the BORI, or was it not rather returned to Kashmir after copying it and is it identical with "AT', i.e. MS No.805 of the University of Kashmir, Srinagar, as stated by MURAKAMI ? 40 There is, however, quite another and much more likely possibility, viz. that P is in fact the manuscript bought by BHLER in "Kasmr", since all the particulars given by him in describing it agree with those of P except for the material that is indicated by "ditto" to be birchbark (bhrja) (top of p.XXIII). Especially noteworthy is the agreement as to the number of folios ("122") and lines per folio ("12"), as also the fact that BHLER'S manuscript is classed as a new copy ("N.C.") and is written in "DevangarP. If this conclusion is correct BHLER'S "Detailed Report ..." would be wrong in just this one regard of "ditto" in the column on "Material". D, a Devangar transcript of K [see above p.VI], is of no little help in deciphering K1 including "The Marginal Notes ...", and gives, as has already been mentioned, variants from two more MSS (cf. above 2). A which covers the text only up to p. 134.18 of our edition does not show any of the specific features indicating that it was directly copied
35

Compiled by Shridhar R. Bhandarkar, Bombay 1888, p.xxx. Note that the manuscripts mentioned in G. BHLER'S Detailed Report ... (see fn.38) have been incorporated into this [Consolidated] Catalogue ...: see K.L. JANERT, An Annotated Bibliography of the Catalogues of Indian Manuscripts, Part 1, Wiesbaden 1965, p.126 (no.269). R.C.Pandeya, op.cit., Introduction, p.xii. In a personal communication by A. M. Ghatage (addressed to W.) dated August 28th, 1995. Viz. his Detailed Report of a Tour in Search of Sanskrit MSS. made in Kashmir, Rajputana, and Central India, Bombay and London 1877, p.XXIV(no.374). For example, P has preserved the jihvmltya in the second line of folio No.2 verso. As for typical misreadings of Sarada see Walter SLAJE, Sarada, Deskriptiv-synchrone Schriftkunde zur Bearbeitung kaschmirischer Sanskrit-Manuskripte (Indische Handschriften Bd. I), Reinbek 1993, pp.43ff. In fact what
MURAKAMI

36

37

38

39

40

says (op. cit., p.1020) is that it "is nearly the same as Pn", our P.

INTRODUCTION

XIX

from a Sarada original. It thus clearly stands out from the rest of the material. But at not a few points it is faulty and, what is even more important, offers readings which are clearly the result of an attempt at making the best, i.e. a meaningful text, of an original not really intelligible (for whatever reason). In parts of the text common to A, K, P and D, A has a number of lacunae peculiar to it as against the other three (at times they are even marked as such (e.g. p. 113 n.14, p. 123 n.10, p. 133 n,4)), and this its independence leads to positing the hyparchetype S. Note by the way that ^4's lacunae outnumber those in K, P and D (see e.g. p.62 n.14, p.66 n.12, p.67 n.12) and that many are cases of aberratio oculi (see e.g. p.4 n.6, p.8 n.2, p.11 n.4, p.14 n.14, p.59 n.4, p.61 n.17) indeed all the others too are probably due to mechanical mistakes. The relation between A and B cannot be determined because there is no portion of the text that is common to both covering as they do entirely different Ahnikas. As for the relation in which B stands to the other MSS, i.e.A', P and D, we should like to refer to MURAKAMI 4 1 who has already stated that "on the whole B agrees with Pn", our P, "and Kl", but adds that this holds of course good for D, too. All four MSS have two large lacunae in common (see p.265 n.l and p.265 n.9), viz. practically the whole of the commentary on SK 60-63 and that on SK 65 and 66. All of them have therefore at any rate at least one source in common, namely one in which the corresponding folios were already lost or illegible. It has, however, also to be noted that B has a number of significant lacunae peculiar or substantially peculiar to it, and significant as concerning not merely individual words (see p.233 n.8 and p.234 n.12), but whole phrases or sentences or a part of the mla (see p.259 n.17, p.264 n.18 and p.255 n.8), while in K and P only one such lacuna is found (see p.242 n.2). The first of the lacunae in B, the long quotation from Kdth.S. 11.3 (see pp.259-260), can hardly be a mechanical mistake, whereas the second one (p.264 n.18) may simply be due to the fact that at this point B is reproducing a source in which itself this lacuna was more extensive, already gone beyond the limits it has in the MSS K and P. These lacunae in B, i.e. the ones peculiar to it and the one it shares only in part with K and P, have led us to posit the hyparchetype e. All our manuscripts have extensive lacunae in common; 42 they have hence to be regarded as all going back to a common source, our (in which certain parts of the text, i.e. most probably on various consecutive folios, were missing.) On the basis of these considerations the relation between the MSS, on which the present edition is based, can be represented thus:

41 42

MURAKAMI,

op. cit., p.1018.

See above p.XII.

XX

YUKTIDIPIKA

The Constituted Text and the Features Employed

Typographical

In accordance with the methods of modern textual criticism 43 we have followed the so-called genetic principle 44 in constituting the text of the Yuktidpik. Yet this principle too cannot of course be applied just mechanically as if automatically yielding the correct results; in some cases, e.g. where only the sequence of words of a phrase differs in one of the sources (cf.e.g. p.5 n.l, p.23 n.17), no decision at all was possible; in other cases two alternative interpretations of the origin of variant readings seemed equally possible; only in these latter cases do we add in the critical apparatus the remark that a particular reading "is also possibly the original one". After repeated discussions we have arrived at the conclusion that the author of the Yuktidpik was most probably not consistent as regards his use of iti. Nevertheless we have at several places proposed or suggested the addition of an iti, which, if it should not appear acceptable as a conjecture, will at least clarify how we understand the passage or sentence. Our procedure was this: first we transliterated /f,45 comparing it carefully
43

See e.g. Martin WEST, Textual Criticism and Editorial Technique appliable to Greek and Latin texts, Stuttgart 1973; or Texte und Varianten. Probleme ihrer Edition und Interpretation. Hrsg. v. Gunter MARTENS und Hans ZELLER, Mnchen 1971; or G.Thomas TANSELLE, Textual Criticism and Scholarly Editing, Charlottesville-London 1990. On which cf. Srinivasa Ayya SRINIVASAN, Vcaspatimisras Tattvakaumudt. Ein Beitrag zur Textkritik bei kontaminierter berlieferung (Alt-und Neu-Indische Studien 12), Hamburg 1967, p.29ff. It is for this reason that certain forms of internal sandhi as generally observed in Kashmirian

44

45

INTRODUCTION

XXI

with D step by step, and then we collated the other MSS in order to finally examine the variant readings and to decide (whenever we deemed it necessary because of the genetic principle, or for reasons of the intelligibility, etc., of the text) in favour of one of the variant readings, even if it happened to be found only in one of the MSS, or else to emend the text. 46 The number of the Smkhyakrik to which a particular portion of the Yuktidtpikd belongs as well as that of the Ahnika47 of which it forms part are given as running headlines on the pages to the right. The text of the corresponding Krik, or a part of it, 48 are printed in capitals; pratkas, i.e. words of a Krik repeated in the Yuktidtpikd for the sake of linguistic, grammatical or semantic explanations, are given in italics. Words, or a number of consecutive words explained in "The Marginal Notes ...", are marked off by a number within round brackets ((1), (2), (3) etc.). Emendations are placed within angle brackets, sounds, syllables or words to be deleted within square brackets. Round brackets are used to add information which in our view is immediately useful to the reader, viz. cross-references (page and line of our edition) and the name of texts which are either quoted or referred to by the author of the Yuktidtpik, or in which a parallel to a quotation or reference in the Yuktidtpikd is found. In the case of references "cf." or "see"49 is added before the the name of the MSS have been retained. Although in our case there was no reason whatsoever to become suspicious, it is perhaps advisable to remember what BHLER wrote, in his Detailed Report ... mentioned in fn.27, p.33, about the Kashmirian pandit's practice of 'cooking' MSS: "As the DevangarMSS. are mostly prepared for the market, they are also not unfrequently cooked, i.e. the lacunae and defects in the original are filled in according to the fancy of the Pandit who corrects them. This most objectionable habit prevails in Kasmr to a very great extent, perhaps to a greater extent than in India proper, though in India proper, too, the Pandit has little respect for the sacredness of the ancient texts. That sentiment is in Europe, too, of modern growth, and not much older than the historico-critical school of philology, which arose in the end of the last century. In no part of India have I, however, been told of the practice of restoring or 'cooking' Sanskrit books with so much simplicity as in Kasmr. I was asked by my friends if the new copies to be made for me were to be made complete or not; and one Pandit confessed to me with contrition, after I had convinced him of the badness of the system, that formerly he himself had restored a large portion of the Vishnudharmottara."
46

A question mark after an emendation indicates that we are not certain a) whether it is necessary at all or b) whether it is the correct one among various possibilities that came to our mind. The Yuktidpik as we have it now is divided into four prakaranas and (altogether) eleven hnikas (for details cf. Ram Chandra PANDEYA, Yuktidtpik..., p.xxiv). It is, at least at the present moment, difficult to say whether this division goes back to the author himself and whether and, if so, to what extent it, too, shows the influence of Patanjali's Mahbhsya taken as model by the author (cf. p.XXIIf. and fn.50 and fn.55). If less than a quarter of an ry is quoted, an apostrophe is placed after the letter denoting the ry quarter concerned. We need hardly add that in certain cases it is very difficult indeed to take a decision between these two alternative possibilities: what rather looks like a reference can be a (very) corrupt

47

48

49

XXII

YUKTIDIPIKA

source. 50 A wavy line indicates that we are not certain regarding the text as constituted. Lacunae are marked by a number of dots. By now it can certainly be regarded as an established fact that the Yuktidpik consists of a combination of a Vrttika and Bhsya, only that both are evidently written by one and the same author who wanted thus to follow the model of Patanjali's Mahbhsya embodying the work of Ktyyana, and hence ultimately to create a kind of counterpart, within the tradition of Smkhya, to the works of the famous trimunis of Vyakarana, thus raising the Srnkhya-krik to the status of a Sutra. 51 Nevertheless, it is a welcome confirmation, or in any case a noteworthy fact, that in "The Marginal Notes..." the keyword varttika is used four times, viz. in the note referring to p.19.6 (see p.l9,fn.(5)), to p.25.10 (see p.25,fn.(2)), to p.97.18 and to p.97.19 (see p.97,fn.(4),(5)). We have tried our very best to identify vrttikas as such and to mark them off from the Bhsya text 52 by printing them in bold type; but there are cases, and quite a few at that, where one wonders whether a particular phrase should in fact be regarded as a varttika or not: the mere fact of the existence of a subsequent explanation written in the Bhsya style is not sufficient proofjust as the particular nominal Vrttika style does not allow already by itself to draw the conclusion that what one has to do with is a vrttika in the proper sense. Good examples for such difficulties quotation, and what appears to be a quotation can be the result of a correction by a scribe, or, in general, a person involved in the transmission of the text.
50

Note that this information is not also included in the list of "Signs and Abbreviations" (p.XXX). This has already been noted by our predecessors. It is highly probable that the author of the Yuktidpik thereby wanted to enhance the status of Isvarakrsna's work and that in doing so he did not have only Pnini, Ktyyana and Patafijali in mind, but felt also provoked, if this is the right word, by the lack of an old, not versified Stra in the Smkhya tradition. The details of the reception of the Mahbhsya by the author of the Yuktidpik remain to be studied more closely; W. is preparing an article devoted to this problem.

51

52

This is not done in the MSS themselves. Note that in this regard the MSS of the YD do not differ from those of the Mahbhsya; for the remark of the editor of the Vyakarana Mahbhsya with Kaiyata's Pradpa and Ngesa's Uddyota, Vol.IV, Bombay 1942, i.e. Pt. Bhrgavasstrf Joshi Sstrcrya, in fn.l on p.248, viz. vararucikrtnm vrttiknrn sarvesm api kundalan bhsyakrdbhih kriyata ity abhiyuktnm abhipryah / atra ca [i.e. as regards the phrase samndhikarana iti vaktavyam at MBhsya II 340.20f.] asmadupalabdhapustakesu prcnesv api kundalander adarsann naite vrttike [the dual is due to the fact that the phrase cryd anatvam ca, MBhsya II 340.5, was also regarded as a varttika by some Indian scholars] iti nirnttam asmbhih / yai ca prctnatamesu pustakesu kundalandinimittam drstam, bhavet tesm gaudnm vrttikatve 'bhinivea iti sudhiyo vicrayantu / / can hardly be taken to testify to the existence, entirely unknown so far, of MSS of the MBhsya in which the vrttikas are "encircled" or marked off in a similar graphic manner. The expression kundalan is, also in view of the logical subject bhsyakrdbhih, rather an attempt to render "paraphrase", "circumscription" in Sanskrit, although MONIER-WILLIAMS lists, with reference to "Naish. 1.14", the meaning "drawing a circle round a word which is to be left out in a MS".

INTRODUCTION

XXIII

are perhaps the argument on the three_ kinds of inference (SK 5) (see pp.8386) and the first paragraph of the 3rd Ahnika (see p.109). In many cases, the 'normal' structure of an objection 'taken up', 5 3 viz. "ABC (etc.) iti cen na VW (ablative)" which, of course, is also found several times, e.g. pp.5.19, 14.12, 17.15, 20.15, 21.1,10 etc. is slightly varied in so far as instead of na plus its paraphrase only naitad yuktam or a similar expression is met with. Taken together with similar observations this suggests that the author of the Yuktidpik has not by any means been entirely consistent in distinguishing between the two levels of the text, viz. that of the Vrttika and that of the Bhsya.54 At times one cannot but even consider it possible that he also made use of the device of formulating grahanakavkyas.55 But it is equally possible that, at least at some points, the text is a puzzle to us in this very regard because parts of a vrttika or a Bhdsya explanation have been left out by scribes, e.g. because they were similar to each other or regarded as redundant, etc. 56 That is to say, our distinction between the Vrttika and the Bhdsya within the Yuktidpik is but a first attempt which inevitably has to some extent a subjective character. It can certainly be improved upon, but we doubt that it will ever be possible to solve all the relevant problems, even if new MSS should be 'unearthed'. As for the critical apparatus, it has, of course, been our aim to always give reliable and precise information about the variant reading(s) so that the reader is able to form a clear idea which particular variant is found in the place of precisely which element of the constituted text. We have decided to report
53

In accordance with the dialectical strucure of Indian philosophical, or sstric, texts in general, and of the Yuktidpik, with its long prvapaksa sections, in particular, the reader is reminded of a particular objection, raised by an/the opponent and given earlier in extenso, by a brief repetition of it introduced by e.g. yat tktam, etc. In the case of iti cet phrases the situation is slightly different in that the objection need not necessarily have been dealt with in a previous part of the text and in that it may have the character of an objection self-posed, an anticipation of a theoretically possible objection and hence an element of objection self-raised. In any case a remark of Medhtithi's is quite noteworthy in connection with the general question of the distinction between Vrttika and Bhsya, viz. istam hi vidusm loke samsavysadhranam, found in his Bhsya on Manusmrti 1.1. The sentence is introduced by tad uktam and followed by an iti, and is in fact a quotation, viz. from MBh.(Poona) 11.49cd (cf.also MBh. I app. I 1 [41]). The expression samsavysadhrana, "keeping [something] in memory both succinctly and in extenso11, has been misunderstood by J.A.B. VAN BUITENEN who renders it (The Mahbhrata I. The Book of the Beginning, Chicago-London 1973, p.22) by "(for the wise) wish to retain it for this world, in its parts and in its entirety" (our emphasis).

54

55

On which see Ernst WINDISCH, Ueber das Nyyabhshya, Leipzig 1888, and more recently Johannes BRONKHORST, Ngrjuna and the Naiydyikas, JlPh 13 (1985), pp.121-123. F. KiELHORN was faced with similar problems in reconstructing Ktyyana's Vrttika; cf. Ktyyana and Patanjali: their relation to each other and to Pnini. Bombay 1876, p.27 = Kleine Schriften mit einer Auswahl der epigraphischen Aufstze hrsg. von Wilhelm RAU, Wiesbaden 1969, p.27.

56

XXIV

YUKTIDIPIKA

also evident scribal errors, but refrained from doing so in the case of sandhi phenomena and dandas. In the text itself we use first of all simple dandas more or less as full stops and, with hesitation, certain European punctuation marks (hyphen, colon, comma, semi-colon, quotation marks). A question mark, in the text as constituted by us, means that we are not sure about the authentic reading; in the critical apparatus, however, that readings of the MSS concerned are not clear. Expressions like "add(s)", "insert (s)" in the apparatus are merely descriptive, i.e. do not imply any judgement on the origin and nature, and hence value, of the reading(s) concerned. 5 "The Marginal N o t e s " (TippanT) in t h e mir and Delhi Manuscripts Kash-

It has already been stated above (1) that the discovery and edition of this scholion on the Yuktidpik, although it is by far not a running commentary, forms one of the major improvements we think we have achieved. The designation "Marginal Notes" is fully justified in that these explanatory remarks are indeed written in K on the margins (right, left, top or bottom) of the folios. Yet it has to be noted that the first part of these notes, viz. Ks.2, is found a second time, viz. on separate leaves added before the very beginning of the text of the Yuktidpik itself, yet clearly written by a third hand. 57 There can hardly be any doubt that this is an attempt, incomplete, to extract all "The Marginal Notes" and to turn them into a consecutive commentary. Significantly, this attempt seems to have been undertaken by the Delhi copyist, i.e. the scribe who made D by copying K, and that what he did was transcribed into Sarada most probably when K was returned to Srinagar. Nothing is known about the person(s) to whom we owe these "Marginal Notes". That is to say, there is no clear evidence to decide even the question whether they were written by one or more than one author, not to mention his/their identity or date. The author, or one of the authors, however, was remarkably familiar with Mahyna Buddhism, a fact that would suggest that he/they may have lived before the extinction of Buddhism in Kashmir, i.e. in the 14th century A.D. at the latest. 58 At one point, viz. in the note referring to p.43.12 (see p.43,fn.(4)), the author refers to the opinion of "others" (anye tu... ity huh) ; but that here he is referring to an older and now lost commentary, of whichever type, is just a possibility, and not by any means a certainty: he may equally well have merely had in mind the opinion expressed orally by a 'colleague' of his as in the case where he introduces a particular interpretation by asmadguravas tu (note on p.104.5, see p.l04,fn.(2)). According to an infor57

The (implied) "second hand" refers to the person who is most probably not identical with the scribe of "The Marginal Notes" as such, but responsible for corrections made in them.
NAUDOU,

58

Cf. Jean

Les bouddhistes kamiriens au moyen ge. Paris 1968, pp.210-206.

INTRODUCTION

XXV

mation kindly given by A. SANDERSON, 5 9 what is meant by "Abhinavagupta's Smkhyanirnaya" referred to in the note on p.106.6,10 (see p.lO6,fn.(l)) is most probably not a yet unpublished or even unknown work of this name, but rather the section Tantrloka 13.3-41b. References to other MSS, or another MS, or another "reading" are rather frequent (see p.23,fn.(3), p.25,fn.(4), p.54,fn.(6), p.95,fn.(2)andp.ll7,fn.(3)). Regarding the typographical features employed in "The Marginal Notes..." it should be noted that the expression explained is given within brackets, even if it is 'quoted' in the note itself (in which case it is underlined); at the end of each note, again within brackets, the references to K (folio number, a = recto, b = verso) and, if found there too, to D (folio number plus numbering of the marginal notes as given by the scribe) are added. Passage(s) 'quoted' from the Yuktidpik, other than those directly annotated in a particular "Marginal Note", is/are given in italics. The use of question marks does not differ from that in the main text, and its critical apparatus. 6 Title of the Text, Authorship a n d Date

The name " Yuktidpik" seems to be the correct one: it is not only the one regularly given in the colophon at the end of each of the eleven Ahnikas, but also confirmed by the second of the concluding verses (see p.270.15f.) as clearly as one can wish.60 Some doubt, however, arises because in the sole two cases so far known of later authors referring to the Yuktidpik, the name used is "Rjavrttika": in his Nyyamanjar Jayantabhatta introduces a quotation by yat tu rj vykhytavn and rj is most convincingly explained by Cakradhara to be equivalent to rjavrttikakrah] similarly Vcaspatimisra ascribes in his Samkhyatattvakaumud the verses he quotes from the very beginning of the Yuktidpik (see p.2, nos.9-11) to the "Rjavrttika". 61 Obviously what Jayanta and Vcaspatimisra or the person who coined the name "Rjavrttika" had in mind was the specific, albeit by no means unique, 62 feature of the Yuktidpik, viz. that its kernel is indeed formed by a Vrttika text. They seem to have regarded this feature to be so significant as to name the text as a whole after it, though it does by no means consist of vrttikas only. 63 But there are, of course,
59 60

Viz. in a personal communication of March 16th, 1992 (addressed to W.).

As for its explanation cf. A. WEZLER, Some Observations on the Yuktidpika, in: ZDMG, Supplement II, Wiesbaden 1975, p.434 and fn.2. Cf. A. WEZLER, op.cit., p.450f.

61 62

Cf. J. BRONKHORST, Vrttika, WZKS 34 (1990), pp.123-146, as well as Karen LANG, On ryadeva's Citation of Nyya Texts in the *Sataka, in: WZKS 32 (1988), p.132. Cf. also J. BRONKHORST, op. c*.(fn.62), p.l40f.

63

XXVI

YUKTIDIPIKA

other possibilities too to account for "Rajavarttika", ranging from an alternative, though to all appearances secondary, title, in the full sense of the word, to a kind of a nickname created by and used e.g. among 'students'. Yet, the prior member of the compound poses a problem, too; does "Rajavarttika" mean "the Vrttika of Raj an" or "of a/the king" or "the Vrttika that is a king", i.e. the foremost of its class? 64 We are afraid that even the fact that this title has been given also to other works 65 does not help to solve this particular problem. This has, of course, also to do with the fact that the identity, and hence the name, of the author of the Yuktidipika alias Rajavarttika still remain a riddle; unfortunately he is not like those authors of philosophical texts who did not hesitate to mention or should we say: attached quite some importance to mentioning their own name in a verse at the beginning or the end of their work(s), 66 although he refers to himself by a personal pronoun of the first person (see p.270.20) ; 67 and unfortunately his name seems not to be known to any later author, be he a philosopher or not. This last remark offers the opportunity to state another rather strange, yet noteworthy fact, viz. that knowledge of the Yuktidipika seems to have been confined to Kashmir and some parts of Northern India, at least as far as we can judge at the moment: the extraordinary significance this text has for the history of classical Srnkhya 68 is apparently not reflected in corresponding reception and fame, in the centuries after its composition. Considerations like those just outlined, in the last two paragraphs, will necessarily be made by anybody who muses on the designation "Rajavarttika". "The Marginal Notes ...", however, point in quite different a direction. For immediately upon the second of the two rambhaslokas which are separated from each other by a gap of approximately 6 lines and before
64

Cf. e.g. rjadanta, and Pan. 2.2.31. Cakradhara's explanation of raja by rjavrttikakrah (Nyyamanjargranthibhanga, ed. by Nagin J. SHAH (L. D. Series 35), Ahmedabad 1972, p.59) is unfortunately rather ambiguous; further, Cakradhara does not seem to have himself still known the real name of the author. Besides Akalaiika's Tattvrthavrttika "which is also known by the name Rajavarttika" (J. BRONKHORST, Vrttika, op. cit., p.125) another Rajavarttika is referred to, or quoted, by Sarvajnanryana on Manu 1.75. W. is preparing a series of articles dealing with the "Probleme der Selbstnennung von indischen Autoren".

65

66

67

Cf. the last of the concluding verses, p.270 of our edition. In passing only it should be noted that in P the Yuktidipika is ascribed to Vcaspatimisra and that this has, in its turn, led to MSS of the Smkhyatattvakaumud being catalogued under the title " Yuktidipika"''' (as discovered by W. when he was kindly allowed to copy the corresponding entry in the still unpublished volume of the New Catalogus Catalogorum and he later checked the references). It is difficult to say whether the wrong ascription in the colophon at the very end of P has anything to do with Vacaspatimisra's quotation from the Yuktidipika or is simply caused by the scribe's having some knowledge of the fact that Vcaspatimisra is the author of an extensive, particularly well-known commentary on the Smkhya-Krik. Cf. also Eli FRANCO, Whatever happened to the Yuktidipika?, WZKS 35 (1995), pp.123-137.

68

INTRODUCTION

XXVII

the commentary itself, these "Notes ..." read krh rajanagopalakasya (cf.below p.l,fn.(l)); and this statement about the author of the work can hardly refer to the two, or the last of the two preceding verses, or to the following Tippan proper: its very existence, in addition to the place where it is found, speak clearly against either assumption. What strongly suggests itself is hence the third alternative, viz. that the reader is given information about the Yuktidpik information which one would expect to find at the end of the Yuktidpik, but which is conspicuously lacking in the colophons of all the extant MSS , viz. that it is "the work of [a certain] Goplaka Rjna". In any case this is a particularly interesting, nay exciting piece of evidence, revealing as it does that there is yet another possibility of interpreting "Raja0" of "Rjavrttika": the prior member could be just a synonym of rjna, regarding which M. A. 69 STEIN says among other things that "originally a title", it "must have become a family designation at an early date", in Kashmir and Kangra, similar to the related expression rjnaka70 : A work of the class called Vrttika and written by the member of the family, or clan, of the Rjnas, or by a person bearing the title "almost a king" (rjnaka), could aptly be referred to by the name "the Vrttika of Rj an". As for its date the discussion of which is now avasaraprpta, the decisive evidence is the following: the author of the Yuktidpik quotes Dignga's Pramnasamuccaya71 several times (see p.5.11, p.75.5-6, and p.86.20); NAKADA'S 72 thesis that he refers also to Dharmakrti has been rejected by STEINKELLNER, 7 3 and on good grounds too. This suggests that the Yuktidpik was written after Dignga and before the works of Dharmakrti had become widely known, or could not any longer be ingored. If we start from the dates of these two Buddhist philosophers as proposed by FRAUWALLNER, 7 4 i.e. 480-540 A.D. (Dignga) and 600-660 A.D. (Dharmakrti), it is possible to assign the Yuktidpik to a period between the end of 7th century and the beginning of
69

Kalhana's Rajatarangin ... Translated by M. A. STEIN, Vol. II. Westminster 1900, p.61 (note on VIII, 756).

70

On which see also op. cit. Vol.1, p.244 (note on VI, 117). The identification of those from the apohavda section of the Pramnasamuccaya, viz. on p.75.5-6 (among others), we owe to Ole Holten PIND.

71

72

Viz. in his article Word and Inference in the Yuktidpik Part I, Naritasan Bukky Kenkyjo Kiy 12 (1991), pp.47-74.

73

Cf. his article Dharmakrti on the Inference of Effect (krya), in Papers in Honour of Prof. Dr. Ji Xianlin on the Occasion of His 80th Birthday, Beijing 1991, pp.711-736.

74

Reference is, of cource, to his famous article Landmarks in the History of Indian Logic, WZKSO 5 (1961), pp.l25-148= Kleine Schriften, hrsg. v. Gerhard OBERHAMMER U. Ernst STEINKELLNER, Wiesbaden 1982, pp.847-870.

XXVIII

YUKTIDIPIKA

the 8th century. This date, i.e. ca.680-720 A.D., fully agrees with the fact not observed by PANDEYA among others that the Yuktidipik also quotes a passage from the famous Ksikvrtti, viz. at the beginning of its commentary on Smkhyakrik 1 (see p. 11.10-11); since no parallel to this quotation is found in the Cndravykarana and the wording in the Mahvrtti on the Jainendravykarana is clearly different,75 there can hardly be any doubt that what is quoted at this point is in fact the Ksik which in its turn can be dated with a high degree of certitude 76 to 680-700 A.D. It should, however, be noted that 680-720 A.D. is but the lower limit, though one will certainly hesitate to think of an upper limit which is removed too far from Dharmakrti. We do realize that this conclusion about the date of the Yuktidtpika is rather puzzling because most of those who have read this text or part of it will have gathered the impression that it is ca. 100 years younger. The quotation from the Ksik cannot, however, be simply done away with by assuming that it is but a later addition to the text: it forms an essential part of the paraphrase of a vrttika which is in its turn confirmed by a subsequent passage. It is, hence, necessary to reckon seriously with the possibility that the author, inspite of his dates, did not know the works of Dharmakrti, for whatever reason, but was aware of the works of Kumrila as cautiously assumed by Halbfass. 77 7 Acknowledgments

First of all our sincere thanks are due to the libraries, and the authorities in charge of them, for giving us permission to microfilm the MSS of the Yuktidtpika in their possession and to use them for our edition, viz. the the the the the Bhandarkar Oriental Research Institute, Poona Lalbhai Dalpatbhai Indological Institute, Ahmedabad University of Kashmir, Srinagar National Archives, New Delhi, and Library of the Benares Hindu University, Varanasi.

Next we should like to thank our colleagues and friends Lambert Schmithausen and Karin Preisendanz who allowed us to use their own copies of Pandeya's edition with their own corrections, notes and annotations, and Srinivasa Ayya Srinivasan for correcting our English and making many valuable
75 76

As was kindly pointed out to us by Thomas OBERLIES.

Cf. most recently, Th. OBERLIES, Das zeitliche und ideengeschichtliche Verhltnis der Cndra-vrtti zu anderen V(ai)ykaranas (Studien zum Cndravykarana III), in: Festschrift Paul Thieme zum 90. Geburtstag am 18. Mrz 1995 dargebracht von Schlern und Kollegen, hrg. von H.-P.Schmidt und A. Wezler. ... Stil 20 (1995), pp.265-317. Cf. W. HALBFASS, Tradition and Reflection, Explorations in Indian Thought, Albany 1991, p.94.

77

INTRODUCTION

XXIX

suggestions. Not a small number of friends and colleagues have most kindly rendered us assistance, for the most part with regard to particular passages of the text. These are Koki Aruga, Ram Shankar Bhattacharya, Klaus Bruhn, Gerhard Ehlers, Felix Erb, Sieglinde Dietz, A.M. Ghatage, Jan E.M Houben, Harunaga Isaacson, Ashok Kapoor, Narayan Manila! Kansara, Masaaki Hattori, Minoru Hara, Yasushi Matsuoka, Rebecca Ann Marck, Hisayoshi Miyamoto, Shinkan Murakami, Naomichi Nakada, Yoshihito Muroji, Toru Tomabechi, Izumi Miyazaki, Bun'ei Otokawa, Thomas Oberlies, Rewati Raman Pandey, Ole Holten Pind, Alexander von Rospatt, Alexis Sanderson, Walter Slaje, Ernst Steinkellner, Esther Solomon, Kamalesh Datta Tripathi, and Michael Witzel. To all of them we should like to express our thanks. Last but not least we are most grateful to the "German Research Council" ("Deutsche Forschungsgemeinschaft") which made this publication possible by a subsidy, and to Gregor Hoppen of Franz Steiner Verlag Stuttgart who took excellent care of its production. Autumn 1997 Albrecht Wezler and Shujun Motegi

Signs and 1 1.1 Signs

Abbreviations

Main Text addition correction deletion reading uncertain vrttika deduced by us word(s) of the Smkhyakrik commented on in the Yuktidpik of the Kashmir and Delhi

< > < > with footnote [ ] wavy line letters in bold face italics

1.2

Marginal Notes Manuscripts

< > with note wavy line underlining ( ) italics i.n. s.m. 2 A AV(S) AK AKBh AKV ALB Is U Ai.Br K Kath.U Kth.S Kai.U KP Ks GdhS

correction reading uncertain pratka commented on mla element commented on word(s) quoted from the mla notes written between the lines of the Kashmir Manuscript secunda manus, corrected reading in the Delhi Manuscript

Abbreviations Manuscript of the Yuktidpik, deposited at the Llbh Dalpatbha Indological Institute (Ahmedabad) Saunakya Atharvaveda Samhit Abhidharmakosa Abhidharmakosabhsya Abhidharmakosavykhy Adyar Library Bulletin, Madras Isa Upanisad Aitareyabrhmana Manuscript of the Yuktidpik, which begins after the upodghtah(p.8.16), deposited at the Kashmir University Katha Upanisad Kthaka Yajurveda Samhit Kaivalya Upanisad Manuscript of the Yuktidpik which covers the upodghtah(p.8.16), deposited at the Kashmir University Fragmentary sheets inserted in K Gautamadharmastra

SIGNS AND ABBREVIATIONS Ch Chnd.U JIBS JlPh Tai.Br Tai.S Tai.U TV TSP TSV D

XXXI

Yuktidipika, editio princeps by P.Chakravarti Chndogya Upanisad Journal of Indian and Buddhist Studies, Tokyo Journal of Indian Philosophy, Dordrecht Taittiryabrhmana Taittiryasarnhit Taittirya Upanisad Tattvavaisrad Tatt vasamgrahapanj ik Tattvasamsastravrtti, included in the Smkhya-Sangraha Manuscript of the Yuktidipika, deposited at the National Archives, New Delhi sDe-dge edition of Tibetan Tripitaka, kept in the Tokyo University, Derge Tsad Ma 1, (Ce) Manuscript of the Yuktidipika, referred to in D as kha pustaka Dkha Dvdasra Nayacakra DNC Mtharavrtti Math. Maitryanya Upanisad Mait.U Nirukta Nir Nyyabhsya NBh Nyyabhsana NBh Nyyamanjar NM Nyyavrttika NV Nyyavrttikattparyatk NVTT Nyyastra NS Manuscript of the Yuktidipika, deposited at the Bhandarkar Oriental P Research Institute, Poona Astdhyy of Pnini Pan Peking edition of the Tibetan Tripitaka, mDo 'Grel Ce(95) (vol.130) Peking Prngnihotra Upanisad Pr.U Pramnasamuccaya PS Pramnasamuccayavrtti PSV Manuscript of the Yuktidipika, deposited at the Benares Hindu UniB versity Brhadranyaka Upanisad Brh.U MV Madhyamakavrtti Manusmrti Manu S MBhsya Mahbhsya MBh ' Mahbhrata MS Mmrnsstra Mund.U Mundaka Upanisad YBh' Yogabhsya YV Yogavrttika YS Yogastra RV Rgvedasarnhit Vj.Sam Vjasaneyi-Samhit

XXXII Var Vims VP Vyo VS VSC SPBr SBh SV Svet.U SK SV(I) SDS STK WZKS WZKSO ZDMG

YUKTIDIPIKA Varttika of Katyayana Vijnaptimtratasiddhi Virnsatik Vkyapadya Vyomavat Vaisesikasutra Candrananda's commentary on the Vaisesikasutra Satapathabrhmana abarabhsya Slokavrttika Svetsvatara Upanisad Smkhyakrik Smkhyavrtti(I) Sarvadarsanasangraha Smkhya-Tattvakaumud Wiener Zeitschrift fr die Kunde Sdasiens, Wien Wiener Zeitschrift fr die Kunde Sd- und Ost-Asiens, Wien Zeitschrift der Deutschen Morgenlndischen Gesellschaft

FACSIMILE OF MANUSCRIPTS

XXXIII

u ^ . r t ^ ' ^ ^ S B T O

Ms. K, folio 10 (see pp.35.13-38.14 of the edition)

XXXIV

YUKTIDIPIKA

Ms. D, p.35 (see pp.35.1-36.2 of the edition)

FACSIMILE OF MANUSCRIPTS

XXXV

irafl^ Bj^^i^fr j i t ; ! !: ; ;

Ms. D, p.36 (see p.36.2-18 of the edition)

XXXVI

YUKTIDPIK

Ms. D, p.37 (see pp.36.18-38.1 of the edition)

FACSIMILE OF MANUSCRIPTS

XXXVII

P | l W | ^ W * W f f

Ms. B, folio 1 (see pp.224.11-226.20 of the edition)

P r a t h a m a m

A h n i k a m

svasty astu / om namah sivaya^1)/ om [vitavitavisanasya paksatavanasevinah 2 / pravdh smkhyakarinah sallakisandabharigurh 3 / / ] rsaye paramyrkamaricisamatejase 4 / samsragahanadhvntasryya gurave namah^2) / l / tattvam jijnsamnya viprysuraye munih / yad uvca mahat tantram duhkhatrayanivrttaye / 2 / na tasydhigamah sakyah 5 kartum varsasatair api / bhyastvd iti samcintya munibhih sksmabuddhibhih / 3 / granthenlpena samksipya tad rsam anussanam / KP. svasty astu om namah sivya // om A. om namah kamaladalavipulanayanbhirmya nryanya // sriganesya namah // P. om Sriganesya namah om namah sivya / om D. 0 7 7 1 srismbasadsivya namah / atha / yuktidipikbhidhn smkhyasaptatipaddhatih 2 A. nntvanasevinah D tvanasevinah 3 This sloka is numbered No.l in A. D. writes this sloka with smaller letters and starts numbering at the next sloka. 4 A. paramryrka0 recte: paramrth0 (?) 5 A. sakyh
J

10

Marginal Notes of Kashmir Mss seems to have a kind of arambhaslokas which are written, though not clearly, on the first folio of K., but are not found in D. pancavirnsatitattvesu janman jrinam ptavn / ya disrstau(?) namas tasmai kapilya m ah at mane // bhyah pro_ttapakss(?) cyutabahulasilh ksobhayanty adrayas ced utplutyoccaih saklau pad asu(?) dandahrte 'gnih / dedhlyante 'thavntar miladalaghujalasaptak (?) svasthnj jtucin me pracalati na mano vlradhlram tathpi / / krtl rjnagopalakasya ' ' (namah) namaskro nma vgindriyasya tatkarmodlranapravanasabdaprabandhanirvartakakriys<d>ratvam* antahkaranasya ca tadvisayam eva samkalpbhimndhyavasyacturyam dehasya ca tathvidhasamastakaranavrttiprvakah pranamanarpaprnavrttisvabhvas cestvisesa ucyate //(KP.6b, not found in D.) * K. sdharatvam

YUKTIDIPIKA nibaddham amalaprajnaih sisyanam hitakamyaya / 4 / pratipaksh punas tasya purusesnuvdinah1 / vainsikh prkrtik vikrapuruss2 tath / 5 / tesm icchvightrtham cryaih sksmabuddhibhih / 5 racith svesu tantresu visams tarkagahvarh / 6 / [vltvitavisnasya paksatvanasevinah / pravdh smkhyakarinah sallakisandabhangurh / / ] 3 sisyair duravaghs4 te tattvrthabhrntabuddhibhih5 tasmd Isvarakrsnena samksiptrtham idam krtam / 7 / 10 saptatykhyam prakaranam sakalam sstram eva v / yasmt sarvapadrthnm iha vykhy karisyate / 8 / pradhnastitvam ekatvam arthavattvam athnyat / prrthyam ca tathnaikyam viyogo yoga eva ca / 9 / (see e.g.STK on SK72) 15 sesavrttir akartrtvam clikrthh^ ) smrt dasa / viparyayah pancavidhas tathokt nava tustayah6 / 1 0 / (see e.g.STK on SK72) karannm asmarthyam astvimsatidh matam / iti sastih padrthnm astbhih saha siddhibhih / l l / 20 (see e.g.STK on SK72) yathkramam laksanatah krtsnyenehbhidhasyate /
X A. purusesnuvdinah 2 A. vikrh puruss 3 This loka is not repeated here in A. 4 P. duravaghys 5 D. tattvrthabhrntrabuddhibhih, s.m. tattvrthabhrntabuddhibhih 6 P. tusta rthh smrtrthasah viparyayah pancavidhas tatho yah 7 7 1

A. karannm

(^(culikarthah) pradhnastitvam ityadayo 'rthh pradhnyena culatvenanyasastravaiviktye cihnataymrdhbhisiktatvenacehopadisyante/ te cliksadrsatvc clikrthukth / / (KP.la, D.2 without number) (clikrthh) pradhnastitvam ityder agramatah(?) / asti pradhnam, tac caikarpam tac ca bhogyatvn mahaddisvakryakartrtvc cnyrtham(?) / tadvyatiriktam csti bhoktrtattvam / tadartham eva ca bhogyam na svrtham / tac ca bhoktrtattvam bahuprakram / bhogyasya bhoktram prati caritrthatvena tadasvmikatvam viyogah / acaritrthatvena tatsvmikatvam yogah / prakrtipurusaviveky api tadavivekasamskrt kimcit klam sade<ha>* evstv iti sesavrttih / saptavidhasya ca vaksyamnasya kartrtvasybhvd akart purusa ity ete 'rthh / pradhnyena cltvennyastravaiviktyacihnatay mrdhbhisaktatvena ceha vyapadigyante / tena cliksadrsrthatvc clikrth ity ukth / / (K.Oa, not found in D.) *K. sadesa(!)

PRATHAMAM AHNIKAM INTRODUCTION tasmd atah sstram idam alam nntvasiddhaye / 1 2 / alpagrantham analprtham sarvais tantragunair yutam / pramarsasya tantrasya bimbam darsagam 1 yath / 1 3 / tasya vykhym karisymi yathnyyopapattaye / krunyd apy ayuktm tm pratinandantu 2 srayah / 1 4 /

ha: karisyati bhavn 3 vykhym / i d a m tv dv upanyastam sarvais tantragunair yutam idam tantram iti / ke tantragunh kiyanto veti / ucyate: strapramnvayavopapattir anynat sarnsayanirnayoktih / uddesanirdesam anukramas ca samjnopadesv iti tantrasampat / / <iti /> strni ca pramnni cvayavs ca strapramnvayavh / tesm upapattih strapramnvayavopapattih / upapattih sambhava ity anarthntaram / ananyo 'rtho 'narthntaram 5 / upapattisabdah pratyekam parisampyate stropapattir itydi / ha^ 1 ) 6 laksanopetastropapattir 7 iti vaktavyam / itarath hy alaksanopetasypi strasya tantrngabhvah syd iti / ucyate: na nntarlyakatvt / na hy ant arena laksanopetatvam stratvam / ato na vaktavyam et ad iti / ha: atha stram iti kasmt / ucyate: scant stram / scayati tms tn arthavisesn iti stram / tadyath "kranam asty avyaktam"(SK16a) "bhednm parimnt"(SK15a) iti / atra pratijnhet kanthoktau / tayor upayogi drstntam sdhyasiddhaye samartham iti krtv mlasakalda<yo>8 'trntar anabhihit apy etasmd avasiynte / athav bhiksor upasamhrtabahiskaranntahkaranasya 9 tesu tesv atindriyesv api pradhndisv arthesu buddhim scayatiti stram / athav "sauksmyt tadanupapattih" (cf.SK8a) iti 10 stram / tadyath alpksaram asandigdam sravad visvatomukham / astobham anavadyam ca stram stravido viduh / / (see e.g.NVTT.on NS.1.1.2)
1 D. darsanam, s.m. darsagam 2 KP., P. and D.: pratigrhnantu 3 A. bhagavn 4 A. iha 5 A. arthntaram / anyo 'rtho 'rthntaram 6 A. omits ha. 7 P. laksanopetas tatropattir 8 KP., P. and D.: mlasakaldaya A. mlasakalday We follow 9 A. upasamhrtabahiskaranasya 10 4

10

15

20

25

30

Chakravarti.

A.papattis ceti

praSnah / / (KP.lb, D.3 with a figurative mark like oo)

YUKTIDIPIKA astobham apunaruktam ity arthah / tatha laghni scitrthni svalpksarapadni ca / sarvatah srabhtni strny hur manisinah / / (see e.g.NVTT. on NS. 1.1.2) 5 pramnni ca pratyaksdmi tny uttaratra vaksyati "drstam anumnam ptavacanam ca"(SK4ab') "prativisaydhyavasyo drstam" (SK5ab') itydi 1 / avayavh 2 punar jijnsdayah pratijndayas ca / tatra jijnsdayo vykhyngam pratijndayah parapratyyanngam / tn^1) uttaratra vaksymah(89.16f.) / ha: avayavnabhidhnam anupadest / na hi yath pratyaksdlni pramnny upadistni tathvayav upadisth / tasmd avayavopapattir ity et ad asat / bhsyakraprmnyd adosa iti cet / syn matam / yady api strakrenvayavopadeso na krtas tathpi bhsyakrh kecid esm sangraham cakrus te ca nah pramnam / tasmd yuktam avayavopapattir iti / etac cyuktam 3 / kasmt / utstratvt / na hi utstram vycaksnh bhsyakrh pramnam bhavanti(cf.MBhsya.I.12.27) / tath caitad utstritam iti / ucyate: na lingt / naitad yuktam 4 anupadesn na santi jijnsdayah / kirn tarhi / anupadistam apy esm astitvam lingt pratipadymahe 5 yad ayam 6 cryah duhkhatraybhightj jijiis tadapaghtake hetau /(SKlab) 20 iti jijfisanam 7 caste / "kranam asty avyaktam"(SK16a) iti pratijnm karoti / "bhednm parimnt"(SK15a) iti hetum vyapadisati 8 / "natavad 9 vyavatisthate Ungarn" (SK42d) iti drstntam dyotayati / "ksirasya yath tath 1 0 pravrttih pradhnasya" (SK57b'd) ity upasamharati / "tasmt trividham karanam 11 dvri"(SK35cd') iti nigamayati / na cnabhipretair crynm sstre vyavahro laksyate / tena 12 vayam lingt pratipadymahe santi 13 jijnsdayo 'vayavh sstra 14 iti /
X A. iti 2 A. avayavdayah 3 A. csatyam 4 KP. ne..ktam D. nettham 5 A. pratisidhymahe 6 A. yam instead of yad ayam 7 A. jijnsprayojanam 8 A. upadisati 9 A. na tvad 10 A. omits tath. 11 A. kranam 12 A. te 13 A. sati 14

10

15

25

P. not clear.

A. omits sstra iti // ha ... jijnsdayo 'vayavh.

tan iti / avayavpeksaya pumlingena nirdesah krtah / / (KP.2a, D.4 with a figurative mark)

PRATHAMAM AHNIKAM INTRODUCTION aha: sat am anupadese prayojanavacanam / evam cen manyase santi jijnsdayo 'vayavh sstre tesm anupadese prayojanam vaktavyam 1 amusmd dhetor cryena nopadisyante 2 santi ca ta iti / ucyate: pramnntarbhvt / pramnesv antarbhva esm ity ayam 3 upadisto hetur asmbhih / anumnngam hi jijnsdayah / tasmt tadantarbhtas ta iti na prthag upadisyante / kirn ca tantrntarokteh / tantrntaresu 4 hi vindhyavsiprabhrtibhir 5 cryair upadisth / pramnam ca6 nas ta cry ity atas cnupadeso jijnsdlnm iti / ha: na pramnnupadesaprasangt / yadi 7 ca tantrntaropadesd eva avayavnm anupadesah pratyaksdlny api ca tantrntarespadisyante / "srotrdivrttih pratyaksam" (cf.e.g.PS.:Peking.Ce.3bl, Derge.Ce.3a3; NV. and NVTT.onNS.1.1.4) / "sambandhd ekasmt sesasiddhir anumnam" (see e.g. NV.onNS.1.1.5) / "y yatrbhiyuktah karmani cdustah sa tatrptas tasyopadesa ptavacanam" (cf.SV(I). on SK4) iti tesm apy 8 anupadesaprasahgah / atha sati t antrnt aropadese pramnny upadisyante nvayav iti nanv 9 et ad icchmtram iti / ucyate: prva 10 eva tarhi parihro 'stu / athav punar astu tantrntarokter ity ayam api 11 parihrah / yat 12 tktam 13 (5.9) pramnnupadesaprasahga ity atra brmah: a y u k t a m etat / kasmt / prayojanavatm upadesasydosatvt / anupadeso hi prayojanavatas 14 codyata iti yuktam etat / upadesa 15 eva tu sadosa iti krtv kah pratycaksita / tasmn na kimcid etat / kirn cnyat / pradhnopadese gunabhtntarbhvasiddheh / tadyath taksnuhi caitra ity ukte yvadbhih sdhanavisesair 16 vin taksanam nopapadyate sarvms tms caitra updatte / tath pratyaksdisu pramnespadistesu yair esm avinbhvah sarvni tny updsymahe 17 / kirn cnyat / anyatrpi tadanusthnt / na kevalam ihnyatrpy ayam cryah pradhnnm evopadesam karoti / tadangabhts tu tadupadesd eva pratiyante / tadyath "kranam asty avyaktam"(SK16a) "bhednm parimnt" (SKI5a) iti 1 8 / itarath hi drstntbhvd asdhanam etat syt / pasyati tv ~ cryo ndrstntam sdhanam sdhyam pnotiti krtv prtipdakh 19 pratip2 A. cryenopadiSyante 3 A. antarbhva ity esm 4 A. tantrntare 5 A. vindhyavsa0 6 KP., P. and D. omit ca. 7

10

15

20

25

30

*A. vaktavyam prayojanam avyam(sic)

A. pramna ca D. iti A. omits apy. P. na tv D. na tv, s.m. nanv A. prvam 11 A. astu 12 D. tad, s.m. yad 13 A. yad uktam for yat tktam 14 A. prayojanatas 15 A. upadesam D. sdhanasesair, s.m. sdhanavisesair A. updhsymahe 18 A. omits iti. 19 A. prtipdikh

YUKTIDIPIKA danakale 1 tantrantaropadistan api mulasakaladin aksepsyantiti / kim canyat / anumne bhtavad upadest / atas caitad evam yad ayam cryah "trividham anumnam khytam" (SK5b') iti braviti / katham krtv jnpakam / khytasya hi pratymnye bhtavcin sabdenopadeso bhavati na cnena 2 5 prvam trividham anumnam khytam / khytam eveti 3 cen na / <na> tad khytam 4 kvacid iti sakyam pratipdayitum / so 'yam ankhyypi yad bhtavcinam sabdam updatte 5 tajjiipayaty cryas tantrntaraklptnm apiha sanniveso 'nglkriyate / kim etasya jnpane prayojanam 6 / tantrntaro padisto 7 'pi karmayonmm prnabheddinm ca laksanopadesah sangrhito 8 10 bhavatiti siddham tantrntaropadesd avayavnupadesah / tasmt sktam L evvayavopapattir 9 iti / anynat(3.10) / padrthakrtsnyam asesatnynatety abhidhiyate / padrths ca dasa clikrthh pancsat pratyayh / tatrstitvam 10 ekatvam paficabhir vitaih siddham / arthavattvam kryakranabhvah / prrthyam sam15 hatyakrinm 11 parrthatvt 12 (cf.SK17a) / ata evnyatvam cetansakter gunatrayt /"janmamaranakarannm 13 "(SK18a) ity evamdibhih purusabahutvam (cf.SK18a) / "purusasya darsanrthah"(SK21a) iti samyogah / "prpte sarirabhede 14 "(SK68a) iti viyogah / "samyagjnndhigamt;>(SK67a) iti sesavrttih / "tasmc ca viparyst"(SK19a) iti purusasykartrtvam ity ete dasa clik^r20 thh / S panca viparyayabhed bhavanty asaktis ca karanavaikalyt / astvimsatibhed tustir navadhstadh siddhih //(SK47) iti pancsat pratyayh / sais sastih padrthnm / tadupapattir 15 anynat / samsayanirnayoktih(3.10) / samsayas ca nirnayas ca 16 samsayanirnayau tayor uktih samsayanirnayoktih / smnybhidhnam samsayah / tadyath mahaddi tac 1 7 ca kryam prakrtivirpam sarpam ca / (SK8cd) ity ukte samsayo bhavati kena dharmena kryam prakrtivirpam kena v sarpam iti 1 8 / visesbhidhnam nirnayah / sa ca dvividhah, sabdato 'rthatas ca /
1 P. pratipdankle 2 D. ca anyena 3 A. khytam deti 4 D. tathkhytm instead of tad khytam 5 A. updhatte 6 A. prayojanam nma 7 KR, P. and D.: tantrntaroddisto 8 A. omits sangrhito .... tantrntaropadesd 9 KP., P. and D.: avayavopapattir 10 A. tatrsristatvam(l) 11 P. samyatyakrinm 12 A. padrthatvt 13 A. krannm 14 A. sarirabheda 15 A. tadupattir 16 A. ca tau 17 18

25

avayavnupadesah.

P. tas A. sarpam ceti

PRATHAMAM AHNIKAM INTRODUCTION

sabdatas tvad yath hetumaddibhih 1 (cf.SK10) kryam prakrtivirpam traigunydibhih prakrtisarpam iti / arthatas tadyath "tebhyo bhtni panca pancabhyah, ete smrt visesh" (SK38bc) / kirn kranam / yasmt "snt ghors ca2 mdhs ca"(SK38d) / asntaghoramdhatvt "tanmtrny 3 avisesh"(SK 38a) / uddesanirdesam (3.11) / uddesas ca nirdesas coddesanirdesam / "sarvo dvandvo vibhsayaikavad bhavati"(cf.MBhsya.1.476.1) iti dvandvaikavadbhvah / samksepavacanam uddesah / tadyath esa pratyayasargo 4 viparyaysaktitustisiddhykhyah / (SK46ab) vistaravacanam nirdesah / tadyath "paiica viparyayabhed bhavanti" (SK47 ab') "bhedas tamaso 'stavidhah" (SK48a) itydih 5 / anukramas ca(3.11) / padrthnm nuprvy sannivesopadeso ?nukramah / tadyath prakrter mahrps tato 'hamkras tasmd ganas ca sodasakah / (SK22ab) ity anena / samjnopadesau(3.11) / samjnipratyyanrthah 6 sabdah samjii (cf.MBhsya.1.38.20) / s ca dvividh / arthanibandhan svarpanibandhan ca / tatrrthanibandhanrthavasenrthakriypeks / j tydyarthasvarpntarbhvi7 yathrthas tathbhtam eva samjiiinam8 pratyyayati / tadyath "pcako lvakah"(cf.SBh.onMS.1.1.5) iti / svarpanibandhan punah samjnipratyyanopyamtram svarpamtropakrini 9 vinvayavrtham samayavasd 10 atathbhtam api samjiiinam pratyyayati / tadyath gajakarno 'svakarna iti / prayatnato bhagavatah paramarser rsena jnnena sarvatattvnm svarpam upalabhya samjnm vidadhato 11 nsti svarpanibandhanah sabdah / tadyath pradhiyante 'tra vikr iti pradhnam / "puri sete" (cf.e.g.Gop.Br.l.l.39) iti purusa itydi / tanmatnusrinm apy crynm tbhir eva samvyavahrn nsty aprvasamjnvidhnam praty darah / upadesah (3.11) / itikartavyatphalasamkhynam 12 upadesah / tadyath evam tattvbhysn nsmi na me nham ity aparisesam / aviparyayd 13 visuddham kevalarri utpadyate jfinam / / (SK64)
1

10

15

20

25

30

D. samjninah A. samjnipratyayopyamtrasvarpa0 10 D. samjnivaSd 11 A. vivadato 2 A. samdhynam 13 A - -1 A. aviparyasad

3 A. mdhatvn mtrny 4 A. omits sargo. 5 A. itydibhih 6 A. pratyayanrthah 7 t>.ntarbhve 8

A. hetuh padadibhih A. omits ca.

YUKTIDIPIKA <iti /> ete sutropapattyadayas tantragunah / itikaranam (3.11) prakrrtham / evamprakr anye 'pi drastavyh / tadyathotsargo 'pavdo 'tidesa 1 itydi / tatrotsargah "prakrtivirpam"(SK8d') vyaktam "sarpam ca"(SK8d') ity apavdah / tath 2 "tadvipantah"(SKlld') ity utsargah / "tath ca pumn"(SKlld') ity apavdah / "smnyam acetanam prasavadharmi vyaktam tath pradhnam"(SKllbc) ity atidesah / ity evam any api tantrayuktayah saky iha pradarsayitum / atiprasahgas tu prakrtam tirodadhtiti 3 nivartyate / siddham tantrayuktinm sambandhopapattes tantram idam iti 4 / kim ca tantrntaravirodht 5 / yadi khalv apidam 6 prakaranam syt tantrntare<sm> 7 ptanjalapancdhikaranavrsaganaprabhrtlnm anyatamasya sesabhtam syt tais csya <v>irodhas8 tatra tatreti vaksymah / prvatantrasesabhvd iti cet tulyam / etny api prvatantrasesabhtni tesm api prakaranatvaprasahgah / atha matam sakalapadrthasangraht tantrntarny etni / evam ihpi sakalapadrthasarigraht tantrntaratvam abhyupagantavyam / tasmd yuktam etat tantram idam / ity upodghtah^ 1 )/ ha: kimvisistya^2)9 sisyya punar idam tantram vykhyeyam iti / ucyate: jijnsave matimate mimmsakyrthine 'bhyupagatya 10 sisyya vykhyeyam sstram / kasmt / paramarsiprmnyt / yasmd bhagavn visvgrajah paramarsir^3) bhagavadsurer 11 jijfism upalabhyottaragunavise1 A. apadesa 2 A. omits tath ... pumn ity apavdah. 3 A. tirodadtiti 4 A. idam iti kim iti instead of idam iti 5 KP., P. and D.: tantrntarvirodht 6 A. idam api 7 K., P. and D.: t antrnt arena A. tantrntare 8 K., P. and D.: csyvirodhas A. cpy avirodhas 9 A. kimgunavisistya D. kimvisistya, s.m. kimgunavisistya 10 P. 'dhyupagataya 11

10

15

20

A. paramarsibhagavadsurer

(^(upodghatah) upamsur asphutam krtvarthavasad adav eva hanyate tarikitatvenollikhyate gamyate vrth<o>* yena sa upodghtah samksepoktih // (D.8 without number, not found in K.) *D. vrth (2) (kimvisistya)* adhikrinam nirpayitum ha kimguneti / sampadam cety atra vykhytavn iti sesah / athavokta ity atra sthitena sambandhah / vacanam uktam tad vidyate yasya sa ukta uktavn ity arthah // (Ks.2**, D.10b-l) *cf.p.8,fn.9 **Besides its main text K. has four fragmentary sheets on which marginal notes have been recompiled. We call them here Ks. for the sake of convenience (cf .Introduction of our edition, p.XVII; p.XVII,fn.21). (3) (visvgrajah paramarsir) paramarslti / paramarsim eva pramnlkurvantv itiyvat / tasya pramnikaranahetur visvgraja iti / / (Ks.2, D.10b-2)

PRATHAMAM AHNIKAM SKlab sasampadam^1) ca vyakhyatavan / raja eva duhkham^2) tannirakarisnor viveko 'yarn sattvt / sattvam csmn nnety^3) evamdin^4) vacanapratipdyo 'yam artho mahadbhis coktah^5) / tasmd rajoduhkhopaghatopaghatakajijnasoh^6) sattvd^7) dharmdikusalamlavipkotpitsor duhkhatrayanivrttaya idam

(i)(uttaragunavisesasampadam) uttaraguna iti / matih sravanagrahanasaktatvam / mimamsohpohayogah / arthitvam tattvbhinivesah / abhyupagatatvam upapannatvam* iti jijnsnantarbht ye gunavisess tesm sampadam sampannatvam prnatvam copalabhya vykhytavn iti vkyasesah / yadi vokta ity uttarena sangatih / vacanam uktam tad vidyate yasya sa ukta uktavn iti yvat / / (Ks.3, D.llb-3) *D. upapannam (2)(raja eva duhkam) nanu kutas tvayedrso vrttnto* jnta ity sarikyharaja evetydi // (Ks.2, Ks.3, D.9b-5) '"Ks^ tvayedrsah paramarser vrttnto (raja eva duhkham) raja evetydi* / raja eva duhkham / tena duhkhasyarajovirahena rpam nasti / duhkhanirkarisnoh sisyasya viveka utpanna iti sesah / ayam ca vivekah sattvt / nanu prg api sattvam abhn na ca viveka ity hasattvam** csmd itydi / asmd rajaso yad nneti prthagbhtam tad tadanugrahdivirahitam prakrstam tadsmd viveka ity arthah // (Ks.2***, K.Ob, D.9J3-5) *D. omits raja evetydi. **D. omits sattvam csmd viveka ity arthah. ***cf.p.lO,fn.(2). (3) (sattvam csmn nn) sattvam csmn nneti / asmd rajasah sattvam nn prthagbhtam / yad rajogunbhibhavarahitam sattvam udriktam* sambhavet tadsmd viveka ity arthah / / (Ks.3, D.9b-*5) *D. udraktam (4) (evamdin) nanu tatkathanam katham taih krtam ity haivamdineti / grantheneti sesah / tadlyam* grantham eva pathati raja eva duhkham itydi // (Ks.2, Ks.3, D.9b-5) *Ks.2 omits tadiyam grantham eva pathati raja eva duhkham itydi (5) (vacanapratipdyo 'y a m artho mahadbhis coktah) vacanapratipdyo 'yam artho mahadbhis cokta iti / atra casabdo bhinnakramah / ayam atrnvayah / ayam crso vrttnto 'rthasabdenokto mahadbhir vindhyavsiprabhrtibhir vacanapratipdyah / mahadbhir asyrthasya yad vacanam kathanam tatah kathand dhetoh pratipdyah pratipattum sakyo 'smbhir ity arthah // (Ks.2*, Ks.3, D.9b-5) *Ks.2 only reads: ayam crso vrtto mahadbhir vindhyavsiprabhrtibhir vacanapratipdyah II (cf.p.lO,fn.(2).). (6)(rajoduhkhopaghtopaghtakajijnsoh) rajoduhkhena ya upaghto gamyamnas tadupaghtako ya upyas tarn jijfisoh // (K.Ob, D.9-6) ^ ^(sattvd) katham1 jijfisur ity ha sattvd iti / sattvt kldrsd / dharmdi yat kusalasya sattvaprakarsadnalaksanasya mlam kranam tasya yo vipkas tasya2 dntmakakryaunmukhyam tasmin saty utpattum udgantum prakrstlbhavitum icchu yat sattvam tasmt / kranasya3 hy avikalpasya smnidhye kryasya prdurbubhsut4 / / (Ks.2, K.Ob, D.9-7) Ks.2 omits katham jijnsur ity ha sattvd iti. D. vipkasattvaprakarsasya Ks.2 omits kryasya hy avikalpasya smnidhye kryasya prdurbubhsut. D. prdurbabhsut

10

YUKTIDIPIKA

sastram pravrttam / tad arthat 1 parinamyate^ 1 ) 2 sisyasyeti / katham nama sisyasya3 nihsreyasena yogah syd ity evamartham idam 4 vykhynam kriyata iti / ha: yad uktam(8.18) jijnsave vykhynam^2) kartavyam iti tatra kutah punar iyam jijns kasmin5 vrthe bhavatiti / ucyate: yat tvad uktam(10.4) kutah punar iyam jijns bhavatlty 6 atra brmah: DUHKHATRAYBHIGHTJ JIJNS / (SKlab') duhkham raja ity anarthntaram / duhkhayatiti duhkham iti bhavati 7 / tiayam iti samkhypadam^3) sarvadravyavisayam, tad duhkhena 8 visisyate /
1 A. omits tad artht. 2 A. parinamsyate 3 A. omits sisyasya. 4 A. omits idam. 5 A. omits kasmin v ... punar iyam jijns. 6 P. inserts kasmin vrthe before bhavatity. 7 K. and D.: duhkham bhavati P. duhkham 8

10

bhavatiti A. and Dkha.: duhkhasabdena instead of tad duhkhena

(^(parinamyate) parinamyate cankramanaya hrdaye 'nupraves"yate / / (Ks.2,not found in D.)

(2) (vykhynam) vibhajykhyyante 'rth iti vykhynam* // (Ks.2**, D.llb-4) *Ks.2 vykhynam ca **Ks.2 is a random collection of marginal notes. Altogther it reads as follows: nanu kutas tvayedrsah paramarser vrttnto jnta ity sankyha raja eva itydi / ayarn crso vrtto(vrtt<n>to) mahadbhir vindhyavsiprabhrtibhir vacanapratipdyah / nanu tatkathanam taih katham krtam ity haivamdineti / grantheneti sesah / adhikrinam nirpayitum ha kimguneti / sampadam cety atra vykhytavn iti sesah / athavokta ity atra sthitena sambandhah / vacanam uktam tad vidyate yasya sa ukta uktavn ity arthah / paramarsiti / paramarsim eva pramnikurvantv iti yvat / tasya pramntkaranahetur visvgraja iti / sattvam csmd iti / nneti prthagbhtam / tadanugrahdivirahitam prakrstam, tadsmd viveka ity arthah / rajovirahena duhkhasya rpam nsti / nirkarisno sisyasyety arthah / sattvt kidrst / dharmdi yat kusalasya sattvaprakarsadnalaksanasya mlam kranam tasya yo vipkah sattvaprakarsadntmakakryaunmukhyam tasmin saty utpattum udgantum prakrstt bhavitum icchu yat sattvam tasmt / parinamyate cankramany hrdaye 'nupravesyate / vibhajykhyyante 'rth iti vykhynam ca / caturdasavidhe sarge yat kila traidhtukavdibhir ucyate / ihviceh prsthe dvtrimsat sthnny rdhavrttyvatisthante / tatra prathamni pancadasa sthnny astau naraks catvro manusyaloke ca dvips trini devasthnni / tadyath meror madhyabhge caturprahrjikh (<cturmahrjak>) meror upari trayastrimsh, tesm apy upari nirlamban vimnasth uparyuparivrttayas tusit nirmnaratayah parinirmitavasavartinas ceti saisa pancadasasthnah kmadhtuh / atra kmargnm kramena pretnm manusynrn devnm ca sthitih / tadupari saptadasa sthnni rpadhtur yatra kmavitarg abhidhynasukh atyaktabhavargs tisthanti / rpyadhtuh punar aniyataprasthno yatra dhynasukhavitargh / tatra rpadhtuparyantam jar vidyate maranam ca / rpyadhto tu visistarpatbhvj jaraso 'sambhave na maranam vidyate // (cf.p.l8,fn.(2) second half) (3) (samkhypadam) samkhy hi nma na padrthntaram api tu vastny* eva samhabhvena grhyamnnlti vaktum samhavcakam padam samkhypadam vyavahitam / / (K.Ob, D.9-8) *D. vastuny

PRATHAMAM AHNIKAM SKlab

11

prdhnyc ca^1) vyatiriktabuddhy grhyamnam sambandhitvd dhrasya bhedanibandhanyh sasthy nimittatvam pratipadyate x duhkhnm trayam duhkhatrayam / abhihanyate 'nenety abhightah^ / kah punar ayam abhighto nma / ucyate: yo 'sv uparyuktaduhkhatrayenntahkaranena 2 (10.8) cetansakter abhisambandhah^3) / tasmd duhkhatraybhightj jijns / yad uktam (10.5) kasminn arthe bhavatiti tatrha 3 TADAPAGHTAKE HETAU / (SKlb') apahantlty apaghtakah, tasypaghtakas tadapaghtakah4 / ha: tadapaghtake iti samsnupapattih 5 pratisedht / "kartari yau trjakau tbhym saha sasthi na samasyate" (Ksik 2.2.16, Pn.2.2.15) / tasmt tasypaghtaka 6 iti vaktavyam / ucyate: na sstre^4) darsant 7 / "tatprayojako hetus ca" (Pn. 1.4.55) iti sstre drstah prayogah / padakras cha "jtivcakatvt" (Vr.7 on Pan.4.1.14, MBhsya.II.206.23; Vr.l on Pn.1.2.10, MBhsya.1.107.21) / tath "kadcid guno gunivisesako bhavati kadcit tu 8 gunin 9 guno visisyate"(cf.MBhsya.
2 A. upayukta0 3 A. omits tatrha. 4 A. omits tasypaghtakas 5 A. samnupapattih 6 A. tasybhightaka 7 A. sstradasant 8 A. omits tu. 9

10

15

^Dkha. pratipadyate

tadapaghtakah.

Dkha. guninm

W (prdhanyac ca) pradhanyac ceti / yada tu samuhinah pradhanatvena grhyante tada vastuny eva bhnti / yad tu samhah pradhanatvena grhyate tadsau vastunistha eva bhti na svatantra iti vastni tasydhratay* laksyanta dhram ca sambandhitay sakyo vivaksitum iti ttparyam / / (K.Ob, D.10-1) *K. indicates a lacuna after tasydhratay. ' ' (abhightah) abhihatis ca nma buddhisattvasya prakstmano rajas duhkharpena duhkhapraksarpatvyaktih* / / (K.la, D.10-3) *D. rpat vyaktih * ' (abhisambandhah) antahkarane parigrfiltavisaykre caitanyacchyay yo 'nugraho yasmin sati sa visayah praksito bhavati saiva cicchaktyantahkaranayoh* sambandha ucyate / sa ca dvidhnugraho 'bhightas ceti / yad tu grhltasukhkravisayapratibimb buddhir bhavati tad tasym yas cetansaktyanugraho yasminsati sukhaniscaytm visayah praksito bhavati so 'nugrahah / grhltaduhkhkravisayapratibimbym buddhau cicchaktisambandho 'bhightatm pratipadyate / tenedam ttparyam yas cetansakteh sambandhah sa duhkhatrayena hetunbhighta^abdavcyo bhavati // (K.Ob, D.10-2) *K. praksi cicchaktyantahkaranayoh
(4

>(Sstre) sabdalaksane / / (K.la, D.10-4)

12

YUKTIDIPIKA

10

15

II.356.8-9) iti curnikarasya^1) prayogah / tasmad anavadyam etat / ayam tu pindrthah( 2 V trividhena duhkhenbhihato brhmanas tadapaghtakam hetum jijiisate / ko nmsau hetuh syd yo duhkhatrayam abhihanyd iti / ha: duhkhasabdvacanam 1 dv amangalrthatvt / mangaldini hi sstrni prathante vlrapurusni^3) ca bhavanti / adhyetras ca mangalenbhihitasamskrh^4) sstrrthn su2 pratipadyante(cf.MBhsya.I.40.7-9) / duhkham ity ayam cmangalrthah^ 5 ) 3 sabdas tasmn 4 nrabdhavyah sstrdv iti / ucyate: na vkyasyrthe prayogt p a d a s y n a r t h a k y d a m a n g a lrthatvnupapattih / vkyam arthapratyyanrtham prayujyate visistrthbhidhnt / na padam 5 / tath hi padrthavyatirekena 6 visista eva vkyrthah pratlyate kevalam tu padam smnyrthd apracyutam 7 visistrthbhidhnsamartham 8 / ata eva na vivaksitrthapratyyanayogyatayopdlyate^ 6 ) 9 / tadyath devadattety ayam sabdah kartrvcakatvenopttah sarvakriyvisayatvn nntarena 10 karmakriysabdau visistrthah pratlyate /
X A. sabdavacanam 2 A. su ca 3 A. ayathmangalrthah instead of ayam ca 4 A. tvan 5 A. visistrthbhidhnnupapadam 6 P. padrtham vyatirekena 7 K. ad apracyutam 8 A. visisyrth0 9 Dkha. tayopdiyate narthakyt 10

mangalrthah

A. omits nntarena

kriy sarvakarmakartrvisayatvt(l2.15-13.2).

(^(curnikarasya) asamasabhuyistha yadasanghatanocyate tatpradhanam grantham karotiti crnikro mahbhsyakrah / / (K.la, D.10-5) (2) (pindrthah) pindrtha etvanmtravastv iti yvat // (K.la, D.10-6) (3)(vlrapurusni) vTratvam utshasampat // (K.la, D.ll-1) (4) (-samskrh) samskro vighnabhtasya matimndyasypsanam // (K.la, D. 11-2) (5) (amangalrthah) amangalam duhkhapratipattilaksanam arthah prayojanam yasyeti yvad // (K.la, D.ll-3) (6) (-pratyyanayogyatay) pratiyogipadd anyad yat <anyat> krakd api / vrttisabdakadambasya sam band has tena nesyate / / yath tarunyo vrsallbhryah pravlrarn putrakmyati* rddhasya rjamtang iti na syuh prayuktayah // caitrasya dsabhryeyam lnacakraratho** may / saraih stitapatro 'yarP vrksd iti satm matam // (K.la, D.ll-4) (cf.Mughdhabodhavykarana, p.359.2-8.) *D. prakmyati / **The Mughdhabodhavykarana reads lnacakro ratho.

PRATHAMAM AHNIKAM SKlb

13

tathgm iti karma^1) sarvakriykartrabhidhnanimittatvt 1 / tath<bh>yjeti2 kriy^2^ sarvakarmakartrvisayatvt 3 <...> / yad tu devadatta gm abhyja 4 suklm ity ucyate tad devadatto 5 gosabdena karmntarebhyo vyavacchidya6 svtmany^3) avasthpyate <...> kriy ca <...> / gosabdas ca <devadattena> sarvakartrbhyo < vyavacchidya> devadattakarmatay vyavasthpyate / kartrkarmani cbhyjikriyyh 7 sdhanabhvenaiva niyamyete / suklasabdas ca 8 gosabdam^4) sarvagunavisayam^5)9 dheyntarebhyo vyavacchidya10 svtmana dhratve<na>11 niyamya 12 tadvisayatrp^ 6 ) 13 pratipdayatity anena kramena visisto vkyrthah / kevalnm tu pad an am smnyrthd apracyutnm 14 visesnabhidhnd narthakyam / ha ca 15 prthannivistatattvnW 7 ) prthagarthbhiptinm / indriynm yath kryam rte dehn na labhyate / / tathaiva sarvasabdnm prthagarthbhidhyinm 16 / vkyebhyah pravibhaktnm arthavatt na labhyate //(cf.VP.II.423-424)
x Dkha. kartrabhidhnatvat 2 K., R and D.: tathtyjeti 3 Dkha. sarvakarmakriyvis ayatvt 4 K., P. and D.: atyja 5 A. devadattena 6 K., P. and D.: vicchidya 7 K. and P.: ctyjikriyyh D. ctyjyakriyyh 8

10

A. cbhyjakriyyh A. suklasabdo gosabdas ca 9 A. sarvagunivisayam 10 A. vyavacchedya 11 All the Mss read dhratve. 12 K. and P.: niyamyate D. niyamyate, s.m. niyamya Dkha. niyamya 13 A. tadvisayat 14 A. smnyrtht pracyutnm 15 A. omits ca. 16 P. reads prthagarthbhidhnd and repeats narthakyam // ha ca prthannivistatattvnm ... sabdnm prthagarthbhi dhyinm, i.e. P. omits in this case sarva of sarvasabdnm.

^) (karma) karma karmasabda ity arthah / nantarena kriyakarmasabdau visistarthah pratiyata ity adhyhrah / / (K.la, D.ll-5) (2)(kriy) kriyvcT sabdah / / (K.lb, D.llb-6) (3)(svtmany) svbhidheye / / (K.lb, D.llb-7) (4)(gosabdam) gosabdrtham ity arthah / / (K.lb, D.llb-8) '5) (sarvagunavisayam) sarvagundhratay yogyam iti yvat // (K.lb, D.llb-9)
(6

)(tadvisayatm) suklagunavisayatm // (K.lb, D.llb-10)

^7) (prthahnivistatattvnm) bhinnsraynm / / (K.lb, D.12-1)

14

YUKTIDIPIKA

10

15

20

iti / evam sati kuto ' y a m niscayapratilambhoyad 1 duhkhasabdo ' y a m amangalartho yvat sandihyata evyam kirn2 svrthapratipattyartham uptto 'tha heyatvyeti 3 / vkyasya tu mangalrthatvam 4 duhkhaprahnrtham 5 updnt / yad dhi duhkhaprahnrtham 6 vkyam updiyate tan mangalrtham drstam / tadyath vydhyapagamah 7 syd alaksmir m bhd iti / duhkhaprahnrtham 8 cedam vkyam upttam / tasmn mangalrtham idam / tatra yad uktam(12.4) duhkhasabdvacanam 9 dv amangalrthatvd ity etad ayuktam / ha: trayagrahannarthakyam gunaikatvt / duhkham raja iti pratipanno bhavms tac caikam sstre pathyate / tasmt trayagrahanam anarthakam iti / nimittabhedd bhedopacra iti cet / syn matam / yady apy ekam duhkham tathpi nimittnm adhytmdhibhtdhidaivalaksannm bhedd asya bhedopacrah karisyata 10 iti / tac ca naivam / kasmt / njmittnantyena gunnantyaprasangt 1 1 / dhytmikam hi 12 dvividham sriram mnasam ca / srlram tvad vtapittaslesmanm vaisamyanimittam / tath mnasam <kmakrodhalobhamohavisdabhayersyratysyvisesadarsananimittam>^) 1 3 / dhibhautikam 14 ca manusyapasumrgapaksisarlsrpasthvaranimittam / dhidaivikam sltosnavtavarssanyavasyyvesanimittam 15 / tatra nimittabhedt tritvapratijnasya gunnantyaprasangah / sa ca nestah / tasmn na nimittabhedt tritvam / ucyate: yad uktam(14.8ff.) rajasa ekatvt tritvnupapattis tasya nimittabhedt tritvopacra iti satyam 16 etat / yat tktam(14.13) nimittnantyena gunnantyaprasanga iti tad ayuktam / kasmt / bhede^2) 'pi sati varna1 A. reads niscayapratilambhah kuto yad, omitting 'yarn. 2 Dkha. atha kirn instead of ay am kirn 3 Dkha. pratipattyartham updatte atha heyatye(ti) 4 A. rtham 5 A. prahranrtham 6 A. prahranrtham 7 Dkha. vyapagamah 8 A. prahranrtham 9 A. sabdavacanam 10 12 K., 13

Dkha. tathpi adhytmdhibhtdi(sic)daivalaksananimittabhedd bhedopacrah karisyate ^Dkha. duhkhnantyaprasangt P. and D. omit hi. K., P. and D.: vi$dabhayersyratyavisesadarsana A. and Dkha.: visdabhayersysyratyavises adarsana0 14 A. omits dhibhautikam sthvaranimittam. 15 P. osma instead of osna 16 A. samam

(1)(kamakrodhalobhamohavisadabhayersyaratyasuya-) kmah strTbhogeccha / krodhah prajvalantm / mohah sukhasdhanesu sukh<>sdhanabuddhih(?)* / Trsy sdhranatay bhogyogye 'pi vastuni svtmakabhogyatrtham aparabhogsahanam / asy gunesu dosviskaranam / aratih kutrpy anavasthnam, arater bhva ratyam** (cf.Pn.5.1.119) / visdo glnih / / (K.2a, D.13-1) *K. and D. sukhasdhanabuddhih **D. anavasthnam, s.m. anavasthnam arater bhv ratyam (2)(bhede) prathamabhedd eva sarvasangrahd iti ttparyam / / (K.2a, D.13-2)

PRATHAMAM AHNIKAM SKlb

15

samkhyvad vyavasthnopapatteh / tadyath catvro varn ity asyh samkhyyh sati paippalddibhede 1 tesm brhmanatvdivyatirekbhvn na samkhyntarahetutvam no khalv api varnvyatirekd ekatvam bhavati / evam trini duhkhnity asyh samkhyyh sati srirdibhede 2 tesm dhytmikdivyatirekbhvn 3 na samkhyntarahetutvam no khalv api duhkhvyatirekd ekatvam4 bhavitum arhati / kirn cnyat / nimittabhedd bhedopacra iti bhavn eva pratipannah / na copacrah paramrtha ity alam asthne 5 yatnena / ha: abhightj jijnsym atiprasangah sarvesm s a m b h a vt / yady surer6 duhkhatray abhightj jijns bhavatlty 7 et ad ist am tena sarvesm abhighto 'stiti sarvesm jijnsprasangah / atha mata<m>8 duhkhbhighte^1) kasyacij jijns bhavati kasyacin neti / nanv <etad> icchmtram 9 / prkprasangc ca 1 0 / prg(2) apy surer 11 jijnsy duhkhatraybhighto na csytyantike hetau jijns babhva / tena kirn prptam / pascd asya yato babhva tad vaktavyam / yathnyatra^3) brahmano 12 ? bhysanimittd adharmaksayt prvadharmnugrahc 13 ca vividis tathnyesm^4) kusalaJ A. paipyaladi0 2 K., P. and A.: sarirdibhede D. sarirdi0, 3 A. and Dkha.: vyatireksambhavn 4 P. ekam 5 A. ity ayasthne 6 A. yathsure 7 A. omits ity. 8 K., P. and D.: sati A. mata 9 K., A., P. and D.: nanv evam icchmtram 10 D. prkprasangc ca, s.m. prkprasangs l ^A. sure 12 A. brahmano 13

10

15

s.m. srirdi0

Dkha. nanu icchmtraprasangc ca ca

Dkha. prvadharmnugrahena

(^(duhkhbhighte) matabhedesu pathyatvbhimnndh jan vrth / yato ghattakutlbhvah param tvam visvatomukha // ghattakutl jaktkhna* iti bhsay prasiddhas tadvad bhvah satt yasya sah / / (K.2b, D.141) *D. ghattakutTjakt khna na tu punar iyam abhightanimitt jijnslaksaneccheti jijnsyh prg iti sambandhah // (K.2b, D.14-2) ^3^ (yathnyatra) yathnyatra samiksdisstre tannimittntaram uktam <tathety api>* vaktavyam iti sambandhah / tatratyam eva grantham pathati brahmana** iti brhmanasyety arthah / yadi v brahmano vedajnnasya yo 'bhysas tatkrtd adharmaksayt / nanu sa evbhysah kuta ity ha prvadharmeti / / (K.2b,D.14-3) *K. and D.: tathpi **D. brahmana ^4'(anyesm) anyesm api sstrakrnm evamvidham vkyam astlti tad vkyam pathati / / (K.2b, D.14b-4)

16

YUKTIDIPIKA

10

mulabhyasaparipakat^ 1 ) <iti(?)> / na capadistam^2) ato laghuktam^3) etat / kirn cnyat / tadapaghtc^ 4 ) cnirmokso 'krtsnatvt^ 5 )/ mokso hi kmarprpyadhtutrayd 1 isyate / daivamnusyatiryagyonitrayd 2 v / ekadesas ca samsrasya duhkhatrayam / tasmt prayojanam apy ayuktam^ 6 )/ kirn ca nimittntarasadbhvd / divyakmadhynasukhnapeksasypi^7) vividis sambhavati na kevalam tpodvignasya 3 / tasmn nimittam apy(8) ayuktam / kirn cnyat / ubhayath csambhavt / parikalpyamn khalv aplyam 4 jijns purusasya v syd gunnm v / kirn ctah / tan 5 na tvat purusasya sambhavati / kasmt / nairgunybhyupagamt / icchdvesaprayatnasukhaduhkhadharmdharmajnnasamskrnm tmagunatvam (cf.NS.1.1.10) na 6 bhavadbhir abhyupagamyate / na gunnm cetanyt 7 / na hy acetan ghatdayo hithitaprptiparihram 8 jijfisamn drsyante / na ca cetan 9
1 A. karmaruparupya0 Dkha. kamarupyarupya0 2 A. and Dkha.: devamnusatiryagyoni0 3 K., P. and A.: tpodvignasypi D. vignasypi, 4 A. apiya 5 Dkha. omits tan. D. tan na, s.m. na 6 A. na tad 7 A. caitanyt 8 Dkha. parihsam 9

s.m. vignasya

A. cetanh

(*) (kusalamulabhyasaparipakat) kusaleti / kusalam muladharmanugrahas taddhetuko yo ?bhyasas tasya paripkt // (K.2b, D.14b-5) (2) (apadistam) nimittntaram // (K.2b, i.n., not found in D.) (3) (laghktam) apariprnam uktam // (K.2b, D.14b-6) (4^ (tadapaghtc) duhkhatraypaghtt // (K.2b i.n., not found in D.) (5) (tadapaghtc cnirmokso 'krtsnatvt) duhkhatrayam asypaghtake krte 'pi kmadhtor eva traidhtukasamsraikadesamtrd duhkhatrayasamprnn mukto bhavet / na tu rprpyadhtubhym / tayor hi dhynam pattisukhaikaghanasvabhvatvn na tu duhkhatrayarpat / tad vaksyati samsraikadesas ceti / nanu traidhtukah samsra iti naitat siddham / ucyate tathpi devditrayam samsrtmakam prasiddham / / (D.14b-3, not found in K.) ^6^ (prayojanam apy ayuktam) duhkhatrayanivranam hi prayojanam tac cyuktam asamprnamoksarpatvd* iti bhvah // (K.2b, D.14b-7) *D. asamprnam moksa0 (7)(divyakmadhynasukhnapeksasypi) divyam sukham devnm kmasukham narnm dhy- nasukham dhyyinm / anena sukhnapekspi jijnsymhetur bhavati na tu duhkhatraybhighta evety uktam // (K.2b, D.14b-8) (8) (nimittam apy) nimittam apTti / jijnsym duhkhatrayajihs nimittam ity uktam, anyad api sambhavati / tat kirn iti noktam iti ttparyam / / (K.2b, D.14b-9)

PRATHAMAM AHNIKAM SKlb

17

bhavatm gunh "smnyam 1 acetanam prasavadharmi"(SKllb) pradhnam iti vacant2 / kirn cnyat / tattvntarnupapatteh / na ca gunapurusavyatiriktam vas tattvntaram 3 asti yasya jijfis parikalpyamn 4 parikalpyeta / tasmd anupapann 5 jijfis / ucyate^: yad uktam(15.8) abhightj jijnsym atiprasangah sarvesm tatsambhavd ity atra brmah: na abhightatvenpratipatteh^/ yady apy avisisto 'bhightas tathpi 6 sarve nainam abhightatvena pratipadyante / tath hi satsv 7 dhytmikdiduhkhesv arjanaraksanaksayasangahirpssu8 ca prityabhisvarigd esm na visayesdvegpadvesau9 na ca visayaparitygo bhavati / tasmn nvisisto 10 'bhightah / visese 'bhightabuddher 1 1 nimittbhidhnam 1 2 iti cet / athpi syd 13 yeyam asati visese sarvaprnabhrtm surer eva bhagavato duhkhatraybhightabuddhir bhavati na punar anyesm ity atra nimittam abhidhniyam / na hy antarena nimittam asau viseso14 'vastKpayitum15 sakyata iti / etac cyuktam / kasmt / prasnsambandht / kuto jijfis16 bhavatlty evam codakena prvam akri prasnas tasys ca skst kranam abhightah kranntarnm anabhidhnd ity asyaiva 17 nirdesah krtah / yat tu khalv idnlm kranakranam api prcchyate tad anavasthpfasangabhayn nocyate / atha nirbandhah kriyate tena prvadharmnugrahasya kusalamlbhysaparipkasya kranakranatvam na 18 pratisidhyata iti tad eva kirn na grhyate / etena prkprasarigah pratyuktah / yat tktam(16.2) td<apaghtc>19 cnirmokso 'krtsnatvd ity etad apy ayuktam 2 0 / kasmt /
2 K., P. and D.: vaksyamnavacant 3 A. vastutattvntaram Dkha. nas tattvntaram 4 P. parikalpamn 5 A. anupann 6 A. omits api. 7 Dkha. na hi sa satsv for tath hi satsv 8 A ajainaraksana0 9 D. visayesdvegpadesau Dkha. visayesdve rgadvesau 10 A. na vis ist o 11 A. ?buddhe D. avighta0, s.m. abhighta0 12 Dkha. nimittd abhidhnam 13 Dkha. cet / api syd 14 A. and Dkha.: visese 15

10

15

20

*A. smnyem

Dkha. sthpayitum Dkha. kuto hetor jijfis A. hetau jijfis 17 A. asaiva 18 A. and D.: asmbhir na 19 All the Mss read tadabhighte. 20 Dkha. omits apy.

(1

l(ucyate) siddhantino vakyam itah prabhrti // (K.3a, D.15 without number*) *D. deletes this note with a horizontal line.

' ) (abhightatvena) abhightatvena jfiyamno 'bhighto jijfisnimittam ity anena tad api parihrtam yac cod it am sureh prvam eva kasmn nbhj jijfis (cf.15.12) iti / prvam hy eso 'bhightamnbhightatvenmamsteti bhvah // (K.3b, D.16-1)

18 sastrarthanavabodhat^ 1 ) /

YUKTIDIPIKA

astavikalpo daivas tairyagyonas 1 ca pancadh bhavati / mnusyas caikavidhah /(SK53abc) ity etvn asmkam samsrah / na tu tadvyatirikth kmarprpyadhtavah^2) kvacid api^3) siddhh / caturdasavidhe ca2 samsre y sukhamtr s duhkhabhyastvt tacchabdavcy bhavatlti / tath coktam
1 K., 2

P. and D.: tairyagyonis A. tiryagyonis A. omits ca.

a-) tattvapariksaprayojanam hi sst ram idam iti bhavah / / (K.3b, D.17-1*) *D. writes the same note in the bottom margin of D.16, and deletes it with a horizontal line. (2) (kmarprpyadhtavah) kmarprpyadhtava1 iti / caturdalavidhe sarge2 yat3 kila traidhtukavdibhir ucyate / ihvlceh prsthe dvtrimsat sthnny rdhvordhvavrttyvatisthante / tatra4 prathamni pancadasa sthnny astau naraks catvro manusyaloke ca dvlps trlni devasthnni / tadyath5 meror madhyabhge <cturmahrjak>6 meror upari trayastrimsh, tesm apy upari nirlamban vimnasth uparyuparivrttayas tusit nirmnaratayah parinirmitavasavartinas ceti / saisa pancadasasthnah kmadhtuh / atra kmargnm kramena pretnm manusynm devanm ca sthitih / tadupari saptadasa sthnni rpadhtur yatra kmavltarg abhidhynasukh atyaktabhavargs tisthanti / te ca saptadasavidhh / tath trlni dhynni pratyekam bhmiktritayena vartante / iti nava bhedh / caturtham dhynam astabhmikam iti saptadasa / evam uparyuparivittlni dvtrimsat sthnni kmadht rpadhtus ca / rpyadhtuh punar aniyatasthno7 yatra dhynasukhavltargh, tesm caturdhopapattih / ksam anantam iti bhvayatm ekah prakrah / vijnnam anantam 9 iti bhvayatm dvitlyah / kimcanyam8 anantam iti bhvayatm trtlyo na samjn na samjnlti bhvayatm caturthah /10 ete ca bhvannurpasamvitsatattvamtrases bhavanti / tatrsmims traidhtukakrame 'pi caturdasavidht sargn na kimcid abhyadhikam uktam / / (Ks.lj D.17b-2) 1 D. kmarpyadhtava, s.m. kmarprpyadhtava 2 K. adds caturdhadasavidhe sarge 3 4 5 above the line. D. yath, s.m. yat K. adds tatra above the line. K. omits 6 tadyath meror ... vartinas ceti. D. has this phrase in the bottom margin. D. catur7 8 9 prahrajikh D. sthnh, s.m. sthno D. s.m. kimcanyam D. na samjn 10 nasamjn iti D. omits 'pi. (kmarprpyadhtavah) caturdasavidhe sarge yat kila traidhtukavdibhir ucyate / ihvlceh prsthe dvtrimsat sthnny rdhavrttyvatisthante / tatra prathamni pancadasa sthnny astau naraks catvro manusyaloke ca dvlps trlni devasthnni / tadyath meror madhyabhge <cturmahrjak>* meror uparitrayastrimsh, tesm apy upari nirlamban vimnasth uparyuparivrttayas tusit nirmnaratayah parinirmitavasavartinas ceti saisa pancadasasthnah kmadhtuh / atra kmargnm kramena pretnm manusynm devanm ca sthitih / tadupari saptadasa sthnni rpadhtur yatra kmavltarg abhidhynasukh atyaktabhavargs tisthanti / rpyadhtuh punar aniyataprasthno yatra dhynasukhavltargh / tatra rpadhtuparyantam jar vidyate maranam ca / rpyadhtos tu visistarpatbhvj jaraso 'sambhave na maranam vidyate / / (Ks.2**) *Ks.2 caturprahrjikh **cf.p.lO,fn.(2).) (3) (kvacid api) kvacid aplti / etvataiva pramnasiddhatvam samjnmtram adhikam krtam iti bhvah / / (K.3b, D.17-3)

PRATHAMAM AHNIKAM SKlb atra jarmaranakrtam 1 duhkham prpnoti cetanah purusah / lingasyvinivrttes tasmd duhkham samsena 2 / / (SK55)

19

drsyate ca' 1 ) loke bhyas grahanam / tadyathmravanam iti / tasmt krtsnavikalpapratisedho ' y a m 3 / Ya^ punar etad uktam(16.5) divyakmadhynasukhnapeksasypi vividissambhavn nimittam ayuktam iti 4 tad apy anupapannam / kasmt / uttaratra^ 2 ) pratisedhd ist am 5 evaitat^ 3 ) sangrhltam( 4 V tath cottarastrena^ 5 ) pratisetsyaty cryah drstavad nusravikah sa hy avisuddhiksaytisayayuktah 6 / (SK2ab) tasmd divyasukhnapeksasypi^6) yukt 7 vividis / dhynasukham 8 api ksaytisayau ntivartate 9 / tad apy atraiva sangrhitam / tasmt pratisedhya evyam paksa(7) iti na kimcid abhidhlyate / yad apy uktam lo (16.8) ubhayathsambhavj jijfisnupapattir ity astu gunnm jijns / yat tktam (16.12) cetanyd 11 asambhava iti saty cetanye 12 buddher^8) icchdisadbhvam uttaJ K. and P.: atra janmajar0 D. 2 D. samsena, s.m. svabhvena 3 A. pratisedhyam 4 A. ayktam ceti 5 D. drstam, s.m. istam 6 A. ksaytiyuktah 7 K., P. and D.: napeksasyokt 8 Dkha. dhynam 9

10

atra janma0, s.m. tatra janma0

K., P. and D.: kramtisayau ntivartate A. ksayatisayo notivartate Dkha. ksaytisayau ntivartate 10 A. ayuktam 11 Dkha. acaitanyd A. caitanyd 12 Dkha. saty api caitanye

M (drsyate ca) nanv atra sukham apy astity aha drsyate ceti / duhkham hi bhuyo bahutaram rajasa eva pravrttirpatvena sarvatra smnyt / / (K.3b, D.17-4) (2) (uttaratra) uttaratreti / uttarena hi strena sukhnapekspi nimittatvenoptt / anyanimittatvam jijnsyity adhyhrah / yat tvay coditam abhighta eva hetutvena jijfisym ukte nimittntaram tu noktam ity uttarastrena parihrtam // (K.3b, D.17-5) ^3^ (istam eva) istam eveti / anapeksy hetutvam ity adhyhrah / / (K.3b, D.17-6) ^4^ (sangrhitam) nanu kasmt tan noktam ity ha sangrhitam iti / uttarastreneti bhvah / / (K.3b,'D.17-7) ^5) (tath ca) etad vrttikam vycaste tath ceti / / (K.3b, D.17-8) ^ ' (divyasukhnapeksasya) sukhnapeksasya duhkhbhightena samvedanahetutaysmbhir ukt jijns / saiva divyasukhnapeksasya na tv ahetuketi bhvah / / (K.3b, D.18-1) ' )(paksa) anapeks jijfisym hetur ity esa paksas tyjyaiveti (K.3b, D.18-2) / ato hetor duhkhbhightam muktv nnyat kimcid abhidhlyate jijfishetutveneti / / (K.3b, D.17-8) ^(buddher) buddher iti / cetansaktiyogena cetayamn* buddhir icchdlngunn bhajate / na tu cidekasvabhve pumsTcchdiyogenpy atyantcetanadehaghatdv** iti vaksymah / /

20

YUKTIDIPIKA

10

15

ratra pratipadayisyamah(SK20) / tasmad upapanna jijfiasa / ha: tacchabdnarthakyam pratipadam asambandht 1 / yo ' y a m cryena tacchabdah stre pathito 'sya khalu pratipadam asambandht svalpm apy arthavattm nopalabhmahe / tasmn nainam apuskalrtham adhyesymaha iti / ucyate: katham hi nma prayoktrpratantryc chabdasya sabdntarena sambandho^1) na syd iti / ha: na brmo 'vidyamnasambandho 2 'sambandhah / kirn tarhi 3 / ayuktasambandho yah sa khalv asambandhah / tadyathncro mnavaka iti dravyena kriysaktitvn^2) na sakyam kimcid ancravat 4 ksanam apy 5 avasthtum / ayuktam tv carann 6 ancra ity ucyate / tath csya tacchabdasya pratipadam sambandho na yuktas tasmd anarthakas tacchabdah / nantaryj jijnssabdasyeti cet / syn^3) matam / "anantarasya vidhir v 7 bhavati pratisedho 8 v"(cf.MBhsya.I.101.12) ity anay yukty 9 jijfissabdasya tacchabdenbhisambandhah sakya iti / tac ca naivam / kasmt / tadapa^4) prayojansadbhvt 1 0 / na hi jijnspaghte kimcit prayojanam saty 11 api sambandhe na tacchabdenrthah / abhightasyeti cet / athpi syd / yadi jijnspaghte na kimcit prayojanam astity atas tatsambandho 12 nesyate tena tarhy abhightasabdensybhisambandhah 13 karisyate /
1 A. pratipadasambandhat 2 A. avidyamnas sambandho 3 A. trhy 4 D. ancravatah A. ancrat 5 A. omits apy. 6 A. carann 7 A. vidhi v 8 A. pratisedh 9 A. yuktym 10 K., P. and D.: prayojansambhvt 11 A. omits saty api ... kimcit prayojanam 12 A. atatsambandho 13

astiti.

Dkha. sabden$ypaghtasybhightasambandhah

(K.3b, D.18-3) *D. cetayamn, s.m. cetanyamn **D. yogenpi atyantcetanadehaghatdv, s.m. yogo npi atyantcetane dehaghatdv (*) (prayoktrpratantryc chabdasya sabdntarena sambandho) na hi sabdena sabdasya svbhvikah kascit sambandhah / sa tu prayoktrkalpitah // (K.4a, D.18-4) W (kriysaktitvn) kriysaktyavyatirekd avyabhicrt kriymsatvt / / (K.4a,D.18-5) (3) (syn) syd iti / sambhvanm darsayann abhyupagamamtram et at / / (K.4a, D.19-1) (4) (tadapaghtake) jijnspaghte // (K.4a, D.19-2) (5) (na hi jijnspaghte kimcit prayojanam asti) svpdyavasthyam api jijns nsti na ca s prpyeti bhvah / / (K.4a, D.19-3)

PRATHAMAM AHNIKAM SKlb

21

tath cpi tacchabdo 1 'rthavn bhavisyatiti / etad a n u p a p a n n a m / kasmt / nimitt vast hne^1) punah punar 2 utpatteh 3 / naimittiko ' y a m abhightas tasya nimittavattvd tyantiko 4 'paghto na syt / itarath^ 2 ) jvaranimitto 5 dha iva sitadravyasarnsparst prasnto 'pi nimittvasthnt punah punah pravartata ity asyphalatvam 6 vyymasya / trayasabdasyeti cen na pratantryt / srayaparatantr 7 hi samkhy, tasy nntarensrayopaghtam apaghtah 8 sakyah 9 kartum / narthakyam ca samnam 10 iti sutarm tacchabdena nrthah / duhkhasyeti 1 1 cet / syn matam / yady etesm padnm abhisambandhe yathoktadosopapattih, duhkhasabdam 12 tarhi tacchabdenbhisambhantsymah 13 / tasminn esa nisedho visatiti / tac ca naivam / kasmt / anekapadavyavadhnt / katham anantaravrttin 14 sarvanmnnekapadavyavahitasyaduhkhasabdasybhisambandhah sakyeta 15 pratipattum 1 6 / tasmn na kimcid etat / kirn cnyat / upasarjanatvt / ayam khalv api duhkhasabdah samsa upasarjanlbhtah / na caikasmin kle sabdasya^3^ pradhnatvam upasarjanatvam ca yuktitah sambhavati / pradhnasya ca padntarenbhisambandhah 17 / tasmd vivdspadam 18 evaitat stram / kirn cnyat / nitynm apaghtnupapatteh / iha nitynm apaghtah kartum na sakyate 19 / tadyath purusnm / anitynm cpaghto drstah / tadyath jvardinm / nityarn^4) ca
2 K., P. and D.: punar (not repeated) 3 A. utpakteh{7) 4 A. nimittavattve tv tyantiko 5 A. jvaranimittako 6 A. aphalatvam asya 7 Dkha. sritaparatatr 8 Dkha. nntarensrayam samapaghtah 9

10

15

a. tath capasabdtho

A. saktah ^A. samnm n K., P. and D.: duhkhasabdasyeti 12 A. duhkhasabdena 13 A. bhibhatsymas D. sambatsymah, s.m. sambhatsymah 14 Dkha. antaravrttin 15 A. sakyate 16 A. pratipditum 17 K., P. and D.: padrthenbhisambandhah 18 A. vivdvastham 19 A. nsakyate

\ ' (nimittavasthane) duhkhatray<am>* sati nimitte bhavatiti yavat / yadi nimittocchedo na syd iti sesah // (K.4a, b.19-4) *K. and D.: duhkhatraye
(2

^(itarath) nimittnucchede / / (K.4a, D.19-5)

' *(sabdasya) anyatrahi paratantribhtasya katham anyatra samkrntih //(K.4b, D.20-1) ^4)(nityam) rajoguno hi nitya eva // (K.4b, D.20-2)

22

YUKTIDIPIKA

10

15

duhkham / tasmat tadapaghate 1 'bhyutthananarthakyamW / vrttyapaghate tadapaghata^ 2 ) 2 iti cet / syt punar es buddhih / satyam nitynm apaghto na yuktitah sambhavati / na tu vayam gunalaksanasya duhkhasypaghtam brmah / kirn tarhi / vrttir asybhibhyata iti / tac ca naivam / kasmt / uktottaratvt / uktam atrottaram 3 (21.2) nimittvasthne punah punar^3) utpatter iti / tasmd ayam apy amrgah 4 / kirn cnyat / avisest / kalpayitvpi vrttyapaghtam vrttivrttimator 5 ananyatvd vrttyapaghte 6 vrttimadapaghtah prpta iti nsti kascid visesah / tasmt krso 'yam7 parihra iti nrthas tacchabdena / ucyate: yad uktam(20.2) tacchabdnarthakyam pratipadam asambandhd iti / astu duhkhasabdenbhisambandhah / tatsambandhe 8 yathoktadosopapattir iti cet / syn matam / yadi tarhi tacchabdasya duhkhasabdenbhisambandho 9 'bhyupagamyate tena ye 'smbhih prvam abhihit doss te prasajyante 10 / tasmt pratisiddhasya 11 paksasya 12 parigrahe shasamtram iti / etac ca naivam / kasmt / pratividhnt / satyam asati pratividhne shasamtram syt / pratividhiyate tu, tasmd adoso ' y a m iti / kirn tad iti cet / syn matam 1 3 / ucyatm 14 tarhi kirn tat pratividhnam^ 4 ) yasyvastambhennekadosavyhato 'py 15 ayam paksa sriyate 16 / na hy anuktam asmbhir kramtrena^ 5 ) sakyam pratipattum iti / ucyate bdham / yat tvad uk1 Dkha. omits tad-. A. tadupaghate 2 A. vrttyupaghtatadaghta 3 A. atrottare 4 A. amrga iti 5 A. kalayitvpi vrttyabhightam vrttimator 6 A. apaghto 7 A. krsoya 8 A. sambandho 9 A. sabdenaivbhisambandho D. duhkhasabdasybhi0, 10 A. prasajyete 11 12 A. 13 A. 14 A. 15 A. 16

s.m. duhkhasabdenbhi0

D. pratisabdasya pakse matam syd ucyate omits apy. Dkha. sriyeta A. srayeta

W ('bhyutthananarthakyam) udyama evatra na yukta iti yavat / / (K.4b, D.20-3) (2) (tadapaghta) duhkhbhightah / / (K.4b, D.20-4) (3) (punah punar) punah punar iti / vlpsay bahuso 'py ucchinn vrttih kranasadbhvt bhaved eveti vrttyucchedah praysamtram ity ha / / (K.4b, D.21-1) (4^ (pratividhnam yasya) pratividhnam* yasyeti karmani sasthl / / (K.5a, D.21-2) *D. omits pratividhnam. (5) (kramtrena) kramtrena scanmtrenaivety arthah / yadvstm viseskrena, smnykrenpi pratipattum na sakyam ity arthah / / (K.5a, D.21-3)

PRATHAMAM AHNIKAM SKlb

23

tain (21.11) anekapadavyavadhnn 1 na duhkhasabdasya tacchabdenbhisambandha ity atra brmah: n a a n a b h y u p a g a m t / yo hy anantarakrtam sabdasya sabdntarena saha 2 sambandham caste 3 tarn praty ayam uplambhah 4 syt / vayam tv arthakrtam sambandham caksmahe / tath coktam yasya yenbhisambandho drasthasypi 5 tasya tat^ 1 ) 6 / arthatas tv 7 asamnnm nantarye 'py asambhavah / / 8 (cf.e.g. NBh.1.2.9, NVTT on NS. 1.1.4) kirn cnyat / s s t r e d a r s a n t / sstre ca vyavahitnm api sarvanmnm abhisambandho drsyate "yasya, gunasya hi bhvd dravye sabdanivesas9 tadabhidhne( 2 ) tvatalau 10 "(cf.Vr.5onPn.5.1.119, MBhsya.II.366.10) iti / atrrthakrtas 11 ca sambandhah sabdnm abhyupagatah^ 3 ) 12 / "hypprtipadikt"(cf.Pn.4.1.1) "bahusu bahuvacanam"(cf.Pn.l.4.21) "supo dhtuprtipadikayoh"(cf.Pn.2.4.71) "alug uttarapade"(cf.Pn.6.3.1) ity evamdinm abhisambandhbhyupagamah 13 / tath^4) "anadvham 14 udahrini bhagini vahasi y tvam siras 15 kumbham avcinam abhidhvantam adrksih" (cf.MBhsya.I.152.26ff.) iti vrttike drstntah / na hy atra saty nantarye sirasnaduho vahanam kumbhasya v saranam upapadyate / yath ctra vyavahitnm abhisambandhas tathehpi drastavyah / yat punar etad uktam (21.14) upasarjanatvt padntarennabhisambandha 16 iti / etad anupapannam 17 / kasmt / samsd 1 8 a p o d d h r e b u d X A. vyavadhonn 2 A. omits saha. 3 A. ccaste 4 A. rambhas 5 A. drasypi 6 A. sah 7 A. arthato hy 8 D. asambhavah //, s.m. 9 A. sabdanivasas 10 A. ttalv 11 A. omits atra. 12 Dkha. abhyupagamah 13 14 D. anudvham, s.m. 15 K., P. and D.: Sirasi 16

10

15

20

asambhavah // iti /

K., P. and D.: abhisambandhbhyupagamt the bottom margin. anadvham

D. reads abhyupagama ity anydarse pthah in

K. and P.: sambandhe A. and Dkha.: sambandha D. sambandhe, s.m. sambandha K. etad anupannam (sic) A. anupapannam etat K. and P.: samsrd D. writes and deletes samsrd in the left margin.

I1' (tat) tatpadam tasya sambaddham yasya yenabhimukhah sambandho yuktah / / (K.5a, D.22) d-) tacchabdena bahupadavyavahito gunah pratyavamisyate / / (K.5a, D.22-1) ^3'(abhyupagatah) abhyupagama ity anydars"e pthah / / (K.5a, not found in D.) (4) (tath) tatra hy ekavkyatay vykhynam kriyate / / (K.5a, D.22-1)

24

YUKTIDIPIKA

10

dhya vyavasthitasya 1 svatantryopapatteh / satyam upasarjanasya padantarenbhisambandho nopapadyate / na tu vayam samsavrtter eva tacchabdenbhisambandha iti pratipadymahe / kim tarhi / samsd apoddhrtasya buddhivyavasthitasyopajanitasvtantryasya^ 1 ) sabdntarena sambandham icchma iti / athaitad anistam ' V g a P r a m a n e 2 c a tadabhve 'darsanam syt" (cf.Pan. 1.2.55) "atha sabdnussanam, kesm sabdnm"(cf.MBhsya.1.1.1-2) iti caivamdlnm 3 prayognm virodhah prpnoti / anistam caitat / yat punar et ad uktam(21.17) nitynm apaghtnupapatter 4 vrttyapaghte 5 ca tadapaghtaprasahgd iti / etad apy 6 anupapannam / kasmt / gunasakteh prayojanoparame 7 saty t m a k a l p e n a vyavasthnbhyupagamt / naitad 8 abhyupagamyate gunasyocchittir bhavati vrttir vsybhibhyate / kim tarhi / purusrthanibandhan caritrth 9 saktir asya^2) purusrthapravrttau prayojansadbhvd 10 tmakalpena vyavatisthata ity etad vivaksitam / tasmd yuktam etat tadapaghtake hetau jijns pravartata iti / DRSTE SPRTH11 CET / (SKlc) syd etat / pratyakso 12 duhkhapratikrahetur asti / tasya samatikrame kim prayojanam / tadyath srlrasya tvad ayam apagamahetur 13 anekadravyarasyanopayogah^ 3 ) 14 / mnasasypi 15 manojiiastrlpnabhoj anavilepanavastrlamkrdivisayasamprptih^ 4 ^ 16 / dhibhautikasya nitisstrbhysah sastrs1 D. buddhyavasthitasya 2 A. yogapramno 3 A. tath caivamdlnm 4 A. anupaghtnu0 5 A. vrttyupaghte 6 A. omits apy. 7 A. prayojane 'parame 8 A. na tad 9 D. taddhitrth (?), s.m. caritrth 10 K., P. and D.: purusam prati pravrttau prayojansambhvd 11 A. samarth 12 A. pratyakse 13 K. upagamahetur Dkha. apaghtahetur 14 A. rasyanopabhogo 15 Dkha. mnasas tasypi 16 0

15

K., P. and D.: stripnavilepanabhojana A. divisayam asamprptir

hi-) buddhyaiva hi paratantryam kalpitam tathaiva svatantryam prakalpyam tato 'bhisambandha isyata* iti bhvah / / (K.5b, D.23-1) *K. 'bhisambandhah syata D. 'bhisambandha syata, s.m. 'bhisambandha (i)syata (2)(asya) gunasya / / (K.5b i.n., not found in D.) (3) (anekadravyarasyanopayogah) anektmakni dravyni manimantrdlni sarlraraksnimittni rasyanam ca rasyanopdnam bhedena tasya prdhnyakhypanrtham / / (D.24-2, not found in K.) (4) (manojfia-) manojnasabdasya pratyekam sambandhah / / (K.6a, D.24-3)

PRATHAMAM AHNIKAM SKlcd

25

trakusalat 1 visamasthnnadhysanam 2 ca / dhidaivikasypi yathklam vividhanivasanstaranagarbhagrhaprsdajlntaracandanavyajanamanihrdisevvividhausadhamangalastutimantraprayognusthnam 3 iti / drste 4 hetau s jijiisprtheti cet
NAIKNTTYANTATO'BHVT / / (SKld) 5
6 1 7

etac ca naivam / kasmt / e k n t t y a n t a t o ' b h v t / eknto^ ) nma niyamena bhvah / atyantam bhtasyvinsah / ekntas ctyantam ca te eknttyante tayor abhva eknttyantato'bhvah tasmt / sasthisthne paficamT / sasthyaiva v tasih "sasthy vysraye"(cf.Pn.5.4.48) iti yogavibhgt / asamsakaranam^2) vrttapranrtham mnasasya ca^3) duhkhasya pratikre dosntaropasahgrahrtham 8 / tath hi strydinm 9 saty etasmin dosadvaye 'sakyam 10 arjanam 11 kartum asvbhvikatvt^ 4 )/ saty arjane raksanam asakyam sdhranatvt / sati ca raksane ksayah krtakatvt / sahgc cnupasamo bhtopaghtam antarena csambhava ity ete dosh /
X A. bhy$as sstrrthakusalat 2 A.: visamasthndhysanam D. 0 sthnsanam 3

10

Dkha. nitisstrbhysakusalat visamasthnnadhy0, s.m. visamasthndhy0 Dkha.

A. yathklavividhinisvaranagarbha0 A. and Dkha.: hrdyupasev0 (this is also possibly the original reading). 4 A. omits drste ... tyantato'bhvt(25.3-5). 5 A. tac 6 A. eknttyantato'bhvah 7 A. omits eknto nma ... eknttyantato'bhvah tasmt(25.6-8). 8 A. samgrahanrtham 9 D. strdinm, s.m. strydmm 10 K., P. and D.: na sakyam 11 A. arjanyam

(^(ekanto; atyantam(25.7)) ekanta iti karmadharayah pumlingah / niscayo 'nt<a>bhavah* / atyantam ity avyaylbhvena napumsakenvinsa ucyate / / (K.6a, D.25-1) * K. pumlingah / niscayah / antbhvo D. pumlingah antbhvo, s.m. pumlingah niscayah antbhvo (2) (asamsakaranam) asamsakaranam iti1 / tasipratyayntena2 saha samso nsti / tat kasmt 3 4 tasipratyayo 'tra krtah / ekntbhvd ity eva kasmn na krta ity sahkyedam vrttikam / / (K.6a, D.25-2) 1 The phrase asamsakaranam iti is not found in D. 2 D. tasya pratyayntena 3 D. tasya 4 pratyayntena D. na (3) (mnasasya ca) mnasasya ceti / abhvasabdo hy asamastah svatantro yvat prayuktas tvat tena cnyenpy abhisambandho 'sya vivaksita iti dhvanyate / tena yo mnasaduhkhapratlkrahetus tasya raksanasaktyabhvd* ansaktyabhvd ahimsbhvd itydayo 'pi hetavo labhyante saty apy eknttyantbhvalaksane dosadvaye / / (K.6a, D.25-3) * D. arjanaraksanasakty0
1 (4) (asvbhvikatvt) asvbhvikatvd <iti /> anyattatvd ity arthah / svbhvikatvd iti pthe bhvasabdo hetuvcl / tena2 svahetuprayuktam katham arjayitum sakyam / / (K.6a, D.25-4) 1 D. omits asvbhvikatvd. 2 D. reads svahetuprayuktatvenety arthah in the left margin, seemingly referring to tena.

26

YUKTIDIPIKA

aha: katham etad avagamyate yad drstasya hetor anaikantikatvam 1 anatyantikatvam ceti / ucyate: pratyaksata 2 evaitad upalabhyate yad yurvedasya 3 kriykramasybhiyuktam tmavantam bhesajabhisakparicrakasampannam 4 praty narthakyam / ha ca sarvesm vydhirpnm nidnam trividham smrtam / h r a s ^ ca vihras^2) ca karma prvakrtam tath / / tatrhravihrotthn rogn dravyam apohati / yas tu karmakrto vydhir 5 marant sa nivartate / /

10

punar apy ha sopadravah sarvarpc^3) balammsendriypahah / sristas caiva yo vydhis tarn bhisak parivarjayet / / ity evam anaikntikatvam / antyantikatvam tu nivrttnm api vydhinm punarutpattidarsant / mahat khalv api prayatnena nivartit 6 vydhayah punar utpadyante / tath coktam punar jvare samutpanne kriy prvajvarnug / iti / tasmd yathaivsyyurveddeh 7 pratikrahetutvam pratyaksasiddham evam eknttyantato'bhvo 8 'pi / tath mnasasya ca / yath ca sriraduhkhapratikrahetavo 9 'naikntiks tath strydayo 'pi 1 0 / kasmt / tatsannidhne 1 1 visayntarbhilsadarsant / yadi hi strydayo visayh sarvad duhkhapratikrasamarth 12 bhaveyuh kirn iti tesu sannihitesu visayino
1 A. anaikantikam 2 K, P. and D.: pratyaksa 3 K., P. and D.: yurvedavihitasya 4 Dkha. paricrasampannam 5 A. omits vydhir ... caiva yo. 6 Dkha. vivartit 7 Dkha. yath vsyyurveddeh 8 A. ekntyato'bhvo 9 A. pratzghta Dkha. pratighta 10

15

20

D. hetur, s.m. hetavo Dkha. yath ca sariraduhkhapratightahetavas tath mnasasya ca naikntikh strydayo }p } instead of tath mnasasya ca .... tath strydayo pi 11 A. ttsanni0 12 A. pratikrahetavo

(^(hras) bhojanam* / / (K.6a i.n., D.25-5) *D. hro bhojanam (2)(vihras) vyymah* // (K.6a i.n., D.25-5) *D. vihras ca vyymah (3) (sarvarpo) yasya krtsnny eva sstroktni rpni drsyante sa sarvarpah / aristasabdena viparltalaksanay maranascakalaksanny ucyante / / (K.6b, D.25-6)

__

PRATHAMAM AHNIKAM SKld

27

visayntarajighrks syt / evam anaikntikatvam / antyantikatvam api nivrttecchnm api 1 bhyah prrthansadbhvt 2 / yadi hi visayopabhogo3 'tyantam eva mnasam duhkham apahanyt kim^1^ prptam yena 4 bhyas^2^ tarn prati visayino 'bhilsah 5 syt / kimkranam / yasmn na hy avidyamne tamasi devadattasya pradipam praty apeks6 bhavati / drsyate ca nivrttecchnm api visayopabhogd7 visayinm bhyo 8 visaybhilsah / tena manymahe nyam hetur 9 duhkham apahanti / kirn tarhi / sutarm vrddhim karoti / ha ca 10 na jtu kam ah kmnm upabhogena smyati / havis krsnavartmeva bhya evbhivardhate / / (cf.ManuS.2.94, MBh.L693.6pr., 1.840.lpr., XII.app.78.98pr., XII.616.lpr, 426.1pr, app.l5.4001pr.) apara ha samvedyatvd gurutvc ca ninditatvc 11 ca sdhubhih / sarvatrsannidhnc ca na drsto hetur 12 isyate / / samvedyatvt / bhogasdhanavikalnm arthinm madhye visayinopayujyamns 13 taih samvedyante 14 / tesm^3) apradyopayujyamnam nairghrnyam viskuryt / visayin 15 pradlyamno vrthibhyah^4) parimitatvd avacchidye1 A. omits api. 2 A. prrthansambhavt 3 A. visayopayogau P. vistayopabhogo Dkha. visayopayogah 4 A.omits yena. 5 A. abhils 6 Dkha. pratiks 7 A. visayogd Dkha. visayopayogd 8 A. bhyo 'pi 9 K., P. and D.: nyam drsto hetur A. nyam tur Dkha. nyam 10 A. omits ca. 11 A. nirmitatvt 12 A. tur 13 D. bhujyams, s.m. yujyamns 14 Dkha. samvecyante 15

10

15

hetur

A. visayinah

kirn anyan nimittam utpannam yena punar abhilasa iti sangatih / / (K.6b, D.26-1) <2)(bhyas) bahutaram / / (K.6b, D.26-2) tesm ity anay sasthyedam hayady api sstrlyavidhiprayuktam tn praty vasyakarn na dnam / ata eva tesm na sampradnat / tathpitair drsyamnam ekkin bhujyamnam vastu krplos cintnusayam karoty eveti / / (K.6b, D.27-1) ^4^ (arthibhyah) arthibhya iti pancaml na tu caturthT / tena dlyamno 'sau visayas tasmd arthivargd yena trutyed ity arthah / / (K.7a, D.27-2)

28

YUKTIDIPIKA

tety 1 anupayo 'yam2 duhkhapaghate 3 buddhimatam / kirn ca gurutvt^ 1 )/ bhognm vividhanivasanastripnabhojanavilepandinm 4 smagrye 5 sukham utpadyate / nnyataravaikalye / smagryarn6 caism svbhvikatvd^2) anupapannam / ha ca 7 5 nbhijtim 8 na vijnnam 9 na ca sauryam 10 apeksate / laksmih samskrayogc^3) ca kvacid evvatisthate / / ity evam aneksrayatvd 11 gurur visayabhogah 12 / kirn ca ninditatvc 13 ca sdhubhih / ninditah khalv api sdhubhir visayopabhogah 14 / yasmd ha 10 yss(4)ca vights^5) ca 15 vipralambhabhayni^6) ca / yac cnyad asivam16 loke tat kmebhyah^7) pravartate / / punar apy ha
1 A. avacchidyatety 2 Dkha. omits 'yarn. 3 Dkha, duhkhpaghto 4 A. and Dkha.: vilepanlamkrdinm 5 A. smrthe 6 A. smarthyam 7 A. omits ca. 8 D. nbhijtyam 9 A. vijntim 10 A. moham 11 A. and Dkha.: anekrthsrayatvd 12 A. and Dkha.: guruvisayabhogah 13 K. and P.: ninditc 14 D. visayabhogah, s.m. visayopabhogah 15 16

A. ysc ca pratight for yss ca vights ca. ca vights ca K. yac csivam for yac cnyad asivam

D. ysc ca vightc ca, s.m. yss

(1)(gurutvat) bhuyastvenarjayitum asakyatvat // (K.7a, D.27-3) (2) (svbhvikatvd) svahetvasmarthyt // (K.7a i.n., D.27-4) (3) (samskrayogc) svahetusmarthyd ity arthah / / (K.7a i.n., not found in D.) (4) (yss) sarirakhedh // (K.7a i.n., D.28-1) (5) (vights) labdham labdham idam mayeti ciram samcitypi yadalbhe ye manastps te pratlghth // (K.7a, D.28-1) (6) (vipralambhabhayni) vidambanh trsh // (K.7a i.n., not found in D.) (7)(kmebhyah) visaybhilsebhyah // (K.7a, D.28-2)

PRATHAMAM AHNIKAM SKld ayam sa^1) ksetriyo^2) vydhir ayam tyantiko jvar ah / idam spadam Itlnm esa yonih sappmanm 1 / / agdham etat ptlam esa panko duruttarah / klesavydhibhaykirnam etac chvabhram 2 bhayvaham 3 / / vividhysasoknm etad yatanam mahat / dainyasramavisdnm^ ) etat ksetram apvrtam / / yo 'smd 4 visayasambhogd 5 vihagah panjard iva / gato vanesu ramate sa sukhni samasnute 6 / /
3

29

tasmt sdhubhir apkrtatvd asdhur visayopabhogah / kirn ca sarvatrsannidhnt / na hi supratinivistasypi 7 kminah sarvatra^4) visayasannidhnena^5) bhavitavyam / no khalv apy(6) ekasmin 8 dese Vasthnam sambhavati visaybhvaprasangt / tasmd avasyam viyogena bhavitavyam / viyoge ca sati dhruvo 'nistnubandha iti ko 'rtho visayaparigrahena / tatra yad uktam 9 (25.3f.) drstasya hetoh sadbhvd aprthak jijiisety etad ayuktam / ha: yady eknttyantato'bhvd drste hetv 10 aparitosas tena tarhy asty ayam anyo hetur ubhayadosavarjitah sa kasmn na parigrhyate / ko
1 P. 2 A. 3 A. 4 K. 5 A. 6 A. 7 A. 8 A. 9 A. 10

10

15

sappmant chubhram and Dkha.: bhaynakam (this is also possibly the original reading). and P.: yasmd and Dkha.: visaya samyogd sukhbhisamasnute P. $amusnute(?) supratinistasya caikasmin yuktarn Dkha. drstahetv

I1) (ayam sa) ayam sa ityadibhih sarvanamabhir ayam artho dhvanyate / sruyate taval loke 'sti* marannto vydhir tyantiko jvara itydi, sa ca nnyat kimcid vastu, api tu visayasariga eveti / / (K.7a, D.28-3) *D. omits 'sti. (2) (ksetriyo) ksetriyo marannta<h> paraksetre* cikitsyata iti krtv / / (K.7a,D.28-3 latter half) *K. and D. maranntaparaksetre (3)(dainya-) dainya<m> sokdi* / / (K.7a, not found in D.) *K. dainyasokdi W (sarvatra) atyantabhogbhiyukto 'pi yam yam desam yti tatra tatra / / (K.7a, D.28-4)
(5

> (visaya-) strydi / / (K.7b, D.28-4 end)

(6) (no khalv apy) nanv ekatraiva tisthatu / maivam / tatrpi samcitaksaye 'vasyam visaybhvah / tad hano khalv apTti / / (K.7b, D.28-5)

30

YUKTIDIPIKA

10

15

'sau 1 / ucyate sastroktah karmavidhih 2 / sa hy aikantikah / katham / evam hy ha "pasubandhena sarvml lokn jayati" (cf.SPBr.11.7.1.1, SBh. 1.2.4) / na tktam kadcij jayati kadcin neti / phalasya pratyaksanupalabdher 3 anaikntikatvaW 1 ) iti cet / syn mat am / pratyaksata evedam vihitasya karmanah phalam nopalabhyate / tath hi putrakma istim nirupya^2) duhitaram api na prpnoti 4 / arthak am as ca karma krtv msakam api na labhate / tasmn nyam aikntika 5 iti / etac ca naivam / kasmt^ 3 '/ sdhanavaikalyt tadanupapatteh / anekasdhanasdhyo hi karmavidhih / yatra phalam 6 nopalabhyate tatra sdhanavaikalyam anumtavyam / kasmt / na hy et ad ist am sati krane kryam na bhavatiti 7 / kirn cnyat^ 4 )/ samsrbhvaprasaiigt 8 / yadi khalv api karmanah phalavattvam nesyate tena tannimittasya samsrasybhvaprasangah 9 / anistam caitat / tasmt siddham asya aikntikatvam / tyantikatvam api siddham eva 10 / yasmd ha "apma somam amrt abhma"(RV.8.48.3a) iti / atra somapnd amrtatvaprptih 11 sryate 1 2 / tasmt tad evnusthtavyam / kirn anyena hetun parikalpiteneti jijnsprthaiveti / ucyate: DRSTAVAD NUSRAVIKAH / (SK2a) anusryata ity anusravah / anusrave bhava (cf.Pn.4.3.53) nusravikah / drstena tulyam vartate 13 drstavat (cf.Pn.5.1.115) / kirn asau / anabhipreta iti vkyasesal/ 5 ) /
X K,, P., and D.: ko 'sv iti cet Dkha. ko 'sv ity 2 A. karmavidhas 3 Dkha. pratyaksatnupalabdher 4 Dkha. labhate 5 A. ekntika 6 A. phalena 7 P. bhavati 8 Dkha. samsrabhvaprasatigt 9 Dkha. samsrasya bhva0, s.m. samsrabhva0 10 A. omits eva. 11 Dkha. amrtatvptih 12

20

A. apma somam amrt abhma aganma jyotir avidma vedn kin nnam asmn krnavada rtih kimu dhrttir amrta marttyast/e'(cf.AtharvasiraUpanisad 3) somapnm amrtatvvptih sryate 13 A. omits vartate.

t1) (anaikantikatvam) kadacid bhavati putra ity abhiprayenanaikantikatvam // (K.7b, D.29-1) (2)(nirupya) nirupyeti nirvaped iti vidhin nirpitam, tat sampdyetyarthah / / (K.7b, D.29-2) (3) (kasmt) nanu karmaiva nisphalam astu / kirn iti smagrlvaikalyam anumlyate / tad ha kasmd iti / / (K.7b, D.29-3) (4^(kim cnyat) nanu kranam eva m bhd ity ha / / (K.7b, D.29-4) (5) (vkyasesah) vkyasesa ity anennabhipretadrstatulyatvamtrat<>ym* nusravikasya na hetur ucyata iti darsayati / anusryamnam gurusisyaparampardhyayanakramennava-

PRATHAMAM AHNIKAM SK2ab

31

ha: kah punar ayam anusravah / ucyate: mantrabrhmanam yvad v purtanam anusryamnam prmnyenbhyupagamyate tatrabhavadbhir yath srutinibandhanh 1 smrtayo 'ngni ^1) tark v / yathha vedavedhgatarkesu vedasamjfi nirucyate / aha: kirn purvasmad eva hetor ayam anusraviko hetur anabhipreta iti / nety ucyate / kirn tarhi SA HY3 AVISUDDHIKSAYTISAYAYUKTAH4 / (SK2b) y sa ity nusravikasya hetoh pratinirdesah / hisabdo yasmdarthe / avisuddhis ca ksayas 5 ctisayas cvisuddhiksaytisays6 tair yukto ' y a m ? s a bhavaty avisuddhiksaytisayayuktah / etad uktam bhavati / yasmd ayam nusraviko hetur api ca 8 avisuddho^2) 'nityas tratamyavms cto drsta ivnabhipretah 9 / tatravisuddhiyuktas tvat himsvidhnt / yad 10 ha brhmane 11 "brhmanam labheta 12 " (Tai.Br.3.4.1) itydi / tath satsatni niyujyante pasnm madhyame 13 'hani / asvamedhasya vacand nni pasubhis tribhih / / iti / hirns cvisuddhih prninm istasariravypdant / ha: tadanupapattih sstracoditatvt / yadi sstracoditeyam na syn 14 muktasamsayam avisuddhitvam asyh pratipadymahe / sstracodit
X A. nibandhanah 2 A. omits iti. 3 A. hi 4 A. omits avisuddhiksaytisayayuktah ... hisabdo yasmdarthe. 5 A. visuddhiksayas 6 K., P. and D. omit avisuddhiksaytisays. 7 K., P. and D. omit 'yam sa bhavaty avisuddhiksaytisayayuktah. 8 K., P. and D. omit api ca. 9 A. iva nbhipretah Dkha. (iva) nbhipretah (this is also possibly 10 A. yasmd 11 A. and Dkha.: brhmano 12 A. lambheta 13 Dkha. prathame 14

10

15

20

the original reading).

K., P. and D.: sstre coditeyam hirns na syt Dkha. sstracodito 'yam na syt

A. sstrena codyate }yam hirns na syn

cchinnena pravartamanam, idamprathamataya <prathamaya> ravartamanam iti yavat / / (K.8a, D.30-1) *K. and D.: mtrataym vidanti caturvargespyam yena sa veda iti nirvacanam / / (K.8a, D.30-2) ^2^ (avisuddho) avisuddha iti / nusravikasya hetor yat phalam tat ksayi st i say am ca / atah sa hetur apy upacrt ksaytisayayuktah / / (K.8a, D.31-1)

32

YUKTIDIPIKA

10

15

tu / tasman neyam avisuddhih 1 / tatpramanyanabhyupagamad adosa 2 iti cet / syn matam / vedaprmnyam abhyupagacchatm asamsayam etad evam syt / hetuvdakusals tu 3 vayam / tasmd abhidhiyatm 4 yadi kascid asty ubhayapaksaprasiddho hetur yato na samsayapratyayah 5 syd^1) iti / e t a c cyuktam / kasmt / abhyupagamavirodht 6 / "drstam anumnam ptavacanam ca"(SK4ab') iti prmnyatrayam abhyupagatam bhavadbhih / idnim vedasyptavacanatve 7 saty aprmnyam bruvatah svamatavyghtas 8 tasmd ayuktam etat^ 2 )/ vedasyptavacanatvnupapatter 9 adosa iti cet / syn matam / ptavacanatvam prkprasdhysya 10 vedasya pascd ayam uplambho yuktam abhidhtum syt / tat tv asiddham / tasmd anuplambho 'yamW iti / etad apy a y u k t a m / kasmt / <apurusabuddhiprvakatvt(?)> / purusabuddhiprvakatve sati rgdiyogc chabdo vicrrhah syt kirn ptavacanam na veti / apurusabuddhiprvakas tv mnyah svatantrah purusanihsreyasrtham pravartate / tasmn naivamvidham anistam vicram arhati / kirn cnyat / a v i s u d d h i t v n u p a p a t t i p r a s a n g t / yadi caitasminn arthe bhavn^4) api paryanuyujyeta 11 katham idam nisciyate yad uta prninm istasariravypdand avisuddhir himseti / avasyam abhidhniyam sstrata^5) iti / tad eva ca sstram kratau himsm^6) ha / tasmt ko 'tra hetur
X A. asuddhih 2 A. avisuddhir 3 A. omits tu. 4 K., P. and D.: adhzyatm 5 A. nissamsayah pratyayah (this is also possibly the original 6 A. abhyupagavirodht 7 A. ptavacane 8 A. svapaksavyghtah 9 A. ptavacannupapatter Dkha. vacanatvd upapatter 10 A. prasadhyasya 11

reading).

A. paryanuyujyate

t1) (-pratyayah syad) pratyayah syad ity etadantam himsaya avisuddhivadino matam / / (K.8a, D.31-2) (2) (tasmd ayuktam etat) tasmd ayuktam etad ity etatparyantam* himsyh suddhivdino matam // (K.8b, D.31-3) *D. etadantam (3)('yam) avisuddhitvavdi<no>* matam / / (K.8b, D.32-1) *K. and D.: vdinm (4)(bhavn) himsy aviuddhivdl// (K.8b, D.32-2) (5) (abhidhniyam sstrata) bhavatbhidhnlyam sstrata ity anvayah / / (K.8b, D.32-3) (6) (tad eva ca sstram kratau himsm) yena sstrena bhavatvisuddhir himsety abhidhmyam tad eva sstra<m>* kratuhimsm vaktlti tasyh suddhitvameva / / (K.8b, D.32-5) *K. tad eva sstrakratuhimsm D. tad eva kratau himsm

PRATHAMAM AHNIKAM SK2b

33

anyatra pramnam ihaivaitad^1) apramnam bhavitum 1 arhati himsto dharma 2 <ititi>3/ anugrahopaghtalaksanatvd ahimshimsayoh pratyaksasiddhir iti( 2 ) cet / athpi syt 4 / ahimstas cnugraho 5 bhavatistasariravypdanalaksano 6 himstas copaghto bhavaty abhipretasariravypdanalaksanah 7 / kriynurpam ca phalam anumtum yuktam iti pratyaksasiddham anayor 8 istnistaphalahetutvam / tasmt ko 'tra sstravypra iti / etac^3) cnupapannam / kasmt / a n i s t a p r a s a n g t / evam hi parikalpyamne gurubhrygamane 9 'pi sattvntarnugrahasmarthyd istaphalasambandhah syt / mnavakam copaniya vratdesasaucabrahmacaryasvdhyybhysabhaiksgniparicaranagurususrsdisu 10 pravartayato 'nistaphalasambandhah syt / tasml lokasstraviruddho 'sattarko nesta^4^ iti / ubhaybhidhnc chstravirodhaprasanga^ 5 ) iti cet / syn matam / tad 1 1 eva sstram ahirnsm ha tad eva himsm / evam sati parasparaviruddhayor 12 arthayos coditatvd ubhaynugrahsambhave sstravirodhaprasanga iti / tac^6) ca naivam / kasmt / utsargpavdayor 1 3 visayabhedt / smnye hi sstram 14 ahimsm utsrjya 15 visese kratulaksane 16 'pavdam ssti / smnyavihitam ca visesavihitena bdhyate / tadyath "dadhi brhmanebhyo diyatm takram kaundinyya"(cf.MBhsya.1.115.2-3 et passim) iti / tasmd utsargpavdayor visayaX A. apramnam idam atha pramnam bhavitum 2 K., P. and D.: himso 'dharma 3 All the Mss read iti. 4 A. syt (?) (not clear) 5 A. ahimstah prninm anugraho 6 A. reads sarirnabhidrohalaks anah, omitting ista. 7 D. vypdalaksanah 8 Dkha. etayor 9 K., P. and D.: gurubhrynugamane 10 0

10

15

A. bhaiksgnicarana (this is also possibly the original reading). susrsdi 11 A. yadi tad 12 A. and Dkha.: virodhinor (this is also possibly the original reading). 13 A. tatsargpavdayo 14 K., P. and D.: sstre 15 A. utsr 16 D. krta0, s.m. kratu0

K., P. and D.: guru-

kratuhimsayam / / (K.8b, D.32-6) (2) (iti) avisuddhitvavdinah// (K.8b, D.32-4) (3)(etac) suddhitvavdino matam / / (K.9a, D.32-7) ^4^ ('sattarko nesta) avisuddhitvavdino 'sattarko nesta ity etatparyantam sstrly hims suddhir eveti prativditam // (K.9a, D.33-1) (5) (ubhaybhidhnc chstravirodhaprasanga) himsy avisuddhitvavdinah prasnah / / (K.9a, D.33-2) kratuhimsyh suddhitvavdina uttaram / / (K.9a, D.33-3)

34

YUKTIDIPIKA

10

15

bhedan nasti sastravirodhah 1 / kirn cnyat / knygamanavat 2 punarvidhne dosbhvt / yath khalv api 3 sstre pratisiddham^1) knygamanam 4 iti / nednim abhirpah pratigrhya tm abhigamydharmabhg bhavati / "grhasthah sadrsim bhrym vindetnanyaprvikm" (GDhS. 1.4.1) iti sstrntarasadbhvt / evam sastre pratisiddh hims / nednim kratau himsym pravartamno 'nistaphalah 5 syt / prvoktd eva sstrntarasadbhvt / tatra yad uktam (31.18) prninm istasariravypdand avisuddhir himsety etad ayuktam / ucyate: na abhiprynavabodht / citram api bahv etad abhidhiyamno nbhipryam 6 sprsatlty upeksyate 7 / kirn kranam / [yasmn] 8 na vayam vedasyaprmnyam 9 pratycaksmahe 10 / no khalv api brmah sstracoditym 11 himsym pravartamnasynistaphalasambandho 12 bhavati / kirn tarhi / sati svargaprptinimittatve 13 vedavihitasya karmanah samanusthnam prni<n>m14 upaghtam antarena na sambhavatiti 15 hitakmair apy upeksyate / yasmn na hy etad uktam yad anyesm upaghtentmnugrahah 16 krya iti / ha na tat parasya sandadhyt pratiklam yad tmanah / esa samksepato dharmah kmd anyah pravartate / / (cf.MBh.V.39.57, XIII.114.8)

20

ha: yady etan nbhyupagamyate katham prvam uktam prninm 17 istasariravypdand avisuddhir himseti 18 / ucyate: krye kranopacrt / yo 'sau himsnimittakah 19 krunyn manasi nah paritpa utpadyate s khalv avisuddhir abhipret / tasym 20 kraX K., P. and D.: sstre virodha iti 2 K., P. and D.: kanygamant 3 A. omits khalv api. 4 K., P. and D.: kanygamant 5 A. 'nistaphalabhk 6 Dkha. abhidhiyamnam no nbhipryam 7 A. nbhipryam veda bhavn 8 A. omits kirn kranam yasmt. 9 K., P. and D. omit prmnyam. 10 K. prtyksmahe 11 A. sstre coditym 12 A. sambandh 13 A. svaprptinimittatve 14 All the Mss read prnijam. 15 A. sambhavetiti 16 A. upaghto 'nttmnugrahah 17 A. na prninm 18 A. omits himseti ... s khalv avisuddhir. (34.21-23) 19 K. and P.: himsnimittikah 20

A. kirn tu tasym

(^(pratisiddham) sastroktavidhina* samskararahitakanyagamanam pratisiddham / / (K.9a, D.33-4) *D. omits sastroktavidhina.

PRATHAMAM AHNIKAM SK2b

35

nam upacaryoktam avisuddhir himseti / yath mudgais trpt gobhih sukhina iti / ha: katham etad avagamyate himskaryam paritapamtram avisuddhir cryasybhipret 1 na punar himsaiveti / ucyate: prakarsapratyayopalabdheh / vaksyaty uparistt "tadviparitah sreyn" (SK2c) iti / samnajtiyam ca pratiyoginam 2 apeksya prakarsapratyaya utpadyate 3 / yadi cnusravikasya prasasyat 4 nbhipret syt prakarsapratyaynupapattiprasangah / tasmn notstram etat / ha: sannysnupapattih^ 1 ) aviyogasravant 5 / na hi karmanas tygasannysayos ( 2 ) 6 tvam Tsise / kirn tarhi / sstram yad ha tad avasyam kartavyam 7 / tac c marant karmabhir aviyogam8 ssti / kasmt / evam hy ha u jarmaryam^ etat sattram 9 yad agnihotradrsapaurnamsau 10 jaray ha etasmt 11 sattrd vimucyate 12 mrtyun ca"(cf.SPBr.l2.4.1.1) / punar apy ha kurvann eveha karmni jijivisec^4) chatam samh / (Is.U.2) tasmd marant karmanm atygah / tasmin sati hetvantarakarmanm^ ) narthakyam 14 /
l 5 13

10

15

A. cryasybhissukhina(sic) iti / ha / katham etad avagamyate himskaryam paritapamtram avisuddhir cryasybhipret (A. repeats sukhina iti ... avisuddhir.) 2 K., P. and D.: cpratiyoginam 3 P. utpadyeta 4 A. prasasyat 5 A. aviyogn D. abhiyogasravant 6 K., P. and D.: karmano Hygasannysayos A. karmanos tygasayos Dkha. karmanas tygasannyse yas 7 K., P. and D..: avasyakartavyam 8 D. abhiyogam 9 A. jarparyanta etat stum(?) 10 Dkha. yad agnihotram darsa0 n D. ekasmt 12 A. ha v etasmt strd vipramucyate 13 K., P. and D.: hetvantarnm 14 K., P. and D.: nantaryam A. narthakyam

(^(sannyasnupapattih) nanv evam samnyaso yo bhavato hrdi parisphurati vaidikanam karmanm tityaksanlyatvt* sa eva parlksyatm ity sayenhasamnysnupapattir iti / / (K.9b, D.35-1) *D. titiksiniyatvt W (tygasannysayos) tygah karmanm akaranam samnysah phalnabhisandhnam iti visesah // (K.9b, D.35-2) ( ' (jarmaryam).jarmare sdhur jarmaryas tadantam ity arthah // (K.9b, D.35-3) (cf.Pn.4.4. 98)
(4)

(Jivisec) jlvitum icchet / / (K.lOa, D.35-4)

^ ' (hetvantarakarmanm) karmanm phalam dravind icchanto na nisedur natsnlm smcakre kecid rsayah prajvanta iti / / (D.35-5, not found in K.)

36

YUKTIDIPIKA

10

15

20

ucyate: na sadhananam 1 asvabhavikatvat / patmsamyogadibhir anekaih sdhanair ayam karmavidhih prasdhyate / tesm csvbhvikatvd asakyam arjanam prayogatah 2 prvam kartum iti pratipditam (25.12) / tasmd anityni karmni / hetusstravipratipattau sstraballyastvd 3 iti cet / syn matam^1) / yatra hetusstrayor vipratipattir bhavati tatra vipralambhabhyisthatvd 4 anumnasya ballyah sstram ity avasyam abhyupagantavyam iti / tac cnupannam / kasmt / saktito viniyogt 5 / saktim apeksya sstram agnihotrdini karmni vidadhat tesm anityatm jnpayati / katham / evam hy ha "yo 'lam sann 6 agnihotrygnihotram na 7 juhoti tarn 8 es devatparuddhparunaddhy^ 2 ) asmc ca lokd 9 amusmc cobhbhym" (Ai.Br.5.30=25.5.12) / tasmd anityni karmni / kirn cnyat / jargrahanasmarthyt 1 0 / tvadlya 11 eva jiipake 12 jargrahanam asti / ato 'numiyate saktyapeksam anityam ca karma / kirn cnyat / s s t r a h n e h / ubhayam hi sstre drstam / karmni 13 sannysas ca / yadi punah karmni kartavyatayesyante 14 tena sannysasstram hiyate / tasmd visayargviskaranam etad vah / ha: na srutiballyastvt / tulyabalayor hi 15 sstrayor ekavisayasannipte dvayor yugapadanugrahsmbhave vikalpaparyyau^3) bhavatah / srutismrtisannipte ca srutir baliyasl smrtivihitas ca sannysah / tasmn nnayor vikalpah / no khalv api paryyo nyyyah 16 / ucyate: tad itaratra tulyam / yathaiva karmanm samanusthnam ssti sstram tath sannysam api / katham / evam hy 17 ha
1 Dkha. sdhranam 2 K M P. and D.: niyogatah 3 A. sstrabaliyastvam 4 Dkha. vilambha0 5 K., P. and D.: yasmc chaktito viniyogah 6 A. omits sann. 7 A. ngnihotram 8 A. tad 9 K., P. and D.: asml lokd. 10 A. smarthy n K., P. and D.: tadiyam 12 K., P. and D. omit jnpake. 13 A. nirdistakarmni instead of drstam / karmni 14

K., P. and D.: nityakartavyatayesyante A. tayesyate tavyatesyante 15 A. eva 16 K., P. andD.: nyyah 17 A. omits hy.

D. kartavyayesyante, s.m. kar-

(1)(matam) id am tu matam abhipretam ity arthah / / (K.lOa, D.36-1) (2) (aparuddh) utpannakrodh // (K.lOa, D.36-2) (aparunaddhy) cyvayati // (K.lOa i.n., D.36-2) (3) (vikalpaparyyau) vrlhibhir v yajeta yavair veti vikalpah / paryyas tuyatra vidhidvayam apy anustheyam klabhedena / tadyath drsapaurnamsbhym yajeteti drsaygavidhih paurnamsavidhis ca klabhedennustheyau / / (K.lOa, D.36-3)

PRATHAMAM AHNIKAM SK2b na karman na prajay dhanena tygenaikenmrtatvam^1) nasuh / parena nkam' 2 ) nihitam guhym vibhrjate yad yatayo 1 visanti / /

37

(cf.Kai.U.3) tath karman 2 mrtyum rsayo nisedhuh 3 prajvanto dravinam^3) icchamnh 4 / athpara 5 rsayo mamsinah pararn karmabhyo 'mrtatvam nasuh^ 4 )// brhmanam 6 ctra bhavati / "tad ya ittham 7 viduh / ye ceme 'rany<e>8 sraddhtapa 9 ity upsate / te 'rcisam(5) abhisambhavanti / arciso 'hah / ahna 10 pryamnapaksam 11 / pryamnapaksd 12 yn sad udann eti 13 msms tn / msebhyah samvatsaram / samvatsard dityam / dityc candramasam /
2 A. na karman 3 K., P. and D.: niseduh 4 Dkha. dram Thamn D. dram, s.m. dravinam 5 D. atha vpare Dkha. atha v pare 6 A. brahmnam 7 K., P and D.: idam 8 All the Mss read 'ranyh. We follow Chakravarti. 9 Dkha. sraddh tap 10 A. ity upsete 'rcir abhisamvarty arcisah ahah arkah J vaty atho har ahna J1 A. pryamnapaksas 12 A. tasmd 13

10

a. vibhrjad etad yotayo

Dkha. (ity) upsate na cbhisambha-

A. yn tdanneh(l) ti

(1)(ekena) ekenanyasahakary<a>napeksenety* arthah / / (K.lOb, D.37-1) *K. and D. sahakryanapeksenety (2) (parena nkam) parena nkam / nkd api param svargd apy utkrstamsarvn praty aprakatatvd bhvanaikagamyam bhrjate cidtmatay // (K.lOb, D.37-2) (3)(dravinam) karmanm phalam / / (K.lOb i.n., D.37-3) (4) (nasuh) prpuh / / (K.lOb, not found in D.) (5) (te 'rcisam) te Vcir itydin phalam sannysasyhaarcir iti / dityatejorpam abhisambhavantTty visantlti yvat / arciso 'nantaram jyotissamcaytmakadinarpatm, tato dinasamcaytmakataypryamnam paksam, tato 'pi paksair pryamnam1 udann <ety>2 uttaryanarpamsasatkam, tato 'pi msasamhatay vitataklasvarpasamvatsararpatm, <...> tato 'pi praksnandaghanam candram, tato 'pi svapraksaikamtram parapraksnvilam vidyudrpamabhisam<bhava>nty3 visanti, tac ca vidyudrpam prkrtapraksnvi4 lam purusah prakatvn mnavah samvidrpatvt / sa ca purusas tn viduso 'rcir dhikyam pannd brahma gamayati kevalarpatm nayatlty arthah / / (K.lOb, D.37-4) K. pryanarn 2 K. paksam pryamnti instead of udann <ety> D. udann iti 3 K. and D.: abhisamvisanti 4 D. prkrtam praksnvilam

38

YUKTIDIPIKA

10

15

candramaso 1 vidyutam / tat puruso 'manavah / sa etan^ 1 ) 2 brahma gamayati"(Chnd.U.5.10.1-2) / punar apy ha "etam eva viditv munir bhavati, etam eva pravrjino lokam 3 icchantah pravrajanti / et ad vah sarve 4 prve vidvrnsah prajm nkmayanta 5 prajay kirn6 karisymo yesm nyam^2) tm nyam loka^3) iti te ha(4) sma putraisanys ca vittaisanys ca lokaisanys 7 ctha 8 bhikscaryam caranti"(cf.Brh.U.4.4.25) iti / tasmd ete tygasannysayor ubhayor9 lihgam / ha: yady apy evam sstram 10 tathpi samanusthne vidhir asti / vihitam cvasyam kartavyam / sannyse tv arthavdamtram ity anayor ayam visesah / tasmin sati samanusthnam jyyo na tygah / ucyate: ko 'y a r n vidhih 11 ko ' y a m arthavdah / ha: vidhis tad<a>rthenprvopadesah( 5 ) 12 / yo hi vidhyarthena lin lot krtyair vprvopadesah 13 kriyate sa vidhih^ 6 )/ yath 14 "agnihotram juhuyt svargakmah" / "vyavyam svetam [ajam] labheta bhtikmah"(cf.Tai.S. 2.1.1.1) iti 1 5 / stutir arthavdah / tasya tu vihitasya prarocanrtham 16 y stutih 1 7 so 'rthavdah / tadyath "vyur 18 vai ksepisth^7^ devat vyum
2 Dkha. etam 3 A. lokam pravrjina 4 A. etad dha sma vai 5 P. prajnm kmayantu Dkha. prajnrn 6 A. kirn prajay 7 K., P. and D.: putresanys ca vittesanys 8 A. ca vyutthytha 9 A. ubhayo 10 A. and Dkha.: sstravacanam 11 A. vidhir nma 12 13 A. krtyaivprvopadesah 14 A. tadyath 15 Dkha. itydi 16 K., P. and D.: prayojanrtham 17 A. and Dkha. stutih kriyate 18

*A. candramas

kmayante ca lokesanys

K., P. and D.: tadarthatvenprvopadesah follow Chakravarti.

A. and Dkha.: tadrthenprvopadesah We

A. v

upsakn / / (K.lOb i.n., D.38-1) (2) (ayam) ^uddhah purusarpah / / (K.lOb, D.38-2) (3) (nyam loka) nyam loka iti / brahmapraksa ity arthah / / (K.lOb, D.38-2) (4) (ha) ha itihsadyotakah / / (K.lOb, D.38-2) (5)(aprva-) dharmopadeso yadi vprvasya pramnntarnadhigatasyety arthah / / (K.lOb, D.38-3) (6) (vidhih) vidhikryatvd upadeso 'pi vidhir iti yvat / / (K.lOb, D.38-4) (7) (ksepisth) ksipratarticaturety arthah* / / (K.lla, D.39-1)

PRATHAMAM AHNIKAM SK2b

39

eva svena1 bhgadheyenopadhvati sa evainam2 bhtim 3 gamayati"(cf.Tai.S.2. 1.1.1) iti 4 / evamvidhm stutim 5 upasrutya phalrthine 6 hi 7 yajamnya vidhih prarocate / etasmin hitakmah pravartata iti / ucyate: na ata eva sannysasiddhih / evam cen manyase yam mnyah sreymsam artham manyate tarn prarocanya stauti <iti> tath sannysasiddhih / kasmt / stutatvt / bahulrthinm 8 sannysam mnyah stauti / s kasmn na prarocate / itarath hy narthakyam / yadi khalv apy arthavdah stuvann 9 api prarocayed yad uktam(38.15) prarocanrtho 'rthavda iti tad bhavadbhir 10 hpitavyam syt / anarthako hy evam saty arthavdah, na prarocanrthah / arthntaravacanam v / yadi 11 prarocanrthatvam asya nesyate tena tarhy 12 arthntaram vaktavyam m bhd anarthakatvam vedaikadesasyeti 13 / tasmn nnay vibhisikay vayam sakyh sanmrgd 14 apanetum / kirn cnyat / ubhayath vikalpe 'nistaprasangt 15 / ihyam mnyo vidheyatvena16 v sannysam styd avidheyatvena v / kirn ctah / tad yadi tvad 17 vidheyatvena stauti kirn anyad vicryate / siddhah sannysah / athvidheyatvena stutv asya prayojanam 18 kartavyam 19 / yad dhi kartavyatay nestam 20 tad apurusabuddhiprvakah^1) svatantrah purusanihsreyasrtham pravartamna 21 mnyah kirn iti prarocayet / tasmd etm api kalpanW 2 ) krtv krsam evaitat / athavobhayath vikalpa ity asyyam anyo 'rthah /
1 K., P., A. and D.: tena 2 A. enam 3 A. bhvim Dkha. omits bhtim. 4 A. omits iti. 5 K., P. and D.: evamvidhm hi stutim A. evamvidh srutim 6 A. phalrthini 7 A. omits hi. 8 K., P., and D.: bahubalrthinm Dkha. bahuphalrthinm 9 A. omits stuvann ... prarocanrtho 'rthavda. 10 A. bhavadbhir eva n A. yadi v 12 13 A. vaidekadesasyeti 14 A. sarnmrgd 15 D. vikalpe anistaprasangah 16 A. vidhayatvena 17 A. omits tvad. 18 A. stutvasyaprayojanam 19 21

10

15

20

A. tenerhy(l)

Dkha. ubhayvikalpe 'nistaprasatigah

A. vartavyam D. nistham, s.m. nestam A. pravartamnaSya

*D. ksipratam artha, s.m. ksipratarcaturety arthah D. reads ksepistha before ksipra0. (^(apurusabuddhiprvakah) anenvipralambhatvam ha / / (K.lla, not found in D.) (2)(kalpanm) arthavdakalpanm / / (K.lla i.n., D.40-1)

40

YUKTIDIPIKA

10

15

20

ihayam amnayo 1 bhutarthena^ 1 ) va sannyasam prarocayed abhutarthena va / kirn ctah / tad 2 yadi tvad bhtrthena prarocayati tath saty 3 amrtatvaprpakasya sannysasyparigrahe visayargd anyo hetur vaktavyah / athbhtrthena 4 puruso nihsreyasd dhiyate 5 / kasmt / na hy et ad yuktam yad asreyasi mrge pramnabhta mnyo mtrmodakanyyena 6 hitrthinah prninah pratrayet 7 / tasmd ayuktam etat / kirn cnyat / anekntt / na cyam eknto yad vihitam eva kartavyam / tath ca sbarh pathanti "grmagamanam bhavatah sobhanam ity atrntarena vidhim stutir eva devadattam grmagamanya prarocayati" iti / kirn cnyat / sankprasangt / yadi khalv api kimcit satyam kimcid anrtam 8 bryd vedas tath sati pauruseyavkyavad vedavkyesv apy sank prasajyeta 9 / tath ca sati yad uktam 10 "<m tri(?)> u srutau bhaktih sahasaiva mahtmanm" iti tad vyhatam iti / kirn cnyat / <avaisadya>prasangt 12 / yadi khalv api kimcit satyam kimcid anrtam bryd vedas tath sati <avaisadya>prasarigo13 'nistam caitat / kirn ca vidhyanumnam 1 4 v <t>adekadesabhtatvt 15 / athav vidhyekadeso16 'rthavda ity atisrstam^2^17 bhavat / tatra sannyse 18 'rthavdam upalabhya vidhir apy astity anumtavyam / anupalambhd 1 9 adosa^3^ iti cet / syc caivam yady^4^ asau vidhir upalabhyate / tasmd anupalambhd ayam dosn nivartisyata 20 iti / etac c n u p a p a n n a m / kasmt / anekabhe1 A. mnye 2 A. kirn ctad 3 A. bhtrthe yath saty 4 K., P. and D.: abhtrthena 5 A. purusanihsreyasrtho hiyate 6 A. modakanyyena P. mtrmodakanyyane 7 A. pratorayet 8 Dkha. pritam 9 A. prasajyate 10 K., P. and D. omit <m tri> .... vedas tath sati 11 A. m tari 12

(40.12-15).

A. atha vaisasaprasangt K. ardhavarnsaprasangah P. ava..prasangah A. avaisasyaprasange D. prasarigah, s.m. ardhavamsaprasangah 14 A. buddhyanumnam 15 K., P. and D.: tad evam ekadesabhtatvt A. dadekadesa0 16 A. vidhyaikadesau 17 A. abhisrsta 18 K., P. and D.: nyse 19 A. uplambhd 20 A. nivartata (^(bhutarthena) bhutam ksamadav rte 'tita iti kosah // (K.lla, D.40-2) (cf.Amarakosa.3.3.78) (2) (atisrstam) smnyenoktam ity arthah // (K.llb i.n., D.41-1) (3) (anupalambhd adosa) anupalambhd adosa iti / asyrtho nivartisyata ity etatparyantam// (K.llb, D.41-2) (4) (yady) jy^di vidhih syd upalabhyeta / / (K.llb, D.41-3)

^ _

PRATHAMAM AHNIKAM SK2b

41

datvt^V upalambhau 1 yatnah kriyatm (cf.MBhsya.I.9.19ff.) / anekabhedo hi prativedam mnyah / tatra yad uktam(38.8f.) vidhisadbhvt kriyprdhnyam^2^ ity etad apy ayuktam / itikartavyatnupadest 2 sannysnupapattir iti cet / athpi syt / yadi sannysam apy mnyo vidheyarn manyeta 3 tena yath grhasthyasyetikartavyatm bhryodvahandikm mantravad(3) upadisati tath sannyasam apy upadiset / na tpadistavn / tasrrin nsti sannysa iti / etad apy ayuktam / kasrnt / abhvt 4 / itikartavyatnm hi sarvsm abhvah sannysah / tatra kirn sstram upadeksyati 5 / yvati khalv 6 itikartavyat sannysngam tm upadisati 7 / katham / evam hy ha tapahsraddhe ye hy upavasanty aranye snt vidvrpso bhaiksacarym 8 carantah / sryadvrena te <virajh>9 praynti yatrmrtah sa puruso <hy> avyaytm 10 / / (Mund.U. 1.2.11) tatra tapahsraddhe ye hy upavasantlty anena sraddhayopetam 1 x yamaniyamalaksanam 12 dharmam ha / aranya iti grhebhyo vinissrtim / snt itindriynm antahkaranasya ca visaybhilsd vinivartanam / vidvmsa iti prvartrparartrdisu klesv anirvinnasya 13 yogino jnnbhysam / bhaiksacarym 14 caranta iti sarlrasthitinimittamparimitam 15 abhyavahraniyogam 16 /
A A. upalabdho 2 A. ity etn upadest 3 K., P. and D.: manyate 4 A. abhvatah 5 D. upadiksyati 6 A. ca khalv 7 A. and Dkha.: upadisati sstram 8 A. bhikscaryarn 9 K. rajasah A. virajah P. aranah D. 'rajasah, s.m. virajasah 10 A. vyay 11 K., P. and D. read atropetam instead of anena sraddhayopetam. 12 A. yamaniyamavcakam laksanam 13 P. klesu nirvinnasya A. klasv evisanagasya 14 A. bhikscarym 15 A. and Dkha. omit parimitam. 16

10

15

A. adhyhraniyogam

^'(anekabhedatvt) anekabheda iti / "navadhatharvano1 <v>edah2 sahasravartma samaveda ekasatam adhvaryuskhs3 caturvisamtidh b<>hvrcyam4" iti hi sryate (cf.MBhsya. I.9.21ff.)//(K.llb, D.41-4) 1 D. navadhtharvo, s.m. navadhatharvano2 K. and D.: bhedah 3 D. adhvaryaskh 4 K. and D.: bahvrcyam W(kriyprdhnyam) karmana eva prdhnyam / na tu <sannysa>sya* / / (K.llb, D.41-5) *K. and D.: smnyasya * '(mantravad) mantravad iti / mantrayuktam krtveti kriyvisesanam, samantrakam upadisati / / (K.llb, D.41-6)

42

YUKTIDIPIKA

10

15

uttarardhena ca 1 phalam acaste / tannibandhanas^ 1 ) ca vistarah sannyasetikartavyatym 2 manvdibhir abhihitah / srutinirvacans^ 2 ) 3 ca smrtayo bhavatm pramnam iti paksah / tatra yad uktam (41.-3) itikartavyatnupadesn nsti sannysa ity etad 4 ayuktam / evam ca na nityni 5 karmni / yat tv anenaitad uktam (30.1) nusraviko hetur <ai>kntika6 iti satyam etat / avasyam hi karmanah phalam abhyupagantavyam / itarath hi tannimittasya samsrasybhvd anist aprasangah / tasmd anistam 7 evaitad cryasya / ha: katham etad anumatavyam^3) iti / ucyate: ksayagrahanasmarthyt / yadi prvastroktam^ 4 ) ihnuvartte ksayagrahanam anarthakam syt( 5 )/ kasmt / atyantbhvaparyyo hi ksaya iti krtv / evam siddho 8 'visuddhiyogah / ha: ksayayoga idnim katham 9 anumtavya iti / ucyate: ksayayogo 'ngaparimnt 10 / ksayayogah punar asya 11 hetor 12 angaparimnd 13 veditavyah / yni hi yajer angni pasupurodsdini 14 tni parimitni / parimitnm 15 sdhannm tantvdinm parimitam kryam
1 A. pha ca 2 A. omits sannysetikartavyat ... itikartavyatnupadesn nsti. 3 K., A. and D.: srutinirvacanc 4 A. ed 5 A. evam anityni Dkha. evam cnityni (this is also possibly the original 6 K., P., D. and A.: anaikntika Dkha. ekntika 7 A. ist am 8 A. siddhau 9 A. katham idnim 10 A. angaparinmt 11 A. asye 12 K., P. and D.: hetoh punar 13 A. angam parimnd 14 A. pasupurodasaprabhrtini 15

reading).

A. and Dkha.: parimitnm hi

(^(tannibandhanas) abhihitasrutimulah / / (K.12a i.n., D.42-1) (2) (srutinirvacanas) srutyartham nirbhajya vistarena vacanam ybhis th pramnam / / (K.12a, D.42-2) (3^ (katham etad anumtavyam) tasmd anistam evaitad* cryasyaikntikatvam** abhlstam iti katham jnyata ity arthah // (K.12a, D.42-3) *D. etad **D. knvikatvam (4) (yadi prvastroktam) yadi ca prvoktahetum apy crya icchet ksayagrahanam na kuryd <arth>bhvd* ity atidesenaiva gatrthatvd iti bhvah / / (K.12a, D.42-4) *K. and D.: antbhvd (5) (ksayagrahanam anarthakam syt) nusravikasytraikntikatvam evbhlstam na tv anaikntikatvam / yady atra tad abhlstam syt tarhi prvoktastrasytyantbhvasynuvartanena ksayrthopalambht ksayagrahanam anarthakam syt / / (K.12a, D.42-5)

PRATHAMAM AHNIKAM SK2b

43

patdi drstam / parimitam 1 ksayadharmi drstam 2 / tadvad^1) eva3 <etad> / kim cnyat / s a m s r o p a l a m b h t / drsyate cyam vgbuddhisvabhvhravihrabhedabhinna<h> karma<vipka>vaicitryanimittah4 samsrah / yadi punah skstkrtam karmksayaphalam syt sa^2)5 punarvrttyabhvt prninm nopalabhyeta 6 / sabdasmarthyn nityatvam iti cet / syd etat / "sabdapramnak vayam / yac chabda ha tad asmkam pramnam" (cf.MBhsya.I.ll.lff., 1.366.12ff.) / sa csya hetor amrtatvam ha "tarati^3) mrtyum tarati ppmnam"(cf.Mund.U.3.2.9) itydi / tasmd anicchatpy etad avasyam abhyupagantavyam / anabhyupagame 7 v pratijnhnir vedah pramnam iti / e t a c 8 ca naivam / kasmt / sabdnt arena 9 virodht / anityatvam asya hetoh sabdo 'numanyate / tasyaivam sati virodhah prpnoti / katham / evam hy ha "atha ye ime grme istprte^ 4 ) 10 dattam ity upsate 11 te dhmam abhisambhavanti / dhmo bhtvbhram bhavati / megho bhtv pravarsati / ta iha vrihiyav osadhivanaspatayas tilams 12 iti jyante / <ato>13 vai yo(5^ <hy>
1 A. and Dkha.: parimitam ca 2 A. stam 3 A. evam 4 All the Mss read vihrabhedabhinnakarmavihravaicitryanimittah. 5 A. omits $a, 6 A. yate 7 A. abhyupagame 8 A. tac (this is also possibly the original reading). 9 Dkha. sabdntare 10 D. istprtt 11

10

After upsate K., P. and D. insert Chnd.U.5.10.5, which reads as follows: athaitam evdhvnam punar nivartante yathetam (D. yath itam) ksam ksd vyum. 12 A. tilams 13 All the Mss read tato.

(^(tadvad) ghatavat / / (K.12b, D.43-1) (2)(sa) samsrah / / (K.12b i.n., not found in D.) (3) (tarati) mrtyutarand aksayatvam uktam // (K.12b, D.43-2) ^4) (istaprte) istam antarvedym yajfie dattam / prtam anyatra / tayor dvandve cchndaso dirghah / 1tena ye yajnyajfiayor dattam / dattam ity upsate te tatra 2phalbhisandhnabhvanm kurvanti, sarlrnte dahyamn dhmam abhyetya kramena meghavrstisasyaretahSarlraparivartanakramena samsraprabandham anubhavanti / atra5 cvivaksitavcyatay punah punah samsrvartane4 malinarpsuddhamrgvaghitvam laksyate / anye tu 6 yathsthitam etad vcyam vivaksitam ity huh / / (K.12b, D.43-3) D. bhvannm1 s.m. bhvananm 2D. dahyamnadhmaprabhrtikramena, s.m. dahyamnadhmam abhyetya kramena 3 D. cviviksit0 4D. ravartane 5 K. mrgvighitvam D. malinarp Suddhamrgvighitvam, s.m. malinarp suddhamrgvaghitvam 6 D. viviksitam (y) y 'sau tasyausadhyder annasya bhokt suklasya sekt ca tadbhvena taddhtvtmakatayste / tato bhyo retodvrena bhavati / bhyo 'pi caivam evestprtaphalbhisambandhd dhmdikramena bhavatlti samsrasya paunahpunyena prabandha ukto yo 'sv ev<>javanjavlbhva* iti vaksyate / / (K.12b, D.43-6) *K. eva javanjavtbhva D. eva javanjwabhva

44

YUKTIDIPIKA

10

15

annam' 1 ) atti 1 yo retah siiicati tad 2 bhuya eva3 bhavati"(cf.Chand.U.5.10.3,5,6) iti / tatra yad uktam(43.5) sabdasmarthyn nityatvam ity et ad ayuktam / ubhaybhidhnc 4 chstravirodhaprasariga iti c e t 5 / syn matam / tad eva sastram nityatvam ha tad evnityatvam / evam sati parasparavirodhinor arthayos coditatvd ubhaynugrahsambhave sati sstravirodhaprasahga iti / tac ca naivam / kasmt / asambhave saty arthntaraklpteh / yadi 6 hi pramnabht srutir asambhavinam artham codayati tatrrthntaram kalpayati / tadyath "sa tmano vapm^2) udakhidat 7 "(Tai.S.2.1.1.4) / "stenam mano 8 'nrtavdini vk(3)"(cf.!Bh.l.2.2) ity evamdisu / evam ihpi nsti sambhavo yad eko 'rtho nityas ca syd anityas ceti / tasmn nityatvavcakasya sstrntarasya^ 4 ) 9 bhaktyrthntaram^ 5 ) parikalpayisymah / tadvad itaratrplti cet / syn matam / yathaiva bhavat nitynityayor ekatrsambhavn 10 nityatvasya 11 bhakty kalpan krt tathaivnityatvasypi karisyata iti / etac cyuktam / kasmt / sarvapramanavirodhaprasangt / vinse^6) hi 12 bhakty kalpyamne sarvapramnavirodhah 13 prasajyeta / katham / pratyaksa1 A. yannim itta(?) instead of yo <hy> annam atti 2 K., P. and D.: sa 3 A. bhya eva bhya eva bhyariva instead of bhya 4 A. ubhayathbhidhnc 5 A. omits cet / syn ... sstravirodhaprasanga iti. 6 A. and Dkha.: yatra 7 A. udakhindat 8 A. manuh 9 A. sstrasya 10 A. sambhvn X1 A. nityatvam asya 12 P. vinso 13

eva

A. sarvapra

(x) (annam) osadhibhvntaram // (K.12b, D.43-5) (2)(vapm) "prjpatyam <t>param1 ajam labheta" (cf.Tai.S.2.1.1.5) ity asya vidheh sesah / 2 prajpatir tmano vapm udakhidad iti vaphomamhtmyapradarsanrtham ucyate / agnau3 pragrhTtamtrym vapym ajas tpara udagd(cf.Tai.S.2.1.1.4) iti pasuyoge vaphomaprasamsym4 vrttnta esah / / (K.12b, D.44-1) 2 *K. and D.: tv aparam D. prajpatir 3D. agno 4K. prasamsya (3) (stenam mano 'nrtavdinl vg) stenam mano 'nrtavdinl vg iti gauna esa vdah pracchannatay stenam prajpatir mana ucyate bhulybhipryena cnrtavdinl vg iti // (K.12b, D.44-2) (4) (sstrntarasya) prajpatir tmano vapm uccikheda / tasmd anyo 'py utkhided tmano vapm iti duradhisthno 'yam art hah / ko hi nmtmano vapm utkhidet kasya v / vaphome sati samanantaram eva hutabhujah pasus tpara udgacched ity arthntarakalpan // (K.13a, D.44-4) (5) (bhakty) laksanay // (K.13a, D.44-3) (6)(vinse) anityatve // (K.13a, D.44-5)

PRATHAMAM AHNIKAM

tvat samsropalambht / anumnavirodW 2 ) 'ngaparimne 1 saty angino nityatvnupapatteh / sabdavirodhah "te dhmam 2 abhisambhavanti" (cf.Chnd.U.5.10.3) iti 3 vacant / na tu nityatve bhakty kalpyamne doso 'ya.m upapadyate 4 / tasmd visamam 5 et at / ha 6 : katham idnim bhakty kalpayitavyam sstram iti / ucyate: prakrstrthatay / yath khalv api "amrtam v mrtam 7 atijlvo 8 rh te 9 hsisur asavah sariram(3)"(AV(S).8.2.26) ity abhidhiyate / na ca prninm atyantysavo na 10 jahati / kirn tarhi / prakrstam klam / evam ihpy ucyate 11 "tarati mrtyum" (cf.Mund.U.3.2.9) iti / ntyantya mrtyum tarati / kirn tarhi / prakrstam klam / upacaryate hi 12 lok<e> 'pi 13 prakrste 14 nityasabdah^ 4 )/ tadyath "nityaprahasito nityaprajalpitah 15 "(cf.MBhsya.I.7.4) iti / evam siddhah ksayayogah / ha: atisayayoga idnim asya hetoh katham 16 anumtavya iti / ucyate: atisayayogah kriybhyst / yatra hi kriy sakrt 17 pravartate yatra csakrd vartate tatrtisayo drstah / tadyath krsydisu / yajfie ca dravyopdnasaktyapeks kvacit sakrd eva pravrttih kvacit punah punar ango 'ngaparimne K. and D.: sabdavirodhate dhmam A. sabdavirodha istprtasya dhmam virodhas te dhmam (above this D. reads ga pustake 'pi.) 3 A. abhisambhabhavatiti 4 D. upapadyate iti 5 A. visayam 6 A. omits ha. 7 A. vmrto 8 A. hi jive 9 A. to 10 K., P. and D. omit na. 11 A. omits ucyate. 12 A. omits hi. 13 K., P. and D. omit 'pi. A. loko 'pi 14 A. prakampe Dkha. prakrto 15 A. nityajalpita 16 A. katham asya hetor 17 K. andD.: 'sakrt
l A. 2

10

15

Dkha. sabda

(*)(pratyaksavirodhas) pratyaksapramanavirodhah / pratyaksasabdena taddrstah samsaro 'bhidhlyate, tena samsradarsane tad virudhyate nityatvam karmaphalasyeti yvat / / (K.13a, D.44-6) ^2^ (anumnavirodhah) angni pasupurodsdlni / uktam yad anumnam kramikavinasyatphalayogyatay* karmana uktatvd** iti bhvah // (K.13a, D.44-7) *K. yogitayd **K. uktatvam ^3^(m te hsisur asavah sarlram) tava prnh sariram m hsisur m tyksur amrtam* ca m tyksuh / crthe vsabdah / nanu kirn tad amrtam / tadhaatisayena jlvanam atijlva evmrtam / evam tava prn atijlvanaviyukt etaccharlraviyukts ca m bhvann ity arthah / / (K.13a, D.45-1) *D. omits amrtam ca m tyksuh. '4> (nityasabdah) nityasabda iti / nityavisaye yah prayoktavyah sabdo mrtyum taratltydih sa ity arthah / / (K.13a, D.45-2)

46

YUKTIDIPIKA

10

15

avrttih 1 / tasmad atisayena bhavitavyam / kim canyat / a n g a t i s a y a t ^ 2 / ihngnm atisayd angino 'pi ghatder atisayo drstah / asti cyam pratiyajnam angnm daksindmm atisayah / tasmd atrpy atisayena 3 bhavitavyam 4 / devatngabhvagamant ksaytisaynupapattir iti cet / athpi 5 syt / yo hi yajfie dravyamtrasya sdhanabhvam anumanyate 6 tarn prati kaytisayayogv 7 aparihryau sytm / vayam tu dravyasamavyinim devatm kratv^2) ahgabhvam upagacchantim vidmah / tasmd adoso 'yam iti 8 / tac cnupapannam / kasmt / sdhyatvt / devatnm aparimitatvam sdhyam tadangabhvagamanc ca <dosbhvo 'pi sdhyah> 9 / na ctm kriyngam 10 udslnatvd iti nah^3) siddhntah / tasmd ayuktam etat / upetya v kratusamanusthnnarthakyaprasangt / yadi dravyasamavyinim devatm upalabhya^4) tadangabhvagamand 11 aksayo 12 niratisayas ca hetur avagamyata 13 itistam vah 1 4 / tena tarhi yad v tad v vedoktakarma 15 krtv sakyo Vptum arthah / kim prnivinsahetubhih 16 / katham / na hi kimcit karma vidyate yatra sarirasyngabhvo na syt^ 5 )/ sarvadevatmayam sariram 1 7 yasmd ha tasmd vai vidvn^6) purusam idam brahmeti manyate /
X A. pravrttih 2 Dkha. kim crigtisayt 3 A. atirekena 4 A. repeats kim cnyat / angtisayt 5 A. atha v 6 A. upamanyate 7 A. ksaytisaydosv 8 A. omits iti. 9 All the Mss read dosbhvah. 10 A. ctmakriyngam n K., P. and D.: tadngabhva0 12 A. ayaksayo 13 A. and Dkha.: avpyate (this is also 14 A. ity estavyah 15 A. vedoktam karma 16 K., P. and D.: hetubhih kratubhih 17

/ ... bhavitavyam.

possibly the original reading).

A. ca sanram

(^(angtigayt) angabhvo hi samhatyakrita / / (K.13b, D.45-3) (2) (kratv) kratau na vrlhdy arigam kim tu tadadhisthtrl kcid devat s ca sarvatra tuly / / (K.13b, D.46-1) (3)(nah) yadi tvac charlrarp devat tat tatrpy atisayena bhvyam / tmarpeti cet tasyngabhvnupapattih / angabhvo hi samhatyakritsanghtarpas ctmeti vaksymah (168.12) / / (K.13b, D.46-*2) (4) (upalabhya) abhyupagamya / / (K.13b, D.46-3) (5) (syt) japamtram api hi kurvato 'vasyam sarlram ahgabhvam eti //(K.13b, D.46-4) (6)(vidvn) vidvn jnni purusam sartram evedam brahma vetti // (K.13b, D.47-1)

PRATHAMAM AHNIKAM SK2c sarv hy asmin devath sarire 1 'dhisamhith^1) / / (cf.Pr.U.3)

47

tatra yad uktam (46.4) devathgabhvagamant ksaytisaynupapattir ity etad ayuktam / evam ayam hetus tridosah / tena yah 2 phalaviseso 'bhinirvartyate so 'pi tathjtlya 3 iti sakyam anumtum / tasmn nsya 4 jijfisor atra samdhih( 2 ) 5 / aha: yadi nayam sreyan iti krtvasya jijfisor natra samadhis 6 tena tarhi yah sreyn phalavisesah sa upadestavya iti / ucyate: TADVIPARITAH SREYN / (SK2c) tad ity anena karmavidhinispditasya svargaprptilaksanasya phalasybhisambandhah / tasmd vipantah7 suddho 'ksayo niratisaya ity arthah / ko 'sv ity ucyate moksah sreyn^ / etad uktam bhavati / ubhv apy etau prasasyau svargpavargv mnyavihitatvt / moksas tu prasasyatarah / kasmt / yathoktadosnupapatteh / sa hy avasyambhvitvd aikntikah / atlndriyatvd asamvedyah^4)/ svtmany avasthitatvl laghuh 8 sarvatra sannihitas^5) ca / mnyastutatvt 9 prasastah / sadbhir sevitatvd aninditah / ^a^ia^j^ajnavajr^gj^a^ visuddhah / adravyatvd^6) aksayo niratisayas ca /
1 D. sartre devat instead of devatah sarire 2 A.yat 3 A. and Dkha.: tathjtiyaka 4 D. nsti 5 D. atra samdhih, s.m. atrsamdhih 6 A. atrsamdhis (this is also possibly the original reading). 7 A. omits viparitah .... prasasyatarah / kasmt (47.11-13). 8 Dkha. avasthitatvc ca laghuh 9 D. and A.: mnyas tu tattvt P. mnyastutvt 10

10

15

A. yamaniyamajnnavairgybhyupyasuddher

(^('dhisamhith) adhisthtrtayaikgrlbhth / / (K.13b i.n., D.47-2) ^2) (samdhih) asamdhir* ansvsa ity arthah / / (K.13b, D.47-3) *D. 'samdhir W (reyn) drstasya tu drpstatvd atra gananaiva na yuktety sayena krikkrah sreyn ity abhy<a>dhn* na tu sresthah / / (K.14a, D.47-4) *K. and D.: abhidht (4' (asamvedyah) asamvedyety anena parasamvedyasya visayabhogasysvdane saty anyesm ananugrahe nairghrnyam yad uktam tat parihrtam // (K.14a, D.48-2) ^5^ (sarvatra sannihitaS) sarvatra sannihita ity anenrjanaraksanaksayasahgabhtopaghtdidossankm nirkaroti / / (K.14a, D.48-1) ^6^ (adravyatvd) dravyam dharmisvarpam* avasthtr, tatrvasyam avasthvaspeksau** ksaytisayau stah / / (K.14a, D.48-2) *D. s.m. dharmisvarpam **D. s.m. avasthvaspeksau

48

YUKTIDIPIKA

aha: katham punar^1) ayam apavargah prapyata iti / ucyate: s a m y o g b h v t / duhkham ca 1 pradhnam 2 / tath ca tantrntaresv apy uktam "duhkhahetuh kryakaranasaktih^ 2 ) 3 " iti / tena^3) yad purusasya 4 samyogas tadvisuddhitvam 5 asya / svasaktivisesayogt^4) tesu tesu jtyantaraparivartesu( 5 ) dharmdinimittasmarthyd ysam anubhavati / yad tu pradhnasamyogo ]muvartate tad nimittbhve naimittikasypy abhva iti krtv na 7 gunar^dvandvny anubhavati / ha: Jcinwthah^ punar ayam pradhnasya purusena saha samyogah / ucyate: naitad ihbhidhniyam / vaksyaty ayam uparistd cryah purusasya darsanrthah 9 kaivalyrthas tath pradhnasya / pahgvandhavad ubhayor api samyogah /(SK21abcd > ) iti / ha: viyogas tarhi kasmn nimittd bhavatiti / ucyate:

10

15 *A. omits ca.

VYAKTVYAKTAJNAVIJNNT / / (SK2d)
2 A. pradhna 0 3 A. kryakrana 4 A. purusya 5 A. tadvisuddhatvam 6 A. nivartate 7 A. punah 8

Dkha. kimartham A. pradhnrthah

W (katham punar) nanu bhavatv evam tathapy upyabhvad durlabhatvad asyasakyopadesatvam ity sayenha katham punar iti // (K.14a, D.48-3) (2) (kryakaranasaktih) kryasya bhtapancakatanmtrapaiicaktmanah karanasya ca buddhidharmkhyadasakntahkaranatrayasvarpasya y Saktih pradhntmik s duhkhasya hetuh // (K.14a, D.48-4) (3)(tena) pradhnena / / (K.14a i.n., not found in D.) (4) (svasaktivisesayogt) nanu kah khaldslnasya pumso duhkhnubhava ity hasvasaktivi<se>sayogd* iti / svaaktih pumso drgrpat svasya pradhnasya saktir drsyat tayoh saktivisesayor yo yogo drastrdr^yabhvas** tatah / etad uktam bhavati: duhkhnurakte buddhisattve yad etat pumsah pratyaynupasyatvam yena suddham api samvidrpam duhkhasamvid ity upacaryatesa evsya duhkhnubhava iti yvat / / (K.14a, D.48-5) *K. svasaktivisayogd D. s.m. svasaktiviseyogn(l) **D. drstrdrsyabhvah (5) (jtyantara-) kirn tasyvisuddhitvam ity sarikyha jtyantareti / brahmdisthvarntesu * / / (K.14a,*D.48-6) *K. not clear D. indicates a lacuna after brahmdisthvarntesu.

PRATHAMAM AHNIKAM SK2d

49

vyaktam cvyaktam ca jnas ca vyaktvyaktajfih / tesm vijnnam vyaktvyaktajnavijnnam tasmt 1 / bahusv aniyamd alpco 'pi 2 na 3 prvaniptah (cf.Pn.2.2.34) / athav jnnasya sdhakatamam 4 vyaktam^1) tatprvakatvd avyaktasamadhigamasyety 5 abhihitam / yadv vyaktam cvyaktam ca te 6 vyaktvyakte te vij,n,titivyaktvyaktajnas tadvijnnt samyogo nivartate / vaksyati7 caitat drst mayety upeksata 8 eko drstham ity uparamaty 9 any 1 0 / (SK66ab) iti / tatra rupapravrttiphalalaksanam^ 2 ) 11 vyaktam / rpam punar mahn ahamkrah paiica tanmtrny ekdasendriyni panca mahbhtni / smnyatah pravrttir dvividh hitakmaprayojan^ 3 ) chitapratisedhaprayojan ca / visesatah paiica karmayonayc/ 4 ) 12 <dh>rtydyh 13 / prndys ca panca vyavah 14 / phalam dvividham / drstam adrstam ca / tatra drstam siddhitustyasaktiviparyayalaksanam adrstam brahmdau stambaparyante samsre sarirapratilambha 15 ity etad vyaktam / esm 16 gunnm sattvarajastamasm arighgibhvagamand visesagrhltih / yad tv arigabhvam 17 agacchanto
l A. omits tasmt. 2 A. alpasypi jnasabdasya 3 A. ornits na. 4 A. jnsdhakatamam 5 A. omits avyaktasamadhigamasyety ... yadv vyaktam 6 A. ceti instead of ca te 7 A. iti vaksyati 8 A. upeksa 9 A. omits uparamaty any iti. 10 D. uparamaty any ah Dkha. uparataika 11 A. rpavrttiphala0 12 A. panca yonayah 13 All the Mss read vrttydyh. 14 A. pancvayavh 15 K, P. and D.: karmapratilambha 16 D. yesm 17

10

15

ca (49.4-5).

A. agabhvam

"'(vyaktam) vyaktam hi sukhaduhkhamohanvitam sad avyaktasiddhim karoti tadayatta ca purusasiddhih / svahetusv yattatm vadati* // (K.14a, D.48-7) *D. omits svahetusv yattatm vadati. (2J(rpapravrtti-) rpyate vis"esyate* nirpyate trayovimSatitattvni / pravrtti^abdena tu rpnm eva yo vyprah sa ucyate / / (K.14b, D.49-1) *D. visesato W (hitakmaprayojan) hitasya kmo 'bhilsa updnam tat prayojanam yasyh / / (K.14b, D.49-2) W(panca karmayonayo) panca karmayonaya iti / <dh>rtih* sraddh sukh vividisvividisety eva pancadh karmayonih / samastakarannm smnyarp pravrttir ntarlyavtaprerito** vyuh / / (K.14b, D.49-3) *K. and D.: vrttih **D. ntariyay ta ... prerito

50

YUKTIDIPIKA

nirlikhitavisesa^1)1 vyavatisthante tadavyaktam ity ucyante / cetanasaktirupatvc 2 citram gunavrttam jntiti jiiah / esm 3 traynm bhedam^2) abhedam ca 4 vijnya samyoganivrttim labhate / kasmt / samyoganivrttipratidvandvibhtatvd 5 viyoganimittasya / iha ya<to> darsananimittah 6 pradhnapurusayoh samyogas tasmd asya pratidvandvibhtena jnnena viyogahetun bhavitavyam / ko drstntah / tamahpraksavat / yath tamas tirohitni dravyni ghatdini nopalabhyante tatpratidvandvibhtena tu pradipena 7 praksitnm 8 bhavati tadvad ihpi drastavyam iti siddham jnnn moksah / uktam ca vrksgrc^3) cyutapdo yadvad anicchan^4) narah 9 pataty eva / tadvad gunapurusajno 'nicchann api kevali bhavati / / (Paramrthasra [verse] 83) kirn cnyat / mnybhihitatvt / mnyanibandhano hy ayam 10 art ho jnnn moksa iti na ydrcchikah / katham / evam hy ha

10

15

satyam jiinam anantam brahma / yo veda nihitam guhym parame vyoman^5)11 / so 'snute sarvn kmn / saha brahman vipascit 12 / / (Tai.U.2.1) yato vco nivartante 'prpya manas 13 saha / nandam brahmano vidvn 14 na bibheti kutascana / / (Tai.U.2.9)
X K., P. and D.: 'nirlikhitavises 2 A. cetanrpasaktitvc 3 A. etesm 4 A. omits ca. 5 0 A. samyoganimittapratidvandvi 6 0 0 K. and D.: yad 'darsana P. yaddarsana 7 K., P. and D omit pradipena. 8 A. inserts esm after praksitnm. 9 A. anicchannan narah 10 A. and Dkha.: mnyanibandhanas cyam 11 A. vyomni 12 A. vipascitah 13 A. manaso 14

A. yadadarsananimittakah

A. matv

t1) (nirlikhitavises) lekho likhitam tasman niskranta nirlikhita iti yavat / nirlikhita visesa yesu gunesu te tathokth prasntavises iti yvat / / (K.14b, D.49-4) (2) (bhedam) sdharmyavaidharmye ity arthah / / (K.14b, D.49-5) (3) (vrksgrd) hrltakrikm pathati yrksgrd iti / / (K.14b, D.50-1) (4) (anicchan) anicchann ity anenvasyambhvam upodbalayati* / / (K.14b, D.50-1) *D. upodbalati (5) (parame vyoman) parame vyomnlty arthah / / (K.15a, D.50-2)

PRATHAMAM AHNIKAM SK2d tarn 1 eva viditvmrtatvam eti nnyah panthyanya vidyate /

51

(cf.Svet.U.3.8, 6.15) tath brhmane 'py uktam "tarati sokam tmavit"(Chnd.U.7.1.3) "brahmavid 3 brahmaiva bhavati" iti / tasmd mnyaprmnyd api manymahe jiinn moksa iti / ha: jnnavcino^ 1 ^ 4 'mrtatvanimittbhyupagamn mahata m nyntarasynarthakyam / yadi 5 jnnavcina mnyakhandakd amrtatvam avpyata ity etad abhyupagamyate tena kriyvcino mahata mnyntarasynarthakyam prptam / kirn kranam / na hy anysenestvptau 6 satym ysabhyisthe karmani pravartamnah krti bhavatiti / ha ca arke^2)7 cen madhu vindeta kimartham parvatam vrajet 8 / istasyrthasya samprptau ko vidvn yatnam caret / / (cf.e.g.SBh.1.2.4, NVTT. on-NS.1.2.1) ucyate 9 : yadi punah karmny atyantakartavyatayesyante 10 jnnavcina mnyasya katham 11 arthavatt siddh bhavati / ha: samuccaye tbhayrthavattvam / jiinakarmanos tu samuccaye 'bhyupagamyamne dvayor apy mnyrthavatt siddh bhavati / "vidvn yajeta vidvn yjayet" iti vacant / tath sarvapurusnm kratv adhikro 12 'srotriyasandhasdravarjam 13 iti nyyt / tasmj jnnakarmanoh samuccayd istaprasiddhih / ucyate: na prvadosaparihrt / yadi niyamato vidusaiva karmni kartavynity abhyupagamyate 14 tena yah prvokto(30.10) dosah samsrbhvaprasangastasyparihrah / omits tarn eva ... ayanya vidyate. brhmana omits brahmavid brahmaiva bhavati. and D.: jnnavdino K., P. and D. omit yadi ... mnyntarasynarthakyam. A. yadi jnnavcino mahata mnyntarasynarthakyam yadi 6 A. ysenestvyptau 7 K., P. and I).: akke 8 A. caret 9 K., P. and D. omit ucyate. 10 0 A. antyantakartavya 11 A. katham mnyasya 12 A. anadhikro 13 A. omits sdra. (this is also possibly the original reading). 14 A. omits abhy.
l A. 2 A. 3 A. 4 A. 5 2

10

15

20

(^(jnnavcino) mnyasya// (K.15a, D.51-1) <2)(arke; K. akke) grhakone / / (K. i.n., not found in D.) (arke; K. and D.: akke) akkasabdah kakradvayasamyukto grhakonavcakah / na tu rephakakrayuktah / tasya hi sryasphatikavcakatvd iti / yad uktam arkah sphatikasryayor iti* / / (K.15a, D.51-2) (cf.Amarako^a 3.3.4) (cf.p.51,fn.7) *D. omits iti.

52

YUKTIDIPIKA

10

15

20

kim ca sastrahanes ca / yac 1 ca2 sastram "istapurte 3 samupasya te 4 dhumam abhisambhavanti 5 "(cf.Chnd.U.5.10.3) iti tad etasym kalpanym hiyate / kim cnyat / bhinnaphalatvt / ihbhinnaphalni dravyni samucciyante tadyath bhujyahgni spdmi / abhinnam tesm trptilaksanam phalam iti / na 6 caitaj jnnakarmanor abhinnam phalam svargpavargahetutvt / jiinasmarthyt kaivalyam abhinnam phalam iti cet prvenvisesah 7 / yad uktam (30.10) samsrbhvaprasanga 8 iti tad anapahrtam 9 eva10 bhavati / kim cnyat / sryamnaphalavirodhas ca / yac ca kriyyh phalam 11 sryate "agnihotram juhuyt svargakmo 12 rstram agnistomena jayati 13 " iti tad virudhyate / <kim cnyat /> karmanas ca sesabhvah svrthopasarjanatve 1 4 saty arthntaranispdakatvt 1 5 / yathvahanti (cf.Tai.Br.3.2.5.6) ity evamdyh kriyh svam phalam upasarjanikrtya taddvrena yajer upakurvantyas tacchesabht 16 bhavanty evam kriypi jfinaphalabhtatvt tacchesabht syt / vidhisadbhvt kriyprdhnyam iti cen na uktatvt / katham etat / nsti vidhikrto 17 visesah / upetya v tatrpi^1) tadutpatteh / asti hi jnnasypi vidhyakam sstram / katham / evam hy ha "y a tmpahatappm 1 8 vijighatso vipipso 19 vijaro vimrtyur visokah <satya>samkalpah20 so 'nvestavyah sa jijfisitavyah / sa 21 sarvms ca kmn avpnoti sarvms ca lokn 22 yas tarn 23 tmnam anuvidya 24 vijntlti prajpater vacanam sryate" (cf.Chnd.U.8.7.1) <iti> / punar apy ha "dve vidye veditavye 25 par caivpar ca y"(cf.Mund. U.l.1.4) <iti> / tasmd vidhisadbhvt kriyprdhnyam iti svapaksnrgamtram etat /
X A. yah P. yas 2 A. omits ca. 3 D. istaprtT 4 A. omits te. 5 A. abhisambhavati 6 A. omits na ... abhinnam phalam iti. 7 A. prvena visesah 8 D. reads in the right margin samsrabhveti pthah. 9 A. anapakrtam Dkha. apanitam 10 Dkha. omits eva. 11 A. phalam kriyyh 12 A. surga* 13 A. yajati 14 A. svargpasarjanatve 15 A. arthntaraphalanispdakatvt 16 A. tacchesabht 17 A. virodhakrto 18 A. tmhatappm 19 A. vijighatso pipsm 20 K., P. and D.: sannyastasamkalpah A. satyasthasamkalpas 21 K., P. and D. omit sa. 22 K., P. and D. omit sarvmS ca lokn. 23 K., P. and D. omit tarn. 24 A. anuviddhi 25

A. veditavye te

(^(tatrpi) jfine 'pi / / (K.15b, D.52-1)

PRATHAMAM AHNIKAM SK2d

53

drstrthatvd ity e k e 1 / eke punar cry manyante drstam eva jiinasyjnnanivrttilaksanam 2 phalam, tasmn na sstrena 3 vidhiyate / kirn kranam / drstrthasya hi karmano na sstram prayojakam4 svayam evrthitatvt 5 tatra pravrtter bhujydivat / tesm jiinavidhyakni vkyni / tny upyagunavidhnrtham 6 anuvdabhtny 7 sriyante / tadyath "dadhn juhoti payas juhoti" iti / yat tu 8 khalv idam ucyate (51.17) "vidvn yajeta vidvn yjayet srotriyasya ca karmany adhikrah" iti tasyyam arthah / adhitya vedam kriynuprvim ca jntv karmani < pravartitavyam pravartayitavyam ca> 9 / evam ca sati na kascid dosah / yadi punar niyamata evtmavidm karmany adhikras tena samsrbhvaprasangah 10 svbhvikatvd vijnnasya sstrasya sarvdhikravirodhas <ca(?)> tasmn nsti samuccayo jnnakarmanoh / apara ha: satyam nsty anayoh samuccayah / kirn tarhi / sarvrth kriy jnnam pratisiddhrtham / ye hi 11 pandndhabadhirdayah 12 karmano 'tyantam nirkrts tesm jfind sramntare^1) 'mrtatvvptih / itaresm tu mlsrame^2) karmana eveti tasya nyam 13 vdinah parihra iti / ucyate: na svasamayavirodht / evam bruvnasysya vdinah svasamaya eva virudhyate yad uktam "vidvmsah prajm na kmayante 14 kirn prajay karisymah"(Brh.U.4.4.22) atha 15 yad uktam "putraisanys ca 16 vittaisanys ca vyutthytha 17 bhaiksacaryam caranti"(cf.Brh.U.3.5.1, 4.4.22) iti / na ca pandnm putraisanvyutthnam arthavad bhavati daivakrtatvt 18 / kirn cnyat / rahasyabhtatvt / rahasyabhtam hi vednm 19 jnnam / yasmd ha "tad 20 dha smaitad runir auddlakir jyesthya putrya provca /
1 A. evam 2 A. jnnanivrtti0 3 A. sstre (this is also possibly 4 A. prajojakam 5 A. evrthitvt 6 A. upguna0 7 A. anuvdaprptny 8 K., P. and D. omit yat tu. 9

10

15

20

the original reading).

Instead of pravartitavyam pravartayitavyam ca K., P. and D. read pravartayitavyam, while A. reads pravartitavyam. 10 K. not clear P. samsa~rapra..sangah D.: samsrbhvaprasangah 11 A. omits hi. 12 K., P. and D.: sandndha0 A. pandandhabadhiraprabhrtayah 13 K., P. and D.: vyam 14 A. nkmayanta 15 A. omits atha. 16 A. omits ca. A. omits vyutthytha ... pandnm putraisan. P. omits atha. 18 P. devakrtatvt (this is also possibly the original reading). 19 A. devnm 20 A. yad

(^(alramantare) sannyasasrame / / (K.16a, D.54-1) ^2^ (mlsrame) grhasthsrame / sarvair upajlvyamnam grhasthyam mlsramah / / (K.16a, D.54-2)

54

YUKTIDIPIKA

idam <vava>* jyesthaya putraya 2 pita 3 brahma prabruyat 4 pranayyaya^1) cntevsine 5 nnyasmai^2) yasmai kasmaicana / ya imm adbhih parigrhitm vasun vasumatlm prnm dadyd etad eva tato bhyah^3) "(cf.Chnd.U.3.11. 4-6) iti / bhavati ctra^ 5 param rahasyam vednm avasnesu pathyate / panddyartham tad ist am ced disty saphalat^4) sruteh / / vidvn karmni kurvitety etad^5) uktam kila srutau / sa ca panddir eva syd 7 yo 'tyantam karmanas cyutah / / sa eva vartyatm prjfiaih kirn nyyyo 'tha matibhramah / indriyrthnurgo v dveso8 v moksavartmani / / kaivalyaprptihetutvd y vedavihit stutih 9 / prasast yjnavalkydyair visistais tattvaniscayt / / seyam visayargndhair viparitrthavdibhih / vidy kanyeva pandya dlyamn na sobhate / / tasmd rgnugair uktm kuhetuprtanm imm / apohya matimn yukty 10 hy 11 sramd sramam 12 vrajet( 6 )//
1 A. vta K., P. and D. omit <vva>. 2 K., P. and D. jyesthaputrya 3 A. omits pita. 4 A. vrabryt 5 A. pranyyyte vsine 6 A. trtra 7 A. reads y and omits syd ... indriyrthnurgo 8 A. dvesm 9 K., P. and D.: stut 10 A. and Dkha.: apohya yukty matimn 11 A. omits hy. 12

10

15

v(54.8-10).

K., P. and D.: asramam D. s.m. sramam

(^(pranayyaya) tadekanisthayety arthah / / (K.16b, D.54-3) (2) (nnyasmai) nnyasmaity anena rahasyam uktam / / (K.16a, D.54-4) (3) (ya imm...bhyah) ya imm iti / yah samudrntm ratnaprnm vasumatlm dadyt tato 'pi dtur etad brahma bhyo bahutaram / tena tasm api na deyam iti ttparyam / / (K.16a, D.54-5) (4) (saphalat) kkv nisphalatety arthah / / (K.16b, D.55-1) (5) (vidvn karmni kurvltety etad) vidvn karmni kurvitety etac chalamukhena dsanam / jnnam hi tvay panddivisayam eva krtam iti chalam / vastutas tu 'nyadevattmajnnam taih panddivisayam istam / vidvn iti tu kriynuprv<y>dijnnam(?)* anyadevatbhimatam / / (K.16b, D.55-2) *K. and D.: kriynuprvt dijnnam (6)(vrajet) vased vrajed iti pthayor eka evrthah / / (K.16b, D.55-3)

PRATHAMAM AHNIKAM SK2d

55

iti yuktidipikayam saptatipaddhatau1 prathamam hnikam2/

*K., P. and D.: iti rimadacryesvarakrmaviracitaym samkhyasaptatau yuktidtpikanmni vivarane D. hnikam samptam /

D v i t i y a m

A h n i k a m

aha 1 : samyag upadistam bhavata 2 vyaktavyaktajnavijnanan mokso 'vapyata iti 3 / idnim 4 upadestavyam katham etat trayam pratipattavyam iti / ucyate: trayasysya pratipattim dvedh 5 sammananti / samsato vistarat as ca / tad eva^1) trayam paiicabhir adhikaranair bhidyate / kni punar adhikaranniti / ucyate: prakrtivikravrttam^ 2 ) kryakranavrttam atisaynatisayavrttam nimittanaimittikavrttam visayavisayivrttam iti / tatra prakrtivikravrttaprva*D. atha dvitiyam ahnikam arabhyate / aha s.m. idmm

2 A. bhagavat 3 K., P. and D. omit iti. 4 A. cednim D. iddim, 5

A. omits dvedh.

(*)(tad eva; adhikaranair; nimittanaimittikavrttam) tad eveti / atra evakaro bhinnakramah pancabhir ity anena sambadhyate / paricabhir evety art hah / adhikaranam (57.5) vrttam ucyate 'dhikrtir vartanam iti / nimittanaimittikavrttam*(57.8) tu sahakrisahakryarpam prguktacatustaybhve 'pi yath purusrthasya pradhnaparinmasya ca sattvarajastamasm ca parasparbhibhavdin dharmdes caturdasavidhabhtasargasya ca / tac ca** "purusrthahetukam"(SK42a') itydin "dharmena gamanam rdhvam"(SK44a) itydin ca vaksyate, evam updnopdeyabhvah sahakrisahakryabhvo grhyagrhakabhvaupyopeyabhvah prakarspakarsas cety etvad eva prameyam sambhvyate //(K.lb, D.56-1) *D. nimittanaimittikam vrttam **D. omits ca. W (prakrtivikravrttam kryakranavrttam atisaynatisayavrttam visayavisayivrttam; "savisesnm ?vrttir na") tatra prakrtivikravrttam updnopdeyabhvah sa "prakrter mahn" (SK22a ) itydin vaksyate / arthasya ca cturvidhyam "mlaprakrtih" (SK3a?) iti krikay nirpayisyate / kryakranavrttam(57.7) tu prakrtivikrayor apy haranadhranapraksanenhrydisu bhavati tadyath karanatrayodasasya sve sve gocare tac ca "adhyavasyo buddhih" (SK23a) itydin vaksyate / visayavisayivrttam(57.8) kryakranavrttntargatam / aprakrtivikritve 'pi ca tad dhi dvradvribhva eva / tac ca "sntahkaran buddhih sarvam visayam avaghate yasmt tasmt trividham karanam dvri dvrni sesni" (SK35) iti vaksyate / anye tu "buddhlndriyni tesm" (SK34a) itydin "sesny api pancavisayni" (SK34d) ityantena visayavisayivrttam huh / atisaynatis"ayavrttam( 57.7) tv aprakrtivikratve 'py akryakaranatve 'py advridvratve J pi dharmdlnm buddhidharmnm prakarspakarsayogah / tat tu "smsiddhiks ca bhvh" (SK43a) itydin bhavisyati / savisesannm vrttir neti(59.3) / nedam vcanikam api tu vkyrthbhidhne* yad

58

YUKTIDIPIKA

katvad 1 itaresam adhikarananam tadbhedan vaksyamah / tat punas caturdha bhidyate / kimcit kranam eva na kryam / kimcit kranam ca kryam ca^ 1 )/ kimcit kryam eva na kranam^ 2 ) 2 / kimcin naiva kranam 3 na cpi 4 kryam 5 iti('3V ha: <smnyopadistam>(4)6 etan 7 nsmkam buddhv avatisthate / tasmd vivicyopadisyatm^5)8 kasya padrthasya kirn vrttam iti / ucyate: bdham 9 upadisyate / MLAPRAKRTIR AVIKRTIH / (SK3a)

10

mlam dhrah pratisthety anarthntaram 1 0 / prakarotiti prakrtih 1 1 / mlam csau prakrtis ca 12 mlaprakrtih / mlaprakrtih 13 kasya mlam / mahaddinm 1 4 / samjn^6) khalv iyam pradhnasya 15 mlaprakrtir iti / s cvikrtir16 avikrnutpdyety 17 arthah /
1 A. prakrtivikraprvakatvd 2 A. omits na kranam. 3 A. kryam 4 A. omits cpi. 5 A. kranam 6 K, P. and D.: smnyoddistam A. atismnyopadistam Dkha. atra 7 A. and Dkha.: iti 8 A. vibhajyopadisyatm (this is also possibly the original reading). 9 A. sutrtum (recte: stram tu?) 10 K., P. and D.: pratistheyam arthntaram 11 A. prakrti 12 K., P. and D. omit ca. 13 A. omits mlaprakrtih. 14 A. mhdznm 15 16

smnyoddistam

A. pradhnas Dkha. s csau vikrtir 17 A. vikrnutpdyety D. avikrah anutpdy ity

samarthyam nasti tada samasabhava ity evam param etat / rddhasya rajapurusa iti samasenarddhrthasya pums** sambandho gamyate / na tu rjnah / sa hy rddhasya putro v mitram veti pratipattih / na tv rdddhasya rjria iti / iha tu vkyrthbhidhnam vidyata evety etat paksntaradarsanavyjenhavkyapratipdyasyeti / / (K.17a, D.56-2) *D. vkyrthbhidhne, s.m. vigrahavkyrthbhidhne **D. pumsah W (kimcit kranam ca kryam ca) mahaddyah / / (K.17a, not found in D.) (2) (kimcit kryam eva na kranam) sodasakah / / (K.17a, D.56 without number) (3) (kimcin naiva kranam na cpi kryam) purusah / / (K.17a i.n., D.56 without number) (4)(<smnyatopadistam>) vyaktvyaktajnety (SK2d') atra / / (K.17a, not found in D.) (5)(vivicya) kasya mlam itydin / / (K.17a i.n., D.57 without number*) *D. deletes this note with a horizontal line. (6) (samjn) nanu mahn ahamkrasya ca mlam prakrte vikrtis cety sankyha samjneti / / (K.17a, not found in D.)

DVITIYAM AHNIKAM SK3a

59

ha: s a m s n u p a p a t t i h visesanntaropdnt 1 / mlam ity ayam sabdah prakrtivisesanrtham uptto mahaddivisesanntaram updatte / tatra "savisesannm vrttir na"(MBhsya.I.361.5 cf.ibid.II.18.7) iti samsapratisedhah prpnoti / s a m s n t a r a v i d h n d adosa iti cet / syn matam / yady etasmin samse doso ' y a m upapadyate samsntaram atra vidhsyate mlam prakrtinm mlaprakrtir iti / etac 2 cnupapannam / kasmt / dosntaropapatteh / evam api "upasarjanam prvam (Pn.2.2.30) nipatati" (MBhsya.II.355.9) iti sasthyoktasyopasarjanatvt 3 prvaniptah / tatraivam 4 bhavitavyam mlam prakrtinm prakrtimlam iti / tasmd idam apy asram 5 iti / ucyate: prva eva samso 'stu sambandhisabdah 6 <spekso>7 nityam vrttau samasyate / yat tktam(59.1) visesanntaropdnt samsnupapattir iti tatra 8 brmah: sambandhisabdnm sambandhyantaram anapeksya svarpapratilambha eva nstity knksvatm 9 eva vrtty bhavitavyam tadyath devadattasya gurukulam iti sambandhisabdatvd devadattasabdam apeksamno 'pi gurusabdah kulasabdena saha vrttim^1) pratipadyate (cf.MBhsya.L361.13fF.) / evamihpi mlam ity ayam 10 sambandhisabdatvn 11 mahaddyapekso Jpi prakrtisabdena saha vrttim^2) pratipadyata(cf.MBhsya.I.362.27) iti / kirn cnyat / vkyapratipdyasyrthasya vrttv upalabdheh / yatra hi vkyapratipdyo 'rtho vrtty^3) na gamyate 12 yath rddhasya rjfiah purusa iti / tatra "savisesannm vrttir na"(MBhsya.I.361.5 cf.ibid.II.18.7) iti vyavasthitam 13 sstre / gamyate ceha 14 vkyapratipdyo 15 'rtho vrttau 1 6 satym / tasmd adoso ' y a m iti / kirn ca jnpakc ca 1 7 / jnpakam khalv api "karmavat karman tulyakriyah"
1 A. visesanrtham aptto mahaddivisesanntararopdnt 2 A. tac (this is also possibly the original reading). 3 A. sasthyam tasyopasarjanatvt 4 A. omits tatraivam ... prakrtimlam iti. 5 A. apasram 6 K., P. and D. omit sambandhisabdhah <spekso> nityam vrttau samasyate. 7 A. sksepo We follow Pandeya. 8 A. ity atra (this is also possibly the original reading). 9 K., P. and D.: knksvata 10 K., P. and D.: ayam sabdah 11 After sambandhisabdatvn A. repeats devadattasabdam ... sambandhisabdatvn. 12 A. labhyate 13 A. vyavasthpitam 14 A. gamyata eva 15 A. vkyapratipdito 16 A. vrttv api 17

10

15

20

25

K., P. and D. omit ca.

W (vrttir) samsah / / (K.17a, not found in D.)


(2

)(vrttim) samasam / / (K.17b i.n., D.58-1)

<3) (vrtty) samsena// (K.17b, D.58-2)

60

YUKTIDIPIKA

10

15

(Pan.3.1.87) tatha "akarasya vivrtopadesah" (cf.MBhasya.I.L2,1.15.2) ityadi / tasmt "ntrsy 1 kartavy"(cf.MBhsya.II.356.1ff.) iti / aha: avayavasya pratyavamarsnupapattih samjnsabdatvt / samjnsabdesu hi nvayavasya parmarso bhavati / tadyath gajakarno 'svakarnah / kasya gajasya kasysvasyeti 2 / ucyate: na arthopapatteh / yatra hy artha upapadyate bhavaty eva tatra samjfisabdesv avayavesu <p>armarsah3/ tadyath sapta parnny asya parvani parvany astau pad any asya panktau panktau saptaparno 'stpadam iti / upapadyate cehyam art hah / tasmd adoso ' y a m / ha 4 : mlaprakrteh prakrtitvvacanam^ 1 ) 5 / mlaprakrtir 6 avikrtih prakrtir 7 iti vaktavyam 8 / yad ha 9 "mahaddyh prakrtivikrtayah sapta" (SK3b) iti / ucyate^2): prakrtitvvacanam 1 0 / prakrtitvam ca mlaprakrter na vaktavyam 1 1 / kirn kranam / arthd patteh^ 3 ) 12 / mlaprakrtir avikrtir ity eva siddham 13 / ucyamnam hi 14 tad^4^ anarthakam syt / ha(5)*. prakrtitvnupapattih satkryavdbhyupagamt 1 5 / prakarotiti prakrtis tadbhvah prakrtitvam / tac ca sati krye na ghatate / kasmt 1 6 / na hi sat am tmdinm kranam 17 upapadyata iti /
1 A. nanyasuya 2 A. kasysvsyati 3 K., P. and D.: avayavesv aparmarsah A. avayavaparmarsah 4 A. and Dkha. omit ha. 5 K., P., D. and Dkha. omit mlaprakrteh prakrtitvvacanam. 6 A. mlaprakrtir mlaprakrtih 7 A. and Dkha. omit prakrtir. 8 Dkha. ha avikrtir na vaktavyam instead of iti vaktavyam 9 A. yathha 10 A. prakrtivacanam 11 A. avaktavyam (this is also possibly the original reading). 12 K., P. and D.: arthopapatteh 13 K., P. andD.: siddhih 14 K. and P.: scyamnam hi D. scyamnam, s.m. scyamnam 15 A. tatkrya0 16 A. yasmt Dkha. yasmin 17

hi

K., P. and D.: karanam

W (mlaprakrteh prakrtivacanam) rudhitvopayogasya vidyamanatvad asti codyavakasa iti tatparyam // (K.17b, D.58-3) (2) (ucyate) siddhntavdT// (K.17b, D.59-1) (3) (arthd patteh) arthpatteh // (K.17b, D.59-2) (4)(tad) prakrtitvam // (K.17b, D.59-3) (5)(ha) prvapaksah // (K.17b, D.59-4)

DVITIYAM AHNIKAM

tad itaratrpi 1 tulyam / yathaiva hi 2 satm tmdinm kranam nopapannam evam asatm sasavisndinm apiti 3 nsti kascid visesah / trtiy^2) tuvisdvasthaiva 4 kotih / evam(3)5 ubhayapaksavyudst svapaksasiddhir iti cet / athpi 6 syt / sadasatoh kriysambandham praty avisesa7 upadarsyate bhavat / tenobhayor api paksayor vyudsah krto bhavati / tena 8 cobhayapaksavyudst svapaksasiddhir iti / etac cyuktam / kasmt / uttaratra pratisedht / sa^4) khalv esa vdi satkryavdam pratycaste / tasmt svaka evainam adhikre nivartayisymah 9 (109.3ff.) / ha: avikrtyabhidhnnarthakyam 1 0 mlaprakrtitvt tatsid11 dheh / y hi mlam sarvsm 12 prakrtinm avikrtyaiva 13 tay bhavitavyam / itarath hi mlaprakrtitvnupapattih / yadi khalv api pradhnasypi prakrtyantaram syn mlaprakrtitvam nopapannam bhavet 14 / tasmn mlaprakrtitvavacand eva tatsiddher avikrtigrahanam anarthakam iti / ucyate: na anavasthprasanganivrttyarthatvt / yath hi 15 mldinm bijam prakrtis tasypy anyat 16 tasypy anyad ity anavasth evam 17 mahaddinm pradhnam mlaprakrtis tasypy anyad ity anavasth prasajyeta / s m bhd ity 18 atas tannivrttyartham tadabhidhnam / ha: na hetvanupadest ( 5 ) 1 9 / asamsayam eva syd etad evam 20 / na tu
X A. omits api. 2 A. yathaiveti 3 A. ceti 4 K., P. and D.: vivdvasthaiva 5 A. iti 6 A. athavpi 7 A. avasesa 8 K., P., D. and A.: na Dkha. tena 9 A. varttayisymah 10 A. avikrtyabhidhnrtham n K., R andD.: tatsiddhih 12 A. sarvosm 13 A. hy avikrtyaiva 14 A. syt 15 A. omits hi. 16 A. omits tasypy anyat. 17 A. omits evam ... anyad ity anavasth. 18 After ity A. repeats anavasth prasajyeta 19 A. hetvapadesat 20

10

15

sa m bhd ity.

K., P. and D.: asamsayam etad eva syd

(^(ucyate) siddhntavdy ha / / (K.18a, D.59-5) <2)(trtly) sadasatpaksah / / (K.18a, D.59-6) (3)(evam) prvapaksavdl // (K.18a i.n., D.59-7) (4)(sa) ubhayapaksavyudst svapaksasiddhir iti vdl // (K.18a, D.60-1) (5> (hetvanupadest) mlaprakrtir avikrtir eva bhavitum arhati / etasmd dhetor iti ko 'pi hetur atra noktah / / (K.18a, D.60-2)

62

YUKTIDIPIKA

10

15

hetur atropadisto bhavadbhir na canupadistahetukam vipascidbhih pratipattum nyyyam 1 / tasmd ayuktam et at / ucyate: kranntarapratisedht puruskartrtvV 1 ) 2 pradhnkhynm gunnm cvasthntarnupapatter avikrtitvasiddhih / ihrabhyamn prakrtih kranntarair Isvardibhir rabhyate purusena v 3 gunair v / kirn ctah / tan na tvat kranntarair Isvardibhir rabhyate / kasmt / pratisedht / yath kranntarni na santi tathottaratra 4 pratisedhah karisyate(154.28ff.) / idnim sattvam rajas tamah purusa iti padrthacatustayam pratijiiyate / tatrpi purusakartrtvam pratykhyyate / tasmin pratykhyte 5 gunnm evvasthntarpeksah kryakranabhvah / sksmnm mrtilbhah kryam / nivrttavisesnm 6 avibhgtmanvasthnam 7 kranam ity ayam siddhntah / tatrstahgatavisesnm nivrttaparinmavyprnm ahgngibhvam 8 anupagacchatm 9 upasamhrtasaktinm sarvavikrasmyam sarvasaktipralayam nissattsattam nissadasadavyaktalaksanam avasthntaram upasamprptnm(cf.YBh.2.19) nsty anyat sksmataram avasthntaram yasyedam pradhnalaksanam avasthntaram kryam syt / tasmt susthcyate mlaprakrtir avikrtir iti / MAHADDYH PRAKRTIVIKRTAYAH10 SAPTA / (SK3b) mahn dyo ysm t mahaddyh / avayavena vigrahah samudyah samsrthah / anyath mahn evtrparigrhitah syt / prakrtayas ca vikrtayas ca prakrtivikrtayah / kranni 11 kryni cety arthah / tatra mahn ahamkrasya prakrtih pradhnasya vikrtih 12 / ahamkro 'pi tanmtrendriyaparvanoh <prakrtir mahato vikrtih) 1 3 / tanmtrni 14 ca bhtaparvanah prakrtir ahamkrasya vikrtih / ha: saptagrahanam kimartham / ucyate: saptagrahanam avadhiparicchedrtham / akriyamne hi saptagrahane na jiiyate kiyn prakrtiganah prakrtivikrtisamjiio bhavatiti 15 tatra mahbhtendriyaparvanor api prakrtitvam prasajyeta 16 /
1 K., P. and D.: nyyam 2 Dkha. purusasykartrtvt 3 A. omits v. 4 A. tathtra 5 A. omits tasmin pratykhyte. 6 A. nivrttivisesnm 7 A. abhibhvtmanvasthnam 8 A. angngim 9 A. omits anupagacchatm. 10 A. omits prakrtivikrtayah ... ysm t 11 D. kranni ca, s.m. kranni 12 A. prakrtih 13 14 K., 15 K., 16

20

25

mahadyh.

K., P. and D.: prakrtir vikrtir mahatah A. prakrtimahator vikrtih Dkha. vikrtir ahamkrasya P. and D. omit tanmtrni ... ahamkrasya vikrtih. P. and D. omit iti. A. prasajyate

(^(puruskartrtvt) purusasykartrtvt* // (K.18a, D.60-3) *D. purusasykrtakatvt

PRATHAMAM AHNIKAM SK3bc

63

ha: naitad asti prayojanam parisesasiddheh / iha bhavatm pancasikhnm pancavimsatis tattvni / tatra "mlaprakrtir avikrtih" (SK3a) ity uktam / sodasakas tu vikro na prakrtir na vikrtih purusah /(SK3cd) iti vaksyati / parisesatah saptaivvasisyante / tasmn nrthas tadarthena saptagrahanena / ucyate: ahamkraparigrahrtham / evam tarhi naivhamkro vidyata iti patanjalih 1 mahato 'smipratyayarpatvbhyupagamt 2 / tatparihrrtham 3 etad bhavisyati / ha: na uttaratra parigraht / etad api nasti prayojanam / vaksyati hi 4 mahat kanthenoparistd 5 cryah "prakrter 6 mahms tato 'hamkrah" (SK22ab') iti 7 / tenaivedam siddham 8 / nrthas tadarthenpi saptagrahanena / ucyate: rpabhede 'pi tattvbhedajnpanrtham / evam tarhi dharmdiny astau rpni buddher vaksyamnni (cf.SK23), ahamkras ca vaikrikataijasabhtdirpatvt^ 1 ) trilaksano 9 vaksyamnah lo (cf.SK25) / tatra rpabhedt tattvabhedo m bhd ity evamartham saptagrahanam kriyate / ha: he turn antarenpratipatteh / kanthoktam 11 api yuktim antarena na tarkasilh 12 pratipadyante / kirn punar lesopapditam 13 / tasmd atra samdhir vcyah katham anekarp buddhir ekaiveti / <ucyate:> na uttaratra vicrant / uttaratraitad vicrayisymah 14 (171.25fF.) kirn anekarpvirbhve 'pi tad eva tad vastu 15 bhavaty hosvid rpabhedt tattvabhedah <iti?> / tasmd iha tvad drsyatm iti siddham mahaddyh prakrtivikrtayah sapteti / SODASAKAS TU VIKRAH / (SK3c) sodasaparimnam asya so 'y ar ri 16 sodasakah sanghah / "tad asya 17 parimnam" (Pn.5.1.57) "samkhyyh samjnsanghastrdhyayanesu"(Pn.5.1.58) iti 1 8 kanpratyayah /
2 A. mahato 'smitt pratyaya0 Dkha. mahato asmin pratyaya0 3 A. tatparigrahrtham 4 A. omits hi. 5 A. kanthakenoparistd 6 A. prakrte 7 A. omits iti. 8 A. tenaiva siddham idam (this is also possibly the original reading). 9 A. and Dkha.: bhtdilaksanatvt trirpo 10 A. vaksymnah 11 K., P. and D.: kanthoktam 12 D. tarkasrh 13 A. klesopapditam 14 A. vicrayisymih 15 recte. vastu instead of tad vastu 16 K., P. and D. omit so 'yarn. 17 K., P. and D.: tasya 18

10

15

20

25

*A. ptnjalih

A. omits iti.

(^(-bhtdi-) tmasa / / (K.19a, not found in D.)

64

YUKTIDIPIKA

10

15

20

25

aha: kah punar ayam sodasaka iti / ucyate: panca mahbhtny ekdasendriyni 1 / tusabdo 'vadhranrthah / ha 2 : sakyah punar ayam artho 'ntarenpi 3 tusabdam avptum / katham / mahaddyh prakrtivikrtayah saptety apadistam 4 purastt / tato 5 'hamkratanmtraprvakatve siddhe satmdriyamahbhtaparvanoh punahsruter niyamo bhavisyati / tadyath 6 "panca pancanakh bhaksyh" (cf.MBhsya.I.5.15) ity atra ksutpratikrasamarthnm dravynm arthd 7 eva sarvesm bhaksane samprpte punahsruter niyamo bhavati / tadvad idam drastavyam / istato 8 Vadhranrtha iti cet / syn matam / istato 'vadhranrthas tarhi tusabdo bhavisyati / katham nma sodasako vikra eveti vijnyate 9 / sodasakas tu vikra ity evam10 m jnyiti 1 1 / yady evam asthne 12 tarhi tusabdah pathitah sodasako vikras tv iti vaktavyam / atha matam / vrttaparipranrtham 1 3 ayam asmin pradese pathitas tusabdah / yatra nirdosas tatraivyam drastavya iti / etad anupapannam / kasmt / asandeht / mahaddyh prakrtivikrtayah saptety apadiste kirn iti smsayik bhavisymah / tasmt pelavam asya pthe 14 pray oj an am pasymah / athyam 15 abhipryah syd yady apy etad arthatah 16 siddham 17 tathpy ayam cryah sphutapratipattyartham avadhranam pratydriyate / kirn kranam / yasmc citrh 18 strakrnm abhipryagatayah / tadyath bhagavn pninih "nah kye"(Pn.l.4.15) "rt sasya"(Pn.8.2.24) ity evamdisv antarena 19 prayatnam istato 'vadhrane siddhe 'nyatra "ajdl 20 gunavacand eva"(Pn.5.3.58) "stautinyor eva sanyabhyst"(Pan.8.3.61) ity evamdisu yatnam 21 karoti / tadvad ihpi drastavyam iti / etad a n u p a p a n n a m / kasmt / asakyatvt / sati v punar avadhranrthatve tusabdasya katham evtra 22 sakyam avadhranam pratipattum yvat mahbhtnm api sarirdilaksanam kryam upalabhyata iti / tatra kecit samdhim huhsarirdinm anarthntara1 A. indriyny ekdasa 2 K., P. and D. omit ha. 3 -A. arthntarenpi 4 K., P. and D.: sapteti hy upadistam 5 A. tatra 6 D. bhavisyati, s.m. bhavisyati tath 7 A. arthitvd Dkha. arthatvd 8 A. omits istato ... syn matam. 9 A. yath vijnyate 10 A. eva 11 A. vijnyzti D. jnyi, s.m. vijnyi Dkha. 12 A. asthnene 13

vijnyi (iti)

A. vrttapranrtham (this is also possibly the original reading). D. vrttaprnrtham, s.m. vrttapariprnrtham 14 A. not clear. 15 A. athpy ayam 16 A. arthas 17 A. omits siddham. 18 A. vicitrh (this is also possibly the original reading). 19 A. evntarena 20 D. ajder 21 A. prayatnam 22 A. ivtra

__

DVITIYAM AHNIKAM SK3c

65

bhvt 1 prthivydlnm aprakrtitvam yasmt kila prthivydTnm sannivesavisesamtram kryam mustigranthikundaldivan nrthntarabhtam ata evaism2 aprakrtitvam 3 iti / etac 4 cnupapannam / kasmt / avisest / sarvam 5 eva hi smkhynm kryam anarthntarabhtam / tatraitasym 6 kalpanym sarvatattvnm aprakrtitvam prasajyeta / athaitad 7 anistam satkryavyght<t> 8 / anye punar huhaparinmitvn mahbhtnm vikritvnavadhranam 9 iti / tad apy a n u p a p a n n a m / kasmt 10 / pratyaksopalabdheh / pratyaksata evopalabhyate mahbhtnm kalilnkurakslrdiparinmah 1 1 / anumnagrhyas 12 tu 1 3 tattvntarnm / tad etad avarottaram 14 bhavati / tasmd 15 ayuktam etat / [ha] na tarhi 16 pratipattavyam sodasako vikra eveti / ucyate: pratipattavyam / kirn kranam / tattvntarnupapatteh 1 7 / 18 iha purusrthena hetun smyt pracyutnm gunnm yo ' y a m mahaddivisesnto 19 viparinmah 20 sa tattvntarotpattiniyamena 21 vyavatisthate / na tu prthivydibhyas tattvntarotpattir asti / tasmd etesrn vikratvam eveti / kirn cnyat / grhakntarbhvt / yath tanmtrair rabdhesu prthivydisv ahamkrt tadyogyam grhakntaram indriyalaksanam utpadyate naivam prthivydivikrnm ghatdinm grhakntaram asti / tasmn na tattvntaram / atas ca 22 prthivydayo vikr eveti / kirn cnyat / pradhne prakrtibhvapratyastamayavat 23 tesu 2 4 vikrabhvapratyastamayt 2 5 / yath pradhnt sksmataram avasthntaram nstiti 26 prakrtibhvasya pratyastamayas 27 tath 2 8 tesu vikrabhvapratyastaJ A. anarthantarabhvt 2 K. and D.: ata esm P. ata e..sm 3 A. prakrtitvam 4 A. tat 5 A. prvam 6 A. tatretasym 7 A. tathaidad 8 K., P. and D.: anistam satkryavyghtah A. anistasatkryavyghtah 9 A. vikritvvadhranam 10 A. omits kasmt. 11 A. klamnkurakstrdiviparimnah 12 P. anumnagrahs 13 A. ta 14 A. and Dkha.: adharottaram (this is also possibly the original reading). 15 A. kasmd 16 A. and Dkha.: tarhtdam 17 K., P. and D.: tattvnupapatteh 18 A. iha iha 19 A. mahaddir visesnto 20 A. 'pi parinmah 21 A. tattvntero0 22 A. omits ca. 23 A. prakrtibhvah pratyastamayavat Dkha. prakrtibhvapratyastamayt 24 P. pratyastayamayavartesu 25 K., P. and D.: pratyastamayah 26 A. nstiti tatra 27 A. stamayah D. pratyastamayah, s.m. pratyastamayt 8

10

15

20

A. omits tath tesu vikrabhvapratyastamayah.

66

YUKTIDIPIKA

mayah / tasmad 1 yuktam ucyate sodasako 'yam vikara eveti / ha: puruse tarhi 2 k pratipattir iti / ucyate: NA PRAKRTIR NA VIKRTIH PURUSAH / / (SK3d) 5 na hy ayam 3 avasthntaram pratipadyate / no 4 khalv apy avasthntarasyvasthntaram bhavatiti / ha 5 : na tad 6 yuktim antarena sraddhiyate / tasmd upapdyatm katham 7 asyprakrtitvam avikrtitvam ceti / ucyate: prakrtitvnupapattih uttaratra pratividhnt / "tasmc ca viparyst"(SK19a) ity atra yuktim upadeksymah / tasmt tvad asyprakrtitvam 8 / avikrtitvam pradhnavat / yath 9 pradhnam evam ayam api purusah kriyamnah kranntarair Isvardibhir 10 nrabhyate / kasmt / pratisedht / yath kranntarni na santi tathottaratra pratisedhah karisyate11(154.28ff.) / kranntarni 12 santlti cen na purusntaraih samat v t 1 3 / samh sarve purus na ca samnm kryakranabhvo drstah / kirn ca niskriyatvt suddhatvc ca / esm viparinmalaksan parispandalaksan v kriy vibhutvd anupapann / kasmt 14 / esm itaretarnrambhakatvt / na gunair bhinnajtlyakatvt 1 5 / ihcetan gun 16 ity etat pratipdayisymah / yac ca yenrabhyate tanmayam tad bhavati 1 7 / yadi gunaih purusnm rambhah syt 18 tesm apy acetanatvam syt / cetans tu t e 1 9 / tasmn na gunair rabhyanta iti siddham etat 2 0 / kimcit kranam eva na kryam kimcit kranam ca 21 kryam ca / kimcit kryam eva / kimcin naiva kranam naiva 22 kryam 23 iti caturvidham kryakranavrttam pratipditam 24 (58.2) / etat pratijiipindastram / yad 25 apadis1 K., P. and D. omit tasmd yuktam ... eveti. 2 A. tarhidnim 3 A. omits ayam. 4 A. nau 5 A. omits ha. 6 A. naitad (this is also possibly the original reading). 7 P. kam 8 A. tasmd asya tvad aprakrtitvam 9 Dkha. yad 10 D. kranntaraim(l) isvar0, s.m. kranntarair isvar0 11 A. karisyate ha 12 K., P. and D. omit kranntarni santiti cen na. 13 A. purusais sambandht 14 A. tasmt 15 A. bhinnajtiyatvt 16 A. guna 17 K., P. and D.: tac ca tanmayam bhavati instead of tanmayam tad bhavati 18 A. tad 19 A. omits te. 20 A. evam etat 21 K., P. andD. omit ca. 22 A. na 23 D. naiva kryam naiva kranam, s.m. naiva kranam naiva kryam 24 A.and Dkha.: vykhytam 25

10

15

20

A. atra yad

DVITIYAM AHNIKAM SK3d,4

67

tarn bhavadbhir 1 asmin sastre 2 <tat(?)> prameyam 3 ity avagantavyam / / 3 / / ha: athasya prameyasya kutah siddhir 4 iti / ucyate: PRAMEYASIDDHIH PRAMND DHI / / (SK4d) pramiyate tad 5 iti prameyam / prameyasya siddhih prameyasiddhih / siddhir adhigamo 6 'vabodha ity arthah / pramiyate 'neneti pramnam / karanasdhano 7 lyut (cf.Pn.3.3.117) / tad ekam eva buddher ekatvbhyupagamt / updhivast tu bhinnam sriyate pratyaksam anumnam itydi / tasya yo 'sv updhikrto bhedas tarn ansritya prameyaparicchedakatvam 8 angikrtyaikavacananirdesah kriyate pramnd iti / etasmt prameyasiddhir 9 ity avagantavyam / katham / vnhydivat / yath vrlhydi prameyam 10 prasthdin parimnena 11 paricchidyata evam 12 ihpi vyaktdiprameyam pratyaksdipramnena 13 paricchidyata iti 1 4 / hisabda idnim kimarthah 15 syt / avadhrnrtha iti / ha: yady evam hisabdvacanam 1 6 avadhrannupapatteh / na hy etasmin stre kathamcid avadhranam upapadyate 17 / tasmd avacanam eva hisabdasya nyyyam 18 / prameyasyaiveti 1 9 cen na anyasysambhavt / sati hi vyabhicrasambhave 20 vastv avadhryate tadyath gaur 21 evyam nsvo devadatta evyam na yajnadatta iti / na ca prameyprameyayoh pramnaparicchedyatve 'sti prasahgo 22 yannivrttyartham prameyasyaivety avadhryate / pramnebhya eva iti cen na rsajiinavirodhaprasangt 2 3 / paramarser hi bhagavato jiinam 24 smsiddhikam apramnaprvam 25 iti vah paksah /
J A. etad bhavadbhir 2 K., P. and D.: sstram 3 K., P. and D. omit prameyam. 4 P. siddher 5 Dkha. yad 6 K. and P.: avagamo D. avagamo, s.m. adhigamo 7 A. kranasdhano 8 A. prameyaparicchedakatvasmnyam 9 Dkha. pritam 10 A. pramnam 11 A. pramnena 12

10

15

20

K. and P. omit evam ... pratyaksdipramnena paricchidyate, which D. adds in the right margin. 13 D. pratyaksdin pramnena 14 A. iha 15 D. kimarthakah, s.m. kimarthah 16 A. hisabdvacanam A. utpadyate 18 K., P. and D.: nyyam 19 K., P. and D.: prameyasyeti A. vyabhicrasyasambhave Dkha. vyabhicrasadbhve 21 A. gor 2 A. omits prasango. K., P. and D.: tmajnnavirodhaprasangt 24 K., P. and D. omit jnnam. 5 K., P. and D.: apramnaprvakam

68

YUKTIDIPIKA samsiddhikas ca bhavah prakrtika vaikrtas 1 ca dharmadyah / (SK43ab)

10

15

20

25

iti vacant / tad evam sati virudhyeta 2 / ubhayvadhranam iti cen na ubhayadosaprasangt / ubhayvadhrane saty ubhayor api paksayor ye dosas te prasajyante / tasmd ayuktam etat / siddhir eveti cen na anekntt 3 / kadcid dhy ayam pramt sannihite 'py ditydau linge dinniscaydisv4 arthesu pratihanyate / tasmd anekntt siddhir evety etad ayuktam avadhranam / ucyate: yad uktam(67.14) hisabdvacanam avadhrannupapatter iti / astu pramnebhya evety avadhranam / yat tktam (67.20) rsajnanavirodhaprasanga ity ayam adosah / kasmt / siddharpatvt / sdhyamnarpni hi vastni nntariyakatvt 5 svarpanispatteh 6 sdhanasambandham praty knksvanti bhavanti, siddharpam tu 7 bhagavatah paramarser jiinam / tasmd asya sdhanasambandham praty knks nopapadyata iti / athav punar astu siddhir evety avadhranam / yat tktam (68.4) anekntd iti tad 8 anupapannam / kasmt / sattvdlnm angngibhv<>niyamt 9 tamahprakarsasma<rthy>t 10 pramnavaikalyopapatteh / iha sattvdlnm aniyato 'ngrigibhvah / desaklanimittasmarthyd dhi kadcit sattvam 11 prakrsyate kadcid rajah kadcit tamah / sattvaprakars<as>12 ca praksarpatvt pramnam / tatra yad tamah prakrsyate tad tenbhibhtatvt sattvasya tatkryam anumnam <vikalngam>13 upatisthata ity atah satym apy ditydilingapravrttau dinniscaydisv arthesu pratihanyate / itarath tu na svarpahnam / yasya tu nispattivaikalyt pramnapratibandho 14 nestas tasya svarpahnam pramnnm prptam / katham / etvad dhi tesm svarpam yad uta prameyaparicchedah / tasmd yuktam etad avadhranrtho hisabdah <iti> / ha: bahni pramnny cryair abhyupagamyante / tni sarvni kirn bhavn 15 anumanyate / nety ucyate / kirn tarhi / TRIVIDHAM PRAMNAM^1) ISTAM / (SK4c)
1 A. 2 A. 3 A. 4

and D.: vaikrtiks virudhyate anaikntt A. dinnidayuktam etat / siddhir eveti cet na / anaikntt kadciscydisv 5 A. nntartyatvt 6 A. svarpanispattaye 7 A. omits tu. 8 A. anaikntd ayuktam tad ity atad 9 K., P. and D.: angiigibhvaniyamt A. angiigibhvo We follow Pandeya. 10 K. and P.: tamahprakarsasmagryt A. omits tamahprakarsasmagryt ... aniyato 'rigrig bhvah. D. tatah prakarsasmagryt, s.m. tamahprakarsa0 We follow Chakravarti. X1 K. and P.: satyam D. satyam, s.m. sattvam 12 K., P. and D.: praksas A. sattvaprakarss 13 All the Mss read triklngam. We follow Raghavan. 14 A. pramnaprabandho 15 A. bhvn

(1)(TRIVIDHAM PRAMNAM)

trividham pramanam pratyaksam anumanam agama iti trividhagra-

__

DVITIYAM AHNIKAM SK3d,4

69

vidhnam vidh, tisro vidh asya tat trividham triprakram ity arthah / anenaitad caste: ekam eva buddhilaksanam sattvam nimittntarnugrahopajanitbhih kryavisesaparicchinnarpabhedbhih saktibhir upakrd bhinnam iva pratyavabhsamnam drstdisabdavcyam bhavati / na tu yath tantrntariynm visayopaniptibhir indriyair upajanit bahvyo buddhayas tatheha vidyante yh parikalpyamnh svatantrni trini 1 pramnni syuh / syn matam / katham punah pramnalaksannm saktinm ekavastusannivese rpabhed 2 bhavantiti / ucyate: sattvdivat / yath sattvdinm gunnm ekasabddivastusannivese 'pi praksdikryabhedd rpasamkaro na bhavati, yath v sabdasparsarparasagandhnm ekadravyasannivese 'pi grhakntaragamyatvt 3 , yath v kartrkarandhikaranasampradnpdnakarmalaksannm saktinm ekadravyasannivese 'pi kryavisesaparicchinnni svarpni na samkiryante, tadvad idam drastavyam / saktyantaropajanane vastvantaropapattir iti cen na anabhyupagamt / na hi ksanabhahgashasam 4 yuktim ant arena dandabhayd api pratipadymahe / na tu <tasyyam(?) avasara>5 iti sthiyatm tvat / ha: katham punar etad 6 gamyate yath trividham eva pramnam na punar anekavidham 7 apiti / ucyate: SARVAPRAMNASIDDHATVT / (SK4b') sarvni ca tni pramnni sarvapramnni / siddhasya bhvah siddhatvam (cf.Pn.5.1.119) / sarvapramnnm siddhatvam sarvapramnasiddhatvam / siddhatvam antarbhva ity arthah / tasmt sarvapramnasiddhatvt / tasminn eva trividhe pramna iti vkyasesah / sarvesm paraparikalpitnm pramnnm asminn eva trividhe pramne 'ntarbhvd iti yvad uktam syt tvad
1 A. omits trini. 2 P. ekavastusannivesarpabhed 3 A. gamyakatvt 4 A. ksanabhaiigishasam 5 K., P. and D.: tasym avasara A. 6 A. eted 7 A. ekavidham 8 8

10

15

20

25

tasyvasara

After sarvapramnni P. reads siddhatvt sarvni ca tni pramnni sarvapramnni.

hanam avadharanartham / sarvasam pramanavyaktinam pratyaksadilaksanais tribhir eva sangrhltatvt tath copamndlnm atraivntarbhvam pratipdayisymah / pratyaksam evaikam pramnam ity eke / tad api na yuktam pratyaksena pramnenetaravibhgsiddheh, sukhaduhkhdisdhanpratipattes1 ca tanmle pravrttinivrttl api na sytm / npratyaksam pramnam astlty abhyupagamya parapratyyanrtham sstram pranayan vkyam coccrayan svm eva pravrttim svavc vidambayatlty ato bhadram pndityam tmanah prakatitavn iti / anumnam evaikam pramnam ity eke / tad api na yuktam / pratyaksbhve 'numnotthnsambhavt / sudram api gatv hi dharmilihgadistntnm anumnapravrttim icchat~avasyam2 pratyaksena grahanam abhyupagantavyam / etengama evaikam pramnam ity etad api nirastam / tatrpi pratyaksennumnena v padavkydyaprasiddhv3 gamrthapratipatter asambhavd iti / / (Ks.4, D.70-1) 1 D. sdhannm pratipattes 2D. icchatah instead of icchatvasyam 3 D. padavkyaprasiddhv

70

YUKTIDIPIKA

10

idam ucyate sarvapramanasiddhatvad iti / athava sarvapramanesu siddham sarvapramnasiddham / saptami u siddhasuskapakvabandhaih"(cf.Pn.2.1.41) iti samsah / yath snksyasiddhah 1 ptaliputrasiddha iti / tadbhvah sarvapramnasiddhatvam, tasmt sarvapramnasiddhatvt / kasya / trividhasya 2 pramnasyeti vkyasesah / kena punar krena trividham pramnam siddham iti / ucyate: paraspar<>visest 3 / anyni punar asmt trayd yathbhinnni tath pratipdayisymah(70.25ff.) / ha: kirn punas tat trividham pramnam iti / ucyate: DRSTAM ANUMNAM PTAVACANAM CA / (SK4ab') tatra drstam nma upttavisayendriyavrttyupanipti yo 'dhyavasyah / anumnam dvayor avinbhvinor ekam pratyaksena pramya tatprvakam sambandhyantare yat pascn mnam bhavati / ptavacanam tu pramnabhtadvrako 'tyantaparokse J rthe niscaya ity uddesamtram idam / laksanam tv cryo vaksyati svayam eva "prativisaydhyavasyo drstam" (SK5ab?) itydi / ha: <trai>vidhynupapattih 4 nyndhikasravant / <tantr>ntari5 yh kecic catvri pramnnicchanti "pratyaksnumnopamnasabdh pramnni" (NS.1.1.3) iti vacant / tath sad ity anye / pratyaksam anumnam ca sabda<s>6 copamay saha / arthpattir abhvas ca hetavah sdhyasdhakh / / ity abhidhnt / etni sambhavaitihyacestsahitni navety apare / pratyaksnumne eveti vaisesikabauddhh / tatra katham idam nisciyate trividham eva pramnam na punar nynam adhikam veti / ucyate: kirn punar idam upamnam nma / ha: "prasiddhasdharmyt sdhyasdhanam upamnam"(NS. 1.1.6) / prasiddhah prajfitah, tena sdharmyt sdhyasyprasiddhasya sdhanam adhigamo yas tad upamnam / avabodhavidhis tu yennupalabdho gavayah sa tasyopalabdhyartham adhigatagavayam paryanuyunkte kimrpo gavaya iti / sa tasm casteyath gaur evam gavaya iti / tatra pratipatt<>tya<n>tnupalaksitagavayasvarpo 7 vykhytrpratipditaprasiddhavastusdharmyajnnhitasamskrah pratipadyate nnam evamrpo gavaya iti / apara ha: prati<pattur> 8 ptavacanopajanitaprasiddhavastusdharmyajnnhitasamskrasyottaraklam pratyaksena tarn upalabhya y samkhysambandhapratipattir iyam asv artho Jsya sabdasya samkheya iti tad upamnam
1 A. samksyasiddhah 2 K., P. and D. omit -sya .... cptopadesabalt 3 A. parasparavisest 4 A. trividhynupapattir. We follow Pandeya. 5 A. trtiyntanyh. We follow Pandeya. 6 A. sabdam 7 A. pratipattytyatnupalaksita0 8

15

20

25

30

35

pratipattprasi- (70.4-71.2).

A. pratir

DVITIYAM AHNIKAM SK3d,4

71

ucyate: yady evam upamaitihyvacanam ptopadesasiddheh / yath gaur evam gavaya iti cptopadesabalt pratipattprasiddham gavayam upalabhate na 1 sdharmyamtrt 2 / tasmn na sabdt prthag upam / yat tu khalu "iti ha uvca yjnavalkyah" (Brh.U.2.4.13 et passim) ity et ad aitihyam nma pramnntaram upakalpyate 3 tad api vaktrvisespeksatvn na sabdd arthntaram / ha: na sdharmypeksatvt / yadi hy ptopadesa upam syt tena yath svarge 'psarasa uttarh kurava ity evamdisv antarena 4 sadharmyopadanam pratipattir bhavati evam ihpi s y t ^ / gavayam tv ayam khyt pratipdayisyan 5 prasiddhasdharmyagarbham sabdam updatte na kevalam( 2 V pratipattpi tasmd eva(3) pratipadyate na sabdamtrt / tasmt prthag evsyopadesah^4) kartavyah / sabdavyprt^ 5 ) tadantarbhva 6 iti cen na vltvltayor api tatprasangt / syn 7 matam / sabdavyprasahito ? yam prasiddhasdharmyalaksan<o> 'rtho 8 gavayapratipattau na kevalah / tasmd asya tatrntarbhva iti / tad apy anupapannam / kasmt / vltvltayor api tatprasangt / vitvitv api 9 het parapratipdanrtham upadiyamnau sabdavypram apeksete 10 , tayor apy ptavaeanatvaprasangah / anistam caitat / tasmn nopamnam ptopadesah / ucyate: sdharmyvyatirekah 11 upyabhtatvt / khytrprm12 nyd eva 13 pratipattur 14 gavayavijnnam15 upapadyate / sa tu kausald
1 K., P. and D. omit na. 2 A. sdhamyemtrt 3 A. upakalpyeta 4 A. antareno 5 Dkha. pratipdayan 6 P. omits tad of tadantarbhva. 7 8 A. sdharmyalaksanrtho 9 K., P. and D.: eva 10 D. apeksete, s.m. upeksete 11 D. sdharmyvyatireke 12 D. khytapr0 13 A. omits eva. 14 A. pratipattir 15

10

15

20

K., P. and D. omit syn matam / gt (71.13-16).

apy anupapannam / kasmt / vitvitayor api tatprasan-

A. gavaye vijnnam

'*' (ihapi syat) sabdavat sadharmyopadanam antarenapy upamane 'pi pratipattih syat / / (K.23a, D.71-1) ^(kevalam) kevalam iti prasiddhasdharmyarahitam sabdamtram / / (K.23a, D.71-2) ' 3 ' (tasmd eva) tasmd eveti sabdavat sadharmyopadanam antarenpy upamne 'pi pratipattih syt // (K.23a, D.71-3)
(4

^(asya) upamnasya// (K.23a, D.71-2) ) sabdntara- / / (K.23a, not found in D.)

72

YUKTIDIPIKA

10

15

20

durupapado 1 ' y a m artha iti krtva 2 prasiddhasadharmyam upadatte / tasmad khytur gavayapratipdanrtham upyabhtam sdharmyam updadnasya 3 sabdd anarthntaram udbhavati 4 / athaivamjtiyaknm api pramnntaratvam isyate / tentyalpam 5 idam ucyate catvri pramnniti / kirn tarhi / pnivihrksinikocaprabhrtinm apy upasamkhynam kartavyam 6 / kirn ca vaktrvisesapeksatvt / yatra hy arthavast pratipattir utpadyate na 7 tatra pratipatt vaktrvisesam 8 apeksate drstrtho ' y a m adrstrtho 'yam iti tadyathnumne / asti 9 copamne vaktrvisespeks / tasmn na sabdd arthntaram tat / avasyam caitad evam 10 vijiieyam / yo hi manyate prasiddhasdharmyd eva tasya y 11 pratipattir 12 yathsvas tath gavaya ity etasmd api sampratipattih 13 syn na crhati bhavitum mithyjfinatvt 14 / yat tu khalv idam ucyate yatah samkhysambandhapratipattir iti 15 tad 1 6 upamnam ity etad 17 anupapannam / kasmt 18 / anavasthprasahgt / yath 19 bahusu nisannesu 20 ko 'tra devadatta ity ukte yo mukuti kundall vydhoraskas tmryatksa(cf.MBhsya.I.259.20fF.) iti pratyha tatas ca samkhyasambandhapratipattir iti pramnntaraprasanga 21 ity evam anavasth pramnnm syt / anistam caitat / evam hi 22 na 2 3 tvat parata upamnam pramnntaram / yad svayam eva gm gavayam copalabhya vikalpayati yathyam tathyam iti tad tasyrthasya pramnntarendhigatatvt^ 1 ) pramnam eva tan na bhavatiti / tasmt susthktam(71.1) upamaitihyvacanam 24 ptopadest siddher 25 iti / kirn cnyat / arthpattisambhavbhvacestnm anumnasiddheh /
1 A. durapasado 2 K. and R: krtvt 3 A. updadhnasya 4 A. na sabdd arthntaram bhavati 5 A. tenlpam (this is also possibly the original reading). 6 A. kartavyam syt 7 K., P. and D. omit na. 8 K., P. and D.: prativaktrvisesam D. s.m. pratipattih vaktrvisesam 9 P. omits asti. 10 K., P. andD.: eva 11 A. omits tasya y. 12 A. gavayapratipattir iti 13 A. api tasya sampratipattih 14 D. jnnatvt, s.m. jnnatvam 15 A. omits iti. 16 A. tadvad 17 A. not clear 18 A. omits kasmt. 19 A. tadyath 20 D. nisasyesu^), s.m. nisannesu 21 A. pramnntaratva0 22 D. encircles hi 23 A. omits hi na. 24 P. ay am aithyvacanam 25

A. ptopadesasiddher

(x) (pramanantarena) pratyaksa- / / (K.23b i.n., not found in D.)

DVITIYAM AHNIKAM SK3d,4

73

avacanam ity anuvartate / tatrrthpattir 1 nma yatrrthayoh prvam avyabhicram upalabhya^1) pascd anyatarasya darsanc 2 chravand vnyatarasmin pratipattir bhavati / darsand yath 3 gudam upalabhya mdhuryam indriyntaravisayam pratipadyate / sravand yath gudasabdam srutv mdhuryam asabdakam^2) pratipadyata^ 3 ) iti / apar khalv arthpattih / yatra dharmayor avyabhicram upalabhya tatpratidvandvinor api shacaryakalpan / s tu dvividh vyabhicrinl cvyabhicrinl ca 4 / tatra vyabhicrinT yath svayavam anityam ity ukte 'rthd pannam 5 niravayavam6 nityam iti / tac ca karmdisv adrstam 7 ity esnaikntikatvt pramnam eva na bhavatiti / y tv avinbhviny avyabhicrinl8 yath kesarivarhayor upahvare 9 sanniptam upalabhyottaraklam kevalam kesarinam 10 varhavrannkitasanram prayntam upalabhya 11 pratipadyate jito^4) varha iti tad anumnam / katham / yasmt kesarivarhayor12 yau jayaparjayau tayor avyabhicr! 13 sambandhah / tatra yad kesarino jayam upalabhyvyabhicrinam itarasya 14 parjayam pratipadyate kirn any at syd rte 'numnt / adhigatobhayasambandhisamudyasya hi pratipattuh pratyakslbhtnyatarasambandhino 15 y sambandhyantarapratipattis tad anumnam / ittham crthpattir ato na tasmt prthag 16 bhavitum arhati 1 7 / sambhavo nma / dronah 18 prastha ity ukte 'rdhadrondinm sannidhnam avasiyate / iyam 19 api shacaryakalpanayrthpattir eva / katham / yasmd
1 A. tatrrthpatti 2 D. anyatarasyopalambhant, s.m. anyatarasya darsant 3 A. tadyath 4 A. omits ca. 5 D. pannam, s.m. patitam 6 A. niravayamvam 7 A. karmdistadrstam 8 A. omits avyabhicrinT. 9 A. kesaravarhayor upagahvare 10 P. kesarivarhayor upahvare instead of kesarinam 11 A. pratiyntam upalabhyamnah 12 A. kaisarivarhayor 13 A. avyabhicre 14 K., P. and D.: uttarasya 15 A. pratyakse bht0 16 A. omits prthag. 17 18 A. 19

10

15

20

A. arhati bhavitum omits dronah prastha ity ukte 'rdha-. A. ity ayam

(^(upalabhya) caksusa / / (K.23b, not found in D.) (2) (asabdakam) madhurasabdarahitam // (K.23b i.n., not found in D.) (3) (pratipadyata) gudasya mdhuryenvyabhicrt / kevalagudasabdasravanenpi mdhuryam pratipadyate// (K.23b, D.74-1*) *D. reads kevalaguda0... pratipadyate before gudasya mdhuryenvyabhicrt. <4)(jito) simheneti / / (K.23b, D.75-1)

74

YUKTIDIPIKA

10

15

20

uktaparimane dravye dronasabdo vartate 1 na nyune nadhike 2 / tatra drona ity ukte yad atyantasahabhuvm tadavayavnm anyasabdavcynm 3 api sannidhnam tad arthpattir iti 4 / s 5 cnumnam ity uktam 6 / abhvo nma / tadyath dhmasya bhvd agnibhvah 7 pratiyate evam dhmbhvd agnyabhva ity ayam 8 pratidvandvishacaryakalpanayrthpattir 9 abhihitah / tatra yad vyabhicrashacaryakalpan tad pramnbhva eva tadyath [hy]10 ayogudngrdisu 11 dhmbhvo ngnyabhvah / yatra tu kvacid ekntah 12 syd yathkrtakatvn nitya iti tatrnumnam / katham / shacaryopapatteh 13 krtakatvnityatvavat 14 / anye tv abhvam anyath varnayanti tadyath gehe nsti caitra ity ukte bahir astlti sampratyayo bhavati / tatra gehbhvo bahirbhvasampratipattihetur arthpattir 15 eva pratidvandvishacaryakalpanay / katham / yathaiva hi div na bhunkte devadatta ity 16 atrbhojanapratiyogino 17 meduratvasyopalambhd divpratiyogini kle bhujir 18 avaslyata evam ihpi gehbhvbhidhnasmarthyt tatpratiyogini viparyayah kalpyate / anyath tu yady abhva evbhipretah syn nsti caitra eveti bryt / arthpattis cnumnam / cest nrnbhipryascakah kascid evodaratdannjalikarandih 19 sariravyprah / sa hi bubhuksdiny apratlyamnny api 20 pratipdayatlti 21 pramnam ity 22 ucyate / sa cnumnam eva / kasmt 23 / yasmd bhojanecchdisahacaro 24 hi vypro 'nusthlyamno yadi sahacrinam gamayati 25 tad 2 6 nnumnt prthag iti sakyam pratijfitum / ha: pratibh tarhi pramnntaram bhavisyati / ucyate: key am pratibh nma /
1 A. 'nuvartate 2 A. nyndhike 3 A. asabdavcynm 4 A. eva 5 A. sa 6 A. and Dkha.: uktaprakram 7 K., P. and D.: agner bhvah 8 A. aya 9

Dkha. kalpan arthpattir A. omits -k alp an ay arthpattir abhihitah / tatra yad vyabhicrashacarya-. 10 D. encircles hy. 11 A. ayogudnkrdisu 12 A. aikntas 13 A. shacarypapatteh 14 A. krtakatvn nityatvavat 15 A. ity ayam apy arthntarpattir ***A. devadattah pina ity 17 K., P. and D.: atra bhojanapratiyogino 18 A. kle rtrau bhujir 19 A. evodaratnunnjalikarandih Dkha. karandibhir 20 K., P. and D.: api pratiyamnni 21 A. omits pratipdayatiti. 22 A. omits ity. 23 A. katham (this is also possibly the original reading). 24 A. omits di of bhojanecchdisahacaro. 25 A. 'nusthiyamno bhavati sahacrinam ca yadi gamayati 26 A. katham tad

DVITIYAM AHNIKAM SK3d,4

75

ha: yo ' y a m andau samsre devamanusyatirascm 1 abhinne 'rthe bhye strydau pratyaye prvbhysavsanpeksah kunapakminibhaksydykrabhedabhinnapratyaya itikartavyatngam utpadyate s hi pratibh / tath coktam yathbhysam hi vkyebhyo vinpy arthena jyate / svapratyaynukrena pratipattir anekadh / / (PS.5.47; PSV.:Peking.Ce.82b6,168b3; Derge.Ce.77a5) yena hi yo 'rtho 'bhyastah sukhditvena tasya vinpi tenrthena sabdamtrt pratipattir utpadyate / tadyath vyghro 'tra prativasatity ukte vinpi bhyenrthenbhysavasd eva svedavepathuprabhrtayo bhavanti / tasmt pratibhaiva devamanusyatirascm 2 itikartavyatngatvt pramnam iti / ha ca 3 pramnatvena tm 4 lokah sarvah samanugacchati / vyavahrh pravartante tirascm api tadvast / / (cf.VP.II.147) ucyate: pratibhy drstdivyatirekena rpntarnupapatteh / avacanam ity anuvartate / yadi prvbhysavsanpeksah pratyayah pratibhety 5 upagamyate 6 tena tarhy asau pratyaksam anumnam ptavacanam 7 <v>ety8 et ad pannam / kasmt / yato na hi drstdivyatirekena 9 pratyayarpam kadcid apy 10 upalabhmahe / tasmn na 11 tebhyo 'rthntaram pratibh / rsapratyayasambhavd ayuktam iti cet / syd etat 1 2 / asty rso 13 hi 14 drstdivyatirekena sarvapadrthesu smsiddhikah pratyayah sa prtibho 15 bhavisyatiti / etac cpy ayuktam / kasmt / uktatvt / uktam(68.12) etat siddharpam bhagavatah paramarser jnnam / ato na pramnpeksam iti 1 6 / yoginm iti cen na anabhyupagamt / na hi yoginm apramnaprvakam jnnam iti yath tath vaksymah / sa laukika iti cen na aniscitatvt 1 7 / syd etat / asti laukikah pratyayo drstdivyatirekena 18 / tadyath santamase vrajato drg iti vijnnam 19 utpadyate ?sti me pratighti 20 dravyam purastd
1 K., P. and D. omit0 devamanusyatirascm ... bhavanti / tasmt pratibhaiva(75.1-11). 2 A. davamanusya 3 K., P. and D. omit ca. 4 A. tml 5 D. pratibhocyate, s.m. pratibhety 6 K., P., and D.: abhyupagamyate 7 D. pratyaksam ptavacanam anumnam, s.m. pratyaksam anumnam ptavacanam 8 All the Mss read cety. 9 A. and Dkha.: vyatiriktam 10 A. omits apy. n D. ne(?), s.m. te 12 A. syn matam 13 K., P. and D.: rse 14 K., P. and D. omit hi. 15

10

15

20

25

A. pratibh A. pramnpeksni bhavanti 17 A. niscitatvt 18 A. drstdivyatirekena tu 19 D. jnnam, s.m. vijnnam Dkha. pratightd

76

YUKTIDIPIKA

10

urdhvam avasthitam iti / tac ca naivam / kasmat / aniscitatvat / na hi tatra niscaya utpadyate idam tad dravyam asti purato v vyaktam astiti / na cniscitam pramnajnnam isyate / kirn cnyat / anavasthprasangt / yadi caivamjtlyako 'pi pratyayah pramnam 1 abhyupagamyate tennavasth prpnoti / kirn kranam / anavasthnd 2 dhi 3 vikrasya 4 <kmakrodhalobhabhayavisddidvrako>5 vikalpah samyan mithy v yasmd aneka utpadyate tasmn na laukikah pratyayah pratibh / yat tu khalv idam ucyate(75.8) arthbhysavsanpekssatsv 6 api vyghrdisu pratipattir utpadyata iti / satyam etat / s tu mithyjfinatvt pramnatvena na parigrhyata ity ayam adosah / tasmt siddham drstdivyatirekena 7 rpntarnupapatteh pratibhyh prthaganabhidhnam 8 / tatas ca "sarvapramnasiddhatvt trividham pramnam istam"(SK4b'c) iti 9 sthitam etat INI' ha: astv evam etat / laksanna<vasthnt> 10 tadapratipattih tasmt t a dab hid lin am / anavasthitam hi drstdlnm laksanam 11 drstivaicitryt 1 2 / "indriyrthasannikarsotpannam jiinam avyapadesyam avyabhicri vyavasytmakam pratyaksam"(NS.1.1.4) iti kecit / tath "tmendriyamano'rthasannikarsd yan nispadyate tad anyat 13 "(VS.3.1.13) ity eke / u satsamprayoge 14 purusasyendriynm buddhijanma tat 1 5 pratyaksam"(MS.1.1.4) ity apare / a srotrdivrttih"(cf.5.11) iti vrsaganh / "kalpanpodham" (cf.PS.1.3) ity anye / ittham anavasthitam laksanam iti drstdTnm apratipattih / tasml laksanam abhidhmyam / ucyate: PRATIVISAYDHYAVASYO DRSTAM / (SK5ab') visinvantiti 16 visayh sabddayah 17 / athav visiyanta upalabhyanta ity arthah / te ca dvividhh / visist avisists ca / visisth 18 prthivydilaksan asmaddi1 D. 'pi pramanam, s.m. 'pi pratyayah pramnam 2 A. anavasthitatvd 3 A. omits dhi. 4 K., P. and D.: karanasya 5 K., P. and D. omit -di-, A. omits -lobha-, 6

15

20

25

A. abhysavsanpekssatsv D. vsanpeks satsv A. drstvyatirekena 8 A. prthagabhidhnam 9 A. iti cestam 10 All the Mss read laksannabhidhnt. 11 A. omits laksanam. 12 A. drstavaicitryt 13 A. adhyaksam 14 A. tatsamyoge 15 A. tah 16 D. prativisunvanti iti, s.m. visinvanti iti 17 A. omits sabddayah / athav visiyanta. 18 A. visists ca

DVITIYAM AHNIKAM SK5

77

gamyh / avisists ca tanmtralaksan yoginm rdhvasrotasm 1 ca gamyh / vaksyati caitad uparistt buddhlndriyni tesm pafica visesvisesavisayni2/ (SK34ab) "adhyavasyo buddhih" (SK23a) iti ca vaksyati / visayam visayam prati vartata iti prativisayam / kirn tat / indriyam / tasmin yo 'dhyavasyah sa prativisaydhyavasyah / upttavisaynm indriynm vrttyupanipti sattvodrekd 3 arajastamasam 4 yat praksarpam [yad5 drstam iti yvat] tad drstam / pratyaksam ity arthah / etat 6 pramnam / anena yas cetansakter 7 anugrahas tat phalam / prameyh sabddayah / evam uttaratrpi pramnaphalabhvo drastavyah / ha: kirn punar idam pramnt phalam arthntaram hosvid anarthntaram / <ucyate(?):> <ka>tham tvad 8 bhavitum arhati / anarthntaram ity ha / kasmt / adhigamarpatvt / adhigamarpam hi jiinam, tasyotpattyaivdhigato 'rtha iti kutah phalabheda iti / ucyate: karanabhva 9 idnim katharn syt / ha: 10 karanabhvas 11 tu prasiddhivast 12 / visayanirbhs^1) hi jfinasyotpattih / adhigamarppi 13 loke savypreva <pratltir iti(?)> 14 kalpanay karanabhvo 15 'bhyupagamyate na paramrthatah / ^2) phalasyrthntarabhvah 16 adhikaranabhedt / bud1 2

10

15

20

A. rdhvaretasm P. pancavisesh visesavisayni Dkha. buddhindriyni panca ca kati varnh santo visesvisayni (this reading of Dkha. is deleted with a wavy line across the word). 3 A. sattvotsedhd P. not clear. 4 K., P. and D.: arajastamaskam 5 A. tad 6 A. tat 7 P. cetansaktair 8 A. kakathams(l) tvad K., P. and D. omit <ka>tham tvad ... kutah phalabheda iti(77.1315). We follow Pandeya. 9 K., P. and D.: karanabhva 10 K. and P. omit ha. D. adds ha in the right margin. 11 K., P. and D.: karanabhvas 12 D. prasiddhivast, s.m. prasiddhavadht 13 A. adhigamarup hi 14 K., P. and D.: pratiteti A. pratiti 15 D. karanabhvo, s.m. karanabhvo 16 K., P. and D.: ntarbhvah

(x) (visesanirbhasa) visayakarataiva pramanatvam / karanatvam vastutah phalasvabhavety arthah / / (K.25b, D.80-1) ^ (ucyate) ayam sayah / visaykram v yad idam jnnam bhavadbhir ucyate tat sukhaduhkhamohabhedena vartata <ity asmkam(?)>* tvat siddhntah / atas ca sukhdisvabhvatvd yogyatvena jadatvam, tatra pramnarpatayvasthite viruddham cidrpatvam iti tadvyatiriktam cetannugrahah phalam itikatham pramnaphalayor abhedah syt / / (K.25b, D.81-1) *K. and D.: iti bhavatm

78

YUKTIDIPIKA

dhyasrayam hi pramnam adhyavasayakhyam1 purusasrayam 2 phalam anugrahalaksanam / na ca bhinndhikaranayor ekatvam arhati bhavitum / yat tktam (77.14) adhigamarpatvj jnnam eva phalam iti tad anupapannam / kasmt / asiddhatvt / yathaiva hi ghatdayo 'rth jnnam 3 antarena na tadrp ntadrp 4 iti na 5 sakyam pratipattum evam jnnam api purusapratyayam 6 antarena na visayarpam nvisayarpam / tath ca sstram tasmt 7 tatsamyogd 8 acetanam cetanvad 9 iva Ungarn / (SK20ab) iti vaksyati 10 / atah purusapratyayam 11 antarena jnnam adhigamarpam iti smkhyam praty asiddham 12 et at / ubhayapaksaprasiddhena ca vyavahrah / purusbhvd ayuktam iti cen na uttaratra pratipdant / "sanghtaparrthatvt"(SK17a) ity atra purusstitvam pratipdayisymah / tasmt siddham adhyavasyapramnavdinah 13 pramnt phalam arthntaram iti / ha: yadi tarhy 14 adhyavasyah pramnam katham laukikah prayogo 'rthavn bhavati pratyaksam vastv 15 iti / ucyate: visaye pratyaksasabdah tatpramitatvt tatkranatvc ca 1 6 / yath prasthapramito vrihirsih prasthasabdavcyo bhavati / evam pratyaksapramito 'rthah pratyaksasabdavcyah 17 syt / ha: n a 1 8 anyatrpi tatprasangt / yadi pratyaksapramitatvd visaye pratyaksasabdas tena tarhy anumnapramito 'rtho 19 'numnamiti syt / sabdapramito 'rthah sabda iti / na cgnisvargdayah20 pramnasabdavcy bhavanti / tasmd visamam etat / etena tatkranabhvah pratyuktah / yo 'pi hi manyate pratyaksopadesas 21 tatkranesv apratisedhya iti visaye22 pratyaksasabdas tasypy anumnaprasango ?sv avasthita iti 2 3 / ucyate 24 : kranatulyatvt 2 5 tu sabdatulyatvam 2 6 / evam tarhy
1 A. adhyavasyasdhyam 2 Dkha. purusasrayam hi 3 A. ghatdyarthajnnarn 4 D. na tadrp ntadrp, s.m. tadrpena tadrp 5 A. omits na. 6 A. purusasya pratyayam 7 K., P. and D. omit tasmt. 8 A. taratsamyogd(l) 9 A. cetand 10 A. vacant 11 Dkha. purusasya pratyayam 12 A. sdhyapratyaksasiddham Dkha. {smkhyam) prati siddham 13 K., P. and D.: 'vcinah A. adhyavasyah pramnavdinah We follow 14 K., P. andD.: hy 15 A. idam vastu 16 K., P. and D. omit tatkranatvc ca. 17 D. pratyaksavcyah, s.m. pratyaksasabdavcyah 18 A. omits na. 19 A. 'tha 'rtho 20 A. cgnisvargdayo 'rthah 21 22 A. 23

10

15

20

Pandeya.

A. pratyaksavyapadesas ato visaye A. anumnaprasango (')s eveti 24 A. omits ucyate. 25 K., P. and D.: kranatulyatvam D. s.m. kranatulyatvt 26 K., P. and D. omit tu sabdatulyatvam.

DVITIYAM AHNIKAM SK5

79

aksam aksam prati vartata iti pratyaksam ucyate / dvayam cksam prati vartate visayo 'dhyavasyas ca / visayo 'nugrhakatvennugrhyatvenetarah 1 / tenobhayor api tulyam nimittam iti krtv tulyasabdavcyat bhavisyati / ha: itaratra katham / ucyate: tadabhvd itaratrpravrttih / pramnntare tu nsti smnyam nimittam / katham / anumiyate 'nenety anumnam / na cgnydibhih 2 kascid anumiyata ity atas tulyasabdavcyat na bhavati / ha: adhyavasyagrahanam kimartham / ucyate: atiprasanganivrttyartham / prativisayam drstam itiyaty ucyamne yvat kimcit prativisayam 3 vartate 'nugrhakatvenopaghtakatvena v tat sarvam drstam ity etad padyate / adhyavasyagrahane punah kriyamne na doso bhavati 4 / ha: na 5 pramndhikrt / ndhyavasyasabdasya pray oj an am / kutah / pramndhikro ? y a m / n a cdhyavasyd rte yat kimcid visayam prati vartate 6 tena kimcit 7 pramiyate 8 / tena 9 vayam smarthyd adhyavasyam evbhisambhantsymah 10 / tadyathdhyayandhikre brhman nlyantm ity ukte ya evdhiyante ta evniyante 11 / ucyate: karanntarnm 12 t u sandehanivrttyartham / evam tarhi srotrdinm 13 anyatamam antahkaranam cety etad 14 dvradvribhvena catustayam visayam prati vartate / tasmd adhyavasyagrahanam kriyate sandeho m bhd iti / ha: astv atra sandehah / naikena kenacit kascid15 visaya 16 updiyate 1 7 / 18 tena vayam sarvesm pratyaksatvam pratipatsymahe / ucyate: sarvbhyupagame hi s s t r a h n i h 1 9 / yadi punah sarvesm eva pramnatvam abhyupagamyate tena yac chstram "ekam eva darsanam khytir eva darsanam" (cf.YBh. on YS. 1.4) iti tad dhiyate / vaksyati ccryah 20 a ete pradipakalph"(SK36a), sarvam praty upabhogarn yasmt purusasya sdhayati buddhih / (SK37ab)
1 A. 2 D. 3 A. 4 A. 5

10

15

20

25

anugrhyakatvene0 cjndibhih visayam prati bhati K., P. and D. omit na. ^A. visayam pratipadyate 7 D. kimcit, s.m. kimcit ca 8 P. pratiyate A.te 10 D.: evbhisambhatsymah A. cbhisamdhsymah 1 A. tesm evnyayanam bhavati na brhmanam namya instead of ya evdhiyante ta evniyante 12 A. karanntare Dkha. karanntaram 13 D. strdinm 14 A. caitad 15 A. and Dkha.: na kascid instead of naikena kenacit kascid 16 A. visesa 17 A. updhiyate 18 A. and Dkha.: te 19 K., P. and D.: sstrahnih pramnam A. cyam cryah

80

YUKTIDIPIKA

10

15

20

iti tad virudhyate / tasmad adhyavasayagrahanam kartavyam sandeho ma bhud iti / ha: "sandehamtram 1 etad bhavati / sarvasandehesu cedam 2 upatisthate" (MBhsya.L42.11ff., I.119.23fF. et passim) "vykhynato visesapratipattir na 3 hi sandehd alaksanam"(MBhsya.I.6.26 et passim) iti 4 / tatrdhyavasyo drstam iti vykhysymah 5 / ucyate 6 : muktasamsayam cendriyavrttipratipattih 7 / syd etad yady atra sandehah syt / naiva tv atra 8 sandehah prptah 9 / kim tarhi / srotrdivrtter eva grahanam / ha: kim punah kranam 10 srotrdivrtter 11 evtra 12 grahanam prpnoti nntahkaranasyaiva pratyaksatvam / ucyate: tatra ca 13 mukhy srotrdivrttih / kasmt / sksd 14 visayagrahanasmarthyt / nntahkaranam taddvrena pratipatteh / gaunamukhyayos ca 15 mukhye sampratipattih 16 / tadyath "gaur anubandhyo 'jo 'gnlsomiya iti 1 7 na bhlko 'nubadhyate18"(cf.MBhsya.I.71.18ff. et passim) / ha: yadiyam 19 srotrdivrttir eva20 pratyaksam ity 21 abhyupeyate 22 ka evam sati dosah syt 2 3 / ucyate: rgdivisayam 24 yad vijiinamlingalingiprvakam 25 yoginm 26 ca dhynabhmiksu 27 viharatm prtibham 28 yad vijnnam utpadyate tad 2 9 upasamkhyeyam 30 syt / na 31 hi sukhdayah srotrdivrttigrhyh yoginm ctlnd1 A. na sandehamtram 2 K., P. and D.: caitad 3 A. omits na hy sandehd alaksanam. 4 K., P. and D. omit iti. 5 A. evam vykhymah 6 A. omits ucyate. 7 K., P. and D.: pratipatteh 8 A. naiva v punar atra 9 A. prpnoti 10 A. karanarn 11 A. yena nimittvisese 'pi srotrdivrtter (this is also possibly the original reading). 12 A. eva 13 A. tatrpi 14 A. paksd 15 A. omits ca. 16 Dkha. sampratyayah 17 A. anbandhyeti D. anbandhy, ajo 'gni, s.m. anbandhyah, ajo 'gni 18 K., P. and D.: bhiko nnubadhyeta 19 A. yadi punar iyam 20 A. eva hi 21 A. omits iti. 22 A. abhyupagamyate 23 A. omits0 syt. (this is0 also possibly the original reading). 24 D. rg , s.m. sukh D. reads ptha above the corrected sukh in the right margin. 25 A. Ungarn / lingiprvakam 26 A. tath yoginm 27 A. bhmisu (this is also possibly the original reading). 28 A. inserts anumngamtitam before prtibham. 29 A. tatra 30 A. pramnntaratvam upasarnkhytam 31

K., P. andD.: kuto na

DVITIYAM AHNIKAM SK5

81

riyam jnnam iti / yathnysam tu kriyamne te 'pi visayh / tesm 1 yo 'dhyavasyas tasya pratyaksatvam kena vryate / ha: prativisayagrahanam tarhi 2 kimartham / ucyate: prativisayagrahanam asadvyudsrtham / adhyavasyo drstam itiyaty 3 ucyamne mrgatrsnikltacakragandharvanagardisu yo 4 'dhyavasyas tad drstam iti syt / prativisayagrahant tu 5 tesm vyudsah krto bhavati / ha 6 : yady evam visaydhyavasya7 ity evocyatm 8 / kirn pratigrahanena / ucyate: pratigrahanam sannikarsrtham / visaydhyavasyo drstam itiyaty ucyamne visayamtre sampratyayah syt / pratigra<hane> punah kriyamne pratir bhimukhye vartate 9 (see NM.partl.p.100.17) / tena sannikrstendriyavrttyupanipti yo 'dhyavasyas tad drstam ity etal labhyate 10 / ha: kasya punar atlndriyasannikarse 11 pratyaksatvam prpnoti 1 2 / ucyate 13 : anumnasya / kasmt / tad dhi lingadarsand asannikrste visa14 ye bhavati / ha: anumnasyprasangah smnyavihitasya visesavihitena bdhant (cf.MBhsya.I.383.24fF. et passim) / smny<e>15 hi 16 visayamtre 17 'dhyavasyasya pratyaksatvam vidhya visese18 lingalirigiprvake 'numnam ssti / smnyavihitam ca 19 visesavihitena bdhyate (cf.MBhsya.I.383.25f. et passim) yath "dadhi brhmanebhyo 20 diyatm takram kaundinyya" (cf.MBhsya. 1.115.2-3 et passim) iti 2 1 / ucyate: smrtes tarhi pratyaksatvam prpnoti 22 / tatryam 2 3 apavdo nbhinivisata iti / <ha:> na smrteh pramndhikrt / pramndhikro 'yarn / na ca smrty kimcit pramiyate smrteh pramite 'rthe prdurbhvt 24 /
1 A. tesu 2 A. omits tarhi. 3 A. ity 4 A. disv apt yo 5 A. omits tu. 6 K., P. and D. omit ha. 7 A. omits visaydhyavasya 8

10

15

20

25

pratigrahanam sannikarsrtham(81.7-9). P. eva cocyatm 9 K., P. and D.: pratin tv bhimukhyam dyotyate instead0 of pratigra<hane> punah kriyamne pratir bhimukhye vartate A. pratigrahe punah kriya We follow Pandeya. 10 K., P. and D.: ity upalabhyate A. ity etal labya bhavati Dkha. (ity) etal labhyate 11 A. punah kasya asatmdriyasannikarse 12 A. pratyaksatvam jfiatvam prpnoti 13 A. inserts yadartho yatnah kriyata iti before ucyate. 14 A. 'gnydau 15 K., P. and D.: smnyam A. syamnye We follow Pandeya. 16 K., P. and D. omit hi. 17 A. visesamtre 18 A. viseso 19 A. omits ca. 20 A. tadyath brhmanebhyo dadhi 21 D. omits iti. 22 A. omits prpnoti ,.. astu tarhindriynm prati-(81.22-82.20). 23 Dkha. yatryam 24 D. smrteh pramityarthe prdurbhvt, s.m. smrtipramite 'rthaprdhurbhvt

82

YUKTIDIPIKA

10

15

20

25

ucyate: samsayasya tarhi prapnoti / <ha:> na samsayasya adhyavasyagrahant 1 / adhyavasyo hi drs2 tam ity ucyate / na ca samsayo 'dhyavasyo 'niscitatvt / ucyate: indriyntarktavisaye tu prasangah 3 / evam tarhmdriyrthasannikrstendriyavrttyupaniptiti doso na bhavati 4 / ha: rgdyupasamkhynam / yadi sannikrstendriyavrttyupanipti yo 'dhyavasyas tad drstam ity abhyupeyate tena rgdivisayam vijnnam atmdriyatvt pratyaksam na prpnoti / tasyopasamkhynam kartavyam 5 / ucyate: na 6 tarhidam pratigrahanam indriyavisesanam visayam visayam prati yo vartate tasmin yo 'dhyavasyas tad drstam iti / kirn tarhi / adhyavasyavisesanam visayam visayam prati yo 'dhyavasya iti / ha: adhyavasyavisesanam iti cet sabd^y upasamkhynam / sabddlnm eva tena pratyaksatvam na 7 prpnoti / tesm upasamkhynam kartavyam prpnoti / kirn kranam / antahkaranasya taih sannikarsnupapat t e h / pratigrahanam sannikarsrtham iti prvam atisrstam(81.9) bhavat / tac cednim antahkaranavisesanam / na cntahkaranasya sabddibhih sannikarsa upapadyate srotrdivaiyarthyaprasarigd 8 dvridvrabhvasypaghtaprasangc ca / tasmt sudram api gatv pratigrahanam pratykhynn na mucyate rgdyupasamkhynd veti / ucyate: astu tarhindriynm prativisayagrahanam visesanam / yat tktam(82.6) rgdlnm upasamkhynam kartavyam iti tatra 9 brmah: ekasesanirdest 10 (cf .MBhsya.I.88.25 et passim) siddham / evam tarhi prativisaydhyavasyas ca prativisaydhyavasyas ca 11 prativisaydhyavasya iti sarpnm ekasesah(cf.Pn.l.2.64) karisyate / tatraikena bahirarigasyendriyasya parigrahah 1 2 / dvitlyenntarangasya 13 prtibhasyeti 14 rgdivisayam yoginm ca yad vijnnam tat sangrhitam 15 bhavatlti vykhytam pratyaksam / ha: anumnam idnim vaktavyam 16 / ucyate: TRIVIDHAM ANUMNAM KHYTAM17 / (SK5b')
1 Dkha. samsaye 'dhyavasaya? 2 D. drsyam, s.m. drstam 3

Dkha. akute tu visayaprasangah D. akut avis aye tu prasangah, s.m. kte tu visayaprasangah 4 D. doso na bhavati, s.m. ndoso bhavati 5 D. adds prpnoti after kartavyam in the right margin. 6 Dkha. nanu 7 K., P. and D. omit na.0 8 D. strdivaiyarthya , s.m. srotrdivaiyarthya0 9 A. ity atra 10 A. ekadesanirdest 11 A. omits prativisaydhyavasyas ca. D. adds this phrase in the top margin. 12 A. bahirangasya indriyakasya pratyaksasya parigrahah Dkha. ekenendriyasya bahirang parigrahah 13 A. dvitiyantarangasya 14 D. repeats pratibhasya and deletes the second pratibhasya. 15 A. and Dkha.: tat sarvam sangrhitam (this is also possibly the original reading). 16 A. vaktavyam iti 17 A. anumkhytam instead of anumnam khytam

DVITIYAM AHNIKAM SK5

83

anumnam triprakram cryair khytam1 / prvavac chesavat smnyatodrstam^1) ca 2 / tatra prvam iti kranam ucyate 3 / yasya hi yat kranam sa loke tatprvaka 4 ity ucyate yath 5 tantuprvakah pato devadattaprvako 6 yajnadatta iti / prvam asystlti prvavat / sesa iti vikranma / sisyata iti krtv / tath coktam 7 "na seso <'gne>8 'nyajtam 9 <asti"(RV.7.4.7c; cf.Nir.3.2) iti> 10 / npatyam anyena jtam 1 1 sambhavatity arthah / seso 'systlti sesavat / tatra prvavad yad kranam 12 abhyuditam drstv bhavisyattvam kryasya pratipadyate yath meghodaye bhavitavya<t>13 vrsteh / ha: naitad asty udharanam anekntt 1 4 / na hi meghodayo 'vasyam vrsteh kranam bhavati 15 vyvdinimittapratibandhasambhavt 16 / ucyate: yadi 17 tarhi kranasaktim sahakrisaktyantarnugrhltm apratiyoginim drstv kryasya vyaktim 18 pratipadyate 19 tadyath 20 yad <cakrodaka2 A. v 3 A. kranaparyyo 'yam instead of kranam ucyate 4 A. yasya hi loke yat kranam sa tatprvaka instead of yasya 5 A. tadyath 6 A. devadattakaprvako 7 K., P. and D. omit tatha coktam. 8 K., P. and D.: 'gre A. 'gneh 9 A. 'nyasya jtam 10 K., P., D. and A.: ity asti Dkha. asti n Dkha. omits jtam. 12 K., P. and D.: kranatvam 13 14 A. anaikntt 15 A. na hi meghodayam vrster avasyam 16 A. vyvdinimittapratibandht 17 K., P. and D.: yad 18 P. vyaktih 19 20

10

*K., P. and D.: vykhytam

hi yat kranam sa loke tatprvaka

K. P. and D.: bhavitavyam A. tadyath meghodayam drstv bhavisyattvam for yath meghodaye bhavitavya<t> We follow Chakravarti. kranam bhavati

A. pratipadyante K., P. and D. omit tadyath ... kranasadbhvam pratipadyate (83.1284.3).

(^(prvavac chesavat samanyatodrstam) kecit tu purvavad iti kevalanvayy anumnam, sesavad iti kevalavyatireki, smnyatodistam ity anvayavyatireklti / katham / prvasabdennvaya upadisyate prgadhyavasiyamnatvt / na hi yvan ngnibhve dhmabhvo 'dhyavaslyate tvad agnyabhve dhmabhvo drsto 'py <adhy>avastum1 sakyate vidhyadhyavasyaprvakatvt / nisedhdhyavasyasya prvam eva vidyate 'nvaya evsti yasynumnasya tat prvavat / seso vyatirekah / sa eva yasysti tac chesavat / bdhakopakrtasya kevalavyatirekasya gamakatvam na vyatirekamtrasyeti pradarsanrtham sesavad ity uktam na vyatirekavad iti / anvayavyatirekayoh sdhanhgayoh smnyena yad anumnam 2 drstam tatsmnyatodistam / etad uktam bhavati: yathnvayenaitad anumnam up<a>krtam tath vyatirekenpy anvayavyatirek<i>vad3 itarayor api gamakatvam astlti nyyabhsane / gkyh khalu kevalnvayinah kevalavyatirekinas ca gamakatvam nstlty huh / (see NBhs.p.190.16-26) apare tu prvavaddipadni laksanrthatvena varnayanti kila / prvam updnt paksah prvasabdenocyate / so <*stv eva>4 yasya tat prvavat paksavypakam Ungarn ucyate / sesa iti sapaksa uktt paksc chisyamnatvd atah sesavad iti / sapaksavad iti uktam bhavati / smnyatodistam iti vipaksa ity adhyhryam / smnyen<>drstam5 vipaksasabdbhidheye sarvatrdrstam ity arthah //(K.28a, D.88-1) (see NBhs.p.191.21-26) 1 K. and D.: avastum 2 K. and D.: upkrtam 3 K. and D.: anvayavyatirekavad 4 K. and D.: fsya 'vayavasya 5 K. and D.: smnyena drstam

84

YUKTIDIPIKA

10

15

20

dandadisadhanasampannena) 1 vyaparavata kumbhakarenadhisthitam mrdam upalabhya ghatasya tad prvavat / sesavat yad kryani<r>vrttim2 drstv kranasadbhvam pratipadyate tadyath kumrakam drstv dvayasampattim / ha: naitad apy 3 asty udharanam anekntt 4 / na hi dvayasampattiprvaka eva prnabhrtm 5 prdurbhvo drondinm 6 anyathotpattivisesasravant / ucyate: yad tarhi prabhnuranjitam antariksam drstv candrrkayor udayam pratipadyate tad sesavat / ha: 7 etad 8 api nsty udharanam anekntt 9 / na hi prabhnurgo 'ntarikse 10 candrrkanimitta eva bhavati / kirn tarhi / digdhdinimitto 11 'pi / ucyate: yad tarhi 12 nadipram drstv 13 vrstim pratipadyate 14 tad sesavat / ha: 15 etad api nsty udharanam anekntt 1 6 / nadiprasya hi nimittam anekavidham bhavatiti 17 himavilayanasetubhangagajakriddi / tasmd ayuktam etat / ucyate: yad tarhi parnam drstv slkam pratipadyate 'rikuram v drstv bijam iti tad sesavat / athav punar astu prv<am>18 evodharanam / yat tktam(83.9) anekntd 19 ity atra brmah: vltvltasmarthyt / vitvitbhym hetubhtbhym abhipretrthasiddhir iti vaksymah / prasahgidharmntaranivrttirnukhena cvitaprayogah 20 / tatra yad prasanginm himavilayandinm 21 desaklalingaih pratisedhah kriyate tad muktasarnsayarn pratipattir 22 bhavati / desatas tvat tadyath 2 3 daksinpathe nsti himavilayanasambhavah 24 / klato yath 25 prvrtkle 26 / lingato Jpi yasmn mudga1 A. candlaudidanddisdhanasampannena 2 A. kryanivrttim. We follow Pandeya. 3 A. omits apy. 4 A. anaikntt 5 A. p ram an ab hr tarn 6 A. drondinm hy 7 KM P. and D. omit ha. 8 9 A. anaikntt 10 A. 'tariksasya 11 A. tarhy utptdinimitto (this is also possibly 12 K., P. andD.: tu 13 A. navapravrddhajalm nadirn drstv 14 A. bhtatvam varsasya pratipadyate 15 K., P. and D. omit ha. 16 A. anaikntt 17 D. bhavati, s.m. bhavatiti 18 All the Mss read prvakam. 19 A. anaikntt 20 A. prasangah 21 A. himavilaydinm 22 A. muktasamsayapratipattir 23 P. yath 24 A. himasambhavah 25 A. omits klato yath. 26

D. etad, s.m. tat

the original reading).

A. prvrtkle ca

DVITIYAM AHNIKAM SK5

85

gavedhukasymkaksthatrnamtrasakrtprabhrtinm 1 anupalambhas 2 tathosmakalusatvdinm 3 upalambhah / tasmt parisesato meghy 4 evpa iti / tasmn nnekntah 5 / evam krtv prvny apy 6 udharanny upapannni bhavanti desdivicrasmarthyt 7 / smnyatodrstam nma 8 yatraikadrthay<o>r9 avyabhicram upalabhya desntare klntare ca tajjtiyayor avyabhicram pratipadyate tadyath kvacid dhmgnisambandham drstv kvacid dhmntarengnyantarasystitvam pratipadyate / ha: naitad asty udharanam avisesaprasangt / sarvatraiva hy 10 anumne kvacid arthayor avyabhicram 11 upalabhynyatra tajjtiyayor arthayor avyabhicram pratipadyate tadyath kvacit sdhanavato 12 mrtpindd ghatanispattim upalabhynyatra sdhanavatah pindntard ghatntaranispattim pratipadyate / tathaikatra 13 nadiprd vrstim upalabhynyatra nadiprd 14 vrstyantaram avaslyate / tath ca sati traynm avisesaprasangah / ucyate: yad tarhi 15 sahabhuvm ekasya visistagunam 16 upalabhya ses17 nm api tadvattvam 18 anumiyate 19 tad smnyatodrstam tadyath vrksd ekasya phalasya 20 pkam upalabhya sesnm phalnm vrksntarnm 21 ca pko 'numiyate / ha: etad api nsty udharanam anekntt 2 2 / na hi sarvesm phalnm tulyaklam pko bhavati prvparaklanispannatvn nimittabhedc ca / ucyate: yad tarhi samudrd ekam udabindum 23 prsya sesasya lavanatnumiyate 24 , sthlym 25 vaikam pulkam upalabhya sesnm pko 'numiyate tad smnyatodrstam / ha: naitad apy asty 2 6 udharanam akrtsnasangraht / vaksyaty
X P. trnasutrasakrtprabhrtinam 2 A. anupalambhot(7) (tatho0) 3 K., D. and A.: tathosnakalusatvdtnm 4 P. megh 5 A. nnaikntah D. nneknth, s.m. nnekntah 6 D. omits apy. 0 7 D. desdivikra , s.m. desdivicra0 8 K., P. and D. omit nma. 9

10

15

20

K., P. and D.: yatrrthayor A. yatraikadrthayaur Dkha. yatraikrthayor We follow Pandeya. 10 A. omits hy. 11 A. omits avyabhicram upalabhynyatra tajjtiyayor arthayor. 12 A. sdhanato 13 A. tatraikatra 14 A. nadiprntard 15 A. tahim 16 A. visistagunayogam A. sesnm 18 A. tattvena Dkha. tadvat tena 19 A. grahanam Dkha. omits anumiyate. 20 Dkha. vrksdeh phalasya K., P. and D.: sesnm vrksntarnm Dkha. sesnm phalnm 22 A. anaikntah 23 A. udakabindum 24 A. lavanavatm anumiyate 25 A. sthly 6 K., P. and D.: naitad asty A. etad api nsty

86 ayam uparistad acaryah

YUKTIDIPIKA

smnyatas tu drstd atindriynm prasiddhir 1 anumnt / (SK6ab) iti / tatraivam pramne parikalpyamne kryakranayos 2 tatsanghtnm ca sukhaduhkhamohasvabhvopalambht tanmtrhamkramahatpradhnnm 3 samadhigamah 4 syt na purusasya tajjtiyrthnupalambht / ucyate: yad 5 tarhi kvacid dharmena dharmntarasyvyabhicram upalabhyaikadharmopalambhd 6 bhinnajtiye 7 'tyantnupalabdhasya dharmntarasya pratipattis tad smnyatodrstam tadyath devadatte gamand desntaraprptim upalabhytyantdrstam jyotism 8 desntaraprpter gamanam 9 anumiyate / tath prsddinm vrddhiprvakam dlrghatvam upalabhyausadhivanaspatmm dirghatvadarsand vrddhir anumiyate / ha: naitad apy asty 1 0 udharanam prvenvisest / kryt kranasydhigamah sesavad11 iti prvam atisrstam bhavat 1 2 / atrpi ca 13 desntaraprptilaksant kryd gatilaksanasya kranasydhigamah / tasmc chesavatsmnyatodrstayor abhedaprasahgah / ucyate: na aniyamt / yatra hi niyamatah 14 kryena kranam adhigamyate tac chesavad ity ayam asmadabhisandhih 15 / na tu tad asti smnyatodrste 1 6 / kasmt / sanghtatvasmnyt prrthyasmnyasdhanam 17 api drsyate / yathha 18 <vya>bhicrd19 visess tu pratlth pratipdakh / / (PS.2.19cd; PSV.:Peking.Ce.32a8-32bl,113b5-6; Derge.Ce.31a7) iti / sdhyasdhanasmnyayor api drsyate / yathnityah sabdah krtakatvd iti / tatraivam sati niyamavdinah pratijnhnih / etensiddhaviruddhnaikntikasdhanbhsh 20 pratyukth / te hi samsayaviparyayjfinahetutvd 21 agamak 22 iti vykhytam anumnam /
X K., P. and D.: pratitir 2 A. kryakranays 3 K., P. and D. omit -mahat-, D. lambhc ca tanmtra0, s.m. lambht tanmtra0 4 A.hy adhigamas 5 A. yadi 6 K., P. and D.: upalabhyaivam dharmopalambhd 7 A. bhinnajtiyo 8 K. and P.: tyantdrstajyotism D. tyantdrsta0, s.m. tyantadrsta0 9 A. prpte 'rtham instead of prpter gamanam 10 A. etad api nsty 11

10

15

20

25

A. sesavd A. bhagavat 13 A. omits ca. 14 K., P. and D.: niyamah 15 K., P. and D.: asmd abhisamdhih 16 A. samsayatodrste 17 A. prthyasdhanasmnyam 18 A. yath 19 All the Mss read avyabhicrd 20 A. sdhyavacanenniruddhnaikntikbhsh 21 K., P. and D.: viparyayajnnahetukatvd 22 A. gamak

DVITIYAM AHNIKAM SK5,6 ha: ptavacanasya kirn laksanam iti / ucyate: PTASRUTIR PTAVACANAM TU / / (SK5d)

87

pt nma rgdiviyuktasygrhyamnakran parrth vyhrtih / sravanam srutih / pt csau srutis ca 1 ptasrutih / athavptsystity 2 ptah / akro matvarthiyah (cf.Pn.5.2.127) / tadyath tundo ghata 3 iti / ptebhyah srutir ptasrutih / ptasrutis cptasrutis cptasrutih / sarpnm ity ekasesah4 (cf.Pn.1.2.64) / tatra prvenptasrutigrahanenedam pratipdayati 5 / apurusabuddhiprvaka mnyah svatantrah 6 purusanihsreyasrtham pravartamno nihsamsayam pramnam iti / dvitiyena manvdinibandhannm ca 7 smrtlnm vedngatarketihsapurnnm sistnm 8 nnsilpbhiyuktnm 9 cdustamanasm yad 10 vacas tat pramnam ity etat 1 1 siddham bhavati / tusabdo Vadhranrthah / ptasrutir eva12 ptavacanam na 1 3 sabdamtram / evam sati yad uktam tantrntariyaih "simsapdisabdnm nirvikalpam anumne 'ntarbhvas trilaksanatvt" iti tad ayatnatah pratiksiptam bhavatiti vykhytni pramnni / etaih 14 prvoktam prameyam yathsvam pratipattavyam

10

15

ha: astu tvad aksasannikarsabhjm 15 arthnm pratyaksenopalabdhih / asannikarsabhjm api copalabdhasambandhnm anumnena / ye tv atindriybhvs tesm ubhayavailaksanyn nsti pratyaksnumnbhym upalabdhih / gamikatve 16 sarvavdasiddhiprasanga ity ato 'tyantam 17 evgrahanam prptam 1 8 / tatra yad uktam (67.10?) etvadbhih pramnaih sakalapadrthvabodha ity et ad 19 ayuktam / ucyate: syd etad evam yady 20 ekarpam evnumnam adhitam 21 syt / kirn tarhi / trividham / tatra satyam eva prvavacchesavati22 prganubhta1 K.J P. and D. omit ca. 2 K., P. and D.: athavpto 'systity 3 A. mutra 4 A. sarpnm ekasesa ekavibhaktv ity ekasesah 5 A. pratipdayatv 6 K., P. and D.: sa instead of svatantrah 7 A. omits ca. 8 A. tath sistnm 9 A. nntisilpbhiyuktnm 10 A. ca yad 11 A. caitat 12 K., P. and D. omit eva. 13 K., P. and D. omit na. 14 A. anyaih 15 D. aksasamkarsabhjm, s.m. aksasannikarsabhjm 16 A. gamikatve ca 17 D. iti tv atyantam 18 A. evgrahanaprptam 19 A. ed 20 A. eva yedy 1 A. evnumadhttam P. evnumnum adhitam 22

20

25

A. prvavacchesavat D. prvavacchesavatt, s.m. prvavacchesavat te

88

YUKTIDIPIKA

sanbandhavisayaphale iti krtva na tabhyam asesapadarthadhigamo 'bhyupagamyate / SMNYATAS TU DRSTD1 ATINDRIYNM PRASIDDHIR2 ANUMNT3/ (SK6ab) 5 yat tv etat smnyatodrstam 4 anumnam tasmd 5 atindriynm arthnm samadhigamah pratyavagantavyah / katham / yath hi krtakatvnityatvayor 6 ghate sahabhvam upalabhynyatra sabddau krtakatvadarsand anityatvam anumiyate / evam sakaldlnm tajjtlyatay candandiprvakatvasiddheh kryak<a>ranasya7 sukhdijtlyatay 8 tatprvakatvasiddhih 9 / sayandinm ca sanghtatvt prrthyasiddheh krya<ka>ranasypi10 sahghtatvt prrthyasiddhir iti sarvam istam sangrhitam bhavatlti / yesm tu sesavad eva smnyatodrstam tesm 11 tasya kryadvrena 12 samadhigamahetutvt purusasygrahanaprasahgah 13 / vrttau kryopacrd adosa iti cet / syn matam / yady api purusasya krybhvas 14 tathpi purusvyaktamahadahamkr<>visesnm 15 smprate kle 16 svavrttibhyas tesm grahanam ity uktam / tasmd 1 7 vrttisaktir 18 esm kryatvenopacarit svam tmnam 19 <vy>anaktiti(?) 2 0 / tac cyuktam / kasmt / hetvantarbhidhnt 2 1 / yadi vrtty grahanam purusasya spapdam abhavisyat samhataprrthyam cryo hetutvena 22 nvaksyat 23 / tac cvrttibhtam ity avasyam sesavatsmnyatodrstayor arthntarabhvo 24 'bhyupagantavyah 25 / tasmt siddham smnyatodrstd atindriynm 26 arthnm 27 samadhigamah / tasya 28 prayogamtrabhedd
1 A. std 2 Dkha. pratitir 3 D. anumnt, s.m. anumnam 4 A. drstam smnyato 5 K., P. and D.: anumnam etasmt 6 A. krtakatvnityayor 7 All the Mss read kryakranasya. 8 D. mukhdi0, s.m. sukhdi0 9 A. siddheh 10 K., P. and D.: kryakranasypi A. akryakranasypi 11 A. tu tesm tu 12 A. tasya kryasesavatah kryadvrena 13 A. purusasya grahanaprasangah 14 A. krybhvas Dkha. kryat bhavet 15 16 A. sampratikle 17 K., P. and D.: kasmt 18 A. vrttir 19 A. tmn 20 All the Mss read yunaktiti. 21 A. na hetvantarbhidhnt 22 Dkha. hetun 23 A. novaksyat 24 A. bhedo' 25 A. 'py avagantavyah 26 A. evtmdriynm 27 Dkha. smnyatodrstnm 28

10

15

20

K., P. and D.: purusvyaktamahadahamkravisesangrahanesu A. purusavyaktamahad ahamkrd avisesnm

arthnm instead of smnyatodrstd atindriynm arthnm

A. tsya

DVITIYAM AHNIKAM SK6 dvaividhyam vita^avlta^ iti / tayor laksanam mananti yad hetuh svarpena sdhyasiddhau prayujyate / sa vlto 'rthntar<a>ksepd 2 itarah parisesatah 3 //

89

svarpam hi sdhanasya dvividham sdhranam asdhranam ca / tatra sdhranam sdhyasahabhvi 4 tatpratipattihetutvena yathvad sriyamno 'rthtm / asdhranam punah "parimnam anvayah"(cf.SK15a'b') "sanghtaparrthatvam"(cf.SK17a) itydi 5 / tatra yad hetuh parapaksam <an>apeksya6 yathrthena 7 svarpena sdhyasiddhv apadisyate 8 tad vitkhyo bhavati / yad tu svasdhyd arthntarabhtnm prasanginm 9 ksepam apoham krtv parisesatah sdhyasiddhv apadisyate tadvitkhyo bhavati tadyath 10 na cet paramnupurusesvarakarmadaivaklasvabhvayadrcchbhyo j agadutpattih sambhavati parisesatah pradhnd iti tad punar avitkhyo bhavati / tatra yad vito hetuh svabuddhv avahitavijnnasvarpam 11 vijiinntaram dadhnena 12 vaktr pratipdydau vkyabhvam upaniyatevkyam antarenrthasya 13 buddhyantare samkrmayitum 14 asakyatvttadvayavivkyam parikalpyate / tasya punar avayavjijnssamsayaprayojanasakyaprptisamsayavyudsalaksans 15 ca vykhyngam / pratijnhetudrstntopasamhranigamanni 16 parapratipdanngam 17 iti / tatra jfitum icch jijns / kascit 18 kamcid upasadyhapurusam 19 jfitum 20 icchmi 21 kirn asti 22 nstiti / kutah samsaya iti paryanuyuktah pratyha anupalabhyamnasyobhayathdrstatvt / ihnupalabhyamnam ubhayathdrstam sadbhtam asadbhtam ceti 2 3 / sadbhtam ca 24 arkenduX A. avita 2 All the Mss read 'rthntarksepd. 3 K., P. and D.: parisesitah 4 D. sdhyasahabhve 5 A. iti 6 All the Mss read apeksya. 7 A. yathoktena 8 A. upadisyate 9 K. and P.: prsangiknm D. prsangiknm, s.m. knm 10 A. omits tadyath ... tad punar avitkhyo bhavati (89.10-12). 11

10

15

20

A. hitavijnnasarpam D. dadnena A. ndadhnena A. arthntarenrthasya 14 A. samkrmayitum K. and P.: samsayavyudnalaksans D. samsayavidnalaksans laksanec 16 A.: pratijnhetudrstntopanayanigamanni A. ca parapratipdanngam 18 A. yath kascit 19 D. puruse, s.m. purusam 20 A. samjntum 21 D. icch me 22 A. kisti 23 A. omits iti. A. omits sadbhtam ca.

A. samsayavyudsa-

90

YUKTIDIPIKA

10

15

20

mandalaparabhagadi / asadbhutam ca 1 sasavisanadi / ayam api catma 2 nopalabhyate 'tah samsayah kim 3 astinstiti 4 / kirn asys 5 cintyh prayojanam iti prsto vycastesstrasatattvdhigamah tatas ca moksvptih / katham iti / yadi tvad ayam tmsti tato 6 'syprakrtitvaudsinyavibhutvdisatattvavijnnn nairtmyabhrntivipaksabhtd apavargaprptir avasyambhvimti 7 / yad uktam "vyaktvyaktajnavijiinn mokso Vpyate" (cf.SK2d) iti tac chstram arthavad bhavati 8 / atha nstiti nisciyatetena 9 smnyatodrstd anumnt 10 tadvad anye 'pi padrth na santiti vipralambhabhyistham rsam darsanam apahytmagrahadrstivigaml lokottaram anavalambana<m> snyam dhynavisayam 11 upasamprptas traidhtukaklesaniro dhalaksanam 12 tyantikam nirvnam avpsymiti 13 / sakyas cyam 14 artho niscetum 15 pramnatrayaparigrahd 16 iti vyavasthite vyudasya 17 samsayam / sdhyvadhranam pratijn / sdhyasya 18 yad avadhranam asti purusa iti s pratijn / sdhanasamsavacanam hetuh / sdhyate 'neneti 19 sdhanam lingam 20 / samsah samksepah sdhanasya samsavacanam sdhanasamsavacanam / sdhanagrahanam tadbhsapratisedhrtham / na hi tni sdhanam samsayaviparyayahetutvt / samsagrahanam avayavntarvaksapradnrtham 21 / linganirdesamtram hetuh / yas tu tasya sdhyasahabhvitvalaksanah prapancah 22 so Vayavntarnity uktam bhavati / udharanam tu tannidarsanam drstntah 2 4 / tasya sdhanasya sdhyena sahabhvitvanidarsanam yad asau drstntas tadyath samhatyakrinm parrthatvam drstam yath sayansanarathasarannm 25 / vyatirekas tv avitasya 26
2 A. ctma 3 A. kemm 4 A. v nstiti 5 P. asy 6 A. tm sthito instead of 7 A. omits iti. 8 K., P. and D.: bhavatiti 9 A. yena 10 A. anumnas 11

*A. omits ca.

tmsti tato

K., P. andD.: avalambanasnyam dhynavisayam A. anabalambanam snyadhynavisayam We follow Pandeya. 12 A. traidhtukaklesanirodhe laksanam 13 K., P. and D.: avpsyasyasiti 14 A. has an unreadable aksara after cyam. 15 A. niscatum 16 A. pramnt trayaparigrahd 17 P. vyudasya 18 K., P. and D. omit sdhyasya ... iti s pratijn. 19 A. naneti 20 A. Ungarn 21 A. avayavvaksadnrtham 22 A. laksanaprapancah 23 K., P. and D.: udharanam tv atra nidarsanam D. s.m. udharanatvanidarsanam 24 K. and P. repeat drstntah sahabhvitvanidarsanam. D. adds the same phrase in the bottom margin, but deletes with a wavy line. 25 K., P. andD.: rathacarannm D. rathacarannm, s.m. rathasarannm 26 A. tvitasya

DVITIYAM AHNIKAM SK6

91

prasangidharmntaranivrttirpatvd antarbhta 1 iti na tadartham vaidharmyadrstnta ucyate / sdhyadrstntayor ekakriyopasamhra upanayah / sdhyasya2 caksurdiprrthyalaksanasya drstntasya ca sayander ekakriyopasamhrah 3 / tatrrthntarabhtatvt sdhyadrstntayor afijas naikakriyopapadyate tenaiva tasynidarsand ity ato dharmasmnyd^ 1 ) yathedam tathedam ity ekakriyopacaryate / yath sayandayah samhatatvt parrth 4 evam caksurdibhir api parrthair 5 bhavitavyam / yo 'sau parah sa purusah / tadvast pratijiibhyso nigamanam / hetudrstntopasamhrpeksay yah pratijiiyh 6 punar abhysas tan nigamanam tadyath tasmd asti purusa ity esm avayavnm 7 parasparasambandhd 8 visistrthah samudyo 9 vkyam 10 ity apadisyate^ 2 ) 11 / vkyam apy anekam yad gunibhtasvrtham 12 arthntaropakritvd itarena 13 samsrjyate tad sstram apy ekam vkyam 14 ity avasiyate 15 / ha: jijfisdyanabhidhnam tadvyatirekenapi svayam arthagateh svaniscayavac ca parapratipdant / yath hi svayam utpadyate 16 niscetuh pratyayas tathaivnyah pratyyya 17 ity etan nyyyam / na ca svayam evrtham pratipadyamnasya 18 jijnsdinm tatra vyprah / tasmt parrtham apy esm updnam 19 na kalpyate / samsayavacannarthakyam ca pratltrthatvt / niscitau hi vdiprativdinau svapaksayoh 20 / tayor itaretarasamsayaparyanuyoge 21 nsti prayojanam /
X A. tadantarbhuta 2 A. sdhyasya ca 3 A. ekakriyopahrah 4 A. par 5 A. padsrther 6 K., P. and D. omit yah pratijnyh. 7 A. asm arayavnm(?) 8 K., P. and D. omit parasparasambandhd. 9 K., P. and D.: visistrthasamudyo 10 D. samudyo vkyam, s.m. samudyavkyam n K., P. and D.: atidisyate cf.p.91,fn.(2) 12 K., P. and D.: gunibhtam svrtham 13 A. omits itarena. 14 A. ekavkyam 15

10

15

20

A. adasiyate After adasiyate A. repeats vkyam apy anekam yad gunibhtasvrtham arthntaropakritvd itarena samsrjyate tad sstram apy ekam vkyam ity avasiyate. 16 A. utpadyata 17 D. pratyya 18 A. evrthapratipadyamnasya 19 A. updhnam A. svaparapaksayoh 1 A. itas samsayaparyanuyoge

(^(dharma-) kriyadharma-* / / (K.31b i.n., D.99 without number in the right margin) *D. paryya; kriydharmasmny
(2

> (apadisyate) atiricyate* / / (K.32a, D.99 without number) *This note presupposes atidisyate, a variant of apadisyate.

92

YUKTIDIPIKA

kirn canyat / prayojanasakyapraptyavacanam ca sadhanabhyupagamd eva tatpratlteh / na hi mahatm nisprayojan pravrttir upapadyate / na csakye 'rthe himavatsamlkarandisv apravrtteh 1 / tasmd anarthakam tadabhidhnam / tadbhve bhvd iti cet / syd etat / satsu jijnsdisu satattvdhigamam 2 pratipravrttir bhavaty asatsu na bhavati / tasmd etny api sdhanam bhavisyantiti / etac cnupapannam / kasmt / atiprasangt / satsv tmntahkaranendriylokavisayesu 3 pravrttidarsant tesm api sdhanatvam syt / anistam caitat / tasmj jijiisdayo 'narthakh / pratijiidayo durvihith / katham 4 / sdhyvadhranasyvayavntaresv apy upapatteh / yadi sdhyvadhranam pratijnety ucyate tena sdhyasya hetor drstntasya v 5 yad avadhranam tad api pratijn prpnoti nimittvisest / sdhyasabdo hy ayam smnyavrttir na yatnam 6 antarena visese 'vasthpayitum sakyata iti / kirn ca hetulaksannupapattis 7 ca sdhannupadest / yo hi sdhanasamsavacanam hetur ity etal laksanam caste tena 8 prk sdhanam abhidheyam 9 syt / tato vaktavyam amusya samsavacanam hetur iti / na caivam uktam / tasmd alaksanam etat / kirn cnyat / sams<>vacanam 10 ca vistaranisedhaprasangt 1 1 / yadi hi samsagrahanam kriyate kirn prptam / yo ' y a m dhytmiknm bhednm kryak<a>rantmaknm 12 caikajtisamanvayo drsta ity evamdih sdhanaprapancah so 'hetur 13 ity uktam bhavati / tasmt samsagrahanam anistam / lingbhidhnd adosa iti cet / syn matam / Ungarn hi nah sdhanam / tasytra nirdesah 14 krtah / tasmt svamatijdyd idam anistam adhyropyate na tv asmatpramdd 15 iti / etad apy ayuktam / kasmt / tasya dvidh bhinnasya paiicadh 16 sdhanabhvt 1 7 / tad dhi lingam vitvltatvenestam, tena dvidh bhinnam / tatrpi vltah pancaprabheda ity atah samudyn niskrstasyaikasya lingatvam asakyam vaktum iti /
X P. adisu pravrtteh 2 A. tattvdhigamam 3 Dkha. tatsvtmntahkarane0 4 5 A. ca 6 D. netaram 7

10

15

20

25

After katham A. reads sdhybhidhyinah pratijnbhyupagamd dhetudrstntayor api tatpr sanga. (cf.95.1)

8 A. castate na 9 A. abhidhnzyam 10 All the Mss read samsavacanam. 11 A. vistarapratisedhaprasangt 12 All the Mss read kryakrantmaknm. 13 D. svah ahetuh, s.m. either so 'hetuh or sahetuh. Dkha. sa hetur 14 A. tasya nirdesah Dkha. tasynirdesah 15 A. and Dkha.: asmatprasdd D. prasdd, s.m. pramdd 16 K., P. and D.: bhinnapancadh 17

instead of na yatnam K., P. and D.: ahetu0

A. and Dkha.: sdhanabhvt D. bhinnapancadh sdhanabhvt, s.m. bhinnapancasdha nbhvt v sdhanabhvt

DVITIYAM AHNIKAM SK6

93

kirn cnyat / drstntalaksanyogas ca^1) sabdrthalaksane 1 'nistaprasangt / tannidarsanam drstnta ity atra sabdo vrtho 2 v yena sdhyasdhane nidarsyete 3 sa drstntah syt / [artho v yatra 4 nidarsyate /] kim ctah / tad yadi tvac chabdah parigrhyate tata upanayalaksanam 5 bdhyate 6 / kasmt / na hi 7 yathbhidhnam tath sdhyam ity ekakriy yujyata iti / athrthah 8 parigrhyate tenbhidheyasya 9 vkynavayavatvt pancvayavatvavirodhah 10 / kim cnyat / drstntopanayanigamanbhedas^ 2 ) 11 ca hetupratijfirthbhidhnt 1 2 / sdhanatvam 13 eva sdhyvinbhvitvalaksanam drstntopanayayoh 14 pratyy<y>ate 15 / pratijnrtham ca nigamanasya nvayavntaratvam yujyate / ucyate: yad ucyate(91.15f.) svaniscaye 'nangabhvagamant^ 3 ) 16 parapratyyanrtham jijiisdyanabhidhnam 17 ity atra brmah: na uktatvt / uktam(89.16ff.) etat purastd vykhyngam jijnsdayah <iti> / sarvasya cnugrahah kartavya ity evamartham 18 sstravykhynam vipascidbhih pratyate 19 na svrtham svasadrsabuddhyartham 20 v / tatraivam 21 kalpyamne ye vyutpdys tn prati <naism narthakyam(?)> 22 / athaitad anistam yad
1 A. sabdarthakalpane 2 A. omits vrtho. D. encircles vrtho. 3 P. nidarsyate A. nirdesyete D. nida..yate(!) 4 A. yo yatra instead of yatra 5 A. upanayanalaksanam 6 A. bdhyeta 7 K., P. and D. omit na hi. 8 A. ayathrthah Dkha. athtah 9 Dkha. nbhidheyasya 10 Dkha. virodhd D. yogah, s.m. virodhah 11 A. nigamanabhedas 12 A. hetupratijnnbhidhnt 13 A. sdhanadharmam Dkha. sdhanam 14 D. drstntovinbhvinam, s.m. drstntopanayayoh 15 K., P. and D.: pratyyate A. and Dkha.: pratyyayatoh 16 K. 'nngabhvagamant Dkha. nngabhvagamant 17 Dkha. jijnsbhidhnam 18 A. iti caivam artham 19 K. and P.: pratyyate D. pratyate, s.m. pratyyate 20 A. svasadrsabuddhrtham 21 A. tatraiva 22

10

15

K., P. and D.: vaism kulyam Dkha. vaisamykulyam

(^(ca) agra etadartham karoti / / (K.32b, D.102-1) (2) (drstntopanayanigamana-) drstntopanayau hetvartham pratyyatah / nigamanam ca pratijfirtham bodhayati / / (K.32b, D.102-2) ^3'(svaniscaye, 'nngabhvagamant) jijnsdyanabhidhnam tadvyatirekenpi svayam arthagater (91.15) ityder dsanam ha svaniscaye 'nangabhva iti // (K.33a, D.102-3) ('nngabhvagamant) jijnsdinm // (K.33a, not found in D.)

94

YUKTIDIPIKA

10

15

uktam sandigdhaviparyastavyutpannabuddhyanugrahartho 1 hi satam viniscayah sastrakathety asya vyghtah 2 / kirn ca niyamnabhyupagamt / na hi vayam esm vasyakam 3 abhidhnam caksmahe 4 / kirn tarhi / yad 5 prativdi paryanuyunkte kirn6 jijnsasa ity avasyam abhidhniyam sabdam 7 iti / kena dharmena / kirn8 nityo 'nitya iti / kutah samsayah / amrtatvt / yas tu na paryanuyunkte na tarn praty ete vcyh / kvacid narthakyt sarvatra prasanga^1) iti cen na itaresam api tatprasangt( 2 )/ pratijndmm api tarhi kvacid an abhidhnam 9 , atas tesm api sarvatrvacanam prasajyate / tath ca bhavatoktam 10 kasyacit tu kimcit prasiddham eva bhavatity 11 anyataroktir 12 api sdhanam bhavati sabda ivrthadvayapratitatvd 13 ubhaynabhidhnam iti / yad apy(3) uktam(91.19) niscitatvt samsayvacanam ity asad etat / kasmt / uktatvt / uktam (89.20) etat sati paryanuyoge tadvacanam iti / etena prayojanasakyaprpt! pratyukte 1 4 / yo hi paryanuyunjita kimprayojano 'yain 15 sakyo vyam artha iti tarn prati vcyam 16 etat / yad apy uktam(92.4f.) tadbhve^4) bhvd iti / na anabhyupagamt / na brmo yasmt satsu jijnsdisu satattvadhigamasadbhvah 17 tasmd etesm avayavatvamiti / kirn tarhi / yam 18 praty esm pratipattv angabhvagamanam tarn praty etni sdhanam iti /
X A. sandehakhavipary0 (?) Dkha. sandehaviparyastav utpanna0 2 K., P. and D.: vykhytah 3 A. avasyam 4 D. vasyakam caksmahe, s.m. vasyakam abhidhnam caksmahe 5 K., P. and D. omit yad. 6 A. omits kirn. 7 K., P. and D. omit sabdam. 8 A. omits kirn. 9 A. anabhidhnt 10 Dkha. bhavatoktasya 11 A. bhavatiti cety 12 D. anyatroktir, s.m. anyataroktir 13 A. pratitavyatvd 14 A. prayukteh 15 A. kirnprayojanam 16 A. bdhyam 17 A. tattvdhigama0 18

A. ye

(^(prasanga) aparyanuyoktaram prati yady avacyatvam tarhi paryanuyoktaram praty avcyatvam eva / / (K.33a, D. 103-1) (2) (tatprasangt) yam praty avcys tarn praty avcyatve 'pi nnyapratyavcyatvaprasangah // (K.33a,D.103-2) ( api) samsayavacannarthakyam pratxtrthatvd (91.19) ity asya dsanam hayad aplti // (K.33a, D.103-3) (4) (tadbhve) tadbhve bhvd(92A) ity asya dsanam hatadbhva iti / / (K.33a, D.104-1)

DVITIYAM AHNIKAM SK6

95

yad apy uktamW (92.9) sdhybhidhyinah pratijn<bhy>upagamd1 dhetudrstntayor api tatprasahga iti / ayuktam 2 etat / kasmt / jijnsdeh sadbhve sati tatpratlteh / yady api sdhyasabdo ' y a m avisesena siddhatvd arthntaram^ 2 ) 3 caste tathpi yam prati jijnassarpsayaprayojanasakyaprptayas tasya vyudasya samsayam sdhyasyvadhranam^3) pratijfi, na hetudrstntayos tadastlty 4 asad etat 5 / kirn cnyat / tadbhve cvirodht 6 / yad tu 7 jijnsdayo 8 hetau drstnte v bhavanti tad 9 kirn krtakah sabdo ? tha na krtako 'tha buddhir nity ksanik veti bhavaty eva tadavadhranam 10 pratijfi / yad apy uktam(92.14) sdhannupadesd dhetulaksanyoga ity asad etat 1 1 / kasmt / lokaprasiddhatvt / yath sdhyatvenepsitah paksa iti 12 pratijfilaksanam^4) caksno bhavn na sdhyalaksanam caste / kasmt / sdhaniyam sdhyam iti loke siddhatvd / evam sdhanasamsavacanam hetur iti 1 3 hetulaksanam caksn vayam na sdhanam caksmahe / kasmt / sdhyate 'neneti loke14 siddhatvt / upetya 1 5 vnumnanirdest / lihgam hi nah

10

*K. and P.: pratijnayutatvabhyupagamad A. pratijnvyupagamad Dkha. pratijnaya tattvbhyupagamd (cf.p.92,fn.4.) 2 K., P. and D.: uktam 3 A. avisesena siddhd arthntaram Dkha. avisesinah siddhrthntaram 4 A. and Dkha.: tad astit(y) 5 A. etad asat 6 A. tadbhvenvirodht 7 A. $a yad tu *After jijnsdayo A. repeats hetu drstntayos tad astity etad asat jijnsdayo. In the repeated phrase tu of yad tu is omitted. 9 A. omits tad. 10 A. tad tadavadhranam 11 A. etad asat 12 D. omits iti. 13 K., fP. and D. omit hetur iti. 14 A. neneti krtv sdhanam iti loke 15 D. upeti, s.m. upetya

apy uktam) hetulaksananupapattis ca sadhananupadesad (92.14) ity asya dusanam yad apy uktam itydin // (K.33b, D.104-2)
1 (2) (sdhyasabdo 'yai avisesena siddhatvd arthntaram) sdhyasabdo 'y a m avisesanah 2 3 4 siddhrthntaram ity anydarse pthah / siddhd anyah sdhyah // (K.33b, Dl04 in the right margin) 1 D. starts this note with pamta(l). 2 D. omits anydarse. 3 cf.p.95,fn.3 4 D. has siddhd anyah sdhyah in the left margin, while the preceding passage of this note is written in the right margin.

(3) (sdhyasya) sdhyasya hetor drstntasya v yad avadhranam tad api pratijfi prpnoty <ity>der* dsanam / / (K.33b, D.104-3) *K. and D.: der '4) (yath sdhyavattvenepsitah paksa iti pratijnlaksanam) yath bhavat sdhyavattvena ya Ipsitah paksah s pratijfieti pratijnlaksanam sdhyopadesam vinaivoktam tathsmbhir api sdhanasamsavacanam hetur iti sdhanopadesam vinaivoktam sdhanasya lokaprasiddhatvt / / (K.33b, D.104-4)

96

YUKTIDIPIKA

10

15

20

25

sadhanam 1 tac ca2 nirdistam iti 3 / yat tktam 4 (92.24f.) vitvltabhede 5 sati paiicadh sdhanabhvd ity atra brmah: ayuktam etat / kasmt / samsagrahanasmarthyt / ata eva smsagrahanam kriyate / sdhanasvarpbhidhnamtram 6 hetur iti yath vijnyate 7 / prapaiicas tv avayavntarnlty etena vistarapratisedhaprasangah pratyuktah / katham / na hi samsasabdasyyam artha iti krtv 8 / yat punar etad uktam (93.1) sabdrthakalpane 'nistaprasangd drstntalaksanyoga iti / astu tvac chabdo drstntah / yat tktam(93.4) upanayalaksanam 9 badhyata ity anupapannam etat / kasmt / asambhave sati sambandhyantare kryavijnnt / sabde^1) 'sambhavd arthe kryam 10 vijnsymah / athav punar astv artho drstntah / yat tktam (93.6) abhidheyasya vkynavayavatvt paficvayavatvavirodha ity arthe 'sambhavc chabde kryam vijnsymah / yad apy uktam (93.8) pratijnhetvarthbhidhnd drstntopanayanigamannm nvayavntaratvam ity ayam adosah 11 / kasmt / apratijnnt / na hy etad asmbhih pratijnyate / kirn tarhi / prameyavacanam pratijn / pramnarpamtravacanam hetuh / tasya prameyasahabhvitvanidarsanam 12 drstntah / sdhyadrstntayor dharmasmnyd ekakriyopasamhra upanayah / samudyasya sdhyasiddhaye vypranirdeso nigamanam / tasmd ayuktam etat / kirn cnyat / ekasya sdhyasdhanabhvaparikalpanvat 13 tatparikalpane dosbhvat / yath vkyam e<k>am ca 14 tadarthas ca mukhyau sabdrthau, tayor abhinnrthatvd 15 ity upagamd 16 ekam evrtham abhgam akramam ca buddhv avasthpya srotragrhyatvnityatvakrtakatvaprameyatvdilaksannm 1 7 saktlnm apoddhrt sdhyasdhanasamsayarppannam vaktro bhinnam caksate na caikrthadharmatvt sdhyasdhanasamsaybhidhnnm
1 A. sadhanam 2 A. tas ca 3 A. omits iti. 4 A. tkta 5 P. vitvite bhede 6 D. sdhanasvarpnabhidhna0 , s.m. sdhanasvarpbhidhna0 7 A. has a blank space instead of yath vijnyate. 8 A. iti vistarnsC!) krrntv 9 A. upanayanalaksanarn 10 A. arthakryam 11 A. ayam dosah 12 K., P. and D.: prameyasahabhvinidarsanam 13 14 K., P. and D.: evam ca A. eca 15 Dkha. abhinnatvd 16 K., P., D. and Dkha.: abhyupagamd 17

K., P. and D.: ekasya sdhanabhvaparikalpan A. evam asya sdhyasdhanabhvaparik panvat

A. srotragrhyatvn nityatvkrtakatvaprameyatdilaksannm

( ) sabdarthayoh parasparam sambandhitvad / yadi* canayoh sabda uktam karyam na sambhavati sambandhyantare 'rthe 'pi kryam vijfiyeta / athavrtha uktam kryam na sambhavati tarhi tatsambandhini vijfiyeta iti / / (K.33b, D.105-1) *D. iti

DVITIYAM AHNIKAM SK7

97

ekatvam anusajyate tathaikasya sdhanasya sdhyadharmatatsahabhvitvalaksannm saktmm abhidhnam hetudrstntdinvayavntaram 1 nah syt / tatra yad uktam(93.8) pratijnhetvarthbhidhnd drstntopanayanigamannm nvayavntaratvam ity etad ayuktam / tasmt sktam dasvayavo vitah / tasya purastt prayogam nyyyam 2 cry manyante / kirn kranam 3 / avltalaksanvirodht 4 / avitasya 5 hi laksanam parisesatah sdhynugrahah / tatrnvaydin^1) svarpendhigate 6 pradhnalaksane dharmini parapaksapratisedhamtrenopasamhre kriyamne parisesalaksanam bdhyate / kasmt / iha pratisedhamtram dv ucyate / tena yath hetuvirodht paramnvdibhyo na vyaktam utpadyate tath hetvabhvt pradhnd api notpadyata iti sakyam kalpayitum / atas 7 tadvyavacchedo 'pi <n>vitd8 gamyate / tath sati kah parisesah syt / svarpena^2) tu paricchinne dharminy upasamhro yathvad avakalpyate 9 / na cet paramnvdibhya utpadyate 10 parisesatah 11 pradhnd eva vyaktam utpadyate / parisesata iti yathoktebhyo 'nvaydibhya^3) ity uktam bhavati / tasmt prg vitaprayoga iti siddham smnyatodrstd anumnd atindriynm arthnm samadhigama iti / ha 12 : na kranntarato 1 3 'nupalabhyamnnm agrahant^ 4 )/ 5 yadi^ ^ smnyatodrstd anumnt sarvam paroksam adhigamyata ity [adhigamyate] 14 prptam idam yesm apy arthnm kranntarato 15 'nupalabdhis
1 D. hetuh / drstantadina avayavntaram 2 K., P. and D.: nyyam 3 A. kikranam 4 A. vita0 5 A. vitasya 6 K., P. and D.: svarpennadhigate 7 A. tas 8 K., P. and D.: cvitd A. vitd 9 A. avakalpate 10 A. paramnvdibhya na vyaktam utpadyate 11 A. omits parisesatah pradhnd eva vyaktam utpadyate. 12 K., P. and D. omit ha. 13 D. kranatah, s.m. kranntaratah 14 K., P. and D.: adhigamyate ity adhigamyate A. adhigamyata 15

10

15

20

ity abhyupagamyate

D. kranatah, s.m. kranntaratah

( * > (anvayadina) "samanvayac chaktitah pravrttes ca" (SKl5b) ityadi vaksyamanenanvayadina // (K.34a, D.107-1)
(2

) (svarpena) anvaydin / / (K.34b, D.107-2)

(3) ('nvaydibhya) hetubhyah / / (K.34b i.n., D.107-3) ^ ( n a kranntarato 'nupalabhyamnnm agrahant) vrttikam / / (K.34b, not found in D.) <5)(yadi) vrttikrthah / / (K.34b i.n., not found in D.)

98

YUKTIDIPIKA

tesam api tasmad eva grahanam^1) <iti>/ tadyatha ATIDRT^2) SMIPYD INDRIYAGHTN MANO'NAVASTHNT / SAUKSMYD VYAVADHND ABHIBHAVT SAMNBHIHRC CA / / (SK7) 5 tatrtidrt 1 tvat 2 tadyath proddinasya 3 sakuneh / atismipyd anjanaprabhrtinm / indriyaghtc chabddinm 4 / ma.no'navasthnc chakatdmm / sauksmyt trutydmm 5 / vyavadhnd dhiranydinm / abhibhavt sryapraksd grahdmm / samnbhihrd anekapradipaprabhnm 6 / casabdd aisvaryayogd devdinm 7 / na crhati bhavitum dharmasmnynupapatteh^ 3 ) 8 / tasmd ayuktam sarvam atindriyam anumnagrhyam 9 iti / ucyate: sakyam tvat kranntarato 'nupalabhyamnam kimcit smnyatodrstd anumnd adhigantum tadyath samipvasthitasya sakuner ayatnena caksurgrahanam 10 / yath yath tu viprakarsam pratipadyate tath tath 1 1 pranidhya caksur grhyate tvad yvat kramendarsanam upasamprptah / tatra desaviprakarse pra<c>iyamne12 darsanam upaciyamnam avagamytyantdarsanam api pasct taddhetukam anumlyate / tath ntisamipvasthitasya dravyasysphutam kram avadhrya 13 pascd yath yath
1 A. tatratidura 2 A. omits tvat. 3 A. protinasya 4 K., P. and D.: td badhirdinm 5 D. not clear. 6 A. anekadipaprabhnm D. samnbhihrd 7 A. aisvaryayogc ca devydtnm 8 9 Dkha. anumnagrhyam 10 A. caksus grahanam U K., P. and D. omit tath tath. 12 13

10

15

aneka0, s.m. samnbhihrneka0

K., P. and D.: dharmasmnyd anupapatteh A. dharmasmnypatteh The phrase "dharmasmnynupatteh" is attested by the marginal note of K.(cf.p.98,fn.(3))

K. and D.: desaviprakarsam practyamnam P. karsam pradTyamnam A. desaviprakarse pradiyamne K., P. and D.: dravyasysphuta kro 'vadhryate

'*' (grahanam) na crhati bhavitum (98.9) ity anena sambandhah // (K.34b, not found in D.) (2) (ATIDRT) atidratvam darsanasybhve nimittam / Tsaddratvam iva sprstasya darsanasyety evam anyatra vcyam // (K.34b, D.108-1) (3) (dharmasmnynupapatteh) yesm api vastnm atidratvdikaranntarato 'nupalabdhis tesm api smnyatodistd anumnd eva grahanam prpnoti / na ca tesm smnyatodrstd anumnd grahanam arhati / atra hetum hadharmasmnynupapatter iti / (K.34b, D. 108-2 1st half) yatra hi dharmasmanyam tatraiva smnyatodistasya pravrttih / atra tu tadabhvt tatpravrttyabhva iti kranntarato 'pi yad atindriyam tasypi cet smnyatodrstn na grahanam, tarhi pradhndinm api m bhd iti prvapaksbhipryah / / (D.108-2 2nd half, not found in K.)

DVITIYAM AHNIKAM SK6.7

99

upasampadyate 1 tath tath pratipadyamnadarsanasaktayo 2 'numtrah krsnasriijanaprabhrtinm^ 2 ) 3 agrahanam atismipyd anumimate / tath girisaritsamudrasamlpavartinam 4 sravanapratightinam^ 3 ) 5 prk sabdam upalabhya pasct tasminn eva dese sabdam agrhnnh sravanopaghtam anumimate / TASMD API CSIDDHAM6 PAROKSAM PTGAMT SDHYAM7// (SK6cd) tasmd api csiddham ity anengamavisaye8 smnyatodrstasynavatram 9 caste / paroksam iti visayam pratinirdisati 10 , ptgamt sdhyam11 iti visayinam ha / etad uktam bhavati: tasmd api smnyatodrstd anumnd yan na siddhyati pratyaksagrhyarrr 4 ) api svayam adrstam kranntarapratibaddhavisayabhvam 12 atyantaparoksam^5) v svargpavargadevatdi dharmasmnyarahitam tad ptgamt 1 3 sdhyam / sarvavdasiddhiprasangd 14 aprmnyam iti cet / syd etat 1 5 / yadi tarhy gamah 16 pramnlkriyate tena pratisstram ye 'bhiyukts tesm prmnyam ity avasyam abhyupagantavyam / evam sati sarvcryaprmnyd anekavikalpavicitr 17 tarkavrttir ity D. has rad upasarpatiti pathah / samipam upasarpati in the right margin without referring to any other manuscript. 2 A. pratipdyamnasaktayo 3 P. and D.: krsnasrnjana0 4 A. girisaritsamipaparivartinam 5 A. dravinapratightinan 6 A. api siddham 7 K. and P.: siddham D. siddham, s.m. sdhyam D. writes sdhyam below the title indication of ga.pu in the right margin. 8 A. anena visaye 9 Dkha. anavaratm 10 A. pratininditasya n D . siddham, s.m. sdhyam 12 K., P. and D.: kranntarapratibandha0 13 A. tmgatt 14 A. sarvavdisiddhiprasangd (this is also possibly the original reading). 15 K., P. and D.: tat instead of syd etat 16 A. cgamah 17 A. anekavikalpaviditr
X

10

15

(^(arad) samipam upasarpati / / (K.35a i.n., D.109 without number) (2) (krsnasra-) netratrsthakisnasra- / / (K.35a i.n., D.109 without number) (3) (sravanapratightinam) tlvrah sabdah srotram pratihanti tlvram rpam caksus tathvidhadhvanirpgrahant / / (K.35a i.n,, D.109-1) (4) (pratyaksagrhyam) tajjtlyasya pramtrantarasyeti sesah / / (K.35a, D.109-2) (5) (atyantaparoksam) asmajjtlyasya pramtuh / / (K.35a i.n., not found in D.)

100

YUKTIDIPIKA

10

15

20

apariniscitatvad 1 bhrantih^1) prasajyeta / tatha ca sati jijnasunam apavarg<>prptih 2 / tasmd bhisajeva bhavat paropadeso prayukto 3 nsmn ayam printlti 4 / etac cyuktarn / kasmt / aptalaksanasynavadhritatvt / vyapagatargdidosnm asandigdhamatlnm 5 atlndriyrthadrsvanm Isvaramaharslnm ptatvam caksmahe na sarvesm / yadi vnyo 'py evamdharmo 'sti bhavatu 6 pramnam / kirn cnyat / svavisaye 7 ca 8 tatprmnyasydosavattvt / yasya khalv apiyo visayas tasya tasmin visaye vaco 'ntarenpi sdhanam pramnam 9 ity avasyam abhyupagantavyam / itarath pratisstram crasthitiniyamnm adrstrthnm apratipattih syt / etenkhilalingd 10 <an>arthntaratvam 11 pratyuktam / yasmn mahatbhidhnena yuktir anvisyate tasmd yuktyapekslingd 12 gamo 'rthntaram iti / ha: na anvayavyatirekbhym adhigamahetutvt / yath krtakatvdir dharmo 13 'nityatvdau 14 visaye drstas tadabhve cdrsta ity anitye 'rthe niscayam dadhty 15 evam 16 sabdo 'pi svrthe drsto ? nyatra tajjtiye 17 na drstah pratipattihetur 18 bhavati / tasmd anumnd abhinna 19 evyam iti / ucyate: candrdisv idnim asdhranavisayesu k pratipattih syd iti / ha: avayavpeksatvt / candrasabdo hy anekesv avayavesu20 vartate 21 jtidravyagunakriysu 22 ca / tath 2 3 ditthdisabdah / tasmd evamjtiyaknm api cnumnd 24 abhedah / ucyate: svargdlnm tarhi katham anumnatvam iti / ha: ptav<d>visamvdasmnyt 2 5 / yath hairanyakaprabhrtiX A. atra pariniscitatvd 2 K., P. and D.: apavargaprptih A. apavargaprptivightah 3 K., P. and D. omit prayukto. 4 K., P., D. and A.: omit prtnti Dkha. printiti 5 A. asandigdhabuddhinm 6 A. bhavitum 7 K., P. and D.: avisaye 8 A. tu 9 A. sdhanam anumnam pramnam 10 A. etenkhill lingd D. etena aksaralingt 11

syt

K., P. and D.: arthntaratvam pratyuktam A. omits <an>arthntaratvarn pratyuktam / ... anvisyate tasmd yuktyapeks. The emendation is suggested by Raghavan. 12 Dkha. yuktyapeksl lingd 13 A. krtakatvdivetso 14 D. nityavdau 15 A. dadti 16 P. eva 17 A. 'nyatra ctajjtiye Dkha. yatra tajjtiye 18 K., P. and D.: na drstapratipattir 19 K., P. and D.: bhinna 20 K., P. and D.: anekesu vacanesu 21 A. vattate 0 22 D. jtiguna , s.m. jtidravyaguna0 23 K., P. and D.: tad 24 A. apy anumnd 25 K., P. and D.: ptavaco 'visamvdasmarthyt A. ptavdvisamvdvagamt

(^(bhrantih) apramanyam // (K.35a i.n., not found in D.)

DVITIYAM AHNIKAM SK6.7

101

nm 1 ptnm vkyam avyabhicry evam Tsvaramaharsayo 'pi cpth 2 / tasmd esm api vkyam avyabhicriti sakyam atrpi smnyavisayatvam kalpayitum / evam anumnam evgama 3 iti / ucyate: yad uktam (100.12) anvayavyatirekbhym adhigamahetutvc 4 chabdo 'numnam ity atra brmah: na 5 a p r a t i j n n t ^ V na hi vayam vyavahrnuptinm vrksdinm^2)6 gamatvam 7 caksmahe / kirn tarhi / svargdinm akgantag^^ tasmd apratijnnd anuplambho ' y a r n 9 iti / upetya v vaktrapeksatvt / athavopetypi 10 sarvasabdnm gamatvam evnumnd 11 arthntarabhvam brmah / tath hi krtakatvd iti Ungarn candlakplikair api pray uj yam an am shacarypeksam^3) niscayam dadhti 1 2 / na vaktrvisesam apeksate / vaktrvisespeksas tu sabdah / tasmn na Ungarn / kirn cnyat / viparyayt / na hi Ungarn desntare viparyeti / sabdasya tu drsto viparyayah 13 / sa eva hi sabdo desntare [klntare tu] svrtham na 14 pratyyayaty arthntaram ca prasamsati / s a m b a n d h n u p a l a b d h e r iti cet / syd etat / sambandhntaram 15 desntare 'nupalaksitam 16 / tasmc chabdrthaviparyaya 17 iti / et ad anupapannam lingavaidharmyt / na hi pratya5

10

15

1 Dkha. hiranyakaprabhrtinam 2 A. maharsayo 'typtah 3 K., P. and D.: evam gama 4 A. anvayavyatirekbhym api cdhigama0 5 K., P. and D. omit na. 6 A. vrksdisabdnm 7 Dkha. gamatvam 8 A. atyantaparoksavisaynm 9 Dkha. vaktrapeksatatvt 10 Dkha. athavopetydi 11 A. anumnd 12 A. dadti 13 K., P. and D.: drsto viparyayo drstah 14 Dkha. omits na. 15 A. sambandho 16 A 'nupalaksitas 17

K., P. and D.: rthavisayam

^^(apratijiianat) apratijnnd iti / yadi hi tesam pramanyam abhyupagamyate tadanumanantarbhvacint svaks / na tv evam svargdisabdesu, nnvayavyatirekau sto 'tlndriyrthavisayatvd iti bhvah / / (K.36a, D.112-1) ^2) (vrksdlnm) sabdnm / / (K.36a, D.112 in the left margin) <3) (shacarya-) shacaryam iti / avinbhvabalenety arthah / / (K.36a, D.112-2)

102

YUKTIDIPIKA

10

15

ksabhimatasya lingina upalabdhau gavader^1) Ungarn nopalabhyate 1 / sabdas tpalabhyamne 2 gavdau nopalabhyate / tasmn na Ungarn / kirn cnyat / desaniyamt / na hi lihgasya desaniyamo drstah / asti tu sabdasya desaniyamah / tadyath savatir gatikarm 3 kmbojesv4 eva bhsyate / ramhatih prcyesu5 tath dtir 6 lavanartho 7 < prcyesu > dtram udicyesu (cf.MBhsya.I.9.25ff.) nnyatra / tasmn na sabdo Ungarn / kirn cnyat / istato viniyogt / svbhvikam Ungarn / na hi dhmo 'gner apakrsya sakyate 'psu vyv kse 'nyatra 8 v 9 vinivesayitum^ 2 ) 10 / sabdas tu yatra yatra vaktur 11 abhipryas tatra tatra vinivesyate 12 yath 1 3 vrddhydayah 14 sabdh svngbhyuccaydisu 15 prasiddh daiksu^ (cf.Pn. 1.1.1) vinivesyante 16 / tasmn na te 1 7 Ungarn / sarvbhidhnasaktitvc chabdasydosa iti cet / syn matam / sarvbhidhnasaktih sabdah sarvbhidheyasaktis crthah / tayoh purusavyprena saktyavacchedah kriyate / katham / ayam eva sabdo 'syrthasya pratyyako bhavatu / ayam eva crtho 'nena sabdenbhidhiyatm / etvati 18 purusavyprah / tasmc chabdasya svbhvikah sambandho vaktrapeksay vyajyata 19 iti / etad apy 2 0 a n u p a p a n n a m /
2 K. and P.: tpalabhyamno 3 A. savatitikarm 4 A. cko sv 5 A. prcyabharatesu 6 A. tath da 7 A. lavanrthe 8 A. ksa ity atra 9 A. omits v. 10 K., P. and D.: nivesayitum 11 A. vaktar yatra yatra 12 A. nivesyate 13 A. tadyath 14 A. buddhydayas 15 0

*A. gavade linginopalabhyate

K. and P.: svrthbhyu A. svtyu0 D. svrthbhyu0, s.m. svrigbhyu0 We follow the emendation suggested by D. 16 A. nivesyante 17 A. naitad 18 A. eva tvati 19 D. yujyate 20 A. omits apy.

(1)(gavader) gavader iti / visanadilingam yatnena pariksyamanam iti sesah / anyatha visandy api kadcid anavadhndin nopalabhyetaiva / nanu sabdo lingy arthavattaynumlyamnatvt / maivam / samayakalpito hy ayam art hah / lokas tu sabdd art ham pratipadyate / pratipattihetor njasam lihgatvam loke prasiddham iti bhvah / pratyaksasya visndilihgavato gavder upalabdhau satym api tadlyam visanadilingam na nopalabhyate 'pi tpalabhyate / tath yadi sabdasyalingatvam syt tarhy upalabhyamne gavdv art he upalabdhih syt / na tv evam iti lihgavaidharmyam / / (K.36a, D.I 13-1) (2) (vinivesayitum) vini<vesayi>tum* iti / pratipdakatayeti sesah // (K.36a, D.113-2) *K. and D.: viniscetum (3)(daiksu) "vrddhir daic" iti pninistram (Pn.1.1.1) / / (K.36b, D.113-3)

DVITIYAM AHNIKAM SK6.7

103

kasmt / sutarm anumnd arthntaratvaprasangt / evam api kalpayitvnumnt sutarm sabdasyrthntaratvam padyate / kasmt / na hi yath 1 vaktrapeksay sarvrthasya 2 satah sabdasya saktyavacchedas tath sarvrtham Ungarn vaktrapeksayrthntard avacchidyate / yath caikah sabdo jagaty 3 evam uditah purusaviniyogpeksah sarvam artham abhidhtum samartho <na> tathaikam^1) Ungarn kaycid4 yukty sarvrthapratyyanasam art harn 5 / tasmn 6 na sabdo Ungarn / yat punar etad uktam(100.17) candrdlnm^2) avayavpeksam smnyavisayatvam 7 iti / etad asat / kasmt / sv<a>mativyghtt 8 / yadi khalv api candrdinm sabdnm avayavpeksam smnyavisayatvam abhyupagamyate yad uktam 9 asdhranatvd anumnbhve sabdaprasiddho 'rtha iti tasya 10 vyghtah^ 3 )/ kirn cnyat / jtydisdhyatvt / jtidravyagunakriynm 11 ca parasparato 'rthntaratvam samudyas ca sdhyah / tasmd ayuktam esm tadapeksay^4) smnyavisayatvam / yad apy uktam 12 (100.22) ptavdvisamvdasmnyt 13 svargdisabdnm anumnatvam 14 ity atra brmah: etad apy
X A. 2 A. 3 A. 4 A. 5 A. 6

10

15

yatra savrthasya trag ad ity na kaycid sarvrthapratyayana0 P. sm sabdo Ungarn kaycid yukty sarvrthapratyyanasamartham / tasmn na sabdo Ungarn in place of tasmn na sabdo Ungarn 7 K., P. and D. omit visayatvam iti / ... avayavpeksam smnyavisayatva-. 8 A. svmativyghtt 9 K., P. and D.: tad ayuktam 10 K., P. and D. omits tasya. 11 K., P. and D.: jtigunadravyakriynm 12 A. aktam 13 K., P. and D.: ptavdvisamvdanasmnyt 14 A. anumnat

'1)(<na> tathaikam) na* ^tathaikam^iti / anvitatvenapi hy ekakaranapurvakatvamatram anumlyate na sarve dharmh / / (K.36b, D.114-1) *D. omits na. (2)(candra-) candrasabdasysdhranatvenaikasminn arthe pravrtter drstntbhvennvayasnyatvt / tasmc candrasabdavcyatvasysdhranatvd ekadharmini yatatvd drstntadharminy abhvd anumeyatvbhvena sbdyaiva vikalptmikay prasiddhy prasiddho 'y a m artho ya^ candrah sa saslti tasmt prasiddhibdhita evyam pakso nnumnabdhitah / ittham vadadbhir bhavadbhte candrdaya ekrthaniyat upagath / idnlm tu smnyavisayatvena sdhianavisay iti vyghtah* / / (K.36b, D.114-2) *K. omits iti vyghtah. W (asdhranatvd anumnbhve Sabdaprasiddho 'rtha iti tasya vyghtah) asdhranatvd anumnbhve Sabdaprasiddho Vtha iti yat svarpam bhavadbhih saugatair uktam tasya vyghta iti sambandhah / / (K.36b, D.114-1) '4^ (tadapeksay) tadapeksayeti / avayavasamudydyapeksay / na ca tesm arthntaratvam bauddhamate smkhyamate v siddham iti bhvah / / (K.36b, D. 115-1)

104

YUKTIDIPIKA

10

a n u p a p a n n a m / kasmat / pramanavisayatvat^ 1 )/ satyam asty esam samanyaparikalpan / s tu pramnavisay na 1 prameyavisay / prameyam tu smnyam anumnasyety ayam abhyupagamo vah / tac csdhranatvt svargdinm pratisiddham / tasmt tyajyatm 2 iyam sanknumnam evgama iti / anyah punar anumngamayor abhedapratijrW 2 ) idam aha / svargdayah sabd na 3 p r a m n a m / kasmt / pramnntarena tadarthnupalabdheh / yasya hi sabdasyrthah pratyaksato 'numnato v nopalabhyate sa na pramnam / itaras tu pramnam 4 tadyath nadys tire pakvam mravanam 5 pathi gudasakatam 6 viparyastam iti / na ca svargdisabdnm arthah pramnntarenopalabhyate / tasmd yath vibhur tm sarvatra sukhdisambhavd ity evamdayo bauddham prati dharmyasiddhatvd 7 ayathrth<>s 8 tath vedasabd api pryeneti / etat W 3 ) na yuktarpam / kasmt / anyyena^4) sarvasabdpavdt / k hy atra yuktir yad asmaddibhir
X K., P. andD.: 2 A. tyajatm 3

na tu,

5 A. mravanam 6 A. gudasarkarm 7 K., P. and D.: dharmayasiddhatvdayo 8

A. svargdayo na sabdh A. na pramnam

K. and P.: yathrths A. ayathrthas D. siddhdayo yath arthh, s.m. siddh na yathrthh

t1) (pramanavisayatvat) pramanavisayatvad iti / pramanye sadhya aptoktatvam anumanam / na tu svargdisabdnm svrge pratyaye 'numnatvam iyat bdhitam bhavati / yathoktam janmatulyam hi buddhlnm ptnptagirm srutau / j^mndikop^ogam^ca nnumne trilaksanah // iti // (K.36b, D.115-2) (2) (abhedapratijfia) abhedapratijna iti / svargdisabds tvan na pramnam, ye tu sabdh pramnam pramnntarasamvdyarthapratipdaks te 'numnam upacrd anumnavat paroksrthavisayatvt / anyas tu vycaste anumngamayor ity anumanam upalaksanam / tena yasya vacanasya pramnena samvdam arthah pratipadyate tad vacanam tatah pramnt pratyaksd anumnd vbhinnam upacrt / siddhntl tv anumnasamvdn mukhyam anumanam uktam ity anirdistadvayam upanyasyati / evam saty apramnatvam ca syd iti na hy anumnasamvdt pramntvam bhavaty anumnatvam v / tato hi pramnatvam nisclyatm nma / bhavati tu tatpramnkarand eva caityavandant svarga itydlnm aprmnyam yady api sa icchati tathpy adhyruhyaivam abhidhnam / asmadguravas tv abhedapratijna iti prasajyapratisedho 'y a m / tennumngamayor yo bhedam na pratijnlte / evam hy anumngamayor bhedah syd yady gamo bhavadabhimato vedbhidhnah syt / na caiva<m>* / tath hi dvividha gamah / nadys tire phalni santltydir laukikas tasya cptoktatvd eva prmnyam / atas tesm evptavdd avisamvdasmnyd anumnat / ptoktam pramnam iti ca pramnntarasamvdn niscitam / anyah punar gamah pramnam eva na bhavatlti prvapaksbhipryah / prk tu vedavacasm api prmnyam abhyupagamynumnd abheda ukta iti visesah // (D.115-3, not found in K.) *D.: caiva (3)(etat tu) evam prvapaksavitv siddhntam ha etat tv iti / / (K.37a, D.116-1) (4) (anyyena) anyyeneti / anyyena tvac chabdnm kesmcit prmnyam yuktam bhavi-

__

DVITIYAM HNIKAM SK6,7,8

105

anupalabhyamnrtham pramnabhtnm api vkyam ayathrtham 1 syt / sarvena cvasyam2 kascid pto 'bhyupagantavyah 3 / ato 'yam tatrpi samnah prasangah / na ca pramnam svrthasiddhaye pramnntaram 4 apeksate / tatra yadi sabdasya pramnntarpeksam yathrthatvam sriyate tena na 5 kevalam svargdayah / kirn tarhi / sabd evpramnam iti prptam / anumnasya ca pramnntaranirapeksasya gamakatvnabhyupagamd 6 gamasya tato 'rthntaratvam 7 sutarm prasajyate 8 / tasmd yukty gamavirodhina evamvidh nstikavdh 9 sreyo'rthibhir drd apohy iti sthitam etad anumnd asiddham vastu 10 yat tad ptgamt sdhyam iti 1 1 / evam asya trividhasya pramnasya aindriyikam^1) kranntarato^ 2 ) 12 'nupalabhyamnam ca prameyam vykhytam / etasmt tu yad anyad tad asad iti pratyavagantavyam / / 6 - 7 / / ha: yady 1 3 evam pradhnasysattvaprasangah anupalabdhau 1 4 kranntaratvnupalabdheh 1 5 / tad dhi pratyaksvisayatve 16 saty atidrdibhir anupalabdhikranair nopalabhyate / tan na tvad atidrt smipyd vyavadhnc csygrahanam / kasmt / vibhutvt / nendriyaghtd avikalendriyair17 agrahant 18 / na 19 mano'navasthnd avasthitamanobhir agrahant / na sauksmyt 20 sasavisndinm sattvaprasangt 21 / nbhibhavd
X P. ayatharthyam A. athartha 2 A. cyasyam 3 A. ptas tasya ca vkyam adrstrtham ity abhyupagantavyam 4 A. na ca pramnntaram 5 A. omits na. 6 A. gamakatvbhyupagamd 7 K., P. and D.: 'rthntaram 8 K., P. and D.: prasajyeta 9 A. nstivcakh 10 A. asiddhavastu 11 A. omits iti. 12 K., P. and D.: aindriyakakranntarato 13 D. ity 14 A. sattvaprasangopalabdhau 15 A. kranntarnupalabdheh 16 K., P. and D.: pratyayvisayatve 17 Dkha. avikalpendriyair D. aviklavaindriyair, s.m. aviklavendriyair 18 A. anumnn 19 A. ne 20 A. abhvt 21

10

15

A. sasavisnavad asattvaprasangt

turn iti visamvadakatvat / tvadiyena tv anena yatha<rthanam(?)>* sabdanam apramanatvam syt // (K.37a, D. 116-2) *K. and D.: yath (^(aindriyikam) pratyaksasya // (K.37a. not found in D.) (2) (kranntarato) anumngamayoh // (K.37a, not found in D.)

106

YUKTIDIPIKA

asambhavat / na samanabhiharad ekatvat / tasmat 1 karanantarabhavato 'nupalabhyamnasysattvam 2 icchatah pradhnasya 3 sasavisnavad asattvaprasangah / athaitan nesyate / kranntaram tarhy anupalabdhau vaktavyam iti / ucyate: yat tvad uktam(105.13) anupalabdhau kranntarnupapatteh 4 pradhnasysattvaprasanga ity atrstu 5 SAUKSMYT TADANUPALABDHIR NBHVT^/ (SK8ab') yat tktam(105.18) sasavisndinm api sattvaprasahga 6 iti tad ayuktam / kasmt / s d h a n o p a p a t t e h / asti hi pradhnasya sauksmyt tadanupalabdhau sdhanam na sasavisndinm / kirn tat / ucyate:

10

KRYATAS TADUPALABDHIH / (SK8b') pradhnasya hi kryata7 upalabdhir ity etad uparistt pratipdayisymah 8 (SK9) / na tu sasavisndinm kryam asti / tasmd visamo 'ya-m upanysah (cf.MBhsya.1.16.13, U8.18 et passim) / ha: evam api pratijnn<ya>tarnarthakyam 9 ekena krtatvt / sauksmyt tadanupalabdhir10 ity ukte gamyata etan nbhvd iti / tasmt tadvacanam anarthakam^2) iti / ucyate: na vltvltaparigrahrthatvt 1 1 / evam siddhe 12 yat pratijndvayam karoti taj jfipayaty cryo(cf.MBhsya.I.33.17, 1.35.9 et passim) vitvitbhym abhipretrthasiddhih <iti> / prk ca 13 sauksmytisayt 14 tadanupalabdhir ity caksnah pratipdayati purastd vitah prayoktavya iti /
1 D. kasmat, s.m. tasmt 2 A. mnasya sattvam 3 K., P. and D.: pradhnasypi 4 K., P. and D.: kranntarnupapattih 5

15

20

K., P. and D.: atas tu ^A. sasavisndivad asattvaprasanga 7 A. krya 8 A. pradatipdayisymah 9 K., P. and D.: pratijnntarnarthakyam A. pratijnnnatar0 10 A. sauksmyksadanupalabdhir 11 D. parigrahrthatvt, s.m. parigrahrtham 12 A. siddhe satt 13 K., P. andD.: tat 14 A. sauksmyt

(*) (SAUKSMYT T A D A N U P A L A B D H I R NBHAVT; K R Y A T A S TADUPALABDHIH) sauksmyt tadanupalabdhir iti / vltaprayoge vihite 'bhvd eva tadanupalabdhir bhavatu* / na sauksmyd iti prasarigidharmntaram, tannivrttir nbhvd ity avltena kriyate / sauksmyt tadanupalabdhir ity asy vltapratijfiy hetuh kryatas tadupalabdher(SK8b?) iti / tath nbhvt tadanupalabdhir ity asy avltapratijny api hetuh kryata upalabdher iti / evam pratijndvayayogy eka eva hetur ity abhinavaguptakrte smkhyanirnaye / / (K.37b, D.117i) *K. bhavitum D. bhavitum, s.m. bhavatu (2) (tadvacanam anarthakam) nbhvd iti vacanam anarthakam sauksmyagrahanad eva nbhvd ity asyopalabdher iti / / (K.37b, D.117-2)

DVITIYAM AHNIKAM SK8

107

ekasmims ca visaye dvau 1 prayunjnah samuccayena siddhim dyotayati / kim siddham bhavati / yad uktam tantrntariyaih "na prthakpratipattihet vltvitau" iti tad istam eva2 sangrhitam bhavati / tatra vitasya pratijn 3 sauksmyt tadanupalabdhih tatra 4 cvitasya prasangidharmntaranivrttirpena 5 nbhvt 6 / hetur ubhayayogi / katham / yasya pratyaksato 'nupalabhyamnasya "kryatas tadupalabdhih 7 "(SK8b') tasya "sauksmyt tadanupalabdhih" (SK8a) drst 8 tadyathendriynm / yadi punar asybhvad anupalabdhih syt, kryato 'nupalabdhiprasangah / asti ceyam kryata upalabdhih / tasmt "nbhvt"(SK8b') / na ced abhvt parisesatah "sauksmyt tadanupalabdhih" (SK8a) iti / ha: kim punah tat kryam yad bhavn pradhnasystitve Ungarn9 casta iti / ucyate: MAHADDI TAC CA KRYAM PRAKRTIVIRPAM SARPAM CA 1 0 // (SK8cd) tad dhi mahad ahamkrendriyavisesvisesalaksanam kryam11 pradhnena visadrsam sadrsam cety uparistt(SK10,ll) pravedayisymah 12 / ha: prastvbhvd ayuktam etat / kim punar adhikrtyedam ucyate prakrtivirpam sarpam ca mahaddi kryam iti / ucyate: 13 "vyaktvyaktajnavijiinn mokso Vpyate" (cf.SK2d) ity etat prakrtam / etni 14 ca parasparavaidharmyasdharmyapratipattim 15 antarena na sakyam 16 vijntum 17 ity evamartham idam 18 prastyate / t asm an nkasmiko vairpyasrpyopanysa iti / iti yuktidipikym saptatipaddhatau 19 dvitiyam hnikam /

10

15

20

X K., P. and D. dvau 2 A. evam 3 A. omits pratijn. 4 K., P., D., and A.: tasya Dkha. tatra 5 0 A. prasiddhidharmntara 6 Dkha. rpenbhvt 7 A. omits tad. 8 K., P. and D. omit drst ... parisesatah sauksymt tadanupalabdhih(107.7-10). 9 A. astitvalingam 10 A. ca sarpam 11 A. mahadahamkrendriyvisesavisesalaksanakryam 12 A. pratipdayisymah 13 K., P. and D. omit ucyate. 14 A. tni 15 D. sdharmyapratipaksam, s.m. sdharmyapratipattim 16 A. sakyni 17 A. jntum 18 K., P. and D. omit idam. 19

D. iti srimadcryesvarakrsnaviracitym smkhyasaptatau yuktidtpiknmni vivarane P. iti sriyuktidipikym saptatipaddhatau

T r t i y a m

A h n i k a m

[om namah sivaya 1 /] ha: stm tvad vairpyasrpyacint 2 / kryam idam eva tvan 3 mahaddi pariksisymahe kirn prg utpatter asti nstiti / kutah samsaya iti cet / syn^1) mat am / asangatrtham prakaranntaram 4 upaksipyate bhavat / na cvidyamnasambandhasya samsayasya5 prakaranntare 'bhidhlyamnasya nirnitim sdhvlm cry manyante 'vakssambhavd iti / ucyate asti samsayvaksah / kasmt / acryavipratipatteh / prg utpatteh kryam asad ity cryh kandksapdaprabhrtayo 6 manyante / sad asad iti bauddhh / naiva san nsad ity anye / tasmd upapannah samsayah / tatredmm bhavatah k pratipattir iti / ucyate: nvidyamnasya mahadder vikrasya pradhnd virbhva iti pratijnimahe / kasmt 7 / sanniveSavisesamtrbhyupagamt / na hi nah krand arthntarabhtam kryam utpadyata ity abhyupagamah / kirn tarhi / visvtmaknm sattvarajastamasm apagatavisesvisesh sanmtralaksanopacayh 8 pratinivrttaparinmavyprh paramavibhgam upasamprpth sksmh saktayah / tsm 9 adhikrasmarthyd upajtaparinmavyprnm sanmtrnukramena pracayam upasampadyamnnm sannivesavisesamtram vyaktam 1 0 / etasym kalpanym asata utpattau kah prasanga iti / etenaiva bhynm tantvdikrynm patdlnm sannivesavisesamtratvd 11 asata utpattih 1 2 pratisiddh boddhavy /

10

15

20

1 D. atha trtiyam ahnikam rabhyate No word of salutation is found in A. 2 Dkha. vairpyacint 3 A. and Dkha.: idam etvan 4 K. and P.: asarigatrthaprakaranntaram D. asangatt prakara0, s.m. asangatrthaprakara0 5 K., P. and 0 D. omit samsayasya. 6 P. knd A. knda0 7 A. pratijnimahaikasmt 0 8 A. apagatavisess sanmtra D. apagatavisesvisesh sanmtralaksano0, s.m. apagatavise0 svisesasanmtropalaksano 9 A. tesm 10 A. omits vyaktam. 11 A. sannivesamtratvd 12

Dkha. asadutpattih (this is also possibly the original reading).

syad iti / sambhavanam pradarsayann abhyupagamamatram etat / / (K.38b, D.120-1)

110

YUKTIDIPIKA

10

15

20

aha: avidyamanam 1 etat / kasmat / asiddhenarthantarasiddheh 2 / yadi hi sannivesavisesamtratvam kryasya siddham syd ata 3 et ad yujyate vaktum tadabhyupagamd asadutpatter aprasanga iti / tat tv asiddham dravyntarabhtasyvayavino nispattipratijiint / tasmt kkavisnc chasavisnasiddhivad ayuktam sannivesavisesamtrbhyupagamt 4 satkryasiddhir iti / it as csat kryam / a g r a h a n t / iha srotrdinm visayabhtasya^1) tatsannidhnd^2) avasyam grahanena bhavitavyam / yadi ca prg utpatteh sat kryam syt tad api srotrdisannidhnd grhyeta 5 na tu grhyate / tasmd asat kryam / anupalabdhikranasadbhvd 6 iti cet / tatraitat syt / asti prg utpatteh kryasynupalabdhikranam / tasmd asya 7 sato 8 'py agrahanam 9 bhavati / uttaraklam tadvigamd grahanam iti / etac cnup a p a n n a m / kasmt / asambhavt 1 0 / tad dhi pratyaksavisayatve 11 saty atidrdibhir anupalabdhikranair(cf.SK7) nopalabhyate / na caism tatra sambhavah / tasmd asad etat / <kim cnyat /> kranntarnabhidhn t 1 2 / na ctidrdivyatiriktam anupalabdhau kranntaram adhidhve yato J syagrahanam syt / atas csad eva / kirn cnyat / krannupalabdhiprasangt / anupalabdhikranasadbhvt kryasygrahanam icchatah krangrahanaprasangah / kasmt / abhinnadesatvd ekendriyagrhyatvt sthlatvc ca / tat( 3 ) tv anistam / tasmd ayuktam anupalabdhikranasadbhvt satah kryasygrahanam iti / pramnntaranivrttiprasangd ayuktam^4^ iti cet / syd etad / yadi tarhi pratyaksavisayam^5) evsti tato 'nyan nstity etad upagamyate 13 tentmdriyavisayasynumnasya nivrttiprasangah / anistam cai1 A. 2

apadyamanam K., P. and D.: siddhenrthntarsiddheh A. asiddhenarthantarasiddheh Dkha. asiddhena rthantarasiddheh 3 P. tata A. omits ata. 4 K., P. and D.: sannivesamtrabhyu0 5 P. grhyate 6 A. anupalabdhikranam sad 7 Dkha. yasya 8 D. svato, s.m. sato 9 A. api grahanam 10 A. anupasambhavt 11 K., P. and A. pratyaksavisayatve D. pratyaksavisayatve, s.m. pratyaksavisayatve 12 K., P. and D. omit kranntarnabhidhnt ... atas csad eva. 13 A. abhyupagamyate D. upagamyate, s.m. abhyupagamyate

(^(visayabhutasya) sabdasyety arthah / / (K.39a, D.121-1) (2) (tatsannidhnd) tasya srotrasya sannidhnt / / (K.39a, D. 121-2) (3) (tat) tat krangrahanam / / (K.39a, D.122-1) (4) (pramnntaranivrttiprasangd ayuktam) satkryavdyuktih / / (K. 39a7 D.122-2) (5) (pratyaksavisayam) pratyaksavisayasyaivstlti pratyayo nnyasya / / (K.39a, D. 122-3)

TRTIYAM AHNIKAM SK9

111

tat / tasmn nnupalabdher asat kryam iti / et ad apy ayuktamW/ kasmt / kriygunavyapadessambhavt / yad dhi pratyaksato nopalabhyate tat 1 kriyaystiti samscyate yath harmy vast hit nm trnnm udvahand 2 vyuh, gunena yath mlatHat gandhena 3 , vyapadesena v krydin yathendriyni / na 4 prg utpatteh kryasya kriygunavyapadesasambhavah (cf.VS.9.1) / tasmd asat kryam / itas 5 csat kryam / kartrpraysasphalyt / iha prg vypropakramt^2) kartras tasmt phalam upalipsamnh kryavisesaniyatasmarthyam sdhanam updya vypriyante / tac cet prg api vyprt syt tadarthasya parispandasya narthakyam prptam / anist am caitat / tasmt kartrpraysasphalyd asat kryam / parinamdyupapatter adosa 6 iti cet / syn matam / kranasya parinmavyhasamslesavyaktipracayalaksann dharmn yasmt 7 kartrdlni kurvanti nnarthakni syuh / sattvam ca 8 kryasya na nirudhyate / ka evam sati dosah syd iti / ucyate na sakyam evam kalpayitum / kasmt / mrgntarnupapatteh / parimno hi nmvasthitasya dravyasya9 dharmntaranivrttir 10 dharmntarapravrttis ca (cf.AKBh.p.159.19, YBh.on YS.3.13) / tatra sato 11 dharmntarasya nirodhbhyupagamd asatas cotpattipratijiinn 12 nedam mrgntaram 13 rabhyate / evam vyhdayo 'py upasamhartavyh / tasmt parinmdibhir abhibhavc 14 [ca] kartrdinm arthavattvd asat kryam iti 1 5 / tath coktam jahad dharmntaram prvam updatte yad par am / tattvd apracyuto dharml parinmah sa ucyate / / <itas>16 ca na sat kryam / rambhoparamayor dyantvisesaprasangt 1 7 / yadi sat kryam syt tena yah kriyrthah sdhannm dau parispandah
2 A. tad dhi 2 K., P. and D.: gunodvahand 3 A. gandhana 4 A. na tu 5 K., P. and D.: kutas 6 K., P. and D.: na dosa 7 A. api 8 K., P. and D. omit ca. 9 K., P. and D. omit dravyasya. 10 A, omits dharmntaranivrttir. K., P. and D.: nivrttih 11 D. svato, s.m. sato 12 K. and D.: jnnc ca P. jnnn ca 13 A. arthntaram 14 K., P. and D.: abhvas 15 K., P. and D. omit iti tath coktam ... parinmah sa ucyate 16 K., P. and D.: kutas A. tac 17 0

10

15

20

//.

A. atyantvisesa

(1

)(etad apy ayuktam) asatkaryavdy ha / / (K.39a, D.122-4)

(2) (vypropakramt) samartht sdhand ity arthah / / (K.39b, D.123-1)

112

YUKTIDIPIKA

10

15

20

25

so 'nte 1 'pi syat, yo vante 2 viramah sa adav api syat / kasmat / sadavisesat / na tu tad asti / tasmd asat kryam 3 / <itas>4 casat kryam / utpattidharmasydyantayor 5 avisesaprasangt / yadi sat kryam syt tena yath 6 nispannasyotpattidharmenbhisambandhas tathdv api 7 syt / yathaivdv abhisambandhas 8 tathnte 'pi syt / drstas tv abhisambandho nbhisambandhas cdyantayoh / tasmd asat kryam / itas 9 csat kryam / janmasacchabdayor virodht / iha janmasabdah prgabhtasyrthasya 10 bhvaprakramam 11 ha / sacchabdas tu kriyntarahetutvam 1 2 / yadi 13 sato janma syd aikrthyam anayoh syt / na tv etad 14 asti / tasmd ayuktam saj jyata iti / ucyate: yad uktam (110.3) dravyntarabhtasyvayavino nisjDattipratijnnn 15 na sannivesavisesamtratvt sat kryam ity atra brmah: tadasiddhih bhedengrahant / yadi tantvdibhyo dravyntarabhtasyvayavino nispattih syt tena yath tantukalpe patas tatraiva v 16 patntaram hitam bhedenopalabhyate tathaivopalabhyeta 17 / na tpalabhyate / tasmn na dravyntaram / samavyd agrahanam iti cet / syd etat / samyoginor dravyayoh saty dhrdheyabhve bhedena grahanam bhavati / samavyalaksan 1 8 tu prptis tantupatayoh / tasmn nsti bhedena grahanam iti / tac cnupapannam / kasmt / asiddhatvt / siddhe saty arthntarabhve 19 Vayavinas tatprptau ca samavye sarvam etat syt / tat tv asiddham ubhayam / tasmd ayuktam etat / kirn cnyat / drstntbhvt / mahparimnam 20 dravyam anyatrhitam samavyd bhedena nopalabhyata 21 ity etasminn arthe 22 paryanuyuktasya kas te drstntah / na csty anudhrto vdah / vypter agrahanam 2 3 iti cet / syn matam / akryakranabhtam dravyam 24 saty api sambandhe na dravyntaram vyasnuta ity ato bhedena grhya2 K., P. and D.: v yo 'nte 3 A. krya iti 4 K., P. and D.: kutas A. tac 5 A. dharmasytyantayor 6 A. tath tena 7 A. omits tathdv api. 8 A. yathaivbhisambandhah 9 K., P. and D.: kutas 0 10 A. prg na bhtasy Dkha. prdurbhtasy0 11 K., P. and D.: bhvakramam 12 K., P. and D.: hetutvam ha 13 A. yadi ca 14 A. aitad 15 K., P. and D. omit nispattipratijnnn ... tantvdibhyo 16 K., P. and D. omit v. 17 A. omits tathaivopalabhyeta / na tpalabhyate. 18 A. samavyalaksant 19 A. arthbhve 20 A. samhraparimnam 21 Dkha. bhedenopalabhyate 22 A. etan matam instead of etasminn arthe 23 A. vypte na grahanam 24

dravyntarabhtasyvayavino.

K., P. and D. omit dravyam.

TRTIYAM AHNIKAM SK9

113

te / tantupatayos tu kryakranabhtatvd vyptih / tasmn nsti bhedena grahanam iti / etad apy ayuktam / kasmt / sdhyatvt / saty arthntarabhve 'vayavidravyntaravat kryakranabhvah 1 sdhyah samavyas ca / ata iyam vyptih syt / s cprasiddhety ato na samyag etat / vemdivad 2 iti cet / syd etat / yath 3 saty arthntarabhve vemdayo 4 Vayavinah kranam evam tantavo 'pi <iti> / etad 5 anupapannam / kasmt / anabhyupagamt / karanam 6 vemdayah 7 patasya 8 na kranam ity ayam abhyupagamo 9 nah 1 0 / tasmd visamo ' y a m drstntah / kirn cnyat / tadvad avyptiprasangt / vemdivad 11 arthntaram patt 1 2 tantava ity evam bruvatas tadvad avyptiprasangah / kirn cnyat / sparsakriymrtigurutvntaravatas tadvati pratlghtt / iha 13 sparsntaravati sparsntaravatah 14 pratighto drstah / tadyath ghatasysmani / sparsntaravms ca te patas tantubhya ity ato 'sya 15 tadvypitvam 16 ayuktam / evam ca kriydayo vaktavyh / tasmd yuktam etad bhedengrahann 17 nvayavi dravyntaram iti 1 8 / itas ca 19 nvayavi dravyntaram / krtsnaikadesavrttyanupapatteh / sa hy avayavesu vartamnah krtsnesu v 20 vartate pratyavayavam v / kirn ctah / tan na tvat krtsnesu vartate / kasmt 2 1 / ekadesagrahane grahanbhvaprasangt 2 2 / yad anekesu vartate tasya krtsndhragrahane sati grahanam 23 spastam 2 4 / tadyath dvitvdlnm / evam ca sati visndigrahane gograhan<bhva>prasangah25 / kirn ca avayavnavasthprasangt / sa hy avayavn vypnuvams 26 tadvyatirekenvayavntarbhvt kena vypnuyt / avayavntarbhyupagame cnavasthprasangah 27 / krtsnaikadesavrttiprasarigas 28 ca samnah / tasmn na sarvesu parisampyate /
1 A. karmakranabhvah 2 D. vimdivad, s.m. vemdivad 3 K., P. and D.: tadyath 4 D. vTmdayo, s.m. vemdayo 5 A. etad apy 6 A. kranam D. karanam, s.m. kar 7 D. vimdayah, s.m. vemdayah 8 A. omits patasya. 9 Dkha. abhyupagamo 'yarn 10 K. and P.: vah A. na D. vah, s.m. nah 11 1 D. vtmdivaa , s.m. vemdivad 12 P. pat 13 K., P. and D.: iti 14 K., P. and D. omit sparsntaravatah. 15 A. has a lacuna in the place of bhya ity ato 'sya. 16 18 A.ita 19 A. omits 20 A. omits 21

10

15

20

A. tadvyptitvam K. and P.: bhednm grahann D. bhednm grahann, s.m. bhedengrahann

itas ca. v. A. tasmd 22 A. omits grahanbhvaprasangt / yad anekesu vartate tasya krtsndhragrahane. A. (ekadesagrahane) saty agrahanam A. and Dkha.: drstam (this is also possibly the original reading). 25 All the Mss read gograhanaprasangah. 26 A. avayavt prpnuvams A. prasangt 28 A. krtsnaikavrttidesaprasangc

114

YUKTIDIPIKA

10

15

na 1 pratyekam / anekatvaprasangad / anekadharaparisamaptam hy anekam rpdi drstam iti / kirn cnyat / sstrahneh / pratyavayavam parisampto VayavTty etad icchato mrtimatvayavena samnadesah 2 syt / tatas ca yac chstram "mrtimatm asamnadesatvam" iti tasya vyghtah / avayavaparimnam ca p r p n o t i ^ mahattvdiparisamptatvt 3 / ekadravyam ca 4 prpnoti( 2 V tatas ca yac chstram "dravyam anekadravyam adravyam v" (cf.Vyo.p.231.5-6;VSC.onVS.2.1.11) <iti> tasya hnir etvat csya vrttir 5 bhayaiiti^ bhavet / sarvath ca dosah / tasmn nvayavi dravyntaram / arthntarvasthne^ 3 ) 'rthntarotpattivin^adarsand anyat vam' 4 ' 6 iti cet / syd etat / vidyamnesu 7 tantusu pato na bhavati samyogalaksanasya kranntarasynutpatteh / samyogottaraklam tu 8 bhavati^ 5 )/ kranasmagry 9 vidyamnesv eva ca tantusu vinsam upayti 1 0 / vibhgd^6) arthntarvasthne 11 crthntarotpattivinsau drstau / tadyath himavadavasthne davgneh 12 / tasmd arthntaram 13 pat as tantubhya iti / etad apy ayuktam / kasmt / sdhyatvt / sdhyam tvad etat kirn atrrthntaram 1 4 utpadyate vinasyati vhosvit tantusv eva samavasthnavisespeksasya patbhidhnasya pravrttinivrtti senvanavad bhavatah / tasmd etad api nvayavino 15 dravyntarabhve Ungarn / tatpurusabahuvrihidvandvasamsopapatter anya iti cet 1 6 / syn matam / ihrthntaratve sati tat1 D. tena, s.m. na 2 A. na samnadesah 3 A. na mahattvdisamptatvt 4 K., P. and D.: na ca 5 K., P. and D.: etvatz vrttir 6 A. anyathtvam 7 A. dvidy0 8 A. omits tu. 9 K., P. and D.: smagryd 10 A. upaynti 11 D. vasthone, s.m. vasthne 12 A. dvgnes 13 P. athntaram 14 A. omits atra. 15 K., P. and D.: apy avayavino 16

K., P. and D.: dvandvasamse instead of dvandvasamsopapatter anya iti cet

(^(prapnoti) pratyavayavam parisamaptipakse / / (K.40b, D.127 without number) (2) (prpnoti) avayavl// (K.40b i.n., D.127 without number) (3) (arthntarvasthne) asatkryavdy hrthntareti // (K.40b, D.127-3) (4) (anyatvam) patasya / / (K.40b i.n., not found in D.) (5) (bhavati) patah / / (K.41a, D.127-4) (6) (vibhgd) prthag arthntaratvenvasthnt / na tv evam satkryavdipakse patasya tantubhyah prthagavasthnam iti / / (K.41a, D.127-5)

TRTIYAM AHNIKAM SK9

115

puruso drstah / tadyath rjnah puruso rjapurusa 1 iti / bahuvrihis ca citraguh sabalagur iti 2 / dvandvas ca plaksanyagrodhv iti / asti cehpi tatpurusas tantnm patah / bahuvrihis ca drdhatantuh suklatantuh 3 / dvandvas ca tantupatv iti / tasmd avayavy4 arthntaram iti 5 / etac cyuktam 6 / kasmt / anekntt 7 / ananyatve 'pi hi 8 tatpuruso drstah / tadyath sengajah knanavrksa iti / bahuvrihis ca virapurus 9 mattagaj seneti^ 1 ) 10 / dvandvas tu yadi syt satyam evrthntaram 11 avayavi syt / na tu kascit patvasthym evam 12 prayunkte 13 tantupatv nayeti / tasmn manorathamtram etat / etena samkhysmarthyabhedh pratyukth / te cpi cnarthn<tara>tve 14 sati sendisu drst<>h 15 / tasmn nvayavi dravyntaram / dravyntarabhtasyvayavino <nispattipratijnnn na tu sannivesavisesamtratvt> 16 sat kryam ity etad ayuktam / yat punar etad uktam (110.10) anupalabdher asat kryam ity atra brmah: etad apy ayuktam / kasmt / samsayakranatvt / sa<d>asadvisaynupalabdhir 17 ity etasmd eva hetoh smsayik vayam / tm eva tu niscayrtham avalambamno na yuktimrgam anuyti / yat punar etad uktam(110.15) kranntarnabhidhnd ity etad apy anupapannam / kasmt / abhiprynavabodht / yo hi yath knde bad<a>rny 18 arthntarabhtny <>hitni19 tath krane kryam astlty caste tarn praty ayam uplambhah syt / vayam tv anekasaktadharminah sahakrisaktyantar<nu>grhitasya 20 prvasyh saktes tirobhvam uttarasys cvirbhvam updadhnh kranam eva kryam ity anumanymahe / tayos tu saktyor yugapad agrahanam itaretarapratibandhahetutvt / vastrasyymavistravat krmngam iva drastavyam / yath vastrasyopasamhrapratibandhd ymavistrau na grahanavisayatm pratipadyete sattm v na jahitah
1 K., P. and D.: rajnah purusa iti 2 K., P. and D. omit iti. 3 A. suklam tantuh 4 K., P. and D.: tasmc cvayavo 5 K., P. and D. omit iti. 6 A. etad apy ayuktam (this is also possibly the original reading). 7 A. anaikntt 8 K., P. and D. omit hi. 9 A. drsto virapurus 10 D. mattgaj send iti, s.m. mattagajasen iti 11 K. and P.: evvayavntaram D. avayavntaram, s.m. arthntaram 12 K., P. and D.: eva.... 13 K., P. and D. omit prayunkte ... prg utpatteh kryasya samadhigamam 14 A. cnarthnatve 15 16

10

15

20

25

(115.8-116.15).

A. drstas We follow Pandeya. A. nispattipratijnnnnusannivesavisesamtratvt A. sa ca sadvisay0 18 A. badirny We follow Pandeya. 19 A. ahitni We follow Pandeya. 20 A. saktyantargrhitasya We follow the suggestion of Pandeya.

(*) (mattagajasena) matta gaja yasyam senayam sa gajadinam senangatvenasenatvat / / (K.41a, D.I28 without number)

116

YUKTIDIPIKA

10

15

20

kurmasyevangani tatha tantvadmam api bhavanam karanabhimata karyabhimat cvasth / <kramena tv vis tiras ca bhavanti>1 / tannimittas tadgrahangrahanavikalpah / etena kran<>grahanam2 pratyuktam (110.17) / yad apy uktam(110.21) pramnntaranivrttiprasangd iti satyam etat / yat tktam(111.2) kriygunavyapades<>sambhavd anumn<>bhva3 iti tad anupapannam / kasmt / prthaktvnabhyupagamt / kryakranaprthaktvavdinas tatkriygunnm prthaktvam anumtum yuktam ity <atas> tantvavasthne 4 patakriygunagrahand anumnbhva ity ayara uplambhah svaksah syt / asmkam tu kranamtrasyaiva sanghtd krntaraparigrahd v kriygunnm pracitir vyaktiviseso bhavatiti bruvatm adosah / vyapadesas tu kryakranaparyyah / so 'y u ktah / kasmt / anekntt / dravyagunatvakarmatvdinm kriygunakryakranabhvo 'tha ca sattvam isyate bhavadbhir atha lingaparyyah / na tarhi vayam paryanuyojy vyapadesbhvd asat kryam iti / kirn kranam / prakarant / vipratipattau hi satym lingatah prg utpatteh kryasya samadhigamam karisyma 5 iti prakrtam evait a t 6 / anaikntikatvam ca 7 samnam nispattyanantaram dravyasystitvbhyupagamt / "agunavato dravyasya gunrambh<t>( 1 ) 8 karmagun agunh 9 " (VS.7.1.12) iti vacand utpannamtram dravyam niskriyam nirgunam avatisthata iti vah paksah / na csya tathbhtasya^ 2 ) lingam asti / atha cstitvam bhavadbhir abhyupagamyate / siddher^3) grahant sadbhva 10 iti cen na sarvavivdasiddhiprasangt / drstntaviruddham^ 4 ) artham pratijiiya prati<s>idhyamnena11 siddhabuddhivisayat smartavyetyt 5 ) 12 etasym kalpanym sarvavdasiddhiprasangah syt / kirn cnyat / pratipakse
l A. kramena v sthiras ca bhavan 2 A. kranagrahanam 3 A. kriygunavyapadesasambhavd anumnbhva We follow Pandeya. 4 A. atantvavasthne We follow Pandeya. 5 K., P. and D. read prayisyma instead of karisyma after a lacuna (cf.p.H5,fn.l3). 6 A. evetad 7 K., P. and D. omit ca. 8 K., P. and D.: gunrambhah A. gunrambhh 9 A. akarmagun instead of agunh 10 A. grahansadbhva 11 K., P. and D.: pratividhyamnena A. pratipdyamna We follow Raghavan. 12

A. siddhabuddhivis ayanmantavyety

(1)(gunarambha<t>) prathame pakse / / (K.41a i.n., D.129-1) (2) (tathbhtasya) agunavato dravyasyotpattau / / (K.41a, D.129-2) (3) (siddher) utpannamtrasyadravyasyasiddhihsarvajnairgrhyataiti tasystitvasambhavah// (K.41a, D.129-2) (4) (drstntaviruddham) drstntaviruddham pramnaviruddham ity art hah / bhyodarsane vyptipakse v drstnta eva yuktimlam iti yuktiviruddham ity arthah / / (K.41a, D.1293) (5) (siddhabuddhivisayat smartavy) rtatrnakrinl devat kcid evety upahsah / / (K.41b, D.129-4)

TRTIYAM AHNIKAM SK9

117

ca 1 s a m n a t v t / asmatpakse 'pi tarhi bhagavatpancasikhdmm pratyaksat v t ^ sat kryam 2 abhyupagantavyam / tasmn na kriygunavyapadesasambhavd asat kryam / yat punar etad uktam(111.7) kartrpraysasphalyd asat kryam ity atra brmah: etad apy ayuktam / kasmt / ASADAKARANT / (SK9a') yady ubhayapaksaprasiddhasysatah kriyyogah syd ata etad yujyate vaktum krye sati kartuh prayso 'narthaka iti / tat tv asatah karanam 3 anupapannam / tasmd ayuktam etat / h e t v a n a b h i d h n d a s i d d h i r (2) iti cet / syd etat / yath 4 nispannatvn madhvdinm dhranasamartho ghato na kriyata 5 ity ayam apadisto hetur asmbhir evam 6 ittham kryasysatah 7 k<a>ranam8 nopapannam^3) iti noktam bhavat / tasmd asiddhir iti / etac c n u p a p a n n a m / kasmt / saty asati v s a m b a n d h e d o s a p r a s a n g t / tad dhi kriyamnam sati v sambandhe krakaih kriyate 'sati v / sambandhas csya bhavan 9 pravrttikle^ 4 ) 10 v kraknm 11 syn nivrttikle 12 v / kirn ctah / tan na tvat pravrttikle 13 sambandho yuktah / kasmt / a d r a v y a t v t / pravrttikle kartrdinm kriygunavyapadesbhvd avastubhtam sasavisnasthniyam 14
1 K.f P. and D. omit ca. 2 D. satkryavdam 3 A. kranam 4 A. omits yath. 5 A. ghatah kriyata. 6 7 K., P. and D.: kryasya satah Dkha.(?) kryasy s at ah(cf.p.117,fn.(3)) 8 All the Mss read kranam. 9 A. bhavat 10 D. pravrttikri, s.m. pravrttikle 11 A. krannm 12 A. nispattikle D. nivrttikrt, s.m. nivrttikle 13 D. pravrttikrT, s.m. pravrttikle 14 0

10

15

A. eva

K., P. and D.: avastubhtasasavisna

(^(pratyaksatvat) yad dhi pratyaksato nopalabhyate tat kriyayasti samsucyat a (111.2) ityadina prvoktena kriygunavyapadessambhavd(111.2) asat kryam uktam tan* neti / / (K.41b, D.129-5) *D. san, s.m. tan (2) (hetvanabhidhnd asiddhir) hetvanabhidhnd asiddhir ity atrokt ysiddhih / / (K.41b, D.130 without number) (3) (kryasysatah k<a>ranam nopapannam) kryasysatah kranam nopapannam* ity anydarse** / / (K.41b, D.129 in the right margin) * D. omits nopapannam. ** D. anydarse pthah <4) (pravrttikle) krakapravrttikle / / (K.41b, D.130 without number)

118

YUKTIDIPIKA

vah karyam na casti tathabhutasya^ 1 ) vastubhutena^2) sambandhah / atha 1 nivrttikle^ 3 ) 2 'bhisambadhyate 3 yad uktam(111.7) sato 4 nispannatvt kriynutpattir iti tasya vyghtah / atha 5 matam asaty api sambandhe nispattir 6 bhavatiti tena krakavyparavaiyarthyaprasangah / prg api ca 7 krakopdnt kryanispattiprasanga 8 iti / uktam ca asattvn nsti sambandhah krakaih sattvasangibhih / asambandhasya cotpattim icchato na vyavasthitih^4)9 / / iti 1 0 / (see SKT. on SK9)

10

ha: nanu ca madhyame kle kartrdibhih kryam kriyate / kah punar asau madhyamah kla iti / ha rambhya prasrt yasmin kle bhavanti kartrah / kryasy nis<n>ts11 tarn madhyamam klam icchanti 12 / / yad hetavah pravrttrambh 13 bhavanty uddisya kryam na ca tvan 14 naimittikasytmalbhah samvartate sa madhyamah klah / tasmin kriyate krakaih kryam iti / ucyate: na avasthntarnupapatteh / prn nispatter asatt nispannasya 15 sattety avasthdvayam 16 / sadasadrp cvasth 17 nsti yo madhyamah syt / ato na yuktam et ad iti / kirn cnyat / prvadosaparihrt 1 8 / uddisya
1 A. sarnbandhtha 2 A. nispattikle 3 A. sambadhyate 4 D. svato, s.m. sato 5 A. vyghttha 6 A. sambandhanispattir 7 A. omits ca. 8 A. omits krya. 9 A. mativibhramah instead of 10 A. omits iti. 11 P. kryasy nisna~ta~s{7) 12 K., R and D.: icchantiti 13 K., P. and D.: pravrtt 14 A. tva 15 A. nispannasya ca 16 A. avasthyadvayam 17 K., P. and D.: ca satt 18

15

na vyavasthitih (cf.p.H8,fn.(4)) A. kryasynisttas

A. prvadosnapahrd

t1) (tathabhutasya) avastubhutasya / / (K.41b, D.130 without number) (2) (vastubhtena) kranarpena // (K.41b, D.130 without number) (3) (nivrttikle) kartrdlnm / / (K.41b, D.130 without number) (4) (na vyavasthitih) mativibhrama iti ca pthah* / / (K.42a, D.130 without number) *D. kha pustake 'pi ca mativibhramah iti ca pthah

TRTIYAM AHNIKAM SK9

119

kryam tasytmano lbht kena saha sambandha ity atrpy ayam paryanuyogo naiva nivartata iti / tasmc citram api vkyam prasrya na kimcit parihrtam bhavat / tasmd yuktam etat saty asati v sambandhe dosaprasangd asan na kriyata iti / yasya punah sat kryarn tasya doso nsti / kasmt / UPDNAGRAHANT / (SK9aV) updnam iti kranam tantvdy caksmahe / tad^1) dhi tasya^2) krakair^3) grhyate 1 'bhisambadhyata ity arthah / tasmc ca nrthntaram 2 kryam ity atah kranenbhisambaddhnm 3 kraknm kryenaiva sambandho bhavatity adosah / ha: nanu ca yasypi sat kryam tasyopdnd arthntaram 4 tat kryam syt / kasmt / kryrthibhir updnt / yad yadartham^ 4 ) updiyate tat 5 tasmd arthntaram tadyath vemdibhyah patas tantavas ca pat<rth>ibhir6 updlya<n>te 7 / tasmt tebhyo 'py arthntaram 8 patah / etena sattvam pratyuktam / yad yadartham updiyate tat tasminn asad yath vemdisu pata iti / ucyate: na avayavipratisedht / pratisiddhas tvad avayavi dravyntarabhtah / tasmd anupapannrtham etat / kirn cnyat / SARVASAMBHAVBHVT / (SK9b') updnasmnyd vemdivad arthntaram 9 patas tantubhya iti bruvato 'rthntaratvasmnyt 10 tantuvat sarvasmt krant kryasya sambhavah 11 syt / na tv evam asti / tasmt sarvasambhavbhvd asamyag etat / kirn cnyat / jtibhedaprasangd 1 2 arthntarrambhaprasangc ca / updnasmnyd vemdivad 13 arthntaram patas tantubhya iti bruvato
1 A. kriyate 2 A. tasmd anarthntaram 3 K., P. and D.: krakenbhisam0 A. kranenbhisambandhn 4 A. anantararn 5 K., P. and D. omit tat tasmd ... pratyuktam / yad yadartham updiyate. 6 A. patdibhir 7 A. updiyate We follow Pandeya. 8 A. arthyantaram 9 D. vtmdivat padrthntaram, s.m. vemdivad arthntaram 10 K., P. and D.: 'rthntarasmnyt 11 A. sadbhvah 0 12 13

10

15

20

A. jtiprabheda D. vimdivatd1 s.m. vemdivad

(x)(tad) tantvdi / / (K.42a, D.131 without number) (2) (tasya) patasya / / (K.42a, D.131 without number) (3) (krakair) krakaih / patasya nimittakranaih kuvindaturlvemdibhih* / / (K.42a, D.131-2) *D. turtya (4) (yadartham) yannispattaye* / / (K.42a, D.132 without number) *D. nispattaye

120

YUKTIDIPIKA

10

15

20

yatha vemadibhyo 1 bhinnajatiyc^1) bhinnadesas ca tatha 2 tantubhyah patah syt / yath cvasthite pate vemdayah patntaram kurvanti tath hy avasthite pate tantavo 'pi patntaram rabheran / na caitad istam / na tarhy updnasmnyd vemdivat tantubhyah patasyrthntaratvam / yat punar etad uktam(l 19.15) yad yadartham updiyate na tat tatrstity atra brmah: ayuktam etat / kasmt / dhrdheyabhvnabhyupagam t 3 / asakrd uktam asmbhir na tantusu pato nma kascid asti / kirn tarhi / tantava eva patah <iti(?)> / tat tu sanmrgavidvesd bhavat na grhyate / kirn cnyat / anekntt 4 / upetya^2) v brmah: katham tvat tils tailrtham updiyante bhavati ctra tailam / mrdvik rasrtham updiyate bhavati csym rasah / godhuk ca payo'rtham 5 gm datte 6 bhavati ca tasym 7 ksiram / slikalpas ca tandulrtham updiyate santi ctra tandul ity 8 anaikntiko hetuh / ha: varanopalabdher ayuktam / tildisv varanam pratyaksata upalabhyate tatpratibandht taildinm agrahanam / vypras 9 ca kartus tadvigamrtho 10 na tu kryasyvaranam asti^3) / tasmd visamo drstntah / ucyate: na mrgntaratvt 1 1 / yad yatrsti 12 na tat 1 3 tadartham updiyata 14 iti prvam bhavattisrstam (119.15) / idnlm tv gamavigamrtham^ 4 ) 15 sato 16 'py updnam iti bruvato mrgntaragamanam prvavdatygo 'naikntikasya cparihra iti 1 7 / yat punar etad uktam (111.11) parinmdyupapatter adosa iti tath tad
1 D. vimadibhyo, s.rn. vemadibhyo 2 K., P. and D.: tathvasthite instead of tath tantubhyah patah syt yathcvasthite 3 A. dhrdheynabhyupagamt 4 A. anaikntt 5 A. payo 6 A. updatte 7 A. csym 8 A. ity ayam 9 K., P. and D.: agrahanavypras 10 K. and P.: tadvirgrtho A. tadvigamo D. tadvirgrtho, s.m. tadvigamrtho 11 A. nmrthntaratvd 12 A. yatra nsti 13 A. tan na 14 A. updhiyate 15 A. avagamavigamrtham 16 D. svato, s.m. sato 17

A. omits iti.

(^(bhinnajEtlyo) patah / / (K.42b, D.132 i.n.) (2)(upetya) bhavanmatam / / (K.42b, D.133-1) (3) (na tu kryasyvaranam asti) na tu tath kryasya patder varanam asti yena tadvigamrthah kartur vyprah / / (K.42b, D.133-2) (4) (gamavigamrtham) pratibandhavigamrtham / / (K.42b, D.133 in the right margin)

TRTIYAM AHNIKAM SK9

121

astu / yat tktam(111.15) mrgntarnupapatter ity atra brmah^ 1 ): etad apy ayuktam / kasmt / parinmadharmnavabodht / sato dharmntarasya nirodham asatas cotpattim parinmam abhidadhato vyaktam ayam uplambhah syt / na tv anay kusrty 1 pratisthmahe / kirn tarhi / sdhannugrhitasya dharmino dharmntarasyvirbhvah prvasya ca tirobhvah parinmah / na cvirbhvatirobhvv utpattinirodhau 2 / vyhasarnslesavyaktipracayas tu kim asato 3 dharm uta svayam 4 asanta iti vicryam / kirn ctah / yadi 5 tvad asato dharmh yath kasyeti vcyam / atha svayam asantah pascd bhavanti / tad apy ayuktam / kasmt / anarthntaratvt 6 / saty arthntarabhve prg asantah pascd upalabhyamnh satkryavdam nirkuryuh 7 / sa caism arthntarabhvo na prasiddhah / tasmt kim atrotpannam / grahangrahanavikalpe coktah parihrah / kim cnyat / dravyntarotpattivyghtt 8 / upetya vaism^2) utpattim brmah: yadi hi parinmavyhasamslesavyaktipracayamtram kryam isyate yad uktam "dravyni dravyntaram 9 rabhante" (VS.1.1.8) iti tasya vyghtah / kasmt / na hy ete bhv dravyntaram / tasmd dinakarakiranapratpamrcchitasyeva 10 dvgnyupasarpanadoso 'nutpyaiva 11 bhavatah pratipattih / etenrambhoparamotpatty<dyant>visesaprasango 12 janmasacchabda<virodhas>(?) 13 ca pratyuktah 14 (111.23, 112.8) / katham / tmabhtam hi tantnm 15 patkhyam vyhasthmyam 16 sannivesavisesam yad krakni svena svena vyprenviskurvanti tad kriyata utpadyate jyata 1 7 ity evamdir lokasya vyavahrah pravartate / yad tu krakni saktyantarvirbhvt samsthnntarenautsukyavartitm 18 avasthm upasam1 A. anaynusrty 2 A. tirobhvau cotpattinirodhau 3 K. and P.: sato D. svato, s.m. sato 4 K. and P.: svato (this is also possibly the original 5 A. tad yadi 6 Dkha. arthntaratvt 7 A. nirkuyuh 8 A. dravyntarotpattivyt 9 A. omits dravyntaram ... na hy ete bhv. 10 P. mrcchitasyaiva X1

10

15

20

reading). D. svato, s.m. svayam

K., P. and D.: dvgnyupasarpanadosnutpyaiva A. davgnyupasarpanam doso 'nupaghtyaiva We follow Pandeya. 12 K., P. and D.: etenrambhoparamotpattyavisesaprasango A. etenrambhe parama utpattyavisesaprasarigo 13 K., P. and D.: janmasacchabdas A. janmasasabdas 14 P. janmasacchabdapratyuktah 15 A. omits tantnm. 16 A. vyahasthmyam A. jantnyata 18 Dkha. saktyantarvirbhvtmasthn0

' '(atra brumah) tatra sato dharmntarasya nirodhabhyupagamd asatas cotpattipratijnanan nedam mrgntaram rabhyata (111.17-18) itydy asatkryavdyuktam dsayitum ha atra brma iti / / (K.42b*, D.133-3) *Though found in the margin of K42b, this note refers to atra brmah of K43a. (2)(esm) vyhdlnm / / (K.43a i.n., D.134 without number)

122

YUKTIDIPIKA

10

haranti tada prag upalabdham samsthanam vinasasabdavacyatam pratipadyate / paramrthatas tu na kasyacid utpdo 'sti 1 na vinsah / yat punar et ad uktam (112.8) janmasabdah prgabhtasyrthasya bhvaprakramam 2 heti tad apicchmtram / kasmt 3 / vivdt / sadasadvisayam 4 janmeti vivde 'nusakte janmasabdah 5 prgabhtasya sadbhvam casta iti bruvato 'nuktasamam / purusadv adrstatvd asiddhir iti cet / syd etat / yadi tarhi 6 kriyata utpadyate jyata ity eso 'rthah sadvisayah kalpyate 7 pradhnapurusayor api tatprasangah sadavisesd^ 8 ity atas ca vivdvastham evaitat prakaranam iti / e t a c cayuktam^ 2 )/ kasmt / samsthnavisayat v t 9 / yad bhvah svato 'narthntarabhtam samsthanam bhajate tadaite 10 sabdh pravartanta ity uktam / drstam ca loke tadyath mustigranthikundalni karoti janayaty utpdayati / abhivyakttmasujcajm^Jbkdisu^11 bhavaty utpannam jtam iti / ubhayapaksaprasiddhe 12 tu sasavisndau naite sabdh pravartante / tasmd bhavata evnistaprasahga iti / uktam ca yady asattvam ghatdinm utpattau hetur isyate / sasasrnge 'pi tulyatvd utpattis te prasajyate / / iti siddham sat kryam / itas ca sat kryam / SAKTASYA SAKYAKARANT / (SK9c)

15

20

sakyam idam asya saktas cyam asyety ayam niyamah satm drstah / tadyath caksuso rpasya ca 1 3 / asti cyam pat asya vemdinm ca 14 niyamah / tasmc
1 A. kasyacido 'sti 2 K., P. and D.: bhvopakramam 3 D. tasmt, s.m. kasmt 4 K., P. and D.: sadvisayam0 5 A. janmasabdeh D. jarma , s.m. 6 A. tahi 7 P. kalpyeta 8

janma0

K. and P.: sadasadavisesd A. sadasadvisesd D. sadasadavisesd, s.m. sadavisesd The reading of sadavisesd is attested by the marginal note of K (cf.p.l22,fn.(l)). samsthvisayatvt not clear.' A. and Dkha.: ca mlodakdisu K indicates a lacuna with three dots, while P. does so with four and D. with three dots and two dashes. D. reads in the top margin that kha. pustake trutir nsti, and in the bottom margin that kha. pu camlokdisu ity evam pthah na tu madhye campadntaram trutih. 12 A. prasiddhes 13 K. and P. omit ca. D. rpasya, s.m. rpasya ca 14 K., P. andD. omit ca.
9 P. 10 A. 11

(1)(sadavisesat) sadavisesat sattvavisesat / / (K.43b, D.135 without number) (2) (vivdvastham evaitat prakaranam iti / etac cyuktam) saty* eva janmasabdah prayujyata ity etad vivdapatitam purusadv adrstatvt / atra parihram haetac cyuktam iti / kramavicitrasvabhve bhve tath kramavicitrdhyavasye visaye** 'mlsm s ab d an am avaksah / purusas tu na tath cinmtrasvabhvatvt / / (K.43b, D.135 without number) *D. etat prakaranam iti saty. **D. hyavasy avis aye

TRTIYAM AHNIKAM SK9

123

ca sat kryam / sahakrivat tanniyama iti cet / syn matam / yathpo bijnkurasyotpattau 1 samarth bhavanti na ksthd agner v^ 1 ) 2 / ubhayam ca^2)3 tat tsu na vidyate bijd apm 4 vicchinnatvt / yath ca 5 sryah sryakntd agnim utpdayitum samartho na candrakntc ca pniyam / ubhayam ca 6 tat tatra^ 3 ) na vidyate / tath^4) ca tantvdmm patasyaiva 7 saktiniyamah syt / na ca patasya tantusu sattvam syd iti / e t a c c y u k t a m / kasmt / sdhyatvt^ 5 )/ ankurdayo 'pi kryam abdinm / <a>tah8 sdhyam 9 kirn apsv 10 ankuro 'sty atha 1 1 nasty eva / tath sryaknte 'gnih / tadartham eva cyam vivdo 'nusaktah 12 / yat tktam (123.3) apm vicchinnatvn na tsv ankuro 13 'stiti tatrpi ysm apm bijnupravesd ankurabhvena viparinmas tbhyas 14 tasynyatvam 15 sdhyam / ato na kimcid etat / kirn
2 A. agnair utpattau samartho v instead of 3 A. vobhayarn instead of ubhayam ca 4 A. ap 5 A. omits ca. 6 K., P. and D. omit ca. 7 A. patasauva 8 K., P. and D.: ntah We follow Raghavan. 9 10 K., P. and D. 11 A. atha v 12 A. 'nukto 13 14 A. 15

10

*A. btjd ankurasyotpattau

agner v

A. reads kryam nabhas sdhyam instead of kryam abdinm / <a>tah sdhyam with a lacuna between kryam and nabhas. omit apsv.

K. and P.: vicchinnatvam ankuro instead of vicchinnatvn na tsv ankuro D. ankurah, s.m. a nkure syd yas instead of tbhyas A. tasynanyatvam

(^(va) utpattav apah samartha bhavantiti sambandhah / / (K.43b, D.136 without number) (2) (ubhayam ca) ubhayam ceti / tsv apsu nnkuro ngnir atha csattvvisese 'py ankuram janayanti ngnis tasmd updnd apy evam vyavasthplti* bhvah / / (K.43b, D.136 without number) *D. vyavasth apiti, s.m. vyavasth bhavisyatt apiti (3)(tatra) tatreti*- / srye ngnir na pnlyam ity art hah / / (K.43b, D.136 without number) *D. omits tatreti. ^ '(tath) cakrdv api ghatasya vartulatvdikrymsamtram sesalaksanam vidyata eva / sesnugrahakritvt tu sahakrinm updnaparatantratayaiva kryakranatvam iti 1 kranat tesm nkranat / tath saktipratiniyamt svbhvikd adhunopdnapratantryam2 evsritya sahakriny asadbhvam kryasya / na hi3 sa kascit svatantra updnsamlagnah / / (K.43b, D.136 without number) 1 D. karanat, s.m. kranat 2 K. parantantryam D. adhvanopdnapara tantryam, s.m. adhunopdnapratantryam 3 D. na nahi, s.m. na hi ^' (sdhyatvt) sdhyatvd iti / na hi sarvathaivpsu na vidyate 'hkuro y hy* po byadenupravesenslnd updnd antarviparivarttitaynkuramjanayantlti tsv apy ankuro 'sty eveti** / / (K.44a, D.136 without number) *D. y hi y hi **D. eva.

124

YUKTIDIPIKA

canyat / rupavyavasthanac 1 ca / tadyatha rup<a>vijiianotpattihetutve 2 sati caks<>rpam(1)3 drstam iti nednim tatsmnyd rpam apy arpam 4 bhavati / evam5 patakranatvd vemdayo na pata iti nednim tantavo 'py apatah / tasmd yuktam etac chaktasya 6 sakyakarant sat kryam <iti(?)> / it as ca sat kryam 7 / KRANABHVC CA SAT KRYAM8// (SK9d) ihasati krye kranabhvo nsti tadyath vandhyyh 9 / asti ceha kranabhvas tantupatayoh / tasmt sat10 kryam / kranntart kryntarotpattidarsand 1 1 anyatra tadbuddhir iti cet / syn matam / prk kranntart kryntarasysata utpattim upalabhya pasct kranntare kranabuddhir bhavatiti / e t a c c y u k t a m / kasmt / anabhyupagamt / asatah kryasyotpattir eva na siddh 12 sasavisndisv asiddhatvt 13 / kutah punas tannimittkrabuddhih 14 / kranabhvd iti cet / syd etat / asattvvisese 'pi patasya kranam samavyyasamavyinimittalaksanam 15 asti / tasmt 16 pata utpadyate 17 na sasavisnam iti / etac cyuktam / kutah / hetvabhavt / asattvvisese 'pi patasya kranam asti na sasavisnasyety atra 1 8 hetur anuktah / purusavad iti cet / syd etat / yath tuly<e>19 sattve patasya kranam asti na purusasya, evam asattve patasya kranam asti na sasavisnasyeti / etad apy ayuktam / kasmt / uktatvt / samsthnam kryam / patasya 20 samsthnam na purusasyoktam 21 prk (122.9) / samsthnavat tadvisesa iti cet / syn matam / yath sattvvisese patah samsthnam 22
1 A. rpavad vyavasthnc 2 All the Mss read rpam vijnnotpattihetutve. 3 K., P. and D.: na rpam instead of caks<>rpam A. caksurpam 4 D. api rpam, s.m. apy arpam 5 K., P. and D.: eva 6 K. and P. repeat chaktasya. D. saktasya, s.m. sakyasya 7 K., P. and D. omit Has ca sat kryam. 8 A. omits sat kryam. 9 A. vadhyyh 10 A. omits sat. 11 K., P. and D.: kryotpattidarsand 12 A. tvad asiddhya instead of na siddh 13 A. disu siddhatvt 14 A. kranabuddhih 15 A. omits samavyyasamavyinimittalaksanam. D. samavysamavyanimitta0, 0 vyyasamavyinimitta 16 A. omits tasmt ... asattvvisese }pi patasya kranam asti. 17 K., P. and D.: ucyate 18 K., P. and D. omit atra ... kranam asti na sasavisnasyeti. 19 All the Mss read tulyatve. 20 A. pars 21 A. na purusa ity uktam 22

10

15

20

s.m. sama-

A. omits samsthnam na purusah, evam asattvvisese patah.

(1)(caks<u>rupam) na hi rupasvabhavam caksuh, rupam tu svarupasvabhavasvarupam eva, yas tu rpasabdena karmasakter grhyatm vycaste tasya spastrthatyge 'bhipryam na vidmo yath caksur vijnnotpattihetutve sati nlrpam drstam / na hi caks rpasvabhvam nednim rpam api vijnnotpattihetutvd arpam bhavitum arhati / / (K.44a, D.137)

TRTIYAM AHNIKAM SK9

125

na purusah, evam asattvvisese patah kryam na sasavisnam iti / etad 1 a p y ayuktain / kasmt / s m n y a v i s e s b h v t 2 / smnyasya hi visesaparigrahah samsthnam / na tv ayam asti cetansaktau 3 vikalpah / tasmn na purusah samsthnam / asatas tu nirtmakatvd viseso durupapdah 4 / tadupapattau 5 v sattvaprasanga iti / ha ca nirtmakatvd asatm sarvesm avisist at / visesanam ced bhinnam te sattvam abhyupagamyatm / / tasmd yuktam etat kranabhvc ca sat kryam (SK9d) <iti(?)> / evam tvad vaisesikamatensatkryavdo na vimardasahah 6 / bauddhapakse tu bhyn dosah / katham tarhi 7 dravyntaram pato nesyate / tantusv eva tathsthesu pata itydibuddhaya ity evamdin nyyenvayavipratisedht samyogo 'pi na samyogibhyas8 tesm arthntaram istah / tatraitvati parikalpan syd yad 9 uta tantusamyogo v patah, samyogakranam 10 v dravyntaram / ubhayam ca tesm nrthntaram / athotpattivinsau kasypiti mykracestitam / tad api citrataro ' y a m upanysah / kndnm 11 tu dravyntarotpattivinsbhyupagamn na trkikasadrso vicrah / tasmt pramarsa eva pakso jyyn / yath csat kryam na sambhavati tath casabdt 12 (SK9d) sad asat kryam api parasparavirodht / naiva san nsad ity eke 1 3 / etad 14 apy anupapannam / kasmt / sattvahetvabhidhnt 15 / niscitah prg utpatteh kryasya sadbhvah

10

15

20

prakrtam idanim vaksyamah / kirn ca prakrtam / mahaddi tac ca kryam 16 prakrtivirpam sarpam 17 ca / (SK8cd) iti vacand <v>airpyam18/
X A. tad (this is also possibly 2 A.: visesbhvt 3 A. cetansaktau 4 A. durapasdas 5 A. tadutpatto 6

the original reading).

A. vimardaks amah A. deletes tarhi. K. and P.: samyogopasamyogibhyas D. samyogopasamyogibhyas, s.m. samyogo 'pi samyogibhyas 9 A. omits yad. K., P. and D.: samyogakranam *K., P. and D.: kranopdnam 12 A. tath sabdt 13 K., P. and D. omit eke. 14 A. tad (this is also possibly the original reading). 15 K., P. and D.: sattve hetvabhidhnn 16 K., P. and D. omit kryam 17 A. omits sarpam. K. and A.: vacand dvairpyam. P. not clear D. vacant dvairpyam We follow Chakravarti.

126

YUKTIDIPIKA

10

15

20

prak sarupyagrahanam sukhapratipattihetutvat / adhigatasrpyasya hi sukham vairpyapratipattir 2 bhavatiti prk sarupyagrahanam kartavyam / yath tantrntarlynm "sad anityam dravyavat krya<m> kranam 3 smnyavisesavad iti dravyagunakarmanm avisesam4" (cf.VS. 1.1.7) uktv "dravyni dravyntaram rabhante" (VS.1.1.8) "guns ca gunntaram" (VS.1.1.9) ity evamdi<r> viseso5 'bhidhiyate / ucyate: tadanupapattih avisest / yathaivdhigatasrpyasya laghiyasi vairpyapratipattir evam adhigatavairpyasya laghiyasl srpyapratipattih / kasmt / parasparpeksatvt 6 / vairpypeksam hi srpyam, srpypeksam ca vairpyam iti / ha^2) : evam api vairpyasya prgabhidhne prayojanavacanam / dvayor 7 apy avisese 'nyatarasya prgabhidhne niyamahetur vaktavya iti / ucyate: na vairpyasya prakarannangabhvt / vicchinnam hi vairpyam / atas tat prvam abhidhya prakaranngam srpyam sukham abhidhtum ity evamartham cryenaivam8 kriyate / katham srpyasya prakaranngatvam iti cet / traigunybhidhnadvrena^ 3 ) gunalaksanopadest tatsiddhau cvivekydmm 9 vyaktasiddheh kranaguntmakatvc ca kryasya pradhne traigunydipratipatteh, kryakranabhvsandehc ca pradhnstitvaprasiddhyapadest 10 tatsiddhau ca bhogyasya 11 bhoktrapeksatvt purusasiddher adhigatabhoktrbhogyasya ca 12 tatsamyogasya 13 sukhapratipdyatvt tdarthyc ca tattvabhtabhvasargnm 14 / tasmd yuktam etat prakaraniigatvt 15 srpyam pascn nirdisyate tadasambandhd itarat^4) prg iti / ha: yadi tarhi bhavn prg 16 vairpybhidhnam nyyyam 17 manyate
X A. ha ca 2 K., P. and D.: vairpyasya pratipattir 3 All the Mss read kryakranam. We follow Pandeya. 4 A. avisesasmnyam 5 All the Mss read evamdiviseso. We follow Pandeya. 6 A. kasmd apeksyatvt 7 K., P. and D. omit apy. 8 K., P. and D.: cryenaiva 9 A. omits cvivekydinm ....prasiddhyapadest tatsiddhau ca. 10 D. pradhnstitvaprasiddhyapadest, s.m. pradhnam asti prasiddhyapa0 11 A. bhogyasd 12 K., P. and D. omit ca. Dkha. bhoktrbhogysrayasya 13 A. tatsamyogasya ca 14 A. tattvabhvabhtasargnm (this is also possibly the original reading). 15 A. prakaranatvt 16 A. bhvd instead of bhavn prg 17

K., P. and D.: nyyam

(x)(aha) purvapaksah / / (D.139 i.n., not found in K.) (2)(ha) purvapaksah / / (D.140 i.n., not foujid in K.) (3) (traigunybhidhnadvrena) "trigunam aviveki visayah" (SKIla) itydin / / (K.45a, D.140 without number) (4)(itarat) vairpyam / / (D.141 i.n., not found in K.)

TRTIYAM AHNIKAM SKIP tad vaktavyam kim punar idam vairpyam iti / ucyate: 1

127

HETUMAD ANITYAM AVYPI2 SAKRIYAM ANEKAM SRITAM LINGAM / SVAYAVAM PARATANTRAM VYAKTAM3 VIPARITAM AVYAKTAM4// (SK10) tatra hetuh kranam ity anarthntaram / tad asystlti hetumat / nityam dhruvam / na nityam anityam / vypnotiti vypi / na vypy avypi / asarvagatam ity arthah / saha kriyay sakriyam5/ anekam bhinnam / sritam dheyam / Ungarn tallaksanopapannam / avayyanta ity avayavh / prthag upalabhyanta ity arthah / sahvayavaih svayavam / paratantram anydhinam / ete hetumaddayah paratantrnt nirapavd vyaktasysdhranh pradhnapurusbhym dharmh / ha: hetumad ity avisesah sarvatra sadbhvt 6 / vyaktvyaktapurusnm hi sarvesm hetur^1) astlty avisesa evyam pathitavyah <iti> / ucyate: na krakaparigraht 7 / yady api 8 vyaktvyaktapurusnm avisistam hetumattvam tathpi 9 Visist asya krakasya 10 hetoh parigraham karisymah / sa ca vyaktasyaiva nnyasyeti nyam aviseso bhavisyati / ha: tadanupapattih visesnupdnt / hetur iti smnyasabdo 'yarn / smnyasabdas 11 ca nrthaprakaranasabdntarbhisambandham antarena visese 'vatisthata 12 iti visesa updeyah syt / sa 13 tu nopdiyate / tasmt te 'visesa evyam iti 1 4 / ucyate: na sarvasambhavino 'bhidhnasya prakarsrthatvt / iha yah sarvasambhavi dharma ekavisaya updiyate tasmt prakarso vijfiyate / tadyath bhokt mnavaka ity ukte sarvesm bhoktrtvasya sambhavd evam vijiiyate prakarsenyam bhokteti / evam ihpi sarvasambhav<iny> ha 15 cryo vyaktam hetumad iti / tena 16 vayam asmt prakarsam 17 vijnsymah /
1 A. omits ucyate. 2 A. asypi 3 A. vaktavyam 4 A. omits viparitam avyaktam. 5 D. sakiy sakriyam, s.m. sakriyam 6 K., P. and D.: sarvatrsambhvt Dkha. 7 A. krakapratigraht 8 A. yatrpi 9

10

15

20

25

sarvatra sambhavt

A. tatrpi D. repeats krakasya hetoh parigraham karisymah, and deletes the repeated phrase. 11 A. smnyasabdc 12 A. 'vatisthanta 13 A. s 14 A. eva instead of evyam iti K., P. and D.: sarvasambhavity ha A. sarvasambhave saty 16 A. and Dkha.: te D. tena, s.m. te A. asmkarsam

W (hetur) siddhau / / (D.141 i.n., not found in K.)

128

YUKTIDIPIKA

10

15

20

kas ca prakarsah / karakajnapakayor ubhayor api sambhave karakasyaiva grahanam / anityasabdasambandhd 1 v / athavyam cryo hetumad ity uktvnityam iti pathati / sabdntarbhisambandhd yo 'nityasahacaro 2 hetus tasyeha grahanam gamyate / kas 3 cnityasahacaro hetuh / krakah / ha: evam apy a n u p a p a n n a m etat / kasmt / ubhayatra tatsambhavt / utpdyavyangyayor 4 hi vinsam 5 patdisu drstatvd avyabhicrt tantrntariy manyante / tasya v parihro vaktavyo na v vaktavyo visese sthitir astiti / ucyate: na ekntavdaprasangt / sarvena hi vdinvasyam 6 kimcin7 nityam abhyupagantavyam / antato vinse 8 'pi na kascid arthah sabdabuddhibhym na vyajyate / tath ca9 saty ekntavdo 'yam syt / sa ca yuktimadbhir nesyate / tath ca 10 samskrtam apy evam kalpyamne 11 vinsi syt / tasmd 12 utpdyavyangyayor vinsam bruvato 'tishasam / ha: anityatvnupapattih satkaryavdbhyupagamt / yathaiva hi nsata utpattir asty evam sato 'pi vinsena na bhavitavyam / atha sato 1 3 vinso 'bhyupagamyate tena pralayakle vinastnm tattvdinm 14 pascd asatm utpattih satkryavdam 15 nirkuryt / tasmd anityam vyaktam 16 ity ayuktam iti 1 7 / ucyate: na vyaktyapagamapratijnnt 1 8 / satyam eva 19 vayam sato vinsam caksnh satkryavdam 20 pratycaksimahi 21 / krannm tu yah parasparasamsargt 22 samsthnavisesaparigrahas tasya virodhisaktyantarvirbhvd 23 vyaktis tirodhiyata ity etad vinsasabdena vivaksitam / tath ca vrsaganh 24 pathanti a tad etat trailokyam 25 vyakter apaiti na sattvt / D.: anityah sabdah sambandhad sahacaro Instead of kas cnityasahacaro hetuh K., P. and D. read tasmn nityasahacaro hetuh, and Dkha. reads kasmd anitye sahacare hetuh. 4 A. utpdyavyarigayor 5 K., P. and D.: vinsah 6 A. vdino 'vasyam 7 K. not clear. 8 P. vinso 9 K., P. and D. omit ca. 10 K., P. and D.: tathyam (this is also possibly the original reading). Dkha. omits ca. 11 P. kalpamne 12 A. omits tasmd. 13 K., P. andD.: sato 'pi 14 D. tattvdmm, s.m. tantvdinm 15 A. satkryavodam 16 P. yuktam 17 K., P. and D.: anityam eveti instead of iti 18 D. vyaktyapagapratijnnt, s.m. vyaktyapagamapratijnnt 19 K., P. and D.: sad instead of satyam eva 20 A. satkryavda 21 D. pratycakhimahi(?), s.m. pratycaksimahi 22 K., P. and D.: parasparam samsargt 23 A. virodhasaktyantar0 24 A. vrsaganoh 25 A. trailokam
1 K., P. and 2 A. 'nityas 3

TRTIYAM AHNIKAM SKIP

129

apetarn^1) apy asti 1 vinsapratisedht 2 / samsargc 3 csya sauksmyam 4 sauksmyc cnupalabdhih / tasmd vyaktyapagamo 5 vinsah / sa tu dvividhah / sargapralayt tattvnm kimcitklvasthnd 6 itaresm" (cf.YBh.onYS.3.13, NBh.1.2.6) iti 7 / ha: ayuktam etat / kasmt / vipratipatteh 8 / sarvam eva ksanikam 9 buddhibodhyam ksanirodhavarjitam 10 iti skyaputriyh pratipannh / tesm pratisedho 11 vaktavyo na v 12 vaktavyo dvividham anityam iti / ucyate: na hetvanupagamt / pratiksanam ucchidyate trailokyam ity atra Ungarn abhiyukt api nopalabhmahe / tasmn naitad asmkam 13 buddhv avatisthata iti / ha: ante ksayadarsant / iha yasynte ksayas tasya ksanikatvam drstam tadyath pradipajvlbuddhisabdnm 14 / asti cnte ksayah samskrnm 1 5 / tasmt ksanikh / uc<ya>te16: tadanupapattih sdhyatvt / iha tu siddhentideso 17 bhavati / tadyath gav gavayasya / na tu pradipajvlbuddhisabdnm ksanikatvam prasiddham / ato na kimcid etat / ha: naitad aprasiddham / kasmt / vrddhyadarsant^ 2 ) 18 / yadi hy avinastym jvlym indhanntare 19 jvlntaram utpadyate vrddhih 20 syt / na tu drsyate / tasmd anavasthit pradipajvl / kirn ca sraybhvt / yadsray jvlotpattis tad utpadyamnaivsau nirunaddhiti na yuktam asy vinsrayenvasthtum / upayuktendhany 21 <apy> avasthnaprasangt 22 /
J A. esti 2 A. vincapratisedht 3 A. asamsargc 4 A. sauksmm 5 A. vyaktyapagamo 6 K., P. and D.: kimcitklntarvasthnd 7 A. api 8 A. vipratipattaih 9 A. ksanikatvam 10 A. buddhir bodhyasaksanirodhavarjitam 11 A. pratisedh 12 K., P. and D.: v na 13 A. yuktam asmkam 14 A. omits buddhi. 15 A. samskronm 16 All the Mss read ucyante. 17 A. siddhatventideso 18 Dkha. vrddhyv adarsant vrstyv adarsant 19 K., P. and D.: indhanntarle 20

10

15

20

K., P. and D.: vrddhv api A. upayunktendhany 22 K., P. and D.: avyavasthnaprasangt A. avasthnaprasangt We follow Chakravarti.

(^(apetam) vyakter apetam apy* asti vidyata ity arthah / / (K.46a, D.144 without number) *D. omits apy. W (vrddhyadarSant) vrddhv adarsant // (K.46b, D.145 without number)

130

YUKTIDIPIKA

10

15

20

25

kim ca avaranopanipatena 1 prabhabhedaprasangat / jvalanam avasthnam icchata uparistd varanopaniptt prabhys tantor 2 iva dvaidhikaranam syt / anistam caitat / tasmn na dlpajvlnm 3 avasthitir astiti / etena sabdo 'pi pratyuktah / katham / tasypi yadi vinso na syd 4 drutapavanmbudhrbhightt pratiksanam aprvasabdvirbhvt prvas a b d a v i n s c 5 ca vrddhih syt / adrst csau / kim ca pratyaksata upalabdheh 6 / pnyupaghtajo 7 hi sabda utpatter rdhvam na bhavatiti pratyaksasiddham idam / abhivyakter 8 iti cen na niyamdarsant / sabdnm hi 9 vcyavaktrbhedabhinnnm krananiyamo drstah / na caitad asti samnendriyagrhynm / kim ca prthaksruteh / abhivyaktikranadesc ca prthak sryate sabdah / na caitad abhivyaktnm 10 ghatdinm drstam iti ksanikh / buddhes 11 tu prg evokt 12 nsahetavah / tatra yad uktam(129.14) sdhyatvt pradipajvlbuddhisabddinm ksanikatvasya na samskrh ksanik ity et ad ayuktam / ucyate: yad uktam(129.17) vrddhyadarsand ity atra brmah: ayuktam etat / kasmt / visesapratipatteh / ksanikam 13 ity uktaparimno 14 'yam klanirdesa sriyate / vrddhyabhvdibhyas ca kadcid vinsamtram pratlyate / sa tu vinsa 15 ekam ksanam 16 avasthitnm jvlnm bhavati na punah ksanadvayam trayam 17 v paryusitnm ity atra <hetur noktah> 18 / tasmd yuktarn apy etad anuktam / yat punar etad uktam(129.18) indhannavasthnj jvlnavasthnam ity atra brmah: etad apy anupapannam / <kasmt /> sdhyatvt / ksanam avasthitasyendhanasya <ni>rodho19 na punah <ksanadvayam avasthitasya> ity etad 20 apramnakam / jnmtrd agrhltasikskah 21 kah 22 pratipattum utsahate / yat tktam (130.1) varanopaniptt prabhbhedaprasanga ity etad apy
1 K., P. and D.: varanopanipte 2 Dkha. tanor 3 A. dipe jvlnm 4 A. vinsas syd 5

A. varanaipaniptena

K., P. and D.: aprvasabdvirbhvt prvasabdavinsc A. aprvasabdvirbhvt pr sabdavinst prvasabdavinsc We follow Pandeya. 6 A. upalabdhaih 7 A. prnyupa0 8 K., P. and D.: abhivyaktir 9 K., P. and D. omit hi. 10 K., P. and D.: abhivyangynm 11 K., P. and D.: iti ksanikabuddhes 12 A. eva 13 A. ksanikatvam 14 K. aktaparimno D. atyaktaparimno 15 K., P. and D. omit vinsa. 16 D. ksanam ekam, s.m. ekam ksanam A. has a blank space between vinsa and mavasthitnm instead of ekam ksanam. 17 K., P. and D. omit trayam ... na punah <ksanadvayam avasthita$ya>(130.1923). 18 A. hetu After hetu A. has a blank space instead of <r noktah>. 19 A. virodhah We follow Pandeya. 20 After na punah A. has a blank space instead of <ksanadvayam avasthitasya> ity eta-, 21 K., P. and D.: jnmtr ca grhttasikskah 22 A. omits kah.

TRTIYAM AHNIKAM SKIP

131

ayuktam / kasmt / ubhayathnupapatteh / kirn tvad yasya dvaidhibhvo drstas tadaksanikam 1 hosvid yasya na drstas tat ksanikam iti / kirn ctah / tad yadi tavd evam abhyupagamyate yasya dvaidhibhvas tad aksanikam iti tantor aksanikatvaprasangah / atha matam / yasya dvaidhikaranam na drstam tat ksanikam iti yath kirn ity udhryam 2 / kutah / yasmn na hy asty 3 anudhrto 4 vdah / etena sabdavrddhih pratyukt / yat punar etad uktam(130.7) pnyupaghtajasabdnavasthnd 5 iti tatra bhavataivoktam vyangyatvd 6 iti / yat tktam(130.8) niyamdarsann 7 na vyangyah sabda iti tad ayuktam / anekntt 8 / yath suklakrsnau niyamatah suklakrsnasabdbhym pratyy<y>ete na 9 ca tau tayor na vyangyau 10 , evam sabdasypi vaktrv<c>y~adiniyamah n syn na cvyangyah syt / yad apy uktam(130.10) vyangyavyanjakayor desabhednupapatter na 12 vyangyah sabda iti tad apy ayuktam / kasmt / caksurvat tatsiddheh 1 3 / tadyath caksuso rpasya ca desabhede 'pi vyangyavyanjakabhva evam 14 sabdasypi syt / tasmn na sabdo 'pi ksanikah / buddhes tu svdhikra eva ksanikatvahetunirkaranam 15 vaksymah(189.19) / tatra yad uktam (129.11) ante ksayadarsant pradipajvlbuddhisabdavat ksanikah samskr ity etad ayuktam iti / ha: itas tarhi pradlpdinm 16 anyesm ca bhvnm ksanikatvam / kutah / avasthne hetvabhvt 1 7 / nast<as>18 ced artho 'bhyupagamyate 19 nanu 20 prptam id am utpannamtrasysya vinsavighno nstiti tvaty 21 eva vin<>sena22 bhavitavyam / athsati pratibandhe na <vinsah syd iti> 23 kautasthyam sarvabhvnm prptam iti / ucyate: na kranopapatteh / adhikro hi sarva<bhv>nm24 samskr1 A. aksanikatvam 2 K., P. and D.: kirn atrodharanam 3 K., P. and D. omit asty. 4 D. anuhrto 5 A. prnyupaghtasabdnavasthnd 6 A. vyangatvd 7 A. niyamdarsann 8 A. anaikntt 9 K., P. and D.: pratyyete na A. pratyo tena We follow 10 A. vyangau 11 K., P. and D.: vaktrvdiniyamah A. vakrvkydiniyamah 12 A. ne 13 K., P. and D.: tadasiddheh 14 P. eva 15 K., P. and D.: ksanikatvahetur iti karane 16 A. pradipnm 17 A. hetyabhvt 18 All the Mss read nast. We follow Pandeya. 1

10

15

20

25

Pandeya. We follow Raghavan.

K. and D.: anavasthnahetvabhva ... st ced artho 'bhyup agamy ate P. hetubhva ... drstd artho 'bhyupagamyate 20 AT"tat K., P. and D. omit tvaty ... vinso <syd iti>. 2 A. vinosena 23 A. vinso sviti We follow Pandeya. All the Mss read sarvabhtnm.

132

YUKTIDIPIKA

10

15

20

vasad utpattih / tasmat tadavasthanam 1 eva tesam alam sthitaye / sati vinasvaratve samskropayoge tu sthityapabhramsa ity ato 'sti kamcit klam avasthnam bhvnm 2 / na ca kautasthyaprasangah / kirn cnyat / santativinsaprasangt/ namstus 3 ced utpattisamanantaram vinsa isyate santatir apy ante ksayadarsann namstri 4 / tasy api tathaiva vinsah prptah / tatas ca tadidvilasitavat ksanadrstanastasya 5 trailokyasybhve6 samsrocchedaprasangah / tasmd ayuktam namstur 7 utpattisamaklam eva vinsa iti / krannavasthnn 8 na dosa iti cet / syn matam / asti kranam prvotpanno bhva uttarasyotpattau, sa cpy uttarasyety evam santater anucchedah / virodhibhvntarasarpsargt 9 tbhayatas 1 0 tathotpatter bhramsa 11 iti / etad apy ayuktam / kasmt / prvahetutygt / prg uktam yena namstavyam 12 asau mantrausadhamahgalaprayogair 13 api ksand rdhvam 14 nvatisthate / smpratam tu narnstri santatih kranavasd avatisthata iti 15 so 'y a r n prvahetutygah / vinsahetvabhvt ksanikatvam iti cet / syd et at / nsti bhvnm vinsahetor upalambha ity atah svbhvikah pradhvamsah / tasmd utpattisamaklam 16 asau kena vryate <iti> / tad 1 7 apy ayuktam / kasmt / anabhyupagamt / ko hy etad <eva> mamsyaty ahetuko 18 vinsah <iti> / kirn tarhi / prg evoktam (131.25) <samskra>vasd19 bhvnm sthitis <tadavasthitnm cpabhramso> virodhidravyntarasambandhendhytmikdin 20 bhavatlti / vinsasya vinsaprasangd ayuktam iti cet / syd etat 2 1 / yadi tarhy abhvo 'pi hetumn parikalpyate prptam asypi vinsitvam 22 / anistam 23 caitat / tasmd ahetuko vinsa iti / etad apy 2 4 ayuktam / kasmt / vyaktyapagamapratijiint / bhvavinsavdinam 25 prati satyam evyam 26 uplambhah syt / vyaktyapa2 A. bhvnm 3 A. nastus 4 A. nastri 5 K., P. and D.: ksanadrstinastasya D. deletes an unclear word between ksana and drsti. 6 K., P. and D.: trailokyasybhvah 7 A. nastur 8 A. kranvasthntn 9 A. viro dhib h vntara samp ark t 10 A. tu bhyas 11 A. bhmsa 12 A. nastvyam 13 A. asausadhamangalaprayogair 14 A. rdhva 15 A. eva tisthati instead of avatisthata iti 16 A. utpattisamayaklam 17 K., P. and D.: idam 18 K., P. and D.: ko hy e .... ahetuko. A. ko hy etad avamamsyati ahetuko 19 All the Mss read arthavasd. 20 K., P. and D.: sthitis tad ava....virodhi A. sthitis ta....mnam cpabhraso virodhi0 21 K., P. and D. omit syd etat 22 A. ghatavad vinsitvam 23 A. anist a 24 K., P. and D. omit apy. 25 K., P. and D.: abhvavinsinam 26

*K. and P.: ta....d instead of tasmt tadavasthnam D. ta

d eva sthnam

A. corrects eva vyam into evyam.

TRTIYAM AHNIKAM SKIP

133

gamas tu no vinsah 1 / sa ca2 hetumattvena katham virotsyata iti 3 / tasmn na vinsahetvabhvt ksanikam samskrtam iti / it as ca na ksanikam / kasmt / agrahanaprasaiigt 4 / ihsato 'grahanam drstam tadyath dvitlyasya sirasah / ksand rdhvam ca te ghatdayo na bhavanti / tasmat tesm apy agrahanaprasangah / tatsadrs<o>tpatter 5 adosa iti cet / syd etat / utpattisamakla<m> <n>irodhe6 'pi ghatasynyasya tdrsasyotpattir bhavati tannirodhe 'nyasyety evam avicchedena grahanam bhavati jvlnadisroto'nusandhnavad iti / etad apy ayuktam / kutah / kranbhvt / syd etad evam yadi tadnim sadrsotpattau kranam syt / na tu tad asti prg eva nirodht / tasmd asad etat / prvotpannasya kranabhvt tatsiddhir iti cen na updnt tannispattiprasiddheh / ihopdnn mrtpindakasamjnakl loke ghatanispattih prasiddh na ca tadnim asti mrtpindah / kirn ca kramnupalabdheh / iha siv<a>kdinnukramena 7 ghatotpattir upalabhyate / na cnukramo 'sti / kirn ca krakasma<gr>ybhvt 8 / iha kumbhakradandacakrastropalasmagryd ghatanispattih prasiddh / na csty esm tatra sambhavah / kirn ca <tadupdnt tadupdnasynispatteh(?)> 9 / iha ghatd ghatanirvr<tt>ir 10 na prasiddh loke / na cprasiddho 'sti drstntah / buddhisabdavad iti cet / syd etat / yath buddhir buddhyantaram sadrsam ste sabdas ca sabdntaram evam ghatd ghatanispattir bhavatiti / etad apy asat / kasmt / <siddhatvt(?)/> siddham hi buddher buddhyantaram sabdc ca sabdntaram jyata iti / etad apy asmkam prasiddham / tasmt pralpamtram etat / tatra yad uktam (133.5) sadrsotpatteh so ' y a m iti grahanam avicchinnam ksanikatve 'pi bhvnm ity etad ayuktam / kirn cnyat / kryotpattikle krananivrtteh / yad [na] kranam asti na tad kryam utpadyate dvayor ghatayor yugapadupalabdhiprasarigt / yad tu kryam utpadyate tad kranam <niruddham>11 iti ni<r>bijah12 prdurbhvah prpnoti / anistam caitat satatotpattiprasarigt / anutpanne hetusmarthyd adosa iti cet / syd <e>tat 13 / anutpanne krye kranena pray oj an am utpanne tadvyprnarthakyt, asti cnutpanne krye kranam / ato na nirbijah prdurbhva iti / tad apy ayuktam / kasmt / abhve 'pi tadutpattiprasangt / ahga tvad anuso vibhajyantm agnau v ksipyantm tantavas tadpi prasiddhavinsnm abhvann iti sakyam upadestum yad <e>tebhyah14 pata utpadyate / tasmd bhrn1 A. nvinsah 2 K., P. and D.: tu 3 A. has a lacuna instead of virotsyata iti. 4 K., P. and D. omit agrahanaprasaiigt tadabhvd 5 A. tatsadrsautpatter 6 A. utpattisamaklavirodhe We follow Pandeya. 7 A. sivikdin0 8 A. krakasmarthybhvt We follow Pandeya. 9 A. tadupdhynurupdhyasynispatteh 10 A. ghatanirvrtir 11 A. virodham We follow Pandeya. 12 A. nibijah We follow Pandeya. 13 A. syt tad 14

10

15

20

25

30

asiddho 'syai mie(133.3-134.18).

A. yadi tebhyah

134

YUKTIDIPIKA

10

15

tir iyam / yugapat karyakaranayor utpattinirodhau tulanatonnatavad iti cet / syd etat / yathnmonnmau tulnta<yor>1 <yau>gapadyena 2 bhavata evam utpattivinsau karyakaranayor iti / tad apy ayuktam / kasmt / k r y a k r a n a b h v d a r s a n t / kim idam udake nimajjadbhih phenam avalambyate / tuly [tasya] hy ekasyvanatir avasth taddvitiyasyonnataye hetur bhavati / bhavatah kranavinsah kryotpattis ca yaugapadyena bhavatah / na ca tayor hetumadbhvah sakyah kalpayitum / tasmd ayuktam etat / visesagrahant ksanikatvasiddhir iti cet / syn matam / yady utpannamtroparatir nsti bhvnm kimkrtah sarirdlnm prnpn<a>sramarpdikrto 3 'bjsmaprabhrtinm ca sitosnasparsakrto bhedah / ghantdinm csabdaknm pascc chabdavatm grahanam / tasmd anisiddhah ksanabhanga iti / etac cyuktam / kasmt / uktatvt / uktam (133.10) atrottaram kranbhve 'nutpattiprasangd iti / kim ca <samsthnntarnupalabdheh) 4 / na hy atra prvasamsthnaviparltam samsthnntaram grhnlmahe / tasmd avisists ta ity evam avagamyatm / visesagrahanam tv avasthntarnugrah<ah>5 saktyantarvirbhvt / uktam(132.23) ca vyakt<e>r6 apagamo 'bhistah prvasamsthnahnitah / tadabhvd asiddho V vise... 7 / / 1 0 / /

20

25

<aha8 : > nasahacarabhavo drstas tamahprakasavat / tasmd anyonyamithunatvam anupapannam / ucyate: yat tvad uktam gunnm nntv<>bhvah9 svabhvavyatikaropalambhd ity atra brmah: yadi khalv idam isyate 10 svabhvavyatikaragrahand gunnm nsti nntvam iti kim prptam / yady esm samklrnah 11 svabhva upalabhyeta 12 na syd esm nntvam / asti caism asamkirnasvabhvopalambhah / katham iti / ucyate SATTVAM LAGHU PRAKSAKAM ISTAM UPASTAMBHAKAM13 CALAM CA RAJAH / GURU VARANAKAM EVA TAMAH / (SK13abc) eva sabdah pratyekam parisampyate / sattvam laghu praksakam evestam / yat kimcit kryakarane laghu praksakam ca tat sattvarpam iti pratyaJ A. 2 A. 3 A. 4 A. 5 A. 6 A. 7 A. 8

tulntaryr yogapadyena We 0 follow Pandeya. prnpnsrama We follow Pandeya. sthnnvarnupalabdher We follow Pandeya. avastvantardnugrahe vyaktar We follow Pandeya. ends here. A11 the Mss omit <ha....> nasahacarabhavo .... katham iti / ucyate(134.19-25). D. introduces this phrase by: khapu$take esa adhiko 'sti pthah, and corrects nmha carabhvo into nsahacara0 in the left margin. 9 Dkha. nntvabhvah 10 Dkha. idam ucyate sva isyate, s.m. idam isyate 11 Dkha. esm asamkirnah, s.m. esm samkirnah 12 Dkha. svabhvah pra upalabhyeta, s.m. svabhvah upalabhyeta 13 D. praksakam, s.m. praksakam istam

TRTIYAM AHNIKAM SK13

135

vagantavyam / tatra kryasya tvad udgamanahetur 1 dharmo laghutvam, karanasya vrttipatutvahetuh / praksas 2 tu prthividharmasya cchylaksanasya tamasas tiraskrena dravyntarapraksanam, karanasypi grahanam samkalpbhimndhyavasyavisayesu yathsvam pravartamnam 3 / upastambhakam calam eva rajah / yah kascid upastambhas calat copalabhyate tad rajorpam ity avagantavyam / tatropastambhah prayatnas calat kriy / s ca dvividh parinmalaksan praspandalaksan ca / tatra parinmalaksanay sahakribhvntarnugrhitasya dharminah prvadharmt pracyutih / praspandalaksan prndayah karmendriyavrttayas 4 ca vacandyh / bhynm dravynm 5 utpatananipatanabhramandini / guru varanakam eva tamah / yat kimcid gauravam varanam copalabhyate tat tamorpam iti pratyavagantavyarti / tatra gurutvam kryasydhogamanahetur 6 dharmah, karanasya vrttimandat / varanam api kryagatam ca dravyntaratirodhnam / karanagat csuddhih praksapratidvand<vi>bht 7 / ity esa sattvdinm avyatikarena^1) svabhvopalambho yata 8 esm nntvam avasiyate / yat punar etad uktam striksatrameghesu 9 svabhvavyatikaropalambhd ekogunas trirpah, sarve v sarvarph, rpntarasya vsata utpattir ity atra brmah: na gunabhtasya bhaktita upakrt pradhnarpopapatteh / iha gunabhtasya bhaktitah pradhnopakritve sati bhaktitas tadrp<opa>pattir 10 drst tadyath ksirdeh / tad dhi 11 mukhdisu drstapratilabdhapravrtt<i>( 2 ) 12 pittasya svena rpenngabhvam^3) gaccha<t>13 tasyopakrt tiktam sampadyate na ca tath^4) sad eva / sattvam api straina<m>
X D. udgamahetur, s.m. udgamanahetur Dkha. udgamanahetur 2 Dkha. praksakas 3 D. pravartanam Dkha. pravartamnam 4 D. karmendriyavrttais 5 D. vacanadravynam, s.m. dravynm 6 Dkha. kryasynumnhetur 7 All the Mss read dvandvibht. 8 D. ita 9 D. stre ksatrameghesu 10 All the Mss read tadrppattir We follow Pandeya. n D . sad dhi, s.m. tad dhi 12 All the Mss read pravrttih. 13

10

15

20

All the Mss read gacchams(n).

(^(avyatikarena) vyatikarah svabhavabhedah / / (K.48b, D.150 without number) (2)(tad dhi mukhdisu drstapratilabdhapravrtt<i>) tad dhlti / kslraghrtdi / mukhdisv iti kslram mukhe ghrtam caksusoh karpram triputikym* itydi / drsteti drstaprvvalokitaiva** pratilabdh vrttir yena, na tasya kslrasya mukhe pratiksiptasyny kcid vrttih svarpam, api tu prvadistam eva tasya rpam iti yvat / / (K.49a, D.151 without number) *K. tripratikym **D. drsteti drst prvvalokitaiva (3) (svena rpena) < pit tasya > bahirmukhibhavanasamarthyenety* arthah / / (K.49a, D.151 without number) *K. and D.: pittabahirmukhtbhavana0 ^4^(na ca) na ceti / na hi kslram sat tiktatvena* / anensamklrnatvam drstnte darsitam / /

136

YUKTIDIPIKA

10

15

gunabhutam 1 sapatmrajasah svena rupenangabhavam gaccha<t>2 tasyopakard duhkham sampadyate / tamaso mohah^ 1 )/ evam kstram raja^2) ryadralaksanasya sattvasya dasyulaksanasya ca tamasah / evam meghyam tamah kr<sakasya> sattvasya 3 prositadayitys ca rajasah / tasmn nsti gunnm svabhvavyatikarah / kirn cnyat / agunabhtnm^ 3 ) svabhvagrahant / yad caite 'ngabhvam upagacchanto madhyasths tulyasamskrs ca pratipadyante^4) tad <...> svarpenaiva (5) <...> / tasmd asamkirnam gunarpam / ha: na sandeht / ubhayath hi rpntaragrahanam kslrdisu drstam / tdrpyt tais ca 4 viparinatnm gunabhvc ca yathoktam / tatra katham idam ekntena nisciyate gunabhvt sattvdinm rpntaragrahanam na punas tdrpyd eveti / ucyate: grahanavikalpopalambht / yadi strainam sattvam tdrpyd eva sapatny <duhkhena(?)>5 grhyate tena bhartur api tath grahanaprasahgo madhyasthnm^6^ tulyasamskrnm ca / anistam caitat / tasmd bhkto ' y a m <grahana>vikalpopalambhah6/ kirn cnyat / uttaraklam svarpagrahant / nivrttnusaybhis caikrthatm upagatbhih sapatnibhih svenaiva rpena strainasya sattvasya grahanam upalabhyate svagrhasamavasthitais cryadraih ksatriynm, nispannasasyais ca krsivalair meghnm /
1 A11 the Mss read strainagunabhutam. 2 A11 the Mss read gacchams(n). 3 All the Mss read krsikasattvasya. 4 recte: tesm(l) instead of tais ca 5 All the Mss read tena. 6

All the Mss read gunavikalpopalambhah.

(K.49a, D.151 without number) *D. sattyaktena, s.m. tiktatve sat (na ca tath) na tu kslram tiktam (tl) // (D.151 in the left margin, not found in K.) '*' (tamaso mohah) sapatnlsambandhinas tamaso <'ngabhvam gacchat>* sattvam mohah sampadyate moha iva sampadyate bhatlti sambandhah // (K.49a, D.151 without number) *K. and D.: 'hamkram gacchan (2) (kstram raja) kstram raja ryadralaksanasyhgabhvam gaccha<d>* itydin sahgltaevam tamasa ity at ret i / / (K.49a, D.151 without number) *K. and D.: gacchann (3) (agunabhtnnm) pradhnnm // (K.49a, not found in D.) (4) (agunabhtnnm) tl nanu sattvdirpam asamklrnam tarhi katham nirbhsata ity haagunabhtnm iti // (D.151 in the right margin, not found in K.) (5) (svarpenaiva) sattvkrena // (K.49a, not found in D.) (6) (madhyasthnm) madhyasth ye na rakt na dvist ity arthah / madhyasth ity ukte kasyacid vltargasahk syt, na ca vltargasya striyh sattvtmatay pratibhsas tadartham tulyasamskrs ceti visesanam / tenyam arthahye tulyasamskr avltarg atha ca tasym striym madhyasth na rakt na dvist iti / / (D.152-1, not found in K.)

TRTIYAM AHNIKAM SK13

137

tasmd bhkto 'yam grahanavikalpopalambhah / tasmd yuktam etad anyo nyajananavrttayo gun na ca samkirnasvabhv iti / yat punar etad uktam anyonyamithunatvnupapattih sattvasy<e>taraviro dhd 1 ity atra brmah: asti cyam virodho gunnm PRADIPAVAC CRTHATO VRTTIH / / (SK13d) kim / upapadyata iti vkyasesah / tadyath vartijyotistailnm parasparavirodhe 'pi pradipakaranaikakryasdhanabhvopagatnm vrttaya ekatra sammrchith sahabhvam prakrstam api klam anubhavanti / evam sattvarajastamasm sati virodhe mahaddyekakryasdhanabhvopagatnm vrttaya ekatra mrchith^1) saha bhavantiti / yuktyabhvd asiddhir iti cet / syn matam / k punar atra yuktir yena virodhinm ekakryat bhavatiti / ucyate gunapradhnabhvt / gunabhto hi pratiyogl^2) pradhnabhtena tadupakrakatvn na virudhyata iti samsargena vartitum utsahate / tulyabalayos tu dvayoh satyam eva sahvasthnasya nsti sambandhah / tath ca bhagavn vrsaganyah pathati "rptisay vrttyatisays 2 ca virudhyante / smnyni tv atisayaih saha vartante" (cf.YBh.onYS.2.15,3.13) / tadyath jalgni pacaniyasvedaniyesu kryesu, chytapau ca sksmarpapraksane 3 , sitosne ca prajvasthitau 4 / evam tatsiddhah pradipavat sattvarajastamasm virodhe 'pi sahabhvah / ha: yad uktam laghvdibhvasvabhvabhedd^3) gunanntvam ity atra brmah: bhinn laksanabheds cen mithah sattvdayo gunh / tarhi laksanayuktatvt 5 sad gunh prpnuvanti te / / yadi laghvdilaksanabhedt sattvdinm nntvam mitho 'bhyupagamyate tena laghutvapraksatvayor api bhedo 'sti <iti> gunadvayaprasangah / evam upastambhacalatbhym gauravavaranbhym 6 ca dvayam dvayam iti sad
J A11 the Mss read sattvasyottaravirodhd. We follow Pandeya. 2 K. and D.: rptisayd vrttyatisayc P. rptisayd vrttyatisays 3 P. praksanena 4 K. and P.: vrajvasthitau D. vrajvasthitau, s.m. prajsthitau 5

10

15

20

25

We follow Pandeya.

D. tarhi laksanayuktatvt, s.m. bhinnalaksanayuktatvt D. gauravavarnbhym, s.m. gauravvarnbhym

(^(murchitah) misrikrtah / / (K.49b, D.153 without number) (2) (pratiyogl) virodhl// (K.49b, not found in D.) (3)(laghvdibhvasvabhvabhedd) laghutvasya laksanasya praksakatvasya <ca> laksanasya yadi bhedo 'sti tarhi laksanabhedd gunadvayaprasangah, evam anyayor api gunayoh / atha laghutvam eva praksakatvam ity anayor abhedas tarhi laghusabdenaiva praksatvbhidhnn na prthakpraksasabdagrahanam kryam / yadi tcyate laghutvapraksakatvayor bhede saty api sattvasya na bhedas tarhi laghutvapraksakatvopastambakatvacalatvagauravvaranabhede 'pi na gunabhedah syt / kim tv eka eva gunah syn na tu tritvam / / (K.50a, D.153 without number)

138

YUKTIDIPIKA

gunah prapnuvanti / atha matam / laghutvaprakasatvayor 1 abheda iti prthaganabhidhnam prptam / tadbhede v grahanabhedam anicchatah prpto laghutvdibhede 'pi <gunbhedas>2 tath caiko guna iti prptam / yat punar etad uktam (135.18) gunabhtasya bhaktita upakrt pradhnarppattir ity <atra brmah:(?)> angabhvam vrajat sattvam duhkham sampadyate yadi / <trai>rpyasyopasamhrt3 prvadosnivartanam / / yadi hi rajaso 'ngabhvam upagacchat sattvam upakrt tadrpam^ 1 ) bhavati tena <pra>tijntasya4 rpntarasyopasamhrt^ 2 ) trairpyam gunnm ekaikasya prptam rpntarasya v sata utpattih / tasmt prvadosparihrt pratijnmtram evyam samdhih 5 / yad apy uktam (136.5) agunabhtnm svabhvagrahand ity <atra brmah:(?)> angabhvnapeksam <tu> grahanam 6 nsty rser api /

10

15

20

25

paramarser api gunnm kryam eva pratyaksam na saktimtratvena 7 avasthnam asamvedyatvt / tatra cngngibhvagamanam anivryam / tasmd dosam anicchat gun eva v parityjyh 8 , nsti v sudram api gatv tatsamkaradosaparihrah / ucyate: yat tvad uktam(137.24) lakasanabhedd gunanntvavdino laksanadvayayogd ekaikasya gunasattvaprasanga iti <tad ayuktam /> kasmt / dvayor^3) gunapradhnabhvnupapatt <eh>9/ ihrthntarasyrthntarena gunapradhnabhvo bhavati / yath striksatrameghesu 10 vykhytam (135.16ff.) / na ca laghutvapraksayor upastambhacala<t>yor 11 gauravavaranayos 12 ca mitho gunapradhnabhvo 'sti / <tasmd>13 anarthntaram dharms ta iti nsti sattvaprasariga iti / kirn ca aprasiddhatvt / na hy etat
1 K. and P.: praksayor D. praksayor1 s.m. praksatvayor 2 All the Mss read gunabhedas. We follow Pandeya. 3 All the Mss read vairpyasyopasamhrt. 4 All the Mss read tenpratijntasya. We follow Pandeya. 5 Dkha. ayam na samdhih 6 A11 the Mss read grahanam instead of tu grahanam. We follow Pandeya. 7 K., P. and D.: saktimtrena We have accepted the reading of Dkha. 8 K., P. and D.: evparityjy Dkha. eva vparityjy 9 All the Mss read gunapradhnabhvnupapattih. We follow Pandeya. 10 0 0 D. stre ksatra , s.m. striksatra We have accepted the reading of Dkha. 11 All the Mss read calanayor. 12 D. gauravavarnayos 13

All the Mss read tad.

(^(tadrupam) tadrupam rajorupam // (D.154-1, not found in K.) (2) (rpntarasya) sattvavisaye rajorpasya rpntarasya // (D.154-2, not found in K.) (3)(dvayor) tl laksanayor iti sesah // (D.155 in the left margin, not foundin K.)

TRTIYAM AHNIKAM SK13

139

kvacit prasiddham yath yvanto dharms tvanto dharmina iti na cprasiddhena vyavahrah / kirn ca prthaktvaikntaprasangt / laksanabhedn nntvapratijnasya sarvrthnm svasmnyalaksanayogt^1) svato 'rthntaram iti prthaktvaikntaprasahgah / athaitad anistam na tarhi vaktavyam laksanabhedd gunnm sattvam iti / yat punar etad uktam (138.7) angabhtasya pradhnarppatteh prvadosnivrttir iti / tad apy ayuktam / kasmt / bhaktyabhidhnt / asakrd abh<ihi>tam1 asmbhir bhkto ' y a m gunnm grahanavikalpa iti / na ca bhaktih paramrtha ity asthne yatnah / yat punar etad uktam (138.15) agunabhtnm sattvdinm rser apy avisayatvam iti / satyam etat / yat tktam(138.16) kryasya visayabhtatvd angngibhvagamanam gunnm 2 <...> sakalam satkryam 3 apeksate / <...> tath striksatrameghh^ 2 ) 4 prakrth, tesv angabhvam <upa>gacchanta^3)5 iti vijnyataW iti / smnyasabdnm hi prakarand visese 'vasthnam bhavati / tadyath bhojanakle saindhavam nayety ukte lavane sampratipattir nsvdisu / tasmt prakaranam anapeksya mahati tantre dosbhidhnam blavkyasthniyam / evam gunalaksanopadest siddham traigunyam / / 1 3 / /

10

15

aha: avivekyadir idanim ganah katham pratipattavya iti / ucyate: AVIVEKYDIH SIDDHAS TRAIGUNYT / (SK14ab?) yat trigunam tad "aviveki visayah smnyam acetanam prasavadharmi" (SKlla'b) iti / katham avagamyata iti cet TADVIPARYAYBHVT / (SK14b')
1 K. 2 D. 3 K. 4 D. 5

20

and D.: adhitam P. abhitam gunam, s.m. gunnm and P. sakalasatkryam D. sakalasatkryam, s.m. sakalam satkryam stre ksatrameghh We have accepted the reading of Dkha. AU the Mss read agacchata. D. reads in the footnote upagacchantv iti pthah.

(^(svasamanyalaksanayogat) ti samanyavisesalaksanadvayayogat sarvam prthag iti na kimcid ekam iti syt / / (D.I56 in the right margin, not found in K.) (2) (striksatrameghh) tl sattvakryam strikstram rajahkryam meghas tamahkryam / / (D.I56 in the right margin, not found in K.) (3) (-bhavam <upagacchanta>) bhvam upagacchantv iti pthah / / (D.156 in the bottom margin, not found in K.) (4) (sakalam satkryam; strlkstrameghyh prakrth, tesu; vijiiyata) tl sakalam satkryam kartr yady apy gunnm anghgibhvam apeksate tay vin na bhavatlty arthah / tathpiha gunagatenngngibhvena na kimcid virudhyate / yatah strlkstrameghyh prakrth, tesu ca prakrtesu satsu / vijnyata iti prvoktam ni^clyate / kirn tat / angabhvam agacchata iti / / (D.156 in the bottom margin, not found in K.)

140

YUKTIDIPIKA

yasmad gunaviparyayah ksetrajnah, tatra visayatvam acetanatvam prasavadharmitvam ca na bhavatity uparistt 1 pratipdayisymah(169.18) / tasmt parisesato vyakta 2 etesm dharmnm avirodhah / ha: "tath pradhnam" (SKllc') iti prg uktam bhavat / tad idnlm katham pratipattavyam pradhnam api trigundiy uktam iti / ucyate: KRANAGUNTMAKATVT KRYASYVYAKTAM API SIDDHAM / (SK14cd)

10

15

20

25

iha kranaguntmakam kryam drstam / patdivyakte ca traigunydy upalabhyate / tasmt kranam apy asya tathjtlyakam iti sakyam anumtum / siddhntamtropadarsanam etad cryah karoti / nyyam tu yathoktesu pradesespapdayisymah (cf.SK15) / ha: kryadharmasya kranopalabdhau 3 hetumaddiprasangah avisest / yadi krye drstasya dharmasya krane sadbhvo 'bhyupagamyate prpto hetumaddinm api dharmnm kryadrstatvt pradhne prasahgah / atha kryopalabdhau tulyym hetumaddayo nesyante na tarhitaresm api kranvasthitir astiti / ucyate: na svarpavirodhitve tadapavdavijiint / kranaguntmakatvt kryasyety anena lingena hetumaddayo 'pi krane prasajyante / tesm tu kryakranarpavirodhitvd apavdo vijfiyate / katham / yadi tvad dhetumaddayo vyakte drstatvt 4 pradhne <pras>ajyante5 krtakatvt kryam eva tan na^1) kranam iti prptam, anityatvc ca svayam ucchidyamnam ananugrhakam avypitvdibhis cnantavikrotpdanasaktihlnam / ahetumadyah pradhne 'bhyupagamd vyakt<e>'pi6 prpyante tdrsh / kransambhavt kryam eva tan na <kranam> bhavatiti prptam / avivekydayas tbhayatrpi bhavanto netaretarasvarpavirodhinah / tasmt kryakranabhvbhyupagamd dhetumaddyapavda itaresm ca kranasadbhvah siddhah / yad uktam kranaguntmakatvt kryasyvyaktam api siddham / (SK14cd) iti tad ayuktam / kasmt / vyaktvyaktayoh kryakranabhvprasiddheh / siddhe hi vyaktvyaktayoh <krya>kranatve7 etad eva<m>8 syt / tat tv asiddham / tasmd ayuktam etat / visesnabhidhnad ubhayasmyam
X K. and P.: bhavatiti purastat D. bhavatiti purastat, 2 D. 'vyakte, s.m. vyakte 3 P. karanopa0 4 D. vyakte drstatvt, s.m. vyaktadrstatvt 5 K. and D.: vyajyante P. vyanjante 6 All the Mss read vyakter api. 7 A11 the Mss read kranatve. We follow Raghavan. 8

30

s.m. bhavatity uparistt

All the Mss read eva. We follow Raghavan.

(x)(tan na) na tat sarvagrahakatvena mulakaranam bhaved ity arthah //(K.51b, D.158)

TRTIYAM AHNIKAM

iti cet^ 1 )/ syn matam / yath bhavn ha vyaktvyaktayoh kryakranabhvo 'prasiddha 1 evam vayam vaksymas tayoh kryakranabhvprasiddhir apy asiddh, na ca kvacid viseso 'sti / ubhayasmyam bhavisyatiti^ 2 )/ tac cyuktam / kasmt / sadbhvsiddheh / satyam anabhidhlyamne visese syd ubhayasmyam / avyaktasya tu sadbhva evsiddha ity ayam visesah / tasmd ayuktam etad apiti^ 3 )/ kryasya kranaprvakatvd vyaktasya ca kryatvd avyaktasadbhve pratipattir iti cet / syd etat / kryam kranaprvakam drstam / ghatdikryam ced<am> vyaktam 2 pramitatvt / tasmd idam api kranaprvakam bhavitum arhati yac ca tasya kranam tad avyaktam iti / tac cnupapannam / kasmt / anekntt / ihkasmiki 3 ca kryasyotpattir drst tadyathendradhanusah^ / asatas ca bhrntimtrt tadyath^5) mysvapnedrajlamrgatrsnikltacakragandharvanagarnm / satas ca krant tadyath^ 6 ) mrddibhyo ghatdlnm / kryam ced<am> vyaktam 4 / atah samsayah kirn indradhanurvad akasmd asya prdurbhvo ? tha mydivad asato 'tha krant sato ghatavad iti / ucyate: nkasmikam asatprvam vyaktam / kasmt / BHEDNM PARIMNT / (SK15a) yat parimitam tasya sata utpattir drst / tadyath mlnkuraparnanladandabusatusaskapuspaksiratandulakannm / parimits ca5 mahadahamkrendriyatanmtramahbhtalaksanabhedh / tasmt satkranaprvakh 6 / yad esm kranam 7 tad avyaktam / iti yuktidlpikym smkhyasaptatipaddhatau trtiyam hnikam 8 prathamam
1 D. na siddhah 2 KM P. and D.: ced avyaktam Dkha. ced vyaktam 3 D. ihkasmike 4 K., P. and D.: ced avyaktam D. reads ced vyaktam iti ca pthah in the right margin. 5 K. and P.: parimit D. parimit, s.m. parimits ca Dkha. parimits ca 6 D. satkranaprvakh s.m. tasmt kranaprvak Dkha. tasmt kranaprvak 7 Dkha. kranam 8

10

15

20

D. iti srimadcryesvarakrsnviracitym smkhyasapttau yuktidipiknmni vivarane trtiyam hnikam / 3 /

(^(viSesanabhidhnd ubhayasmyam iti cet) samkhyamukhena prasnah // (K.52a, D.159 in the right margin) (2) (ubhayasmyam bhavisyatlti) tl samkhyamukhena prvapaksavdyuktih / / (D.159 in the right margin, not found in K.) (3)(iti) tl prvapaksah // (D.159 in the right margin, not found in K.) <4) (tadyath) tl ekah paksah // (D.160 in the top margin, not found in K.) (5) (tadyath) tl dvitlyah / / (D.160 in the left margin, not found in K.) (6) (tadyath) tl tritlyah / / (D.160 in the right margin, not found in K.)

142 ca prakaranam samaptam 1 /

YUKTIDIPIKA

D. prathamam prakaranam ca samaptam / I / , s.m. prathamam ca prakaranam samptam / I /

a t u s t a y a

A h n i k a m

[aha1 : kasmad asty avyaktam] asadbhedanam api parimanadarsanad a n e knta iti cet / syn matam / asti hi mysvapnendrajlnuvidhyinm api bhednm parimnam iti tasmd anaikntiko hetur iti / tac ca naivam / kasmt / <aniyamt(?) /> na hi tesm niyamo 'sti etvadbhir evotpattavyam nnyair iti / mahaddayas tu pralayaklatirobhts tvanta evotpadyante / tasmn nnekn<ta>h 2 / ha: parimnnavasthnam kladvaynupalabdheh / satyam smprate kle mahaddayo yuktaparimnh pratyaksnumnopalabdheh / atitngatayos tu klayor nsti prasiddhih / tasmd ayuktam etat / ucyate: na viparyaye pramnnupalabdheh / idnim etvanto bhed ity etac chakyam anumtum / atitngatayos tu klayor nsti prasiddhih / tasmn na bhednavasthprasangah / ha: bhedbhednavasthnt 3 / mahaddinm ye bhed devamanusyatiryanco ghatdayas ca tesm asakyam parimnam paricchettum / s m n y e 'ntarbhvd <yu>ktam 4 iti cet / syn matam / asti sarlrnm mahbhtasmnyam ghatdlnm ca prthivismnyam tatparimnd ete Jpi parimit iti / tad ayuktam / kasmt / abhvt / na hi vah smnyam dravyd arthntarabhtam asti srpyamtre smnyaparikalpant / ucyate: na tattvntarnupapatteh / tattv<>bhedena5 parimit bhed ity etad vivaksitam yathoktam asmbhir uktam ca / yady asti tattvntaram ucyatm / yat punar etad uktam(143.18) smnyasyrthntarabhtasya bhavatpakse 'nupapattir iti satyam etat / tathvidhenpi tu tena samvyavahro na pratisidhyata iti vaksymah(164.16) / tasmt siddham bhednm parimnd asty avyaktam / kirn cnyat /

10

15

20

25

SAMANVAYT / (SK15b')

D. atha samkhyasaptatipaddhau yuktidipikanamni vivarane dvitiyam prakaranam prarabhyate tatredam caturtham hnikam / ha (D. caturthaprathamam hnikam, s.m. caturtham hnikam) P. om / ha 2 K. and D.: nneknth P. nekntah 3 D. bhedbhed0, s.m.'bhedabhed0 4 All the Mss read ayuktam. 5 All the Mss read tattvabhedena. We follow Raghavan.

144

YUKTIDIPIKA

10

15

20

25

30

iha yena bhedanam samanugatis tasya sattvam drstam tadyatha mrda ghatadinm / asti ceyam sukhaduhkhamohaih sabddmm samanugatih / tasmt te 'pi santi / ye ca sukhdayo 'stamitavisess tad avyaktam / tasmd asty avyaktam / ha: na asiddhatvt / sukhdibhih sabddayo 'nugamyanta ity etad aprasiddham / kena kranena pratipattavyam iti / ucyate: tadbuddhinimittatvt / iha sabdasparsarparasagandhnm sannidhne svasarnskravisesayogt sukhaduhkhamohkrh prninm buddhaya utpadyante / yac ca ydrsim buddhim utpdayati tat tennvitam 1 tadyath candandibhih sakaldayah / tasmn nsiddhih samanvayasyeti / ha: asiddha evyam samanvayah / kasmt / vilaksanakryotpattidarsant 2 / na hy ayam niyamah kranasadrsam eva kryam utpadyate / kirn tarhi / vilaksanam agnidhmasabddi / katham / na hy agnis trndisvabhvako 'gnisvabhvako v dhmah / na ca bherldanddisvabhvah sabdah / tasmt sukhdyanugath sabddaya iticchmtram / ucyate: na visesitatvt / sukhdisvarph sabddayah tatsannidhne sukhdykrapratyayotpatt<er> 3 ity etad dita evsmbhir visesitam / tasmn na bhinnajtiys ta iti / yat tu khalv idam ucyate(144.10) 'gnydlnm vilaksannm utpattidarsant pradhnabhednm atajjtiyaprasanga iti tad ayuktam / kasmt / abhiprynavabodht 4 / naiva brmo yo yasya vikrah sa tajjtlyaka iti / kirn tarhi / yo yajjtlyakah sa tasya vikra iti / tasmd ayuktam etat / kirn cnyat / udharanprasiddheh 5 / na caitad udharanam prasiddham agnydayah svakranajtim nnuvidadhatiti / kasmt / balavirynuvidhnt tadyath agner dhmasya ca tvakcandananalikdisnigdhatnuvrttes 6 taiksn<y>dyanuvrttes7 ca / bherivikrah sabdah, na tu yath bherlrpam avasthitam, pradipeneva tu dandbhightena vyajyata iti sdhyam etat / na caikaiko rpdlnm dravykrah samudyadharmatvt / tasmn na bherivikrah sabdah^1^ / tatra yad uktam(144.10) vilaksanakryotpattidarsand asiddho 'nvaya ity etad ayuktam / tasmd yuktam etat samanvayd asty avyaktam iti / kirn cnyat / SAKTITAH PRAVRTTES CA / (SK15b') iha yvati kcil loke pravrttir upalabhyate s sarv saktitas tadyath kumbhakrasya, danddisdhanavinysalaksanys ca sakteh sannidhnd ghataX D. tennyatvam Dkha. tennvitam 2 D. vilaksanakryotpattidarsant, s.m. 3 All the Mss read pratyayotpattir. 4 Dkha. navabodhand 5 6

vilaksanotpattikryadarsant

K., P. and D.: udharanprasiddheh Dkha. udharansiddheh D. corrects udharansi ddheh of Dkha. into udharanprasiddheh. D. reads in the right margin: digdhnuvrtteh iti pthah / digdhah mmsety prasiddhah gandhah /. 7 All the Mss read taiksndyanuvrttes. We follow Chakravarti.

t1) (na bherivikrah sabdah) rupadipancakavyatiriktam tavad dravyam nasti / na ca rupam eva v gandho v rasa eva v sparsa eva v bherl yena tadvikrah sabdo bhavet / / (D.164, not found in K.)

CATUSTAYAM HNIKAM SK15

145

karanepravrttir asti / vyaktasya^1) ceyam kryatvt tadbhvena pravrttir ity 1 atas tasypi sakty bhavitavyam / yasau saktis tad avyaktam / tasmd asty avyaktam iti / ha: prk pravrtteh saktyabhvah pravrttyanupalabdheh / yadi saktiprvik pravrttir iti manyadhvam tena yvat pravrttir nopalabhyate tvac chaktir nstity etad pannam / kasmt / satym saktau krybhve 2 svarpbhvaprasangt / yadi khalv api vidyamn saktih kenacit pratibandhena kryam notpdayec chaktir asaktety etad pannam / tasmt 3 sahakribhvntarasannidhnt pravrttisamaklam evrthnm saktaya utpadyante ts ca tvad^2) eva pradhvamsante / tatra yad uktam(144.31) prk pravrtteh saktidarsnd vyaktasypi nispdik saktir astity etad ayuktam / kirn cnyat / bhedbhedakalpannupapatteh / iha pradhnam eva v saktihsyt pradhnd v bhinn / kirn ctah / tad yadi tvat pradhnam eva saktis^3) tena kryabhedc 4 chaktibhedo 'vasiyata iti saktibhedt pradhnanntvaprasangah / pradhnaikatvd v tadavyatiriktnm saktinm ekatvaprasangah / tatas ca kryanntvbhvah / atha m bhd ayam dosa iti pradhnd arthntarabhvah saktinm abhyupagamyate / tena bhinnnm saktinm pravrttitah siddhau pradhnasiddhir nstity etad pannam^ 4 )/ kirn cnyat / svarp<na>bhidhnam 5 ca / pradhnasya saktimtrd apy(5^ arthntaratvam abhyupagamya rpam Idrk pradhnam svvasthym iti <abhidhmyam> / tac csakyam abhidhtum / tasmd bhedbhedakalpannupapatter akalpaniy saktir iti / ucyate: yad uktam(145.4) prk pravrtteh saktyabhvah pravrttyanupalabdher ity atra brmah: n a aprasiddhatvt / [kranam saktih kryam
1 K. and D. omit ity. 2 KM P. and D.: saktyrn 3 D. tasmt, s.m. kasmt 4 P. krye bhedc 5

10

15

20

krybhve Dkha. saktau krybhve D. s.m. saktym krybhve

All the Mss read svarpbhidhnam.

(^(vyaktasya) purvoktamahadadeh / / (D.165 without number, not found in K.) (2)(tavad) tasminn eva ksana ity art hah / / (K.54b, D.165 without number) (3) (tad yadi tvat pradhnam eva saktis) pradhnam eva saktir iti darsanesaktytmakam pradhnam pradhntmik v saktaya iti vidhyanuvdabhedena dsanadvayam dadti tad yadltydin / / (K.54b, D.165 without number) (4) (etad pannam) etad pannam iti / na hy anyasya siddhv anyasya siddhili saktayas ca prasiddhh pradhnd arthntarabht iti bhvah / / (K.54b, D.l66 without number) ^5^ (Saktimtrd apy) saktimtrd aplti prvam ca tvayoktam y saktis tat pradhnam iti vadat saktimtrapradhnarpam iti tad dhrdaye nnuvisati, adhun tu tato 'pi kimcid arthntaram pradhnam ity ukte nirupkhyam eva kimcit tad abhihitam syt / k hi tasya pradhnasya sv das svam rpam iti yvat / / (K.54b, D.166 without number)

146

YUKTIDIPIKA

10

15

20

pravrttih /] na ca karyanupalabdhau karanabhava 1 ity etal loke prasiddham^ 1 )/ yat punar uktam( 145.6) kry<>nispattau2 sakteh svarpahnam 3 ity atra brmah: na pradlpadrst antat / tadyath pradipasya ghatdipraksanasaktir^2) asti / atha ca kudydyvaranasmarthyn na ghatdln praksayiturn saknoti / na ca sakyate vaktum pradipasya praksanasaktir asakteti / evam anyesm api bhvnm prk pravrtter api saktih syt / na ca pravrttyadarsand 4 asyh svarpahnam 5 syt / yat tktam( 145.8) sahakribhvntarasannidhnt pravrttisamaklam evrthnm saktiprdurbhva ity atra brmah: tadaprasiddhih saktyapeksatvt / iha sarvah kart svagatm saktim apeksya tadyogyatay sahakribhvntaram updatte / s cet prk pravrtter na syt sdhannm visayasvabhvnavadhrand anupdnaprasangah / anistam caitat / tasmt prk 6 pravrtteh saktih / yat punar etad uktam(145.10) tvad eva pradhvarnsa7 ity atra brmah: na kryanisthdarsant^ 3 )/ yadi pravrttisamaklam eva pradhvarnsah 8 syt kryanisthaiva na syt tannimittatvt kryasya / asti tv asau / tasmn na pravrttisamaklam eva saktipradhvarpsah / sadrsasantnotpatty 9 kryanistheti cen na vinsaklotpattyasambhavt 1 0 / athpi syt / ekasym saktau ksanasdhyam 11 amsam avasya vinastym 12 anyat tatsadrsam saktyantaram utpadyate tasmin vinaste 'nyad ity evam saktisantnt kryanisth bhavatiti / etad apy ayuktam / kasmt / vinsaklotpattyasambhavt / ko hy atra hetur yena vinsasamaklam anyac chaktirpam kryam avasyayati na punah prktanam evvasthitam iti / kirn cnyat / kautasthyadosaparihrt / ksanottaraklvasthne 13 ca bhvnm yo dosa upttah kautasthyaprasanga iti tasya parihra uktah / tasmn nsti saktlnm pravrttikle vinsah / pravrttyuttaraklam api nsti /
1 K., P. and D.: krybhva Dkha. kranbhva 2 K., P. and D.: kryanispattau Dkha. kynispattau 3 D. svarpahnir, s.m. svarpahnam 4

K. na na pravrttidarsand P. na ca(l) pravrttidarsand D.: na pravrttidarsant, s.m. na na pravrttidarsant D. reads in the right margin: na ca pravrttyadarsant asyh svarpahnam syt iti ca pthah. 5 D. svarpahnam, s.m. asyh svarpahnam 6 D.: tasmt k, s.m. tasmt prk 7 D. pradhvamsa1 s.m. pradhvamsante 8 Dkha. saktipradhvamsah 0 9 0 K. and P.: sadrsasandhno0 D. sadrsasandhno , s.m. sadrsasantno0 10 0 K. and P.: vinsasamaklo Dkha. vinsaklo D. vig(1)sasamaklo, s.m. vinsasamaklo0 11 Dkha. laksanasdhyam 12 D. vinasthyam, s.m. vinisthyam 13 D. vasne

(*) (prasiddham) na hi ghate bhavati kulalasyoktam samarthyam nasti svasamvedanasiddhatvad iti bhvah / / (K.55a, D.166 without number) (2) (pradlpasya ghatdipraksanasaktir) na hy vrtasypi kudydibhih pradlpasya praksanasmarthyam nsti, evam hy asau pradlpa evndhatamasdivivikta iti / / (K.55a, D.167 without number) <3) (-nisth-) tl sthitih // (D.167 i.n., not found in K.)

CATUSTAYAM AHNIKAM SK15

147

kasmt / punahpravrttidarsant / saktyantarotpattau pravrttyantarasadbhva iti cen na hetvabhvt / ko hy atra nirbandhah tasym vinastym any pravrttyantarahetur bhavati naiva punah <saiveti>1/ krtrthatvd iti cen na anabhyupagamt / na hy ekaghatrth saktir abhyupagamyate / tatra yenaiva hetunaikam ghatam vasya na vinasyati tenaiva yvanti kartavyniti / tasmt trisu klesu saktayo 'vatisthante / yat punar etad uktam(145.11) bhedbhedakalpannupapattir ity atra brmah: astu pradhnd abhinn saktih / na tasya nntvam saktyekatvam v prasajyate / kasmt / samkhyvyavahrasya buddhyapeksatvd buddhinimittasya cgajtkxenaj)radhnasaktisvabhvt / ihyam samkhyvyavahro buddhyapeksah / katham / yad abhinnm buddhim utpdayati tad ekam / pradhnvasthym ca saktayo 'stamitavisesatvd abhinnm buddhim utpdayanti / tasmd ekam / tatpravrttikle visesvagrahena bhedam pratipadyate 2 devasaktir manusyasaktir itydi / tasmn nsm ekatvam / ato na bhedbhedakalpannupapattir 3 iti / vyakte darsanc 4 chaktlnm avyakte <'>pratipattir 5 iti cet / syd etat / vyakte saktipravrtti 6 drste na cvyakte 7 kvacid <ity> ato 8 vyaktam evaitasmd dhetoh siddhyati nvyaktam ity / etac cyuktam / kasmt / smnyato<drstt> 9 siddheh / yathaiva hi devadattdhray kriyay tasya desntaraprptim upalabhytyantdrstam jyotism desntaraprpter gamanam anumiyate, evam pravrtteh saktiniyamitatvd vyaktasya ca pravrttibhtatvd avasyam atyantdrst saktir abhyupagantavyeti siddham saktitah pravrtter asty avyaktam / kirn cnyat / KRANAKRYAVIBHGT / (SK15c) kranam ca kryam ca kranakrye tayor vibhgah kranakryavibhgah / idam kranam idam kryam iti buddhy dvidhvasthpanam vibhgo yah sa kranakryavibhgah / tad avasthitabhvaprvakam drstam tadyath sayansanaratha<sa>randih 10 / asti cyam vyaktasyakranakryavibhgah 11 / tasmd idam apy avasthitabhvaprvakam / yo 'sv avasthito bhvas tad avyaktam 12 / ha: tadanupalabdher ayuktam / na hi sayandinm kranakryavibhgah kascid upalabhyate / tasmd ayuktam etat / ucyate: na kryakranayor upakrakopakryaparyyatvt / <na hi> kranam 13 kryam iti nirvartyanirvartakabhvo 'bhipretah / kirn tarhi /
1 All the Mss read saiva sett. We follow Pandeya. 2 D. pratipadyate, s.m. pratipadyante 3 D. papattir, s.m. papatter 4 D. vyakte darsanc, s.m. vyaktadarsanc Dkha. vyaktadarsanc 5 K., P. and D. avyakte pratipattir Dkha. avyaktapratipattir 6 D. saktipravrtte, s.m. saktipravrtti 7 D. cvrkte1 s.m. cvyakte 8 A11 the Mss read anyato instead of <ity> ato. 9 All the Mss read smnyatodrstntt. We follow Chakravarti. 10 All the Mss read 0sayansanarathacarandih 11 D. kryakrana , s.m. kranakrya0 12 D. avyaktam, s.m. avyaktam; tasmd asti avyaktam. 13

10

15

20

25

30

P. kranam

148

YUKTIDIPIKA

10

15

upakarakopakaryabhavah / sa casti sayanadmam vyaktasya ca / ato na pramadbhidhnam etat / ha: kah punar vyaktasya paraspa<ra>kryakranabhva 1 iti / ucyate: gunnm tvat sattvarajastamasm praksapravrttiniyamalaksanair dharmair itararetaropakrena yath pravrttir bhavati tath "prityapritivisdtmakh"(SK12a) ity etasmin stre vykhytam / tath sabd adln am prthivydisu parasparrtham ekdhratvam^ 1 )/ srotrdlnm itaretarrjanaraksanasamskrh^ 2 )/ kranasya^3)2 kryt sthnasdhanaprakhypan<ni> 3 / kryasya^4) karand^5^ vrddhiksatabhangasamrohanasam<po>sanapariplanni 4 / prthivydlnm <dhrtisangrahapakti>vyhvaksadnair 5 gavdibhvah(cf.NS.3.1.26(c)) / devamnusatirascm yathartuvidhnejyposanbhyavahrasamvyavahrair itaretardhlna<tvam> 6 / varnnm svadharmapravrttivisayabhvah / anyac ca lokd yathsambhavam drastavya<m> 7 / ha: tadanupapattih kramayaugapadysambhavt / yo ' y a m Sul>nm praksapravrttiniyamair itaretaropakro ? bhyupagamyate sa khalu kramena v syd yugapad v / kirn ctah / tan na tvat kramena sambhavati / kasmt / ekasya nirapeksasya pravrttv itarayor api tatprasangt / yadi tvat sattvam prvam gunntaranirapeksam svasaktita eva praksate tayor 8 upakrakam ity sriyeta 9 tena yath sattvam evam itarv apy upakranirapeksau
2 D. kranasya 3 All the Mss read prakhypandi. 4 0 All the Mss read vrttiksatabharigasamrohanasamsosana . 5 0 K. and D.: vrttisamgrahapaktivyh P. vrttisamgrahapanthivyh0 6

the Mss read parasparasya kryakranabhva. We follow Chakravarti.

K. vyavahrair itaretardhyayanam P. vyavahraititeratardhyayanam D. vyavahr itaretardhinam 7 A11 the Mss read drastavyah. We follow Chakravarti. 8 P. prakseta tayor Dkha. praksetarayor 9 K. and P.: sriyate D. sriyate, s.m. sriyeta

(^(ekadharatvam) ekadharatvam iti / sabdadayah pafica prthivim upakurvate gandharahit jalam, gandharasarahits teja evam anyesv api jneyam / evam bhtni sabddln dhrayanti* / / (K.56b, D.171 without number) * After dhrayanti D. adds iti parasparam upakri by a different hand.

(2) (itaretara-) itaretarasabdena visayo v svarpam v yathyogam srotrasrutaabdnusrena caksuh pravartata iti tasya visayah srotrenrjita caksus niskantake mrge 'nviste pdasya raks caksus kantakoddharanena hastaparimrjane pddeh* samskrah** / / (K.56b, D.170 without number) *D. hastaparimrjane pdeh, s.m. hastaparimrjane na pdeh **After samskrah D. adds evam anyatrpy hyam by a different hand. (3) (kranasya) indriyasargasya kryc charlrt sthitih / tatra hi tni tisthanti santi svakryam sdhayitum saktni bhavanti svakryasiddhidvrena ca tesrn anumnapravrttau svtm prakhypitas tair indriyair bhavatlti // (K.56b, D.171 without number*) *This footnote of D. is marked by a sign similar to an asterisk. (4) (kryasya) sarlrasya // (K.56b, D.171-2) (5)(karand) tl hastagateh // (D.171, not found in K.)

CATUSTAYAM HNIKAM SK15

149

svakryam karisyata ity upakrnarthakyam / atha m bhd ayam dosa ity ato yaugapadyam sriyate / tad apy anupapannam / kasmt / <saha>bhtnm1 anupakrakatvd govisnavat / kirn cnyat / sadasadvikalpnupapatteh / iha sattvam praksamnam rajastamasor vidyamnam v praksam viskuryd avidyamnam v / kirn ctah / tad yadi tvad vidyamnam abhivyanakti tena sarvesm ekasvbhvyd <eka>gunatvaprasangah2/ kirn ca sattvavac cetarayoh svtantryaprasangah / yathsattvasya praksasaktir astity atas tad gunntaranirapeksam praksate tadvad itarv aplti <dosah>3/ athavvidyamn 4 praksasaktih sattvasambandhd rajastamasor upajyate / tena yad uktam(146.12) prk pravrtter avatisthante 5 saktaya iti tad dhinam / tatas ca satkryavdavyghtah / kirn c<nyat>6 / anekntt / na hy ayam ekntah parasparopakrinm avasthitabhvaprvakatvam iti / tath hi sattvdayah parasparopakrino na cvasthitabhvaprvakh / tena yad uktam(147.24) kranakryavibhgd 7 bhednm avyaktam asti <ity> et ad ayuktam / ucyate: yad uktam (148.14) upakrbhvah kramayaugapadysambhavd iti / astu yugapadupakrah / yat tktam(149.2) sahabhtnm 8 anupakrakatvam govisndivad ity atra brmah: na anyathnupapatteh / na hi govisnayoh sahabhtatvd upakrnupapattih / kirn tarhi / ekakrybhvt / yesm tu kryam ekam sahabhve tu tesm upakro na pratisidhyate tadyath prthivydinm dhrtisangraha<pa>ktivyhvaksadnaih 9 sarirasthitau 10 / kramabhvinor api khuravisnayor nsti parasparopakrah / tasmn na sahabhvasahabhvv upakrnupakrahet / kirn ca drstatvt / drstah khalu^ bhogenordhvagamane vyvor ardhacanddinm yugapadupakrah 11 [na ca kascid dosah] / tath gunnm api syt / samyoganimitta iti cet sdhyam / kirn arthntarabhtam uta prptimtram samyoga iti <sdhyam> / yat punar etad uktam(149.4) sadasadvikalpnupapatter ity atra brmah: ayuktam 12 etat / kasmt / pangvandhavat tadupakre dosnupapatteh / tadyath pangvandhayor itaretarasamban<dhc ca>13 vidyamnayor drggatisaktyor anyonytmani vyaktir na cvidyamnayor atha caikakryasiddhih 14 / yath ca prthivydinm parasparopakritvam saktayor abhivyajyate na parasakt<y>15 evam gunnm aplti / yat punar etad uktam (149.12) anekntd iti tad ayuktam / kasmt /
1 A\\ the Mss read mahbhtnm. We follow Chakravarti. 2 All the Mss read gunatvaprasangah. We follow Raghavan. 3 All the Mss read ado sah. 4 D. athav vidyamn, s.m. athavvidyamn 5 P. eva tisthante 6 All the Mss read cyam. 7 D. kranakryabhgd, s.m. kranakryavibhgd 8 D. sahabhtnm, s.m. mahbhtnm 0 9 All the Mss read dhrtisamgrahasaktivyh . 10 P. sanrasthito 1Ji P. yugadupakrah 12 D. avyaktam Dkha. ayuktam 13 All the Mss read itaretarasambandhn na. 14 D. caikakryayoh siddhih, s.m. caikakryasiddhih 15

10

15

20

25

30

All the Mss read parasaktaya. We follow Pandeya.

150

YUKTIDIPIKA

10

15

sastranavabodhat / ihasmakam karyakaranayor 1 <arthantaratvana>bhyupagamd 2 gunnm avasthntaram evvasthntar<>peksam3 kryakranasabdavcyatm labhate / tatra ye tvat 4 pradhnvasthnubhvino guns tesm saktimtrarpatvd anirdesyapraksdisvabhvnm nsti tannibandhana upakrah / yad vaisamyam padyante tad nivritapraksdirps tannimittam upakram pratipadyante / tasmd vyaktnm upakrbhyupagamd avasthitabhvaprvakatvam na virudhyata iti sstram anavagamyaivam ucyate 'naikntiko 'y ar P hetuh <iti> / pradhnvasthym upakrnabhyupagamd uttaraklam api tatprasanga iti cet / syn matam / yadi gunnm dye prakope svasmarthyd eva prvasmt pracyutis tenottaraklam api tadvad eva bhavisyati / atha pradhnvasthym api copakro na tarhy <an>aikntiko 5 hetur iti / tac ca naivam / kasmt / agnivat svasaktinimittatvt / tadyath sksmo 'gnih skmam praksam svayam eva karoti / ghatdipraksane tu tailavartydy apeksate / tadvad gunnm dyah prakopah svasaktitah mahaddyapeksas tpakratah 6 / tasmd yuktam etat kranakryavibhgd 7 asty avyaktam iti / kirn cnyat / AVIBHGD VAISVARPYASYA / / (SK15d)

20

25

iha yad visvarpam tasyvibhgo drstas tadyath sldlnm 8 jalabhml 9 (cf. YBh.onYS.3.14) / visvarps ca 10 mahaddayah / tasmd esm apy avibhgena bhavitavyam / yo 'sv avibhgas tad avyaktam / tasmd asty avyaktam / sldlnm 11 jalabhmyor avibhgatvenprasiddhatvd <a>yuktam 1 2 iti cen na / tan na / tatprva<ka>tvt 13 / yo hi tatprvakas ta<danu>bhvy 14 asau drstas tadyath kaplaprvako ghatah kaplvasthnubhvT / jalabhmiprvaks ca slh / tasmt te Jpi tadavasthnubhvinah / yath ca sldayas tath visesatanmtrhamkramahatm uttarottarapadX D. karyakaranayor, s.m. kryakranayor 2 K. and P.: arthnabhyupagamd D. arthbhyupagamd, s.m. arthnabhyupagamd 3 All the Mss read evvasthntarnapeksam. We follow Raghavan. 4 D. tatraitvat 5 All the Mss read tarhi nnaikntiko. 6 D. tpakratah, s.m. tpakrah 7 D. kryakranavibhgd, s.m. kranakryavibhgd 8 D. writes and deletes: sldinmf jalabhmer visvarpc ca mahaddayah tasmd esm

apy avibhgena bhavitavyam yo sv avibhgas tad avyaktam tasmd asty avyaktam (150.19 21) ha kirn punas tad vaisvarpyam ko v visvarpa iti ucyate vaisvarpyam iti visistam avasthnam caksmahe astamitavisesatvam avibhga iti visesasya smnyaprvakatvd yo frthas tad uktam bhavati avibhgd vaisvarpyasyeti(154.811). 9 D. jalabhmer, s.m. jalabhme 10 D. visvarpc ca, s.m. visvarps ca 11 K., P. and D. omit sldinm .... nstiti flokatarkaviruddham efa*(150.22-154.7). To introduce this portion D. reads: nimnalikhito yam bhgah khapukt pritah. See Introduction p.XI. 12 Dkha. yuktam 13 Dkha. tatprvatvt 14 Dkha. tanubhvy D. corrects tanubhvy into tadanubhvy. We follow the emendation suggested by D.

CATUSTAYAM HNIKAM SK15

151

rthaprva<katvt> 1 tadavasthnubhvah siddhah / smnyatodrstd anumnn 2 mahatas cvyaktvasthnubhvah / tatprvakatvsiddher ayuktam iti cet / syn matam / prk pradhnam asiddham sdhayisymlti bhavat vaisvarpyasyvibhgd iti het<o>h3 sldidrstnta upttah / tatah sldinm avibhgo 'siddha 4 iti tatprvakam upttam / yvat tvad apy asiddham sa bha<vn>5 svapnasopnaparamparayksam rdho 'pi dharanisthita eva / tasmd asiddham pradhnam iti / etac cyuktam / kasmt / vrddhidarsant / krannvayinl hi sldinm vrddhir upalabhyate / tm drstv grhnimahe nnam bhaums caudaks cvayavh kranvayavasahakrinm pari<mnam>6 pratipadyante, tathaism vrddhir bhavatiti / kirn cnyat / tadanuvidhnc ca / drsyate khalv api drdhadurbalatvasnehar<au>ksynm 7 jalabhmigatnm sldibhir anuvidhnam na cprakrter anuvidhnam drstam / ato 'pi manymahe tatprvak<>h 8 sldayah / prthaggrahand ayuktam iti cet / syd etat / jalabhmyoh sldinm prthaggrahanam drstam na ca tat prakrtivikra<yor>9 astiti / etad a y u k t a m / kasmt / sdhyatvt / ye jalabhrriyor avayavh sldibhvam padyante tebhyas tesm prthaggrahanam sdhyam / ato na kimcit <etat>10 / atyantavinsd avibh<g>nupapattir 11 iti cet / syd <etat> / iyam punar abuddhimatm sahk / yad idam j alabhmyavasth<nubhvitvam>12 sldinm punah punar apy <agrahlsmahi>13 .... tadamrsyamnnm XtSj^ sJJ^dajah^svakranavibhgavinsino <'>sad14 iti bhtapratyaksbhvd bhtasmrter virdhapratya<ksatvc>15 cety(cf.VS.9.6) evamdibhir <a>pi16 hetubhir nrabh<ya>kranvasthnubhvina 17 iti / tad apy ayuktam / kasmt / pratisedht / asato hi janma prg vistarena nisiddham(122.3ff.) satas ca tasya <vyakty>apagamd18 anyo vinsah syt / punaruktabhayn na kimcid abhi2 Dkha. anumn(t) 3 Dkha. hetuh 4 Dkha. avibhgo siddha 5 6 Dkha. 7 Dkha. 8 Dkha. 9

10

15

20

25

a. prvat

Dkha. sabhvt D. corrects sabhvt into sabhavn (sa bhavn?). We follow the emendation suggested by D. parinmam sneharroksynm D. corrects sneharroksynm into sneharoksynm. tatprvakah Dkha. prakrtivikro D. corrects prakrtivikro into prakrtivikrayoh. We follow the emendation suggested by D. 10 Dkha. syt ^Dkha. avibhgd anupapattir D. corrects avibhgd anupapattir into avibhgnupa0. We follow the emendation suggested by D. 12 Dkha. avasthbhvitum D. corrects avasthbhvitum into avasthnubhvitvam. We follow the emendation suggested by D. 13 Dkha. agrtsmahi D. corrects agrismahi into agismahi. 14 Dkha. vibhgavinsinah sad 15 Dkha. pratyanvac D. corrects pratyanvac into pratyaksatvc. We follow the emendation suggested by D. 16 Dkha. dibhiripi D. corrects dibhiripi into dibhir api. We follow the emendation suggested by D. Dkha. nrabhikranvasthnubhvina 18 Dkha. tasya kam(l) vaktrapagamd D. corrects tasya kam(7) vaktrapagamd into tasya

152

YUKTIDIPIKA

10

15

20

dhiyate / [tena] tenetarah pratyukto yo 'pi hi manyate prag utpatteh karyasysattvt pr<a>krtv1 avibhgo 'nupapanna iti tenpy "asadakarant" (SK9a') ity <etat>2 prakaranam apeksyam / desngasvabhvavibhgnupapatter ayuktam iti cet / athpi syt / vaisvar<pya>syvibhgbhyanujnnd3 vibhgo 'py anujnta 4 eveti sakyam anumtum / sa ca <vi>bhgo5 vyaktasya [desavibhgd v syt] iksu<ksodarasavad>6 desavibhgd v syt, <...angavibhgd v syt,> bhojanntararasavat svabhvabhedd v syt / kirn ctah / tad yadi tvad desavibhgt kryakranann<tva>prasango 7 gavsvavat, athngavibhg<t> 8 gradhiia^ ca JtmS&a^^ > a t h a svabhva10 bhedat tathapi karyakaranananatvaprasangah sitosnavat / etavams ca vibhagavikalpah syt / sarvath ca dosa iti tasmd asad eta<d> n iti / tac cnupapannaiii / kasmt / vise<sita>tvt 12 / prvam evsmbhir visesitam yathaikam eva no vastu ni<vrtta>visesam13 avibhgaity ucyate samupajtavisesam vibhga iti / kasmt / vibhgavisesayor arthbhedt / evam ca sati des<nga>vibhgayoh 14 kah prasangah, svabhvabhedo 'pi nsti traiguny<dya>visest 15 / saktibhedd iti cen na anek<ntt> 16 / asti hi senvandeh samsthnasya samsthnibhyah saktibhedo na ca nntvam / anekakranaprvakesv 17 <anvaya>parimndidarsand 18 asiddhir iti cet / syn matam / anekakranaprvakesv avigarbhakdisv anvayaparimn<v> upalabdhv 19 anekakartrkesu sayandyangesu kryakranavibhgah /
1 Dkha. prkrtv 2 3 Dkha. 4 Dkha. 5

vyaktyapagamd. We follow the emendation suggested by D.

Dkha. et vaisvarpasy0 anujntah D. corrects anujntah into anujnta. Dkha. cvibhgo D. corrects cvibhgo into ca vibhgo. We follow the emendation suggested by D. 6 Dkha. iksdarasave D. corrects iksudarasave into iksuksodarasavat. We follow the emendation suggested by D. 7 Dkha. kryakranannprasarigo 8 Dkha. vibhg 9 Dkha. amsnm ntmtvayavatvaprasangas (not clear) D. corrects amsnm ntmtvayavatvaprasangas into amsnm tmvayavaprasatigas, and again corrects into amsann stmvayavatvaprasangas. 10 Dkha. kryakranam nntvaprasangah D. encircles the sign of anusvra. n Dkha. etam(d) (D. seems to suggest to read etad.) 12 Dkha. visesatvt D. corrects visesatvt into visesitatvt. We follow the emendation suggested by D. 13 Dkha. nirlitavisesam 14 Dkha. desmsavibhgayoh 15 Dkha. traigunydivisest D. corrects traigunydivisest into traigunydyavisest. We follow the emendation suggested by D. 16 Dkha. anekt D. corrects anekt into anekntt. We follow the emendation suggested by D. 17 Dkha. prvakesu arbhakdisu D. inserts after prvakesu the following passage: prvakesv parimndidarsand asiddhir iti cet syt matam anekakranaprvakesv avigarbha kdisu. We accept the inserted passage. 18 D. parimndidarsand (cf.p.l52,fn.l9.) 19 Dkha. anvayaparimnnupalabdhau D. corrects anvayaparimnnupalabdhau into parim nau upalabdhau. We follow the emendation suggested by D.

CATUSTAYAM HNIKAM SK15

153

tasmd anekntd asdhanam parimndaya iti / etac cyuktam / kasmt / hetvantaratas tatsiddheh / syd etat / yadi na tasyaikatvam ata eva sdhyate / kirn tarhi / abhinnabuddhinimittatvt / upetya v sarvesm taddhetutvd avigarbhakdmm anvayaparimnasambha<ve>1 parasparo pakro nsti sayandyangnm caikasminn avibhgah / sarvavitasambhave hi kranatvam / bhinnajtlyanivrttyartho 'py ayam ekasabdo drsyate <na>2 vastvantaranivrttyartho brhmana eko varnah slaya ekam sasyam iti / apaksadharmatvt pradhnsiddhir iti cet / syn matam / pari<mn>dayo3 vyakter drstatvt taddha<rmo> na cnyadharmo 4 'nyasiddhaye samarthah / kas<mt>5/ kkasya ksa<b>dd6 api pradhnstitvaprasarigt / tasmt parimndibhih pradhnasyeti / <tac ca> 7 naivam / kasmt / prthaktvnabhyupagamt / kryakranaprthaktvavdino hi kryadharmh kransambandhin<a>8 iti krtv yuktam abhidhtum syt / na tv et an matam asmkam / tasmt suvikalpa<h>9 pratisedho ' y a m / kirn ca svapaksa<tat>pratipaksasiddheh 1 0 / idam tvad ayam sarvasstraparikskrah <pra>stavyo 11 'tha bhava<to>12 'gnir atra dhmd usna<h>13 sarvo 'trgnir ity asmin prayoge katham dhmgnyor agnisparsayos ca lih<ga>lingibhvah14/ gamakatvd ity ha / na hi no gunaguni<tve>na15 dharmavyavasth / kirn tarhi / sdhyatvpeksay sdhyo lingi sdhanam Ungarn ity ucyate / lihgatvam gamakatve svapakse 'bhyupagacchatah 16 parapakse kay yukty na lingagama<ko>17 'nvayah / asdhranatvt pradhnasvarpasynumnd aprasiddhir iti cen na anabhyupagamt / yatra vipratipattis tatpratyaksatvvisayatve 'numnasya gocara ity ayam abhyupagamo nah / tasmd etad apy abdhakam /

10

15

20

a. sambhavo D. corrects sambhavo into sambhave. We follow the emendation suggested by D. 2 Dkha. tena D. corrects tena into na. We follow the emendation suggested by D. 3 Dkha. parinmdayo 4 Dkha. taddharmnanyadharmo D. corrects taddharmnanyadharmo into taddharma na cnyadharmo. 5 Dkha. kasmt ksrdt(?) D. corrects kasmt ksrdt into kasmt. We follow the emendation suggested by D. 6 Dkha. ksardd 7 Dkha. tatas ca D. corrects tatas ca into tac ca. We follow the emendation suggested by D. 8 Dkha. kransambandhinam D. corrects kransambandhinam into kransambandhinah. We follow the emendation suggested by D. 9 Dkha. suvikalpam D. encircles the sign of anusvra. 10 Dkha. svapaksapratipaksa0 D. corrects svapaksapratipaksa0 into svapaksatatpratipaksa0. We follow the emendation suggested by D. J1 Dkha. prstavyah 12 Dkha. bhavatu D. corrects bhavatu into bhavato. We follow the emendation suggested by D. 13 Dkha. usna 14 Dkha. Ungarn lingibhvo D. corrects Ungarn lingibhvo into lingalingibhvo. We follow the emendation suggested by D. 15 Dkha. gunaganitena D. corrects gunaganitena into gunagunitvena. We follow the emendation suggested by D. 16 Dkha. 'bhyu(pa)gacchatah 17 Dkha. lingagamake D. corrects gamake into gamako. We follow the emendation suggested by D.

154

YUKTIDIPIKA

kim canyat / a t y a n t a g i a h a n a p r a s a n g a t / atmdriyasya dharminah svarupam pratyaksasyvisayah / tatrnumnam api pratisedlKato) 1 'tyantgrahanam prptam pramntarbhvt / drstam ca loke ditthdlnm gatydibhir anumnam dittho ' y a m vyaktam gacchati 2 <iti> / ha ca 5 tad evaitac chirognvam tau bh parighopamau / tad eva csya vikrntam nyam anyo dhananjayt //(MBh.IV.36.31) tasmd asdharanavisayamnam nastiti lokatarkaviruddham etat / <...> ha: kim punas tad vaisvarpyam ko v visvarpa iti / ucyate: vaisvarpyam iti visistam avasthnam caksmahe 'stamitavisesatvam avibhga iti / visesasya smnyaprvakatvd iti yo 'rthas tad uktam bhavaty avibhgd vaisvarpyasyeti / evam etaih pancabhir vltair vyaktasya kranam asty avyaktam iti siddham / ha: vipratisedhaprasangah karanntarapratisedhvacant / yath bhavn ha pradhnam jagadutpattisamartham kranam asti, evam tantrntariyh paramnupurusesvarakarmadaivasvabhvaklayadrcchbhvn kranatvenbhidadhati / tesm ca pratisedho nocyata ity ato vipratisedhah prpnoti / kim pradhnam eva kranam hosvid etny eva <atha>vobhayam iti / anvayadarsanat tadanupapattir iti cet / syn matam / pradhnnvaya eva prthivydisu sukhdilaksana upalabhyate / yac ca yennvitam 3 tasysau vikra iti yuktam etat prg apadistam (144.20?) / tasmt pradhnavikra eva vyaktam iti / tac cnupapannam / kasmt / aneknvayasa<d>bhv t 4 / paramnvanvayo 'pi hi vyakta 5 upalabhyate rpdisattvt / purusnvayah karanasya samvedakatvt / Isvarnvayah saktivisesayuktnm upalabdheh / karmadaivnvayo jagadvaicitryopalambht(cf.AK.p. 192.5) / svabhvnvayo dravyntarasamsarge 'pi bhvnm tasmd apracyuteh / klnvayo yugdyanuvidhnt / yadrcchnvayo niyambhvt / abhvnvayo gavdlnm paraspartmasv adarsant 6 / itaretarni pratyuktni / kranntaraprvakatve 7 J pi khalu vyaktasya sakyh 8 parimndayah prvam eva kalpayitum / tasmd ayuktam 9 anvaydibhyah 10 kranam asty avyaktam iti / ucyate: yat tvad uktam(154.13) paramnnm apratisedhd vipratisedhaprasanga 11 ity atra brmah: tadanupapattir 1 2 astitvnabhyupagam a t 1 3 / astitve hi paramnnm abhyupagamyamne sati satyam evam syd
2 After gacchati Dkha. writes and deletes: tad evaitac chirogriva. 3 D. yac cethennvitam, s.m. yac ca yennvitam 4 All the Mss read: nvayasambhavt. 5 D. vyakta, s.m. vyakte 6 D. tmasv adarsand, s.m. tmasva 'darsand 7 0 0 D. krakntara , s.m. kranntara 8 P. saktyh 9 Dkha. pritam 10 D. ayuktam anvaydibhyh, s.m. ayuktam etat anvaydibhyah 11 D. apratisedh .... vipratisedhaprasariga, s.m. apratisedhd vipratisedhaprasanga 12 D. anupapattih, s.m. anupapatteh 13

10

15

20

25

30

pratisedho D. corrects pratisedho into pratisedhatah. We follow the emendation suggested by D.

D. astitvnabhyupagamt, s.m. astitvbhyupagamt

CATUSTAYAM AHNIKAM SK15

155

iyam sank kirn paramnuprvakam idam visvam1 at ha pradhnaprvakam iti / na tu tesm sadbhvo niscitah / tasmd ayuktam etat / yat tu khalv idam ucyate(154.18) prthivydisu rpdyupalambhd anvaya<da>rsand2 annm sadbhvah pradhnavad eva kalpayitavya iti / etad api cnupapannam / kasmt / anyathpi tadupapatteh / tanmtraprvakatve 'pi hi prthivydinm kalpyamne rpdisattvd ato na yuktam etat / sukhdlnm tmagunatvenbhyupagamt pradhne 'pi tatprasanga iti cet / athpi 3 syt / yath tanmtrnm rpdimattvam kalpyate tatprvakatvam ca prthivydinm drsyam api tesu rpdisattvalingena 4 paramnubhyo niskrsyate, evam asmbhih sukhdlnm tmagunatvbhyupagamt tadbuddhinimittatve prthivydinm pradhnaprvatvksepah karisyata iti / etac cnupapannam / kasmt / tmagunatvapratisedht / "tasmc ca viparyst"(SK19a) ity atra sukhdlnm tmagunatvapratisedham 5 karisymah / tasmd asamyag etat / ha: yadi punas tanmtrnm eva paramnutvam abhyupagamyate ka evam sati dosah syt / ucyate: na sakyam evam bhavitum / kirn kranam / vrddhimatyas tanmtralaksanh prakrtayo 'smbhir abhyupagamyante / kasmt / svakryd dhi prathiyasi prakrtir bhavatiti ca nah samayah / mahnti ca prthivydini mahbhtni / tasmt tesm tadatiriktay <prakrty>6 bhavitavyam / paricchinnadess ca paramnavah / tasmn na tanmtrbhyupagamt tesm abhyupagamah / upetya v tadasambhavah krtakatvt / astu v paramnnm sadbhvas tathpi tebhyo jagadutpatter asambhavam brmah / kirn kranam / krtakatvt / akrtakena hi jagatkranena yuktam bhavitum / krtaks ca paramnavah / tasmt saty api sadbhve na tesm jagatkranatvam upapadyate / hetvanupadesd ayuktam iti cet / athpi syt / kirn punar atra kranam yenkrtakam jagatkranam isyata iti / ucyate tasyaiva kranatvaprasangt / yad dhi tat paramnnm kranam tad eva jagatkranatvena yuktam kalpayitum syn na tannispdith paramnavah / krtakatvsiddher ayuktam iti cet / syn matam / yadi paramnnm krtakatvam prasiddham ata etad yujyate vaktum amusmd dhetor akranam paramnava iti / tat tv asiddham / tasmn na kimcid etat <iti> / ucyate paricchinnadesatvt / iha yt paricchinnadesam tat krtakam drstam tadyath ghatah / paricchinnades<>s7 ca <paramnavah> / tasmt [paramnavah] krtakh / kirn cnyat / rpdimattvt / iha yad rpdimat tat krtakam drstam tadyath ghatah / rpdimantas ca paramnavah / tasmt krtakh / kirn cnyat / ausnyayogt / iha yad ausnyayuktam 8 tat krtakam tadyath pradipah / tadvantas cgneyh paramnavah / tasmt krtakh / kirn ca vegavattvt / iha yad vegavat tat krtakam tadyath isur [vegavn] /
1 D. visvam, s.m. visvapadam 2 All the Mss read anvayasparsand. We follow Pandeya. 3 D. athpi, s.m. anyathpi 4 D. rpdimattvalirigena, s.m. rpdimattvalingatvena 5 D. pratisedhe(?), s.m. pratisedham 6 All the Mss read prthivy. 7 AU the Mss read paricchinnadesas. 8

10

15

20

25

30

35

K. and P.: ausnyam uktam D. ausnyam uktam, s.m. ausnyayuktam

156

YUKTIDIPIKA

10

15

20

25

30

35

tadvanto vayaviyah paramanavah / tasmat krtakah / kirn ca snehadravatvayogt / iha yat snehadvravatvayuktam tat krtakam yath kedrdisv pah / ittham cpyh paramnavah / tasmt krtakh / kirn ca dheyatvt / iha yad anyasminn dhlyate tat krtakam tadyath badaram 1 / dhiyante ca paramnavah prthivym / tasmt krtakh / kirn ca arthntardhratvt / iha yad arthntarasydhratvam pratipadyate tat krtakam tadyath ghatah / arthntarasya ca dvyanukder dhratvam anavah pratipadyante / tasmt krtakh / kirn ca prptivyavadhnt / iha yayor madhye 'ntar dravyam avasthitam prpter vyavadhyakam bhavati tau krtakau tadyath dvyariguli / tath cn dvv antarnvantaram 2 avasthitam yayoh3 prpter vyavadhyakam tau krtakau / tasmt tv api krtakau / kirn ca dravyntarrambhakatvt / iha yad dravyntarrambhakam tat krtakam vah(cf.VS.1.1.8) tadyath tantuh / dravyrambhaks ca paramdnavah / tasmt krtakh / kirn ca pratyaksatvt / iha yat pratyaksam tat krtakam drstam tadyath ghatah / pratyakss ca yoginm paramnavah / tasmt krtakh 4 / ata ev<>krtakatvam 5 iti cet / syn matam / yata eva yoginm pratyaksh paramnavas tata ev<>krtakh 6 / kirn kranam / asmaddipratyaksam ghatadi hi krtakam drstam iti krtv / etad apy anupapannam / kasmt / sarlrkrtakatvaprasangt 7 / sarlram api hi yoginm pratyaksam, kmam tad apy akrtakam astu 8 / atha naitad evam tarhi nkrtakh paramnavah / pradhndisu prasanga iti cen na anabhyupagamt / srlkapilabrhmanair api pradhnapurusv apratyaksv iti nah sstram / tasmd yat kimcid etat / sattdivad iti cet / syn matam / yath sattgunatvarpatvdlnm 9 sati pratyaksatve 'krtakatvam evam paramnnm bhavisyatiti / tad apy ayuktam / kasmt / sdhyatvt / paramnvakrtakatvavat sattdmm sadbhvo siddhah / tasmc chasavisnt 10 purusavisnasiddhivad agrhyam etat / sauksmyd annm krtakatvprasanga iti cet / syn matam / na hi paramnubhyah sksmataram anyad bhvntaram asti yad esm rambhakam syt / par khalv es ksth sauksmyasya ^atj)aramnavah / tasmd esm krtakatvam anupapannam iti / etac cyuktam / kasmt / pkajesv atiprasangt 1 1 / sauksmyd akrtakatvam icchatah prthivesu tu paramnusv agnisamyogc chymatm apamrdya ye pkaj dhiyante tesm akrtakatvaprasangah / te 'pi paramnavah sksmh / yat tu khalv atisauksmyt pradhnapurusayor akrtakatvam drstam tat sati vibhutve / na ca yath pradhnapurusv evam anavo 'pi visvam badharam P. vadharam D. vadaram, s.m. badaram antarvntaramC?), s.m. antarnvantaram yo yah D. yayoh, s.m. tayoh and P.: tat krtakh D. tat krtakh, s.m. tasmt krtakh All the Mss read eva krtakatvam. We follow Raghavan. 6 All the Mss read eva krtakh. 7 K. and P.: sanrakrtakatva0 D. sartrakrtakatva0, s.m. sarirkrtakatva0 8 P. akrtakas tu 9 D. satt gunatva0 10 D. chasavisnt, s.m. chasavisnavat n D . atiprasangt, s.m. aprasarigt
1 K. 2 D. 3 P. 4 K. 5

CATUSTAYAM AHNIKAM SK15

157

vyasnuvate / tasmt sati sauksmye pkajavad esm krtakatvam 1 anivryam / yesm tu kryadravyarn pacyata 2 iti paksas tesm ayam anuplambha ity atah paramnusamavetam karmodhryam / tad dhi 3 sksmam atindriyam krtakam ceti siddham krtakh paramnavah / krtakatvc caism anityatpy 4 anuptiniti 5 krtvntarlapralayamahpralayesu pradhvamst paramnnm "kranbhvt krybhvah" (VS. 1.2.1) iti svasstrasiddhd anumnj jagaducchittidosaprasangah / tath bhoginm upacitasya svakarmano ? nupabhogt krtasya vipransah / anistam caitat / tasmn na jagatkranam paramnavah / ypi khalv iyam sank purusj jagadutpattir bhavisyatiti spy ayukt / kasmt / pratisedht / "tasmc ca viparyst"(SK19a) ity atra purusasykartrtvam upapdayisymah / caitanyvisesd Isvarasypi sa eva vidhih kranatvapratisedhe boddhavyah / ha: asty evam Isvara iti psupatavaisesikh / kasmt / kryavisesasytisayabuddhiprvakatvt / iha kryavisesah prsdavimndir atisayabuddhiprvako drstah / asti cyam mahbhtendriyabhuvanavinysdilaksanah kryavisesah / tasmd anenpy atisayabuddhiprvakena bhavitavyam / yatprvako ' y a m sa Isvarah / tasmd astisvara iti / kirn cnyat / cetancetanayor abhisambandhasya cetanakrtatvt / iha cetancetanayor abhisambandhas cetanakrto drstas tadyath gosakatayoh / asti cyam cetancetanayoh sarirasaririnor abhisambandhah / tasmd anenpi cetanakrtena bhavitavyam / yatkrto V a m s a isvarah / tasmd astlsvarah kranam / ucyate: yat tvad uktam(157.13) kryavisesasytisayabuddhiprvakatvd Isvarasadbhvasiddhir ity atra brmah: na sdhyatvt / asmaddibuddhiprvakh prsddayo 'tisayabuddhiprvak veti sdhyam etat / tasmd anuttaram / kirn ca prk pradhnapravrtter buddhyasambhavt kranntarapratisedht / pradhnd ayam buddhiprvakam kryavisesam kurvita / prk ca pradhnaviparinmd buddhir eva nstlty anupapannam 6 etat / saktimattvt svata iti cet / syt punar etat / sarvasaktipracita Isvarah / tasya prg api pradhnaviparinmt svata evecchyogd buddhimadbhvo na 7 pratisidhyata iti / etad apy a n u p a p a n n a m / kasmt / drstntbhvt / buddhih svata evety atra paryanuyuktasya kas 8 te drstntah / tasmd asad etat / saktivisesd adosa iti cet / athpi syt / nnyesm buddhimatm Isvaratuly saktih / ata esm pradhnc chariravyhasamaklam tmdisannikarsd v buddhaya utpadyanta [iti] Isvarasya tu svata iti / etad apy a n u papannam / kasmt / sarvavdasiddhiprasangt / drstntaviruddham artham dya 9 pratibadhyamnena saktivisesah smartavya ity etasym kalpanym sarvavdasiddhiprasangah syt / tasmd grahamtram etat / evam svata
J D, krtakatvam, s.m. akrtakatvam 2 P. pasyata 3 D. tad dhi, s.m. buddhi 4 D. anyatpy, s.m. anityatpy 5 P. anaptiniti 6 K., P. and D.: upapannam Dkha. anupapannam 7 D. buddhisadbhvo na, s.m. buddhisadbhvena 8 P. paryanuyuktakas 9

10

15

20

25

30

35

D. artham dya, s.m. artham pratijnya

158

YUKTIDIPIKA

10

15

20

25

30

35

lsvarasya buddhisambhavo na ced bhaved yuktam ucyate prak pradhanapravrtter buddhyasambhavn na buddhimatprvako ' y a m kryavisesah <iti>/ kirn ca phalnupapatteh / drstam adrstam v phalam uddisya buddhimantah kryavisesn prsdavimndln rabhamn drsyante / anupahatas cyam aisvaryt / kirn ca prayojaknupapatteh / anyena khalu prayukt buddhimantah kryavisesam rabhamn drsyante / tac cnupapannam / Isvarasya tadvisistnupapatteh / kirn ca anekntt / na ca sarvah kryaviseso buddhiprvako vrksdlnm tadvyatirekenotpatteh / sarvasyesvarabuddhiprvakatvbhyupagame drstntbhvah / na csty anudhrto vdah / tasmd anekntn na buddhimatprvakam vyaktam / kirn ca duhkhottaratvt / buddhiprvakas 1 ced <ayam>2 kryavisesah syt kartur duhkhottaravidhne prayojanam nsti saktimms cyam iti sukhottaram eva vidadhyt / duhkhottaras cyam / tasmn na buddhiprvakah kryavisesah / kirn ca duhkhopyatvt / buddhiprvakas ced ayam kryavisesah syd dharmrthakmamoksaprptayah sukhopyh syuh / duhkhopys ca <...> / tasmd abuddhiprvakah / dharmdharmanimittatvd adosa iti cet / syn matam / yady aplsvaraprvako ' y a m kryavisesas tathpy disarge sukhottarnm <asmd> utpannnm 3 prninm dharmdharmaparigrahd dhlnamadhyamotkrstavayojtisvabhvdiyogo bhavati / tat as ca npardho 'yarn 4 Tsvarasyeti / etad apy ayuktam / kasmt / adharmotpattihetvabhvt 5 / Isvaras ced dharmdharmayor utpattv Tste dharmam eva prninm sukhahetutvd utpdayet / ndharmam prayojanbhvt / atha matam svbhviki dharmdharmayoh svakrand utpattih / yad uktam(157.16) sarvam Tsvarabuddhiprvakam vyaktam iti [tu] tasya vyghtah / tasmd Isvaro na kranam / yat punar etad uktam(157.17) cetancetanayor abhisambandhasya cetanakrtatvd lsvarasya sadbhva ity atra brmah: ayuktam etat / kasmt / sdhyatvt / yo ' y a m cetancetanayor gosakatayor abhisambandhah sa kena cetanena krtah / yadi caitrena tasya kryakranasanghtatvd <acai>tanyam6/ atha caitrasabdavcyasya pindasyopadrast ksetrajnas tatkrta isyate / tad ayuktam / sdhyatvt / na hi purusakartrtvam asmatpakse prasiddham / ubhayapaksaprasiddhena vyavahrah / kirn cnyat / anavasthaprasangt / cetancetanayor abhisambandhasya cetanakrtatvam bruvatah prptamlsvarakryak<a>ranayor 7 abhisambandhasya cetanakrtatvam / tath cnavasthprasahgah / atha m bhd ayam dosa iti svbhvika lsvarasya kryakaranayor abhisambandha isyate / na tarhy aiknti1 D. buddhiprvakas, s.m. buddhimatprvakas 2 All the Mss read asya. 3 All the Mss read asmadutpannnm. 4 Dkha. apardho 'yam 5 Dkha. hetubhvd 6 All the Mss read cetanyam. 7

Dkha.: buddhimatprvakas

All the Mss read kryakaranayor. We follow the emendation suggested by G.Chemparathy, in "The Testimony of the YuktidTpik concerning the Isvara Doctrine of the P s u pat as and Vaisesikas", WZKSO.vol.9 (1965) p.l40,fn.74.

CATUSTAYAM AHNIKAM SK15

159

ko hetuh / tayor <api caitanycb 1 adosa iti cet / syt punar etat / Isvarasya yat kryakaranam tad api cetanam Isvaro 'pi / tasmt sambandhe na 2 pratyudharanam upapadyata iti / etad ayuktam / kasmt / asambandhaprasangt / caitanyvisesd tmana 3 tmntarenbhisambandho nsti / evam Isvarakrya<ka>ranayor4 api na syt / anistam caitat / kirn ca <v>iparyayaprasangt 5 / ubhayacaitanyapratijnasya 6 yathesvarasya karanam buddhydaya evam Isvaro 'pi buddhydlnm karanam syt / kasmt / avisest / athaitad anistam / na tarhy ubhayos caitanyam / krya<ka>ranavattnabhyupagamd 7 adosa iti cet / <syd etat> / vypi (cf.Svet.U.3.11 et passim) niravayavo 'nantasaktih (cf.Mait.U.7.2) sksmebhyah sksmatamo mahadbhyo mahattamo (cf.Kath.U.2.20) Nihjka^in^^ (cf.Mait.U.7.2) ity evam anantalaksanam Isvarapadrtham tadvido vycaksate / tasya kutah kryakaranam avalambyedam adhyropitam iti / etad apy a n u p a p a n n a m / kasmt / a n u mnavirodht / ittham ced Isvaro yad idam anumnam kryavisesasytisayabuddhiprvakatvc [ca] cetancetanayor abhisambandhasya cetanakrtatvd iti tad vyhanyate / kasmt / na hy 8 etvad Idrsrthena sahaitad drstam iti / upetya v mrtiparigrahavyghtt / yady ekntenaivam rpa Isvarah ksitydimrtiparigraho vyhanyate 9 / kirn cnyat / sruteh / srutir api csya mrtim caste "krttivsh pinkahasto vitatadhanv nHasikhandi"(cf.Tai.S.1.8.6.2) itydi / tadabhyupagamt svapaksahanir iti cet / syn matam / yadi tarhi srutivacann mrtimn Isvarah parigrhyate tena siddham asystitvam / kasmt / na hy asato mrtimattvam upapadyata iti krtv / etad apy ayuktam / <kasmt /> abhiprynavabodht / na hy ekntena vayam bhagavatah 10 saktivisesam pratycaksmahe mhtmyasarlrdiparigraht / yath [tu] bhavatocyate / pradhnapurusavyatiriktas tayoh prayokt nstlty ayam asmadabhipryah / tasmd etasya bdhakam / ato na pradhnapurusayor abhisambandho 'nyakrtah / kirn cnyat / asakyatvt / kurvnah khalv apy ayam abhisambandham sariramtrena v 11 sarlrinah kuryt sarlrakranena v / kirn ctah / tan na tvac charlramtrena karoti / kasmt 12 / anapeksasya sarirotpattau nimittbhvt / na sarlrakranena vibhutvt / paricchinnayor gosakatayor abhisambandho 'nyakrtah / vibh ca pradhnapurusau / kirn ca prrthyt / gosakatayor abhisambandhah parrtho drstah / na tu pradhnapurusayor abhisambandhah parrtha iti / Isvarrtha iti cen na
X A11 the Mss read acetanyad. 2 D. sambandhe na, s.m. sambandho na 3 D. tmana, s.m. cait any avisest tmana 4 All the Mss read kryakranayor. 5 A11 the Mss read aviparyayaprasarigt. 6 D. caitanyapratijnasya, s.m. caitanypratijnasya 7 0 All the Mss read kryakrana . 8 D. na hy, s.m. tarhi 9 K. and P.: vyhanyeta D. vyhanyeta, s.m. vyhanyate 10 Dkha. vayam saktivisesavantah 11 D. encircles v. 12

10

15

20

25

30

35

Dkha. vyhanyate

Dkha. tasmd

160

YUKTIDIPIKA

10

15

20

25

30

35

uktatvat / drstadrstartha lsvarasyanupapanna ity adav evoktam (158.3) etat 1 / [evam tvat psupatnm Isvaraparigrahe dosah / vaisesiknm cyam dosah /] kirn ca dravydipadrthntarabhvbhvaparikalpannupapatt < es >2 ca / [tair] Isvaro dravyagunakarmasmnyavisesasamavyabhto v parikalpyamnah parikalpyeta padrthntarabhto v / kirn ctah / tan na tvad dravydibhtah / kasmt / dvividham hi dravyam anekadravyam adravyam ca(cf.VSC.onVS.2.1.11) / tatra nnekadravyam Tsvarah krtakatvdidosaprasangt / ndravyam parisamkhynt / prthivydlni manahparyantni navaiva dravyni(cf.VS.1.1.4) iti vah siddhntah / itikaranasya parisamptyarthatvt / kirn ca gunakarm<>nirdest 3 / sati csya dravyatve vaisesikagunanirdesa cryena krtah syt / kranntaraprayogasamarthasya ca karma nirdistam syt / na tu tath / tasmn na dravyagundayah / srayaparatantr hi gundayah pa<d>rthh4 / evam na dravydibhto npi padrthntarabhtah / padrthatve hi sati dravydival laksanam uktam abhavisyad cryena / na tktam 5 / tasmt strakramate nstisvarah / lingd iti cet / syn matam / "samjiikarma <tv>6 asmadvisistnm lingam"(VS.2.1.18) / "pratyaksaprvakatvd v samjfikarmanah"(VS.2.1.19) ity etasml lingd Tsvaraparigraha cryasya siddha iti / tad apy ayuktam / kasmt / abhipretsiddheh / satyam anena lingensmaddibhyo visistasakteh kasyacid eva mhtmyasarirasynyasya v pratipattih syt / samjnmtram tu / yath bhavadbhih sarvakrannm srstyupasamhrapravrttihetur ekah svatantra isyate tath <n>sml7 lingt pratipattih / kirn cnyat / prganupadese 'kausalaprasangt 8 / Isvaraparatantre ced annm pravrttinivrtti sytm tarn eva prg upadised dharmavat (cf.VS. 1.1.1) / pradhnapadrthasya v prg anupadesd akusalah strakra ity etad padyate 9 / na caitad <i>stam10 ubhayam / kirn cnyat / asamklrtant / sstrapradese cyam Isvaro na kasmimscid apy cryena samkirtitah / na csya vadhv iva svasuranmasamkirtane dosopapattih syt / dosasamvibhgrtham idam cryasynistam adhyropyat e 1 1 / na tu matam asyaitat / fevam kndnm Isvaro 'stiti psupatopajnam etat / 1 tasmd Isvaro Jpy akranam / karmnubhir vykhytam / katham / yath krtakatvn na jagatkranam anava evam karmpi na sarlranimittam / tasmt tad apy akranam / itaretaranimittatvd adosa iti cet / syn matam / yathntarena sarlram karma notpadyamnam drstam evam antarena karma sarlrasypi kranntaram asakyam kalpayitum iti parasparanimittatvn nsya parivartanasya prvakotih praMss read nupapattis. Mss read gunakarmanirdest. All the Mss read parrthh. We follow the emendation suggested by G.Chemparathy, op.cit., p.l45,fn.l01. (cf.p.l58,fn.V.) 5 K. and P.: tu noktam D. tu noktam, s.m. nau tktam 6 All the Mss read samjnkarmatvam. 7 All the Mss read csmL We follow the emendation suggested by G.Chemparathy, op.cit., p.l45,fn.lO3a. (cf.p.l58,fn.7.) 8 P. kausala0 9 D. padyate, s.m. padyeta 10 All the Mss read anistam. We follow Chakravarti. 11 D. adhyaropyate, s.m. adhyropyate
1 D. et 2 All the 3 All the 4

CATUSTAYAM AHNIKAM SK15

161

jnyate 1 / tasmn nsty anayoh kranntaram iti / etac cyuktam / kasmt / anavasthnnm avasthnaprvakatvadarsant / tadyath sukrasonitc chariram sarirc chukrasonitam ity asya parivartasya prvakotir adrst, pratijfiyate cyonijatvam Isvarasarirnm disarge [ca] / tath ca bijd ankurdayo 'nkurdibhyo bijam ity anavasth, bhavati ctrdisarge paramnumtrd api bijaprdurbhvah / tath sarirakarmanor 2 anavasthednim api cdisarge cdhikramtravasc charirotpattih syt / sdhranavigrahatvaprasanga iti cet / syd etat / yady adhikranimitt sarirotpattir disarge 'bhyupagamyate prptam ekena sarlrena sarvapurusnm abhisambandho niyamahetvabhvt / tat as ca sarirntarnarthakyam / tenaiva sarvesm upabhogasmarthyd 3 iti / etad a n u p a p a n n a m / kasmt / pratyaksavirodht / satyam etad anumnatah / pratyaksatas tu sarirni pratipurusam / tasmn nyam prasangah / apavarganiyamaprasaiiga iti cet / syn matam / yady adhikramtravasc charirotpattih paramarser evpavargasdhanam sarlrd utpadyeteti / ucyate na tasyaiva kirn tarhi sarvesm / gunnm prdhnyt tannimittni sarirny disarge smsiddhikny utpadyante / tatra yasya sattvapradhnam kryakaranam sa paramarsih / yasya sattvarajobahulam 4 sa mhtmyasarirah / evam gunasamparkd gunapradhnpradhnabhvena yvat sthvarasariraprdurbhva ity ato nsti gunnm sariraviniyogapaksaptah / tasmd yuktam etat krtakatvn na karma jagatkranam iti / etena <d>aivam5 vykhytam / tad api hi karmanm eva prptaparipknm abhidhnam / arthntaram eveti cet sdhyam / tasmd 6 apy akalpaniyam iti / <... /> yad apy uktam klj jagadutpattir bhavisyatiti tad anupapannam / kasmt / k<a>ranaparispandasyaiva 7 tadabhidhnasannivest / na hi nah klo nma kascid asti / kirn tarhi / kriyamnakriynm evdityagatigodohaghantstanitdinm 8 visistvadhisarpapratyayanimittatvam / parpardilingasadbhvt (cf.VS.2.2.6) pratipattir iti cen na akrtakesu tadanupapatteh / yad eva krtakam tatraiva param aparam itydih pratyayo drstah / sa yadi kriyvyatiriktanimittah syd avisesn nitynityesu syt / kvacit smarthyd <p>kajavad9 adosa iti cet / syn matam / yathgnisamyogah pkajahetus tath cvisese 'pi prthivym eva pkajotpattinimittam bhavati nksdisu, evam klo 'pi parpardihetur atha cnityesv10 eva syn na nityesv iti / tac cyuktam / kasmt / visesopapatteh / rpdivikriyhetur agnis tadyuktam yad asau tadvati dravye pkajn dadyt <n>tadvaty n ksdau /
X D. prajnayate, s.m. pratijnayate 2 D. sarirakarmanor, s.m. sartrasarirakarm an or 3 D. upacbhoga0 (?), s.m. upabhoga0 4 K. and P.: sattvam rajobahulam D. sattvam rajobahulam, 5 All the Mss read caivam. We follow Raghavan. 6 D. tasmd, s.m. tasmt0 tad 7 All the Mss read krana . 8 P. godohaghatstanitdinm 9

10

15

20

25

30

35

s.m. sattvarajobahulam

All the Mss read apkajavad, D. atha ca atha cnityesv, s.m. atha cnityesv *K. and P.: tadvaty D. tadvaty, s.m. na tadvaty We follow the emendation suggested by Pandeya.

162

YUKTIDIPIKA

10

kalas tu sambandhamatropakan, na vikriyahetuh / tasmad asad etat 1 / evam yadi kriybhyo 'nyah kla isyate kranaparispandasya jagatkranatvam athnyat sdhyam / yadrcchpi na kranam karmavat / kryakranabhvt / kryakranabhtam hidam vyaktam iti prg (147.28) vykhytam / sa ca kryakranabhvah preksprvakrtnm sayandinm upalabdhau ydrcchikesu cnupalabdhau na tasy lihgam iti sakyam vaktum / abhvo 'py akranam / parimnadidarsant / na hi tata utpannnm parimnam upapadyata ity ato npy anvayah stmakanirtmakayor atyantajtibhedt / npi saktis tadabhvt / nopakro 2 'navasthnt / na vibhgo nirtmakatvt / tasmn na paramnupurusesvarakarmadaivaklasvabhvayadrcchbhvebhyo vyaktam utpadyate 3 / na ced ebhyah parisesatah pradhnasyaivastitvalingam idam / tasmd yuktam etat bhednm parimndibhyah KRANAM ASTY AVYAKTAM / (SK16a)

15

iti / / 1 5 / / ha: evam apy asya vyaktahetutvam anupapannam ekatvt / bahnm kryrambho drstas tantvdinm / ekam pradhnam / tasmn na tad rambhasaktiyuktam iti / ucyate: yady api gunnm pradhnalaksanam avasthntaram abhinnabuddhinimittatvd ekam <evam> api kryakle kimcid vaisamyopajanitavyapadesyarpbhir itaretaropakrinibhih saktibhih samudyatvam padyate / tasmd idnlm PRAVARTATE TRIGUNATAH SAMUDAYC CA / (SK16b)

20

25

30

pravartata ity anenotpattim caste / trigunata* ity avyapadesyarpnm pradhnpradhnabhvena gunasaktinm vaisamyd vyapadesyarpntaram ha / yatraitac chakyate vaktum trayah sattvdaya iti tad avasth<ntaram>5 kryrambhakam iti / samudayd6 ity anena parasparpeksnm rambhasaktim avadyotayati / etad uktam bhavati: kryakle gunh parityaktaprvvasth bhedam pratilabhya parasparopakrena samhanyante samhats ca vyaktam 7 utpdayanti / tasmn nvasthntarasybhinnabuddhinimittatvt 8 pradhnaikatvadosah / gunabhedn naikasya kryrambha iti / ha: niskriyatvt tarhi prakrteh kryrambho 'nupapannah / <nis>kriyatvnabhyupagame 9 v vyaktavaidharmyavirodha iti /
1 Dkha. asatyam 2 D. no upakro, 3 D. upapadyate 4

etat s.m. nopakro

D. trigunasaktinm, s.m. trigunata ity avyapadesyarpnm pradhnpradhnabhvena gu saktinm 5 All the Mss read avasthnam. 6 D. samudayd 7 D. vyaktim Dkha. vyaktam 8 D. nimittatvtvt, s.m. nimittatvt 9 All the Mss read kriytvnabhyupagame.

CATURTHAM AHNIKAM SK15,16

163

ucyate: na kriyvaidharmyabhedt / dvividh hi kriy praspandalaksan parinmalaksan ca / tatra praspandah pradhnasya sauksmyt pratisidhyate / PARINMA<TA>S1 (SK16c') tu tatkryam rabhata iti / ha: nanu ca parinmo 'pi sauksmyt pradhnasya nopapadyate / kasmt / na hi sauksmyt sksmasyksder viparinmo drsta iti / ucyate: samskrasya sauksmye 'pi parinmo 'bhyupagantavyah 2 / tasmd <yu>ktah3 sksma<h> parinmiti 4 / ha: kah punar ayam parinmo nma / ucyate: jahad dharmntaram 5 prvam updatte yad param / tattvd apracyuto dharmi parinmah sa ucyate / / iti / yad saktyantarnugraht prvadharma<m>6 tirobhvya svarpd apracyuto dharmi dharmntarenvirbhavati tad avasthnam asmkam parinma ity ucyate / ha: naitad abhidhnamtram drstntam antarena pratipadymahe / tasmd yath kim iti vaktavyam / ucyate: yath p<a>lsam7 palsd apracyuta<m> nimittntarasytap8 der anugrahc chymatm tirobhvya pit at am vrajati tathedam drastavyam / ha: na anyathotpatter apratisedht / katham punar etad avagamyate p<a>lsam9 svarpd apracyutam dharmntarasya paritygam updnam ca karoti / na punar anyath cnyath cotpadyata iti / ucyate: ksanabhangapratisedht / prg eva ksanabhang<e> nirdistam lo (133.8) vinastnm 11 bhvnm punarutpattau nsti kranam / tadabhve cotpattir ayukteti / ha: dharmadharminor ananyatvbhyupagamd 1 2 dharmotpattivinse dharmyutpattivinsaprasarigah (cf.AKBh.p. 159.24) / na hi vo dharmebhyo 'nyo dharmi / tatra yadi dharmasya nivrttir abhyupagamyate dharmino ? pi nivrttir ananyatvt prpt dharmotpattau tadutpatt<eh> 13 / tatra yad uktam (163.14) dharmotpattivi<nse> 14 dharmisvarpvasthnam ity etad ayuktam /
X A11 the 2

10

15

20

25

30

Mss read parinmas. We follow Pandeya. D. viparinmo 'bhyupagantavyah, s.m. viparinmo drsta ity ucyate, samskrasya sauksmye 'pi parinmo 'bhyupagantavyah 3 A11 the Mss read ayuktah. We follow Chakravarti. 4 All the Mss read sksmaparinmtti. We follow Chakravarti. 5 Dkha. jagaddharm0 6 All the Mss read prvadharmi. We follow Raghavan. 7 All the Mss read plsam. 8 All the Mss read apracyutanimitt0. We follow Raghavan. 9 All the Mss read plsam. 10 All the Mss read ksanabhanganirdistam. 11 D. vina$th(J!)nm, s.m. vinastnm 12 D. ananyatv0, s.m. anyatv0 13 AH the Mss read tadutpattih. 14 All the Mss read dharmotpattivirodhe.

164

YUKTIDIPIKA

10

15

20

25

30

35

ucyate: na senadivad vyavasthanopapatteh / tadyatha senangebhyo 'nanyatvam senyh / na ca senng<a>vinse1 senvinsah / tath tantubhyo nnyah patah bauddhnm samyogvayavipratisedht / na ca patavinse tantuvinsah / tatra yad uktam(163.29) dharmavinse dharmivinsa ity etad ayuktarn / ha: evam apy ayuktam <e>tat 2 / kasmt / smnyavisesayor dharmisvarpaparikalpannupapatteh / iha rpdismnyam v dharmirpatvena parikalpyamnam parikalpyeta rpdiviseso v / kirn ctah / tan na tvad rpdismnyam dharmisvarpam iti sakyam kalpayitum / kasmt / asambhavt / yadi tvat prthivTsmnyam ghatdir visesas3 tena prthivy api tanmtrpeksay visesah / yvat pradhnam iti nsti smnyam / tadabhvd 4 dharmisvarpbhvah / atha vises ghatdayas tesm visesntarena sahvasthnd dharmisvarpnavasth<nam> 5 / tatas ca yad uktam(163.15) svarpd apracyuto dharmi dharmntaram vijahti dharmntaram updatta iti tad vyhanyata iti / ucyate: yad uktam(164.8) rpdismnyavisesayor dharmisvarpaparikalpannupapattir iti / astu smnyam / yat 6 tktam(164.12) smnyam smnyntarpeksam visesatvm iti <atra brmah:> na pratyay<>nivrttau 7 smny<a>bhvvasthites 8 tatas ca dharmisvarpasiddheh / yvat prthivlty ayam pratyayo na nivartate tvat prthivi smnyam ghatdir visesah <dravyatvam>9 csau dharmntaraparivartesu tadkrapratyayotpattitah svarpvasthnasiddher dharm ghatdayah / yad tu prthivipratyayanivrttis tad tanmtrnm smnyabhvo dravyatvam ca viseso dharma iti yvat pradhnam / tasya tu smnyntarnupapatteh kautasthyam eva / yatra sarvavisesbhvas tat pradhnam / yadi tu prthivydinm nityam avyvrttam syt smnyarpam evam sati kautasthyam esm prptam / tasmn na dharmisvarpbhvah / sakter v smnyabhvbhyupagamt / athav sukhaduhkhamohasaktaya eveha mahadadin visesntena lingena parinmam pratipadyante / tsm ca satatam smnyapratyayanimittatvt svarpd apracyuter dravyatvam 10 lingasya <ca> dharmatvam / aprasiddher ayuktam iti cen na uktatvt / prg uktam (144.3?) etat 11 sukhdiprvakam idam visvam iti / ha: evam api vaisvarpynupapattih kranvisest / yadi sukhdisaktaya eva parinminyo yad idam brahmdisthvarntam vaisvarpyam tan nopapadyate / kasmt / na hy abhinnam kryam utpadyata iti / ucyate: saktitas ca parinmim bhavati tena vaisvarpyam / katham /
1 AU the Mss read senangebhyo vinse. 2 All the Mss read tat. 3 P. ghatdivisesas 4 D. tadabhd, s.m. tadabhvd 5 All the Mss read dharmisvarpnavasthnt. 6 D. smnyam, smnyam yat, s.m. smnyam, yat 7 All the Mss read pratyayanivrttau. 8 A11 the Mss read smnybhvvastites. We follow Raghavan. 9 All the Mss read drastavyam. We follow Pandeya. 10 P. apracyute tad dravyatam n

K . et

CATURTHAM AHNIKAM SK16 SALILAVAT PRATIPRATIGUNASRAYAVISESAT1// (SK16c'd)

165

yathntariksd avisistasymbhasah pracyutir sray<n>m2 gobhujangamostrdinm visest kslramtravisdivaisvarpyam <prati>padyate3, tath gunasaktayo 'visisth parasparsrayavisesd brahmdistambntamjtykrtivgbuddhisvabhvhravihrarpam vaisvarpyam pratipadyante / tasmt siddham etat prakrtir eva sarvabhvnm prasavitri na ca kascid dosa iti / / 1 6 / / yuktidlpikym smkhyasaptatipaddhatau caturtham hnikam /

2 All 3

salilavat pratigun0 the Mss read srayanam. All the Mss read copapadyate. We follow Chakravarti.

P a n c a m a m

A h n i k a m

aha: samadhigatam pradhanam / purusa idanim karyakaranavyatirikto 'stity etat pratipdyam / kutah samsaya iti ced anupalabhyamnasyobhayath drstatvd ity uktam (89.21) / kirn cnyat / c r y a v i p r a t i p a t t e h / vijnnaskandhavyatirikto nsti kascid artha iti skyaputnyh pratipannh / kasmt / sarvapramnnupalabdheh / iha yad asti tat pratyaksdin pramnenopalabhyate tadyath rpdi / tatas ca tvad 1 ayam tm na pratyaksata upalabhyate / kasmt / asat>ddilaksanatvt / nntahpratyaksatah / kasmt / trigundiviparitasya tadavisayatvt / na prvavacchesavadbhym kryakrannupapatteh / na ca smnyatodrstd 2 dharmasmnybhvt 3 / nptavacand 4 anabhyupagamt / na hi bauddhnm srutismrtipurnetihsh 5 pramnam / yas caism gamah sa evam ha tmaiva hy tmano nsti viparitena kalpyate / naiveha sattvam tmsti dharms tv ete sahetukh / / dvdasaiva <bh>avngni6 skandhyatanadhtavah / vicintya sarvny etni pudgalo nopalabhyate 7 / / (cf.AKBh.p.466.8-11) snyam dhytmikam pasya 8 snyam pasya bahirgatam / na drsyate so ?pi kascid yo bhvayati snyatm / / (cf.AKBh.p.466.12-13, MV.18.3(p.348.12-13)) punar apy ha "asti 9 karmsti vipkah krakas tu nopalabhyate ya <imms ca skandhn niksipaty>10 anyms ca pratisandadhty anyatra dharmasamkett"(cf.AKBh.p.468.20-22, TSP.p.173.6-7) / tasmt sarvapramnnupalabdher nsty tmeti /
1 D. tatas ca tavad, s.m. tac ca tvat 2 D. smnyato drstd 3 D. dharmasmnybhvt^ s.m. dharmasmnybhvt 4 Dkha. npyavacand 5 D. purranetihsh, s.m. pramnetihsh (?) 6 All the Mss read tavtigni 7 D. pudgalenopalabhyate, s.m. pudgalo nopalabhyate 8 K. and P.: viddhi Dkha. pasya D. viddhi, s.m. pasya 9 Dkha. nsti D. ash, s.m. nsti 10

10

15

20

All the Mss read imn svn dharmn ksipati.

168

YUKTIDIPIKA

ucyate: yat tavad uktam (167.7) pratyaksatah purvavacchesavadbhyam ctmano 'nupalabdhir 1 iti satyam etat / yat tktam(167.10) smnyatodrstd 2 anupalabdhir tmasmnynupapatter iti tad ayuktam / kasmt / SANGHTAPARRTHATVT / (SK17a) 5 iha sanghth parrth drsts 3 tadyath sayansanarathasarandayah 4 / asti cyam sariralaksanah sanghth / tasmd anenpi parrthena bhavitavyam / yo 'sau parah sa purusah 5 / tasmd asti purusah / ha: <na> sahghtrthatvopalabdheh / sayandayo hi saty api parrthatve sanghtrthh / yadi ca tair atidesah kryak<a>ranasanghtasya 6 kriyate prptam asya tadvat sahghtrthatvam / evam purusaviparit<>rthasiddhiprasangah 7 / athaitad anist am na tarhi caksurdayah parrthh / ucyate: na sakyam etad pdayitum / kasmt / asamhatatvasiddhau vdapravrtteh / siddhe saty asamhatatve purusasyyam vdah pravrttah / tasmn na prrthyam 8 anena bdhyate / katham avagamyata iti cet pratyaksato 'nupalabdheh / sati hi sanghtatve devadattdivad ayam purusah pratyaksata evopalabhyeta 9 / tath ca sati samsaybhvt pravrttir evsya vdasya na syt / tasmd ayuktam samhatrthh sayandivac caksurdayah / ha: <na> parasparopakritvt <pratantrysiddhih> 10 / iha ksetrodakasrydayah sasydlnm upakrakh / tath kryak<a>ranasanghtas 11 ca yathoktam / tasmd ayuktam etesm pratantryam iti / ucyate: na sayandivat tato 'nyenrthavattvt / tadyath sayandyangnm sati parasparopakritve tato 'nyenrthavattvt 12 tadabhve crthnarthakyam 1 3 / evam 14 caksurdinm sati parasparopakritve tato 'nyenrthavattvam bhavitum arhati tadabhve^1^ crthnarthakyam [iti] / ha: sayandlnm devadattrthatvt tasya ca bhedbahirbhvt parasparrthatvaprasangah / evam 15 sayandayo devadattrthh kryaP. catmanopalabdhir(7) D. catmananopalabdhir, s.m. catmanonupalabdhir D. smanyato drstd 3 D. parrthdrsth 4 D. rathacarandayah, s.m. rathasarandayah 5 D. parah purusah, s.m. parah sa purusah 6 All the Mss read kryakrana0. We follow Chakravarti. 7 f A11 the Mss read purusaviparito rthasiddhiprasangah. We follow Pandeya. 8 D. paramrtham, s.m. prrthyam 9 D. labhyeta, s.m. labhyate 10 All the Mss read prrthyasiddhih J1 K. and P. read kryakranatvt sarightas. D. sanghts, s.m. sanghtc 12 D. rthavattvt, s.m.0arthavattvt (bha)vittum arhati(l) D. seems again to correct (bha)vittum into (bha)vittam. 13 D. narthakyam iti 14 D. writes evam ... tadabhve crthnarthakyam iti in the right margin and corrects evam into prvam. 15 D. evam, s.m. evam api
1

10

15

20

25

(*) (tato 'nyenarthavattvam bhavitum arhati tadabhve) tato narthavattvam bhavet tadabhave pthah / (D.201-1, not found in K.)

PANCAMAM AHNIKAM SK17

169

k<a>ranasanghtas1 ca devadattasabdavcyah / tatra bhednm eva bhedrthatvt purusrth<>siddhih 2 / drstntbhvo v / atha matam / sayandayo na devadattrthh / kirn tarhi / ksetrajfirthh / tath sati sdhyasamo drstnta iti / ucyate: na prasiddhyanurodht / satyam kryak<a>ranasanghtasya 3 prrthyam bhoktrtvam <ca> nopapadyate / loke tu devadattrthatvam sayandlnm prasiddham / atas tad anugacchanto 4 vayam apy evam brmah / kasmt / prasiddheh / prasiddhena hy aprasiddham taddharmatm padyate / pasct tu dvayor apy ekadharmnugamd dharmntarenpi tadvattnmlyate / tath ca ksanabhangdhikre 5 bhavadbhir apy uktam "yasya hi pratiksanam anyathtvam nsti tasya bhyapratyayo bhedah / pascd visesagrahane nsti tadyath bhmer apacyamnyh pkajnm / na ca bhmeh pratiksanam anyathtvam 6 nsty aksanikatvaprasangt" <iti> / sauksmyd duradhigamo bheda iti drstntah pratyuktah 7 / tasmt siddham sanghtaparrthatvd asti purusah <iti> / itas ca TRIGUNDIVIPARYAYT / (SK17b') "trigunam aviveki visayah smnyam acetanam prasavadharmi"(SKllab) ca bhydhytmikam "tath pradhnam" (SKllc') / tatra yady etvad etat syt kirn apeksya vyaktvyaktayos traigunydlti 8 / kirn cnyat / ADHISTHNT9 / (SK17b') ihkasmikym pradhnapravrttv arthavasah 10 sannivesavisesaniyamo na syt, srotrdiprthivydinm devamnusatiryaksu hitayogrthas chitapratisedhrthas ca / sa <csti(?)> / tasmd asti tadvyatirikto yadadhisthitnm gunnm ayam citrarpo viparinmah / kartrtvaprasangd adhisthnnupapattir iti cet / syn matam / yadi gunnm purusdhisthitnm pravrttir abhyupagamyate kartrtvam asya prptam / athkart 11 na tarhy asty adhisthtrtvam iti / etac cyuktam / kasmt / art he tadupacrt / yath purusrthah 12 sidhyati tath gunh kryakranabhvena 13 vyhyanta ity atas tatpratantryd
1 A\\ the Mss read kryakrana0. 2 A11 the Mss read purusrthasiddhih. We follow Raghavan. 3 All the Mss read kryakrana0. 4 D. atas tadanugacchanto, s.m. atadanugacchanto 5 6 D. anyatvathtvam, s.m. anyathtvam 7 D. pratyuktah, s.m. prayuktah 8 Dkha. traigunyd iti D. traigunydlti, 9 D. adhisthnt, s.m. anisthnt 10

10

15

20

25

30

This might refer to the missing portion of the argument against ksanikavda in the Yuktidlpik. s.m. traigunyd iti

D.(fn.) pradhnasya pravrttd arthavast sannivesanivesa0 This seems to be a variant for pradhnapravrttv arthavasah. U D. athkart, s.m. atha kart 12 K. and P.: athpurusrthah D. athpurusrthah, s.m. yath purusrthah Dkha. yath purusrthah 13 D. writes and deletes krana before kryakranabhvena.

170

YUKTIDIPIKA

esam adhisthitatvam upapadyate purusasya cadhisthatrtvam / ato nasya 1 kartrtvaprasangah / tasmd yuktam etat / adhisthnt purusah 2 / kirn cnyat / PURUSO 'STI3 BHOKTRBHVT / (SK17c) 5 iha sukhaduhkhamohtmakatvd acetanam vyaktam avyaktam ca / tasmd asya parasparena bhogo nopapadyata ity avasyam bhoktr bhavitavyam / yo 'sau bhokt sa purusah / ha: kah punar ayam bhogo nma / ucyate: bhoga <...> <ha: na vijnne> upalabdhisadbhvt / vijnnam eva hi visayopalabdhisamartham ity atas tvanmtram evstu / kirn purusena 4 parikalpiteneti / ucyate: kirn punar idam vijnnam 5 nmeti / ha: cittam mano vijnnam iti(Vims.p.3.3, AKBh.p.62.1-2) / tac ca sadvidham jnnam caksur vijnnam srotravijnnam ghrnavijnnam jihvvijnnam kyavijnnam manovijnnam iti / tatra rpam pratltya caksus cotpadyate caksur vijnnam / evam srotrasabdaghrnagandhajihvrasamanodharms 6 cittam utpdayanti / tasya dharm vedan samjfi cetan sparso <manaskra>7 evamdayah(cf.AK.II.24) / tasmd vijnnaskandhasyaivopabhogasmarthyn nsty tmeti / ucyate: na acetanavikrasya 8 c e t a n n u p a p a t t e h / yat tu khalv idam isyate (170.16) rpam pratltya caksus cotpadyate caksurvijfinam itydi tencetanavikratvt 9 tad acetanam ghatdivad ity pannam / tasmn manodharmas cetaneti manorathamtram etat / vilaksanakryotpattidarsant tatsiddhir iti cet / syn matam / nyam niyamo yad uta yajjtlyam kranam tajjtiyakena kryena bhavitavyam / kirn tarhi / vilaksanakryotpattir api bhvnm upalabhyate / tadyath srngc charo jyate, golomvilomabhyo drv, vatsatarn mu..kayah 10 , candrakntendusamyogt salilam, sryakntagomayrkasamparkt sudhodakasamparkd araninirmathanc cgnih / evam acetanebhyo rpdibhyas cetanam utpadyata iti / etac c y u k t a m cetan c e t a n o t p a t t i n i y a m a v a t t a n n i y a m t / yath saty etasmin vilaksanakryaprdurbhve bhavatas cetanc cittn ncetanam ghatdy utpadyata iti niyamas tath saty 11 etasmin vilaksanakryaprdurbhve ncetanebhyo rpdibhyas cetanam cittam utpadyata ity ayam niyamo nah / tasmd esm
X D. etensya, s.m. ato nsya 2 D. adhisthnt purusah, s.m. adhisthnt asti purusah 3 D. puts puruso 'sti in parentheses. 4 D. purusena, s.m. purusena 5 D. punar vijnnam, s.m. punar idam vijnnam 6 P. dharmc 7 A11 the Mss read manah samskram. 8 K. and P.: acetanavikrasya D.0 acetanavikrasya, s.m. 9 Dkha. itydi cetancetanavikra 10 n

10

15

20

25

30

acetanavikrasya

D. mu. ka. yac, s.m. mukayas Dkha. mukayas D. reads in the bottom margin: kha pu mukayas candraknteti pthah na tv atra kapustakasyeva trutih /. D . tath sati, s.m. tathsati (without space)

PANCAMAM AHNIKAM SK17

171

drstnm sati bahutve mykranagaravinysavad ayathrthajnnavisayatvd asdhiyastvam / pradlpavat tadvyavastheti cet / syd etat / yath cetanebhyah 1 sattvdibhyo 'vyavasyakam2 ghatdy utpadyata iti nednim vyavasyako mahn notpadyata evam rpdibhyo <>>cetanam3 ghatdy utpadyata iti nednim cetanam cittam notpadyata iti / etad apy a n u p a p a n n a m / kasmt / saktibhedt / praksasvbhvyd vyavasytmakam sattvam / tad yuktam <yad(?)>4 tatprdhnyd vyavasytmako mahn utpadyate / tamahprdhnyd avyavasyak ghatdayah / bhavatas tv ekkr<>rpdayah 5 / tasmd ayam asamah samdhir iti / ha: kirn vyavasyacaitanyayoh kascid rpabhedo 'sti na veti / ucyate: <... /(?)> kim tarhi / traigunyt sati pratyayarpatve samvedy 6 buddhir yath tu vyavasyarpam tath caitanyarpam iti / tath ca vrsaganh pathanti "buddhivrttyvisto 7 hi pratyayatvennuvartamnm anuyti purusah" iti / ha ca arthkra ivbhti yath buddhis tath pumn / bhsamno buddhyto boddh manivad ucyate // yath yath manovrttih puruso 'pi tath tath / buddhirpam avpnoti cetanatvt parsrayam / / ha: rpbhedt purusntahkaranayor anyataraparikalpannarthakyam / yadi tarhi yath vyavas<ya>rpam10 tath caitanyarpam evam sati vyavasyamtram parikalpanlyam caitanyamtram v / kasmt / na hy ek<rtha>krinor11 yugapatkalpane 12 smarthyam asti rpntarbhidhnam v / atha vyavasyacaitanyayoh padrthntaram eveti nityato 13 visesyate tarhi vaktavyam idam amusyaivam rpam nmusyeti / ucyate: ya evam ha rpbhedd 14 arthbheda iti sa tvad idam prastavyah / atha kim /bhavatah kim vijfinavisayayor krabhedo 15 'sty uta nstlti / nety ha / kasmt / krntare sati visayaparicchednupapatteh / na hi visasyasya vijnnapratyavabhsam antarena sakyam svarpam paricchettum / tatra yad anykro gaur anykram 16 govijnnam syt tena yath1 D. yatha cetanebhyah 2 K. and D. 'dhyavasyakam 3 A11 the Mss read rpdibhyo cetanam. We follow Raghavan. 4 All the Mss read yadi. 5 All the Mss read ekkrarpdayah. 6 D. pratyayarpatve samvedy, s.m. pratyayarpam tu asamvedy 7 D. buddhivrttyvist Dkha. buddhivrttivist 8 D. boddh, s.m. bauddh 9 Dkha. manir yad ucyate D. manivad ucyate, s.m. manir yad ucyate 10 0 0 K. and D.: yathdhyavasyaka P. yath vyavasyaka We follow Pandeya. 11 All the Mss read ekntakrinor 12 D. yugapatkalpane, s.m. yugapatkalpamne 13 D. nityato, s.m. nirbandho 14 Dkha. rpbhedd 15 D. krabhede, s.m. kre bhedo 16 8 9

10

15

20

25

Dkha. ananykro gaur ananykram

172

YUKTIDIPIKA

nyakarenasvavijnanenanyakarasya gor apariccheda1 evam 2 anyakarena govijnnennykrasya 3 gor aparicchedah 4 syt / tasmn nasti visayavijnnayor krabheda iti / ucyate: tayor idnim visayavijnnayoh kim ubhayatvam ut<>bhedah5 / bheda ity ha / kasmt / jnapyajnpakabhvd [iti] / ucyate jnnavijneyayor yadvad 6 rp<>bhede7 'pi bhinnat / grhyagrhakabhvena tathaivtmapraksayoh / / yathaiva tarhi bhava<tah>8 saty apy kr<>bhede9 jnnavijneyayor grhyagrhakabhvaparikalpand bheda evam purusntahkaranayor aplti^/ grhyagrhakabhvsiddher ayuktam iti cet / syd etat / yath gotadvijnnayor 10 grhyagrhakabhvo niscito naivam purusntahkaranayoh / tasmd vaisamyam iti / etad anupapamiam / kasmt / mrgntaragamant / prg uktam(171.19) yesm krabhedo nsti tesm ekatvam / idnim tu rpbhede 'pi grhyagrhakabhvd evam bruvato mrgntararn / jnnamtrbhyupagamd aSkylyam iti cet / syn matam / jfinam evntarsadbhtavisaynuranjitam 11 visayavisayirpena pratyavabhsate / na tu kimcid bhyam kimcid grhyarppannam asti / tasmj jnnavijneyayor grhyagrhakabhedd bheda ity askylyam etad iti / tad apy ayuktam / kasmt / siddhntabhedt / yesm bhyo visayo 'sti tatpakse ' y a m dosah / itaresm tu jnnamtrasya visayavisayibhvam pratisetsyma [iti] / ha: evam api visaynavasthprasangah visayino visayatvapratijnnt / yadi visayino 'py adhyavasyasya visayabhvah pratijnyate tena purusasypi visayino 'nyo visayiti prptam / tasypy anya ity anavasth / atha m bhd ayam dosa iti puruso niscayarpatvn na visayah, na tarhy adhyavasyd api niscetur 12 arthntaram kalpayitavyam iti / ucyate: cetanatvt puruse tadanupapattih / indriyni tvad grahanamtrarpatvd apratyaynlti pratyayava<tas>13 tvat karanam parikalpyate / antahkaranam apy upttavisayendriyavrttyupaniptt tadrppattv api satym 14 acetanatvt svayam upalabdhum asamartham evam visayam ity ato bhoktram cetanam purusam apeksate / purusasya tu cetanatvd drastrantaram asakyam kalpayitum / tasmn nnavasthprasaiigah /
1 P. gaupariccheda 2 Dkha. apariccheda eva evam 3 P. gavijnnen0 4 Dkha. goparicchedah 5 All the Mss read uta bhedah. We follow Raghavan. 6 K. and D. writes r yadvad ... apy krabhede jnnavijneyayo in 7 All the Mss read rpbhede. We follow Raghavan. 8 All the Mss read bhavat. We follow Pandeya. 9 All the Mss read krabhede. We follow Raghavan. 10 P. gatodvijnnayor D. goto dvijnnayor, s.m. gotadvijnnayor n 12 D. niscetur, s.m. nisceturn 13 All the Mss read pratyayavadantas. 14

10

15

20

25

30

the right margin.

K. and P.:evntarsadvisayabhtnuranjitam D. satym, s.m. satyym

PANCAMAM AHNIKAM SK17

173

ha: purusasydhyavasyakartrtvaprasangah 1 caitanyt / yady acetan buddhis tena tasy adhyavasyo vrttir ghatdivan na prpnoti / atah purusasydhyavasyah prptas tatas ca buddhyabhva iti / ucyate: na kaivalyd apratibandhaprasangt / anmisrarpam purusatattvam ity etad uparistd vaksymah(179.12,180.6) / sa yadi vyavasyakah syd apratibandhena dinniscaydisu <...(?)> suptamattamrcchitnm ca vyavasyah syt / drstas tv evamavasthasya vyavasyapratibandhah / tasmn na purusasya vyavasyah / yasya punar antahkaranam vyavasyakam tasyaivam doso nsti / kasmt / traigunyt / sattvdisamsthnaviseso hi buddhih kranntarapratisedht / tatra yaddhyavasyalaksanam sattvam gun<a>bhvt2 pradhnabhtena tamas tiraskrtasakti bhavati taddhyavasyapratibandhah / ha: katham punar etad gamyate sarvam idam acetanam iti / ucyate: prakrtivikrabhtatvt / iha yat prakrtivikrabhtam tad acetanam tadyath tantupatdayah / prakrtivikrabhtam <sarvam) / tasmd acetanam 3 / kSe 'dar^ann naiknta iti cen na asiddhatvt / n a hy ksasytmapakse 4 prakrtivikratvbhvah siddhah / tasmd yuktam etat prakrtivikrabhtatvd acetanam sarvam / ata eva ca cetanasyprakrtivikrabhtatvam parasparavaidharmyt / tasmn nnyasya pa<d>rthasya5 bhoktrtvam cetanyjd^ upapadyate 7 / na cet sktam bhoktrbhvd asti purusah / KAIVALYRTHAM PRAVRTTES8 CA / / (SK17d) iha pravrttimatm nimittam antarena <pra>vrttir9 nopapadyate / pradhnam api ca pravrttimad vyaktadarsant / tasmd yasya kaivalyam pradhnapravrttihetuh sa purusah / pradhnnabhyupagamd ubhayprasiddhir iti cet / syd etat / pradhnam cetanavad asmkam aprasiddham / <yac ca>10 tasya kaivalyrtham pravrttir 11 bhavat purusstitve lingam 12 apadisyate tad idam asiddham na siddham pratipdyata iti / etac cyuktam / kasmt / prvam tatpratipdant / prk pradhnam apratipdyaivam caksnah satyam evam paryanuyogrhah syt / prasdhitam 13 tu pradhnam parimndibhir 14 (cf.SK15ab) iti / ato na kimcid etat / sarvcryavipratipatteh purussiddhir 15 iti cet / syn matam / yadi purusasya sattvam eva syt tena tarn praty crynm na dharmavivdah syt / asti csau / tath hi kesmcin nirgunah
1 D. purusasyadhyava0, s.m. purusdhyava0 2 All the Mss read gunbhvt. We follow Raghavan. 3

10

15

20

25

30

4 Dkha. krasy0 5 All the Mss read paramrthasya. 6 D. cetanyd, s.m. cetanym 7 K. upapadyeta D. upapadyeta, s.m. upapadyate 8 Dkha. kaivalyrthapravrttes 9 A H the Mss read nivrttir. 10 All the Mss read yvat. U D. kaivalyrthapravrttir 12 D. purusstitve lingam, s.m. purusstitvalingam 13 K. and P.: sdhayitum D. sdhayitum, s.m. prasdhitam 14 D. parimndibhir, s.m. parinmdibhir 15

D. writes and deletes tad acetanam before tasmd acetanam.

Dkha. prasditam

K. and P.: purusrthasiddhir D. purusrthasiddhir, s.m. purussiddhir

174

YUKTIDIPIKA

10

kesamcit Kgunavan)1/ atah paresam 2 vibhuh parimito 'nyesam tathaiko naika 3 iti / tasmd bhrntimtram purusakalpaneti / etad anupapannam / kasmt / sarvapadrthbhvaprasangt rpdisv api <vi>pratipatteh 4 / kesmcit ksanikh kesmcit klntarvasthyinas tathsrith svatantr itydi / tath srotrdini bhautikny hamkrikni ^ajmisniti^vipratipattih / evam sarvapadrthbhvah syt / tasmd asti purusah / tatra yad uktam 5 (167.6) sarvapramnnupalabdher nsti purusa ity etad ayuktam / yad apy uktam(167.18) snyam dhytmikam pasyeti 6 tasya pasct pratisedham vaksymah(SK19) / yat punar etad uktam(167.21) asti karmsti vipkah krakas tu nopalabhyata iti satyam etat / na hi purusa<h> skandhnm 7 niksepe pratisandhne 'nyatra v kraka iti nah paksah / tasmc chreyo'rthibhih 8 sarvgamatarkaviruddhm nairtmyavdaparikalpanbhrntim asamanjasm apohya purusasattvaparijnnd eva jananamarandisarvopadravapratipaksabhtam param amrtam dhruvam sthnam avptavyam iti / / 1 7 / / ha: grhnlmahe tvad asty ayam tmeti / idnlm aneko 'thaika iti vicryam / kutah samsaya iti cet / sambandhinm ubhayath drstatvt / iha kasyacid anekasynekena sambandha upalabhyate tadyath srotrdin sarirasya / kasyacid ekasynekena tadyathksasya ghatdin 9 / ayam api ctm kryak<a>ranasambandhity 10 atah samsayah kirn srotrdivad anekah, ksavad eko veti / kirn cnyat / cryavipratipatteh / aupanisadh khalv eka tmeti pratipannh / kndksapdrhataprabhrtayah punar aneka iti / yath caiknekatvarn praty tmano vipratipattir evam sksitvaudsinyadrastrtvkartrtvesu / tasmd vaktavyam katham ete dharmh puruse Vatisthanta iti/ ucyate: yat tvad uktam(174.16) sambandhitvd tmapadrthe 11 sandehah kirn aneko 'tha eka ity atra 12 brmah: bahavah purus iti pratijn / kasmt / JANMAMARANAKARANNM13 PRATINIYAMT / (SK18ab')

15

20

25

30

janmeti mahaddeh sksmasarirsritasya lingasya yathsamskram bhyena sanrena sambandhah / maranam iti prvakrtasya karmanah phalabhogapari2 K. 3 D. 4

*A11 the Mss read paravn. and P.: sarvesm D. sarvesm, s.m. paresrn Dkha. paresm tathaiko naika, s.m. tathaiko 'neka K. and P.: rpdisv api pratipatteh D. rpdisv api pratipatteh, s.m. rpdipratipatteh Dkha. rpdipratipatter We follow Pandeya. 5 P. tatra yuktam 6 D. 'snyam dhytmikam pasya ' iti 7 A11 the Mss read purusaskandhnm. We follow Raghavan. 8 K. and P.: sreyobhih D. Sreyobhih, s.m. sreyo'rthibhih 9 D. ghatdin, s.m. gavdin(7) 10 All the Mss read kryakrana0. 11 D. tmaparodrtheC?), s.m. tmaparrthe 12 D. ata, s.m. atra 13 K. and P.: jananamaranakarannm D. jananamaranakarannm, s.m. janmakaranamara

PANCAMAM HNIKAM SK17,18

175

sampteh smpratasya ca phalabhogasya pratyupasthne lingasya prvasarlratygah / "karanam trayodasavidham" (SK32a) iti vaksyati / janma ca maranam ca karanni ca janmamaranakaranni tesm pratipurusam niyamah / etasml lingd tmano bahutvam avasiyate / et ad uktam bhavati / janmalaksanam ca maranalaksanam ca kryak<a>ranasyvasthnta<re>1 parasparavirodhi<nl>2 tamahpraksavat / tatra yady eka tm syt tena yathaikam dravyam tamahpraksv ekapradesopaniptinau na saknoty anubhavitum asambhavt, evam ayam janmamarane 'pi na saknuyd upabhoktum / asti cyam kenacit kryakaranena janmopabhogah kenacin maranopabhogah / tena manymahe nn tmno yesm virodhidharmopabhogasmarthyam iti / tath karannm prakstisayo visayagrahanalaksan<o> 'suddhyatisayas 3 cstvimsatidhsaktih (cf.SK47c) / tayoh parasparavirodhd ekentman yugapadupabhogo nopapadyate 4 / na hi sakyam ekentman prakstisayo visayagrahanalaksano 'suddhyatisayas 5 csaktilaksano virodhitvd yugapad upabhoktum / asti cyam karananimittah pratipurusam niyamah / tena manymahe nn tmna iti / kirn cnyat / AYUGAPATPRAVRTTES CA / PURUSABAHUTVAM SIDDHAM / (SK18b'c) kasyyugapatpravrtteh6/ pradhnasyeti sesah / yasya pravrttir upapadyate / [kasya7 pravrttir upapadyate / pradhnasya] / katham iti / ucyate: yady eka tm syt tenaikapurusdhikranibaddham pradhnam saktas csau yugapad anekni sarirny upabhoktum 8 ity ato yvadbhih sarirair apacitsu 9 klamtrsv asmin bhavaparivarte bhavitavyam sarvesm utpattim prati yugapat 10 pravarteta / drst tu pradhnasyyugapac charirabhvena pravrttih / tasmd ayugapatpravrttes ca nn tmna iti / anye punar huh: bahiskarannm evyugapatpravrtteh / katham / yady eka tm syt tena tatsamskropanibaddhny eva sarvni karannity atah pratipindam avasthitaih karanair yugapad visayn grhniyt / bdhirydyupaghte v sati pindntarasambandhin karanennyasya sabddi<graha>nam 11 apratisiddham syt / na tu tath bhavati / tasmt karannm ayugapatpravrtter 12 nn tmna iti / tad ayuktam / kasmt / prvenvi1 A11 the 2 All the 3

10

15

20

25

30

Mss read kryakranasyvasthntaram. Mss read parasparavirodhinau. We follow Pandeya. K. and P.: laksansuddhyatisaya$ D. laksan suddhy0, s.m. laksanasuddhy We follow Chakravarti. 4 D. upabhogenopapadyate, s.m. upabhogo nopapadyate 5 D. suddhyatisayas 6 K. and P.: kasmt / ayugapatpravrtteh D. kasmd ayugapatpravrtteh, s.m. kasyyugapatpravrtteh 7 D. writes kasya pravrttir upapadyate in the right margin and corrects kasya into kasyacid. 8 D. anekni upabhoktum, s.m. anekni sartrni upabhoktum 9 D. upacitsu 10 D. pratiyugapat, s.m. prati yugapat 11 All the Mss read sabddikaranam. 12 D. ayupatpravrtter, s.m. ayugapatpravrtter

176

YUKTIDIPIKA

sesat / karananam pratiniyamad ity anenayam upasangrhito 'rthah / tasmad yathoktam evastu / kim canyat / TRIGUNDIVIPARYAYC CAIVA / / (SK18d) 5 iha trigunam aviveki visayah smnyam acetanam prasavadharmi / (SKIlab) ity ete dharmh pratipindam upalabhyante / yath caite tath tatpratiyogino nairgunydayah purusadharmh / tatra yathaiva gunasvabhvaviparitasvabhvasyopalambhd ekasmt pindd ekapurusasiddhir evam pratipindam gunasvabhvaviparltasvabhvasyopalambht 1 purusanntvam avaseyam / tasmd avasthitam et an nn tmna iti / / 1 8 / / ha: siddham tmano nntvam / sksitvakaivalyamdhyasthyadrastrtvkartrtvnm 2 idnim kasmd dhetoh pratipattir iti / ucyate: 15 TASMC CA VIPARYST SIDDHAM SKSITVAM ASYA PURUSASYA / KAIVALYAM MDHYASTHYAM DRASTRTVAM AKARTRBHVAS CA / / (SK19) tasmd ity anena hetusmnyam caste / casabdo 'vadhrane / viparysd iti smnyena hetum upttam visese Vasthpayati / siddham sksitvam asya purusasyety evamdin sdhyadharmanirdesam karoti / tatra sksitvam ity anena gunnm pravrttv asvtantryam khypayati / pradhnasya tadarthanibandhanatvt 3 pravrtteh / adhisthtrtvam katham iti / ucyate: yath hi kriysksini kasmimscid avasthite kart tadicchnuvidhyi kryam nirvartayati na svatantrah, evam pradhnam api / pravrttinivrttyor yath purusasyrthah sidhyati tath mahadahamkratanmtrendriyabhtadevamanusyatiryaksthvarabhvena vyhate na yadrcchtah / tasmt purusas t ad arthapar at antrat vt pradhnapravrttinivrttyoh sksl / kaivalyam ity anena samsargadharmatvam tmano nivartayati / na yath sattvdinm parasparena praksdidharmpeksnm samsarga evam purusasya tair bhavati / mdhyasthyam ity anentisayanirhrsnupapatteh purusasya gunaih saha bdhnugrahnupapattim svakryapravrttau cpaksaptam darsayati / drastrtvam ity anenodsinasya kryakaranapindavyhasamaklam 4 caitanyasaktisadbhvt sukhaduhkhamohasvabhvnm gunacestnm <anir> vrttrthnm 5 sannidhnamtrd upalabdhimtram pratijnti / akartrbhvas cety anena
1 D, 2 D. 3 D. 4 K. 5

10

20

25

30

35

svabhvasya upalambhat, s.m. svabhavopalambht kaivalyasdhyasthy0 , s.m. kaivalyamdhyasthy pradhnasya tadartha , s.m. purusatadartha0 and P.: kryakrana0 All the Mss read anivrttrthnm.

PANCAMAM AHNIKAM SK18,19

177

saptavidham akartrtvam srayati / na hy ayam visayesu bhyntahkaranasnnidhye 'dhyavasyam kurute / na ca sattvdinm praksapravrttiniyamalaksanair dharmair itaretaropakrena pravartamnnm svena caitanyalaksanena dharmenngabhvam pratipadyate npy angibhvam / evam saha gunaih kryam na kurute <dh>trikumravat 1 / sthitaprayogam na kurute rathasakatayantraprerakavat / na svtmano mrtpindavat / na paratah 2 kumbhakravat / npy desn 3 mykravat / nobhayato mtrpitrvat / tad evam anena strencryah purusasydhisthtrtvam nairgunyam audsinyam bhoktrtvam akartrtvam ca sdhyatm pdya trigundiviparyayam sdh<ana>tvenopanyasyati 4 / taih pancabhis trigundiviparitaih <dha>rmabhih5 paficnm esm yathsambhavam pravrttir avagantavy / tatra nairgunyt sksitvam / yasmd ayam sukhdibhyo 'rthntarabhtas [tasmd ayam sukhdibhyo 'rthntaras] tasmt tatkriysaksi / ha: tadasiddh<i>h 6 nairgunysiddheh / yady asya sukhdidharma<rahita>tvam7 tmanah prasiddham syd ata etad yujyate vaktum / tat tv asiddham / tasmd ayuktam etat / visesnabhidhnd itarsiddhir 8 aplti cet / syn matam / tmagunh sukhdayo na sabdagun ity atrpi bhavat viseso nbhidhiyate / tasmd etad apy asiddham <iti> / etad apy ayukt a m 9 / kasmt / <ahamkrenaikavkyatvt / ...(?)> ahamkrenaikavkyatve <5>bhinndhikaranatvam10 syt / drstam tu sukhito 'harn duhkhito ?ham iti / tasmt sukhaduhkhayoh sabddytmabhvo na yuktah / ucyate: na gaurdisv anekntt / tadyath <gauro 'harn) 11 krsno 'harn iti sariradharmair tmano bhinndhikaranatvam ahamkrenaivam sukhaduhkhayor api syt / na ctmagunatvam syd iti / ha: prthagupalabdher ayuktam / yady api gaurdlnm avibhaktam ahamkrena grahanam tathpi prthag [ayam] prg etn tmano grhltv pascd avibhaktn grhnan saknoti vyavasthpayitum amusyaite na 12 punar amusyeti / na tv evam sukhaduhkhayoh prthagupalabdhih / tasmd asad etad iti / ucyate: naivam upapadyate 1 3 / kasmt / mrgntaragamant / ahamkrenvibhaktagrahand tmagunatvam iti prg apadistam 14 / idnim tu saty api tasmin prthaggrahand abhvam bruvato mrgntaragamanam anaikntikasya cparihrah / kirn cnyat / samsayvyatirekt / yata eva gaurdayah prthag upalabhyante na sukhdayo 'ta eva samsayah / na ca yata eva samsayas tata eva nirnayo yuktah / tasmd yuktam etad gaurdivad
2 K. and P.ipuratah D. purutah, s.m. paratah 3 D. npy desn, s.m. npy adesn 4 All the Mss read sdhyatveno0. We follow Raghavan. 5 All the Mss read karmabhih. 6 All the Mss read tadasiddheh. 7 All the Mss read sukhdidharmatvam. 8 P. itart siddhir 9 D. etad apy ukta, s.m. etad apy ayuktam 10 11 All the Mss read gaurah. 12 D. amusya etena 13 Dkha. tenaivam upapadyate 14

10

15

20

25

30

*A11 the Mss read strikumravat.

All the Mss read bhinndhikaranatvam. We follow Raghavan.

D. upadistam, s.m. apadistam

178

YUKTIDIPIKA

10

15

20

25

30

ahamkarenapy abhinnagrahanac chabdadyatmabhutah 1 sukhadayah <iti> / kim cnyat / svabhvnavadhrand anupdnaprasangt 2 / sukhdy<an>tmakh 3 sabddaya ity evam bruvatah sabddlnm svabhvnavadhrand anupdnaprasangah / nimittatvenopdnd agnivad adosa iti cet / syn matam / yathgnih pkajanimittam updlyate 'tha caism prthivatvam evam sabddayo 'pi sukhdinimittatvenopdlyerann atha caism tmagunatvam eva syd iti / tad apy anupapannam / kasmt / smndhikaranyadarsant / yath nimittasygner na pkajaih smndhikaranyam pakvo 'gnih pacyate 'gnir ity evam sabddlnm nimittatvn na smndhikaranyam syt sukha<h> sabdo <'>duhkha(?)4 iti / drstam tu / tasmn na tesm nimittrthenopdnam iti/ ha: evam api sukhdlnm sabddytmabhvo na yuktah / kasmt / vipratipatteh / yath hi sabdh sabdtmak iti sarvaih sabdarpena grhyanta evam sukhtmako V a m iti sarvais tadrpena grhyeta 5 / drst tu vipratipattih / tasmd tmagun iti / ucyate: na samskravisesanimittatvt / tadyath pittdismarthyn mdhurydisu vipratipattir na caism asabddigunatvasamskravisesayogt 6 sukhdisu vipratipattih <... evam ...> na caism asabddigunatvam iti / kim cnyat / nimittatve 'pi t a t p r a s a n g t / nimittavdino 'py etat samnam 7 / na hi nimittanaimittikayor vipratipattir asti / tadyath pradipapraksayos tatas ca vipratipatter nimittatvam api sabddlnm akalpamyam syt / yas 8 ca dvayor doso na tarn ekas codyata iti / tmagunknksitvd adosa iti cet / syn matam / nimittam apradhnatvd anyaparipkavasena sukhaduhkhe <u>tpdayati 9 / tmanas tanmayatve tu nirknksatvt pradhnasya vyavasthbhedo na yukta iti / tac ca naivam / kasmt / uktatvt / tanmayatve 'pi gunabhvn mdhurydisu vipratipattir ity dv evoktam (178.16) etat / tasmt tanmayatve prdhnyam iti cniscitbhidhnam etat / ha: evam apy ayuktam etat / kasmt / atltngatesv api <tad>drst e h 1 0 / <...> tasmt sukhdlnm sabddytmabhvo na yukta iti / ucyate: na smrtinimittatvd buddheh / ayam atltngatesv api sabddisu smrtasukhaduhkhayogo 11 bhavati / tatsamparkt tu purusena tathnubhyate / purusagunatve tu pkajavan nimittd utpannnm sukhdlnm visesabhvt tivramandatnupapattih syt / tasmt sukhaduhkhayoh sabddytmabhvo <n>yuktah 12 /
X D. abhinnagrahanacchaddyatmabhutah, s.m. 2 D. encircles da of navadhrandanupdna0. 3 All the Mss read sukhdytmakh. 4 5 P. 6 D. 7

abhinnagrahanac chabdadadyatmabhutah

All the Mss read sukhasabdo duhkha. Another possible emendation would be: sukhah sabdo duhkhah sabda. grhyate vise$ayogt, s.m. vise$yogt Dkha. vdino 'py atat samnam 8 D. yac 9 All the Mss read notpdayati. 10 All the Mss read tu drsteh. U D. yogo, s.m. yoge 12 All the Mss read na yuktah.

PANCAMAM AHNIKAM SK19

179

kirn cnyat / anirmoksaprasangt / dravyasya gunair aviprayogt sukhaduhkhayor tmagunatve saty tmanas tbhym anirmoksaprasangah / tasmt tayor tmagunatvam ayuktam iti / symdivat tadvinivrttir iti cet / syn matam / yath symagunatve saty anor agnisambandht tadvinivrttih 1 sabddigunatve cksasysabdakasyvasthnam evam tmano 'piti / etad ayuktam / kasmt / visesopdnaprasangt sdhyatvc ca / yath hy anuh symatm parityajya rpavisesam eva raktalaksanam updatte na rpavattm tyajati, evam tmpi bhyanimittasmarthyt sukht sukhntaram duhkhd duhkhntaram updadita na te 2 atyantam jahyt / tathksam sabdalaksanam kasymcid avasthym asabdakam bhavatity asmn prati sdhyo ' y a m arthah / bherydisabds tu tadguna eveti pratipdayisymah(225.15) / tasmt sukhaduhkhayoh sabddytmabhvo yuktah / evam anmisrarpa tm / tatas cecchdvesaprayatnadharmdharmajnnasamskrnm (cf .NS .1.1.10) anekasvabhvnm parasparavirodhinm ca tadgunatvam anupapannam / tasmd yuktam et an nirguna tm, nairgunyc ca sksimtra iti / kevalo viviktatvt / <y>asmd3 ayam gunebhyah prthagbhtas tasmt kevalo na taih saha samsargena vartate / ha: kah punar asytmano gunebhyah prthagbhvo 'bhipreta iti / ucyate: tadupakranirapeksnm sattvdinm svakryasmarthyam prthagbhvah 4 / na hi sattvdayah praksdibhir dharmair itaretaropakrena vartamnh purusakrtam upakram apeksante / praksdidharmasannidhnamtrd eva tu pravartante / tath ca vrsaganh pathanti "pradhnapravrttir apratyay purusenparigrhyamn disarge vartate" iti / yasmd guns tadupakranirapeksh pravartante tasmd asv api tatsamsargam nnubhavati / drst tu loke 'py ekakrya<tvbhvt>5 [prthak] r^h^gbhyaparikalpan / tadyatheme bhrtarah prthag <y>esm6 naikam kryam, na prthag ime yesm <e>kam7 iti/ madhyastho visayitvt / yasmd ayam puruso visayi tasmn madhyasthah / kirn kranam / visaynm hy atulyabalatvt ny<nat>tisayopapattes 8 ca parasparena bdhnugrahv upapannau / visayi cyam / tasmn nsti nynatdyupapattih / tatas <ca(?)> cetan<a>bhvah9 / <an>misrarpatvt 10 / sangadvesau gunavisayau, ato madhyasthah / drastrtvam caitanyt / prakrtivikrabhtatvt sattvdibhyas caitanyam apoddhrtya 11 puruse vyavasthpaniyam 12 / na ccetannm 13 drastrtvam upapadyata ity atah purusa eva caitanyd drast nnyat tattvntaram /
1 D. tadvinipri, s.m. tadvinivrttih 2 Dkha. te na 3 All the Mss read tasmd. 4 D. smarthyaprthag0, s.m. smarthyam prthag0 5 All the Mss read ekakryatvt. 6 All the Mss read esm. 7 All the Mss read naikam. We follow Pandeya. 8

10

15

20

25

30

35

All the Mss read nyntisayopapattes. the Mss read tatas cetanbhvah. K. and P.: na cmisrarpatvt D. na cmisrarpatvt, s.m. na cnmisrarpatvt 11 D. apoddhrtya, s.m. uddhrtya 12 D. vyavasthpamyam, s.m. vyavasthpitam 13 D. ccetanm, s.m. ccetannrn(?)
9 All 10

180

YUKTIDIPIKA

10

15

20

25

akartrbhavo 'prasavadharmitvat / prasavartho dharmah / prasavadharmah so 'systi(cf.Pn.4.3.120) iti prasavadharmT / kah punar asau prasavartho dharma ity ucyate / praspandanaparinmau / niskriyatvd akarteti yvat tad idam aprasavadharmitvd akarteti / kathain asya niskriyatvam iti cet caitanyt / acetannm hi ksirdinm kriyvattvam upalabdham cetanasya na kasyacid ity ato niskriyah purusah / kim ca anmisrarpatvt / misrarpam hi kriydivat ksirdi / anmisrarpas cyam / tasmn niskriyah / vibhutvd iti cet / syd etat / yath vibhutve sati pradhnasya sakriyatvam evam purusasya sati vibhutve sakriyatvena bhavitavyam iti / tac ca naivam / kasmt / dhar mad vayasahitasya shacaryopalabdheh / tad vibhutvam <acaitanydy>anekarpatvasahitam1 kriyvati drstam na kevalam / na tu tath puruse / tasmd visamam etat / evam niskriyah puruso niskriyatvc ca <parasmt(?)>2 kryakaranam na kurute / kasmt 3 / kriyvatah kumbhakrasya mrtpindt kryanispattismarthyadarsant / syd etat / utpditasynyena sthitim kurute dhtrikumravat / sthitasya v prayogam rathasakatayantraprerakavad iti / etad apy anupapannam / prvasmd eva hetoh / athpi syt svatah purusah kryakaranam kuruta iti / tad apy ayuktam / cetancetanayor atyantabhedt prakrtivikrabhvnupapatteh / atha matam ubhayata iti / tad api naiva sambhavaty ubhayadosaprasangt / syt punar etad avyapadisya yonim puruso 'bhidhynamtrena kryakaranam kuruta iti / asad etat / kasmt / anutpattv 4 abhidhynnupapatteh / Isvarakranapratisedhe 'bhihitam( 157.28) prk pradhnaviparinmd buddhimato buddhir nsti / na ca buddhim antarenbhidhynam upapadyate tadvrttibhtatvt / tath buddhimatprvakasrstipratisedhah krtah / sa ihpi yojyah / adhyavasyakartrtvam ca prk pratisiddham (173.4) / evam saptavidhenkartrtvenkart purusah / uktam ca ndhyavasyam kurute puruso naiva sthitim prayogam v / na svtmano na parato <na> vyapadesn 5 na cobhayatah / / tad yuktam etat

30 iti / / / /

tasmc ca viparyst siddham sksitvam asya purusasya / kaivalyam mdhyasthyam drastrtvam akartrbhvas ca //(SK19)

yatas cetansaktisambandht purusa eva drast nnyat tattvntaram guns ca kartro na purusah 35 TASMT TATSAMYOGD ACETANAM CETANVAD IVA LINGAM / GUNAKARTRTVE CA TATH KARTEVA BHAVATY UDSINAH / / (SK20)
1 A\\ the Mss read cetanynekarpatva0. 2 All the Mss read pradhnt. 3 D. kasmt, s.m. tasmt 4 D. anutpattv, s,m. anupapattau 5

All the Mss read nvyapadesn. We follow Raghavan.

PANCAMAM AHNIKAM SK19,20

181

purusasamparkd dhi grahanadhranavijiinavacanohpohakriyKnm) 1 yakhr ny^bhini^ pratyayarpnm ivopalabdh<is>2 cetansaktes cdhyavasyavrttim anurudhyamnys tadbhvasannivesinm sattvdinm vypravatm 3 abhisambandhd vyprvisty ivopalabdhih / yatas tatryam anekaklapravrttamithypratyaybhysavsanpekso bhavabijahetur jnnavisesah prnabhrtm avabhsate srotram upalabhate 4 tvakcaksurjihvghrnam itydi tath purusah karmanm kart, purusah sukhaduhkhayor iti, tasmt karanasya 5 grahanarpat purusasya ca kartrrpat, sambandhyantarasamparkd anyagatnyatropalabhyamn bhaktydhyavastavy, na paramrthatah / uktam ca cetandhisthit buddhis cetaneva vibhvyate / kartrsv avasthitas ctm bhokt karteva laksyate / / ha: samyogt pararpatpattv atiprasangah avisest / yadi cetanasamyogd buddhydinm pratyayavad upacro vypitvd asya ghatdibhir api samyogo na pratisidhyata ity at ah prptas tesm api pratyayavad upacrah / atha samyog<a>visest6 karannm eva pratyayavad upacro na ghatdinm vises as tarhi vaktavya iti / ucyate: tadaprasangah saktyapeksatvt sphatikdivat / yathopadhnasamyog<>visese7 saty ksasphatikayoh sphtikam evopadhnasarpam 8 pratyavabhsate saktito nksam evam purusasamyogvisese buddhighatayoh saktito buddhir eva cetanrppannevopalabhyate na ghatah / ha: purusasya vikryatvaprasangah rpntaropdant / yadi tarhi karanasambandht purusah kartrtvopacram visayasarpatm ca pratipadyate, prptam asypi sphatikavad rpntaropdnd vikryatvam / atha nsya visayarppattir na tarhi karanasarpah purusa iti / ucyate: na bhaktito 'bhyupagamt / buddhir upttavisayendriyavrttyupaniptt tdrpyam pratipadyate / buddhirpam tu sannidhnamtrc chaktivisesayogt phalabhoktrtvc ca rjani bhrtyajayaparjayopacravat purusa upacaryate / na tv asau buddhisamparkt tadrpo bhavati / ata evsya satym 9 cetansaktau vyavasyakartrtvam pratisidhyate / m bhd visayarppattau satym anekasvabhvatvd <v>ikryatvaprasangah10/ tasmd visayasamparkd apy avikryah purusah / na hy asya nityatvt kimcid anugrahya npaghtya / ha ca mustir yath vikirnah scyagre sarsapdinm /
1 All the Mss read vacanohapohakriya. 2 K. and P.: ivopalabdhes D. ivopolabdhes, s.m. ivopalabdhes 3 D. vypravatm 4 P. upalabhyate 5 P. karanasya 6 K. and P.: samyogvisest D. samyogvisest, s.m. samyogvisese 7 A11 the Mss read yathopadhnasamyogavisese. 8 D. evopodhnasarpam, s.m. evpodhnasarpam 9

10

15

20

25

30

D. $attym(t), s.m. satym. A11 the Mss read anekasvabhvatvdikryatvaprasangah.

182

YUKTIDIPIKA tisthati na suksmabhavat tadvad dvandvani sarvajfie1 / /

iti / cetansaktiyogt tu drastrtvam asya svbhvikam / evam ced yad varstapbhynr 2 ) kirn vyomnas carmany asti tayoh phalam / 5 carmopamas cet so 'nityah khatulyas ced asatsamah 2 / / (see AKV.p.699.25, SDS.p.22.3, NVTT. on NS.1.1.22, NM.part 2. p.16.17) iti tad ayuktam / kirn kranam / yasmd <yath> avikryarpasyksasya sannidhnamtrn meghtaparajodhmaprabhrtibhir 3 abhinnadesatvd atyantasuddhasypi malinam iva rpam upalaksy<eta>4 na ca vikryatvam evam tmano 'pi syt / tad yuktam etat purusasamyogt karanasya 5 pratyayopacrah purusasya ca gunasamyogt kartrtvopacra 6 iti / ha: ayuktam etat / kasmt / s a m y o g n u p a p a t t e h / purusasya hi gunnm ca samyogah parikalpyamno 'nyatarakarmajo v parikalpyate yath sthnusyenayoh, ubhayakarmajo 7 v yath mesayoh, samyogajo v <yath> dvyangulksayoh, svbhviko v yathgnyausnayoh 8 , saktinimitto v yath caksrpayoh, yogyatlaksano v yathngusthopnaddravyayoh, ydrcchiko9 v yath svabhratatptinoh, visayavisayinimitto v yath matsyodakayor iti / tan na tvad anyatarakarmaja ubhayakarmajas ca samyoga e s m upapadyate / kasmt / vibhutvt / paricchinnadesnm aprptau satym asau drsto 10 yathodhrtam / na caitad gunnm purusasya ca sambhavati vibhutvt / na svbhvikah anirmoksaprasangt / yathgneh svbhvikd ausnyn 11 mokso na bhavaty evam ntmanah / svbhvikatvd gunasamyogd
J D. sarvajnahj s.m. sarvajfie 2 Dkha. asatphalam D. asatsamah, s.m. asatphalam 0 3 0 0 P. meghparajo K. meghtaparajo D. meghparajo , 4 All the Mss read upalaksyate. 5 P. karanasya 6

10

15

20

s.m. meghtaparajo0

D. purusasamyogt kartrtvopacrah, s.m. purusasamyogt pratyayopacrah purusasya gunasamyogt kartrtvopacrah 7 P. ubhakarmajo 8 P. agnyusmayoh 9 Dkha. ystiko(i) 10 P. satym adrstah n P . ausmyn

bauddh<ai>h* // (K79a, not found in D.) *K. bauddhh (2) (varstapbhym) nityas tv tmbhyupagamyamno yadi sukhdijanman vikrtim anubhavati tad ayam anitya eva dharmdivad uktah syt, nirvikratve tu satsat v sukhaduhkhdin karmaphalena kas tasya visesa iti karmavaiphalyam eva tad uktam varstapbhym itydi* bauddhh / / (K.79a, D.233 without number) *D. iti

PANCAMAM HNIKAM SK20,21

183

anirmoksaprasangah 1 syt / saktinimittas ca / kirn / anirmoksaprasangd eva sa na bhavatity anuvartate / svasvmisaktinimitte hi samyoge parikalpyamne saktyoh satatvasthnd anirmoksa eva prasajyeta / n a 2 yogyatlaksanah saktimtrarpatvt / asamvedya<h>3/ atas tadasiddhih / kim ca prayojanntarnupapatteh / pravrttyanugunam hiyogyam ity ucyate / tagyjj^eva tu pravrtteh purusrtham apohya 4 nimittntaram asakyam 5 kalpayitum / [kasmikatve ca niyamadvaitnupapattih] / tasmd ayuktam purusasya gunnm ca yogyatlaksanah sambandhah / na ydrcchikah moksakrananiyamnupapatteh / samyogakranapratidvandvam kaivalyakranam 6 / yadi ca ydrcchiko gunapurusasamyogah syt tasyjnnn 7 nivrttir nstiti tadarthasybhyutthnasynarthakyam prptam visesnupapattes ca kranntaram kalpayitum / ata etad apy ayuktam 8 [iti] / na vaisayikah anirmoksaprasang t 9 / satatam eva hi purusasya visayitvam avyvrttam gunnm ca visayatvam ity anirmoksaprasanga eva syt / etvms ca samyogah parikalpyamnah parikalpyeta 10 sarvath ca nopapadyate / tasmt tatsamyogd ity ayuktam abhidhtum iti / ucyate: samyogn<eka>tvd 11 iha caupacrikaparikalpand adosah / ihnekavidhah samyogah [tadyath prptiprvik prptih] yathodhrtam anyatarakarmaja 12 ubhayakarmajah samyoga itydi / yatrsau na sambhavati tatra sannidhimtrasmnyd 13 bhakty kalpyate tadyathksasya gavdibhih / pradesair iti cen na abhvt / te 'pi hi niravayavatvd ksasya bhakty kalpyante / mbht krtakatvnityatvadosaprasangah / tasmt pradesopacrt kryam apy upacaritam / anyas tu sstrlyah samyogo 'rthanimittah / tatrnekasamyogopapatter iha purusntahkaranayor abhinnadesatvt sannidhimtrasmnyd bhktam samyogam parikalpyaivam 14 ucyata ity adosah//20// ha: vijntam samyogadvayam / ayam tv anyo 'rthanimittah sstrlyah samyogo bhavat paribhsyate / tatra vaktavyam kimartho 'sv iti / ucyate: PURUSASYA DARSANRTHAH / (SK21a) *D. sarnyogad anirmoksa0, s.m. samyogt nirmoksa0 2 P. omits na. 3 A11 the Mss read asamvedyam. We follow Raghavan. 4 P. upohya 5 P. nimittntarasakyam 6 D. kaivalyakranam, s.m. hi kaivalyakranam 7
8 D. apy aktam, s.m. apy ayuktam 0 9 D. encircles the initial a of anirmoksa . 10 D. parikalpyeta, s.m. parikalpyate 11 All the Mss read samyognityatvd. 12 K. and P.: anyataraja D. anyataraja, s.m. anyatarakarmaja 13 D. sannidhimtrasmd, s.m. sannidhimtrasmnyd 14

10

15

20

25

30

D. tasyjnnn, s.m. tasya jnnn

D. samyogo parikalpyaivam, s.m. samyogam parikalpyaivam

184

YUKTIDIPIKA

drstir darsanam / arthasabdo 1 nimittavacanah / darsanam artho 'syasau darsanrthah / darsananimitto darsanahetur darsanakrana ity arthah / etad uktam bhavati: sannidhnvisese sati 2 tmana ksdes ca yasmd drksaktiyuktah purusas tasmt kryakranatm 3 pannena pradhnena saha bhoktrtvena sambadhyate ncaitanyd 4 ksdaya iti / athavrthasabdah phalavacano yath trptyarth bhujikriy / trptau satym nivartate / prptyarth gamikriy prptau 5 satym / evam purusasya pradhnena darsanrthah samyogah darsane 6 sati nivartate / tath ca vaksyati drst mayety upeksaka eko drstham ity uparataik / (SK66ab)

10

iti / ha: evam api sabddyupalabdhisamaklam eva nivrttiprasangah / kirn kranam / tasym apy avasthym sakyam vaktum drst prakrtir iti / ucyate: yady apy etad evam tathpi yath purusasya darsanrthah samyo/

15

KAIVALYRTHAS TATH PRADHNASYA / (SK21b) kaivalyam iti vivekaparicchinnam sattvdibhir asamsargadharmitvam tmanah, so 'rtho ?sya7, so 'y a m kaivalyrthah / saty api hi darsanvisese pradhnam purusasya kaivalyrtham pravartate / yadsya buddhis tamaso 'hgitvd ye gunh kryarppannh sirahpnydaya dhytmik bhys ca gavdayah k<a>ranarppanns 8 clocanakriysamkalpbhimndhyavasyalaksanh so 'harn 9 ity avisistapratyayopasamhram karoti tad pravartata eva / yad tv anye gunh prakrtibht vikrabhth kryabhth k<a>ranabht 10 acetanh parrth anyo 'harn na prakrtir na vikrtir na kryam na k<a>ranam11 ncetanah 12 svrtha iti bhinnapratyayopasamhram karoti tad nivartate / so ' y a m purusasya drksaktinimittah pradhnasya ca kaivalyvadhiparicchinnah purusrthah / saty api pribhsikatve PANGVANDHAVAD UBHAYOR API SAMYOGAH / (SK21cd') etad uktam bhavati: prg api kryakaranasambandht 13 puruse caitanyam avasthitam <...> tadyath agner dahanam parasos chedanam <ca>(?) asati dhye 14 chedye ca na vyajyate / tatsannidhnasamaklam eva tu vyajyata ity
X D. arthadarsanam sabdo, s.m. arthasabdo 2 D. sati, s.m. 'pi sati 3 D. kryakranatm, s.m. kryakranatm 4 D. ncaitanyd, s.m. na caitanyd 5 D. gamikriyprptau 6 D. ca(l) darsane, s.m. darsane 7 D. 'rthasya 8 All the Mss read kranarppanns. 9 Dkha. so 'yarn 10 All the Mss read kranabht. 11 All the Mss read kranam. 12 All the Mss read na cetanah. We follow Raghavan. 13 K. and P.: kryakrana0 D. kryakrana0, s.m. kryakarana0 14

20

25

30

K. and P.: bhye D. bhye, s.m. dhye

PANCAMAM AHNIKAM SK21

185

atah pradhnam apeksate / tath pradhnam apy antarena purusopakram svakry<>samartham1 anispannakryasamam ceti <tad>2 anarthakam syd ity atah purusam apeksate / tatra yasv anayor 3 itaretarpeks tarn samyogam adhikrabandham hur cryh / parigvandhadrstntas tu nntariyakamtrapradarsanrtham 4 / yath pangur nntarenndham drksakty visistenrthenrthavn bhavaty andhas ca nntarena pangum gamanasakty 5 visistenrthena, evam pradhnam nntarena purusam krtam api kryam drastum saktam anavadhikam ca pravartamnam visesbhvn naiva nivartate / tath purusah saty api cetanatve nntarena 6 pradhnam upalabhybhvd 7 upalabdh bhaved iti pradhnam apeksate / tasmd itaretarpeksay samyoge 8 kalpyamne 9 yad uktam vin sargena bandho hi purusasya na yujyate / sargas tasyaiva moksrtham aho smkhyasya sktat / / iti tad ayuktam / kasmt / na hy asau vin sargena na yujyata iti / ha ca drsyadarsanabhvena prakrteh purusasya ca / apeks sstratattvajfiair
10

10

15

bandha ity abhidhiyate / /

evam vinpi sargena yasmd baddhah 11 pumn gunaih / tasmd viphalatm ytu manorathimanorathah / / iti siddhah samyogah / TATKRTAH SARGAH / / (SK21d?) pradhnapurusayor hi bhoktrbhogyabhvpeksanimitto 'yam tattvasargo mahaddir bhvasargas ca dharmdir bhtasargas ca brhmdih 12 pravartate / s 13 cpekspurusnantyn 14 na nivartata ity ato 'rthavatmm hi prakrtinm tadaparisampter na nivrttir asti 1 5 / 20

and D.: svakaryasamartham P. svakad asamartham K. and P.: tarn D. anispannakryasamam cetitam, s.m. anispannam asamcetam(?) We follow Raghavan. 3 P. svvayor(l) 4 D. nntariyakamtrapra0, s.m. nntariyakatpra0 5 K. and P. omit gamanasakty. Dkha. gamanasakty D. adds gamanasakty in the left margin. 6 D. cetanatvenntarena, s.m. cetanatve nntarena 7 D. upalabhytrabhvd(l), s.m. upalabhybhvd 8 K. and P.: samyogatve D. samyogatve, s.m. samyoge 9 P. kalpamne 10 D. sstratattvajfiair, s.m. $ stras attvajnair U P. bandhah 12 D. brhmdih 13 D. s, s.m. sa 14 D. encircles purusnanty. 15 Dkha. tad api sampter anivrttir asti

J K. 2

186

YUKTIDIPIKA

iti yuktidipikayam 1 saptatipaddhatau pancamam ahnikam dvitiyam ca prakaranam /

P. snyuktidipikayam

S a s t a m a m

A h n i k a m

evam karanantarapratisedhat prakrteh purusartho ' y a m vyaktabhavena viparinma iti sthitam / tatrednim vipratipattir crynm / kecid huh pradhnd anirdesyasvarpam tattvntaram utpadyate tato mahn iti / patanjalipancdhikaranavrsagannm tu pradhnn mahn utpadyata iti / tadanyesm purnetihsapranetfnm mahato >hamk<ra>1 <utpadyate / patanjales tu naivhamkro> vidyata iti pakso mahato 'smipratyayakartrtvbhyupagamt / aharnkrt panca tanmtrniti sarve / m ah at ah sad avisesh srjyante panca tanmtrny ahamkras ceti vindhyavsimatam / tathhamkrd indriynlti sarve / bhautiknlndriynlti pancdhikaranamatam / ekarpni tanmtrnity anye, ekottarniti vrsaganyah / indriyni samskravisesayogt parigrhitarpmti kecit, paricchinnaparimnnity apare, vibhnlti vindhyavsimatam / adhikaranam api kecit trayodasavidham huh, ekdasakam iti vindhyavsi / tathnyesm mahati sarvrthopalabdhih, manasi 2 vindhyavsinah / samkalpbhimndhyavasyanntvam anyesm, ekatvam vindhyavsinah / tath karanam nirlikhitasvarpam snyagrmanadikalpam / prkrtavaikrtikni tu jiinni prerakngasangrhitni pradhnd gacchanti ceti pancdhikaranah 3 , na tu tathety anye / k<a>rannm4 mahati svabhvtivrttih pradhnt svalp ca svata iti vrsaganyah, sarv svata iti patanjalih, sarv parat a iti pancdhikaranah / buddhih ksaniketi <eke>5, klntarvasthyinity apare / evam anekaniscayesv cryesu ye tvat 6 pradhnamahator antarle tattvntaram icchanti tatpratiksepycryah svamatam upanyasyati

10

15

20

PRAKRTER MAHAN / (SK22a') prakrter mahan utpadyate / mahan buddhir matir brahma purtih 7 khyatir lsvaro vikhara iti paryyh / sa tu desamahattvt klamahattvc ca mahn / sarvotpdyebhyo mahparimnayuktatvn 8 mahn / anyasya tu pakse naivhamkro vidyata iti tatpratisedhavivaksayedam ha

25

l PA\ the Mss read 'hamkaro. 2 D. mahasi, s.m. manasi 3 D. pancdhikarani, s.m. pancdhikaranah 4 All the Mss read krannm. We follow Chakravarti. 5 All the Mss read ca. 6 D. etvat instead of ye tvat 7

K. and D.: ptih recte. mahattaraparimnayuktatvn(?)

188

YUKTIDIPIKA TATO 'HAMKRAH / (SK22a'b')

tasmn mahato 'hamkra utpadyate / yah punar ha(187.8) mahatah sad avisesh srjyante pancatanmtrny ahamkras ceti tannirsrtham ha 5 TASMD GANAS CA SODASAKAH / (SK22b') tasmd ahamkrt sodasako gana utpadyate / pafica tanmtrny ekdasendriyni ca / anenaiva ca bhautikendriyavdi pratiksipto boddhavyah / TASMD API SODASAKT PANCABHYAH PANCA BHTNI / / (SK22cd) 10 tasmd api sodasakd gand yah paficako ganas tatah panca mah&bhtny utpadyante / prvapadalopentra mahbhtnlti vaktavye bhtnity ucyate / bhtasamjn hi tanmtrnm na prthivydlnm / atra tu smkhycrynm avipratipattih / bhtakautasthyavdinas 1 tu mimmsak rhats ca / tatpratiksepenedam ucyata|ti^//22// ha: uktam pradhnd buddhir utpadyata iti / tatra vaktavyam kimlaksan punar buddhir iti / ucyate: ADHYAVASYO BUDDHIH / (SK23a) ko ' y a m adhyavasyah j gaur evyam purusa evyam iti yah pratyayo niscayo 'rthagrahanam so 'dhyavasyah / atra ksanikavdy ha: yady arthagrahanam buddhir anity / kasmt / hetvapeksant / arthagrahanam hindriydivisayasannidhnam varandyabhvam cpeksate na ca nityasya kranpeksopapadyate / tasmd anity buddhih / abhivyakter adosa iti cet / syd etat / nendriyasannidhndibhir arthagrahanam janyate / kirn tarhi / abhivyajyata iti / tac ca naivam dvidh dost / s hy abhivyaktih svarpalbho v syt grahanapratibandhavyudso v / kirn ctah / tad yadi tvat svarpalbhah <na> kriyate 'rthagrahanam iti prptam / <atha> grahanapratibandhasyndhakrasya 2 vyudsah / tad apy ayuktam / vipratisedht / grahanam ca syt tatpratibandhas ceti vipratisiddham / kirn ca bhedt / vyangyam hi ghatdi candrrkausadhimaniratnapradipabhedn [na] bhidyate / asti buddhinm arthabhedd bhedah / vrttibhedd adoso mrdvad iti cet / syn matam / yath mrddravyasya ghatdisamsthnavrttibhede 'py abheda evam buddher iti / tad apy ayuktam ananyatvt / yad buddhir anany vrttibhyah prptas tadbhede buddhibhedah / kirn ca drstntsiddheh / sdhyam caitat kirn tad eva mrddravyam ghatdivrttibhedam anubhavati, hosvit pratyayntaravasd anyac cnyac cotpadyata iti / avayavabhedc
J 2

15

20

25

30

35

D. bhutakausta(7), s.m. bhutakautasthya vadinas All the Mss read arthagrahana0.

SASTHAM AHNIKAM SK22,23

189

copetya vnuvrttim brmo na hi tad ekam mrddravyam / kim tarhi / bahavo mrtparamnavo 'nekadesvacchinnavrttaya iti / kim cnyat / vrttivibhaktigrahant 1 / tad dhi mrddravyam samsthnam apeksypi grhyate na tv arthagrahanam anapeksya buddher grahanam asti / tasmd visamo drstntah / parinmd adosa iti cet / syn matam / sattvdlnm angngibhvaniyamt tena tenrthagrahantman viparinmo vrttir iti / etac cyuktam ubhayakalpane dosaprasangt / yadi dharmntaropdnaparitygau vyaktyavyakti dattottara esa paksah(111.16) / atha nsotpdau tena dharmadharminor ananyatvd dharmnm nsotpdd buddher api nsotpdaprasangah / tadanabhyupagame vnyatvam iti dosah / ha ca nastotpannam ananyatvd anityam nityam eva v / nastotpannvinastnm nityam no nsti 2 caikad / / yad apy uktam(189.5) sattvdlnm angngibhvaniyamd iti tad ayuktam / ata evnityatvasiddhes tulynm gunapradhnabhvnupapatteh / sattvdlnm anghgibhvbhyupagamd vrddhiksayv abhyupagantavyau / tat as ca buddhir anityeti prptam tebhyo 'nanyatvt / atha matam tadavasthpy asau nityeti, na tarhi sattvdytmabht buddhir iti prptam / tatas ca kryakranayor aviveka3 ity asya virodhah / tasmd anity buddhir iti / ucyate: yat tvad uktam(188.21) hetvapeksand anity buddhir iti tad ayuktam / kasmt / siddhasdhant / kasytra vipratipattir anity v buddhih syn nity veti / kim tarhi / "hetumad anityam vyaktam"(SK lOa'd') iti vacand anityaiva / tasmd istam evaitat sangrhitam / ata eva ksanikatvam iti cet / athpi syt / hetvapeks hi samskrtatvam / samskrtam ca ksanikam tadyath pradipa iti / tasmd anitye saty api visesnabhidhne ksanikatvam evnena hetun buddheh pratipdyata iti / <tad ayuktam /> kasmt / uttaravacanavirodhaprasaiigt / evam api yad uttara<m> ksanikatvaprasiddhyartham 4 ucyate pratyarthagrahananyatvd anityetydi(188.20f.) tasynarthakyam / tasmt prvottaraviruddhatvt sakalam evedam prakaranam ndhyayanam na prakhynam 5 arhati / paresm tv abhinivist buddhir atrety asangatrthottarpavdadosam anapeksypi r^ ty^kam^agy^ etad asdhanam / vrttivisayatvt / svakranaparinispanny hi buddher 6 vypro 'rthagrahanasamjnaka indriydisannidhnpekso na buddhih / tadananyatvt prasang<>nivrttir 7 iti cet / atha matam / vrttivrttimator ananyatvd ittham api kalpayitvyam prasango na nivartate / tath coktam "svlaksanyam vrttis trayasya"(SK29ab') iti / tad apy abdhakam / kasmt / upacrt / satyam anany vrttir vrttimato 8 bhedengrahant / tathpy uparatavyprasypi parasvder vrttimatah svarpam
X K., P. and D.: nivrttivibhakti0 Dkha. vrttivibhakti0 2 D. nastotpann vinastnm nityam no nsti, s.m. nastotpann 3 D. avivek 4 All the Mss read uttaraksanika0. We follow Pandeya. 5 P. pratykhynam 6 D. nispany buddher, s.m. nispany hi buddher 7 AU the Mss read prasanganivrttir. We follow Pandeya. 8

10

15

20

25

30

35

vinastajam nityam nn 'sti

P. vrttivrttimator instead of vrttir vrttimato

190

YUKTIDIPIKA

10

15

20

25

noparamatiti bhedam upacarya vyavaharo 1 nanakaryavisayah pravartate / ata evanyatv<a>prasanga 2 iti cet / syd etat / yato vrttyuparame vrttimato 'nuparamah kryanntvam cta evnyatvam api syd iti / tad ayuktam <an>ekntt 3 / tadyath senpanktisenkundaldyuparame na tatsannivesinm uparamah kryabhedas ca / na cnyatvam / evam vrttitadvator api ca syt / tasmd yuktam etad dhetvapeksanasya vrttivisayatvn na buddher <n>ityatvam4 iti / etena vyaktivikalpah pratyuktah / so 'pi vrttivisaya iti krtv / <yad>5 apy uktam (188.29) indriydibhede bhedd iti tad apy anenaiva <praty>uktam(?) 6 vrttibhedo 'tra na <vrttimad>bheda7 iti / <... / > kirn ca a n e k n tat / yathodakdibhedt pratibimbabhedo na ca <vya>hgyatvam8 evam anyatrpi syt / dravyntarotpatter adosa iti cet / syn matam / udakasynanasamyogd dravyntaram eva pratibimbalaksanam utpadyate / na tu mukham bhidyata iti / asad etat / kasmt / ubhayoh kranatvena kalpannupapatteh / na hi mukham nimittam sakyam vaktum viprakrstatvn nbdayo 9 mukhpagame 'py upalabdhiprasangt pkajavat / <yat> punar etad uktam(188.31) vrttibhedd adoso mrdvad iti tath tad astu / yat tktam (188.33) ananyatvd drstntsiddhes ceti vrttyananyatvam idnim eva pratyuktam / ksanabhangapratisedhe coktam na prthvydlnm anyath cnyathcotpattih / yat punar etad uktam(189.1) naikam mrddravyam 10 iti / tatra buddhih pramnam / yad ekabuddhinimittam tad ekam / tatra yadi mrdo 'nekatvena prayojanam buddhir upalabhyate . ^ ^ j ^ a m j t i ^ / yat punar etad uktam(189.3) mrddravyasya sarnsthnavyatirekena svabhvo 'vadhryate na tu buddher arthagrahanam antarena svarpagrahanam iti tad ayuktam / <sva>bhvasyrpatvt 11 / upetya v yath bhydyavasthsu vykr cittasantatih / vidyate bijamtr vas tath dhir iti grhyatm / / yath bhyrthkrava<ti> 12 cittasantatih, atha ca suptamrchitavirodhasampannnm artharpd rte bijamtrstity upagamyate, scit<t>ikpi13 vvastheti vacann na ca grhyate, tath buddhir apiti kasmn na parikalpyate / yat punar etad uktam(189.7) yadi dharmntaropdnaparitygau vyaktyavyakti dattottara esa paksa iti tad itaratra tulyam / asmbhir api tarhy
X D. upacaryavyavahro, s.m. upacarya vyavaharo 2 A11 the Mss read evnyatvprasatiga. We follow Pandeya. 3 All the Mss read ekntt. 4 All the Mss read anityatvam. 5 A11 the Mss read tad. We follow Raghavan. 6 All the Mss read anenaivoktam. 7 A11 the Mss read bheda. 8 9 P. not clear. 10 D. prthivyam 11 All the Mss read 12 All the Mss read 13

30

All the Mss read cvyangyatvam.

abhva0. kravac. All the Mss read s citi kpi.

SASTHAM HNIKAM SK23

191

asatkryapratykhyne dattottara esa pakso vyaktir na kriyata iti (121.9) / nsotpdau tv anistv eveti na parihram praty darah kriyate / yad apy uktam(189.11) nastd utpannc cnastam anutpannam 1 cnyan nastlti tad ayuktam / anabhyupagamt / nsotpdau kah pratijnite yam praty etad arthavat syt / kirn ca tvatpaksaprpteh / bhavata eva nastotpannebhyah skan<dh>ebhyo2 nny santatir atha ca nsti dosah / kaypi yukty syd etad anyaivsv iti / tatas caik santatir iti hinam / yad apy uktam(189.15) gunavrddhiksaye 'nityatvam 3 iti tad anupapannam / kasmt / rpntarpyyant / sattvam hi prakarsam anubhavad rajastamasl ca nynatm dharmdirpam buddher pyyayanti nrthntaram kurvanti no khalv apy abhvam / evam rajas tamo v prakarsam anubhavat sattvam ca nynatm adharmdirpam 4 buddher pyyayanti nrthntaram kurvanti nbhvam / evam gunavrddhiksaye 'pi rpntarpyyann nsti ksayo buddheh / tatra yad uktam(188.21) hetvapeksand anity buddhir ity etad ayuktam / yat punar etad uktam(189.27) pratya<rtha>grahannyatvt 5 pratiksanam dipditailadhrsu sabdabhedc ca ksanikety atra brmah: grahannyatve coktam vrttibhedo na vrttimadbheda <iti> / kirn cnyat / bhinnrthagrahanaikatvt / upetya v brmah: yadi pratyartham anyad anyad grahanam kalpyate vikalpabdhasamuccayasamsayadvitvtisayanivranesu tath kalmsam sabalam citram ity an^kTtharajn^ekam grahanam na syt / drstam tat / tasmn nyam ksanikatve hetuh / evam avasthitam idam adhyavasyo buddhir na ca ksaniketi / buddhes tu triguntmakatvt tasya tasya gunasya prakarse tat tad rpntaram utpadyata iti / ha: kasya gunasya prakarse buddheh kimlaksanam rpntaram upajyata iti / ucyate: DHARMO JNNAM VIRGA AISVARYAM / STTVIKAM ETAD RPAM / (SK23bc) atra tv etad rpam iti saty api dharmdibhede buddhir ity abhedavivaksvisaya ekavacananirdesah kriyate / etad uktam bhavati: yad rajastamasl vasam 6 pdya buddhigatam sattvam utkrstam bhavati tad dharmo jiinam virga aisvaryam ity etad rpam bhavati / tatra srutismrtivihitnm karmanm anusthnd buddhyavasthah 7 sattvvayava sayabhto dharma ity ucyate / sa tu dvividhah / brahmdisthnesv abhipretasarirendriyavisayopabhogani<r>vartako8 jnndyahgabhtas ca prathamah / agnihotrahavandikriynusthnasdhano yamaniyamasdhanah <ca> itarah / tatrhims satyam aste1 D. utpannarn 2 All the Mss read 3 D. nityatvam 4 All the Mss read 5

10

15

20

25

30

35

skandebhyo. We follow Chakravarti.

nynatdharmdi0 . We follow Raghavan. K. and P.: pratyaksagrahannyatvt D. grahannyatv 6 D. vasyam 7 D. buddhyavasth 8 All the Mss read bhoganivartako. We follow Raghavan.

192

YUKTIDIPIKA

10

yam akalkata brahmacaryam iti pafica yam ah (cf.YS.2.30) / akrodho gurususrs saucam hralghavam apramda iti pafica niyamh 1 / etesm avilo pennusthnd yater evamvidhottarane sattvadharma sayatm pratipadyate yo jnndlnm rpnm pyyanam karoti / et ad abhyudayanihsreyasayoh sopnabhtam prathamam parva 2 yatryam avasthito 3 yatir itaresm parvanm anusthne yogyo bhavati / jhnam dvividham sabddyupalabdhilaksanam gunapurusntaropalabdhilaksanam ca / tatra sabddyupalabdhilaksanam pratyaksnumngamarpam 4 / gunapurusntaropalabdhilaksanam ca dvividham aprvam abhysajam ca 5 / tayor aprvam "hah sabdo 'dhyayanam"(SK51a) iti siddhikndnupatitni pramnni / abhysajam punar vairgyaparvvajayaprsthalabdham sntam amalam dhruvam sakalabhavbhavapratipaksabhtam / yad cryo vaksyati evam tattvbhysn nsmi na me nham ity aparisesam / aviparyayd visuddham kevalam utpadyate jnnam //(SK64) iti /

15

20

25

30

virgas tu rgapratipaksabhto jnnbhysopajanito buddheh prasdah / tasya tu yatamnavyatirekaikendriyavasikralaksans 6 catasro Vasth bhavanti / tatrendriynm visaybhilsalaksanakasyapcanam prati yah prayatna utshah s yatamnasamjn / yatamnako hy ayam asmin parvany avasthito yatir bhavati / yad tu kesmcid indriynm paripakvam s vyatirekasamjii / vyatiricyante hi tad yater indriyni paripakvny aparipakvebhyo visistatarni bhavantity arthah / viparipakvasarvendriyas 7 tu samkalpamtrvasthitakasyo yad bhavati tadaikendriyasamjfi / nivrttasarvendriyavisayecchasya yater ekam eva manolaksanam indriyam tad <p>aripakvam8 bhavati / samkalpamtrvasthitasypi 9 paripko vasikrasamjii / samkalpamlocchinnavisayamrgatrsno hy ayam 10 yatir 11 indriynm antahkaranasya ca pravrttinivrttyor iste / ekgra ekrmo 'vidyparvano 'tikrntah parasya brahmanah praty anantaro bhavati / tad evam caturavastham vairgyaparva vijflya tadanusthnya 12 yatih prayateta / tasyopyo drstnusravikavisayapratykhyne ya upadisto(SKld) yas ca tustisu vaksyamnas (SK50) tarn ekikrtyottarottarm tattvabhmim vijiinasya visaylkurvan prvasym tattvabhmau madhyasthah syt /
X

D. treats akrodho gurususrusa saucam hralghavam apramda as a verse, and, adding thre dots after apramda, starts a new line with iti. 2 D. patha, s.m. parva 3 D. avasthitau(l), s.m. avasthito 4 D. praksnumn0, s.m. praktyasnumn0 5 D. writes and erases ca. 6 K.and0P.: yatamnavyatireka ekendriyavasikravasikralaksans D. yatamana0, s.m. yatamna Dkha. yatamnendriyavasikralaksans 7 D. encircles vi of viparipakva0. 8 K. and P.: tad 'paripakvam D. tad aparipakvam We follow Chakravarti. 9 Dkha. samkalpamtrasypi 10 Dkha. hrdayam n D . iti 12 K. and P.: tadanusthya

SASTHAM AHNIKAM SK23

193

aisvaryam apratightalaksanam / <t>atx punar astavidham anim mahim laghim garim prptih prkmyam Isitvam vasitvam2 yatrakmvasyitvam iti / tatrnim 3 mahim laghim garimeti bhtavaisesikam / buddhes tu prptydi / evam etac caturvidham mahatah sttvikam rpam 4 iti / ha: atha gunntararpam kirn / ucyate: TMASAM ASMD VIPARYASTAM / (SK23d) etad^ asmd dharmdeh sattvarpd viparyastam tmasam tamahprakarsopajanitam ity arthah / atra sstracoditnusthnd 5 sayanispannasattvvayavo dharma ity uktam / sstracoditasya 6 nityasya karmano 'nanusthnd 7 buddhyavasthas tamo'vayava sayatm pratipanno 'dharmah 8 / sa cpi dvividhah / anistasarirendriyavisayopabhoganirvartakah 9 khytivrakas ca / yath ca jfinam dvividham sabddyupalabdhilaksanam gunapurusntaropalabdhilaksanam caivam ajiinam api viparyayena vcyam / yath ca caturavastham vairgyam tathyatamndikas caturavastho rgo yath cstagunam aisvaryam animdi tathstagunam anaisvaryam / evam etat tmasam mahato rpam / yac caitad adharmdinimittabhtam utkrstam tamorpam tad rajas sahvirodhd 10 ekatm ivpannam asuddhir ity cryaih pathyate / sattvarpam tu praksa ity anayos cbhidhnd yah paficdhikaranapaksah prkrtavaikrtnm jnnnm pradhn<c>11 chuskanadisthniyntahkarane bhye ca prerakajnnmsakakrta upaniptah / tath sttyjka^thrty^j^ iti tat pratiksiptam bhavati / kirn kranam / yasmd asuddhir eva praksam alam atipravrttam 13 nivartayitum 14 ^rakars^a^m^n^bh^ ca pravartayitum 16 iti / evam astarp buddhir vykhyt / yas tv asv anantaram ukto 17 'hamkras tarn vykhysymah / / 2 3 / / ha: yady evam tasmd idam eva tvad ucyatm kirn asyhamkrasya laksanam iti /
1 A\\ the Mss read yat. 2 D. vasitvam ap?(?), s.m. vasitvam 3 K. and P.: atrnim 4 D. omits 0rpam. 5 D. ssva (?), s.m. sstra0 6 D. 6stratroditasya(l), s.m. sstracoditasya 7

10

15

20

25

P. first wrongly writes nispannasattvvayavo, and then corrects it to read nityasya karmano 'na-. The previous editors insert ca after nityasya. 8 P. dharmah D. encircles the avagraha of 'dharmah. 9 P. nivartakah D. nivartakah, s.m. nirvartakah 10 P. mahvirodhd 11 All the Mss read pradhnavac. 12 Dkha. sttvikam ity tmakrtam apratyayasthvasthnam 13 D. praksamana matipravrttam(l), s.m. praksam alam atipravrttam 14 Dkha. yasmd asuddhir eva malamatipravartanivarta(yitum) 15 Dkha. (pann) nyagbht D. pannnybht, s.m. pann nyagbht 16 Dkha. pravartayitur 17 D. anantarmukto

194 ucyate:

YUKTIDIPIKA

ABHIMNO 'HAMKRAH / (SK24a) kartuh svtmapratyavamarstmako yo ' y a m aham iti pratyaya utpadyate sa khalv ahamkrah / mahatas tattvntaram / kasmt / tasya sarvavisaydhyavasyarpatvt, asya tu 1 svtmapratyavamarsa<rpatv>t 2 / na tv arthntaram / kasmt / prakrtivikrayor ananyatvbhyupagamt / na hi nah prakrter arthntarabhto vikra iti prg vistarena pratipditam(109.12ff.) / sa ca mrtipratyaybhym mahatah sthlatarah / kasmt / avibhgt / vibhg<>nispatteh3 kldivat / trigunasya ca mahato vikratvd asv api trigunah / kasmt / prakrtirpasya 4 vikre drstatvt tantupatavat / tadbhvasannivists 5 tu ye sattvdayas 6 ta cryair vaikrikataijasabhtdisabdenkhyyante / tath ca sstram ha "etasmd dhi mahata tmana ime traya 7 tmnah srjyante vaikrikataijasabhtdayo 'hamkralaksanh / aham ity evaism smnyalaksanam 8 bhavati / gunapravrttau ca punar visesalaksanam 9 " iti / ha: k punar gunapravrttir yasym asmipratyayaikarpasyhamkrasya visesapratipattir bhavatlti / ucyate: yo ' y a m TASMD DVIVIDHAH PRAVARTATE SARGAH / (SK24b) 20 dvividha, indriyalaksanas tanmtralaksanas ca s gunapravrttir ity ucyate / kasmt / tatkryatvt / gunapravrttikryo hi sargah / drsyate [sa]10 ca khalu loke krye kranam 11 upacaryamnam 12 tadyath slin bhuhkta iti / ha: prg uktam (188.6) ahamkrt sodasako gana utpadyate / idnim 13 punar ucyate "tasmd dvividhah pravartate sargah"(SK24b) / tad idam prvottaravyghtd ayuktam iti / ucyate: na s m n y e n a vivaksitatvt / abhedavivaksym hi krtv kryakranalaksanam evam asmbhir upadistam dvividhah sarga iti / bhedavivaksym punah AINDRIYA EKDASAKAS T<>NMTRAH14 PANCAKAS CAIVA / / (SK24cd)
2 A11 the Mss read svtmapratyavamarSt 3 All the Mss read vibhganispatteh. 4 D. prakrtirpasya, s.m. prakrtivirpasya 5 0 D. tadbhda , s.m. tadbhna0(?) 6 Dkha. taddhtusannivists tu ye tattvdayas 7 Dkha. ime tu ye 8 D. smnyalaksanam, s.m. smnyam laksanam 9 Dkha. punar avisesalaksanam 10 All the Mss read sa. We follow Pandeya. 11 D. krye kranam, s.m. krane kryam 12 D. mnam, s.m. mnah 13 D. indicates a lacuna before idnim. 14

10

15

25

ca

All the Mss read tanmtrah. We follow Pandeya.

SASTHAM HNIKAM SK24,25

195

indriynm ayam aindriyah / ekdasa parimnam asya ekdasakah / evam tanmtresu vaktavyam / tanmtrnm sabdasparsdinm ayam tnmtrah sargah / paiicakas ca panca parimnam 1 asyeti(cf.Pn.5.1.57) pancakah / asya tu sodasakasya vikrasya samjnlaksanaprayojanny uttaratra vaksyati (SK25ff.) / es gunapravrttir vykhyt yasym asmipratyayasya visesagrahanam bhavati sabde 'ham sparse 'hamrpe 'ham rase 'hamgandhe 'ham iti (cf.Mth.onSK24; TSV.p.76.1)/ ha: ahamkre sattvdlnm samjnntarvacanam narthakyt / yad idam ahamkre sattvdlnm samjnntaram rabhyate vaikrikas taijaso bhtdir iti tan na vaktavyam / kasmt / narthakyt / na hi tattvntarasannivesinm sattvdlnm samjfintarbhidhne kimcit prayojanam asti [iti] / samjnbhyastvt / athyam nirbandhas tattvnta<re> 2 samjnntaram vaktavyam / evam sati 3 tattvabhyastvt samjnbhyastvam prpnoti / prayojanbhidhnam va visistayatnnm ankasmikatvt / athav prayojanam vaktavyam evamartham ahamkre samjiintarbhidhnam iti / kasmt / na hi visistayatnnm kasmikatvam upapadyata iti / ucyate: na kryavisesahetutvt / mahaddilaksannm hi gunnm anekarpas tattvrambha iti [hi] na samjnntaram 4 rabhyate / ahamkras tu sattvatamobahulayor indriyatanmtraparvanoh prakrtih / tadartham crynm yatnavisesah / dharmdivisesbhyupagamn mahati p r a s a n g a iti cen na visesitatvt / tattvntarrambha iti visesitam / na tu dharmdayas tattvntaram / ato na mahati prasangah / v i s e s n a b h i d h n d ayuktam iti cet / syd etat / kah punar atra viseso yena dharmdi na tattvntaram tattvntaram tu srotrditi / e t a c ca naivam / kutah / vrttimtre tadupacrt / vrttimtre hi mahato dharmdyupacrah / tath ca tantrntare 'py uktam "praksavrttir dharmah" iti / vrttinispditas tu samsthnaviseso vrttimatas tattvntaram ity anayor visesah / tasmd yuktam etat kryavisesahetutvam iti / / 2 4 / / ha: yady evam idam tarhi vaktavyam amusya 5 kryavisesasyaivam samjnakd ahamkrt pravrttir iti / ucyate: STTVIKA EKDASAKAH PRAVARTATE VAIKRTD AHAMKRT / (SK25ab) sarga ity anuvartate / ekdasendriyni sattvabahulni vaikrtd ahamkrt pravartante nispadyanta ity arthah / ekdasbhidhnd eva cendriyapratitih purvastre tatsmndhikaranyt 6 / ato na punar indriyagrahanam /
1 2 All the Mss read ntaram. 3 D. evam mati, s.m. evam sati Dkha. evam 4 Dkha. ity ato na samjnntaram 5 Dkha. tarhi vaktavyam avasyam amusya 6

10

15

20

25

30

35

D. pancakas ca parimanam, s.m. paiicakas ca panca parimnam sati

P. dhikranyt

196

YUKTIDIPIKA aha: tanmatrasargah punah kimgunah kasmac cahamkarat 1 pravartata

iti / ucyate: BHTDES TNMTRAH SA TMASAH / (SK25cd') 5 bhtder bhtdisamjnakt tamahpradhnt tnmtrah sargah / tnmtras tu tamobahulo bhtdisamjnakd ahamkrt pravartate / tatra punas tanmtragrahant samkhy sasyata 2 iti nocyate / ha: prakrtivisesanirdesnarthakyam / prg uktam(194.11) sattvdinm ahamkrvasthitnm vaikrikdyh 3 samjfi ucyante <iti> / tad yadi sattvam vaikrikasabdenocyate vaikrik<c>4 caindriya ekdasakah sargah pravartata ity ukte gamyata etat sttviko 'sau, bhtdes tnmtra ity ukte gamyata etat tmasa iti / kasmt / na hy asti sambhavo yat sattvt tamobahulah sargah syt tamasas ca sattvabahula iti / ucyate: na aprasiddhatvajnpant / yasyaivrthasya <aprasiddhis tasya> jfipanrtham evam iha kriyate / katham gamyate / sattvam vaikrikasabdenocyate tamo bhtdisabdena / rajas taijasasabdena / aprasiddhrth hi tntrikl paribhseyam anirnit na gamyata iti / ha: taijasasamjnnarthakyam iti / ucyate: na TAIJASD UBHAYAM / / (SK25d') ubhayatra tatsmarthyt / syd etad evam yady asya kryasmarthyam eva na syt / asmt tu taijasd 5 ubhayam apy etat tanmtrendriyasamjfiakam pravartata ity anuvartate / katham / yad hi vaikriko 'hamkra indriyabhvena pravartate tad niskriyatvt taijasam pravartakatvenknksati, bhtdi bhedakatvena / kasmt / tenaiva tadbhedt 6 / tadyathgnir agnau praksipto 'gnir eva bhavaty po vpsu praksipt pa eva bhavanty evam sattvam eva sattve na 7 bhedam janayati / gunntarasamsargam apeksate / bhtdilaksanasya tu tamasah samsargd bhidyamnam taijasena ca rajas kriytmakennugrhitam ekdasendriyabhvam 8 padyate 9 / tath bhtdilaksanam tamo 'hamkrt tanmtrabhvena pravartamnam pravrttyartham taijasam knksati vaikrikam bheda<ka>tvena 10 / kasmt / tenaiva tasya bhedd 11 iti yojyam / sstram caivam ha a tad etasmin vaikrike chamkrah D. samkhym sasyata, s.m. samkhy sasyata Dkha. sasyata D. corrects sasyata of Dkha. into sasyata. 3 D. vaikryakdyh 4 All the Mss read vaikrikni. 5 0 D. asmt taija , s.m. asmt tu taija0 6 K. and D.: tenaivaitad abhedd P. tenaiva tad abhedd We follow Pandeya. 7 A11 the Mss read sattvena. The previous editors write sattvena and sattve tu respectively. We follow the interpretation suggested by Raghavan. 8 D. grhitame ek(7), s.m. grhitam ek 9 K., P. and D.: apeksate Dkha. padyate 10 All the Mss read bhedatvena. We follow Raghavan. 11 K. and P.: tenaiva tasybhedd D. tenaivaitasya bhedd We follow Chakravarti.
X D. 2

10

15

20

25

30

SASTHAM HNIKAM SK25,26

197

sraksyamna esa bhtdis taijasenopastabdha etam vaikrikam abhidhvati / tathaiva tasmin bhtdau sraksyamna esa <vaikrikas>1 taijasenopastabdha etam bhtdim abhibhavati 2 " iti / anena nyyena taijasd ubhayanispattih / iti vykhyto 'hamkrah / / 2 5 / / ha: prg apadista 3 aindriya "ekdasakah pravartate vaikrtd ahamkrt" (SK25a'b) iti / tat smnybhidhnn na pratipadymahe / tasmd vaktavyam knmdriyni bhavato 'bhipretni / ucyate: dvividhnindriyni buddhindriyni karmendriyni ca / tatra BUDDHINDRIYNI KARNATVAKCAKSRASANANSIKKHYNI / (SK26ab) karnau tvak caksusl ca rasanam ca nsik ca karnatvakcaksrasanansikh / khynam khy pratyyanam ity arthah / etaih sabdair khy yesm tnimni karnatvakcaksrasanansikkhyni / adhisthnabhedd dvivacanena vigrahah kriyate / etni buddhindriyni pratyavagantavyni / buddher indriyni buddhindriyni / <ha:> kirn punar etni buddher iti / ucyate: sabddivisayapratipattau dvram / kasmt / abahirvrttitvt / antahkaranasya nsti bahirvrttir ity ato 4 nlam etat sksc chabddin arthn pratipattum / tasmc chrotrdilaksanam sksdbhyavisayapraksanasamartham k<a>ranntaram 5 apeksate / tatpranlikay tasy visayagrahanam / tasmd yuktam uktam buddher bhyavisayapratipattau dvrabhtatvd 6 buddhindriyniti / ha: karmendriyni punah kniti / < ucyate :> VKPNIPDAPYPASTHH KARMENDRIYNY HUH //(SK26cd) vk ca pni ca pdau ca pyus copasthas ca vkpnipdapypasthh / etni karmendriyny hur caksate / karmrthnindriyni karmendriyni / kirn punah karma / vacandi vaksyamnam / etad dhi kurvantiti karmendriyni / ha: katham etad upalabhyate 'dhisthnd arthntarabhtnmdriyni na punar adhisthnamtram iti / ucyate: adhisthnd indriyaprthaktvam saktivisesopalambhat / yath sarirsambhavino visayavyavasyalaksanasya saktivisesasyopalambhd arthntaram buddhir 7 anumiyata evam adhisthnsambhavino visayagrahanalaksanasya saktivisesasyopalambhd arthntaram indriyam iti /
X A11 the Mss read bhtdis. 2 D. abhibhavati, s.m. abhidhvati 3 Dkha. prg upadista 4 D. iti tyato, s.m. ity ato 5 All the Mss read kranntaram. 6 D. dvrabhtd, s.m. dvrabhtatvd 7

10

15

20

25

30

K. and P.: arthntarabuddhir

198

YUKTIDIPIKA

10

15

20

25

aha: na asambhavasiddheh / adhisthanamatrasya visayagrahanam na sambhavaty arthntarasya ca sambhavatlty etad ubhayam api cprasiddham iti / ucyate: naitad aprasiddham tulyajtlyesu tadanupapatteh / yasmd bhautikesv anyesu ghatdisu visayagrahanasmarthyam 1 nopalabhyate bhautikam ca sravanabildyadhisthnam ato manymahe tasypi visayagrahanasmarthysambhavah /<...> <a> hamkravikra< t vt>2 tatsmarthypratisedhn nendriynm nas tatpratisedho 'numtavya iti / etac cyuktam / kasmt / saktibhed<nu>papatteh 3 / vaikrikam4 sattvam hamkrikam praksarpam, tacchaktivisesd indriyni notpadyante / bhtdilaksanasya 5 tamasah smarthyt tanmtrni / gaiasya? prthivydlnm ekarpatvt / tasmd ayam asamah samdhir iti / etena bhautikatvam pratyuktam^ 1 )/ ha: bhavatu 7 tvad idam abhautikatvam indriynm / idam tu katham avagamyate bahmndriyni na punar ekam evendriyam manovat sarvrtham 8 anekdhisthnam syd iti 9 / ucyate: na yugapatpravrttyapravrttiprasangt / yady ekam evendriyam manovat sarvrtham anekdhisthnam syd, ekavisayapratipattau v sarvavisayapratipattih <...> / drstas tu 1 0 grahanabhedah / tasmn naikam indriyam iti / bhautikair anugrahopaghtadarsand indriynm bhautikatvani iti cet / syn matam / iha bhautiknm ghatdlnm bhautikair mrddandacakrastrodakamudgardibhir 11 anugrahopaghto drsto yadi ca bhautiknindriyni na syuh / naism bhautikair anjandibhir anugrahah kriyata upaghtas ca rajahprabhrtibhir iti / e t a c c y u k t a m / kasmt / anekntt / tadyath bhautikair vadandibhir 12 antahkaranasya grahanadhranasmrtilaksano 'nugrahah kriyata upaghtas copaldibhir na csya bhautikatvam evam indriyasypi syt / vaisesikagunavyafijakatvd vikrapratltir iti cet / atha matam / prthivydivaisesiko gandho ghrnenbhivyajyata audako raso rasanena ca, gneyam rpam vlksa1

K. and P. omit rthyam nopalabhyate bhautikam ... tasypi visayagrahanasma, which D. adds in the right margin. 2 K. and P.: hamkravikravat D. ahamkravikravat K. has a mark like L before of ham0. 3 All the Mss read saktibhedpatteh. 4 K. vai .. krikam 5 D. bhtaldi0, s.m. bhtdi0 6 recte. tasya? 7 K., P. and D. omit bhavatu ... idam tu. This portion is found in Dkha. (cf.p.l99,fn.4.) 8 D. savrtham 9 D. anekdhisthnam iti, s.m. anekdhisthnam syd iti 10 Dkha. khapustake drstas tu0 ity asmt strd anantaram yath ghatdinm ity rabhya mantavya ity ant ah ptho maulah na tu paryyarpah (cf.p.l98,fn.(l)) 11 P. mrddandcakra0 12 D. vadandibhir, s.m. vacandibhir

(1)(pratyuktam) yatha ghatadinam bhautikanam visayagrahakatvad adhisthanasyendriyatvam pratisiddham evam esm agrhakatvd indriynm bhautikatvapratisedhah krto mantavyah / / (K.89b, D.259 without number)

SASTAMAM HNIKAM SK26,27

199

nena 1 , vyaviyah sparsastvac, ksiyah sabdah srotrena / yena ca yasya vaisesikagunbhivyaktis tasya tadvikratvam drstam tadyath pradipasya rpbhivyanjakatve sati taijasatvam 2 iti / etac cnupapannam / kasmt / anistaprasangt / vaisesikagunavyanjaknm tadvikratvam 3 icchatah prptam apm gandhbhivyaktihetutvt prthivatvam / athaitad anistam na tarhy aikntiko hetur iti / tatra yad uktam(199.2) vaisesikagunbhivyanjakatvd bhautiknindriymty etad ayuktam 4 / / 2 6 / / ha: ekdasendriyny ahamkrd utpadyanta iti prg apadistam(195. 34) / idnim buddhindriyakarmendriyni daspadisyante / tad idam padrthanynam iti / ucyate: syd etad evam yady etvad indriyaparva syt / kirn tarhiti SAMKALPAKAM ATRA MANAH / (SK27a) atrendriyaparvani mano bhavadbhih pratyavagantavyam / tatra samkalpakam iti laksanam caksmahe / samkalpo 'bhilsa icch trsnetydy 5 anarthntaram / samkalpayatiti samkalpakam 6 / etan manaso laksanam / tasmd asya pratyaksato 'nupalabhyamnasystitvam avasiyate / kasmt / vyastasamastnm indriyntarnm tadasambhavt / apohya hi manah samkalpam vyastnm indriyntarnm bhavn parikalpayet samastnm v / kirn ctah / tan na tvad vyastnm indriynm samkalpo bhavati / kirn kranam / aniyatavisayatvt / niyato 7 hi srotrdlnm sabddir visayah / aniyatavisayas 8 ca samkalpah / kirn ca triklavisayatvt / vartamnavisay srotrdivrttih / triklavisayas ca samkalpah / tasmn na vyastnm / npi samastnm / badhirdisu tadabhvaprasangt / yadi samastendriyavrttih samkalpah <anyataravaikalye tadabhvah(?) > syt / prndivad iti cet / syn matam / yath samastendriyavrttih prndayo na cnyataravaikalye tadabhva evam samastendriyavrttih samkalpah syn na cnyataravaikalye tadabhvah syd iti / etac cnupapannam visesitatvt / nirvisayprndivrttih sabddivisayas tu samkalpa iti visesitam / tasmd vyastasamastnm indriynm samkalpnupapatter manaso Ungarn etad astitva iti siddham / ha: tad avadhranlyam indriyadvaividhyt / dviprakrni hindriyni purastd upadistni (197.8) / tatra mano 'py avadhramyam kirn buddhindriyam atha karmendriyam iti /
J D. 2 D. 3

10

15

20

25

30

viksanena, s.m. hiksanena taijasam, s.m. taijasatvam K. and P.: tadvikritvam D. tadvikratvam, s.m. tadvikritvam Dkha. tadvikratvam 4 After ayuktam D. inserts the following passage: ha bhavatu tvad idam abhautikatvam indriynm idam tu katham avagamyate bahny etni na punar ekam evendriyam manovat sarvrtham anendhisthnam syd iti, ucyate na yugapatpratipattyapratifpra?)sangt yady ekam evendriyam manovat sarvrtham anekrthdhisthnam syd ekavisayapratipattau v sarvavisayapratipattir drstas tu grahanabhedas tasmn naikam indriyam iti / iti khapustakasthah ptho 'dhiko drsyate 5 P. icch tyasyetydy(l) 6 P. sakalpakam 7 D. niyato, s.m. aniyato 8 D. aniyata0 D. encircles the initial a of aniyata0.

200 ucyate:

YUKTIDIPIKA

TAC CENDRIYAM UBHAYATH SAMKHYTAM / (SK27b) hyarthe cah pathitah / tad dhlndriyam 1 ubhayathety arthah / mano na kevalam buddhindriyam api tu karmendriyam api / niyamahetvabhvd ayuktam iti cet / syt punar etat / ko 'tra niyamahetur yad indriyatvvisese manasa evobhayapracratvam abhyupagamyate nnyesm iti / ucyate: ANTAS TRIKLAVISAYAM TASMD UBHAYAPRACRAM TAT / / (SK27cd) 10 [triklavisayatvd] iha yasyntas trisu ca klesu karanasya vrttis tad ubhayapracram tadyath buddhih / sksd 2 visaynabhisandhnd atitngatavartamnavisayatvc ca mano 'ntas tnkala.visa.yam tasmd ubhayapracram ta.d iti siddham//27// iti 3 yuktidipikym smkhyasaptatipaddhatau 4 sastham hnikam /

2 D. 3 P. 4

D. tad dhindriyam, s.m. tad buddhindriyam karmendriyam Dkha. tad buddhmdriyam (D. corrects tad buddhindriyam into tad buddhindriyam karmendriyam.) sksd, s.m. sksd api omits iti. P. smsaptatipaddhatau

S a p t a m a m

A h n i k a m

samadhigatam karanaparva / tasyedanim vyastasamastavrttayo vaktavyah / sati cobhaybhidhne vyastavrttir eva tvad ucyate na samastavrttih / kim kranam / prakaranasesabhtatvt / srotrdinm hi sadbhvaprakaranam idam anukrntam / sa caism sadbhvah saktivisesop<a>lambhd1 ity uktam / idnim asau saktiviseso 'smkam vyastavrttir ity ucyate / tasmt tadanukramanam karisymah / ha: yady evam tasmd ucyatm kasya2 karanasya kasminn arthe vrttih kimlaksan 3 veti / ucyate: yad uktam kasya4 kasminn arthe vrttir ity atra brmah: RPDISU PANCNM LOCANAMTRAM ISYATE VRTTIH / (SK28ab) rpdisu sabdasparsarparasagandhesu svabhedabhinnesu pancnm srotrat vakcaksurj ihvghr nnm^1) sravanasparsanadarsanarasanaghr nalaksano vypro vrttir ity ucyate / tatra karananirdese srotrendriyasya prkptht tadvisayanirdestilahghane prayojanam nstiti krtv sabddisu pancnm ity eva pathitavyam / prktanas tu pramdapthah / yat punar etad uktam(201.9) kimlaksanety atra brmah: locanamtram isyate / locanam grahanam 5 ity anarthntaram 6 / mtrasabdo visesanivrttyarthas tadyath bhaiksamtram 7 asmin grme labhyata ity ukte nnyo visesa iti jfiyate, chandomtram adhlte mnavaka ity ukte nnyad adhita iti / evam locanamtram indriynm isyate 8 vrttir ity ukte nnyo visesa iti gamyate / tena kim siddham bhavati / yad uktam anyair cryaih "smnyajnnam indriynm visesajnnam buddheh" iti tat pratisiddham bhavati / All the Mss read saktivisesoplambhd. D. sadbhvah saktiviseso0, s.m. sadbhavayukti0 viseso 2 K., P. and D: tasya Dkha. kasya 3 P. kimlaksan D. kirn laksan 4 K. and P.: tasya D. tasya, s.m. kasya 5 D. locanagrahanam, s.m. locanam grahanam 6 D. arthntaram 7 D. bhaiksyamtram 8 Dkha. manyate D. deletes manyate of Dkha.
1

10

15

20

(tvak-) sparsanam iti vaktavye tvaggrahanam upacarat prayuktam paficah krosantitivat tadadhisthnatvam darsayitum / smoty aneneti srotram caste 'neneti caksur jighraty aneneti ghrnam / / (K91a, D.263 without number)

202

YUKTIDIPIKA

10

15

20

25

30

aha: kah punar asmin darsane doso yata etat pratisidhyata iti / ucyate: smnyavisesayor itaretarpeksatve saty ekasminn avirodhd anyataraparikalpannarthakyam / yadi khalv indriyasya smnyajnnam syt 1 tena visespeksam smnyam smnypeksas ca visesa iti yatra smnyajnnam tatra visesajnnam api na pratisidhyata ity ubhayam aplndriyasya syt / tatas cntahkaranaparikalpannarthakyam / visesavato vntahkaranasya kah smnyena virodha ity ubhayasypi tatra sambhavd indriynarthakyam / tasmd apratyayam indriyam iti / kirn ca svavisaytiprasangt 2 / indriyasya cet pratyayah syd yath pratyayavato 'ntahkaranasyniyatavisayatvam evam asypi syt / na tu tad asti / tasmd apratyayam indriyam iti / kirn ca kltivrttiprasangt 3 / indriyasya cet pratyayah syd yath pratyayavato 'ntahkaranasya triklavisayatvam evam asypi syt / na tu tad asti / tasmd apratyayam indriyam iti / kirn cnyat / smrtyadarsant 4 / indriyasya cet pratyayah syd yath pratyayavato 5 'ntahkaranasya <smrti>rpopapattir6 evam atrpi syt / na tu tad asti / tasmd apratyayam indriyam siddham 7 / ha: bhavatu tvad apratyayam indriyam / tat tu grahanarpam na tu praksakam pradipavad ity atra ko hetur iti / ucyate: na k<a>ranntaraprasangt 8 / yadi pradipavad indriyam praksakam syt tena yath tatpraksitesu ghatdisv arthesu karanntaramrganam 9 evam atrpi syt / na caitad istam / ato na pradipavad indriyam praksakam iti / antahkaranasadbhvd ayuktam iti cet / syn matam / asti karanntaram 10 buddhilaksanam yad indriyena pradlpavat praksitam artham grhnti / tasmt paravdnuvdo ' y a m kriyate 11 na pratisedha iti 1 2 / tac ca naivam / kasmt / pradlpendriyayor anyatarnupdnaprasangt / indriyam api praksakam pradipo 'pi / tatrnyatarasynupdnam prasaktam / kasmt / na hy ekrthakrinor 13 yugapatkarane 14 smarthyam astiti / kirn cnyat / antahkaranahneh / indriyena pradlpavat 15 praksitn bhyn arthn sksd antahkaranam grhntiti vadato 'ntahkaranam eva hiyate / tasmd ayuktam antahkaranasya grahanasmarthyam / purusasyeti cen na karannarthakyaprasangt / sksd visayagrahanasamartham purusam icchatah karannarthakyam prasajyate / tasmd yuktam et ad grhaand P.: na syt D. puts na of na syt in parentheses. and P. omit kirn ca svavisaytiprasangt, which D. adds in the right margin. adds kirn ca kltivrttiprasangt ....tasmd apratyayam indriyam iti in the bottom margin. smrtidarsant After pratyayavato D. goes back to 'ntahkaranasyniyatavisayatvam(202.9), and after it repeats the same phrase and reads pratyayato in the repeated phrase instead of pratyayavato. 6 All the Mss read 'ntahkaranasydirpopapattir. 7 D. siddham iti. 8 All the Mss read 0kranntara0. We follow Raghavan. 9 D. kranntara 10 Dkha. kranam 11 D. vdo kriyate, s.m. vdo 'yam kriyate 12 D. pratisedhayati 13 P. krino 14 Dkha. yugapatkalpane 15 D. indriye pradipavat, s.m. indriyena pradlpavat
l K. 2 K. 3 D. 4 D. 5

SAPTAMAM AHNIKAM SK28

203

kam indriyam na tu pradipavat praksakam iti / ha: bhavatu tvad grahanamtram indriyavrttir apratyay / grahanapratyayapraksnm idnim ko bhedah / ucyate: visayasamparkt tdrpypattir indriyavrtti<r> grahan a m 1 / tath visayendriyavrttyanukrena niscayo gaur ayam suklo dhvatity evamdih pratyayah / tath visayasamparkpagame srotrdivrttes tdrpypagamo <iti> vartamnaklat grahanasya / anubhavt tu samskrdhnam tatprvik ca smrtir iti triklavisayat 2 pratyayasyety ayam 3 anayor visesah / bhyas tu prakso na visayarppannah / samskrt tu ghatdinm vyavadhnarpam prthivam chylaksanam dharmam apahatya vyafijakatvya kalpate caksuso4 'nugrahyobhayor v caksurvisayayor ity apare / tasmd upapannam etat praksakam pradipdi grhakam srotrdi vyavasyakam antahkaranam iti / [ha 5 : atha karmendriynm k vrttir iti / ucyate 6 ] naiyyiks tv evam huh "ghrnarasanacaksustvaksrotrnindriyni 7 bhtebhyah8"(cf.NS.1.1.12) <iti> / bhtebhya ity anena svavisayopalabdhilaksanatvam hlndriynm bhtaprakrtitve sati nirvahati 9 nnyath / <bh>tni(?)10 punar indriyakranni / prthivyaptejo vyur ksam iti bhtni(cf.NS.1.1.13) / ebhyah pancabhyo yathsamkhyam ghrnarasanacaksustvaksrotrni pancendriyni bhavanti / bhtaprakrtitvam iti bhtasvabhvam vykhyyamnam paficasv api sambhavati / bhtakranatvam tv anyesu catursu tathaiva / srotre tu kathamcit karnasaskulyavacchinnanabhobhgbhipryena vyavahratah 11 samarthaniyam / evam bhautiknindriyni svasvavisayam adhigantum utsahanta iti 12 tallaksanatvam esm sidhyatity ato bhtebhya ity uktam / etat tu smkhycrynm nestam / evam hi smkhyavrddh huh "hamkriknlndriyny artham sdhayitum arhanti nnyath" <iti > / tath hi krakam krakatvd eva prpyakri bhavati / bhautikni cendriyni 13 katham prpyakrini dravartini visaye bhaveyuh / hamkriknm tu tesm vypakatvd visaykraparinmtmik vrttir vrttimato 'nany sati sambhavaty eveti suvacam prpyakritvam / api ca mahadanugrahanam 14 hamkrikatve tesm kalpate na bhautikatve / bhautikatve hi yatparimnam <graha>nam15 tatparimnam grhyam 16 grhniyt <iti> (see NM.part2,p.49.5-10) / A\\ the Mss read indriyavrttigrahanam. We follow Raghavan. K., P. and D.: triklavisay Dkha. triklavisayat 3 D. pratyayasya treyam 4 D. caksusor 5 K., P. and D. omit ha. Dkha. ha D. deletes ha of Dkha. 6 D. ute, s.m. ucyate 7 D. ghrtiarasanacaksutvaksrotr0 8 D. omits bhtebhyah. 9 P. nirdhahati 10 All the Mss read am. 11 D. vyavahrat 12 D. omits iti. 13 D. bhautiknindriyni, s.m. bhautikni cendriyni 14 D. mahadanugrahanam 15 All the Mss read karanam. 16 D. writes and erases karana before grhyam.
1

10

15

20

25

30

204

YUKTIDIPIKA aha: atha karmendriyanm ka vrttir iti / ucyate: VACANDNAVIHARANOTSARGNANDS CA PANCNM / (SK28cd)

10

15

vkpnipdapypasthnm tu vacandnaviharanotsargnanda\aksa,n, yathkramam vrttayah pratyavagantavyh / tatrocyate 'nena(cf.Pn.3.3.117) iti vacanam / tasmd ya evrthapratyyanasamartho varnasamudyah padavkyaslokagranthalaksanah sa vgindriyasyrtho nnyah / dlyate 'nenety dnam 1 / an abhividhyarthe 2 (cf.Pn.2.1.13) prayujyate / tatas ca yad eva prakslanaparimrjanopasparsandhyayanapraharanasilpavyymdikrtsnamgrahanam sa indriyrtho nnyah / [evam utkrstah sarga utsarga] visistam haranam viharanam / atas ca yad eva samavisamanimnonnatacahkramanaparivartanantyavyymdih sa indriyrtho nnyah / evam utkrstah sarga utsargah / atas ca ya evsitapltaviparinmasya samyaksroto mrgnusrino visargah sa indriyrtho nnyah / evam <api vypya nandanam) 3 nandah / tatas ca ya evsdhranapritinayanbhinispattilaksanah 4 sa indriyrtho nnyah / ittham 5 upasargaprayogenrthavisesasya karmendriyavrttitvena parigrahc charlrapradesntarsdh<ra>nakriyvisesasamp<rn>ni6 santi karmendriymti nirdist srotrdivrttih <...> / / 2 8 / / ha: prg antahkaranavrttinirdesah sargakramnugamt / prvam buddhyahamkramanasm vrttinirdesah kartavyah / kirn kranam / evam hi sargakramo 'nugato bhavati / kramabhede v prayojanam vaktavyam iti / ucyate: na indriyavrttiprvakatvt / antahkaranasya hindriyavrttiprvakah pratyayah / tath ca vaksyati drste tathpy adrste trayasya 7 tatprvik vrttih / (SK30cd)

20

25

iti / tasmt sargakramam atilanghya 8 tannirdesah prg cryena kriyata iti / ha: tadasambhavah sstre prgabhimnbhidhnt / sstram 9 hy evam ha "k nu bhoh samjn mtur udare Vasthitam kumram pratyabhinivisata 10 iti / asmity es mhtmi samvid iti / tath kryak<a>ranavyhasamaklam 11 mhtmyasariro 'smiti pratibudhyate / pravrtts <cbhi>vyakt(?)12
1 D. dhanam 2 D. abhidhyarthe, s.m. abhividhyarthe 3 All the Mss read abhivypynandanam. 4 D. ivsdhranapritinayanbhi0 5 6

K., P. and D. omit ittham ... nirdist srotrdivrttih.(204.16-18) The passage beginning with ittham is supplied by Dkha. D. reads kha pustakt prito 'yam bhgah after srotrdivrttih. Dkha. charirapradesntarsdhanakriyvisesasampjitni D. corrects sdhana0 into sdhrana0. We follow the emendation suggested by D. 7 D. 'tra yasya 8 K., P. and D.: sargakramena vin Dkha. sargakramam atilanghya 9 Dkha. sstre 10 P. pratyabhinirvisata D. pratyabhinivesata, s.m. pratyabhinivisata 11 All the Mss read kryakrana0. 12 All the Mss read caiva hy avyakt.

SAPTAMAM AHNIKAM SK28,29

205

bhavanty asmity asmitmtrh" <iti> / pramnam ca sstram / tasmt prg antahkarananirdesah kartavyah / ucyate: <na> tannimitt<atv>ena 1 vivaksitatvt / satyam etat kryak<a>ranavyhanispattisamaklam 2 asmity es mhtmi samvit pratyupadhiyate 3 / sabddivisayas tv antahkaranapratyayah srotrdinimitta ity etat prvasabdena vivaksitam / na ca nimittam atikramya naimittikbhidhnam nyyyam 4 / athav naiva vayam idam 5 prastavy 6 yath prg antahkaranavrttinirdesah kartavya iti / kirn kranam / yasmt SVLAKSANYAM VRTTIS TRAYASYA7/ (SK29ab') svalaksanam 8 eva svlaksanyam / svrthe taddhitavrttih "<nyabhvyam>9 tu klasabdavyavyt 10 " (Vr.ll on Sivastra 1, MBhsy a. I.18.5) iti yath / buddhyahamkramanasm 11 hi sauksmyn na sakyam svarpam abhidhtum ity ato vrttir eva laksanabhvenopadisyate / srotrdinm api ca sauksmyl laksanam apadestum asakyam iti vrttir evocyate na laksanam / tad eva caism laksanam bhavati / yac chabdlocanasamartham tac chrotram / evam itaresv api vaktavyam / buddhyahamkramanasm ca laksanam adhyavasydy uktam / tad eva vrttitvencaksnah srotrdinm eva <sabddylocanam>12 laksanam cpy caksno vrttivrttimator ananyatvam 13 jnpayati / anyath 14 tu yath vyavasydi laksanam evam rpdisu pancnm locanamtram laksanam ity ucyate, na tu vrttir iti / srotrdivadbuddhydlnm api vyavasydayo vrttir ity ucyate na tu laksanam / tasmd anyath nirdeso jnpakam vrttivrttimator <an>anyatvasyeti15 vykhyt karanavrttih / SAIS BHAVATY ASMNY / (SK29b') seti prvakrtm vrttim abhisambadhnti / eseti sarvanmn pratykrstm tm eva pratyaksam pratinirdisati / bhavatiti vaksyamnena dharmntarensys tadvattnubhvitvam khypayati / asmnyeti dharmam caste / smny sdhranety arthah / na smnysmny / pratikaranam niyatety uktam bhavati / y hiyam anukrnt kara^a^ary^no^'dhyavasydik vrttir iyam vyastnm karannm pratisvam niyat / tatas caism buddhydinm kryavisesanimittabhvasamscitasya svarpasysamkarah siddhah /
1 All the Mss read tannimittarthena. 2 All the Mss read kryakrana0. 3 D. pratyupadiyate 4 K. and P.: nyyam 5 D. naivedam, s.m. naiva vayam idam 6 D. prastavyah 7 D. vrttitrasyasya 8 D. svalanam, s.m. svalaksanam 9 K. and P.: anyabhvas D. anybhvas 10 Dkha. vyavasyd 11 D. manmsi, s.m. manasm 12

10

15

20

25

30

All the Mss read cbhidadhnam. D. vrttimato 'nanyatvam 14 D. has an unclear letter before anyath. All the Mss read anyatvasyeti. We follow Raghavan.

206

YUKTIDIPIKA

aha: samanyavisesayor itaretarapeksatvad asamanyabhidhanena 1 samanyasypy abhidhnd adhyavasydik karannm asmny vrttir ity ukte 'rthd pannam esm smnypi vrttir astiti / tasmd asv api vaktavyeti / ucyate: 5 SMNYAKARANAVRTTIH PRNDY VYAVAH PANCA / / (SK29cd) smny csau karanavrttis <ca> smnyakaranavrttih / prna dyo yesm te prndyh prnpnasamnodnavynh panca <vyavah (?)> samastakaranavrttih pratyavagantavyeti / taih sarvaih sahitah 2 prna iti vedntesv api / ha: ayuktam etat / kasmt / dharmino dharmyantaravrttibhvnupapatteh / vrttir ity ayam sabdo vypram caste / na ca dharmyantaram dharmyantarasya vypro bhavitum arhatiti / ucyate: na krye 3 kranopacrt / satyam etad dharmi dharmyantarasya vrttitvensakyah parikalpayitum / kirn tu smnyakaranavrtty preryamno vyus tatpravanatvt tatkryatm pratipadyate / tatra prndikrye vyau prnopacram krtvaivam ucyate prndy vyavah panca <iti> / tatpreransiddher ayuktam iti cet / syd etat / katham etad avagamyate 'rthntarapreritasya vyor iyam kriy bhavati na punah svatantrasyeti / ucyate na svatas tadvyatiriktatvnupapatteh 4 / iheyam <aneka>bhinn5 kriy vyoh svato v syt karanavrttivyatiriktd v / kirn ctah / tan na tvat svata upapadyate / kasmt / sarvatra prasangt / svbhvike hi vyor diksamcre 6 'bhyupagamyamne sarvatra tatsambhavah syt / tatas ca tiryakptdivrttir hanyeta / na cnyatah / kasmt / adarsant / na hi prthivydinm vyupreranasmarthyam kvacid upalabdham / bhastrdisu drstam iti cen na anyanimittatvt / atrpi caitravypra upalabhyata ity avasyam anyan nimittam upalabhyata ity abhyupagantavyam / tmeti cen na kriypratisedht / upapditam etat prvam(180.3) tm niskriya iti / na ca niskriyasya preranam upapadyate / na ca nirnimitt 7 svabhvabhednm ankasmikatvt / tasmd yat tannimittam s samastakaranavrttih / sa cyam vyur eka eva sthnasamcravisesn 8 nnkhyo bhavati yathaiko devadattah pcako lvaka iti kvacit / tad ayuktam / kasmt / yugapatparaspartisayavirodht / prvasmt prvasmd uttara uttaro vyur baliyn iti hy abhyupagamah / tad etad ekasyaikasmin kle nopapadyate / tasmd upapannam prndy vyavah panca / kirn punar esm prndmm laksanam iti / ucyate: dvividhh prndayah / antarvrttayo bahirvrttayas ca / tatra mukhansikbhym pragamant pranates ca prnah / yo ' y a m mukhansikbhym samcarati so 'ntarvrttir 9 vyuh prna ity abhidhiyate / y kcit
X K. and D.: asmnybhidhne 2 D. sahit 3 D. kryena D. puts na of kryena in parentheses. 4 D. tadvyatiriktnupapatteh 5 All the Mss read akasmd bhinn. 6 D. vyor diksamcre, s.m. vyor bhinnadiksamcre 7 D. nirnimittah 8 D. visesah 9

10

15

20

25

30

35

D. santo vrttir, s.m. so 'ntarvrttir

SAPTAMAM AHNIKAM SK29

207

pranatir nma bhtesu tadyath pranateyam sen, pranato ' y a m vrksah, pranato ' y a m dharme, pranato ' y a m arthe, pranato 'yam kme, pranato 'yam vidyym, tadviparitesu v bhyaprnavrttir es / prn<a>visaya1 evais<a>2 bhavati / sa khalv ayam atrbhivyakto bhavati tadyath mahat v duhkhenbhiplutasya mahat v bandhun viyuktasya sahitasya v saurabheyasya nipnvatlrnasya v mahisasya / avagater 3 apakramanc cpnah / yo ' y a m rasam dhtn sukram mtram purisam 4 vtrtavagarbhrns ckarsann adhogacchann ayam antarvrttir vyur apna ity abhidhiyate / yac cpi kimcid apakramanam nma bhtesu tadyathpakrnto 'yam dharmdibhyas tadviparitebhyo veti bhy khalv apnavrttir es / apnavisaya evaisa bhavati / balavattaras cyam prnd vyoh / kasmt / es<a>5 hy etam prnam rdhvam vartamnam arvg 6 eva sanniyacchati, arvg 7 eva sannirunaddhi / <sa caiso>8 'trbhivyakto bhavati / tadyathpakpam upasvabhram v parivartamna<sypakrntih (?)> satapadim 9 langhayatah / hrdy avasthnt sahabhvc ca samnah 10 / yas tv ayam prnpnayor madhye hrdy avatisthate sa 11 samno vyur antarvrttih / yas cpi kascit sahabhvo nma bhtesu [dvandvrmat] 12 tadyath saha dsye, saha yaksye, saha tapas carisymi, saha bhryputrair bandhubhih suhrdbhis ca vartisya iti bhy samnavrttir es / samnavisaya evaisa bhavati / balavattarah khalv ayam prnpnbhym / esa hy etau prnpnv rdhvam avk 13 ca vartamnau madhya eva sanniyacchati, madhya eva sannirunaddhi / sa caiso 'trbhivyakto bhavati / tadyath srutasrasya v srameyasya. anaduho vodhali^jnnLaDnitaDtaya yaiuaKayan _ aranargnaKayam saKasaKetii nte sarvapraninam pranapanav utsrjyordhvam adhas ca muktayoktrau hayav iva visamam samcrayan sariram sa 16 parsyati / mrdhrohand tmotkarsanc 17 codnah / yas tv ayam prnpnasamnnm sthnny atikramya rasam dhtms cdya mrdhnam rohati tatas ca pratihato nivrttah sthnakarannupradnavisesd varnapadavkyaslokagranthalaksanasya sabdasybhivyaktinimittam bhavaty ayam antarvrttir 18 vyur udna ity ucyate / yas cpi kascid tmotkarso nma bhtesu tadyath hind
X A11 the Mss read pranivisaya. We follow Raghavan. 2 All the Mss read evaisa. 3 D. vvagateh recte: apagateh(1) 4 P. purirtsam 5 All the Mss read es. 6 D. arvg, s.m. avg 7 D. arvg, s.m. avg 8 All the Mss read eso. 9 K. and P.: parivartamnasy ... satapadim D. parivartamnasyham 10 D. ca samnah, s.m. ca sa samnah 11 D. omits a. 12 D. dvandvmatah 13 D. arvk, s.m. avk 16 17 Dkha. 18

10

15

20

25

30

satapadim

D. omits a. mrdhrohant samkarsanc P. antavrttir

208

YUKTIDIPIKA

10

15

20

asmi sreyan, sadrsena va sadrsah, sadrsad asmi sreyan, sreyasa va sadrsah 1 , sreyaso v sreyn2 etasmims tathrpbhimno v prptavidyasya 3 tadyath bahvantaravisesd 4 alpntaraviseso 'smi, agunavato v gunavn asmlti bhyodnavrttir 5 es / udnavisaya evaisa6 bhavati / balavattarah khalv ayam prvebhyah / katham / esa hy etn prndm rdhvam avn 7 madhye ca vartamnn rdhvam evonnayati, rdhvam evotkarsati / sa caiso 'trbhivyakto bhavati sltodakena v paryuksitasya prsam asim vikosam codyatam 8 abhipasyatah / sarlravypter atyantvinbhvc ca vynah / yas tv ayam lomanakhc chariram vypya rasdinm dhtnm prthivydlnm vyham marmanm ca praspandanam prndinm ca sthitim karoti so 'ntarvrttir vynah / yas cpi kascid atyantvinbhvo 9 nma bhtesu tadyath pativrat bhartram mrtam apy anugacchati bhavntare 'py ayam eva bhart syt tath dharmdibhis tadviparltais ceti <bhy vynavrttir es> 10 / vynavisaya evaisa bhavati 1 1 / balavattamas cyam sarvebhyah / katham / anena hi vypte sariradandake tadvaslkrtnm prndinm samsthitir bhavati / sa eso 'ntakle prnabhrtm avinbhvena 12 vartamno 'bhivyajyate tadyath h tarhi pdau <h imau>(?) 13 sltibhtau gulphe janghe r katir udaram urah kanthe 'sya <ghuru>ghuro14 vartate h ity evaiso15 bhyo vyna iti / evam ete prndyh sthnakryavisesascith panca vyavo vykhyth / tesm prerik smnyakaranavrttih / es ca tantrntaresu prayatna ity ucyate / sa ca dharmdisamskrabhvanvasd anuparato jivanam / ha ca vrttir 16 antah samastnm karannm pradipavat / agraks^kriyrp jivanam kyadhrik / /

25

s yvad aniruddh tu hanti vyum rajo'dhik 17 / dharmdyajivrttiyast 18 tvaj jivati mnavah / / atra ca smnyakaranavrttigrahanasmarthyt prndyh panca vyavah, buddhindriyni sastham, karmendriyni saptamam, pur astamam / pur ity
X D. vsadrsah 2 D. vsreyn 3 P. prptavidyas tu D, prptavidyasva, s.m. prptavidyasya 4 Dkha. visesa$ya 5 D. bhya udnavrttir 6 D. evaitad 7 D. arvn 8 D. coditam 9 D. atyavinbhvo, s.m. atyantvinbhvo 10 All theMss read bhyo. 11 P. prabhavati 12 D. bhrtm avinbhvena, s.m. bhrtrn vinbhvena 13 K. he 'sau P. hesau D. hemau, s.m. himau 14 All the Mss read khuraghuro. We follow Chakravarti. 15 D. huyate vaiso 16 D. first treats the following verses as prose, which is then corrected 17 D. rajodik 18

into verses.

D. dharmdin vrttivast

SAPTAMAM AHNIKAM SK29 ahamkrvasthsamvidam adhikurute / yasmd 1 ha tatra

209

samvid ahamkragat<>2 kryam k<a>ranam <ca>3 prayati yasmt / tasmt pur ity 4 ukt pratyavabhsstamam bhoktuh / / s chamkragat samvid buddhigataiva purusenopalabhyate / yasmd 5 vaksyati ete pradipakalph parasparavilaksan gunavisesh / krtsnam purusasyrtham praksya buddhau 7 prayacchanti //(SK36) sarvam praty upabhogam yasmt purusasya sdhayati buddhih / (SK37ab) tasmt saiva pur 8 iti / sstram caivam ha "prnpnasamnodnavynh panca vyavah, sastham manah, saptami 9 ph, astami 10 vk" <iti> / vggrahanena karmendriyaparvano grahanam manograhanena buddhindriyaparvanah / tad etat prnsta<k>am 11 vaikrikam gunasarlrasya paridrastuh ksetrajfiasya sarlram dadnasya nityam stambhasthniyam pratyangam bhavaty acchedyam abhedyam adhyam avinsyam avikampyam 12 / anityni punar bhautikni bhyni sanrni kusamrttiksthnlyny upaciyante ceti / ha: kutah punar iyam prndivrttih pravartata iti / ucyate: s karmayonibhyah / mahatah pracyutam hi rajo vikrtam andasthniyh paiica karmayonayo bhavanti dhrtih sraddh sukh vividisvividiseti / ha ca pracyuto mahato yas tu na prpto jnnalaksanam / vypro jfinayonitvt s yonih kukkutndavat / / tsm laksanavisayasatattvagunasamanvay bhavanti / tatra laksanam tvad vyavasyd apracyavanam dhrtih / phalam anabhisandhya sstroktesu kryesv avasyakartavyatbijabhvah 13 sraddh / drstnusravikaphalbhilsadvrako 14 hi buddher bhogah sukh / vettum icch vividis / tannivrttir avividis / tatra yadyam jantuh subhsubhesu kryesu vrttyanusri jijnsur ajijnsur v sarlram parityajati tm eva karmayonim upapadyate / tasym upapannas tm eva bhvayati / etat tval laksanasatattvam / ha ca
1 D. tasmd 2 All the Mss read ahamkragatam. 3 A11 the Mss read kranam instead of k<a>ranam <ca>. 4 D. prayaty, s.m. pur ity 5 D. bhyate na yasmd, s.m. bhyate yasmd 6 D. ete, s.m. te te 7 D. praksabuddhau 8 D. treats tasmt saiva ph as a beginning of a lost verse. 9 D. saptame 10 D. astame 11 All the Mss read prnstamam. We follow Chakravarti. 12 D. avikalpyam, s.m. avikampyam 13 D. avasyakartavyat bijabhvah 14 6

10

15

20

25

30

D. bhilsadhrako

210

YUKTIDIPIKA vaci karmani 1 samkalpe pratijnam yo <'nu>raksati 2 / tannisthas tatpratijiias 3 ca dhrter etad dhi laksanam / / (see TSV.p.82.15-16) anasy brahmacaryam yajanam yjanam tapah /

dnam pratigrahah saucam sraddhy laksanam smrtam / / (see TSV.p.82.17-18) sukhrthl yas 4 tu seveta vidym karma tapmsi v / pryascittaparo nityam sukhym sa tu vartate / / (see TSV.p.82.19-20; MBh.App.I.No,29b,145ff)

10

dvitvaikatvaprthaktvam nityam cetanam acetanam sksmam / satkryam asatkryam vividisitavyam5 vividisyh / / (see TSV.p.82.23-24) visapltasuptamattavad avividis dhyninm sad yonih / kryakaranaksayakari prkrtik<a>gatih7 samkhyt / /
6

15

visayasatattvam punah sarvavisayinl dhrtih, sramavisayini sraddh, drstnusravikavisayinl sukh, vyaktavisayini vividis, avyaktavisayiny avividis / gunasamanvayas tu rajastamobahul dhrtih, sattvarajobahul sraddh, sattvatamobahul sukh, rajobahul vividis, tamobahulvividiseti / uktam ca laksanavisayasatattvam traigunyasamanvayam ca paiicnm /

20

yoninm yo vidyd yativrsabham tarn tv aham manye / / ity ukth prndayo yonayas ca / etad dvayam adhigamya samyanmrgnugamanam 8 kuryt / rajastamodharmdisdhanabhvavinivrttitas tu / atra prnnm antarvrttir anupdhikatvd anivarty / bahirvrttis tu mrgmrgavisayatay prayoktavy / katham ity ucyate / prnavisay tvat pranatir dharmdivisaya ev<v>aroddhavy9/ tato hy asya sattvavrddhih / sattvavrddhes cottarottarabuddhirpdhigamah / apnavisaya<m>10 tv apakramanam <a>dharmdivisaya11 ev<v>aroddhavyam 12 / evam hy asya khytivisay<v>rakasya13 tamaso nirhrsah / tatas cottarottarabuddhirpdhiga1 D. vcyakarmani 2 All the Mss read na raksati. 3 K. and P.: tatpratijns 4 D.: sukhrtham(?) yas, s.m, sukhrthi yas 5 D. vividisitam 6 Dkha. viparitasupta0 7 A11 the Mss read prkrtik gatih. 8 D. samyak mrgnugamanam 9 AH the Mss read evparoddhavy. We follow 10 All the Mss read apnavisayas. 11 All the Mss read dharmdivisaya. 12 13

25

Chakravarti.

All the Mss read evparoddhavyam. We follow Chakravarti. All the Mss read khytivisaykrakasya.

SAPTAMAM AHNIKAM SK29,30

211

mah / tath samnavisayam shacaryam sattvadharmnugunam kuryt / yasmc chstram ha "sattvrmah sattvamithunas ca sad syt" iti / tmotkarsam tdnavisayam avidyparvano 'ntyam rpam vivarjya tatpratipaksair nivartayet 1 / atyantvinbhvam ca 2 vynavisayam 3 jiinavisaya eva bhvayet / yoninmcatasrnm dhar<ma>bijatm4 evdadyt 5 / avividism apy anistaphalahetusu bhvayet / so ' y a m dharmdisu pravanas tatpratipakspakrntah sattvrmo vinivrttbhimno jnnanisthah savisuddhayonir acirena param brahmopapadyata 6 iti / ha ca bhym prnavivrttim samyahmrge budhah pratisthpya / vinivrttavikharakaluso dhruvam amrtam sthnam abhyeti / / pancnm yoninm dharmdinimittatm ca samsthpya / paripakvam ity adhastn na punas 9 tadbhvito gacchet / / iti vykhyt vyastasamast karannm vrttih / / 2 9 / / ha: yeyam ekaikasmin rpdv arthe karanacatustayasya vrttih s kirn10 yugapad hosvit krameneti / kutah samsaya iti ced ubhayath drstatvt / ihaikrthavisaynm yugapad api vrttir drst tadyath candramandale caksusm manaso v kramasas ca tadyath ghate madhdakapayasm / ekrthavisayam ca karanacatustayam / ato nah 11 samsayah kirn caksurmanovad yugapad asya vrttih, hosvin madhvdivat krameneti / ucyate: yathdarsanam api tvad ucyatm / kirn atra yuktam bhavn manyate / sa cet samyag upadeksyasi ko nirbandhas tad eva pratipadymaha 12 iti / yady evam tasmd idam asmaddarsanam YUGAPAC CATUSTAYASYA TU VRTTIH / (SK30ab') tusabdo Vadhranrthah / yugapad evety arthah / buddhyahamkramanasm 13 hi buddhindriynm ca samnadesatvam / tatra na sakyata etad vaktum sati saktisadbhve visayasambandhe ca kasyacit tatra vrttih kasyacin neti / kirn cnyat / meghastanitdisu kramnupalabdheh / yadi hi kramena srotrdmm antahkaranasya ca bhye 'rthe vrttih syd agi tarhi meghastanita1 P. nirvartayet 2 After ca D. writes and erases jnnavisaya 3 Dkha. dhynavisayam 4 AU the Mss read dharmatbijatm. 5 D. evdadhyt 6 7 8

10

15

20

25

eva.

7 D. dharmdinimittam tm, s.m. dharmdinimittatm 8 D., in the footnote, reads samsthpyety at ah param kha. 9 D. adhastt punas, s.m. adhastn na punas 10 D. not clear, s.m. kim 11 D. na, s.m. nah 12 D. manymahe, s.m. pratipadymahe 13

Dkha. (brahma) upasampadyata

pustakasybhvah.

D. mannamsi, s.m. manasm

212

YUKTIDIPIKA

krsnasarpalocanadisv 1 apy upalabhyeta kramah / na tupalabhyate / tasmad yugapad eva bhye 'rthe catustayavrttir iti / ucyate: yad uktam(211.24) srotrdinm antahkaranasya cbhinnaklam vrttir ity atra brmah: ayuktam etat / kirn kranam / yasmd asmkam 5 KRAMASAS CA TASYA NIRDIST / (SK30b') tasyeti catustayam abhisambadhyate / casabdo 'vadhranrthah / kramasa evety arthah / kramasa eva hi bhyntahkaranavrttyor ekrthopaniptah 2 / yat tktam(211.26) samnadesnm saktisambandhasadbhve vrttyabhvnupapattir ity atra brmah: caksurdivad etat syt / tadyath caksustvacoh samnadesatve saktivisayasambandhopapattau rajodhmtapdhigatah 3 sparsa evopalabhyate na rpam evam ihpi syt / tasmt DRSTE TATHPY ADRSTE4/ (SK30c) kramasa eva catustayasya vrttih / adrstagrahanena punar atrtitngatavyavahitavisayagrahanam / tatrtitam dvividham drstavisayam adrstavisayam ca / atrpi drstavisayam pratyabhijnnam ity abhipretam / adrstavisayam smrtih / s tu linggambhym akasmd v bhavati / tath ca vrsaganavirenpy 5 uktam bhavati "animitto 6 'py evam avasthitasya jiinasya vrttih pratyayah prdus tiras ca <bhavati) vrttyarthe na bhavaty animitto 'pity angatavyavahitavisayajnnam tu linggambhym" <iti> / ha ca visayendriyasamyogt pratyaksajnnam ucyate / tad evtindriyam jtam punar bhvanay smrtih / / tad eva bhvanpeksajnnam klntare punah / tatraiva sendriyam jtam pratyabhijnnam ucyate / / 25 tatra drste kramam prati nsti sandehah / yat punar etad uktam(211.28) drste meghastanitakrsnasarplocandau 7 kramnupalabdher yugapac catustayasya vrttir ity atra brmah: etad apy ayuktam / kirn kranam / yasmt TRAYASYA TATPRVIKAW VRTTIH / / (SK30d) na tvad buddhyahamkramanasm sksd bhyrthagrahanasmarthyam 8 asty antahkarannupapattiprasangt srotrdivaiyarthyaprasangd dvridvrabhvavyghtaprasahgc ca / tasmt prvam srotrdinm arthasambandho
1 D. 2 P. 3 D. 4 D. 5 D. 6

10

15

20

30

krsnasarpdisv, s.m. krsnasarpalocanadisv not clear. adhigatah(7), s.m. adhigatah tah not clear, s.m. adrste vrsiganavirenpy K. and P. indicate a lacuna in place of animitto apy animitto apity (212.18). This portion, which is omitted in the main text of D., is written in its bottom margin as being from ga.pu. 7 D. sarplocandau, s.m. sarpdylocandau 8 0 D. bhyrthe grahana

(^(TRAYASYA TATPRVIK)

trayasya buddhyades tatpurvika bahyakaranapurvika / / (K.98b,

D.282 without number)

SAPTAMAM AHNIKAM SK30,31

213

'sti / meghastanitdv apy avasyam etad abhyupagantavyam / pasct tu tadvrttyupaniptd antahkaranasyety asti kramo 'trpi / tatra yad uktam(211.28) meghastanitdisukramnanugater 1 yugapac catustayasya vrttir ity etad ayuktam / anyais tv anyathnvayo darsitah / tadyath cat us tayasyeti mano'hamkrabuddhlnm antahkarannm bhyenaikena karanena srotrena v caksus v saha catustayasyety arthah / asya2 drste vartamne yugapad vrttih prvcryair nirdist / cryena tu kramenety arthah / adrste 'tltdv api kramasas ca kramenaivayatas trayasyntahkaranasya tatprvik bhyendriyaprvik vrttih / [yad] yathnubhavas tath samskrah yath ca samskras tath smrtir ity evam vrttir bhyendriyaprviketi / / 3 0 / / ha: kirn punar esm karannm svavisayaniyamena vrttir bhavaty hosvid vyatikareneti / ucyate: nanu ca prg eva rpdisu pancnm locanamtram isyate vrttih /(SK28ab) iti coktvcryennte 'padistam "sais bhavaty asmny"(SK29b') iti / tatraivamgate bhavatah samsayah kuta [ity ucyate] / <ha:> satyam evaitat / tathpi jyate samsayah / kutah / karanntarena svavisayopalabdhau karanntarautsukyadarsant / iha karanntarena caksusmraddimdirpopalabdhau 3 satym karanntarasya jihvlaksanasyautsukyam pravrttis copalabdh / tad yadi svavisayaniyatmndriyni naism karanntaravisayopalambht 4 tatshacarypeksah svavisayagrahanabhvah syt / asti ca / tasmd upapannah samsayas tatrednlm bhavatah k pratipattir iti / ucyate: atrpi nstlndriynm svavisayagrahanavyatikarah / kim tarhi / SVM SVM PRATIPADYANTE PARASPARKTAHETUKIM VRTTIM / PURUSRTHA EVA HETUR NA KENACIT KRYATE KARANAM / / (SK31) yasya karanasya y vrttir apadist 5 tadyath srotrasya sabdagrahanam caksuso rpagrahanam itydi tm eva pratipadyante svavisayajighrksayvalambanta ity arthah / parasparasyktam parasparktam / ktam abhipryo 'bhisandhir ity arthah / parasparktam hetuh pratipatter asyh seyam (cf.Pn. 5.4.154) parasparktahetuki / parasparktam pratipatteh kranam iti krtv tcchabdyam labhate "tadyath dadhitrapusam <pratyakso> jvarah 6 " (cf.MBhsya.1.156.8)/ etad uktam bhavati: yad caksusmraddimdirpam 7
1 P. kramanctnugate 2 D. adds in the right margin asya drste vartamne ... tu kramenety arthah. 3 D. ca caksus mra d tim dirp opapal ab dh au, s.m. caksusmraddimdirpopalabdhau 4 0 0 D. karanntara , s.m. kranntara 5 D. upadist, s.m. apadist 6 A11 the Mss read dadhitrapusam jvarah. 7

10

15

20

25

30

D. caksusmradtimtirpam, s.m. caksusmraddimdirpam

214

YUKTIDIPIKA

10

15

20

25

upalabdham bhavati tada rasanendriyam upattavisayasya caksuso vrttim samvedya svavisayajighrksayautsukhyavad1 vikrarri padyate / rasanasya vrttim samvedya pdau viharanam rabhete hastv dnam tvad yvad asau visayo rasanedriyayogyatm <>nitah2 / tato rasanam svavisaye pravartate / evam itaresv api vaktavyam / ha: yady evam tena tarhlndriyntaravrttisamvedane 'ksapratyayavattvaprasangah / yadi tarhmdriyntarenendriyntarasya 3 vrttih samvedyate prptam asya pratyayavattvam / athpratyayam indriyam parasparktasamvedanam tarhi na vcyam [iti] / kirn ca parasparadvridvrabhvaprasangas ca / indriyntaram ced indriyntarasya vrttim samvedya svrtham 4 knkset prptam asya dvritvam itarasya ca dvratvam / ta<smd>5 ayuktam indriynm parasparktasamvedanam iti / ucyate: na upacrt / prg evopadistam asmbhir apratyayam indriyam iti(202.8) / kirn tarhi / svavisayasya patoh sahacrinam artham indriyntaravisayatm pannam samsprsya svabhvata indriyntaram svavisayam prati sknksam 6 bhavati / tatsannidhau vikriydarsant 7 tatra samvedanam upacaryaivam ucyata 8 ity adosah / kirn cnyat / bhautikvayavapratyayavivrttivat tadvivrtteh / yath buddheh prasdasamanantaram bhautiknm avayavnm mukhanayandinm prasdo bhavati na caism pratyayavattvam, evam ihpi syt / na ca pratyayavattvam / etena dvridvrabhvah <ca(?)> pratyuktah / mano'dhisthnasmarthyd v / athav parasparavisayam ktam parasparktam yath jalavisayah purusah jalapurusah 9 / ktam icch samkalpo mana ity arthah / sa hetur asyh seyam parasparktahetuki tm 1 0 / etad uktam bhavati: yad kimcid indriyam visaye pravrttam bhavati tad taddvrena samastam artham upalabhya <manas>tatsahacri<nam>11 arthntaram khksad indriyntaram vrtty<dhi>tisthate 12 / tenknksvat manasdhisthitam indriyam vikriym padyate / tath ca tantrntare 'py uktam "yasys, yasyendriyasya visayam mano dhyyaty abhisampattyarthena tasya tasyautsukyam pravrttis ca bhavati" iti / etad uktam svm svm pratipadyante parasparktahetukim vrttim / (SK31ab) iti / kirn indriyam mano vrttydhisthya svavisaye pravartayati yath parasvdims caitra iti / nety ucyate / kirn tarhi / svavisayasamkalpnugrhltasya manasah samsparst svayam evendriyam svavisayam pratipadyate / kasmt / prayogasaktyasiddheh / na hi yath caitrasya parasvdiprayogasaktih siddhaivam
X D. samvedyasvavisaya 2 All the Mss read yatm nitah. 3 D. indriyntarena, s.m. indriyntarasya 4 D. samvedyasvartham 5 A11 the Mss read tad. 6 D. pratisknksam 7 D. vikriy0, s.m. visakriy0 8 D. upacaryaiva mucyate, s.m. upacaryaivam 9 D. adds jalapurusah in the left margin. 10 11 All 12

30

35

ucyate

D. hetukitm, s.m. hetuki tm the Mss read tatsahacrinm. We follow Chakravarti. All the Mss read vrtty pratitisthate.

SAPTAMAM AHNIKAM SK31,32

215

manasa indriyaprayogasaktih / tasmd ayuktam indriyasya manah prerakam iti / raja iti cet / syn mat am / rajaso hindriyntaraprayogasmarthyam vidyate / tasmd ayuktam uktam(214.34) prayogasaktyasiddher nendriynm manah prayojakam iti / etac cyuktam / kasmt / avisest / indriyntare 'pi hi tarhi rajo 'stity ata tmabhtenaivsya nimittena pravrttir apratisiddh / kirn manas parikalpiteneti / kirn cnyat / karanntaranupapatteh 1 / caitro hi parasvdinm prayogam karanntarena karoti na tu manasah karanntaram 2 astity asamnam / pnivad iti cen na caitravyprpeksatvt / tad api hi caitravyprpeksam pravartate na svatah / kirn ca tadvyatirekena pravrttyupalabdheh / yasya hi prayojakntarpeks pravrttir na tasya kadcid api svatantrasya bhavati / asti tu samkalpavyatirekena meghastanitdisv indriyasya pravrttih / tasmn nendriyntarasya manah krakam 3 / na cet krakam yath maulnm gunnm evam ihpi purusrtha eva hetur na kenacit kryate karanam iti siddham / / 3 1 / / ha: karanam praty cryavipratipattes tadavadhranam [kartavyam] / ihcrynm 4 karanam prati vipratipattih / ekdasavidham iti vrsaganh, dasavidham iti tntrikh paficdhikaranaprabhrtayah, dvdasavidham iti patanjalih / tasmd bhavatah katividham karanam abhipretam iti vaktavyam etat / ucyate: KARANAM TRAYODASAVIDHAM TAD HARANADHRANAPRAKSAKARAM / (SK32ab) panca karmendriyni paiica buddhindriyni mano 'hamkro buddhis cety etat sarvam purusrthopayogikaranam / kasmt / apurusrthopayogitve tattvntarnupapattiprasangt / yadi yath vrsagan hur "lihgamtr<o>5 mahn asamvedyah kryak<a>ranarpenvisist<o> visistalaksanena 6 " tath syt tattvntaram 7 / tan na syd anarthakatvt / <.... / atha matam /> 8 pradhnalaksannm gunnm vaisamyamtrarpatve 'pi tattvntaram asau bhavisyatiti / kasmt / smyd vaisamyam upkhyntaram iti / etac cyuktam / kasmt / tattvnavasthprasangt / evam hi parikalpyamne pradhnamahator yad antarlam tattvntarnm tad api ca kriyrpatvd akriyvata upkhyntaram iti tattvntarnavasthprasahgah / abhyupaga<me>9 v mahatas tattvntarnm ca kriyklavirodhah / tasmt tattvntarnupapattir anavasth v [trayodasavidham karanam 10 ity] anyatara<d> n avasyam
X D. kranntar0 2 D. karanntaram 3 D. karanam, s.m. krakam 4 K. and P.: crynm 5 All the Mss read lingamtre. We follow Chakravarti. 6 All the Mss read kryakranarpenvisistvisistalaksanena. 7 D. sy tattvntaram, s.m. syt tattvntaram 8 K. and P.: ha satyam D. ha satyam, s.m. ha matam 9 All the Mss read 'bhyupagamo. We follow Pandeya. 10 D. karannm, s.m. karanam 11

10

15

20

25

30

We follow Chakravarti.

AH the Mss read anyataravad.

216

YUKTIDIPIKA

10

abhyupagantavyam / tatra casmatpratijnatam eva nirdosam laksyate / tasmad upapannam etat trayodasavidham karanam iti / ha: karanam iti kriykrakasambandhagarbho ' y a m nirdesah / katham / yena <kriyate> tat karanam(cf.Pn.3.3.117) iti / tatra vaktavyam k kriy, kirn ca tat kriyate yad apeksya buddhydinm karanatvam iti / ucyate: yad uktam (216.4) k kriyety atra brmah: tannirvartakam 1 ihbhipretam na danddivat / kim tarhi / tad haranadhranapraksakaram / tatrharanam karmendriyni kurvanti visayrjanasamarthatvt / dhranam buddhindriyni 2 kurvanti visayasannidhne sati srotrdivrttes tadrppatteh / praksam antahkaranam karoti niscayasmarthyt / apara ha "haranam karmendriyni kurvanti, dhranam mano 'hamkras ca, praksanam buddhindriyni buddhis ca" iti / etad abhisandhya buddhydinm karanatvam ucyata iti 3 / yat tktam(216.4) kim kryam iti / ucyate KRYAM CA TASYA DASADH / (SK32c) dasadheti paiica visesh paficvisesh (cf.SK38) / tad apy ata eva kryasabdam labhate / HRYAM DHRYAM PRAKSYAM CA / / (SK32d) tad dhy hartavyam dhranlyam praksayitavyam ca / atah kryam ity ucyate na nirvartyatvt / / 3 2 / /

15

20

etasmims trayodasavidhe tu karane tra<yam>4 katarad iti / ucyate: buddhir ahamkro man as ca / tasmt ANTAHKARANAM TRIVIDHAM / (SK33a) kasmt / visaynabhisandhnt srotrdipranlikay ca visayasampratipatteh / avisesbhidhnd buddhydipratipattir ayukteti cet / syn matam / avisesenedam uktam cryenantahkaranam trividham iti / tatra katham idam avagamyate buddhyahamkramanasm grahanam ihbhipretam na punar anyesm iti / ucyate: na prathainasamkhyvyatikrarnahetvanupapatteh / buddhydisamkhym hi vyatikramamnasya pratipattau nsti hetuh / tasmt tesm eva grahanam yath "vasantya kapifijaln labhate" (e.g.Vj.Sam.24.20) iti / srotrasyntahkaranatvaprasangd ayuktam iti cet / syd etat / buddhim ahamkram coktv tata ha buddhindriyni karnatvakcaksrasanansikkhyni / (SK26ab) iti tasmc chrotram antahkaranam prasajyata iti / etad a n u p a p a n n a m / kasmt / manasah prthagabhidhnt / ata evedam cryenpeksya manaso 'ntahkaranatvam prthag uktam "tac cendriyam ubhayath samkhytam antas triklavisayam" (SK27bc) iti / tasmd upapannam antahkaranam trividham buddhyditi /
J D. 2 D. 3 D. 4

25

30

35

tannivartakam, s.m. tannirvartakam dhranabuddhindriyni, s.m. dhranam buddhindriyni ucyate iti, s.m. ucyate nivrttir iti All the Mss read trayodasam.

SAPTAMAM AHNIKAM SK32,33,34 DASADH BHYAM / (SK33b')

217

panca buddhindriyni panca karmendriynity etad bhyam dasaprakram cryair khyyate / ha: dasadh bhyam ity asynarthakyam / parisesabuddher antahkaranam trividham ity ukte gamyata etat parisesd eva dasadh bhyam iti / tasmt tadgrahanam anarthakam iti / ucyate: n a v i s a y r t h a t v t / "trayasya visaykhyam" (SK33b') ity evarn vaksymlty crya rabhate / akriyamne tv asmin kirn tat trayasya visaykhyam iti na jnyate / ha: evam api visayagrahant siddher bhyagrahanam aprthakam iti / ucyate: vaktavyam tvad idam avasyam visayabhvapratipattyartham / tatra sese v yathnysam 1 vocyamne na 2 kascid visesah / athav nedam bhyasamjnpratipattyartham rabhyate / kirn tarhi / niyamrtham / katham / dasadh bhyarn sabddivisayagrahanabhtam eva trayasypi visaykhyam yath syt, m bhd antah prndibhtam / athav dasadhaiva bhyam bhedavisayam bhyam ity arthah / prndibhtasya tu bhedo nstity adosah / tad etat TRAYASYA3 VISAYKHYAM / (SK33b') buddhyahamkramanolaksanasya hi trayasyopttavisay buddhindriyakarmendriyavrttayah samparkd visayarpapratyavabhsanimittatm upagacchantyo visaykhyatm labhante / tath mano'hamkrv api buddheh / buddhis tu niscayarpatvt karanntaranirapeks sarvam artham 4 pravrtt<im>5 prati niscayarpendhy<avasi>tam6 purusyopasamharati / tatra sabddisannidhne vrttinm tdrpypattes tadapagame ca tdrpypagamt prpyakri SMPRATAKLAM BHYAM / (SK33c) upttavisayendriyavrttisannidhnt tu tadkrasamskrdhnanimittasmrtipratyayavast TRIKLAM BHYANTARAM KARANAM / / (SK33d)

10

15

20

25

ha: prk "sabddisu srotrdinm locanamtram vrttih" (cf.SK28ab) ity avisesenoktam / tatra kirn tathaiva pratipattavyam athendriynm visayaviseso 'stiti / atha coktam "kryam ca tasya dasadh" (SK32c) visesalaksanam avisesalaksanam ca <iti> / tatra kena karanena kasya visayasya grahanam iti / ucyate:
1 D. yath nysarn 2 D. vocyamnena, s.m. vocyamne na 3 D. triyasya 4 D. ntaranipekssarvam, s.m. ntaranipeks 5 All the Mss read pravrttau. 6

30

sarvam

All the Mss read dhyastam.

218

YUKTIDIPIKA BUDDHINDRIYANI TESAM PANCA VISESVISESAVISAYANI / (SK34ab)

tesm prvoktnm indriynm yni buddhindriyni panca srotrdmi tni visesvisesavisayni pratipattrbhedena 1 / tatra devnm ynmdriyni tni dharmotkarsd visuddhny avisesn api grhnanti [prg eva visest] / yoginm ca samprptavisesnm / asmaddlnm tu visesn eva tamas parivrtatvt / ha: kirn karmendriynm api pratipattrbhedd 2 grahanabhedo bhavati / nety ucyate / kirn tarhi / sarvesm eva VG BHAVATI SABDAVISAY / (SK34c)

10

vgindriyasya vyvabhihatesu vadanapradesesu tlvdisu dhvaner varnapadavkyaslokagranthabhvena vikrpdanam sarvaprninm avisist am / ha: athetarni karmendriyni katham iti / ucyate: SESNY API PANCAVISAYNI3 / / (SK34d)

15

20

25

30

pnipdapypasths tv dnaviharanotsargnandalaksanaih karmabhih sabdasparsarasarpagandhasamudyarp mrtir vikurvantiti / ha: yadi pancavisayny 4 <evpi sesniti>5 niyamo 'bhyupagamyate tenaikaikvaranesv <d>ndikriynupapattiprasahga 6 iti / ucyate: na niyamapratisedhrthatvt / svavisayaniyamo buddhmdriyavat karmendriynm api m 7 vijnyity ato niyamapratisedhrtham idam rabhyate / tadartham eva cpi sabdam cryo 'dhijage sambhvanrtham api ca pancavisayny 8 etni prg eva tu catustrivisaymti / ha: katham etad avagamyate visesvisesavisaymndriyni na punar asadvisayniti / ucyate: visesnm asattvsiddheh / pratyaksatas tvad vises upalabhyante / tasmd esm asattvam asakyam pratijntum / <sadhyam iti cet /> athpi syt / sdhyam etat pratyaksam evaitad anavadyam bhyavastuvisaya<m> mrgatrsnikdivijfinavat9 pratyaksbhsam <veti> / etac cyukt a m / kasmt / vikalpnupapatteh / sarvam abhtam abhyupagantavyam yato nsti kimcid bhtrthena pratyaksam yad apeksyetarat pratyaksbhsam 10 syt / uktas tv ayam vikalpah / tasmd ayuktam jnnamtram idam iti / kirn cnyat / viparltadarsanaprasangt / mrgatrsniksvapnavisayair asadbhih satm asattvam icchatas tadvad eva vipantadarsanaprasangah / tath hi gandharvanagardisu kadcit tarn evrtham gm pasyati / kadcid 11 pratipattyabhedena, s.m. pratipattrbhedena pratipattyabhedd, s.m. pratipattrbhedd panca visayni D. panca visayny 5 All the Mss read evvisesniti. 6 All the Mss read andikriy0. We follow Chakravarti. 7 P. s 8 D. panca visayny 9 All the Mss read bhyavastuvisayamayamrgatrsnikdi0. 10 D. pratyaksvabhsam 11 K. and P.: kascid D. kascid, s.m. kadcid
1 D. 2 D. 3 D. 4

SAPTAMAM AHNIKAM SK34

219

gajam pasyati / kadcit patkm / svapne caikamrtipatitnm gopurussvarsabhanadivrksaprabhrtinm darsanam <jg>arane1 viparyayena drstam / tath vtyanena hastiythapravesane....vicchinnnm 2 cvayavnm punah sandhnam, ksagamanam, anlsvarasynimittam rjyalbha iti tad itaratrpi syt / na tv asti / tasmd ayuktam mrgatrsniksvapndivad asattvam bhvnm / arthakriy ca na syt (cf.Vims.3,4) / yath svapne 3 sntnuliptsitapitavastrcchditnm aphalatvam drstam evam ihpi syt / sukravisargavad iti cet / syd etat / yath dvayasampattiprvakah sukravisargah sa ca tadabhve 'pi svapne bhavaty evam itarat syd iti / tad ayuktam rgdinimittatvt / tath hi jgrato 'pi tat dvayasampattim antarena bhavati / tasmn manoranjan<a>nimittam 4 tat / pretavad iti cet / syd <etat /> iyam mama sadbuddhih / yath pretnm asadbhih <pyanady>dibhir5 arthakriy narakaplais ca bdhanam evam atrpi syd iti / tad ayuktam asiddhatvt / na hy etad asad iti siddham / kirn ca p r a t y a k s e n a cpratyaksabdhant 6 / iha pratyaksam baliya ity apratyaksasya tena pratykhynam upapadyate / bhava<n>tas7 tv apratyaksena pratyaksam pratycaksate / tasmd ayuktam narakapldivad asatm arthakriyeti / svabhvabhedt tad a s a t t v a m iti cet / syd etat / yadi paramrthato narakaplh syus tesm api duhkhasambandhah syt mrtimattvvisest / na tu tesm bdhsti / tasmd bhrntir asv iti / etad ayuktam / kasmt / karmasaktivaicitryt / pratyaksam eva tvat karmanimitto vgbuddhisvabhvhravihrasaktibhedabhinno vicitrah samsra upalabhyate / sa nipunam aveksitum asakyo gambhiratvt / kirn punar apratyaksakarmanm vipkavaisvarpyam atarkagocaram asmaddibuddhayah paricchetsyanti / tasmn manorathamtram etat / dharmdharmnupapattis ca syt / yath svapne brahmahatysurpngamyagamandinm aphalatvam evam itaratrpi syd asadavisest / middhopaghtt 8 tadvisesa(cf.Vims.l8) iti cen na avisest / asattve tulye kvacid upaghtah kvacin neticchmtram etat / evam cen nsantah prthivydayah / na ced asanto yuktam upadistam buddhindriyni tesm pafica visesvisesavisaymti / / 3 4 / / iti yuktidipikym 9 saptamam hnikam 10 /

10

15

20

25

30

1 A\\ the Mss read smarane. 2 D. ... vicchinnm, s.m. ... sambhavivicchinnm 3 D. yath svapne, s.m. tath hi 4 All the Mss read ranjannimitttam. 5 All the Mss read prayndydibhir. We follow Chakravarti. 6 D. cpratyaksam bdhand 7 AU the Mss read bhavatas. We follow Chakravarti. 8 D. siddhopaghtt P. siddhaupaghtt 9 P. sriyuktidipikym 10

D deletes yuktidipikym saptamam hnikam.

A s t a m a m

A h n i k a m

dvaridvarabhavam esam idanim vaksyamah / tatra bahyam karanam dvaram antahkaranam dvriti / ha: karanvisesd ayuktam / antahkaranasya hlndriynm ca karanatvam avisistam / tatra ko hetur antahkaranam dvri dvrnindriyniti 1 / ucyate: SNTAHKARAN BUDDHIH SARVAM VISAYAM AVAGHATE YASMT / TASMT TRIVIDHAM KARANAM DVRI DVRNI SESNI //(SK35) sahntahkaranena vartate(cf.Pn.2.2.28) y <s> sntahkaran buddhih / ahamkramanobhym sahit buddhir ity arthah / atra cntahkaranagrahanenaiva buddher grahane siddhe bhyo buddhigrahanam prdhnyakhypanrtham / bhavati hi pradhnasya smnye 'ntarbhtasypi prthagupadesah / tadyath jagma tarn vanoddesam vyasah saha maharsibhih / iti maharsigrahane vyso 'py antarbhtah prdhnyt prthag ucyate / evam sntahkaran buddhih sarvam visayam avaghate / visistn avisistms ca sabddln sannikrstaviprakrstavyavahitn pramnabalena svavrtte visaylkarotity arthah / etad uktam bhavati: aniyatavisayo dvri niyatavisayni dvrni tadyath prsdasya prvottaradaksinapascimnm <dvrnm> svadinniyamo na prvam uttaram daksinam pascimam v kadcid bhavati tathetarny api dvr<>ni2 / <dvn tv aniyatah> 3 sarvadigavasthitair dvraih pravarta<te> 4 / evam ihpi srotrdlni svavisayaniyatni, sntahkaran tu buddhih sarvam visayam avaghate yasmt tasmd aniyatavisayatvd upapannam etat trividham karanam dvri dvrni sesni ti / ha 5 : dvaridvrabhvnabhidhnam strntarena tatsiddheh / "trayasya visaykhyam" (SK33bJ) ity ukte gamyata [ity] etad antahkaranam dvri dvrnlndriyni <iti> / tasmt tadvacanam anarthakam iti /
1 D. dvaridvraniti, s.m. dvridvrni 2 All the Mss read dvrtni. 3 A11 the Mss read tatrniyath. 4 All the Mss read pravartanta. 5

10

15

20

25

indriyniti

D. adds ha ... smarthyam syt / kirn tarhi te(22l.24-222.16) by a different hand. This portion is found neither in K. nor in P.

222

YUKTIDIPIKA

10

ucyate: na hetvabhidhanat 1 / pratijnamatram tatra darsitam na tuktam ko hetur <iti> / iha tu hetvabhidhnam / ato na punaruktam etat / ha: dvrnm anekatvc chstravirodhaprasangah / yadi buddhyahamkramanasm sarvesm dvritvam abhyupagamyate tena yac chstram "ekam eva darsanam khytir eva darsanam" (cf.YBh.onYS.1.4) ity asya virodhah / kirn ca svtantrye ca sambandhnupapattih / traynm hi dvrnm svtantryam abhyupagamyate svtantrye ca parasparnapeksnm sambandhnupapattih / kirn ca samuccaybhvah / ekaikas ca svatantrah svrthamtram purusyopaharatity abhyupagacchato nsti sarvagrahanavrttigrhakam ekam karanam / tatas ca dasnm dasasv arthesu vrttayas trayodasnm trayodasa iti samuccaybhvah / purusasya tatsmarthyd 2 adosa iti cen na akartrtvt / na hi purusah pratyayam karoti darsitavisayatvt / yatah samuccayam kuryt skstkrini v tasmin k<a>rannarthakyam 3 / tasmd ayuktam trividham karanam dvriti / / 3 5 / / ucyate: syd etad evam yadi sarvesm dvrinm svtantryena purusrthopahrasmarthyam syt / kirn tarhi / [te4] ETE PRADIPAKALPH PARASPARAVILAKSAN GUNAVISESH / KRTSNAM PURUSASYRTHAM PRAKSYA BUDDHAU5 PRAYACCHANTI / / (SK36)

15

20

25

30

eta ity anena trayam abhisambadhnti srotrdmm anyatamam rnano 'harnkras ca / pradipakalp ity anena praksasmyam karanaparvana caste / yath pradipah praksaka evam karanam api tadvypre 'sati visayvirbhvnupapatteh / parasparavilaksan ity anena vyastavrttim prvoktm (cf.SK28) karsati / tay hy esm vailaksanyam anumiyata locanasamkalpbhimnabhedt / gunavises ity anena sattvdinm purusavijnnam 6 uddisya tadbhvena parinmam khypayati / krtsnam purusasyrtham iti visesvisesalaksanam kryam hryadhryapraksyatay yathsambhavam praksya svavrttyanugunam krtv visayatvam pdyety arthah / buddhau prayacchanti buddhv dadhati / etad uktam bhavati: yad srotrdinm anyatamam karanam sabddau visaye pravartate tad taddvrenhamkro mano v tarn visayam svavyprennubhya buddhv dhatte tadvisayatm pdayatlty arthah / kadcit tu buddhir eva bhyakaranasamkalpbhimnn niscinoti visayam kadcit 7 samkalpbhimnn niscinoti visayam tvat kadcit samkalpbhimnagrhitam / sarvath tv ayam sstrrthah / yena v <...(?)>
l D. hetvanabhidhnt, s.m. hetvabhidhanat 2 D. purusasytat$marthyd(7), s.m. purusasya 3 D. krannarthakyam. 4 After te D. writes and deletes pradipakalpah. 5 D. praksabuddhau 6 D. puruso vijnnam 7

tatsmarthyd

D. repeats kadcit samkalpbhimnnn niscinoti visayam, and puts kadcit samkalpbhimnnn visayam tvat in parentheses, deleting the repeated portion.

AST AM AM AHNIKAM SK35,36,37

223

tena karanena visayam upttam buddhir adhyavasyati / tay 1 cdhyavasyarppannay cetansaktir anugrhyate / na karanntarasya purusena sambandho 'sti / tatas ca dvrinm bahutvd darsanavisesasvtantryasamuccayntahkaranapurusakartrtvadosnm aprasangah / / 3 6 / / ha: kah punar atra hetur 2 yena dvritvvisese saty ahamkramanasl buddhau visaydhnam kuruto na punar anayoh skst purusena sambandha iti / ucyate: SARVAM PRATY UPABHOGAM YASMT PURUSASYA SDHAYATI BUDDHIH / (SK37ab) ahamkramanasor hi nsti niscayarpat samkalpbhimnamtrarpatvt / aniscitavisayay ca karanavrtty purusasya sambandho 'narthakah syt, svayam v niscetur asya kartrtvam syt / tatas cmisraniscayakaranatvd 3 ayam apy misrarpah syt / sarvam caitad uktottaram(cf.SK20) / niscayarp hi buddhih / atas tadvrttyupanipti visayah sannidhnamtrt purusena samcetito nsyaudsinyam 4 bdhitum utsahate no khalv apy narthakyam anusajyate / etad uktam sarvam praty upabhogam yasmt purusasya sdhayati buddhir iti / ha: evam api sabddilaksano visayah prakrtah sa ca buddhy sarvah pratipdyate / tatra visayntaram apy asti pradhnapurusntaralaksanam / tath chuh "upabhogasya sabddyupalabdhir dih, gunapurusopalabdhir antah" <iti> / tasmt tatpratipattyartham karanntaram vaktavyam iti / ucyate: na vaktavyam / kirn kranam / yasmt SAIVA CA VISINASTI <YAT>AH5 PRADHNAPURUSNTARAM SKSMAM / / (SK37cd) yato yasmt krant s buddhir eva hi ksthpannena tamasbhibhtatvd dharmdinm sattvadharmnm prakrtibhtn vikrabhtn paratantrn upakrynupakrakn acetann samsargadharminas 6 ca gunn tmatvendhyavasya purusyopaharati / sa ca mithyjnnbhysavsannuranjitam buddhipratyayam anurudhyamno darsitavisayatvt tathaiva pratipdyate / yad tu dharmdyabhyst tamorppagame saty uttarottarnm sattvadharmnm utkarsas tad vinivrttamithypratyay vrttih / na prakrtivikrabhtah svatantro ?nupakryo 'nupakrakas cetano 'samsargadharm ca / tato viparits ca gun iti suddhdhyavasyam karoti / purusas ca paropahrtavrttitvt tathaiva pratipdyate / tad etad 7 gunnm purusasya cntaram dvayor api niscayasvabhvatvd asmt prvoktadharmabhede 'pi sati sksmam gambhiram durjneyam /
1 D. tath, s.m. tay 2 P. punar ahetur 3 K. and P.: niscayakranatvd 4 D. nsyaudausinyam P. nsydausinyam 5 All the Mss read punah. 6 K. and P.: samsargidhar0 D. samsargidhar0, 7

10

15

20

25

30

35

s.m. samsargadhar0

D. tad ed, s.m. tad etad

224

YUKTIDIPIKA

atas ca suksmam yad buddhimatram avalambya tad avisist ay as cetanasakter grhyagrhakabhvavyavasthbhede 1 'pi sati cetanasakter abhvo 'bhyupagatah / tathopalaksitasstrair apy anekaklbhyaste guntmabhvagrhaparivestitavikharaih pratyaksaniscitabhedbhya<sta>mtrpitrdrabhojandibhyo 2 'bhilso na nivartate / tasmt pradhnapurusntaram sksmam atarkagamyam / atyantavisuddher bhagavatah paramarser vi<jneyam>3 anyesm ca sattvbhysopajanitavimalajnnanirastavidynm nntvadharmabhjm iti / evam buddheh sar<v>apratyupabhogasdhanabhvt 4 sarvakaranebhyah pr<>dhnyam 5 siddham / / 3 7 / / [iti yuktidipikym saptatipaddhatau saptamam hnikam samptam iti /] [sriganesya namah 6 /] vykhytam karanaparva / kryaparvednim vaktavyam / tasya ca purastd uddesah krtah a kryam ca tasya dasadh" (SK32c) "panca vises<visesh>7" (SK34b?) iti / smpratam tu nirdesam karisymah / ha: yady evam tasmd idam eva tvad 8 ucyatm ke visesh ke 'vises iti / ucyate: TANMTRNY AVISESH / (SK38a) yni tanmtrni panchamkrd 9 utpadyanta iti prg(SK25) apadistam 10 te khalv avisesh / kni punas tanmtrniti / ucyate: sabdatanmtram sparsatanmtram rpatanmtram rasatanmtram gandhatanmtram 11 iti / katham punas tanmtrniti / ucyate: tulyajtiyavisesnupapatteh / anye sabdajtyabhede 'pi sati vises udttnudttasvaritnunsikdayas(cf.Pn.l.2.29-31, 1.1.8) tatra 1 2 na santi / tasmc chabdatanmtram / evam sparsatanmtre mrdukathindayah / evam rpatanmtre suklakrsndayah / evam rasatanmtre madhurmldayah / After grhyagrhaka K. and P. have a blank space and a blank folio. The portion from bhvavyavasthbhede 'pi to hnikam samptam iti (224.2-10) is written only in the bottom margin of D. by a different hand. 2 D. niscitabhedbhya..mtrpitr0 3 D. vinyo. 4 D. sargapratyupabhoga0 5 D. pradhnyam 6 P. om Sri ganesya om Here B. starts. Reading om namo nryaniya in the centre of the top line, it starts with <o> svasti prajbhyahsrtganesya om. (cf.Introduction, p.XIII,fn.l6; p.XVII,fn.29) 7 All the Mss read vises. 8 D. eva tvad, s.m. etvad 9 B. pancatanmtrny ahamkrd D. adds panca before tanmtrni, and deletes it. 10 D. apadistam, s.m. upadistam 11 B. gandhamtram 12 D. tatra, s.m. te 'tra
1

10

15

20

25

ASTAMAM AHNIKAM SK37,38

225

evam gandhatanmtre surabhydayah / tasmt tasya tasya 1 gunasya smnyam 2 evtra na visesa iti tanmtrny ete 'visesh / ha: atha ke punar vises iti / ucyate: yni khalu TEBHYO BHTNI PANCA PANCABHYAH /(SK38b) utpadyante / ETE SMRT VISESH /(SK38c) tatra sabdatanmtrd ksam / sparsatanmtrd vyuh / rpatanmtrt tejah / rasatanmtrd pah / gandhatanmtrt prthivT / tebhyo bhtmty etvati vaktavye panca pancabhya iti grahanam samasamkhykatas 3 tadutpattijnpanrtham / tenaikaikasmt tanmtrd ekaikasya visesasyotpattih siddh / tatas ca yad anyesm crynm abhipretam ekalaksanebhyas tanmtrebhyah parasparnupravesd ekottar visesh4 srjyanta iti(cf.l87.11) tat pratisiddham bhavati / kirn tarhi / antarenpi tanmtrnupravesam ekottarebhyo bhtebhya ekottarnm bhtavisesnmutpattih 5 / tatra sabdagunc chabdatanmtrd ksam ekagunam / sabdasparsagunt 6 sparsatanmtrd dviguno vyuh / sabdasparsarpagund rpatanmtrt trigunam tejah / sabdasparsarparasagund rasatanmtrc caturgun pah / sabdasparsarparasagandhagund 7 gandhatanmtrt paficagun prthivi / atra ca vyoh sitah sparsah, apm ca / tejasa usnah / anusnsitah prthivyh / rpam ca suklam bhsvaram ca tejaso 8 ?pm ca / krsnam prthivyh / raso madhuro 'pm, sdhranah prthivyh / gandhas tu prthiva eva / tadavayavnupravesd 9 bhtntarespalabhyata ity ete prthivydinm dharmh / anye ca parasparnugrhakh / ke punas ta ity ha kro gauravam rauksyam varanam sthairyam eva ca / sthitir bhedah ksam 10 krsnacchy 11 sarvopabhogyat 12 // (see TV. and YV. on YS.3.44) iti te
13

10

15

20

25

prthiva dharms tadvisists tathpare / (see TV. and YV. on YS.3.44)

jalgnipavanksavypaks 14 tn nibodhata / /
1 D. 2 D. 3 D. 4 D. 5 K. 6 D. 7 B. 8 B. 9 D. 10 B. 11 D. 12 K. 13

encircles tasya. gunasya smnyam, s.m. gunasmnyam samkhykatas, s.m. sarnkhytas ekottarvisesh utpatteh, s.m. utpattih sabdasparsagunc chabdatanmtrt, s.m. sabdasparsagunt rasarpa jyotisah D. tejasah, s.m. jyotisah tadavayavnupravesd, s.m. tadavayavntarnupravesd ksap ksamkrsnacchy, s.m. ksamrauksmyam cchy and P.: sarvopabhogyate D. ity ete P. ti iti te 4 D. vypakms

226

YUKTIDIPIKA snehah sauksmyam prabha sauklyam mardavam gauravam ca yat / saityam raks pavitratvam santnas 1 caudak gunh / / (see TV. and YV. on YS.3.44) 2 rdhva<gam> pvakam dagdhr pcakam laghu bhsvaram / pradhvamsy ojasvit jyotih prvbhym <sa>vilaksanam3 / / tiryakptah pavitratvam ksepo nodanam balam / rauksyam acchyat saityam vyor dharmh prthagvidhh / / (see TV. and YV. on YS.3.44) sarvatogatir avyho 'viskambhas ceti te trayah / ksadharm 4 vijfieyh prvadharmavirodhinah / / (see TV. and YV. on YS.3.44, NS.4.2.22) samhatnm tu yat kryam smnyam te gavdayah / itaretaradharmebhyo visesn ntra samsayah / / (see TV. and YV. on YS.3.44)

10

15

20

25

30

tatrkrdibhir dharmaih prthivy lokasya copa<krah> kriyate 5 bhtntarnm ca / tatrkrt tvat gavdinm ghatdmm ckranirvrttih 6 / gauravd esm avasthnam / rauksyd apm sangraho vaisadyam ca bhtnm / varand anabhipretnm chdanam / sthairyd vrttih prajnm bhtntarnm ca / sthiter mtrdisannidhndyanugrahah / bhedd ghatdinispattir vyhas cvayavnm / ksnter upabhogayogyat 7 / krsnacchyatvd rtrisampac chykryaprasiddhis ca / sarvopabhogyatvt sarvabhtnugrahah / evam snehdibhir 8 lokasyopakrah kriyate bhtntarnm ca / snehd rpasampad vyupratikro 'gni<s>amanam9 samgrahas ca prthivyh / sauksmyd anupravesah / sauklyc candrdinirvrttih / mrdavt snnvaghanam 10 ekakriy kathinnm cvanmanam / gauravt santnc ca bhtnugrahrtham srotastvam / saityd usnapratikrah / rakstah prajsu ghorasamanam / pavitratvd dharmopacayah saucavidhir alaksmyupaghtas 11 ca / santnd dravyasahghtah / tathordhvagatydibhir dharmamtrais tejas 12 lokasya copa<krah> kriya13 te bhtntarnm ca / rdhvagateh pkapraksasiddhih 14 / pvakatvd dra1 B. a santnas 2 All the Mss read rdhvabhk. We follow Pandeya. 3 All the Mss read suvilaksanam. We follow Chakravarti. 4 B. kradharm 5 All the Mss read copakriyate. 6 K. and D.: nivrttih 7 D. upabhogayogyat, s.m. upabhojyat 8 D. snehdibhir, s.m. snehdir adbhih 9 A11 the Mss read 'gnigamanam. We follow Chakravarti. 10 D. snnvaghanam, s.m. pnvaghanam 11 K. P. and B.: alaksyopaghtas D. alaksyopaghtas, 12 K. and P.: tejasm D. tejasm, s.m. tejasah 13 All the Mss read copakriyate. 14

s.m. alaksmyupaghtas

B. pkapratikrasiddhih D. pkapraksasiddhih, s.m. pkapratikrasiddhih

ASTAMAM AHNIKAM SK38,39

227

vyasaucam ca / dhakatvt ksrotpattih sitapratikro nabhasas cosnatvam sabdanispattyartham / pcakatvt svedyasvedanam1 annapaktih 2 prthivyavayavnm ca 3 kriyyogyat tath bhyntaraparinmo rasalohitammsasnyvasthimajjsukrnm / lghavd dhytikramah / bhsvaratvd dravyntarapraksanam / pradhvamsitvd dagdhapakvnm upabhogah / ojasah 4 prajplanam / tath tiryakptdibhir dharmair vyun lokasya copakrah kriyate bhtntarnm ca / tiryakptd drstiviksepo gandhasamvahanam 5 ca / pavitratvt ptidravyapavanam / ksepanodanbhym 6 utkarsah prathanam <gha>rmmbhasah 7 vyhas ca sarire rasdinm dhtnm ca, agnes copadhmnam abhightas cksasya / balt samiranam sarvesm / rauksyd visosanam 8 / acchyatvd 9 ahortraprasiddhih / saityd usnapratikrah / tath sarvatogatydibhir dharmair nabhas lokasyopakrah kriyate bhtntarnm ca / sarvatogateh 10 samantt tulyadesasravannm ekasrutitvam / avyh<>viskambhbhym 11 sarvesm avaksatdnam ity ukth prthivydayah / ete vises ity ucyanta iti / ha: katham punar ete vises iti / ucya<t>e12: yasmt SANTA GHORS CA MDHS CA //(SK38d) tatra snts tvat svasamskravisesayogt tatsannidhau pr<a>sddidharmotpatteh 1 3 / ghors tu <bhi>sdidharmanimittatvt 14 / mdhs ca varandidharmahetutvt / tanmtrni punar asntaghoramdhni / ato Vises ity ucyante 15 / tad ete yath vykhyt avises visesh purusrthasiddhyartham bahudh vyavatisthante / kasmt / na hy etesm ekadhvasthne purusrthah siddhyatiti / / 3 8 / / ' aha: atisamanyoktam idam ity ato na pratipadyamahe / tasmad vaktavyam katham 16 visesnm avasthnam iti /
1 K. and P.: vedyasvedanam D. vedyasvedanam, s.m. svedyasvedanam 2 D. annapanktih, s.m. annapaktih 3 K. and P. omit ca. D. adds ca. 4 K. and P.: taijasah D. taijasah, s.m. ojasah 5 D. gandhasamvahanam, s.m. gandhasamvahanam 6 0 P. pavanasksepano 7 K., P. and B.: dharmmbhasah D. dharm0, s.m. vars0 We follow Chakravarti. 8 K. and P.: visesanam D. visesanam, s.m. visosanam 9 D. acchyatvd, s.m. ucchyatvd 10 D. sarvato gateh n K. and P.: avyhaviskambhbhym D. avyhaviskam0, s.m. vyhaviskam0 12 All the Mss read ucyante. 0 13 All the Mss read prsddi . We follow Chakravarti. 14 All the Mss read sesdidharma0. 15 B. ity abhidhiyante 16

10

15

20

25

D. katham, s.m. katidh

228 ucyate:

YUKTIDIPIKA

SKSM MTPITRJH SAHA PRABHTAIS TRIDH VISESH SYUH / (SK39ab) 5 tatra sksm nma cestsritam 1 prnstakam 2 samsarati 3 / mtpitrjs* tu dvividhh / jaryuj andajs ca / tesm kosopahrth / kos lomarudhirammssthisnyusukralaksanh / tatra lomarudhirammsnm mtrtah sambhavah / asthisnyusukrnm pitrtah / tatraivsitapitdhysd 5 astau kosn apare vycaksate / katham punar esm kosatvam / vestanasmarthyt / yath kosakrah kosenvestito 'svatantra evam sksmasariram saprnam etair vestitam asvatantram tat tat 6 karmopacinoti / prabhts7 tdbhijjh svedajs ca / tad etais trividhair visesair daivamnavatairyagyonalaksanas trividho bhtasarga rabhyate / tatra devnm caturvidham sariram pradhnnugrahd yath paramarser virincasya ca 8 , tatsiddhibhyo yath brahmanah putrnm tatputraputrnm ca, mtpitrto yathditeh 9 kasyapasya ca putrnm kevald v yath pitrto mitrvarunbhym vasisthasya / manusynm 10 tu jaryujam / dharmasaktivisest tu kasyacid anyathpi bhavati yath dronakrpakrpidhrstadyumndinm / tiryagyoninm 11 api caturvidham jaryujam gavdinm andajam caiva paksinm / trndes codbhijjam ksudrajantnm svedajam smrtam / / 20 evam trividh vises vykhyth / tatra kecin niyath kecid aniyat iti / ha: ke punar atra niyath ke vniyat iti / ucyate: SKSMS TESM NIYAT MTPITRJ NIVARTANTE //(SK39cd) 25 sksm sargapralayn nityh / mtpitrj nivartante / saha prabhtair iti vartte 1 2 / kecit tu prabhtagrahanena bhynm eva visesnm grahanam icchanti / tesm udbhijjasvedajayor 13 agrahanam / tasmd ubhayath prabht ity etad anavadyam /
1 2 D. s.m. prnstakam 3 D. samsarati, s.m. samharati 4 K., P. and B.: mtrpitrjs 5 B. atraiv0 D. tatraivsitapit0, 6 P. tut 7

10

15

D. corrects cestastakam(?) into cestasrikam, which is again corrected into cestarthesu asritam.

s.m. tatraivsitaptt0

8 D. virancasya, s.m. virancasya ca 9 P. repeats yath brahmanah putrnm tatputraputrnm 10 B. manusynm K. manusynm, s.m. manusynm 11 B. tairyagyoninm 12 D. vartante 13

B. daivasmnusatairyagyonilaksanas D. pravamnavatairyagyeno laksanas, s.m. prabh tdbhijjh svedajs ca tad etais tridhair visesair daivamnavatairyagyonalaksanas in the place of yathditeh

B. udbhijasvedajayor

ASTAMAM HNIKAM SK39

229

ha: sksmnabhidhnam 1 aprasiddhatvt / mtpitrjs ca prabhts ca2 prasiddh ity ato yukta esm parigrahah / sksms tv aprasiddhh 3 / tasmd vaktavyam katham esm utpattir astitvam veti / ucyate: <...(?)> prvasarge prakrter utpannnm prninm sattvadharmotkarsd antarena dvayasampattim manasaivpatyam anyad v yathepsitarn prdurbabhva / tad etad adypi cnuvartate 4 yat kacchapik nirpitenndadhranam 5 karoti / priyam khalv api caksus ninksya krtrtham tmnam manyate 6 / tasym api ksinym vksiddhir 7 babhva / abhibhsya 8 prnino yad icchanti tadpdayanti / tad adypy anuvartate yac chahkhl vitatenpatyam 9 bibharti / priyam khalv api sambhsya mahatim prltim anubhavati 1 0 / tasym upakslnym hastasiddhir babhva / samsprsya pnim Tpsitam artham upapdayanti / tad etad adypy anuvartate yat priyam cird lokya pnau samsprsya pritir bhavati 1 1 / tasym 12 upakslnym slesasiddhir 13 babhva / linganena 14 prnina Ipsitam labhante / tad etad adypy anuvartate yat priyam lihgya nirvrtir 15 bhavati / tasym upakslnym dvandvasiddhir rabdh / stripumsau sahghrsypatyam utpdayetm 16 mamedam mamedam iti ca parigrahah pravrtth / etasminn evvasare 17 samsro varnyate / tatra ccrynm vipratipattih / paiicdhikaranasya tvad vaivartam sariram mtpitrsamsargakle karanvistam 18 sukrasonitam anupravisati / tadanupravesc 19 ca kalaldibhvena vivardhate / vydhvayavam 20 tpalabdhapratyayam mtur udarn nihsrtya yau dharmdharmau satsiddhyupabhogakle krtau tadvasd avatisthate yvat tatksayc chariraptah / tatra 2 1 yadi dharmasamskrtam karanam tato dyudesam 22 sksmasarirena prpyate tadviparyayt tu ytansthnam tiryagyonim v misrlbhvena mnusyam / evam tivhikam sksmasanram indriynm dhranaprpanasamartham nityam bhyenpyin parivestyate parityajyate ca /
1 K., P. and B.: sksmabhidhnam D. suksmabhidhanam, s.m. sksmnabhidhnam 2 D. adds prabhts ca in the right margin. 3 D. apratisiddhh 4 B. apy anuvartate 5 B. kacchapik niriksiten0 D. kacchapiknirpiten0, s.m. kacchapik niriksiten0 6 B. manyante 7 D. vvaksiddhir(?), s.m. vksiddhir 8 D. abhibhsya, s.m. abhilusya 9 K. and B.: vikrten0 D. vikrten0, s.m. vitaten0 10 D. mahatim pritim anubhavati, s.m. mahati pritir bhavati 1X

10

15

20

25

D. bhavati, s.m. bhavatiti After bhavati D. repeats and deletes asym upaksinym hastasiddhir babhva ... pnau samsprsya pritir bhavati. 12 K., P. and B.: asym D. asym, s.m. tasym 13 D. slesasiddhir, s.m. evesabuddhir 14 D. aliriganena 5 D. nirvrtir, s.m. nirvrto D. utpyetm, s.m. utpdayeta 17 B. avasare D. karanvistam, s.m. karannupravistam 19 D. tadanupravesc ca, s.m. tadvesas ca 20 D. vayavam, s.m. vayav 21 K. and P.: tava D. tava, s.m. tatra D. tato dyudesam, s.m. tato 'nyadesam

230

YUKTIDIPIKA

p<a>taiijales1 tu suksmasariram <satsiddhiksaye(?)>2 purvam indriyani bijadesam nayati tatra tatkrtsayavasd dyudesam ytansthnam v karanni [v] prpayya nivartate / tatra caiva yuktsayasya karmavasd anyad utpadyate yad indriyni bij adesam nayati tad api nivartate / sarirapte cnyad utpadyate / evam anekni sarirni / vindhyavsinas tu vibhutvd indriynm bijadese vrtty janma tattygo maranam / tasmn nsti sksmasarIram(cf.SV.tmavda62) / tasmn nirvisesah samsra iti paksah / es sksmasarirotpattih 3 / / 3 9 / / ha: evam anekaniscayesv cryesu bhavatah k pratipattir iti / ucyate: yat tvat patanjalir ha "sksmasariram vinivartate punas cnyad utpadyate" tat "sksms tesm niyath" (SK39c) iti vacand asmbhir nbhyupagamyate / tasmt PRVOTPANNAM ASAKTAM NIYATAM MAHADDI SKSMAPARYANTAM / SAMSARATI NIRUPABHOGAM BHVAIR ADHIVSITAM LINGAM //(SK40)

10

15

20

25

30

tatra prvotpannam ity anena mahaddeh sksmaparyantasya lingasy 4 sargapralayn nityatvam ha / asaktam ity anena gdhasthirabijnupravesam caste / na hi lihgam kvacid vyhanyate / kirn tarhi / liksdibljam apy visati, badaragolam 5 api bhittv pravisati / niyatam ity anena pratipurusavyavasthm 6 pratijnti / sdhrano hi mahn prakrtitvd iti vrsagannm paksah / mahaddity anena prnstakam parigrhnti <pr vn manah> 7 prndys ca panca vyava iti / sksmaparyantam iti tattvntarapratisedham 8 haitvad eva nto 'nyad iti / samsaratiti gatim caste / tatas cvibhutvd bijvesatygau pra<ty>khytau9 bhavatah / nirupabhogam iti sarirntarasyvaksam karoti / sksmasarirasya hy upabhogasmarthye 'bhyupagamyamne sarirntarasya niravaksatvd anutpattiprasangah syt / bhvair adhivsitam ity anena bhvstakaparigraham dyotayati / buddhirpair iha dharmdibhir adhivsitam / tatsmarthyt sarvatrpratihatam prnstakam sksmasarire Vasthnagamanamtraphale vyavasthitam / dyutiryakpretesu samsaratiti tenaiva crthasiddhau sarirntaraparikalpannarthakyam / ato na bahni sarirni / / 4 0 / / yat punar etad uktam(187.12, 230.6) vibhutvd indriynm svtmany avasth<ne>10 vrttilbho vrttinirodhas ca samsra ity ayuktam etat / kas1 A\\ the Mss read ptanjales. We follow Pandeya. 2 All the Mss read yatsiddhikle. 3 K., P. and B.: sksmasarirasyotpattih (this is also 4 D. lingasy, s.m. lingasya 5 D. badaragalomam, s.m. badaragolakam 6 D. pratipurusasya vyavasthm 7 All the Mss read prvtmnah. 8 D. tattvntaram pratisedham 9 All the Mss read prakhydtau. 10

possibly the original reading).

All the Mss read avasthnam.

ASTAMAM AHNIKAM SK39,40,41

23J.

mat / vibhutvsiddheh / na hi vibhutvam indriynm kascid abhyupagacchati / kirn kranam / sat at opalab dhiprasangt yugapadupalabdhiprasangc ca / <karannm>1 hi vibhutve satatopalabdhiprasango visaynm pratibandhbhvt / [prasajyeta] prptyavisesc ca sarvavisesnm yugapadupalabdhiprasangah, vyavahitavisayagrahanam ca / sarvatra sannidhnt sannikrstaviprakrstayoh pratyaksnumngamnm cvisesah prasajyeta 2 / vrttivisest tadvisesa iti cen na hetvabhvt / vibhnm ihsti vrttivisesa ity atra hetur anuktah / tasmn na karannm 3 vibhutvam upapadyate / tasmt CITRAM YATHSRAYAM RTE STHNVDIBHYO VIN YATH CHY4 / TADVAD VIN VISESAIR NA TISTHATI NIRSRAYAM LINGAM //(SK41) yath hi citrasya, kudyam rte 'vasthnam nsti sthiiupurusdibhyo v vin chyyh / tadvad vin visesair na tisthati nirsrayam Ungarn / tasmd upapannam etat savisesah samsrah <iti> / ha: yadi savisesah samsro bijadesagamane sariram upalabheta / na tv evam / tasmd ayuktam etad iti 5 / ucyate: na visesitatvt / sksmam tac chariram iti 6 visesitam / tato nsyhetukam agrahanam iti / ha: sksmasanrayogt <sa>rvesvaratvaprasahgah7 / tasmd ayuktam tannimittam asygrahanam iti / ucyate: na anekntt / tadyath ksudrajantnm sksmasariram laghim [ca] / na caism Isvaratvam evam sarvaprninm syt / <...> atha matam / agrhyamnena sambandht sthlasypi sarirasyagrahanam pretnjanasiddhamlydivat <iti> / tad apy anupapannam anekntt / tadyath karanair agrhyamnaih sarirasya sambandhah, na cgrahanam, piscdibhir v tathaitad api syt / kirn ca antahkarannuvidhne caisvarybhimnt / yasya cadhyavasyam anuvidadhaty animdini tasyaisvaryam abhipretam / na tu yasya svabhvasiddhni / anyath tu pipHikdinm8 apy ksagamand aisvaryam syt / ha: na sarlrnupapattiprasangt / sksmasarirotpattau tarhi caritrthayoh <dharmdharmayoh> sarirntarasmarthyam virudhyate / tasmd ayuktam savisesah samsrah <iti> / ucyate: na anabhyupagamt / na dharmdharmanimittam vaivartam sariram / kirn tarhi / dhikrikam ity adosah / na cnekasariratvam abhyupagamyate / tasmt paksntaroplambho 7 y a m / kirn ca krtsnsayaparinmpratijnnt / krtsnasysayasya parinmam <pratixjnann9 evam uplabhyah syt / ekadesas tu no viparinmi / tasmn na kimcid
2 P. 3

10

15

20

25

30

35

K., P. and B.: kryakaranapurusanam D. s.m. kryakaranapurusanarn andB.: yate D. tasminn akarannm, s.m. tasmn na karannm D. yathchy, s.m. yath chy 5 K., P. and D. omit iti. 6 After iti D. repeats viSesitatvt 0sksmam tacchariram iti. 7 A11 the Mss read prvesvaratva . 8 B. pipilakdinm 9 All the Mss read jnann.

232

YUKTIDIPIKA

10

15

etat / nimittav<i>sesad 1 asayaikadesabhivyaktir ayukteti cet / syan matam / iha nimittnm alpabahutvavisesd saybhivyaktiviseso drstas tadyath vyvdikrodhdisu / pryanaklas cyam phalbhivyaktau nimittam / avisistas csau / tasmd sayaikadesaparinmo 'nupapanna iti / etac cyuktam / kasmt / naimittikatvt / prvakrtasya karmanah phalabhogaparisamptih smpratasya ca phalopabhogrtham viparinmah pryanasya nimittam, na tu pryano 2 viparinmasyeti 3 / kirn ca sarirntarbhvas ca / krtsnasysayasysybhivyaktim icchatah sarirntarbhvo nimittntarbhvt 4 prpnoti / tatra krteneti cen na kalaldyavasthnse 5 tadasambhavt / tatra krtbhym <dharmdharmbhym> hi bijvesah karanasya nispdito yvat kalaldyavasthyam eva / taccharlram vinastam iti tatra krtsaysambhavc charirntarnupapattiprasangah / kirn ca sthvarnm ca sarlrntarsambhavah / sayasya sthvarasarirrambhe caritrthatvt sthvarasarirena csayopdnsambhavt tasya samsrbhvah prptah / tasmd upapannam etat purusrtham disargotpannam sksmasariram samsarati yvac ca sa purusrtho na parisampyate tvat tisthata iti / / 4 1 / / ha: yadi purusrth lingasyotpattir abhyupagamyate tatsamanantaram evnena purusrtho Vasyayitavyah 6 , na punar devamnusatiryagbhvena punah punar javanjavibhvo(cf.MV.25.9) 'nusthtavya iti / ucyate: PURUSRTHAHETUKAM7 IDAM NIMITTANAIMITTIKAPRASANGENA / PRAKRTER VIBHUTVAYOGN NATAVAD VYAVATISTHATE LINGAM //(SK42) yady api purusrthasiddhyartham lingam utpadyate tathpi sattvarajastamasm traynm api <smyd>8 rajastamobhym abhibhte sattve tatpreritanimittanaimittikasanrendriyavisayopabhoganirvartakam 9 srnoti, tadyath "agnihotram juhuyt svargakmah" a y a m a r j y a m agnistomenbhijayati" iti / tatra phalepsay 10 yonih prndims ca sammukhikrtya kriym rabhate / gunavrtt<i>vaicitryc11 ca prayatnavn api manovgdehair malinam api karma karoti / tatas ca prakrter vibhutvayogt tena tena nimittenopasthpitam devamanusyatiryakpretdisarlram 12 ekasvabhvam api san natavad vyavatisthate Ungarn krtivisesopdnatygasmyatah / vibhutvam gunnm traynm api smyd itaretarbhibhavo drstah 1 3 / tasmd bhvanimittah samsrah /
1 2 B. pryeno 3 P. viparinmasyeyana...(not clear) 4 B. nimittbhvt 5 B. avasthvinse 6 B. 'vasyitavyo 7 D. purusrthe hetukam B. purusrthakahetukam 8 All the Mss read prdhnyd. 9 D. nivartakam 10 K., P. and B.:'phalecchay 11 All the Mss read gunavrttavaicitryc. 12 B. devamnusatiryak0 (this is also possibly the original 13

20

25

30

A\\ the Mss read nimittvasesd. We follow Raghavan.

reading).

B. 'bhipretah

ASTAMAM AHNIKAM SK41,42,43 tannimittnupdnn moksah / / 4 2 / /

233

ha: bhv iti tatrabhavatbhidhiyate / na csya sabdasyrtham pratipadymahe / tasmd vaktavyam idam ke punar ami bhv iti / ucyate: dharmdy bhvh / dharmo jnnam vairgyam aisvaryam adharmo 'jnnam avairgyam anaisvaryam ity ete bhvh / tatrcrynm vipratipattih / pancdhikaranasya tvad dvividham jnnam prkrtikam vaikrtikam ca / prkrtikam trividham tattvasamaklam smsiddhikam bhisyandikam ca / tatra tattvasamaklam samhatas ca mahrns tattvtman mahati ca 1 pratyayo bhavati / utpannakryakaranasya 2 tu smsiddhikam bhisyandikam ca bhavati / smsiddhikam yat samhatavyhasamaklam nispadyate yath paramarser jnnam / bhisyandikam ca 3 samsiddhakryakaranasya kranntarenotpadyate / vaikrtam tu dvividham / svavaikrtam paravaikrtam ca / svavaikrtam trakam / paravaikrtam siddhyantarni / ha ca tattvasamam vaivartam tatrbhisyandikam dvitiyam syt / vaikrtam atas trtiyam stk<au>sikam4 etad khytam / / atra tu tattvaih sahotpattyavisest smsiddhikam abhedenha vaikrtam api ca dvividham svavaikrtam tatra trakam bhavati / syt saptavidham paravaikrtam <su>trdi5 nirdistam / / iti / yath jnnam evam dharmdayo 'piti / vindhyavsinas tu nsti tattvasamam smsiddhikam ca / kirn tarhi / siddh<a>rpam6 eva / tatra paramarser api sargasamghtavyhottaraklam eva jnnam nispadyate yasmd gurumukhbhipratipatteh pratipatsyata ity <etad apy>7 ha "siddham nimittam naimittakasynugraham kurute nprvam utpdayati" iti(cf.YBh.onYS.4.12) / nimittanaimittikabhvc caivam upapadyate / tatra paramarseh patur ho 'nyesm klista ity ayam visesah / sarvesm eva tu trakdyavisistam / crya ha "trividh bhvh smsiddhikh prkrtik vaikrtiks 8 ca" (cf.SK 43ab) iti / tatra smsiddhikagrahant tattvasamaklam pratycaste naiva tad astiti / katham / yadi hi tath syt tattvntarnutpatti<h> / sanghto 9 vyhas cnarthakah syt / mahaty tpannam jnnam tatraivopalabdham iti kah sanghtrthah / tath carser 10 ho nopapadyate / pratibandhbhvt / na and D. omit ca. K. adds ca above the line. K., P. and D.: utpannakryakaranasya B. omits ca. K., P. and D.: stkosikam B. satkosikam. We follow Chakravarti. 5 All the Mss read svatrdi. 6 All the Mss read siddhirpam. 7 All the Mss read apity. 8 B. omits vaikrtiks. 9 All the Mss read nutpattisamghto. We follow Raghavan. 10r\ u. cersa, s.m. carser
J P. 2

10

15

20

25

30

234

YUKTIDIPIKA

10

15

hy asya karyakaranavyuhasamakalajnanotpattau 1 kascit pratibandho 'sti / aparivrtakhalatvd 2 yatah klntaram pratikseta 3 / tasmd asya 4 sahaiva kryakaranbhym 5 jiinam abhinispadyate pradlpapraksavat / ity at ah smsiddhikam / anyesm tu sattvasypatutvt klntarena prakrtyabhisyandd <yad> drg iti bhavati krsnasarpadarsanavat tat prkrtam / vaikrtam 6 tu dvividham prvavat / yath ca paramarser jiinam smsiddhikam evam mhtmyasarlrasyaisvaryam bhrgvdinm dharmah sanakdmm vairgyam, adharmo yaksaraksahprabhrtmm, anaisvaryam satsiddhiksayaklotpannnm mnusnm tirascm ca, rgo 'jnnam <ca> paramarsivarjynm 7 / prkrts tu tadyath vairgyam bhagavadsureh / tasya hi paramarsisambhvand 8 utpanno dharmo 'suddhim pratidvandvibhvd apaja<ghna>9 / tasym apahatym prakrteh 10 suddhisrotah pravrttam yennugrhito duhkhatraybhightd utpannajijiisah pravrajitah / tath mahesvarasamparkn nandina aisvaryam, nahusasygastyasamparkd dharma itydi / vaikrts tu bhv asmaddinm / evam trividhabhvaparigraht tv cryasya na sarvam svatah patanjalivat 11 , na sarvam paratah pancdhikaranavat / kirn tarhi / mahati svabhvtivrttih prakrtito 'lp svato vikrtitah / evam SMSIDDHIKS CA BHVH PRKRTIK VAIKRTS CA DHARMDYH12 / DRSTH KARANSRAYINAH /(SK43abc)

20

yath caite tath KRYSRAYINAS CA KALALDYH //(SK43d) trividhaiveti / taialdigrahanena sarirny ha / tesm krtivaisvarpyam caturdasavidhe samsre trividham / tatra smsiddhikas tvat vaivartnm grahanaksatratrdlnm 13 / jtikrtas ca visesah <yath(?)> hamsnm sauklyarn tittirimayrdinm 14 citracchadatvam iti / prkrtam yath mhtmy<a>sarlrbhi<dhy>nt15 tasya hy abhi<dhy>no16 bhavati "hantham putrn <sra>ksye17 ye me karma karisyanti ye mm param <cparam> ca jiisyanti (cf.239.13) / sa ydrk sargam abhidhyyati tdrk pradhnd utpadyate tadyath mahesvarasya rudrakotisrstau" iti / vaikrts tu kalaldy yath bhisagvede
2 D. aparivrtakhalutvd 3 K. and P.: pratiksate 4 D. tasmt sahaivsya, s.m. tasmd asya 5 B. kryakaranbhym 6 D. vaikrti, s.m. vaikrtam 7 r D. varyna( !) 1 s.m. varjynm 8 B. sambhsand 9 All the Mss read apajagma. 10 D. prakrte J1 B. patanjalivat 12 B. reads smsiddhikh prkrtik vaikrtiks ca bhv, 13 B. trprabhrtinm 14 D. titirimayrdinm 15 All the Mss read mhtmyam sanrbhimnt 16 All the Mss read abhimno. 17

25

^ . . P . a n d D . : krana

omitting dharmdyh. .

All the Mss read draksye. We follow Chakravarti.

ASTAMAM AHNIKAM SK43,44

235

'bhihitam "kslram pitv garbhini gauram putram janayati" (cf.Brh.U.6.4.14) iti / ete bhv vykhyth / esm vaisvarpyl lingasya gativisesah samsro bhavatiti 1 / / 4 3 / / ha: kasya punar bhvasynusthnt ko gamanaviseso lingasya nispadyata iti / ucyate: DHARMENA GAMANAM RDHVAM /(SK44a) ukto dharmah / tadanusthnd astavikalpym devabhmv utpattir bhavati / GAMANAM ADHASTD BHAVATY ADHARMENA /(SK44b) adharmo 'py uktah / tadanusthnt pancavikalpym2 tiryagbhmv utpattir bhavati / ha: ekabhmivisesanupapattih gativisest / yadi bhvnm bhmivisesanimittatvam niyamyate tenaikasym bhmau hmamadhyamotkrstatvam jtykrtisvabhvnugrahopaghtnmna prpnoti / ucyate: na tarhy anena bhmiviseso niyamyate / kirn tarhi / rdhvasabda utkrstavacanah / dharmena devesu mnusesu 3 tiryaksu cordhvagamanam 4 utkrstam janma bhavati / tathdharmd adhogamanam apakrstam janma bhavatiti 5 / JNNENA CPAVARGAH /(SK44c) casabdo 6 'vadhranrthah / jnenaivpavargah na bhvntareneti / yad uktam anyair cryih "virgyt purusakaivalyamjnnavairgybhymca" iti tatpratisiddham bhavati / ha: yadi punar virgyt purusakaivalyam abhyupagamyate 7 ka evam sati dosah syd iti 8 / ucyate: na sakyam evam pratipattum / kasmt / samsranimittpratipaksatvt / yadi rgdinimittah pradhnapurusasamyogah 9 syt prptam idam tatpratipaksena vairgyena viyogo bhavisyatiti / na tv evam / kutah / samyogakrte kryakaranasarge sati nispatteh 1 0 / kryakaranavyhottaraklam hi rgo 11 bhavati / tasmn nsau kryakarananispatter nimittam iti sakyam srayitum / yasya tu jfinn moksa iti paksas tasya pratipaksd ajnnd
X D. omits iti. 2 D. pancavikalym, s.m. pancavikalpym 3 D. mnusyesu P. mnavesu (this is also possibly the original reading). 4 B. cotkrstagamanam D. ca rdhvagamanam, s.m. ca utkrstagamanam 5 P. omits iti. 6 8

10

15

20

25

30

D. ca sabdo D. upagamyate, s.m. upagamyeta K., P. and D. omit iti. P. puru$am samyogah 10 D. puts nispatteh in parentheses. D. gamo, s.m. rgo

236

YUKTIDIPIKA

bandha 1 iti praptam asti / <sa>2 casau prag api karyakarananispatteh / tasman na vairgyn moksah / ata eva na 3 jnnavairgybhym mokso 'sty ubhayanimittasambhavt / tasmt sktam jnnenaivpavargah <iti(?)> / VIPARYAYD ISYATE BANDHAH //(SK44d) 5 jfinaviparyayo 'jfinam, tasmd bandhasA trividho bhavati / prakrtibandho daksinbandho vaikrikabandhas ceti / / 4 4 / / ha: kasmd bhvt prakrtibandho bhavati <iti> / ucyate: VAIRGYT PRAKRTILAYAH /(SK45a) 10 vairgyd astasu 5 prakrtisu layam gacchati / asv ucyate prakrtibandha iti / ha: yadi vairgyt prakrtilayah <syt> prpt<am idam>6 prakrtau vairgyam njasam any prakrtis trigun kranabht kryabht kryakranabhtkryakranabhtcetan paratantr ceti / anyah puruso nirguno na kryam na kranam na kryakranam tadviparitas 7 cetanah 8 svatantras ceti tato 'pi prakrtilayah 9 , tatas cnirmoksaprasahga iti 1 0 / ucyate: viparyayd iti vartate / tad ihbhisambhantsymah / tatas ca viparltam yad eva vairgyam tustikndnupatitam prakrtydisu paratvbhimnah / tata eva prakrtilayo bhavati nnyasmt / athavtrpi yat tat prakrtv anyatvajnnam tata eva mokso na vairgyt / kutah / bhavabljpratipaksatvd iti hy 1 1 uktam mbhasikasya ca moksaprasangt / tuly hy asya nntvasamvid 12 sangadosanivrtteh 13 / na caitad istam / tasmd yuktam etad vairgyt prakrtilaya iti / ha 14 : atha daksinbandhah kutah / ucyate: SAMSRO BHAVATI RJASD RGT /(SK45b) yo 'yam drstnusravikavisaybhilsah sa rgah / tatra drstavisayargt 15 tatprptinirvartakam 16 karma karoti tatas ca tatropapadyate / nusravika1 D. bandha, s.m. dharmah 2 All the Mss read na. 3 D. encircles na. 4 D. tasmt tri bandhas(l), s.m. tasmd bandhas 5 B. astsu 6 AU the Mss read prpto yad etat. 7 K. and P.: na tadviparitah D. na ca tadviparitah 8 D. cetan 9 K. and P.: prakrtau layah D. prakrtau layah, s.m. prakrtilayah 10 B. eva iti D. iti, s.m. eva iti 1J B. omits hy. 12 B. nntvam samvid D. nntvasamvidah 13 B. sangadvesa0 D. sangadosa0, s.m. sangadvesa0 14 D. changes the position of ha to the beginning of the new line. 15 D. drstavisaye rgt 16

15

20

25

K., P. and D.: nivartakam

ASTAMAM AHNIKAM SK44,45

237

visaybhilsd1 agnihotrdisu pravartate tatas ca svargdispapattir bhavati / asau daksinbandhah / drstnusravikavisaybhilsadvrena tannirvartake karmani pravartamno gunavrttivaicitryd anistaphalanirvartakam 2 api karma karoti / evam mnusye gatyantare yopapattih sarvsau 3 rgt / ha: rjasagrahannarthakyam tatprvakatvd 4 rgasya / rajonimitta eva hi rgah / tatra samsro rgd ity eva5 vaktavyam / rjasagrahanam anarthakam iti / ucyate: na visayavisesanatvt / visaye6 yo rgah sa 7 samsrahetur 8 ity asyrthasya jnpanrtham idam ucyate / anyath yo yateh sttviko yamaniyamadhyndyanusthnargah 9 pravacanargo v so 'pi samsrya syt / AISVARYD AVIGHTAH10 / (SK45c) yad astagunam aisvaryam animdi prg upadistam (193.1) tasmt sve sve 11 visaye Vighta 12 utpadyate / tadabhiratir vaikriko bandhah / ha: yadi 13 [tribhis] tribhir nimittair vairgydibhis trividho bandho nirvartyate yad uktam(236.5) ajnnd bandha iti tad ayuktam / bhvntaram hy ajnnam / atah phalntarena bhavitavyam iti / ucyate: na mlakranatvt / jnnavarjitnm hi bhvnm yat phalam tatrjnnam mlam tannimittatvt sarvesm / na hi jnnivairgyam alam prakrtilayya, tathetarni paramarsydv adrstatvt / vicitram kryam ekasmt krand ayuktam iti vairgydiny asdhranni prthak kalpyante / sdhranam tv ajnnam / ato na kascid dosah / VIPARYAYT TADVIPARYSAH //(SK45d) anaisvaryt tv animder astavidhd avightaviparyayo vighto bhavati / tad evam etad astavidham dharmdividhnam 14 updystavidham naimittikam upapadyate / evam esa tattvasargo bhvasargas ca vykhytah / etac ca vyaktasya rpam pravrttis ca parikalpyate / phalam idnim vaksymah / / 4 5 / / iti 15 yuktidipikym astamam hnikam trtiyam ca 16 prakaranam /
1 D. corrects visa (not clear) into 2 P. nivartakam 3 D. sarvsau, s.m. s sarvsau 4 D. tatprvaga0 5 B. evam 6 D. visaye, s.m. visayesu 7 B. omits sa. 8

10

15

20

25

visay in the right margin.

D. samsre hetur P. anusthnnurgah D. aisvaryd avightah, s.m. aisvarydivightah 11 D. sve sve, s.m. svapne 12 D. vighta 13 D. yat 14 D. dharmdividhnam, s.m. dharmdivicram 15 B. omits iti. B. hnikam ca trtiyam

N a v a m a m

A h n i k a m

aha: kim punas tatphalam iti / ucyate: yah khalu ESA PRATYAYASARGO VIPARYAYSAKTITUSTISIDDHYKHYAH1/ (SK46ab)

tatphalam iti vakyasesah / esa iti vaksyamanasya sammukhikaranartham ucyate / pratyayasarga iti pratyayah padrtho laksanam iti paryyh / pratyaynm sargah pratyayasargah padrthasargo laksanasarga ity arthah / athav pratyayo buddhih niscayo 'dhyavasya iti paryyh / tasya sargo 'y am > at ah pratyayasargah pratyayakryam pratyayavypra ity arthah / athav pratyayaprvakah sargah pratyayasargah / buddhiprvaka ity uktah / katham / evam hi sstram "mahaddivisesntahsargo buddhiprvakatvt / utpannakryakaranas 2 tu mhtmyasarira ekkinam tmnam aveksybhidadhyau 'hantham putrn sraksye 3 ye me karma karisyanti / ye mm param cparam ca jnsyanti>(cf.234.26) / tasybhidhyyatah pafica mukhyasrotaso devh prdurbabhvuh / testpannesu 4 na tustim lebhe 5 / tato 'nye tiryaksrotaso 'stvimsatih 6 prajajfie / tesv apy asya matir naiva 7 tasthe / athparena vordhvasrotaso devh prdurbabhvuh / tesv apy utpannesu naiva krtrtham tmnam mene / tato 'nye 'stv 8 arvksrotasa utpeduh" / evam tasmd brahmano 'bhidhynd utpannah, tasmt pratyayasargah / sa viparyaykhyo }saktykhyas tustykhyah siddhykhyas ceti / tatrsreyasah sreyastvenbhidhnam viparyayah 9 / vaikalyd10 asmarthyam asaktih / cikirsitd nena nirvr<t>islx tustih / yathestasya sdhanam siddhih / tadyath dharmrthapravrtto 'gnistomdin parityajya samkaram kurvita so 'sya viparyayah, sdhanavaikalyd asmarthyam asaktih, dhnamtrasantosas tustih,

10

15

20

*D. pratyayasargo viparyaya0, s.m. pratyayasargaviparyaya0 utpannakryakranas D. kryakarana$, s.m. kryakranas and D.: draksye testpannesu, s.m. tesv apy utpannesu D. corrects na tustim lebhe into naiva krtam tmnam mene, and deletes the corrected phrase. ^Before fstvimsatih D. writes and deletes devh prdurbabhbuh, testpannesu na tustim la. B. na ve 8 D. omits 'stv in the text, but adds astau in the left margin. P. bhidhnaviparyayah 10 B. kaivalyd K. and D.: nivrttis P. nirvrttis B. not clear.
2 B. 3 B. 4 D. 5

240

YUKTIDIPIKA

krtsnasya kriyavisesasyanusthanam siddhih / evam <anya>rthadisu1 yojyam / yas cyam caturvidhah phalaviseso2 viparyaydir khytah GUNAVAISAMYAVIMARDT TASYA CA BHEDS TU PANCSAT / / (SK46cd) 5 gunnm vaisamyam gunavaisamyam / gunavaisamyam prdhnyagunabhvayoga ity art hah / gunavaisamyd vimardo gunavaisamyavimardah pratyayaparyyena sattvarajastamasm itaretarbhibhavah 3 / tannimitt esm pratyaynm pancsad bhed bhavanti / katham iti / ucyate: PANCA VIPARYAYABHED BHAVANTI / (SK47ab') tamo moho mahmohas tmisro 'ndhatmisra iti / tatra sreyasi pravrttasya pratyay<>vare4 sreyo 'bhimne dyo 5 viparyayas tamaity abhidhiyate / bhautikesv kresu sirahpnydisv tmagraho yo ' y a m vydhoraskah sitadasanas tmrksah pralambabhuh so 'ham iti / tath sravanasparsanadarsanarasanaghrnavacandnaviharanotsargnandasamkalpbhimndhyavasyalaksansu6 karanavrttisv aham srot drast cety evamdir 7 dyaklapravrtto grahah prvasmd a<v>aro8 moha ity ucyate / katham punar ayam avara iti / ucyate: prva<h>9 sarirendriyavyatiriktam upalabdhum icchan sauksmyt tadanadhigame bhtkram abhtam pra<dhnam>10 paraparikalpitam vnumanyeta svayam v parikalpayed iti na mrgd drpagatam etat / ayam tu pratyaksdhigatotpattisthitivinsesv anekarpesu 11 kryakaranesv 12 aham ity abhimanyate / tasmt prvasmd avarah / bhye tu visaye mamedam ity abhinivesah prvasmd avaro 13 mahmohah / katham prvasmd avara iti / ucyate: prvah saririno 'pratyaksatvt karanavrttyavisesd 14 vtmavrtteh kryakarane 15 kuryd tmabuddhim iti sakyam etat / bhinnanimittkradesasvabhvaprayojannugrahopaghtotpattisthitivinsms ca mtrpitr[putra]bhrtr<svasr(?)>putradragohiranyavasancchdandln 16 ayam akasmd
1 All the Mss read arthdisu. 2 D. phalaviseso, s.rn. phale viseso 3 K. and P.: itaretarabhvah D. itaretarabhvah, s.m. itaretarbhibhavah 4 All the Mss read pratyayavare. We follow Chakravarti. 5 D. rso 6 P. omits -darsana-. 7 D. evamdir, s.m. evamdin 8 All the Mss read adharo. We follow Chakravarti. 9 All the Mss read prvam 10 K., P. and B.: pramnam D. pramnam, s.m. prnam 11 K., P. and B.: anekarpakesu D. anekarpakesu, s.m. anekarpesu 12 D. kryakaranesu, s.m. kryakranesu 13 14 D. 15 D. 16

10

15

20

25

K., P. and B. omit avaro mahmohah katham prvasmd. D. adds this phrase in the right margin. vrttivesesd, s.m. vrttyavisesd kryakaranesu, s.m. kryakranesu K., P. and D.: mtrpitrputrabhrtrputradra0 D. parenthesizes putra of mtrpitrputra.

NAVAMAM AHNIKAM SK46,47,48

241.

tmatvena pasyati / tasmt 1 prvasmd avarah / krodhas caturtho viparyayah prvasmd avarah tmisra ity abhidhlyate / katham punar ayam prvasmd avara iti / ucyate: prvo 'bhinivesapratisedham abhyanujnti 2 / yadsya bhyadravyaviyoge kascit kusalasamsrsta evam braviti samsrasya ... buddhv avasthpya vimrsatm yvad ayam klo yadi 3 kascit priyenviyuktaprvah / tasmd 4 gampyisu bhyesu dravyesu vidus nbhinivesah krya iti, tad pratyha satyam evam etad iti / sannikrstas tu viyogakla iti <...(?)> na buddhir avasthpayitum sakyate / krodhvistas tu svavikalpitagrhaviparitabuddhir asakyo dandenpi nivartayitum / tasmt prvasmd avarah / maranavisdah paficamo viparyayah / prvasmd avaro 'ndhatmisra ity abhidhlyate / katham punar ayam prvasmd avara iti / ucyate: prvo 'bhinivest pratisidhyamnah pratlkram antato jihmksiniriksitenpi 5 tvad 6 rabhate / na tu brahmdau stambaparyante samsre svanimittaniyata<sarlra(?)>ptasya 7 vinsasya kenacit pratikrah krtah / tasmd aparihryam maranam anusocan prvasmd avarah / ity ete pafica viparyayabhed bhavanti / ASAKTIS CA KARANAVAIKALYT / ASTVIMSATIBHED /(SK47b'c) bhavatity anuvartate / tatra bhyakaranavaikalyam saha manasaikdasaprakram / saptadasavidham buddhivaikalyam / ete 'saktibhedh 8 / TUSTIR NAVADHSTADH SIDDHIH / / (SK47d) evam caturvidhasya pratyayasargasya gunavaisamyavimardanena pancsad bhed bhavanti / vistarena tu padrthasatashasram nantyam v laksannm / katham iti / ucyate: yasmt 9 BHEDAS TAMASO 'STAVIDHAH / (SK48a) ya ete panca viparyayabhed vykhyts tesu tamaso 'stavidho bhedah / katham / paravijfinam sritya pravrttasystsu prakrtisv aparsu parbhimnagraht 10 /
1

10

15

20

25

30

D. tasmt prvasmd avarah krodhas caturtho viparyayah prvasmd avarah tamisra ity abhidhiyate , s.m. tanmoksam asmd avarah tmisra ity abhidhiyate 2 B. atyanujnti 3 D. klo yadi, s.m. klopaciti 4 B. tasm 5 P. jihmksinirtksito npi 6 D. not clear, s.m. tvad K., P. and B.: svanimittaniyatatamaptasya D. svanimittaniyatatamaptasya, s.m. svanimittaniyatatap tasya 8 D. saktibhedh 9 B. yasmt / mohasya ca D. graht, s.m. grahant

242

YUKTIDIPIKA MOHASYA CA / (SK48b')

kim / astavidho bheda iti / casabdt kryakaranasmarthye 1 'stavidhe 'nimdv aham iti pratyayah / DASAVIDHO MAHMOHAH / (SK48b') 5 mtrpitrbhrtrsvasrpatniputraduhitrgurumitropakrilaksane 2 dasavidhe kutumbe yo ' y a m mamety abhinivesah [drstnusravikesu v sabddisv ity apare] sa dasavidho mahmohah parisamkhyyate / TMISRO 'STDASADH / (SK48c) 10 astavidhe kryakaranasmarthye 3 dasavidhe ca kutumbe visayesu v yah pratihanyamnasyvesah 4 / TATH BHAVATY ANDHATMISRAH / / (SK48d) tatheti smnytidesrthah / andhatmisro 'stdasadhaiveti / katham / asv apy astavidht kryakaranasmarthyd 5 dasavidhc ca kutumbt pratyava<sitasya(?)>6 visdah / evam ete panca viparyayabhedh 7 svalaksanato visayavises laksith 8 / tatrpi cstsu prakrtisu sattvarajastamasm samhataviviktaparinatavyastasamastnm 9 paratvbhimnabhedd ekaik prakrtih pancadasabhed / ata 1 0 eva te 'stau paiicadasa vimsam 11 sat am ca bhavanti / yath mokse pravrttasyaivam dharmakmesv api / ekah padrtho vistarena parisamkhyyamno 'nantabhedah sampadyate / nidarsanamtram etad cryena krtam / evam asaktydisv api laksanntaresu yojyam / seyam avidy paiicaparv saprapanc vykhyt / tadanantaroddistn asaktibhedn vaksymah / / 4 8 / / ha: ativysbhihitam idam iti nsmkam buddhv avatisthate / tasmd viparyayoktam bhedbhidhnam parityajya vaktavyam katham asaktir 12 astvimsatibhedeti / ucyate: EKDASENDRIYAVADHH SAHA BUDDHIVADHAIR ASAKTIR UDDIST13/ (SK49ab)
1 B. kayakarana0 2 K. and P. omit -putra-. D. adds putra above the line. 3 D. and B.: kryakrana0 4 B. prakrtih any a 5 P. and D.: kryakrana0 6 K., P. and B.: pratyavasnasya D. pratyavamnasya, 7 D. bhedh bhavanti, s.m. bhedh 8 B. has a lacuna for laksith. 9 D. sarnhatavivikta0, s.m, samhatavibhakta0 10 B. ta ' 11 D. pancadasavimsam 12 B. asaktim 13

15

20

25

s.m. pratyavasnasya ca

D. uddistah

NAVAMAM AHNIKAM SK48,49

243

indriynm vadh indriyavadhh1 svasamskravisesayogt2 prakarspannena tamas grahanarpasya sattvasybhibhavt svavisayesv apravrttayah 3 / tadyath bdhiryam ndhyam aghratvam 4 mkat jadat ca y / unmdakausthyakaunyni klaibyodvartapanguth / / (see e.g.STK.onSK49) tatra bdhiryam srotrasya, ndhyam caksusah, aghratvam nsikyh, mkat vco, jadat rasanasya, unmdo manasah, kausthyam tvacah, kaunyam pneh, klaibyam upasthasya, udvartah pyoh, pahgut pdayor ity evam indriyavadh ekdasa / anye tu SAPTADASAVADH5 BUDDHIR VIPARYAYT TUSTISIDDHINM / / (SK49cd) tatra tustayah prakrtydy vaksyamnh, tsm dvididho viparyayah / avyutpannasya yogadharmena tasym bhmv apravrttih / vyutpannasya 6 cottarabhmyaparijnnt prvasym bhmau <k>semarpena7 grahanam / tmavido v sarvsu bhmisu / tesu yat prvam tad asaktibhvbhipretam, yan madhyamam tadpeksikam / katham / tanmtrabhmyavastho hi yogy asmitdibhmyanavajayt tusto mahbhttikramt siddhah / tath vijitsmitrpo mahaddyavasthpeksay tustah prvabhmyapeksay 8 siddhah / evam mahadavasthah 9 pradhnpeksay 10 prvpeksay ca / pradhnvasthah 11 puruspeksay prvpeksay ca / gunapurusntarajnas tu siddha eva / tasmd avyutpannasymbhahprabhrtisu navnambhahprabhrtayo buddhivadhs 12 trakdiviparyayenstv atrakdayah / es khalv asaktir astvimsatibhed / tustis tu sannihitavisayasantosc cikirsitd arthd nena ni<r>vrtih13 smnyata ekaiva / pratyartham anant satena tustah sahasreneti 14 / sstre tu bhydhytmiknm sukhaduhkhamohnm prptisv apagamesu <v> vcvyavasthyalaksan 15 upyanavatvn nava tustayo bhavanti / tsm
1 D. vadha indriyavadhah 2 K., P. and D.: svasamskravisayayogt 3 D. apravrttay 4 D. aghratvam, s.m. aghratvam 5 B. saptadasavidh ca 6 D. vyutpannasya 7 All the Mss read bhmv aksemarpena. 8 P. prvam bhmy0 9 D. mahadavasth 10 D. pradhnpeksay, s.m. pradhndyapeksay 11 D. pradhnvasth 12 B. buddhibdhh D. buddhivadhh, s.m. buddhibdhh 13 All the Mss read nivrttih. 14 D. sahasreneti, s.m. sahasrena tusteti 0 0

10

15

20

25

K., P. and B.: vcvyavasthya D. vc vyavasthya

244

YUKTIDIPIKA

ADHYTMIK<YAS>1 CATASRAH PRAKRTYUPDANAKALABHAGYKHYAH2/ (SK50ab) dhytmik<ya>3 iti sarirasaririnor visesam upalipsamnena yogin yadntmany 4 tmabuddhir avasthpyate s khalv dhytmik! 5 tustih, santosah ksema ity arthah / tsm prakrtykhy / yad vitvitaih pradhnam adhigamya tatprvakatvam ca mahaddinm vikrnm, nantyc ca pradhntmanah krtsnasya mahaddibhvena viparinmsambhavd ekadesasyprakrtivikrabhtasya bhoktrtvam akartrtvam 6 cdhyavasya sangad<o>sanivrttim 7 labhate sdy tustir ambha ity abhidhiyate / kasmt / amitarn hi pradhnatattvam bhti jagadbijabhtatvn mahaddibhvaparinmena nynasyaikadesasytmana evprt tadvyatirekena cnyasyaikadesasyobhayadharmino 8 bhoktrbhtasya sadbhvt samprakslane 'pi copasamhrtam vaisvarpyasynucchedt / tath ca sstram ha "ambha iti gunalingasannicayam evdhikurute 9 " <iti> / guns ca sattvarajastamrpsi / Ungarn ca mahaddi, atra sannihitam bhavati / tad idam pradhnam amitam bhty 10 amitam 1 1 upalabhyata ity ambhah / sa 12 khalv ayam yogi pradhnalaksanm bhmim avajitya tanmahimnca <jagad>13 asnyam drstv vyatiriktasya padrthntarasybhvam manyamnas tm eva bhmim kaivalyam iti grhnti / bhinne ca dehe prakrtau layam gacchati tatas ca punar vartate / tasym ca 14 tustv anye saptamahaddikranino Varuddh 15 drastavyh / tatra yath prdhnikasya puruse nsti vijiinam evam itaresm uttaresu tattvesu / mahatkraninah pradhne, asmitkranino mahati, tanmtrakranino 16 'hamkre / tadekadess caism bhoktrah prvavat / atrpi ca sattvdinm samhataviviktaparinatavyastasamastnm bhedd avidyvacchednantyam 17 avaseyam / ha: tustyavidyayor abhedah laksanaikatvt / astsu prakrtisv tmabuddhis tustih / tad eva ca tama ity avidyknde nirdistam / tasmt padrthasamkara iti / ucyate: na pratyayavisesat / tamah pradhnapurusopadese satyapry<a>nirdidhrayisay18 tayoh pradhnam eva jyyo na purusa ity abhi1 A\\ the Mss read dhyatmika. We follow Chakravarti. 2 B. klabhgkhyh 3 All the Mss read dhytmik. 4 K., P. and D.: yad antmany 5 K., P. and D. read siddhih after dhytmiki. 6 D. adds akartrtvam in the left margin. 7 K., P. and B.: sangadvesanivrttim D. sangadesanivrttim 8 D. dharminor 9 B. eva kurute 10 D. adds amitam bhti in the right margin. 11 B. amita 12 P. has only a horizontal line instead of sa. 13 All the Mss read tad. 14 D. adds ca in the left margin. 15 D. mahaddikranino 'varuddh, s.m. mahaddikranaviruddh 16 D. adds mahati; tanmtrakranino in the right margin. 17 D. avidyvacchednantyam, s.m. 0avidyvad bhednantyam 0 18

10

15

20

25

K., P. and B.: satyaprynirdidh

D. satyapry nirdidh

NAVAMAM AHNIKAM SK50

245

nivisate 1 / tustis tu kirn param ity sritya pravrttah 2 pradhnajnnamtre santost padrthntaram vijiitum eva ndriyate / kirn ca prahnavisest / nirdhamlo hy antmany tmagraho 'jnnottaraklabhvanayprahtavyah / tamobahulatvt tama ity abhidhiyate / pelavas tu 3 sattvabahulo darsanapranayas tustih / kirn ca tattvbhijayt / vijitabhmikasya hi yoginas tan<mahima>vasikrtatvd 4 bhmyantare 'pravrttis tustih / itarasya tv abhinivesamtram evety5 anayor visesah / tasmn na padrthasamkara iti vykhyt prakrtykhy tustih / yad tu saty api prakrtismarthye nnapeksya yathsvam 6 updnam bhvnm utpattih sambhavati prakrtyavisese sarvaklam utpattiprasangt / prakrtikrtam evedam visvam ity abhyupagacchatas tadavisesd goh 7 purusd utpattiprasangah 8 , purusasya v mahist 9 / kirn ca jtyabhedaprasangt 1 0 / prakrtikrtam idam visvam ity abhyupagacchato jtibhedo na syt tadavisest, drstam tpdnj jtyanuvidhnam 11 bhvnm / tasmt tad eva kranatvena parikalpayitum nyy<y>am12/ updnaikadesa 13 eva ca kryakranavidharm 14 bhoktety etasmd darsant sangad<o>sanivrttim15 labhate / s dvitiy tustih salilam ity abhidhiyate / katham punar etat salilam / saty updne vikro liyata iti / tath ca krtv sstram ha "salilam salilam iti vaikrikopaniptam evdhikurute sati tasmiml llyate jagat" iti / sa khalv ayam yogi prthivn 16 avajitya tanmahimnjagad asnyam drstv padrthntarasybhvam manyamnas tm eva bhmim kaivalyam iti 1 7 grhnti / bhinne ca dehe prthivydisu liyate / tatas ca punar vartate / yad ca saty updnasmarthye na 18 tvataiva bhvnm prdurbhvah / kirn tarhi / sannihitasdhannm api klam praty a<p>eks19 bhavati / klavisesd bijd ankuro 20 jyate 'nkurn nlam nlt kndam kndt prasava itydi / anyath tpdnnm sannidhnamtrt ksanenaivmism avasthvisesnm abhivyaktih syt / kirn ca klaviparyayenotpattiprasaiil K. and P.: abhiniviseta D. abhiniviseta, s.m. abhinivisate 2 D. pravrtt 3 D. piluvas tu, s.m. pevalas tu 4 All the Mss read tanmhtmyavasikrtatvt. 5 D. abhinivesamtrasev ity, s.m. abhinivesamtram eva ity 6 D. yath svam 7 D. tadavist dgoh, s.m. tadavisd goh 8 B. utpattih prasangah 9 D. mahisyt 0 10 D. jtibheda n B . jtyanabhidhnam 12 All the Mss read nyyam. We follow Chakravarti. 13 P. updnekadesa 14 K., P. and B.: kryakranavidhtm D. vidhtm, s.m. vidharm 15 All the Mss read sangadvesanivrttim. 16 B. prthivyn D. prthivn, s.m. prthivydin 17 D. adds iti in the left margin. 18 D. updnasmarthyena 19 All the Mss read pratyaveks. We follow Chakravarti. 20

10

15

20

25

B. bijnkuro

246

YUKTIDIPIKA

10

g a t 1 / upadanapurvakam visvam2 ity abhyupagacchatah saradi yavanam vasante vrihlnm utpattih prpnoti / na caitad istam / kim ca tadanuvidhnt / drsyante ca prninm klnurph svabhvhravihravyavasthh / tasmd asv eva kranam / tadekadesas cprakrtivikrabhto bhoktety etasmd darsant sangad<o>sanivrttim3 labhate / s trtiy tustir ogha ity abhidhlyate / katham punar ayam kla ogha iti / ucyate: salilaughavat sarvbhyvahant 4 tadyath salilaughas trnam 5 kstham asmnam prninm v svamrtisamsrstam sarvam evbhyvahati 6 / evam ayam klo garbhd blyam blyt kaumram kaumrd yauvanam yauvant sthviryam sthviryn maranam tath bijn mlam mld ankuram iti vahati 7 / tath cha ym eva prathamm rtrim garbhe bhavati purusah / samprasthitas tm bhavati sa gacchan na nivartate / / tasmd oghasmnyd 8 oghah klah / sa khalv ayam yogi klam avajitya padrthntarbhvam manyamnas tm eva bhmim kaivalyam iti manyate 9 / dehabhede ca klam anupravisati tatas ca punar vartate / yad tu saty api klasmarthye bhvnm utpattir bhgyny apeksate / kasmt / tatsannidhne 'py aprdurbhvt / saty api sdhanasmarthye klavisese ca kasyacid utpattir bhavati kasyacin neti / tasmd asti kranntaram yad apeksya bhvnm utpattir anutpattis ca / kim ca abhyutthnnupapattiprasangt / klamtrt phalam bhavatlty etad icchatah sstroktesu kriyvisesesv abhisecanavratopavsgnihotrdisv abhyutthnam na syt / kasmt / narthakyt 1 0 / asti ca / t asm an na klanimitt bhvnm 11 utpattih / kim ca tadanuvidhnt / drsyante khalv api prakrtyupdnaklvisese 'pi 12 bhgyavisest phalavisesh / tasmt tatsamskra eva kranam 1 3 / tadekadesas cprakrtivikrabhto bhoktety etasmd darsant sangad<o>sanivrttim 14 labhate / s caturthl tustir vrstir ity abhidhlyate / katham punar vrstir iti / ucyate: sarvasattvpyyant / yath hi jirnnm 15 api trnalatdinm vrstim prpya punar pyyanam bhavaty evam eva 16 sarvesm prni1 B. krya0 2 Before visvam D. writes and deletes bandha. 3 All the Mss read sangadvesanivrttim. 4 B. reads sarvbhyvarant above sarvbhyvahant 5 D. salilaughastranam, s.m. salilaughas trnam 6

15

20

25

30

D. vahant, s.m. varant

D. evbhyvahati, s.m. evbhyavaharati D. vahati, s.m. vadanti 8 K. and P.: osasmnyd D. dosasmnyd 9 B. grhnti D. manyate, s.m. grhnti 10 P. narthakyt n D . klanimittbhvnm 12 D. klavisese 'pi 13 P. kranam 14 All the Mss read sangadvesanivrttim. 15 P. not clear. 16 D. evam eva, s.m. evam esm

NAVAMAM AHNIKAM SK50

247

nm bhgyaviparinmt punar pyynam bhavati / tasmd vrstismyd 1 bhgykhy tustir vrstir ity abhidhiyate / sstram apy ha "vrstir vrstir iti sriya evopaniptam adhikurute / s hi vrstivat 2 sarvam pyyati" iti / sa khalv ayam yogi bhgyny 3 avajitya tanmahimn jagad asnyam drstv padrthntarasybhvam manyamnas tm eva bhmim kaivalyam iti grhnti / sa tasym eva dehabhede liyate tatas ca punar vartata iti / ha: klabhgyayor apratipattih samkhyparijnnt / prakrtytmakasya tvad yogino 'stau prakrtayo visaya ity uktam purastt / updntmakasya ca prthivydmi mahbhtni / klabhgyayos tu na tathoktam / tasmd vaktavyam kasya tattvasyais samkhyeti / ucyate: na uktatvt / prg evaitad apadistam 4 (161.25) na klo nma kascit padrtho 'sti / kirn tarhi / kriysu klasamjn 5 / ts ca6 karanavrttir iti pratipditam / na cny vrttir vrttimatah / tasmt k<a>ranacaitanyapratijnh 7 kltmak 8 iti / bhgyasamjn tu dharmdharmayoh / tau ca buddhidharmv iti prg apadistam(SK23) / tasmd bhgyavdl buddhicaitanika iti / ha: na tustyantaratvt 9 / prakrtitvn mahn prvam prakrtykhyym tustv avaruddhah / tasyednim tustyantaratvena parikalpanam ntisamafijasam iti / ucyate: mahms tarhi prvatustivisayabhvd apakrsyata iti / athav kryakaranavrtti<m> kriyrpm 10 <vrttimadbhyo bhinnm> n parikalpya tasym 12 klatvam ayam ha / mahatas ca rpam dharmdikam 13 mahato 'rthntaram bhgyam iti [bhgyavn] / athav bhya evyam klah karmakranam nirdisyate / tatra cnye 'pi svamatiparikalpitapadrthntartmabhvagrh 14 evtismkhyh pravdinah 15 pratiksipt boddhavy iti / apara ha: prakrticaitanikah 16 pradhna<bhvavdl> / updnaklabhgyavdino 17 mahadahamkratanmtravdina iti / tad etad ap<r>asiddhatvd 18 ayuktam / na hi mahadahamkratanmtralaksanh prakrtaya updnaklabhgyabhvena prasiddhh / tasmd idam apy ayuktam / evam et dhytmiks catasras tustayah /
1 D. vrstismyd, s.m. vrstisamanyad 2 D. vrstivat, s.m. vrstih sa 3 D. bhgyny, s.m. bhgyny 4 D. upadistam(7), s.m. apadistam 5 D. klasamkhy, s.m. klasamjn 6 D. ts ca, s.m. s ca 7 All the Mss read krana0. 8 P. and B.: kltmak 9 D. tustyantaratvt, s.m. tustyantaram 10

10

15

20

25

All the Mss read kryakaranavrttikriyrpm. K., P. and B.: vrttimaddyotym D. vrttimaddyotym, s.m. vrttimadbhyo 'tym(?) 12 D. tasym, s.m. asym 13 D. rupm dharmdikam, s.m. rpam adharmdikam 14 B. tmakabhvagrh 15 D. evtismkhyh pravdinah, s.m. evbhisamkhypravdinah 16 D. prakrticaitanikah, s.m. prkrtikah 0 17 0 K. and P.: pradhnabhvsdyupdna B. prdhnabhvsdyupadna D. pradhnabh0 0 vsdyupdna , s.m. pradhntmabhavavdyupdna 18 All the Mss read apasiddhatvd. We follow Raghavan.

248

YUKTIDIPIKA BAHY VISAYOPARAMAT PANCA CA1 NAVA TUSTAYO 'BHIHITAH / / (SK50cd)

10

casabdo 'vadhranrthah / avyutpanntmavicrasya yogino visayadosadarsanamtrt sangadosanivrttir 4 bhy tustih / tatra yadrjanadosam avagacchati na tvat sarvasybhijtir astity arthinvasyam visayrjane vartitavyam / tesm asvabhvikatvt kvacid evvasthitir ity uktam prk (25.12, 36.1) / kirn ca sapratyanikatvt 5 / svbhvikam avasthnam visaynm aparikalpypi yad pratigrahdibhir arjanam pratydriyate / tad apy ayuktam / kutah / sapratyanikatvt 6 / evam api nsti kascid apratyaniko visayrjanopyaiti 7 / tadvighte 'vasyam pray at it avy am / sa ca yadi prayatamnah 8 pratyanikivightam kuryt paropaghtentmnugrahnusthnc chstravirodhah / yasmd ha na tat parasya sandadhy 9 pratiklam yad tmanah / esa samksepato dharmah kmd anyah pravartate / / punar apy ha

15

prninm upaghtena yo 'rthah samupajyate / so 'napeksaih 10 prahtavyo lokntaravightakrt / / tasmt sanghtamtratvt sattvdinm ghatdivat / brahmanah parijiiya dehnm anavasthitim / / itas tyam sadbhir diptam trnolkcapalam 11 sukham /

20

sudrdhair na niptavyam 12 duhkhair dehntarodbhavaih / / atha punar ayam pratyanlkair vihanyate / tato ?sya visaybhvah / sukhrtham ca pravrttasya bhyistham duhkham evety etasmad darsann mdhyasthyam labhate / s 13 paficamT tustih sutram ity abhidhlyate / katham punah sutram iti / ucyate: sukham anenopyena taranti visayasamkaicim iti sutram / yad tu yogi 14 prvadosdhigame 'bhijty v yatnrjitavisayatve 15 sati raksdosam upanyasyati / katham / bhoktrbhogyabhvvyatirekt 16 sarvaprnisdhran
X B. ramac ca panca 2 D. 'dhranrthah, s.m. 'vadhranrthah 3 D. avyutpanntmavicrasya, s.m. avyutpanntmantmavicrasya 4 B. sangadvesanivrttir D. sangadosanivrttir, s.m. sangadvesanivrttir 5 D. samprati anekatvt, s.m. sapratyanekatvt 6 D. sampratyanekatvt, s.m. sapratyanekatvt 7 B. ity atas 8 K., P. and D.: pratiyatamnah 9 D. } sandadyt 10 D. py apeksaih, s.m. 'napeksaih n D . trnolk ca palam, s.m. trnolk capalam 12 D. niptavyam, s.m. nimtavyam 13 D. adds s pancami tustih ... mdhyasthyam labhate(249A) in the bottom 14 D. yogi, s.m. yogi sati 15 B. visayatve ca 16

25

margin.

D. bhvvi, s.m. bhvvyatirekt

NAVAMAM AHNIKAM SK50

249

visayh, tasmt tesm raks vidhey / tasym ca pravartamno yadi param upahanyt 1 prvoktadosah 2 , athtmnam visaybhvah / rtrindivam ca tadekgramanasah sukhrtham pravrttasya bhyistham duhkham evety etasmd darsann mdhyasthyam labhate / s sasthl tustih supram ity abhidhlyate / katham punah supram iti / ucyate: sukham anena pram visayrnavasya prayntiti / yad tu sati prvadose <'>sati3 v grmanagaranigamasannivesd vapraprkraparikhnusthnt praharanvaranasmnidhyt smdyupynusthnd v 4 krtavisayarakso yogi ksayadosam upanyasyati / katham yena dravyena mohndh 5 rantum icchanti dehinah / tad evaism vinsitvd bhavaty aratikranam / / yatnoptth sugupts ca visay visayaisinm / pasyatm eva nasyanti budbu<d>h6 salile yath / / na tad asti jagaty asmin bhtam sthvarajangamam / pratyaksato 'numnd v vinso yasya neksyate / / tasmd vinsisv saktm 7 putradragrhdisu / mameti buddhim yatnena buddhimn vinivartayet / / iti 8 / etasmd darsann mdhyasthyam labhate / s saptami tustih sunetram ity ucyate 9 / katham punah sunetram iti / ucyate: sukham anentmnam kaivalyvasthm nayantiti sunetram / yad tu satsu prvadosesu prasangadosam upanyasyati / katham / y prptavisaynam 10 indriynm tadabhilsn nivrttis tat sukham / visayajighrksay ca duhkham / prptir apy esm anupasntaye tadupabhogakausalya ca / yasmd ha yad prabandhd visayi visayn upasevate / tadsya <tesv>11 abhipryah sutarm sampravartate / / ato 'pi yena 12 purusah samayed vadavnalam 13 /
X P. uparunyat 2 K., P. and D.: tad prvoktadosah 3 A11 the Mss read sati. We follow Raghavan. 4

10

15

20

25

All the Mss read grmanagaranigamasannivesdyupynusthnd v. D. adds in the right margin the following passage: (sannivesd) vapraprkraparikhnusthnt praharanvaranasmnidhyt sm(dyupynu). 5 D. writes and deletes yena dravyena mo after katham, and starts a new line with yena dravyen a mohndh. 6 A11 the Mss read budbudhh. D. budbudhh iva dehinah, s.m. budbudhh 7 K. and P.: saktnm D. saktnm, s.m. saktm 8 D. adds iti in the left margin. B. upadisyate 10 P. omits y. D. y prpta0, s.m. cprpta0 11 K., D. and B.: tadsyate tv P. tadsyeta tv 12 B. te yena B. badavnalam

250

YUKTIDIPIKA nendriyany upabhogena visayebhyo nivartayet / / tasmd visayasamparkam asamartham nivartane / indriynm parijnya nirsangamatis caret / /

10

15

iti / etasmd darsann mdhyasthyam labhate / sst ami tustih sumricam ity ucyate 1 / katham sumricam iti / ucyate: arcateh pjrthasya sobhanam arcitam visayasahganivrttasya yogino Vasthnam bhavati / yad tu <satsu(?)> prvadosesu himsdosam upanyasyati / katham / anupahatynyabhtni 2 visayabhognupapatteh / upabhogo hi nma manojnbhyavahrah strisev hayagajanardibhir ynam ity evamdi / tatra manojnbhyavahraciklrsun tadangnm go'jvibalivardastripurusdmm avasyam upaghtah kryah / anupaghte v visaynupapattiprasangah / striyam 3 sevamnennysm strinm mtrpitrbhrtrprabhrtinm ca <...> anyath tadabhvohaydinm / tasmd upabhogrthinvasyam anyopaghtah kryo nihitadandena 4 v visayopabhogas tyjya iti / ha ca yath 5 yath hi visayo vrddhim gacchati 6 dehinm /apaghtas tadangnm tathaivsya vivardhate / / tasmd anicchann anyesm prninm dehapidanam / santosenaiva varteta tyaktasarvaparicchadah / /

20

satyavcah prasntasya sarvabhtny anicchatah / bhavndhakrntajnnam 7 acirena pravartate / / iti / etasmd darsann mdhyasthyam labhate / s navami tustir uttambhayam ity apadisyate / katham / uttamam hi prninm sarvebhyo bhayebhyo himsbhayam iti 8 tadapagamd uttambhayam 9 iti / ha: arjanaraksanalaksanayor api tustyoh paropaghtados<a>h / apadisto 'sym 10 api ca / tatra katham anayor visesah pratipattavya iti / ucyate: na visayabhedt / tatra yesm arjanaraksane pratydriyate
X B. upadisyate 0 2 D. anapahaty 3 B. striym 4 B. nihata0 5 D. writes and deletes ya after ha ca, and starts a new line with yath. 6 K., P. and B.: grhnti D., grhnti, s.m. gacchati 7 K. and P.: bhvndhakr0 B. bhvndhakrntarajnnam D. bhvndhakr0, vndhakr0 8 B. omits iti. 9 D. uttam bhayam 10

25

s.m. bha-

K., P. and B.: paropaghtadosh apadisto 'sym D. puropaghtadosh apadisto 'sym, s.m puropaghtadoso 'sym

NAVAMAM AHNIKAM SK50,51 visayi tadarthinm 1 pratyaniknm 2 avasyam abhighto 'nusthtavya ity dv uktam / iha tu yesm evrjanaraksane tadanupaghtensakyo visayopabhoga ity etad vivaksitam / tasmd asamkirnam etat / ity evam ambhahprabhrtayo nava visayebhyah sangad<o>sanivrttihetavo3 vykhyth / te jnnavirahitnm yoginm tustisabdavcyatm labhante / jfininm tu vairgyaparvasamjnit<>4 svsu svsu tattvabhmisu siddh 5 eveti / / 5 0 / / ha: prg apadistam 6 (SK47) astadh siddhir iti tad idnim abhidhiyatm iti / ucyate: HAH SABDO 'DHYAYANAM DUHKHAVIGHTS TRAYAH7 SUHRTPRPTIH / DNAM CA SIDDHAYO 'STAU / (SK51abc) tatroho nma yad pratyaksnumngamavyatirekenbhipretam artham vicranbalenaiva pratipadyate sdy siddhis trakam ity apadisyate / trayati samsrrnavd iti trakam / yad tu svayam pratipattau pratihanyamno gurpadest pratipadyate s dvitiy siddhih sutram 8 ity apadisyate / katham / sukham anendyatve 'pi bhavasamkatt tarantiti 9 / yad tv anyopadesd apy asamarthah pratipattum adhyayanena sdhayati s trtly siddhis trayantam ity 10 apadisyate / tad etat tranakriyy adyatve 'py avyvrttatvn 11 mahvisayatvt 12 trayantam ity apadistam / ta ete trayah sdhanop<y>yair13 brahmanah prnino ?bhipretam artham prpnuvanti / ha ca "skstkrtadharmna rsayo babhvuh / te 'parebhyo 14 ? skstkrtadharmebhya 15 upadesena 16 mantrn samprduh / upadesya glyanto 'pare bilmagrahanyemam 17 grantham sammnX

10

15

20

P. writes and deletes three lines following tad of tadarthinm, which read as follows: (tad) asya samjnym rasyam (sic) eva ramyakam // dnam yad tu daurbhgyam dnenntitya prvesm traynm antyam eva sdhayati sst ami siddhih sadpramuditam ity abhidhiyate / subhago hi sadpramudito bhavati tasmd daurbhgyanivrttih sadpramuditam / ity evam eth siddhayo 'stau vykhth / etsm samsrayenbhipretam artham yatah samsdhayantity c atah prvcryagatam mrgam ruruksur tatpravanah syd 2fo'(cf.p.252.18n .). 2 D. pratyaneknm, s.m. pratyaneksnm 3 A11 the Mss read sangadvesanivrttihetavo. 4 All the Mss read samjnitm. We follow Raghavan. 5 B. siddha 6 D. apadistam, s.m. aparisistam 7 B. vightatrayam D. vight$ trayah, s.m. vightatrayam D. sutarm, s.m. sutram 9 D. tarantiti, s.m. trayatiti 10 D. api 1J D. avyvrtatvn D. visayatvt, s.m. visaye AH the Mss read sdhanopyair. 14 D. parebhyo 15 B. kstkrta0 D. skstkrta0 16 D. encircles na of upadesena. D. bilmagrahan yemam, s.m. vikalpaprahnya imam

252

YUKTIDIPIKA

10

15

20

25

sisur vedam ca 1 vedangani ca"(Nir.l.2O) iti / bilmam bhasanam samyakpratibhsya visistah samketa uktah / esm tu sdhanopynm pratyanikapratisedhya 2 duhkhavightatrayam / duhkhni triny dhytmikdlni / tatra 3 cdhytmiknm vtdinm siddhipratyanlknm yurvedakriynusthnena 4 vightam krtv prvesm traynm anyatamena sdhayati s caturthi siddhih pramodam ity abhidhiyate / katham / nivrttarog hi prninah pramodayanta 5 iti krtv / yad tv dhibhautiknm mnusdinimittnm siddhipratyanlknm smdin yatidharmnugunena 6 vopyena prvesm traynm anyatamena sdhayati s pancami siddhih pramuditam 7 ity abhidhiyate / katham / anudvigno hi pramudita iti krtv / yad tu sltdiny dhidaivikni dvandvni siddhipratyanikni svadharmnurodhena pratihatya prvesm traynm anyatamena sdhayati s sasthi siddhir modamnamity abhidhiyate / katham / dvandvnupahat 8 hi prnino modanta iti krtv / suhrtprptih / yad tu kusalasamsprstam sanmitram sritya sandehanivrttim labhate s ramyakam iti saptaml siddhir apadisyate / ramyo hi loke sanmitrasamparkah / tasya samjnym(cf.Pn.4.3.147) ramyam eva ramyakam / dnam / yad tu daurbhgyam dnentitya prvesm traynm anyatamena sdhayati sstaml siddhih sadpramuditam ity abhidhiyate 9 / subhago hi sadpramudito bhavati / tasmd daurbhgyanivrttih sadpramuditam / ity evam eth siddhayo 'stau vykhyth / etsm samsrayenbhipretam artham yatah samsdhayantity 10 atah prvcryagatam 11 mrgam ruruksus tatpravanahsyd iti / ha: kah punar atra hetur 12 yena purusrthatvvisese sati gunnm sarvasiddhinimittatvam na bhavatiti 13 / ucyate: yasmt SIDDHEH PRVO ?NKUSAS TRIVIDHAH //(SK51d) sdhyapratipattismarthyasmnyam anglkrtyha siddher iti / prvo viparyaysaktitustilaksano 14 'hkusa ivnkuso nivartanasmnyt / nityapravrttasypi pradhnt siddhisrotaso viparyaysaktitustipratibandht sarvaprnisv
J B. omits ca. D. adds ca in the right margin. 2 0 D. pratyaneka 3 P. tatr 4 B. yurvedavihitakriy0 D. yurvedakriy0, s.m. 5 B. pramodanta D. encircles ya of pramodayanta. 6 B. nugune 7 D. pramuditam, s.m. pramodam 8 B. dvnupahat 9 B. apadisyate D. abhidhiyate, s.m. apadisyate 10 D. samsdayantiti, s.m. samsdhayantiti 11 P. prvcryagatam 12 P. punar ahetur 13 P. sarvasiddhinimittam tv anubhavati B. sarvatra 14 0

30

yurvedavihitakriy0

siddhinimittatvam na bhavati

D. viparyayah sakti

NAVAMAM AHNIKAM SK51

253

apravrttir bhavati / viparyayt 1 tvat sthvaresu / te hi mukhy<a>srotaso2 viparyaytmnah / asaktes tiryaksu / te hi tiryaksrotaso 'saktytmnah 3 / tuster 4 devesu / te hy rdhvasrotasas tustytmnah / mnuss tv arvksrotasah samsiddhytmnah / tasmt ta eva trakdisu pravartante sattvarajastamasm chgngibhvaniyamd viparyaysaktitustibhih pratihanyanta iti 5 na sarvesm sarvad siddhir bhavati / ata etad uktam siddheh prvo 'nkusas trividha iti / yath ca siddheh viparyaysaktitustayah pratipaks evam siddhir api viparyaydinm / s hy utpann sarvn etn nivartayati / katham / avipantajnnam viparyayam, atitngatavartamnesu sannikrstesu viprakrstesv 6 indriyagrhyesv7 atmdriyesu cpratightd asaktim, purusasya prakrtivikravyatiriktasya darsnt sarvsu bhmisu tustim / evam etni srotmsi prndayah karmayonayas ca vykhyth / etesm marge 'vasthpant parm siddhim kaivalyalaksanm acirena 8 prpnoti / ha ca yoninm sapramnnm samyanmrge niyojant / srotasm ca visuddhatvn nirsangamatis caret / / iti iti 9 yuktidlpikym navamam hnikam /

10

15

P. deletes the first two lines of its fol.H3b preceding viparyayat, which read as follows: mahadahamkratanmtrendriyabhtatvenvasthya paramarsihiranyagarbhdinm sariram utpdayanti / satsiddhiksayaklottaram tu gunavimardavaicitryd rajastamovrtyanuytisamsracakram pravrttam // na vin bhvair Ungarn // devamanusyatiryagbhvena vyavatisthata iti vkyasesah //(cf.p.255.11ff.). 2 A11 the Mss read mukhyh srotaso. 3 D. 'sakytmnah, s.m. 'sakytmnah 4 K., P. and B.: tustir D. tustir, s.m. tusteh 5 B. ity ato 6 D. writes and deletes vya before viprakrstesv. D. indriyagrhyesv, s.m. indriyagrhyesv 8 D. adds acirena in the right margin. 9 B. omits iti.

D a s a m a m - E k a d a s a m A h n i k a m

evam yat purvam apadistam "samyogakrtah sargah"(cf.SK21d) iti tad vyakhyatam / atrednim crynm vipratipattih / <...> dharmdmm sariram antarennutpatteh sarirasya ca dharmdyabhve nimittntarsambhavd ubhayam idam andi / tasmd ekarpa evyam yathaivdyatve 1 tathaivtikrntsv angatsu klakotisu sarga iti / crya ha: naitad evam / kirn tarhi / prk pradhnapravrtter dharmdharmayor asambhavo buddhidharmatvt 2 tasys ca pradhnavik<ra>tvt 3 / tatas tadvyatiriktam sabddyupa<bhoga>laksanam4 gunapurusntaropalabdhilaksanam crtham uddisya sattvdayo mahadahamkratanmtrendriyabhtatvenvasthya 5 paramarsihiranyagarbhdinm sariram utpdayanti / satsiddhiksayaklottaram tu gunavimardavaicitryd rajastamovrttyanupti samsracakram pravrttam 6 <iti> / NA VIN BHVAIR LINGAM7/ (SK52a) devamanusyatiryagbhvena vyavatisthata iti vkyasesah / NA VIN LINGENA BHVASAMSIDDHIH / (SK52b) samsiddhir atra nispattir abhipret / LINGKHYO BHVKHYAS TASMD DVIVIDHAH PRAVARTATE SARGAH8// (SK52cd) so ' y a m lingkhyo bhvkhyas ca satsiddhiksayakld rdhvam bhavati / gunasamanantaram tv adhikralaksanah / tasmd dvidh sargo 'dhikralaksano <lihgkhyo> bhvkhyas ca / yesm tu dharmdharmasarirayoh paryyena hetuhetumadbhvas tesm "kranam asty avyaktam"(SK16a) ity atra prativihitam /
1

10

15

20

D. yathaivditye B. buddhirpatvt D. buddhidharmatvt, s.m. buddhirpatvt 3 AH the Mss read vikritvt We follow Chakravarti. 4 K., P. and B.: sabddyupalabdhigunalaksanam D. sabddyupalabdhilaksanam, s.m. sabddyupalabdhigunalaksanam 5 B. mahadamkra0 B. samsrapravrttam 7 To the right of Ungarn D. adds lingena vin kirn. 8 B. omits SK52cd.

256

YUKTIDIPIKA

ye 'pi ca samkhya evam 1 ahur "dharmadharmadhikaravasat pradhanasya pravrttih" iti tesm anyataraparikalpannarthakyam iti / katham / yadi tvad adhikra evyam pradhnapravrttaye 'lam kirn2 dharmdharmbhym / atha <tv>3 antarendhikrasya pradhnapravrttv asmarthyam evam api kirn adhikrena / tayor eva pravrttismarthyt / tasmd adhikrabhvanimitto dvidh sargah / tatra yathedam sariram avibhaktam dharmrthakmamoksalaksansu kriysu vibhaktam bhaved ity atah pnydivikalpo 'sya 4 bhavaty evam sattvasargo 'py avibhakto dharmrthakmamoksalaksansu kriysu <s>amartho5 bhaved iti / / 5 2 / /

10

ASTAVIKALPO DAIVAS TAIRYAGYONAS CA PANCADHA BHAVATI / MNUSYAS CAIKAVIDHAH / (SK53abc) astau vikalp asya so 'yam astavikalpah / astaprakro 'stabheda ity arthah / tadyath brahmaprajpatlndrapitrgandharvangaraksahpisch / tairyagyonas6 ca pancadh bhavati / pasumrgapaksisarisrpasthvarh / mnusyas caikavidho jtyantarnupapatteh / ha: kirn etvn eva bhtasargavikalpa hosvid anyo 'stiti / ucyate: vikalpntaram asty 7 etesm eva sthnnm antarganabhedt / ayam tu 8 SAMSATO BHAUTIKAH SARGAH / / (SK53d) kirn / upadista iti vkyasesah / tatra devnm sdhyamarudrudrdibhedt 9 , tirascm grmyranydibhedt 10 , mnusnm ca brhmanaksatriyavitsdrabhedt / udbh<idbheds>11 ca vistarenpadisyamn<a> nantyam 12 pdayet / tasmt samsato bhtasargo 'padisyate / ha: vikalpntaravacanam srotobhedt / daivamnusatairyagyon 13 iti trividho bhtnm 14 vikalpo 'padisyate / srotmsi tu catvry uktni / tasmd vikalpntaram vaktavyam iti / ucyate: na gunadharmasarigrahasmarthyt / sattvabahul rdhvasrotasah, rajobahul arvksrotasah 15 , tamobahuls tiryaksrotaso mukhyasro tasas ca / tasmd anayor abhedenopadesah / P.: kirn ca D. encircules ca of kirn ca. All the Mss read tvad. We follow Chakravarti. 4 B. pnydivikalpasya 5 A11 the Mss read kriysv asamartho. We follow Pandeya. 6 B. tairyagyonis 7 D. asty, s.m. apy asty 8 D. adds tu in the right margin. 9 P. sdhyarudrudrdibhedt 10 D. grmranyabhedt 11 K., and D.: udbhedabhedc P. udbhedabheds We follow Pandeya. 12 All the Mss read disyamnam nantyam. We follow Chakravarti. 13 0 B. daivamnusya D. daivamnusatairyagyon, s.m. daivamnusataiyagyonni 14 Before bhtnm D. writes and deletes rpn. 15 Before arvksrotasah D. writes and deletes ca (not clear).
1 B. eva 2 K. and 3

15

20

25

DASAMAM-EKDASAM HNIKAM SK52,53,54

257

ha: asurdyupasamkhynam abhedopadeso 1 v / asurayaksakinnarapretnm upasamkhynam kartavyam itaresv <an>antarbhvd2 abhedena vopadesah 3 kryah, na tu daivamnusatirasc<m>4 iti / ucyate: na uktesv eva ta<t>sangraht 5 / asurnm tvad aindra eva sthne 'ntarbhvah prvadevatvt / prvadev hy asurh / kirn ca paryyena indratvt / baliprabhrtinm 6 paryyenendratvam sryate / tath yaksnm raksassv ekarpatvt 7 / kinnaravidydharnm 8 gandharvesu samnasilatvt / pretnm pitrsv adhipatismnyt / tasmt trivikalpa eva bhtasargah / sa cyam RDHVAM SATTVAVISLAH /(SK54a) rdhvam ity anenstau devasthnny ha / tatryam sargah sattvavislah / atra 9 ca vislagrahand vipslopo drastavyah / rdhvam <>rdhvam10 sattvavislah / piscebhyo raksasm raksobhyo 11 ngnm ngebhyo gandharvnm gandharvebhyah pitrnm pitrbhyas tridasnm tebhyah prajpatinm tebhyo 'pi brahmanah / evam vislagrahanam samarthitam bhavati / TAMOVISLAS TU MLATAH SARGAH /(SK54b) mlatas tu sargas12 tamovislah / pasubhyo hi mrgnm prakrstataram tamah / mrgebhyah paksinm, paksibhyah sarlsrpnm, sansrpebhyah sthvarnm / MADHYE13 RAJOVISLAH / (SK54c) devebhyas tiryagbhyas cvakrstsu bhmisu yath yath sattvatamasor 14 nirhrsas 15 tath tath rajaso 16 vrddhih / manusys 17 tbhayor madhyam iti tatra paramah prakarso rajasa 18 arvksrotasah siddhirpatvd atyantam kriypravrttatvt / yath ca mnusesu rajahprakarsa evam brahmanah sthne sattvasya sthvaresu tamasah / sa khalv ayam BRAHMDISTAMBAPARYANTAH / / (SK54d)
1

10

15

20

25

D. adds atra ca vislagrahand vxpslopo drastavyah rdhvam rdhvam sattvavislah in the right margin. This phrase is not found in K., P. and B. 10 D. urdhvam 11 B. raksebhyo Before sargas D. writes and deletes visla. 13 D. adds punar ayam sargo after madhye. 14 D. sattvatamaso 15 P. nihrsah 6 D. rajaso, s.m. rajasas tu 17 B. manusys 18 D. rasasah, s.m. rajasah

2 All the Mss read antarbhvd. We follow Chakravarti. 3 D. abhedenopadesah 4 K., P. and D.: daivamnusatiras ca B. daivamdnusyatiras 5 A11 the Mss read tadasamgraht. We follow Chakravarti. 6 K., P. and B.: dhanviprabhrtinm D. dhanviprabhrtinm, 7 B. aikarpatvt 8 D. kimnnara0, s.m. kinnara0 9

D. adds abhedopadeso vasurayaksakinnarapretanam upasamkhynam in the right margin. This phrase is not found in K., P. and B. ca s.m. baliprabhrtinm

258

YUKTIDIPIKA

caturdasabhedas trivikalpah sattvadyatisayanirhrasavisayabhavena yah sargo vykhytah//54// ATRA JARMARANAKRTAM DUHKHAM PRPNOTI CETANAH PURUSAH / (SK55ab) 5 jarkrtam maranakrtam jarmaranakrtam / tatra jarkrtam tvad yath valltarangitagtratvam, dandam 1 antarena cahkramandisv apravrttih, sarvendriynm visayopabhogesv2 asmarthyam, prabalaksasvsat, ssrvileksanat, dasannm asthiratvam, varnavikrtih, saithilyam, abhivyhrasangah 3 , mand smrtir ity evamdi / maranakrtam api prthivydinm sarirabhvenvasthitau sahabhvam tityaksatm 4 svabhvabhedd dhrtisahgrah<a>paktivyhvaksadnder5 upakrasya pracyutih / indriydhisthnavikrc chabdasparsarparasagandhnm 6 satm agrahanam asatm ca grahanam abhtkram sambhavaviparltam v sarvrthnm grahanam tadyath paurnamsym daksinatah khandasyendumandalasya, piscdinm pndurasya ca nabhasa itydi / tath vtdivaisamyt samupajanitnekaprakravydhih 7 prabhrasyamnasakalendriyavrttih 8 srastngas tmrapitsrvileksano bhramadhasvsdipariga<tntar>marmasandhir 9 jalrtham diso 'valokayan sabrahmalokesv api lokesu trtram avindan rgdyanekakltyaktentmagrahentmakryakaranopahriyamnabuddhir mandamandesv api smrtipralambhesu dayitajanasytmanas 10 cnusmaran dasavidht kutumbd yah prabhrasyate 11 <...(?)> / so ' y a m avasyambhvi 12 sarvasattvnm prakrstodvegakn cvyutpannas cparihryas cniyataklas ca mahtmabhih paramarsydibhir 13 andhatmisrasabdenpadisto maranakrt<am> 14 duhkham / tac cedam duhkham pradhnamahadahamkratanmtrendriyabhtavisesalaksanasya tattvaparvanas caitanysambhavt purusa eva caitanyasaktiyogd upalabhate / tad api samiksyoktam cryena atra jarmaranakrtam duhkham 15 prpnoti cetanah purusah / (SK55ab) iti /
J 2 D. visvopabhogesv, 3 D. abhihrasarigo, 4 D. titiksatm 5

10

15

20

25

D. valttarangitagtram tvadandam, s.m. valitarangitamtratve dandam s.m. visayopabhogesv s.m. abhivyhrasarigo

K., B. and D.: dhrtisangrahpaktivyh0 P. dhrtisangrahpanthivyh0 We follow Chakravarti. 6 B. chabdasparsarasarpagandhnm 7 0 D. samupajanitnekaprakra , s.m. samupajanitpratikra0 8 0 D. prabhrsyamnasakale 9 K. and P.: diparigamntamarmasandhir B. diparigamntamaranasandhih D. brah madhasvsdiparigamntamarana0, s.m. bhramadhasvsdiparigamttamarana0 We f low Chakravarti. 10 D. dayitajanasya tmanas, s.m. dayitjanasya tmanas 11 B. and D.: prabhrsyate 12 B. avasyabhvT 13 D. paramarsdibhir 14 All the Mss read maranakrto. We follow Chakravarti. 15 D. jaramaranaduhkham

DASAMAM-EKADASAM AHNIKAM SK54,55

259

ha: janmakrtasyopasamkhynam / yathaiva hi jar maranam ctmanah prakrstodvegakrakam 1 evam janmpi / tath hy ayam mtur udare jaryuparivestitasariro 'medhyaparipluto 2 vranamtrym garbhadhnym yathsukham asambhavt 3 paripiditagtro 4 mtur asandibhih pidyamno garbhavse duhkham anubhya pasct samvrtensthidvayavivarena nissrto mtrarudhirakalilaih parisiktagtro bhyena vyun karais ca samsparsd asibhir iva tudyamnah svasamvedyam duhkham tmani vartamnam khytum asamarthah svasukhaduhkhasmnyt 5 paratra parikalpitasukhaduhkhabuddhibhir 6 drdhagtrair uc<c>itaklesais7 ca ytyamno janmaduhkham 8 anubhavati / tasmt tad api vaktavyam iti / ucyate: na avypitvt 9 / mnusatirascm eva janmakrtam duhkham bhavati na devnm / katham / tadidvilasitavat ksanamtrena sariraprdurbhvt / jarmaranakrtam tu tesv api na nivartate / tasmt prdhnyd etad evopadistam netarad iti / ha: itaragrahanprasangah tulyatvt 1 0 / na 11 hi devasthnesu jar maranam v sryate / tasmd avypitvt 12 tayor apy agrahanaprasahgah / ucyate: na <sruti>smrtivacant / jiryate 'nayeti jar(cf.Pn.3.3.104) ksaya ity uktam bhavati / sa ca devabhmv api bhavati / kasmt / evam hy ha rajovisaktir angesu vaivarnyam mlnapuspat / patisyatm devalokt prninm upajyate / / sakrdinm vydhisravanc chariraksayah / evam hy ha "tvstriyam sma bhavatmdra<m v ksymayinam> na 1 3 sarvabhtni prasvpayitum nsaknuvams 14 tarn etena smn tvstriyam svpayat 15 "(Tn.Br.l2.5.18,19) iti / tath prajpater vyur aksayit 16 / daksbhispc ca somasya ksayah / tath 1 7 "prajpatir vai somya rjne duhitrr ad an naksatrni sa rohinym evvasat / tny anupeyamnni 18 punar agacchams tasmt stry anupeyamn 19 punar
X D. prakrstotk(1), s.m. prakrstodvegakkam 2 P. 'medhyaparisnuto 3 D. not clear, s.m. yathsukhasambhavt 4 K. and P.: paripiditagtro D. paripititagtro, s.m. paripiditagtro 5 D. sukhaduhkhasmarthyC?), s.m. sukhaduhkhasmnyt D. omits sva of 6 D. parikalpitasukhaduhkhibhi, s.m. parikalpitasukhaduhkhabuddhir 7 A11 the Mss read ucitaklesais. 8 D. janmaduhkam, s.m. janmadrdhaduhkam(?) 9 D. avypyatvt, s.m. avypitatvt 10 D. adds tulyatvt na hi ... tayor apy agrahanaprasangah in the right margin. n D . adds katham before na. 12

10

15

20

25

svasukha0.

D. avypyatvt, s.m. avypitatvt K. and P. bhavati indraksymayi na B. bhavati indraksymayinana(?), s.m. ksymayina na D. bhavati indraksymamayi na, s.m. bhagavattndraksyamyinam 14 B. nuva$ 15 D. tvstriyan svpayad, s.m. tvstriyam svpayed 16 B. aksasviyata D. aksayit, s.m. aksyasvayit 17 B. omits tath ... yaksm<>d amuncad itydi(259.25-260.8). K. anupeyamnni P. anapeksamnni D. anupiyamnni, s.m. anupeyamnni 19 P. not clear (it seems that P. corrects into stry anupeyamn). D. anupeyamnni(?), s.m. anupeyamn

260

YUKTIDIPIKA

10

15

20

gacchati 1 tany anvagacchat tani punar ayacata / tany asmai na punar adadat / so 'bravit sarvesv eva samvad 2 vastha te punar dsymiti sa rohinym evvasat ta<m>3 tasminn anrte yaksmo 'grhnt / candram vai somo rj yad raj an am yaksmo 'grhnt / tad rjayaksmasya janma / sa trnam 4 ivsusyat sa prajpat anthata / so 'bravit 5 sarvesv eva samvad vastha tvto moksymiti / tasmc candramh sarvesu naksatresu samvad vasati / tarn vaisvadevena carunmvasym rtrim ayyajat / tenainam 6 yaksm<>d7 amuncat" (Kth.S.11.3) itydi / tasmd devabhmv api jarkrtam duhkham asti / tath maranakrtam bhmyantaragamant tatrotpannnm yaytir udharanam / tath gopathabrhmanam "devnm ha v pancadasasatny sams tni brahmakilbisd aksiyanta 8 / tatas trayastrimsad evsta / tad etad rcpy uktam 9 / 'sodarynm paficadasnm satnm trayastrimsad udasisyanta devh / sesh prsiyanta 10 ' " iti / svetranye cntakasya rudrena krtam duhkham asti(cf.Rm.3.29.27cd) iti / <ha: disabdalopa> udharanamtrd v / athavodharanamtram eva duhkhnm / disabdalopo v vaktavyah 11 / jarmarandikrtam jarmaranakrtam / <jarmaranam> evodharanatvenbhipretam na punar duhkhntaram / kasmt / tatrpi hy 12 disabdalop<a> udharanamtratvt 1 3 sak<yam>14 parikalpayitum idam iti / ucyate: na sarvaduhkhspadatvt / sarvesm hi duhkhnm spadam 15 jarmaranakrtam sdhranam / katham / tadbandhumitrnm apy udvegahetutvt / na tu janmakrtam sambandhinm praharsanimittatvt 16 / yatas ca brahmdau stambnte 17 jagati jarmaranakrtam duhkham na kascid ativartate 18 LINGASYVINIVRTTES TASMD DUHKHAM SAMSENA //(SK55cd) sukhalesasya tena 19 vyptatvd yvad idam Ungarn na nivartate tvad avasyam duhkhena bhavitavyam paryyena samskrasya 20 smarthyl lokntaropapatteh / tath cha
2 D. samsavad, s.m. samvad 3 All the Mss read tat. 4 D. satrnam 5 D. 5a prajpatnthatamo 'bravit 6 P. yajante nainam 7 All the Mss read yaksmod 8 D. aksiyanta, s.m. aksayanta 9 D. evsta tad etad rcpi uktam, s.m. avasisyanta 10 D. prmxyanta 11 B. drastavyah D. vaktavyah, s.m. drastavyah 12 Before hy D. writes and deletes a. 13 0

25

punar gacchati D. writes and deletes punar agaccham.

ete trayastrimsad devs tad apy uktam

K., P. and D.: disabdalopayudharana B. disabdalope udharana0 We follow Chakravarti. 14 All the Mss read sakty. 15 After spadam D. adds jarmaranakrtam ca tath sdhranatvt. 16 D. praharsahetutvt, s.m. praharsanimittatvt 17 K., P. and D.: stambaparyante 18 D. ativartate, s.m. anuvartate 19 K. and P.: te 20 D. samskrasya, s.m. samskr

DASAMAM-EKDASAM HNIKAM SK55,56

261

sukham ca duhkham <cnu>sayam1 ca vrenyam sevate tatra tatra / / (cf.e.g.DNC.I.p.267.1) katham punar duhkhena vyptam sukham iti ced brahmano 'suddhiksaytisayopapattes tasys ca2 duhkhamlatvt / prajpater aksirogasravant, indrasya kmopatpt 3 gautamaparibhvd rambhys cbhispt psnabhvopapatteh, ngnm sarpasattryst, vaisravanasya ya<ks>bhispd 4 dhastibhvopapatt<e>h 5 , jaratkroh pitrnm ca garte Valambant, piscnm mantrausadhimangalaprayogair 6 udvsant, mnusatirascm pratyaksata eva pryena duhkhspadatvt / tasmn nsti samsre kascit pradeso yatra saha lirigentmnam 7 duhkham nvpnuyd ity ata evam prayatitavyam yena liiigasyaivtyantocchedah / tato hi sarvaduhkhnm atyantopasamah 8 / samsagrahanam tu sukhamohayor avaksadnrtham / anyath samsre tayor abhva evbhyupagatah syt / / 5 5 / / evam yathvat sargam upkhyyopasamharann ha ITY ESA PRAKRTIKRTAH9 PRAVARTATE10 TATTVABHTABHVKHYAH / PRATIPURUSAVIMOKSRTHAM SVRTHA IVA PARRTHA RAMBHAH / / (SK56) ifcikaranena sargasamptim dyotayati / esa ity uktam api pratymnyrtham punar apeksate / prakrty krtah prakrtikrtah / anena vkyaparisamptyartham vitvitbhym siddham pradhnstitvam anvdipratisedham cpeksate / prakrtikrta eva nnvdikrtah / pravartata iti kriyprabandham 11 ha / <na> pravrtto na pravartsyati / kirn tarhi / pravartata evnant<aryam>12 sarirdibhvena parasparnugrahena ca / neyam kriy kadcid api bhtabhavisyadrp bhavati / kirn tarhi / vartamnarp / yath "vahanti nadyas tisthanti parvath" (cf.MBhsya.II.123.6fF.) iti / tattvabhtabhvkhya ity uktnm nigamrtham pratymnyam karoti / tattvkhyo mahaddir bhvkhyo dharmdir bhtkhyo <brah>mdih 13 / purusam purusam prati vimoksah pratipurusavimoksah / tadartham pratipurusavimoksrtham / sarvapurusdhikranibaddhyh sarvasakter nirknksikaranrtham ity arthah / svrtha iva
1 A\\ the Mss read ca hi samsayam. 2 Before tasys ca D. writes and deletes 3 B. indrakmo0 4 All the Mss read yaskbhi0. 5 K., B. and D.: dhastibhvopapattih 6

10

15

20

25

tath cha.

P. vastibhvo0 We follow Raghavan. D. ausadhimangaprayogair, s.m. ausadhimangalaprayogair D. sahalingena tmnam, s.m. mahlingena tmnam 8 D. atyantopasamah, s.m. atyantopayogah 9 D. prakrtigatah(?), s.m. prakrtikrtah 10 B. pravartete 11 D. kriypradhnam, s.m. kriyprabandham 12 All the Mss read evnantnm. K., P. and D.: vyomdih B. dharmdih

262

YUKTIDIPIKA

10

15

20

25

30

parrtha rambhah1/ karyak<a>ranabhavena 2 / tatra karyasya tavac chabdadeh svrtha ivendriynm visayabhvah / indriynm aprptavisaynm laulyam adhisthnavikrnumeyam svrtham iva karannm ca samkalpbhimndhyavasynm visayadvribhvopagamanam manahprabhrtinm ca svapravrttivisayatvam mano'hamkrayos ca buddhau svapravrttyupasamhro 3 buddhes ca sntaghoramdhatvam vyavasyakartrtvam ca sattvarajastamasm ca praksapravrttiniyamalaksanair dharmaih parasparopakritvam 4 / na caisa svrthah sarvasysycaitanyt / kirn tarhi / parrtha evyam rambhah sanghtatvd iti / ha: yad uktam(SK56) pratipurusavimoksrtham ayam rambha iti tad ayuktam cryavipratipatteh / pratipurusam anyat pradhnam sarixdyartham karoti / tesm ca mhtmyasarirapradhnam yad pravartate tadetarny api / tannivrttau ca tesm api nivrttir iti paurikah smkhycryo manyate / tat katham apratisidhyaik prakrtir abhyupagamyata iti / ucyate: na prmnbhvt / na tvat pratyaksata eva tac chakyam niscetum pradhnnm atindriyatvt / lihgam casandigdham nasti / pts ca no nbhidadhuh 5 / ato manymahe naitad evam iti / kirn ca ekenrthaparisampteh / aparimitatvd etad ekam pradhnam alam sarvapurusasarirotpdanya / tasmd anyaparikalpannarthakyam / parimitam iti cet / atha matam parimitam pradhnam iti / na ucchedaprasangt / evam api tasyocchedah prptah ksiravat tath ca samsrocchedaprasangah / kirn ca anavasthprasangt / ekasyesvarasya yogino vecchyogd anekasariratvam tatparimi<tatvd> ayuktam 6 / pratisariram vpradhnaparikalpane pradhnnavasth bhavati / parimitasarirakranatvbhyupagamd 7 anyaparikalpannarthakyam / tatas ca pradhnaikatvam eva / tasmd ayuktam pratipurusam pradhnmti 8 / yat tktam(262.12) mhtmyasarirapradhnapravrttv 9 itaresm pravrttis tannivrttau nivrttir ity atra brmah: na atisaybhvt / yath ksetrajnnm niratisayatvd itaretarpravartakatvam evam esm api, stisayatve v pradhnnupapattiprasango vaisamyt / tasmd yuktam pratipurusavimoksrtham ek prakrtih pravartata iti / / 5 6 / / ha: tadanupapattir caitanyt / ihcetannm ghatdinm uddisya <artham(?)> pravrttir adrst / s ced iyam acetan 10 prakrtir asy apy uddisya purusrtham pravrttir nopapadyate / bhavati cec caitanyam tarhi prptam asyh / tatra yad uktam(SK56c) pratipurusavimoksrtham prakrteh pravrttir
1 D. parrthrambhah, s.m. parrtha rambhah 2 K., P. and B.: kryakranabhvena D. kryakrana bhvena, 3 B. svavrttyupasamhro D. encircles pra of svapravrtty0. 4 B. parasparopikritvam 5 D. ca no nbhidadhur, s.m. codanenbhidadhur 6 K., P. and D.: tatparimitd ayuktam B. tatparimittmayuktam 7 D. parimita0, s.m. aparimita0 8 D. pradhnny eti, s.m. pradhnmti 9 0 B. and D.: mahtmya 10

35

s.m. kryakranabhvena

D. acen, s.m. acetan

DASAMAM-EKADAgAM AHNIKAM SK56,57 ity etad ayuktam iti / ucyate: na drstantopapatteh /

263

VATSAVIVRDDHINIMITTAM KSIRASYA YATH PRAVRTTIR AJNASYA / PURUSAVIMOKSANIMITTAM TATH PRAVRTTIH PRADHNASYA //(SK57) yath kslram acetanam vatsavivrddhim uddisya pravartata evam pradhnam api purusavimoksam uddisya pravartate na csya caitanyam syt / sdhyatvd ayuktam iti cet / syn matam / sdhyam etat kim ksirasyoddisya vatsavivrddhim pravrttir atha neti / tasmd udharanam sdhyatvd ayuktam iti 1 / etac cyuktain / kasmt / tadabhve 'bhvt tadbhve ca bhvt / yatra nsti vatsavivrddhis tatra na ksirasya pravrttir upalabdh / yatrsti tatropalabdh 2 / yad yasmin sati bhavati tasya tadarth pravrttir drst tadyath ghate kumbhakrasya / sa cyam Idrso 'smkam uddeso 'bhipreto yad uta tdarthyam / tasmn nsty udharanasdhyatvam iti / asadbhvbhidhnt satkryavirodha iti cen na vyaktiparyyatvt / vyaktiparyyo hi <s>ad3 iti sstralokaprmnyt / sstram tvat "sattmtro mahn" (cf.YBh. onYS.2.19) / vyaktimtra ity arthah / loke 'pi nsty asmin kpe salilam ity ucyate / na kvacid api kpe salilam nsti, abhivyaktam tu tad bhavati / tasmn na satkryavirodhah / adrstapreranatvd asiddhir iti cet / atha matam / dharmdharmapreritam ksiram pravartate na vatsavivrddhyartham iti / tad apy ayuktam / kasmt / dosasmyt / dharmdharmv acetanau vivrddhikle ksiram pravartayatas tadavasne ca nivartayatah 4 / tasmd ittham 5 api parikalpyamne samno dosah / Tsvaraprerand iti cet / syn matam / Isvaras tatra ksiram pravartayate vatsrtham, na svayam iti / tad ayuktam / kasmt / pratisedht / prk pratisiddham(157.20ff.) Isvarakarma / tasmd idam apy ayuktam / evam ced avasthito drstntah / vrsagannm tu yath strlpumsarlrnm acetannm 6 uddisyetaretaram pravrttis tath pradhnasyety ayam drstntah / ha: katham avagamyate tdarthyd utpannena vyaktena purusasya sambandho na punah snnidhyamtrd <krsi>bhiksuvad7 iti / ucyate: na anapavargaprasangt 8 / snnidhyamtrt purusopabhogam abhyupagacchato <'na>pavargaprasangah9 syn nityasnnidhyt / tasmd ayuktam etat / apravartayitram prati kryak<a>rannm 10 pravrttir ayukteti cet / syn matam / apravartayit krsydinm bhiksuh / ato na tesm api tarn prati pravrttih / evam apravartayit kryakarannm purusah / tasmt tesm api tarn prati pravrttir ayukteti / etad 1 1 api <...> ata evnaikntikam /
1 D. sdhyatvd iti, s.m. sdhyatvd ayuktam iti 2 B. tatra copalabdh 3 K., P. and D.: tad B. omits tad. 4 D. pravartayatas, s.m. nivartayatas 5 P. not clear. 6 B. acetanm 7 A11 the Mss read bhiksuvad. 8 K., P. and D.: anavarga0 9 A11 the Mss read gacchato npavargaprasangah. 10 All the Mss read kryakarannm. We follow Chakravarti. ll

10

15

20

25

30

35

B. ed

264

YUKTIDIPIKA

vatso hi ksirasyapravartayitatha ca tarn prati tasya pravrttih / tasmad yuktam etat purusavimoksrth 1 prakrteh pravrttir na 2 caitanyaprasariga iti / / 5 7 / / ha 3 : na apravrttiprasangt / yadi pradhnasya purusakaivalyrth pravrttis tena tadabhve kaivalyam siddham evety apravrttiprasangah / atha kevale puruse pradhnam 4 pravartate na tarhy asya tadarth pravrttir iti / ucyate: AUTSUKYANIVRTTYARTHAM YATH KRIYSU PRAVARTATE LOKAH / PURUSASYA VIMOKSRTHAM PRAVARTATE TADVAD AVYAKTAM //(SK58) 10 prg evaitad apadistam(SK21) yath drsyadarsanasaktiyuktatvd 5 anyatarbhve ca tayor narthakyt 6 pradhnapurusayor itaretarasambandham praty autsukyam / drst coparamrthpi lokasyautsukyanivrttyarth pravrttih / tath pradhnasypy uparamrth pravrttih / atha drsyadarsanasaktyor autsukyanivrttyartham pravartata iti / ekatra krtrthatvd itaresv apravrttiprasanga iti cet / syd etat / pradhnam ekasya purusasytmnam praksyoparamed evam 7 drsyadarsanasaktyor autsukyanivrttir bhavisyaty apravrttis ceti / etad 8 api nopapannam 9 / kasmt / drstntntarasmarthyt / tadyath kim / ucyate: RANGASYA DARSAYITV NIVARTATE NARTAKI YATH NRTYT10/ 20 PURUSASYA TATHTMNAM PRAKSYA VINIVARTATE PRAKRTIH / / (SK59) tatra 1 1 nnvarnasvabhvavijnnnm preksrthinm purusnm sahghto rahga ity ucyate / nartakys ca tadrdhan 12 nrttakriynekapurusrth 13 / yadi vtra kascid bryn nrttcryena 14 kusllavair v drstaiveyam 15 kasmn na nivartata 16 iti tac cpy asau krtsnasya rangasyautsukynuparamn na nivartate / katham / akrtrthatvt / evam sarvapurusnm kryakaranasambandhenautsukyavatm 17 nirknksikaranrtham pravrtt prakrtih katham 1 8 ekasya
X P. vimoksrtham 2 D. prakrtir na, s.m. prakrteh pravrttir na 3 D. writes and deletes ha after iti, and then starts a new line with ha. 4 B. pradhnam pradhnam 5 B. omits -sakti-. 6 D. narthakyt 7 D. prakso parame devam 8 D. ceti, s.m. cety etad 9 B. apy anupapannam 10 P. nyatyt n B . tatra tatra 0 12 D. tadrthan , s.m. tadrdhan 13 P. nrtukriy0 14 D. nrttcrena 15 K. and D.: drstyaiveyam 16 K., P. and D. omit nivartata0 ... rangasyautsukynuparamn. 17 K., P. and D.: kryakrana 18

15

25

B. omits katham .... atra ca ... / ... kryakara-(264.25-265.4).

DASAMAM-EKDASAM HNIKAM SK57,58,59,64,67

265

purusasyautsukyanivrttau krtrth syt / tasmn naikasya purusasytmnam praksya prakrter nivrttir yukt iti / atra ca 1 / kryakaranakriysksi purusah / tasmd ye bhautikh sirahpnydayo ye chamkrikh sravandayo vacandayah samkalpbhimndhyavasys ca te laksanaviparyayn nh am <...(?)> nstau prakrtayah <...(?)> / tad etad evam tattvnm abhysaikgramanaso yateh punah punar abhysd ekasypy asmitrpasya parikalpitavisaya<sya> bhedapratisedhamukhena 2 NSMI NA ME NHAM ITY APARISESAM / (SK64b) prakrteh pratipaksagrahand AVIPARYAYT / (SK64c') pancasrotaso 'syvidyparvano 3 nivrtteh sntam dhruvam sakalabhv<bhv>nubandhapratipaksabhtam 4 dharmdypyyitasyabuddhitattvasysandigdham aviparitam VISUDDHAM KEVALAM UTPADYATE JNNAM / / (SK64c'd) ha: visuddham kevalam <iti> anyatarnabhidhnam 5 arthbhedt / yad eva visuddham tad eva kevalam ity arthbhedd anyatarac chakyam 6 avaktum iti / ucyate: gunntararpanivrttihetutvt / rajastamodharmnm tvad prahnc chuddham / samsayaviparyayavyatiriktam 7 ca kevalam ksetrajnaparijnne 'prvabhava 8 iti / / 6 4 / / ha: tatsamaklam eva sarirasya ptah prpnoti / sati dha 9 ... vasthne njnnahetukam 10 sariram iti / ucyate: ajfinahetukam sariram 11 / atha cyam nntvadarsi
DHARMDINM AKRANAPRPTAU /

10

15

20

TISTHATI SAMSKRAVASC CAKRABHRAMAVAD DHRTASARIRAH / / (SK67bcd)


1 After atra ca K. and P. mark a lacuna for the 2 All the Mss read parikalpitavisayabheda0 . 3 B. pancaparvane 'syvidysrotaso 0 4 K., P. and D.: sakalabhvnubandha B. 5 B. bhidnam 6 D. anyatarasa, s.m. anyatarac chakyam 7 0 0 D. samsarya , s.m. samsaya 8 B. (')prvabhva D. prvabhva 9 B. does not indicate a lacuna after dha. 10 D. vasthnena ajfinahetukam 11

25

rest of the folio. sakalabhvvabandha0

B. csya sariram

266

YUKTIDIPIKA

10

yada 1 sanrantaroparjita dharmadayo na tavat karanam, buddhilaksanam upasamprpt 2 <k>rtrthatvd 3 buddhis ca pradhnam tad tisthaty ayam nntvadarsi tasya samskrasya smarthyt / ko drstntah / cakrabhramavad dhrtasanrah / tadyath kumbhakraprayatnavisistena dandena ghatdinispattiyogy kriy cakrasya4 bhramah, tena tulyam cakrabhramavat / yath cakrabhramanam ghatrtham nispanne ghate prvasamskrnurodhn na nivartate na ca tad nivrttam iti krtv samskraksaye 'py avatisthate, evam samyagdarsanrtham sariram samyagjnndhigame Jpi na nivartate prvasainskravast / na ca tad nivrttam iti krtv sarnskraksaye 'py avasthpyata i yad tu samskraksayas tannimittasya sarirasya bhedah / atah PRPTE SARIRABHEDE / (SK68a) dharmdharmau krtrthau krane 5 buddhilaksane 6 layam gacchatah / yas csya bhtvayavah sarirrambhakah sa sarvabhtesu, bhtni tanmtresu, indriyni tanmtrni chamkre, ahamkro buddhau, buddhir avyakte / seyam tattvnuprvi 7 tadartham prdhnd utpann, parisampte 'syrthe 8 punah pradhne pralayam gacchati / pradhnam apy arthavasd evsya sarirni tesu tesu jtyantaraparivartesu karoti / sa crthas caritrthah / atah CARITRTHATVT PRADHNAVINIVRTTAU9 /(SK68b)

15

20

atindriyam asamvedyam laghu sarvatra sannihitam prasastam anirmitam visuddham aksayam niratisayam AIKNT<IKAM>10 TYANTIKAM ABHAYAM KAIVALYAM PNOTI / / (SK68cd)

25

etac cvasthnam bauddhair <nirupadhisesanirvnam ity ayam> n apavargo vykhytah / etat param brahma dhruvam amalam abhayam / atra sarvesm gunadharmnm pratipralayah / etat prpya sarvysaih sarvabandhanair andiklapravrttargadvesa<ir> viyukto 12 mukto bhavati / etadartham brhman dayitaputradradhanasambandham 13 apahya gurususrsparh sariram P. and D. indicate a lacuna after ya instead of yada. K., P. and D. read buddhi m upasamprpt, indicating a lacuna after buddhi. 3 All the Mss read akrtrthatvd. 4 D. nispattiyogyah kriydcakrasya 5 D. trane 6 B. kranabuddhilaksane 7 P. tattvnaprvi 8 P. omits 'syrthe. 9 B. pradhnanivrttau. D. pradhnavari(l), s.m. pradhnavinivrttau 10 All the Mss read aikntam. We follow Chakravarti. 11 K., P. and D.: nirupdhiviSesanirvnalaksanam B. nirupdhivisesanirvnam ity ayam 12 All the Mss read pravrttargadvesaviyukto. 13 B. putradrdhana0
1 K., 2

DASAMAM-EKDASAM HNIKAM SK67,68,69

267

aranyesu 1 ytayanti katham nmaikntikam tyantikamca kaivalyam syd iti / yatraivotthnam sstrasya tatraivopasamhra cryena krtah / / 6 8 / / ha: kimartham punar idam sstram kena v prvam praksitam iti / ucyate: yad uktam kimartham iti PURUSRTHRTHAM2/ (SK69a') katham nmjnnavast tatsamskropanip<a>titnm 3 prninm apavargah syd ity evamartham IDAM SSTRAM / (SK69a') vykhytam / yad tktam keneti / ucyate: GUHYAM PARAMARSIN SAMKHYTAM /(SK69b) guhyam iti ghaniyam rahasyam akrttmanm yamaniyamesy anavasthitnm dard 4 apy anadhyeyam / paramarsir bhagavn smsiddhikair dharmajnnavairgyaisvaryair vistapindo visvgrajah kapilamunih / tena kapilamunin samkhytam samyag khytam 5 cirbhyastasya vidysrotaso 6 nirvacanasmarthyt / syd etat katham 7 idam guhyam iti / ucyate: katham vedam guhyam na syt / bhavgrotpannair api sanakasantanasanandanasanatkumraprabhrtibhir anitynm STHITYUTPATTIPRALAYS CINTYANTE YATRA BHTNM / / (SK69cd) tatra sthitis tvad rpapravrtt<i>phalanirdesenotpatair 8 api "prakrter mahn" (SK22a') itydih / pralayo 'pi "avibhgd vaisvarpyasya9 " (SK15d) iti vacant / autsukynuparamt prakrtipurusayoh sthitih / utpattir drsyadarsanasaktyoh 10 speksatvt / tath coktam purusasya darsanrthah kaivalyrthas tath pradhnasya / pangvandhavad ubhayor api samyogas tatkrtah sargah / / (SK21) iti / pralayah
l P. aranesu 2 B. purusrtham 3 All the Mss read opaniptitnm. We follow Pandeya. 4 B. rd 5 D. adds samyag khytam in the right margin. 6 D. cirbhyastavidysrotaso 7 After katham D. writes and deletes etad guhyam. 8 All the Mss read rpapravrttih phalanir0. We follow Chakravarti. 9 B. vaisvarpasya B i 10

10

15

20

25

D. sthityutpattidrsyadarsana

268

YUKTIDIPIKA prapte sanrabhede caritarthatvat pradhanavinivrttau /(SK68ab)

10

iti / athav sthitih ksanabhangapratisedht klntaresv asynsd 1 , utpattir viparinmn nbhtaprdurbhvd akasmd asambhavt, pralayo 'pi nimittntarn na tatsvbhvyd eva / bhtnm api vyaktnm nispattimatm iti yvat / evam ca mahaddayo 'pi parigrhit iti / ha: purusdayas tarhi parityakth / katham v bhtasabda 2 iti / ucyate: vitathapratisedhrthatvt / yvat kimcid avitatham bhtam tasya 3 sarvasyeha sthitydaya ucyanta iti / <ha:> utpattivins<au> pratisedhvisest 4 / evam api purusdinm 5 utpattipralayv api prpnutah / kirn kranam / avisesd iti / ucyate: sambhavato visesanam bhavati / tatra sthitir eva purusdinm / itaresm tu sthityutpattipralay iti vijnsymah / / 6 9 / / ha: kasmai punar idam sstram paramarsin 6 praksitam iti / ucyate:

15

ETAT PAVITRAM AGRYAM MUNIR SURAYE7 'NUKAMPAY PRADADAU8 / (SK70ab) tatra pavitram pvant(cf.Nir.5.6) / agryam sarvaduhkhaksapanasamarthatvt / pavitrntarni punar ek<de>sam9 kslayanty aghamarsanagangdlni / tasmd idam evgryam munir suraye 'nukampay pradadau / ha: sampradnasykasmikatvarn dharmdinimittnupapatteh / na tvt paramarser dharmrtham sstrapradnam u<pa>padyate10 phalennabhisvahgt 11 / nrthakmrtham sisynm anysaprasangt 12 / na moksrtharn smsiddhikenaiva jnnena tatprpteh / na tadviparitrtham 13 asambhavt / parisesd akasmd cryah sstranidhnam 14 pradadv iti / ucyate: na akasmt kirn tarhi anukampay pradadau / dhytmikdhidaivikdhibhautikair 15 duhkhaih pldyamnam surim upalabhya, svtmani ca jnnasmarthyt sati kryakaranasamprayoge 16 duhkhnm apravrttim pari1 D. asya nasd 2 D. bhtasabda 3 B. bhtasya instead of bhtam tasya 0 4 All the Mss read utpattivinsapratisedh . 5 D. purusdtnv{l) 6 D. maharsin, s.m. paramarsin 7 D. munir sunir suraye 8 B. pradadv iti 9 All the Mss read ekdasam. We follow Pandeya. 10 All the Mss read utpadyate. We follow Raghavan. n B . tatphalen0 12

20

25

K., P. andD.: ana ... sa B. ansvsa(l) The lacuna of P. is filled with ysa by adifferent hand. 13 K., P. and D.: tadmd viparitrtham 14 B. sstram suraye 15 B. dhibhautikdhidaivikair 16 K., P. and D.: kryakrana0

DASAMAM-EKADASAM AHNIKAM SK69JQ,71

269

jnya sisyagunms ca, katham nma yath mama sukhaduhkhesu jnnopaniptt smyam evam surer api syt, taddvrennyesm api purusnm <ity > evam anukampay bhagavn 1 paramarsih sastram khytavn / yath ca paramarsir suraye tath SURIR API / (SK70c') dasamya kumrya bhagavatPANCASIKHYA TENA CA BAHUDH KRTAM TANTRAM / / (SK70c'd) bahubhyo janakavasisthdibhyah samkhytam / asya tu sstrasya bhagavato 'gre pravrttatvn 2 na sstrntarava<d>3 vamsah sakyo varsasatasahasrair apy khytum / samksepena tu dvva 4 ... hrita<bddhali>kairtapaurik<a>rsabhesvarapancdhikaranap<a>tanjalivrsaganyakaundinyamkdika-5 SISYAPARAMPARAYGATAM / (SK71a) [bhagavn Isvarakrsnas ca] shyakam sstram / prvcryastraprabandh<o>6 gurulghavam andriyam<nah> purtankhynavykhynavky<nu>vykhynagarbham atipramdam dadtiti 7 granthabhyastvam upajyate / tac cednlntanaih prnibhir alpatvd yuso granthata eva na spapdam kirn punah sravanaprayogbhym / ha ca "caturbhih prakrair vidyopayukt 8 bhavaty gamaklena svdhyyaklena <pravacanaklena> prayogaklena ca / tatra csygamaklenaivyuh paryupayuktam syt>?(cf.MBhsya.I.6.1f.) <iti> / tatas ca sstrnarthakyam ity asya mandadhiym apy su grahanadhranaprayogasampat 9 syd iti sastitantrd upkhynagthvyavahitni vkyny ekata upamrdya 10 sisynukamprtham yvat ISVARAKRSNENA CAITAD RYBHIH / (SK71b) saptaty SAMKSIPTAM RYAMATIN / (SK71c) sarvasattvahitapravrttena SAMYAG VIJNYA SIDDHNTAM / / (SK71d)
l B. bhavn 2 K., B. and D.: 'grapravrttatvn 3 All the Mss read sstrntarava ... 4 recte devala(?) 5

10

15

20

25

. We follow Chakravarti.

K., P. and B. read hritavdvalikairtapaurikaursa0 and ptanjali. D. paryaka, s.m. paurikausa We follow Chakravarti. 6 K., P. and D.: straprabandhe B. sstrasambandhe K., P. and D.: andriyamnapaurastyn vykhynavy nagarbham atipramdam dadtiti B. andriyamnapaurastyn vykhynavykynavykhynagarbham atipram dadhatiti 8 K., P. and D.: vidy spayukt 9 B. grahadhranam prayogasampat 10 B. and D.: upapdya

270

YUKTIDIPIKA

katham casya samyaksiddhantavijiianasyapy 1 anekagranthasatasahasrakhyeyam smkhyapadrthasatattvam 2 akhandam ryanm saptaty samksipta<m>3 ha ca 5 SAPTATYM KILA YE 'RTHS TE 'RTHH4 KRTSNASYA SASTITANTRASYA / KHYYIKVIRAHITH5 PARAVDAVIVARJITS CPI6 //(SK72) yatas ca nryanamanujanakavasisthadvaipyanaprabhrtibhir 7 cryaih pradhnapurusdayah padrthh parigrhits copadists ca prasasts ctah svabhvatah prasiddham aisvaryasya phalata rjv ryamrgam 8 alam kartum iti bhagavadisvarakrsnena padrthasvarpanirpananipunasramatin paramarsydiyathoktgamena pramnatrayam puraskrtya tarkadrs vicrah krtah / na csya mlakanakapindasyeva svalpam api dosajtam astiti / ha ca ajnnadhvntasntyartham rsicandramasas 9 cyut / malinais tlrthajaladais chdyate jnnacandrik / / 15 iti sadbhir asambhrntaih kudrstitimirpah / praksikeyam sarvasya 10 dhryatm yuktidlpik / / sphutbhidhey madhurpi 11 bhratl manisino nopakhalam virjate / krsnugarbhpy abhito himgame kadusnatm yti divkaradyutih / / nayanti santas ca yatah svasaktito gunam paresm tanum apy udratm / 20 iti praytv esa mama sramah satm vicrannugrahamtraptratm 12 // iti yuktidipikym smkhyasaptatipaddhatau caturtham prakaranam ekdasam chnikam / sampt ceyam yuktidlpiketi sivam 13 /

10

1 B. casysamyaksiddhanta0 2 B. padrthasattvam 3 All the Mss read samksiptavn. 4 D. tirthh 5 D. khyyik virahith 6 B. ceti 7 D. nryanananujanakabasistha0(?), s.m. nryanamanujanakavasistha0 8 P. not clear. 9 B. rsticandramasas 10 K. and P.: sargasya B. sarvasya, s.m. sargasya D. not clear. 11 B. madhurd api 12 B. mtraptram 13

B. subham P. chnikam // samprnam krtir iyam srivcaspatimisrnm sivam om tat sat // om hari instead of sivam

A p p e n d i c e s

A p p e n d i x I.

Bibliography

[1] Editions of the Yuktidipika 1. Yuktidipika, edited by Pulinbehari Chakravarti, Calcutta Sanskrit Series No.23, 1938, Calcutta. 2. Yuktidipika, An Ancient Commentary on the Smkhya-Krik of Isvarakrsna, edited by Ram Chandra Pandeya, 1967, Delhi-Varanasi-Patna. 3. Isvarakrsnaviracit Smkhyakarik, Rma-Sankara-Tripthiviracitay Tattvaprabhkhy Vykhyay Ajntakartrkay Yuktidipikkhyay Vivrty ca Vibhsit, edited by Rma Snkara Tripthi, 1970, Varanasi. 4. Yuktidipika, With the Hindi Commentary 'Kal' by Acryasri Kedrantha Tripthi, edited by Acryasri Kedrantha Tripthi, GangnthajhGranthaml vol.15, 1996, Varanasi.

[2] Monographs and Articles on the Yuktidipika 1. Koki Aruga, Some Problems of anumna in Smkhya, JIBS vol.39-2 (1991), pp.1044-1042. 2. , On Vcaspatimisra's Explanation of the Cause of samyoga, JIBS vol.41-2 (1993), pp.1131-1127.

3. Johannes Bronkhorst, God in Smkhya, WZKS vol.27 (1983), pp.149-164. 4 known to ? ^4 Possible Quotation from the Niruktavrttika Durga in the YuktidTpik, Proceedings of the Fifth World Sanskrit Conference, New Delhi (1985), pp.90-100. , Vrttika, WZKS vol.34 (1990), pp.123-146. , The Qualities of Snkhya, WZKS vol.38 (1994), pp.309-322.

5. 6.

272 7.

APPENDIX I , Once Again Vaisesika sutra 3.1.13, Asiatische Studien, vol.XLVIII-2 (1994), pp.665-681.

8. Pulinbehari Chakravarti, Origin and Development of the Smkhya System of Thought, Calcutta 1951; Second Edition Delhi 1975. 9. George Chemparathy, The Testimony of the Yuktidtpik concerning the Isvara Doctrine of the Psupatas and Vaisesikas, WZKSO vol.9 (1965), pp.119-146. 10. Edeltraud Harzer Clear, Isvarakrsna's Two-Level-Perception: Propositional and Non-Propositional, JlPh vol.18 No.4 (1990), pp.305-340. 11. R.C.Dwivedi, Concept of the Sstra, Indologica Taurinensia, vol.XIII (1985-86) pp.43-60. 12. Eli Franco, Whatever happened to the Yuktidtpik?, WZKS vol.35 (1991) pp.123-137. 13. Erich Frauwallner, Die Erkenntnislehre des klassischen Smkhya Systems, WZKSO vol.2 (1958), pp.84-139 = Kleine Schriften, hrsg. v. G.Oberhammer und E.Steinkellner, Wiesbaden 1982, pp.223-278. 14
? Landmarks in the History of Indian Logic, WZKSO vol.5 (1967), pp.125-148 = Kleine Schriften, hrsg. v. G.Oberhammer und E.Steinkellner, Wiesbaden 1982, pp.847-870.

15. Kazuyuki Funatsu, Snkhya Gakuha ni okeru Jissenron (I Yuktidtpik to Kinshichijron o Chshin ni) (On the Practical Theory of Snkhya Philosophy with a Focus upon the Yuktidtpik and the Suvarnasaptati), JIBS vol.27-2 (1979), pp.668-669. 16. Megumu Honda, Pancdhikarana (1975), pp.518-514. 17. 18. a Smkhya teacher, JIBS vol.24-1

, karmayoni, JIBS vol.26-1 (1977), pp.511-506. , Yuktidtpik Zakk (Notes on the Yuktidtpik), JIBS vol.27-1 (1978), pp.64-69.

19. Shiv Kumar and D.N.Bhargava, Yuktidipik, Delhi, vol.1, 1990; vol.2, 1992. 20. Shiv Kumar, Smkhya-Yoga Epistemology, Delhi, 1984. 21. G.J.Larson, The pratyaya-sarga or "intellectual creation" in Classical Samkhya as interpreted by the Yuktidtpik, Religion and Society in Ancient India, Sudhakar Chat topadhy ay a Commemoration Volume, Calcutta (1984), pp.60-71.

BIBLIOGRAPHY

273

22. Esho Mikogami Samkhyakarika Daishichige o megutte ( On the Samkhyakrik v.7), JIBS vol.28-2 (1980), pp.903-896. 23. , Yuktidipik ni okeru Apoha Setu Hihan-ptavacana to pratibh wo megutte ( A Criticism of Apoha in the Yuktidipik: ptavacana and pratibh), Indian Thoughts and Buddhist Culture, Essays in Honour of Professor Junkichi Imanishi on His Sixtieth Birthday, (1996) Tokyo, pp.790-777.

24. Hisayoshi Miyamoto, Smkhya Tetugaku ni okeru Jikan Gainen (The Concept of Time in the Smkhya Philosophy)', Ty Kenky, vol.91 (1989), pp.27-49. 25. Meizo Motegi, Yuktidipik no Kenky (I) (Studies of the Yuktidipik I), JIBS vol.26-2 (1978), pp.166-167. 26. Shujun Motegi, Yuktidipik no Kenky (II) (Studies of the Yuktidipik II), JIBS vol.27-1 (1978), pp.453-448. 27. , Smkhya-ha ni okeru Sz-shin no Kannen no Hensen (Change and Development of the Concept of the Creation God in Smkhya), Shky Kenky (Journal of Religious Studies) vol.240 (1979), pp.67-86. , Yuktidipik no Kenky (III) (Studies of the Yuktidipik III), JIBS vol.28-2 (1980), pp.907-904. , Smkhya-gakuha to Bukky no Rons (An Argument between Smkhya and a Buddhist school), Nihon Bukky Bunka Kenky vol.4 (1983), pp.37-44. , Smkhya-gakuha ni okeru Ninshiki Shutai no Mondai (Some problems on the knower of Smkhya), Journal of Department of Education (Shinshu University) vol.51 (1984), pp.117-128. , Inch-uka to Inch-muka (I) (Satkryavda and Asatkryavda I), St Sh Kenkyuin Kenkysei Kenky Kiy (Journal of Soto Shu Research Fellows) vol.18 (1986), pp.281-266. , Inch-uka to Inch-muka (II) (Satkryavda and Asatkryavda II), St Sh Kenkyuin Kenkysei Kenky Kiy (Journal of Soto Shu Research Fellows) vol.19 (1987), pp.292-278. , The Vaisesikastra 9-1 referred to in the Yuktidipik, JIBS vol.36-2 (1988), pp.1-8.' , Inch-uka to Inch-muka (III) (Satkryavda and Asatkryavda III), St Sh Kenkyuin Kenkysei Kenky Kiy (Journal of Soto Shu Research Fellows) vol.20 (1988), pp.232-221.

28. 29.

30.

31.

32.

33. 34.

274 35.

APPENDIX I , Samkhya-gakuha no Suiri-setu (On the Theory of Anumana of Smkhya), Indo Shisshi Kenky (Studies in the History of Indian Thought) (Felicitation Volume of Prof.Dr.M.Hattori) vol.6 (1989), pp.4152. , Some Vaisesika thoughts referred to in the Yuktidipik, Asiatische Studien vol.XLVIII-2 (1994), pp.807-817. , avibhgd vaisvarpyasya (SK15) o megutte (On avibhgd vaisvarpyasya of SK15), JIBS vol.43-1 (1994), pp.453-447. , Yuktidipik Shahon no Kent (An Examination of the Manuscripts of the Yuktidipik), Indo Shisshi Kenky (Studies in the History of Indian Thought) vol.7 (1995), pp.19-35. (On jfina\

36. 37. 38.

39. Shinkan Murakami, Chigy Heigsetsu (samuccaya-vda) karmasamuccaya-vda), JIBS vol.28-1 (1979), pp.16-21. 40.

, Yuktidipik Yakuch (I) (YuktidipikTranslated into Japanese with Critical Notes I), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.33 (1983), pp.37-69. , Benares-Manuscripts (1987), pp.1020-1016. of the Yuktidipik, JIBS vol.35-2

41. 42.

, Yuktidipik Yakuch (II) (YuktidipikTranslated into Japanese with Critical Notes II), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.38 (1989), pp.31-79. ^ Kankan no smnya-jnna (Yuktidipik p. 102) (On the smnya-jnna of the Sense Organs, Yuktidipik p. 102), JIBS vol.39-2 (1991),pp.788-794.

43

44. Yasutaka Muroya, Satkryavda Ronsh ni okeru abhivyakti to parinma (Parinma and Abhivyakti in the Smkhya Argument for Satkryavda), Indo Shisshi Kenky (Studies in the History of Indian Thought) vol.8 (1996), pp.42-63. 45. Naomichi Nakada, Vykhynga and Parapratipdannga in Yuktidipik, JIBS vol.13-2 (1965), pp.805-799. 46. 47. 48. , Three Kinds of Inference in the Commentaries on Smkhya krik (part II), JIBS vol.15-1 (1966), pp.437-427. , Word and Inference in the Yuktidipik part 1, JIBS vol.18-2 (1970), pp.41-45. , Word and Inference in the Yuktidipik part 2, JIBS vol.19-2 (1971), pp.25-31.

BIBLIOGRAPHY 49. 50

275

, Word and Inference in the Yuktidtpika part 3, JIBS vol.21-1 (1972), pp.19-22. ^ Suiron wo Ksei suru Kakuyso no Kent (Constituent Elements of the Inference as Examined in the Yuktidtpika), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.12, part two (1975), pp.149-170. , Yuktidtpika ni okeru Sanshu no Suiron (Three Kinds of Inference as found in the YuktidtpikaJapanese translation from its Sanskrit text), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.13 part three (1976), pp.171-182.
? Saishi no Kitei toshiteno Dharma to Shakai Kihan toshiteno Dharma "Ronri no Tomoshibi" ni okeru (Dharma as Ritual Norm and as Social Norm, referred to in the Yuktidtpika), "Bukky ni okeru Ho no Kenky11 ("Papers on Dharmas in Budddhism") (Felicitation Volume of Dr.A.Hirakawa), Tokyo (1975), pp.567-587. ? Kotoba to Ronri (Word and Logic), Yamanashiken Kt Gakk Kyiku Kenkykai Kenky Kiy vol.12 (1976), pp.18 pages (no pagination).

51.

52.

53

54

^ Yuktidtpika to Nyyakandalt no Shosetu wo Hikaku shite (Opposing opinions on the relationship between word and inference Comparison of the disputes as found in the Yuktidtpika and the Nyyakandalt), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.20 part four (1983), pp.75-79. , Word and Inference in the Yuktidtpika (Revised and together with two appendixies), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.28 part four (1991), pp.123-153. , Kotoba to SuironYuktidtpika ni okeru (Wayaku to Ktei) (Word and Inference in the YuktidtpikaJapanese Translation and Collation of the Text), Indian Thoughts and Buddhism (A Felicitaion Volume for Dr. H. Nakamura on His Sixtieth Birthday), Tokyo (1973), pp.37-56.

55.

56.

57. Honshu Nakai, Smkhya ha ni okeru Pramna Ron (The theory of Pramna in the Smkhya-System), JIBS, vol.28-2 (1980), pp.678-679. 58. Maria Nowotny, Die Smkhya-Philosophie auf Grund der Yuktidlpik und der Fragmente der Werke alter Smkhya-Lehrer, Wien (1941) [unpublished dissertion]. 59. Gerhard Oberhammer, On the'Sstra' Quotations of the Yuktidtpika, The Adyar Library Bulletin, vol.25 parts 1-4 (1961), pp.131-172. 60. pp.71-91. , The Authorship of the Sastitantram, WZKSO vol.4 (1960),

274 35.

APPENDIX I , Samkhya-gakuha no Suiri-setu (On the Theory of Anumana of Smkhya), Indo Shisshi Kenky (Studies in the History of Indian Thought) (Felicitation Volume of Prof.Dr.M.Hattori) vol.6 (1989), pp.4152.
? Some Vaisesika thoughts referred to in the YuktidTpik, Asiatische Studien vol.XLVlil-2 (1994), pp.807-817. ? avibhgd vaisvarpyasya (SK15) o megutte (On avibhgd vaisvarpyasya of SK15), JIBS vol.43-1 (1994), pp.453-447.

36 37 3g

^ YuktidTpik Shahon no Kent (An Examination of the Manuscripts of the YuktidTpik), Indo Shisshi Kenky (Studies in the History of Indian Thought) vol.7 (1995), pp.19-35. (On jnna-

39. Shinkan Murakami, Chigy Heigsetsu (samuccaya-vda) karmasamuccaya-vda), JIBS vol.28-1 (1979), pp.16-21. 40.

, Yuktidipik Yakuch (I) (YuktidipikTranslated into Japanese with Critical Notes I), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.33 (1983), pp.37-69. , Benares-Manuscripts (1987),pp.l020-1016. of the YuktidTpik, JIBS vol.35-2

41. 42.

, YuktidTpik Yakuch (II) (YuktidTpikTranslated into Japanese with Critical Notes II), Tohoku Daigaku Bungakubu Kenkyu Nenpo (Annual Reports of the Faculty of Arts and Letters Tohoku University) vol.38 (1989), pp.31-79. , Kankan no smnya-jnna (YuktidTpik p. 102) (On the smnya-jnna of the Sense Organs, YuktidTpik p. 102), JIBS vol.39-2 (1991), pp.788-794.

43.

44. Yasutaka Muroya, Satkryavda Ronsh ni okeru abhivyakti to parinma (Parinma and Abhivyakti in the Smkhya Argument for Satkryavda), Indo Shisshi Kenky (Studies in the History of Indian Thought) vol.8 (1996), pp.42-63. 45. Naomichi Nakada, Vykhynga and Parapratipdannga in YuktidTpik, JIBS vol.13-2 (1965), pp.805-799. 46 47. 48.
} Three Kinds of Inference in the Commentaries on Smkhya krik (part II), JIBS vol.15-1 (1966), pp.437-427.

, Word and Inference in the YuktidTpik part 1, JIBS vol.18-2 (1970), pp.41-45. , Word and Inference in the YuktidTpik part 2, JIBS vol. 19-2 (1971), pp.25-31.

BIBLIOGRAPHY 49. 50.

275

, Word and Inference in the Yuktidipika part 3, JIBS vol.21-1 (1972), pp.19-22. , Suiron wo Ksei suru Kakuyso no Kent (Constituent Elements of the Inference as Examined in the Yuktidipika), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.12, part two (1975), pp.149-170. ^ Yuktidipika ni okeru Sanshu no Suiron (Three Kinds of Inference as found in the YuktidipikaJapanese translation from its Sanskrit text), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.13 part three (1976), pp.171-182. , Saishi no Kitei toshiteno Dharma to Shakai Kihan ioshiteno Dharma "Ronri no Tomoshibi" ni okeru (Dharma as Ritual Norm and as Social Norm, referred to in the Yuktidipika), "Bukky ni okeru Ho no Kenky11 ("Papers on Dharmas in Budddhism") (Felicitation Volume of Dr.A^Hirakawa), Tbkyo (1975), pp.567-587. , Kotoba to Ronri (Word and Logic), Yamanashiken Kt Gakk Kyiku Kenkykai Kenky Kiy vol.12 (1976), pp.18 pages (no pagination). ^ Yuktidipika to Nydyakandali no Shosetu wo Hikaku shite (Opposing opinions on the relationship between word and inference Comparison of the disputes as found in the Yuktidipika and the Nyyakandali), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.20 part four (1983), pp.75-79. ^ Word and Inference in the Yuktidipika (Revised and together with two appendixies), Tsurumi Daigaku Kiyo (Bulletin of Tsurumi College) vol.28 part four (1991), pp.123-153. , Kotoba to SuironYuktidipika ni okeru (Wayaku to Ktei) (Word and Inference in the YuktidipikaJapanese Translation and Collation of the Text), Indian Thoughts and Buddhism (A Felicitaion Volume for Dr. H. Nakamura on His Sixtieth Birthday), Tokyo (1973), pp.37-56.

51

52.

53.

54

55

56.

57. Honshu Nakai, Smkhya ha ni okeru Pramna Ron (The theory of Pramna in the Smkhya-System), JIBS, vol.28-2 (1980), pp.678-679. 58. Maria Nowotny, Die Smkhya-Philosophie auf Grund der Yuktidipika und der Fragmente der Werke alter Smkhya-Lehrer, Wien (1941) [unpublished dissertion]. 59. Gerhard Oberhammer, On the'Sstra' Quotations of the Yuktidipika, The Adyar Library Bulletin, vol.25 parts 1-4 (1961), pp.131-172. 60. pp.71-91. , The Authorship of the Sastitantram, WZKSO vol.4 (1960),

276 51 62. 616.

APPENDIX I
} jn Beitrag zu den Vada-Traditionen Indiens, WZKSO vol.7 (1963), pp.63-103.

, Notes on the Tantrayukti-s, ALB vol.31-32 (1967-68), pp.600-

63. V.Raghavan, The Yuktidipik on the Smkhya-krik, Corrections and Emendations in the Text, Annals of Oriental Research (University of Madras) , vol.12 (1954-55) pp.1-14; vol.14 (1957-58), pp.1-8; vol.15-1 (1958-59), pp.1-12; vol.15-2 (1958-59), pp.1-10. 64. Sadhu Ram, References to Smkhya thories in Vtsyyana's Nyyabhsya, ALB vol.22 parts 1-4 (1958), pp.8-24. 65. Ernst Steinkellner, DharmakTrti on the Inference of Effect (krya), Papers in Honour of Prof. Dr. Ji Xianlin on the Occasion of His 80th Birthday, Beijing (1991), pp.711-736. 66. Albrecht Wezler, Some Observations on the Yuktidipik, ZDMG Supplement II (1975), pp.434-455. 67 gg
? Qn Two Medical Verses in the Yuktidipik, Journal of the European yurvedic Society (Reinbek) vol.1 (1990), pp.127-148.

^ On a Prose Passage in the Yuktidipik of Some Significance for the History of Indian Medicine, Journal of the European Ayurvedic Society vol.3 (1993), pp.282-304.

[3] Sanskrit Texts referred to in the present edition 1. Atharvasira Upanisad, Publiee et traduite par B. Tubini, LES UPANISHAD vol.XI, Texte et traduction sous la direction de Louis RENOU, Paris, (1952). 2. Abhidharmakosabhsya of Vasubandhu, edited by P.Pradhan, Tibetan Sanskrit Works Series vol.VIII, Patna (1967). 3. Abhidharmakosavykhy, edited by Unrai Ogiwara, Tokyo, (1971). 4. Dvdasram Nayacakram, edited with critical notes by Muni Jambuvijayaji, Bhavnagar, (1966f.). 5. Mahbhrata, for the first time critically edited by V.S.Sukthankar, Poona, (1954f.). 6. Mugdhabodhavykarana of Vopadeva with the commentary of Ramatarkavagisha, edited by S.N.Siromaniand A.N.Nyayaratna, Bibliotheca Indica, No.1325, Calcutta, (1912). 7. Nyyabhsanam, edited by Svmi Yogindrnanda, Saddarsanapraksana Granthaml prathamam puspam, Varanasi, (1968).

BIBLIOGRAPHY

277

8. Nyayamanjan, edited by S.N.Sukla, Kashi Sanskrit Series No.l06(part 1, part 2), Varanasi, (1971). 9. Nyyadarsanam with Vtsyyana's Bhsya Uddyotakara's Vrttika Vcaspati Misra's Ttparyatik and Visvantha's Vrtti, edited by Taranatha Nyaya Tarkatirtha and Amarendramohan Tarkatirtha, Calcutta Sanskrit Series 18, Calcutta, (1936). 10. Die Nyyastra's, Text, bersetzung, Erluterung und Glossar, edited by Walter Ruben, (Abhandlungen fr die Kunde des Morgenlandes Band 18-Nr.2), Leipzig, (1928). 11. Tibetan Tripitaka (Peking Edition), edited by D.T.Suzuki, Tokyo-Kyoto, (1955-1961). 12. Tibetan Tripitaka (sDe-dge Edition), preserved at the Faculty of Letters, University of Tokyo, Tokyo, (1981). 13. Vijnptimtratsiddhi, Deux traites de Vasubandhu, Vimsatik (la Vingtaine) accompagnee d'une explication en prose et Trimsik (la Trentaine) avec le commentaire de Sthiramati, premiere partie, edited by S.Levi, Paris, (1925). 14. The Vykaranamahbhsya of Patanjali, edited by F.Kielhorn, Poona, 3rd edition by K.V.Abhyankar, (1962f.). 15. Bhartrharis Vkyapadiya, edited by Wilhelm Rau, Abhandlungen fr die Kunde des Morgenlandes Band XLII4, Wiesbaden, (1977). 16. Sarvadarsanasahgraha, edited by M.V.S.Abhyankar, Government Oriental Series Class A No.l, Bhandarkar Oriental Research Institute, Poona, (1978). 17. Srnkhya-Sangraha, edited by Sri Vindhyesvari Prasda Dvivedi, Chowkhamba Sanskrit Series Nos.246, 286, Varanasi, (1969).

278 Appendix II

APPENDIX II

T h e Text of t h e Smkhyakrik as attested in YuktidTpika within the c o m m e n t a r y to the sponding verse

the

corre-

duhkhatraybhightj jijns tadapaghtake hetau / drste sparth cen naiknttyantato'bhvt //!// pp.10.8; 11.8; 24.15; 25.5

drstavad nusravikah sa hy avisuddhiksaytisayayuktah / tadviparitah sreyn vyaktvyaktajnavijfint / / 2 / / pp.30.18; 31.9; 47.9; 48.15

mlaprakrtir avikrtir mahaddyh prakrtivikrtayah sapta / sodasakas tu vikro na prakrtir na vikrtih purusah / / 3 / / pp.58.8; 62.18; 63.24; 66.4

drstam anumnam ptavacanam ca sarvapramnasiddhatvt / trividham pramnam istam prameyasiddhih pramnd dhi / / 4 / / pp.67.4; 68.29; 69.20; 70.11

prativisaydhyavasyo drstam trividham anumnam khytam / ptasrutir ptavacanam tu / / 5 / / pp.76.25; 82.29; 87.3

smnyatas tu drstd atindriynm prasiddhir anumnt / tasmd api csiddham paroksam ptgamt sdhyam / / 6 / / pp.88.3; 99.6

atidrt smipyd indriyaghtn mano'navasthnt / sauksmyd vyavadhnd abhibhavt samnbhihrc ca / / 7 / / p.98.2-3

The Text of the Samkhyakarika as attested in the Yuktidipika sauksmyt tadanupalabdhir nbhvt kryatas tadupalabdhih / mahaddi tac ca kryam prakrtivirpam sarpam ca / / 8 / /

279

pp.106.6,10; 107.14 asadakarand updnagrahant sarvasambhavbhvt / saktasya sakyakarant kranabhvc ca sat kryam / / 9 / / pp.117.6; 119.6,19; 122.19; 124.6 hetumad anityam avypi sakriyam anekam sritam Ungarn / svayavam paratantram vyaktam vipantam avyaktam / / 1 0 / / p.127.3-4

sattvam laghu prakasakam ist am upastambhakam calam ca rajah / guru varanakam eva tamah pradlpavac crthato vrttih / / 1 3 / / pp.134.26-27; 137.5 avivekydih siddhas traigunyt tadviparyaybhvt / kranaguntmakatvt kryasyvyaktam api siddham / / 1 4 / / pp.139.20,23; 140.7 bhednm parimnt samanvayt saktitah pravrttes ca / kranakryavibhgd avibhgd vaisvarpyasya / / 1 5 / / pp.141.17; 143.27; 144.31; 147.24; 150.18 kranam asty avyaktam pravartate trigunatah samudayc ca / parinma<ta>s salilavat pratipratigunsrayavisest / / 1 6 / / pp.162.14,23; 163.4; 165.1 sanghtaparrthatvt trigundiviparyayd adhisthnt / puruso ?sti bhoktrbhvt kaivalyrtham pravrttes ca / / 1 7 / / pp.168.4; 169.17,22; 170.4; 173.20

280

APPENDIX II

janmamaranakarananam pratiniyamad ayugapatpravrttes ca / purusabahutvam siddham trigundiviparyayc caiva / / 1 8 / / pp.174.28; 175.17-18; 176.4 tasmc ca viparyast siddham sksitvam asya purusasya / kaivalyam mdhyasthyam drastrtvam akartrbhvas ca / / 1 9 / / p.176.15-16 tasmt tatsamyogd acetanam cetanvad iva Ungarn / gunakartrtve ca tath karteva bhavaty udsinah / / 2 0 / / purusasya darsanrthah kaivalyrthas tath pradhnasya / pangvandhavad ubhayor api samyogas tatkrtah sargah / / 2 1 / / pp.183.30; 184.15,27; 185.20 prakrter mahn tato 'hamkras tasmd ganas ca sodasakah / tasmd api sodasakt pancabhyah panca bhtni 1/22// pp.187.23; 188.1,5,8 adhyavasyo buddhir dharmo jnnam virga aisvaryam / sttvikam etad rpam tmasam asmd viparyastam / / 2 3 / / pp.188.17; 191.28-29; 193.7 abhimno 'hamkras tasmd dvividhah pravartate sargah / aindriya ekdasakas t<>nmtrah paiicakas caiva / / 2 4 / / p.194.2,18,28 sttvika ekdasakah pravartate vaikrtd ahamkrt / bhtdes tnmtrah sa tmasas taijasd ubhayam //2b// pp.195.32; 196.4,20 p. 180.35-36

buddhlndriyni karnatvakcaksrasanansikkhyni / vkpnipdapypasthh karmendriyny huh / / 2 6 / / p.197.9,25

The Text of the Samkhyakarika as attested in the Yuktidipika samkalpakam atra manas tac cendriyam ubhayath samkhytam / antas triklavisayam tasmd ubhayapracram tat / / 2 7 / /

281

pp.199.12; 200.2,8

rpdisu paiicnm locanamtram isyate vrttih / vacandnaviharanotsargnands ca pancnm / / 2 8 / / pp.201.11; 204.3

svlaksanyam vrttis trayasya sais bhavaty asmny / smnyakaranavrttih prndy vyavah pafica / / 2 9 / / pp.205.9,23; 206.5

yugapac catustayasya tu vrttih kramasas ca tasya nirdist / drste tathpy adrste trayasya tatprvik vrttih / / 3 0 / / pp.211.24; 212.5,12,27

svm svm pratipadyante parasparkutahetukim vrttim / purusrtha eva hetur na kenacit kryate karanam / / 3 1 / / p.213.26-27

karanam trayodasavidham tad haranadhranapraksakaram / kryam ca tasya dasadhhryam dhryam praksyam ca / / 3 2 / / pp.215.21; 216.14,17

antahkaranam trividham dasadh bhyam trayasya visaykhyam / smprataklam bhyam triklam bhyantaram karanam / / 3 3 / / pp.216.22; 217.1,18,25,28

buddhindriyni tesm panca visesvisesavisayni / vg bhavati sabdavisay sesny api paficavisayni / / 3 4 / / p.218.1,8,13

sntahkaran buddhih sarvam visayam avaghate yasmt / tasmt trividham karanam dvri dvrni sesni / / 3 5 / / p.221.7-8

282

APPENDIX II ete pradipakalpah parasparavilaksana gunavisesah / krtsnam purusasyrtham praksya buddhau prayacchanti / / 3 6 / / p.222.17-18 sarvam praty upabhogam yasmt purusasya sdhayati buddhih / saiva ca visinasti <yat>ah pradhnapurusntaram sksmam / / 3 7 / / p.223.9,23 tanmtrny avisess tebhyo bhtni panca paiicabhyah / ete smrt visesh snt ghors ca mdhs ca / / 3 8 / / pp.224.18; 225.5,7; 227.19 sksm mtpitrjh saha prabhtais tridh visesh syuh / sksmas tesm niyat mtpitrj nivartante / / 3 9 / / p.228.2,23

prvotpannam asaktam niyatam mahaddi sksmaparyantam / samsarati nirupabhogam bhvair adhivsitam Ungarn / / 4 0 / / p.230.13-14 citram yathsrayam rte sthnvdibhyo vin yath cchy / tadvad vin visesair na tisthati nirsrayam lingam / / 4 1 / / purusrthahetukarn idam nimittanaimittikaprasarigena / prakrter vibhutvayogn natavad vyavatisthate lingam / / 4 2 / / p.232.21-22 p.231.9-10

smsiddhiks ca bhvh prkrtik vaikrts ca dharmdyh / drsth karansrayinah krysrayinas ca kalaldyh / / 4 3 / / p.234.18-19,21

dharmena gamanam rdhvam gamanam adhastd bhavaty adharmena / jnnena cpavargo viparyayd isyate bandhah / / 4 4 / / pp.235.7,9,19; 236.4

The Text of the Samkhyakarika as attested in the Yuktidipika vairgyt prakrtilayah samsro bhavati rjasd rgt / aisvaryd avighto viparyayt tadviparysah / / 4 5 / /

283

pp.236.9,25; 237.11,22 esa pratyayasargo viparyaysaktitustisiddhykhyah / gunavaisamyavimardt tasya ca bheds tu paiicsat / / 4 6 / / pp.239.4; 240.3 paiica viparyayabhed bhavanty asaktis ca karanavaikalyt / astvimsatibhed tustir navadhstadh siddhih / / 4 7 / / pp.240.10; 241.18-19,22 bhedas tamaso 'stavidho mohasya ca dasavidho mahmohah / tmisro 'stdasadh tath bhavaty andhatmisrah / / 4 8 / / pp.241.28; 242.1,4,8,11 ekdasendriyavadhh saha buddhivadhair asaktir uddist / saptadasavadh buddhir viparyayt tustisiddhinm / / 4 9 / / pp.242.26; 243.11 dhytmik<yas>(?) catasrah prakrtyupdnaklabhgykhyh / bhy visayoparamt paiica ca nava tustayo 'bhihith / / 5 0 / / pp.244.1; 248.1 hah sabdo 'dhyayanam duhkhavights trayah suhrtprptih / dnam ca siddhayo Jstau siddheh prvo 'nkusas trividhah / / 5 1 / / pp.251.10-11; 252.28 na vin bhvair Ungarn na vin lingena bhvasamsiddhih / lihgkhyo bhvkhyas tasmd dvividhah pravartate sargah / / 5 2 / / p.255.14,16,18 astavikalpo daivas tairyagyonas ca paficadh bhavati / mnusyas caikavidhah samsato bhautikah sargah / / 5 3 / / p.256.10-11,19

284

APPENDIX II urdhvam sattvavisalas tamovisalas tu mulatah sargah / madhye rajovislo brahmdistambaparyantah / / 5 4 / / p.257.10,16,19,25

atra jarmaranakrtam duhkham prpnoti cetanah purusah / lihgasyvinivrttes tasmd duhkham samsena / / 5 5 / / pp.258.3; 260.25

ity esa prakrtikrtah pravartate tattvabhtabhvkhyah / pratipurusavimoksrtham svrtha iva parrtha rambhah / / 5 6 / / p.261.15-16

vatsavivrddhinimittam ksirasya yath pravrttir ajnasya / purusavimoksanimittarn tath pravrttih pradhnasya / / 5 7 / / p.263.3-4

autsukyanivrttyartham yath kriysu pravartate lokah / purusasya vimoksartham pravartate tadvad avyaktam / / 5 8 / / p.264.7-8

rahgasya darsayitv nivartate nartaki yath nrtyt / purusasya tathtmnam praksya vinivartate prakrtih / / 5 9 / / p.264.19-20

nasmi na me naham ity aparisesam / aviparyayd visuddham kevalam utpadyate jnnam / / 6 4 / / pp.265.8,10,14

dharmadinam akaranapraptau / tisthati samskravasc cakrabhramavad dhrtasanrah / / 6 7 / / p.265.24-25

prpte sarirabhede caritrthatvt pradhnavinivrttau / aiknt<ikam> tyantikam abhayam kaivalyam pnoti / / 6 8 / / p.266.12,19,22

The Text of the Samkhyakarika as attested in the Yuktidipika purusrthrtham idam sstram guhyam paramarsin samkhytam / sthityutpattipralays cintyante yatra bhtnm / / 6 9 / /

285

p.267.5,8,11,20

etat pavitram agryam munir suraye 'nukampay pradadau / surir api pancasikhya tena ca bahudh krtam tantram / / 7 0 / / pp.268.15; 269.5,7

sisyaparamparaygatam Isvarakrsnena caitad rybhih / samksiptam ryamatin samyag vijnya siddhntam / / 7 1 / / p.269.12,23,25,27

saptatym kila ye 'rths te 'rthh krtsnasya sastitantrasya / khyyikvirahith paravdavivarjits cpi / / 7 2 / / p.270.5-6

286 Appendix The III

APPENDIX III

Text of t h e Smkhyakrik as found in II

con-

texts other t h a n those of A p p e n d i x

duhkhatraybhightj jijns tadapaghtake hetau / (SKlab) drstavad nusravikah sa hy avisuddhiksaytisayayuktah / (SK2ab) tadviparitah sreyn (SK2c) vyaktvyaktajfia-(SK2d') vyaktvyaktajiiavijnnn mokso 'vpyate //(cf.SK2d) mlaprakrtih (SK3aJ) mlaprakrtir avikrtih (SK3a) mahaddyh prakrtivikrtayah sapta / (SK3b) sodasakas tu vikro na prakrtir na vikrtih purusah / / (SK3cd) drstam anumnam ptavacanam ca (SK4ab}) sarvapramnasiddhatvt trividham pramnam istam (SK4bJc) prativisaydhyavasyo drstam (SK5abJ) trividham anumnam khytam (SK5b') smnyatas tu drstd atindriynm prasiddhir anumnt / (SK6ab) sauksmyt tadanupalabdhih (SK8a) sauksmyt tadanupapattih (ef.SK8a) nbhvt (SK8b') kryatas tadupalabdhih / (SK8b') mahaddi tac ca kryam prakrtivirpam sarpam ca / / (SK8cd)

p.4.19 p.19.8 p.35.5-6 p.58,fn.(4) pp.90.6, 107.20 p.57,fn.(2) p.63.2 p.60.11 p.63.4 pp.4.5-6, 32.5-6 p.76.12-13 pp.4.6, 70.16 p.6.2-3 p.86.2

p.107.6-7, 9-10 p.3.26-27 p. 107.9 p. 107.6

pp.6.26, 125.23 prakrtivirpam (SK8d') sarpam ca / / (SK8dJ) asadakarant (SK9aJ) p.8.3 p.8.4 p. 152.2

The Text of the SK in contexts other than those of Appendix II hetumad anityam vyaktam (SKlOa'd') trigunam aviveki visayah (SKlla) aviveki visayah smnyam acetanam prasavadharmi / (SKlla'b)

287

p.189.21 p.l26,fn.(3) p.139.21

trigunam aviveki visayah smnyam acetanam prasavadharmi / (SKIlab) pp.169.18, 176.6 smnyam acetanam prasavadharmi / (SKllb) p. 17.1

smnyam acetanam prasavadharmi vyaktam tath pradhnam (SKllbc) p.8.5-6 tath pradhnam (SKllc') tadviparltah (SKIId') tath ca pumn / / (SKlld') prityapritivisdtmakh (SK12a) bhednm parimnt (SK15a) parimnam anvayah (cf.SK15a'b') samanvayc chaktitah pravrttes ca (SKI5b) avibhgd vaisvarpyasya //(SK15d) kranam asty avyaktam (SK16a) sanghtaparrthatvt (SK17a) sanghtaparrthatvam (cf.SK17a) janmamaranakarannm (SK18a) tasmc ca viparyst (SK19a) pp.140.4, 169.19 p.8.4 p.8.5 p.148.5-6 pp.3.22, 4.21, 5.28 p.89.6 p.97,fn.(l) p.267.23 pp.3.22, 4.20, 5.28, 255.23 p.78.10-11 p.89.6-7 p.6.16 pp.6.19, 66.9-10, 155.12, 157.10

tasmc ca viparyst siddham sksitvam asya purusasya / kaivalyam mdhyasthyam drastrtvam akartrbhvas ca //(SK19) tasmt tatsamyogd acetanam cetanvad iva Ungarn / (SK20ab) purusasya darsanrthah (SK21a) p.180.30-31 p.78.7 p.6.17

purusasya darsanrthah kaivalyrthas tath pradhnasya / pangvandhavad ubhayor api samyogah (SK21abcd?) pp.48.10-11 purusasya darsanrthah kaivalyrthas tath pradhnasya / pangvandhavad ubhayor api samyogas tatkrtah sargah / / (SK21) p.267.26-27

288

APPENDIX III p.255.3 pp.267.22, 57,fn.(2) p.63.11

samyogakrtah sargah / / (cf.SK21d) prakrter mahn (SK22a') prakrter mahms tato 'hamkrah (SK22ab')

prakrter mahms tato 'hamkras tasmd ganas ca sodasakah / (SK22ab) p.7.14 adhyavasyo buddhih (SK23a) tasmd dvividhah pravartate sargah / (SK24b) ekdasakah pravartate vaikrtd ahamkrt / (SK25a'b) buddhindriyni karnatvakcaksrasanansikkhyni /(SK26ab) pp.77.4, 57,fn.(2) p. 194.23 p.197.5 p.216.32

tac cendriyam ubhayath samkhytam antas triklavisayam (SK27bc) p.216.35-36 p.213. . 1 5 rpdisu paficnm locanamtram isyate vrttih / (SK28ab) sabddisu srotrdinm locanamtram vrttih (cf.SK28ab) svlaksanyam vrttis trayasya (SK29ab ) sais bhavaty asmny / (SK29b') drste tathpy adrste trayasya tatprvik vrttih / / (SK30cd) <31ab) svm svm pratipadyante parasparktahetuklm vrttim / (SK31ab) karanam trayodasavidham (SK32a) kryam ca tasya dasadh (SK32c) trayasya visaykhyam / (SK33b?) buddhindriyni tesm (SK34a) buddhindriyni tesm paiica visesvisesavisayni / (SK34ab) panca vises<visesh>(SK34b') sesny api pancavisayni (SK34d) sntahkaran buddhih sarvam visayam avaghate yasmt / tasmt trividham karanam dvri dvrni sesni / / (SK35) tasmt trividham karanam dvri (SK35cd') p.214.30 p.175.2 pp.217.32, 224 .13 pp.217.7, 221.25 (2) P .57,fn. p.77.3 p.224.13 (2) P .57,fn. (2) P .57,fn. p.4.23-24
?

p.217.30 p.189.35 p.213.16 p.204.24

The Text of the SK in contexts other than those of Appendix II ete pradipakalpah (SK36a) ete pradipakalpah parasparavilaksan gunavisesh / krtsnam purusasyrtham praksya buddhau prayacchanti / / (SK36) p.209.6-7 sarvam praty upabhogam yasmt purusasya sdhayati buddhih / (SK37ab) ' pp.79.28, 209.8 tanmtrny avisesh (SK38a) tebhyo bhtni panca paficabhyah, ete smrt visesh (SK38bc) snt ghors ca mdhs ca //(SK38d) sksms tesm niyath (SK39c) purusrthahetukam (SK42a') natavad vyavatisthate lirigam / / (SK42d) smsiddhiks ca bhvh (SK43a) p.7.4 p.7.2-3 pp.7.3-4 p.230.11 p.57,fn.(l) p.4.21-22 p.57,fn.(2) p.79.26-27

smsiddhiks ca bhvh prkrtik vaikrts ca dharmdyh / (SK43ab) p.68.1 dharmena gamanam rdhvam (SK44a) esa pratyayasargo viparyaysaktitustisiddhykhyah / (SK46ab) panca viparyayabhed bhavanty (SK47ab') panca viparyayabhed bhavanti asaktis ca karanavaikalyt / astvirnsatibhed tustir navadhstadh siddhih / / (SK47) bhedas tamaso 'stavidhah (SK48a) hah sabdo 'dhyayanam (SK51a) astavikalpo daivas tairyagyonas ca pancadh bhavati / mnusyas caikavidhah (SK53abc) p.57,fn.(l) p.7.9 p.7.10 p.6.21-22 p.7.11 p. 192.10 p.18.2-3

atra jarmaranakrtam duhkham prpnoti cetanah purusah / (SK55ab) p.258.27 atra jarmaranakrtam duhkham prpnoti cetanah purusah / lingasyvinivrttes tasmd duhkham samsena //(SK55) ksirasya yath tath pravrttih pradhnasya / / (SK57b'd) p. 19.1-2 p.4.22-23

evam tattvbhysn nsmi na me nham ity aparisesam / aviparyayd visuddham kevalam utpadyate jfinam / / (SK64) pp.7.29-30, 192.13-14

290

APPENDIX III p. 184.9 p.49.7 p.6.18 p.6.17-18 p.268.1

drsta mayety upeksaka eko drstaham ity uparataika / (SK66ab) drst mayety upeksata eko drstaham ity uparamaty any / (SK66ab) samyagjnndhigamt (SK67a) prpte sarirabhede (SK68a) prpte sarirabhede caritrthatvt pradhnavinivrttau /(SK68ab)

Index of Words of the Samkhyakarika Appendix IV

291

Index of W o r d s of the Samkhyakarika as in the Yuktidipika and Mss.* -anavasthanat the Marginal

attested Notes of

Kashmir and Delhi -akarant 9a: ( 7.0), 152.2

7b:(98.2)

akartrbhvah 19d:{176.16), 180.31 akaranapraptau 67b:(265.24)

anityam 10n:(127.3), 189.21 anukampaya 70b:(268.15) -anupalabdhih 8a:(106.6), 1077,10,

a g r y a m 70a:(268.15) ankusah 5ld:(252.28) 17.1, 139.21,

a n u m n a m 4a:^.5, 32.5, (70.11)', 5b:6.3, (82.29) anumnt 6b:86.2, (88.3) anekam 10b:(127.3) antah 27c:(200.8), 216.35 antahkaranam ZZa,:(216.22) -antahkarana 3ba:57,fn.(2), -antaram %7d\(223.23) a n d h a t m i s r a h 4%d\(242.11) a n y (66b):^P.7 -andha- 21c:48.11, (184-27), 267.27 - a p a g h t a k e lb:4.19, (11.8) aparisesam 64b: 7.29, 192.13, (265'.8) apavargah 44c:(235.19) aprth lc:(24.15) (221.7)

a c e t a n a m (llb):8.5, 169.18, 176.6; 20b: 75.7, (180.35) ajnasya 57b:(263.3) atidrt 7a>:(98.2)

-atisaya- 2b:19.8, (31.9) atindryanam 6b:86.2, (88.3) - a t y a n t a t o - Id:(25.5) atra 27&:( 199.12); 55a:J9.J, (258.3), 258.27 adrste 30c:204.24, (212.12) adharmena 44b:(235.9) adhastt 44b:(235.9) - a d h i g a m a t (67&):6.18 adhivsitam 40d:(230.14) adhisthnt 17b:(169.22)

adhyayanam 5W.192.10, (251.10) adhyavasyah 2U:57Jn.(2), 77.4, (188.17) -adhyavasyah (76.25) ., 70.16,

api 6c:(99.6); Ud:(140.7) 140.30) 21c:48.11, (184-27), 267.27; 22c:(188.8); 30c.204.24, (212.12); Ud:57Jn.(2), (218.13); 70c:(269.5); 72d:(270.6)

*The Karika number within brackets means that the word concerned is supplemented only from the Appendix III. Page and line numbers are shown by italics. Page and line numbers in brackets mean that the word concerned is given in Appendix II.

292 -aprlti- (I2a):148.6 abhayam 6Sd:(266.22) abhvt 8b:(106.6)

APPENDIX IV aviparyayt 64c:7.30, 192.14, (265.10) avibhgt 15d:( 150.18), 267.23 aviveki ( l l a ) : 126Jn.(3), 139.21, 169.18, 176.6 avivekydih U&:(139.20) avisuddhiksaytisayayuktah 2b:i9.S, (31.9) -avisesa- 34b: 77.3, (218.1), 224.13 avisesh 38a: 7.4, (224.18) -avyakta- 2d:(48.15), 58Jn.(4), 90.6, 107.20 avyaktam lOd:(127.4); Ud:(140.7), 140.30; 1^.3.22,4.20, 5.28, (162.14), 255.23; avypi l0a,:(127.3) -asakti- 46b:7.9, (239.4)

-abhvt ld:(25.5); 9b:(119.19); Ub:(139.23) -abhightt la:^iP, (10,8) abhibhavt 7cd:{98.3) abhimnah 24a:(194.2) -abhihrt 7d:(98.3) abhihith 50d:(248.1) -abhyst (64a):7.29, 192.13 ayugapatpravrtteh l&b:(175.17) -artha- 42a,:57,fn.(l), (232.21); 69a,:(267.5) -arthah 21^.(183.30);
2

Zlc:(213.27);

arthatas 13d:(137.5) -arthatvt 17^.78.11,(168.4)] 68b:(266.19), 268.1 artham Z6c:209.7, (222.18) -artham 17 d;(173.20)\ 56c:(261.16)] 5Sc:(264.8); 69*1(267.5) arthh 72a:(270.5); 72b:(270.5) avagahate Zhb:57Jn.(2), avikrtih 3a:(5<S.S), 63.2 avightah 45c:(237.) avinivrtteh 55c:i9.2, (260.25) (221.7)

asaktih A7b:6.21, (241.18) 49bl(242.26) astadh A7d:6.22, (241.22) astavikalpah 53a: 18.2, (256.10) astavidhah 48a: 7.11, (241.28) astdasadh 48c:(^2.S) astvimsatibhed 47c:6.22, (241.19) astau blc:(251.11)

asaktam 40a:(230.13) asadakarant 9a: ( 117.6), 152.2 asmny 29b:(205.23), 213.16 asiddham c:(99.6)

Index of Words of the Samkhyakarika asti Wa,:3.22, 120, 5.28, {162.14), 255.23; 17c:(170.4) asmd 2ZA:{193.7) -dih asmi 64b:7.29, 192.13, (265.8) asya I9b:( 176.15), 180.30 aham G4b:7.29, 192.13, (265.8); (66b):49.7, 184-9 ahamkarah 22ab:7.14, 63.11, (188.1)-' 24a: 194.2 ahamkrt 25b:( 195.32), 197.5 -kta- 31b:(213.26), 214-30 -khyah 46b:7.P, (239.4); 52c:(255.18); 56b:(261.15) -khyh 50b:(244.1) -khyam ZZb:217.7, (217.18), 221.25 khytam 5b:^.5, (82.29) khyni 26b:(197.9), 216.32 khyyikvirahith 72c:(270.6) gatam -gamt 71^(269.12) 6d:(99.6) Uv.(139.20) -dibhyah Alb:(231.9) -dlnm 67b:(265.24) -dyh Sb:60.11, (62.18); 29d:(206.5); 4Zb:68.1, (234-18); 4Zd:(234-21) dhytmikyah 5Qa,:(244.1) -nandh 2 8 d : ( ^ . 5 ) anusravikah 2&A9.8, (30.18) -di- I7b:(169.17); 18d:(176.4)l 40b:(230.13)] Md:(257.25)

293

ptavacanam 4ab:^.5, 32.5, (70.11); bd:(87.3) ptasrutih bd:(87.3) ptgamt 6d:(99.6) apnoti 68d:(266.22) bhyantaram ZZd:(217.28) rambhah f>d:(261.16) ryamatin 7lc:(269.25)

rybhih 71b:(269.23) alocanamitram 28b:(201.11), 213.15, 217.30 -asrayaUd:(165.1)

tmakatvt Uc:(140.7, 140.30) -tmakh (I2a):148.6

srayam 41a:(^i.P) -asrayinah 43c:(234.19); sritam 10b:(127.3) asuraye 70b:(268.15) surih 70c:(269.5) 43d:(234.21)

tmnam 59c:(264.20) tyantikam 68c:(266.22) -dna- 2Sc:(204.3) -di 8c:6.26, (107.14), 125.23

haraiiadhranapraksakaram 32b: (215.21)

294 hryam $2d:(216.17) huh 2Qd:(197.25) iti 64b:7.29, 192.13, {265.8)] (66a):^P.7, 1819; (66b):49.7, 1819 idam 42^(232.21); 69^.(267.8) indriyaghtt 7b:(98.2)

APPENDIX IV uparamati -uparamt -upalabdhih 8a,:(106.6), 107.7,10 upastambhakam 13b:(lS4.26)

-upasthh 26d:(197.25) -updna- b0b:(244.1) updnagrahant 9ab:(119.6)

indriyam 27b:(200.2), 216.35 indriyavadhh 49^.(242.26) upeksakah (66a):i^.P upeksatah (66a):^9.7 ubhayath 27b:(200.2), 216.35 ubhayapracram 21d:(200.8)

-indriynam 6b:86.2, (88.3) -indriyni 26a,:(197.9), 216.32; 26d:(197.25); 34a:57,/h.#), 77.3, (218.1) iva 20b:78.7, (180.35); 20d:(180.36); 56d:(261.16) istam 4c:(68.29), 76.13; Ub:(134.26) isyate 28b:(20i.ll),

ubhayam 2d:(196.20) ubhayoh 21c.48.ll, (184.27), 267.27 rdhvam 44a:57,fn.(l), S4a,:(257.10) hah bU:192.10, rte Tsvarakrsnena 7lb:(269.23) 4U:(231.9) (235.7);

(251.10)

-rsin 6 9 b : ( ^ 7 . ) ekah (66b):^P.7, 184.9 ekavidhah 2>c:18.3, (256.11) ek (66b):if^.P ekdasa- 49^.(242.26)

-utpatti- 69c:(267.20) -utpannam utpadyate 64d:7.3, (265.14) -utsargaudslnah 20d:(180.36) uddist 49b:(242.26) upabhogam %lv.79.28, 209.8, (223.9) uparata (66b): 184.9

ekdasakah 24c:(194.28); 25^.(195.32), 197.5 eknttyantato'bhvt etat 23c:(191.29); 70^.(268.15); 71b:(269.23) ld:(25.5)

Index of Words of the Smkhyakarika e t e S6&.79.26, 209.6, (222.17); 38c: 7.3, (225.7) eva I3c:(134.27); 18d:(176.4); 24d:(194.28); Zlc-(213S7)' 37c:(223.23) karmendriyini 26d:(197.25)

295

kalaldyh 43d: (23121) -kalpSh 36^.79.27, 209.6, (222.17) ,_ ,_ . , , _ _. 1C ,,.., karanakaryavibhagat lhc:(147.2A) kranaguntmakatvt 14

evam (64&):7.29, 192.13 esah 46a:7.9, (239-4); 56a:(261.15) es 29b:(205.23), 213.16 aikntikam 6Sc:(266.22) aindriyah 24c:(194.28) aiSvaryam 23b:(191.28) aiSvaryt 45c:(237.11) kranabhvt 9d:(124-6) kranam 16&.3.22, 4-20, 5.28, (162.14), 255.23 -krya- 15c:(147.24) kryatas Sb:(106.10) kryate 3\d:(213.27)

kryam Sc:6.26, (107.14), 125.23; 9d:(124-6); autsukyanivrttyartham bS&:(264-7) 32c:(216.14), 217.32, 224.13 -karam Z2b:(215.21) ' karyasya Ud:(U0.7), 140.30

-kla- 21c:(200.8), 216.36; 35c:4.23, 57,fn.(2), -karana- 29c:(206.5) -karanam ^.(216.22) -karan M*:57Jh.(2), (221.7)
kila

(221.8) -klam 33c:(217.25); 83d:(7.)

karanavaikalyt 47b:6.21, (241.18) -karant 9z:(117.6), 152.2

-*#* 2ld:(185.20), 255.3, 267.27; bo3i:(261.15) krtam 70d:(269.7)

-karananam 18^:6.16, (174.28) -krtam 55a:/Ai, (258.3), 258.27 karansrayinah 43c:(234.19) I _ _# krtsnam 36c:509.7, (222.18) karnatvakcaksurasananasikkhyani 26ab:(197.9), 216.32 kart 20d:(180.36) -kartrtve 20c:(180.36) krtsnasya 12b:(270.5) kenacit 31d:(213.27) kevalam 64d:7.50, 192.14, (265.14)

296

APPENDIX IV

ca Ab:4.6,32.6, (70.11); 6c:(99.6); 7d:(98.3); kaivalyrthah 21b:48.10, (184.15), 8c:6.26, (107.14), 125.23; 267.26 Sd:6.26, (107.14), 125.23; 9d:(124.6); kaivalyrtham l7d:(173.20) ( ) 13b:{l34.26); k r a m a s a s 30b:(212.5) 1M:(137.5); lbb:97,fh.(l), (144-31); kriysu 58b:(264.7) 16b:(162.23); -ksaya- 2b: 19.8, (31.9) Ud:(173.20); lSb:(175.17); kslrasya b7b:4.22, (263.3) 18d:(176.4); 19a,:6.19, 66.9, 155.12, 157.10, g a n a h 22b:7.14, (188.5) (176.15), 180.30; I9d:(176.16), 180.31; g a m a n a m 44&:57,fn.(l), (235.7); 20c:(180.36); 44b:(235.9) 22b:7.14, (188.5); 24d:(194-28); -guna- 14c:{140.7), 140.30; 27b:(200.2), 216.35; b:(162.23); 2M:(204.8)', 30b:{212.5); 17b:(169.17) Z2c:(216.14), 217.32, 224.13; Z2d:(216.17); gunakartrtve 20c:(180.36) 37c:(223.23); - g u n a m (11B): 126,fn.(3), 169.18, 3Sd:7.42, (227.192); 176.6 4U:57,fh.(2), 68.1, (234-18); \lb\68.1, (234.18); gunavisesh ?>b\209.6, (222.17) A3d:(234.21); 4Ac:(235.19); gunavaisamyavimardt 46c:(240.3) 46d:(240.3)', 47b:6.21, (24L18); -guntmakatvt 14c: (140.7) 48b:(242.1); 50d:(248.1); -gunsraya- 16d: (165.1) -gunyt guru 14b\(139.20) bSb:18.2, (256.10); b3c:18.3, (256.11); 70d:(269.7); 7lb:(269.23); 72d:(270.6) cakrabhramavat 67d: (265.25) -caks- 26b:(197.9), catasrah 50a:(244.1) 216.32

kaivalyam 19c:(176.16), 180.31; 68d:(266.22)

lZz\(134.27) 69b:(267.11) 9b:(119.6)

guhyam -grahant -ghtt

7b:(98.2)

g h o r h 38d: 7.3, (227.19)

Index of Words of the Samkhyakarika catustayasya 30a:(211.24) caritarthatvat 68b:(266.19), 268.1 calam I3b:(134.26) t a t p r v i k 30d:204.24, (212.27) tatsamyogt 20a:7.7, (180.35) t a t h (llc):8.6, 140.4, 169.19] 20c:(180.36)] 2lb.48.10, (184.15), 267.26] ZQc.204.24, (212.12)] 48d:(242.11)] hld:4.22, (263.4)] 59c:(264-20) tadanupapattih 8a,:3.27 c e t a n v a t 20b:78.7, (180.35) chy 41b:(231.9)

297

c i t r a m 41a,:(231.9) c i n t y a n t e 69d:(267.20) cet lc:(24.15)

c e t a n a h 55b: 19.1, (258.3), 258.27

t a d a n u p a l a b d h i h 8&:(106.6), 107.7, 107.10

janmamaranakarananam \8&:6.16, tadupalabdhih 8b:(106.10) (174.28) " t a d a p a g h t a k e lb:4.19, (11.8) jarmaranakrt am 5 5a: 19.1, (258.3), t a d v a t 4lc:(231.10)] 258.27' 58d:(264.8) -jh 39a:(8S.); t a d v i p a r l t a h 2c:35.5, (47.9)] hd:(228.23) (lld):<^ " jijiis lb:4.19, (10.8) tadviparyaybhvt Ub:(139.23) -jna- 2d:(48.15), 58Jn.(4), 90.6, tadviparysah 4bd:(237.22) 107.20 -jnna- (67a):6.18 j n n a m 2Sb:(19L28)\ 64d:7.30, 192.14, (265.14) j n a n e n a 44c:(235.19) t a t 8c:6.26, (107.14), 125.23] 27b:(200.2), 216.35] 27d:(200.8)] S2b:(215.21) t a t a h 22a,: 7.14, 63.11, (188.1) t a t k r t a h 21d:(185.20), 267.27 t a n t r a m 70d:(269.7) - t a n t r a m 10c:(127.4) tanmtriii 38a: 7.4, (224.18) tamah Uc:(134.27)

t a m a s a h 48a: 7.11, (241.28) tamovislah 54b:(257.16) -tas 8b:(106.10)] \U:(137.5)] lbb:97,fn.(l), (144-31)] Ub:(162.23)] bZd:(256.19)] b4b:(257.16)

tattvabhtabhvkhyah b6b:(261.15) t a t t v b h y s t (64a):7.29, 192.13

298

APPENDIX IV tesm 34a,:57,fn.(2), 77.3, (218.1); *39c:(228.23), 230.11 taijast 2hd:(196.20) tairyagyonah 53b: 18.2, (256.10) -traya- la,:4.19, (10.8) trayah blb:(251.10)

tasmt 6c:(99.6); 19a,:6.19, 66.9, 155.12, 157.10, {176.15), 180.30; ,z 20^:78.7,(180.35); 22b:7.14, (188.5); 22c:(188.8); 24b:(194.18), 194.23; 27d:(200.8); Z5c:4.23, 57Jn.(2), (221.8); 52d:(255.18); 55d:19.2, (260.25) tasya 30b:(212.5); 32c:(216.14), 217.32, 224-13; 4d:(240.3) tnmtrah 24d:(194.28); 2bc:(196.4) tmasah 25d:(196.4) tmasam 23d:(iP5.7) tmisrah ASc:(242.8) -tamisrah A8d:(242.11) tisthati 4ld:(231.10); "67c:(265.25) tu 3c:63.4, (63.24); bd:(87.3); fa:86.2, (88.3); 46d:(240.3); 54b:(257.16) tustayah b0d:(248.1)

trayasya 29b:189.35, (205.9); Z0d:204.24, (212.27); ZSb:217.7, (217.18), 221.25 trayodasavidham 32a: 175.2, (215.21) triklam Zid:(217.28)

triklavisayam 27c:(200.8), 216.36 trigunatah 16b:(162.23) trigunam (lla): 126,fn.(3), 169.18, 176.6 trigundiviparyayt I8d:(176.4) tridh S9b:(228.2) trividhah trividham Ac:(68.29), 76.13; bb:6.2, (82.29); Zbc:4.23, 57Jn.(2), (221.8) 17b:(169.17);

traigunyat 14b: (139.20) -tvak- 26b:(iP7.P), 216.32 -tusti- 46b:7.9, (239.4) tustih Md:6.22, (241.22) tustisiddhinm 49d:(^ te 72b:(270.5) tena 70d:(^9.7) t e b h y a h 38b:7.2, (225.5) dasavidhah ASb:(242.4) darsanrthah 2la,:6.17, 48.10, (183.30), 267.26 darsayitv 59a:(2^.1P) dasadha Z2z.(216.14), 217.32, 224.13;

Index of Words of the Samkhyakarika dnam 5lc:(251.11) n a l&:(25.5); 3d:63.42, (66.42); Sb:(106.6); 31d:(213.27); 4ld:(231.10); 52^.(255.14); 52b:(255.16); 64b:7.29, 192.13, (265.P) natavat 42d:4.21, (232.22) nartald nava navadh 47d:6.22, (241.22) -nsik- 26b:(197.9), 216.32 nimittanaimittikaprasangena 42b: (232.21) -nimittam 51^.(263.3); 57c:(263.4) niyatam 40b:(230.13) niyath Z9c:(228.23), 230.11 -niyamt nirsrayam lSb:(174.28) 4ld:(231.10) 59b:(264.19)

299

duhkhatraybhightt Ia:^.i0, (10.8) duhkham 55b:19.1, (258.3), 258.27; 55(1:19.2, (260.25) duhkhavighth -drt 1^.(98.2) drstam 4*4.5, 32.5, (70.11); "5b:4.6, 70.16, (76.25) drstavat 2a: 19.8, (30.18) drsth 43c:(234.19) drst (66a):^P.7, 184.9 "(66b):49.7, 184.9 drstat 6an86.2, (88.3) drste lc:(24.15); "S0c:204.24, (212.12) daivah 53a: 18.2, (256.10) drastrtvam 19d:( 176.16), 180.31 dvarani 35d:51fJn.(2), (221.8) dvri 35d:^.^5, 57Jn.(2), dvividhah 24b:(194.l8), 52d:(255.18) dharmah 23b:(191.28) dharmdlnm 67b:(265.24) dharmdyh 43b: 68.1, (234.18) (221.8) 194.23; 5lb:(251.10)

nirupabhogam 40c:(230.14) nirdista 30b:(212.5) nivartate 59b:(264.19) nivartante

-dharmi (Ub):8.6, 17.1, 139.21, 169.18, 176.6 dharmena AA*,:57,fn.(l), (235.7) -dhrana32b:(215.21)

-nirvrtti- 5 8 a : ( ^ . 7 ) nrtyt 5 9 b : ( ^ . l P ) -naimittika- 42b:(232.21) pangvandhavat 2lc:48.11, 267.27 (184.27),

dharyam Z2A:(216.17) dhrtasarlrah 67d:(265.25)

300 panca 22d:(188.8)] 29d:(206.5)] 34b:77.5, (218.1), 224.13] 38b:7.2, (225.5)] 47&.6.21, 7.10, (240.10)] 50d:(#.J) pancakah 24d:(194.28) pancadh 53b: 18.2, (256.10) pailcabhyah 22d:( 188.8)\ 38b: 7.3, (225.5) paiicavisayni 34d: 57,fn. (2), (218.13) pancasikhya 70c:(269.7) paiieiim 2^.(201.11), 2Sd:(204.3) paiicsat 46d:(240.3) paratantram 10c:(127.3) paramarsin 69b:(267.11) -paramparay 71a,:(269.12)

APPENDIX IV pavitram 70^.(268.15) -pni- 26c:(197.25) -pda- 26c:(197.25) -pyu- 26c:(197.25) -pitr- 39a:(228.2)] id:(228.23) punah * 37d:(85.&?) pumn (lid): 8.5 -purusa- Z7d\(223.23)] b6c:(261.16) purusah 3d:63.4, (66.4)] 17c:(170.4)] 55b:i9.i, (258.3), 258.27 purusabahutvam 18c: (175.18) purusavimoksani mit tarn 57c:(263.4) purusasya 19b:(176.15), 180.30] 2U.6.17, 48.10, (183.30), 267.26] 36c:209.7, (222.18)] S7b:79.28, 209.8, (223.9)] bSc:(264.8)] 59c:{264.20)

213.15]

paravdavivarjith 72d:(270.6) parasparavilaksanh 36b: 209.6, (222.17)

parasparakutahetukim Ub:(213.26))purusrthah 31c'(213 27) V ; 214.30 purusarthahetukam 42a: 57,fn. (1), parrthah bd:(261.16) (232.21) -parrthatvt 17^:78.11, (168.4) parinmatah I6c:(163.4) pur usart hart harn 69a: (267.5) prvah 5ld:(252.28)

parimnt I5a,:3.22, 4.21, 5.28, (14L17) paroksam 6d:(99.6) -paryantah b4d:(257.25) -partyantam 40b:(230.13)

-prvik 30d:204.24, (212.27) prvotpannam 40a,:(230.13) praksakam -praksa-

*The reading punah of the Mss is emended to yatah in this edition.

Index of Words of the Samkhyakarika praksya S6d:209.7, (222.18); b9d:(264.2O) prakasyam 2>2d.(216.17) prakrtih Zd:63.4, (66.4); 59d:(264.20) -prakrtih 3a,:(58.8), 63.2 prakrtikrtah 56&:{261.15) prakrtilayah 45^.(236.9) prakrtivikrtayah 3bi60.ll, (62.18) pradhnapurusantaram

301 37d:(223.23)

pradhnam (Uc):8.6, HO.4, 169.19 pradhanavinivrttau 268.1 6Sb:(266.19),

pradhnasya 21b:48.10, (184.15), 267.26] *>7d:4.23, (263.4) prabhtaih 39b:{228.2) . p P a m 5 ? a . 4b:(69.20), 76.13 pramnam 4c:t68.29), 76.13 pramanat 4d:(67.4)

prakrtivirpam 8d:6.26, (107.14), 125.23 prakrteh 22a:7.14, 57Jn.(2), 63.11, (187.23), 267.22; 42c:(232.22)
P r

prameyasiddhih 4d:(67.4) prayacchanti 36d:209.7, (222.18) -pralayh G9c:(267.20) pravartate I6b:( 162.23); 24^.(19118), 19123; 25b:(195.32), 197.5; b2d:(255.18); 56b:(261.15); 58c:{264.7) 58d:(264.8)
v ; v ;

f ^

-pracaram 27d:(200.8) prati 37a:7P.2S, 209.8, (223.9) -prati- 16d:(165.1) pratmiyamat 18b:(174.28)

pratipadyante 31a:(^i5.^), 14.

pravrttih h7b:(263.3);
pPaVTtteh

.(l),

(144-31);

Ud:(173.20)

prativisayadhyavasayah oai^.o, 7.i^, (76.25)


m

-prasangena 42b:(232.21) prasavadharmi (Ub):8.6, 17.1, 139.21, 169.18, 176.6 prasiddhih 6b:86.2, (88.3) prkrtikh 4Sb:68.1, (234.18) prndyh 29d:(206.5) -prptih

pratyayasargah 46a:7.9, (239.4) pradadau 70b:(268.15) pradipakalph 36a,:79.26, 209.6, (222.17) ' pradlpavat 13d:(i57.5)

302 prpte 68a,:(266.12), 268.1 -prptau 67b:{265.24)

APPENDIX IV bhvh 43a,:57,fn.(2), 68.1, {23118) -bhvt

prpnoti 55b:10.1, (258.3), 258.27 17 - . . . ._ , -, / 1 O v 1IQ -bhvkhyah S2c:(255.18) pntyapritivisadatmakah (12a.):148.5 u AU u ^ ^ /iio /\ bhvaih 40d:(JO.i^); bandhah 44d:(J&^) 52a:(5ff.l]) -bahutvam lSc:{175.18) -^ uu K v ; -bhuta- 56 bahudh 7Od:(0P.7) k , % . . , bhutadeh bhyam 33b:(^i7.i); 33c-(217 25) bhtnm bhyh 50c:(^i) bhtni 22d:(W) 38b: 7., (j85.5) buddhih 23&:57,fh.(2), 77.1 {188*17); bhedah 48a:7., (241.28) Kz:57,fn.(2), (221.7); Z7b:79.28, 209.8, (223.9); -*>heda l) bhedah buddhivadhaih A9b:(242.26) buddlndriyni 26^.(197.9), 216.32; M*:57,Jh.(), 77.3, (218.1) buddhau 36d:W.7, (222.18)
b r

-bhedh 47z:6.21, 7.10, (240.10)


bhednm

lte:3.22, 4.21, 5.28, 268.1

(UU7} ^ ^ ^.(266.12),

t ^ S 7

P a r y m t <

bhoktrbhvt 17c:(i7M) bhautikah -bhramavat SU:(256.19) 67d:(265.25)

bhavati 20d:(Wft55); 2Vh:(205.23), 213.16; Z4c:(218.8); teb:(235.9); Ahb:(236.25); 1); , (256.10) bhavanti \7b\6.21, 7.10, (240.10) ; ' 'v ^ -bhagyakhySh ; bhvasamsiddhih -bhvab2b:(255J6)
}

-mat 10^.(127.3), 189.21 -matina 7lc:(269.25)

madhye . _ , , n n fflX manah 27^.(199.12) mano'navasthanat 7b:(98.2)

may (66a):^P.7, 184.9 -marana- 18a:6.16, (174.28); 55a:19.1, (258.3), 258.27

Wb:(261.15)

-bhavah 19d:(17&ltf), 180.31

Index of Words of the Samkhyakarika mahadadi 8c:6.26, {107.14), 125.23 40b:(230.13) mahaddyh 3b:60.11, (62.18) mahn 22a: 7.11 57Jn.(2), 63.11, (187.23), 267.22 mahmohah 48b:(242.4) mtpitrjh 39a:(22&2); ?><d:(228.23) -matram 28b:(201.11), 213.15, 217.30 mdhyasthyam 19c:(176.16), 180.31 mnusyah 53c: 18.3, (256.11) mimih 70b:(268.15) mdhh 38d:7.^, (227.19) mlatah 54b:(257.16) mlaprakrtih 3a,:(58.8), 63.2 m e 64b:7.29, 192.13, (265.8) -mohah 48b:(242.4) mohasya 48b:(242.1) yatah 37c:(223.23) yatra 69d:(267.20) yath 4U:(231.9); 41b:(231.9); hlb.4.22, (263.3); 58b:(264.7); b9b:(264-19) yasmt 35b:57,fn.(2), (221.7); Zlb:79.28, 209.8, (223.9) -yuktah 2b:19.8, (31.9) yugapat 30a,:(211.24) ye 12^.(270.5) -yogt 42c:(232.22) rangasya 5 9 a : ( ^ . 19) rajah 13b:(134.26) rajovi^alah 54c:(257.19) -rasana- 26b:(197.9), 216.32 rgt 45b:(236.25) rjast 45b:(236.25) rpam 23c:(191.29) rpdisu 28^.(201.11), 213.15 -laksanyam 29a: 189.35, (205.9) laghu U*,:(134.26) -layah 45z:(236.9) Ungarn 10b:(127.3); 20b:78.7, (180.35); 40d:(230.14); 41d:(231.10); 42d:4.22, (232.22); 57Jn.(2), ^2^.(255.14) lhigasya bbc:19.2, (260.25) liiigkhyah 52c:(255.18) lingena 52b:(255.16) lokah 58b:(264.7) -vacanam 4ab:4.6, 32.6, (70.11); 5d:(87.3)

303

vacanadnaviharanotsargnandh -vat 2a,: 19.8, (30.18); Ud:(137.5); 20b:78.7, (180.35); 2ic.48.ll, (184.27), 267.27; 41c:231.10); 42d:4.21, (232.22); f>8d:(264.8); 67d:(265.25)

304

APPENDIX IV

vatsavivrddhinimittain 57a: (263.3) vinivartate b9d:(264.20) -vadhh 49^.(242.26) -vadh 49c:(243.11) -vadhaih 49b:{242.26) varanakam I3c:(134.27) -vast $7c:(265.25) vk Uc:(218.8) viparyayabhedh 47&:6.21, 7.10, (240.10) viparyayt 44d:(236.4); 45d:(237.22); 49d:(243.11) -viparyaya- 14b:(139.23) viparyaysaktitustisiddhykhyah 46b:7.9, (239.4)" -vikalpah 53a: 18.2, (256.10) vikrah Zc\63.l (63.24) (62.18) viparyastam 2M\(193.7) -vinivrttau 6$b:(266.19), 268.1 -viparitah 2c:35.5, (47.8); (Ud):8.4 viparltam 10d:(i^7.^)

-vda- 72d:(270.6) vkpnipdapypasthh 26cd: (197.25) vyavah 29d:(206.5)

-vikrtayah Sbi60.ll,

vikrtih id:63.4, (66.4) -vighth 5lb:{251.10)

-viparysah 4d:(237.22) viparyst I9<i:6.19, 66.10, 155.12, 157.10, (176.16), 180.30 -vibhgt \hc:{147.24)

-vijfint 2d:(48.15), 90.6, 107.20 vijfiya 7ld:(269.27)

vibhutvayogt 42c:(232.22) -vimardt 4c:(240.3) -vimoksa- b6c:(261.16); b7c:(263.4) vimoksrtham b8c:(264-8) -virahith 72c:(270.6) virgah 23b:(191.28) -virpam 8d:6.26, (107.14), 125.23 -vilaksanh 36b:209.6, (222.17) -vivarjith 72d:(270.6) -vivrddhi- 57*1(263.3) -vislah b4z:(257.10); 54b:(257.16); 54c:(257.19)

-vidhah 24b:(194.18), 194.23) 48an7.ll, (241.28); 48b:(242.4)', 5ld:(252.28); 52d:{255.18); h?>c:18.3, (256.11) -vidham 4c:(68.29), 76.13; 5b:6.3, (82.29); 32a: 175.2, (215.21); c:4-23, 57Jn.(2), (221.8) vin 41b:(231.9); 41c:(231.10); 52a:{255.14); b2b:(255.16)

Index of Words of the Samkhyakarika visinasti ilc:(223.23) vaikrtd 25b:(195.32), 197.5 vairgyt 45a:(236.9) vaisvarpyasya 15d:( 150.18), 267.23 -vaisamya- 46 v y a k t a m l0d:(127.4), 189.21] (llc):8.6 vyaktvyaktajnavijiiiit 90.6, 107.20

305

visuddham 64c: 7.30, 192.11 (265.14) -visesh Wb:209.6, {222.17) visesh 38c:7.3, (225.7)] b:(22ll3) S9b:(228.2) -visest 16d:( 165.1) visesvisesavisayni 34b: 77.5, (218.1)' visesair Alc:(231.10)

2d:(48.15)

vyavatisthate 42d:4.21, (232.22) vyavadhnt lc:(98.3)

-visaya- 5a:^., 70.16, (76.25) visayah (11*): 126Jn. (3), 139.21, ' 169.18, 176.6 -visayam 27c:(200.8), 216.36 visayam Sbb:57,fn.(2), -visay Uc:(218.8) 7, (217.18), (221.7)

saktasya 9c:(122.19) s a k t i t a h 15b:97,jh.(l), (144-31)

sakyakarant 9c:(122.19) s a b d a h 51a.: 192.10, (251.10) sabdavisay ZAc:(218.8) -sarlrah 67d:(265.25) s a r l r a b h e d e 6S*:{266.12), 268.1 snth 38d: 7.5, (227.19) s s t r a m 69a,:(267.8) sisyaparamparay ll&:(269.12)

visaykhyam " 221.25

-visayni 34b: 77.3, (218.1)] 'Ud:57,fn.(2), (218.13) visayoparamt 50c:(248.1) -visda- (12a): 148.6 -viharana- 2 8 c : ( ^ . 5 ) - v r t t i 29c:(206.5) vrttih 13d:(i575); " 28b:(201.11), 213.15, 217.30] 29^:189.35, (205.9)] 30d:204.24, (212.27) v r t t i m nb:(213.26), 214.30

sesni Md:57Jn.(2), (218.13)] *3bd:57Jn.(2), (221.8) - s r u t i h bd:(87.3) sreyn 2c:35.6, (47.9) sastitantrasya 12b:(270.5) sodasakah Zc:63.4, (63.24)] % 22b:7.14, (188.5) sodasakt 22c:(188.8) samksiptam 7lc:(269.25)

-vaikalyt 47b:6.21, (241.18) v a i k r t h 43b: 68.1, (234.18)

306

APPENDIX IV sargah 21d:(185.20), 255.3, 267.27; 24b:(194.18), 194.23; 52d:(255.18); bSd:(256.19); b4b:{257.16) -sargah 46a:7.9, (239.4) sarvapramnasiddhatvt 76.12 4b:(69.20),

sanghat aparrt hat vat 17a: 78.10, (168.4) samyogah 21d.48.ll, '267.27 (184.27),

-samyogt 20a,:78.7, (180.35) samsarati A0c:(230.14) samsrah 45b:(236.25) -samsiddhih 52b:(255.16) samskravast &7c:(265.25) sa 2b: 19.8, (31.9); 2bd:(196.4) sakriyam 10b:(127.3) samkalpakam 27&:(199.12) sat 9d:(124.6) sattvam 1^.(134.26)

sarvam 35b:57,Jh.(2), (221.7); Wv.79.28, 209.8, (223.9) sarvasambhavbhvt salilavat 16c:(165.1) saha 39b:(228.2); 49b:(242.26) smsiddhikh 4U:57Jn.(2), \234.18) sa lc:(24.15); 29b:(205.23), 213.16; 37c:(223.23) sksitvam 19b:(176.15), 180.30 sttvikah 2h*:(195.32) sttvikam 2ic:(191.29) 68.1, 9b:(119.19)

sattvavislah 54*1(257.10) sapta 2b:60.11, (62.18) saptatym 72a,:(270.5) saptadasavadh A9c:(243.11) samanvayt l$b:97,fn.(l), {143.27)

samkhytam 27h:(200.2), 216.35; 69b:(267.11) samnabhihrt 7d:(98.3) samsatah hZd:(256.19) samsena 55d:19.2, (260.25) samudayat l$b\(162.23)

sdhayati Z7b:79.28, 209.8, (223.9) sdhyam 6d:(P9.^) sntahkaran Z$a,:57,fn.(2), (221.7) smnyakaranavrttih 29c: (206.5) smnyam (llb):8.5, 169.18, 176.6 17.1, 139.21,

-sambhava- W.(119.19) samyak 71d:{269.27) samyagjnnbhigamt (67a): 6./^ sarpam Sd:6.26, (107.14), 125.23

smnyatah 6a,:86.2, (88.3) smlpyt 7a:(98.2) smprataklam ZZc:(217.25) svayavam 10c: (127.4)

Index of Words of the Samkhyakarika siddhah 14^.(139.20) -siddhatvt 4b:(69.20), 76A3 siddham 14d:(^0.7), 140.30; lSc:(175.18); I9b:(176.15), 180.30 siddhayah lc:(251.11) smrth 38c: 7.5, (225.7) syuh 39b:(228.2) svm 31a2'-.(213.26), 214-30 svrthah b6d:(261.16) sauksmyat 7c:(98.3); 8a:J,0, (106.6), 107.6,9 -stamba- 54d:(257.25) sthnvdibhyah 4lb:(231.9)

307

sthityutpattipralayh 69c:(267.20) siddhantam 71d:(269.27) -siddhi- 46b:7.9, (239.4) siddhih 476:6.22, (241.22) -siddhih Ad:(67.4) -siddhlnam 49d:(243.11) siddheh bld:(252.28)

svlaksanyam 29a: 189.35, (205.9) hi 2b:19.8, (31.9); 4d:(67.4) hetuh Uc:(213.27)

suhrtprptih 51b:(251.10) sksma- 40b:(230.13)

-hetukam 42a:5?'Jn.(l), (232.21) sksmaparyantam 40b:(230.13) sksmam 37d:(223.23) sksmh 39a:(228.2); i9c:(228.23), 230.11 -hetuklm 31b:(2i3.2), 214.30 hetumad 10^.(127.3), 189.21 hetau lb:4.19, (11.8)

308 Appendix V

APPENDIX V

I n d e x of t h e verses q u o t e d or at a n y rate found the Yuktidlpika

in

angabhvam vrajat sattvam duhkham sampadyate yadi / <trai>rpyasyopasamhrt prvadosnivartanam / / p. 138.6-7

angabhvnapeksam <tu> grahanam nasty rser api / p. 138.14

agdham etat ptlam esa panko duruttarah / klesavydhibhaykirnam etac chvabhram bhayvaham / / p.29.3-4

ajnnadhvntasntyartham rsicandramasas cyut / malinais tirthajaladais chdyate jiinacandrik / / p.270.13-14

ato 'pi yena purusah samayed vadavnalam / nendriyny upabhogena visayebhyo nivartayet / / pp.249.28-250.1

anasy brahmacaryam yajanam yajanam tapah / dnam pratigrahah saucam sraddhy laksanam smrtam / / p.210.4-5

apma somam amrt abhma / p.30.13-14

ayam sa ksetriyo vydhir ayam tyantiko jvarah / idam spadam Itlnm esa yonih sappmanm / / p.29.1-2 arke cen madhu vindeta kimartham parvatam vrajet / istasyrthasya samprptau ko vidvn yatnam caret / / p.51.11-12

arthkra ivbhti yath buddhis tath pumn / bhsamno buddhyto boddh manivad ucyate / / p.171.15-16

Index of the verses quoted or at any rate found in the Yuktidipika alpagrantham analprtham sarvais tantragunair yutam / pramarsasya tantrasya bimbam darsagam yath / / p.3.2-3

309

alpksaram asandigdam sravad visvatomukham / astobham anavadyam ca stram stravido viduh / / p.3.28-29

asattvn nsti sambandhah krakaih sattvasangibhih / asambandhasya cotpattim icchato na vyavasthitih / / p. 118.6-7

kro gauravam rauksyam varanam sthairyam eva ca / sthitir bhedah ksam krsnacchy sarvopabhogyat / / p.225.24-25

tmaiva hy tmano nsti viparitena kalpyate / naiveha sattvam tmsti dharms tv ete sahetukh / / p. 167.13-14

yss ca vights ca vipralambhabhayni ca / yac cnyad asivam loke tat kmebhyah pravartate / / p.28.10-11

rambhya prasrt yasmin kle bhavanti kartrah / kryasy nis<n>ts tarn madhyamam klam icchanti / / p.118.11-12

itas tyam sadbhir diptam trnolkcapalam sukham / sudrdhair na niptavyam duhkhair dehntarodbhavaih / / p.248.19-20

iti te prthiv dharms tadvisists tathpare / jalgnipavanksavypaks tn nibodhata / / p.225.27-28

iti sadbhir asambhrntaih kudrstitimirpah / praksikeyam sarvasya dhryatm yuktidipik / / p.270.15-16

rdhva<gam> pvakam dagdhr pcakam laghu bhsvaram / pradhvarpsy ojasvit jyotih prvbhym <sa>vilaksanam / / p.226.4-5

310

APPENDIX V rsaye paramayarkamancisamatejase / samsragahanadhvntasryya gurave namah / / p. 1.5-6

evam vinpi sargena yasmd baddhah pumn gunaih / tasmd viphalatm ytu manorathimanorathah / / p. 185.17-18

karannm asmarthyam astvimsatidh matam / iti sastih padrthnm astbhih saha siddhibhih / / p.2.18-19

karman mrtyum rsayo nisedhuh prajvanto dravinam icchamnh / athpara rsayo mamsinah param karmabhyo 'mrtatvam nasuh / / p.37.5-6

kurvann eveha karmni jijivisec chatam samh / p.35.15

kaivalyaprptihetutvd y vedavihit stutih / prasast yjnavalkydyair visistais tattvaniscayt / / p.54.11-12

granthenlpena samksipya tad rsam anussanam / nibaddham amalaprajiiaih sisynm hitakmyay / / p p . 1.11-2.1

cetandhisthit buddhis cetaneva vibhvyate / kartrsv avasthitas ctm bhokt karteva laksyate / / p. 181.11-12

caitrasya dsabhryeyam lnacakraratho may / saraih stitapatro 'y a i P vrksd iti satm matam / / p.l2,fn.(6)

jagma tarn vanoddesam vysah saha maharsibhir / p.221.13

janmatulyam hi buddhinm ptnptagirm srutau / janmdikopayogam ca nnumne trilaksanah / / p.l04,fn.(l)

Index of the verses quoted or at any rate found in the Yuktidipika jahad dharmntaram prvam updatte yad par am / tattvd apracyuto dharmi parinmah sa ucyate / /

311

pp.111.21-22, 163.12-13 jaryujam gavdinm andajam caiva paksinm / trndes codbhijjam ksudrajantnm svedajam smrtam / / jnnavijiieyayor yadvad rp<>bhede 'pi bhinnat / grhyagrhakabhvena tathaivtmapraksayoh / / p. 172.6-7 tatrhravihrotthn rogn dravyam apohati / yas tu karmakrto vydhir marant sa nivartate / / p.26.8-9 tattvamjijnsamnya viprysuraye munih / yad uvca mahat tantram duhkhatrayanivrttaye / / p. 1.7-8 tattvasamam vaivartam tatrbhisyandikam dvitiyam syt / vaikrtam atas trtiyam stk<au>sikam etad khytam / / p.233.14-15 tathaiva sarvasabdnm prthagarthbhidhyinm / vkyebhyah pravibhaktnm arthavatt na labhyata / / p. 13.13-14 tad eva bhvanpeksajiinam klntare punah / tatraiva sendriyam jtam pratyabhijfinam ucyate / / p.212.22-23 tad evaitac chirognvam tau bh parighopamau / tad eva csya vikrntam nyam anyo dhananjayt / / p. 154.5-6 tapahsraddhe ye hy upavasanty aranye snt vidvmso bhaiksacarym carantah / sryadvrena te <virajh> praynti yatrmrtah sa puruso <hy> avyaytm / / p.41.11-14 tarn eva viditvmrtatvam eti nnyah panthyanya vidyate / p.51.1 p.228.18-19

312

APPENDIX V tarunyo vrsalibharyah praviram putrakamyati / rddhasya rjamtang iti na syuh prayuktayah / / p.l2,fn.(6)

tasmt sanghtamtratvt sattvdinm ghatdivat / brahmanah parijnya dehnm anavasthitim / / p.248.17-18

tasmd anicchann anyesm prninm dehapidanam / santosenaiva varteta tyaktasarvaparicchadah / / p.250.18-19

tasmd rgnugair uktm kuhetuprtanm imm / apohya matimn yukty hy sramd sramam vrajet / / p.54.15-16

tasmd vinsisv saktm putradragrhdisu / mameti buddhim yatnena buddhimn vinivartayet / / p.249.16-17

tasmd visayasamparkam asamartham nivartane / indriynm parijnya nirsangamatis caret / / p.250.2-3

tasmd vai vidvn purusam idam brahmeti manyate / sarv hy asmin devath sarlre 'dhisamhith / / pp.46.17-47.1

tasya vykhym karisymi yathnyyopapattaye / krunyd apy ayuktm tm pratinandantu srayah / / p.3.4-5

tiryakptah pavitratvam ksepo nodanam balam / rauksyam acchyat saityam vyor dharmh prthagvidhh / / p.226.6-7

tesm icchvightrtham cryaih sksmabuddhibhih / racith svesu tantresu visams tarkagahvarh / / p.2.4-5

drsyadarsanabhvena prakrteh purusasya ca / apeks sstratattvajfiair bandha ity abhidhiyate / / p.185.15-16

Index of the verses quoted or at any rate found in the Yuktidipika dvdasaiva <bh>avngni skandhyatanadhtavah / vicintya sarvny etni pudgalo nopalabhyate / / p. 167.15-16

313

dvitvaikatvaprthaktvam nityam cetanam acetanam sksmam / satkryam asatkryam vividisitavyarn vividisyh / / p.210.10-11

na karman na prajay dhanena tygenaikenmrtatvam nasuh / parena nkam nihitam guhym vibhrjate yad yatayo visanti / / p.37.1-2

na jtu kam ah kam an am upabhogena smyati / havis krsnavartmeva bhya evbhivardhate / / p.27.9-10

na tat parasya sandadhyt pratiklam yad tmanah / esa samksepato dharmah kmd anyah pravartate / / pp.34.17-18, 248.12-13

na tad asti jagaty asmin bhtam sthvarajangamam / pratyaksato 'numnd v vinso yasya neksyate / / p.249.14-15

na tasydhigamah sakyah kartum varsasatair api / bhyastvd iti samcintya munibhih sksmabuddhibhih / / p.1.9-10 naseso< ? gne> 'nyajtam <asti> / p.83.5

nayanti santas ca yatah svasaktito gunam paresm tanum apy udratm / iti praytv esa mama sramah satm vicrannugrahamtraptratm / / p.270.19-20

nastotpannam ananyatvd anityam nityam eva v / nastotpannvinastnm nityam no nsti caikad / / p.189.11-12

314

APPENDIX V nadhyavasayam kurute puruso naiva sthitim prayogam va / na svtmano na parato <na> vyapadesn na cobhayatah / / p. 180.27-28

nbhijtim na vijnnam na ca sauryam apeksate / laksmih samskrayogc ca kvacid evvatisthate / / p.28.5-6

nirtmakatvd asatm sarvesm avisistat / visesanam ced bhinnam te sattvam abhyupagamyatm / / p.125.6-7

pancavimsatitattvesu janman jnnam ptavn / ya disrstau(?) namas tasmai kapilya mahtmane / / p.l,fn.(l)

pancnm yoninm dharmdinimittatm ca samsthpya / paripakvam ity adhastn na punas tadbhvito gacchet / / p.211.11-12

param rahasyam vednm avasnesu pathyate / panddyartham tad istam ced disty saphalat sruteh / / p.54.5-6

prthannivistatattvnm prthagarthbhiptinm / indriynm yath kryam rte dehn na labhyate / / p.13.11-12

pracyuto mahato yas tu na prpto jnnalaksanam / vypro jnnayonitvt s yonih kukkutndavat / / p.209.22-23

pratipaksh punas tasya purusesnuvdinah / vainsikh prkrtik vikrapurusas tath / / p.2.2-3

pratiyogipadd anyad yat <anyat> krakd api / vrttisabdakadambasya sambandhas tena nesyate / / p.l2,fn.(6)

pratyaksam anumnam ca sabda<s> copamay saha / arthpattir abhvas ca hetavah sdhyasdhakh / / p.70.20-21

Index of the verses quoted or at any rate found in the Yuktidipika pradhnstitvam ekatvam arthavattvam athnyat / prrthyam ca tathnaikyam viyogo yoga eva ca / / p.2.12-13

315

pramnatvena tm lokah sarvah samanugacchati / vyavahrh pravartante tirascm api tadvast / / p.75.12-13

prninm upaghtena yo 'rthah samupajyate / so 'napeksaih prahtavyo lokntaravightakrt / / p.248.15-16

punar jvare samutpanne kriy prvajvarriug / p.26.16

bdhiryam ndhyam aghratvam mkat jadat ca y / unmdakaustyakaunyni klaibyodvartapariguth / / p.243.4-5

bhym prnavivrttim samyanmrge budhah pratisthpya / vinivrttavikharakaluso dhruvam amrtam sthnam abhyeti / / p.211.9-10

bhinn laksanabheds cen mithah sattvdayo gunh / tarhi laksanayuktatvt sad gunh prpnuvanti te / / p. 137.22-23

bhyah pro_ttapakss(?) cyutabahulasilh ksobhayanty adrayas ced utplutyoccaih saklau pad_su(?) dandahrte 'gnih / dedhlyante 'thavntar miladalaghujalasaptak (?) svasthnj jtucin me pracalati na mano viradhiram tathpi / /

matabhedesu pathyatvbhimnndh jan vrth / yato ghattakutlbhvah par am tvam visvatomukha / / p.l5,fn.(l)

mustir yath vikirnah scyagre sarsapdinm / tisthati na sksmabhvt tadvad dvandvni sarvajiie / / pp.181.34-182.1

316

APPENDIX V yato vaco nivartante 'prapya manasa saha / nandam brahmano vidvn na bibheti kutascana / / p.50.18-19

yatnoptth sugupts ca visay visayaisinm / pasyatm eva nasyanti budbu<d>h salile yath / / p.249.12-13

yath bhydyavasthsu vykr cittasantatih / vidyate bljamtr vas tath dhir iti grhyatm / / p.190.26-27

yath yath manovrttih puruso 'pi tath tath / buddhirpam avpnoti cetanatvt parsrayam / / p. 171.17-18

yath yath hi visayo vrddhim gacchati dehinm / apaghtas tadahgnm tathaivsya vivardhate / / p.250.16-17

yathkramam laksanatah krtsnyenehbhidhsyate / tasmd atah sstram idam alam nntvasiddhaye / / pp.2.21-3.1

yathbhysam hi vkyebhyo vinpy arthena jyate / svapratyaynukrena pratipattir anekadh / / p.75.5-6

yad prabandhd visayi visayn upasevate / tadsya <tesv> abhipryah sutarm sampravartate / / p.249.26-27

yad hetuh svarpena sdhyasiddhau prayujyate / sa vito 'rthntar<a>ksepd itarah parisesatah / / p.89.2-3

yady asattvam ghatdinm utpattau hetur isyate / sasasrnge 'pi tulyatvd utpattis te prasajyate / / p.122.15-16

yasya yenbhisambandho drasthasypi tasya tat / arthatas tv asamnnm nantarye 'py asambhavah / / p.23.5-6

Index of the verses quoted or at any rate found in the Yuktidipika yarn eva prathamm rtrim garbhe bhavati purusah / samprasthitas tarn bhavati sa gacchan na nivartate / / p.246.12-13

317

yena dravyena mohndh rantum icchanti dehinah / tad evaism vinsitvd bhavaty aratikranam / / p.249.10-11

yo 'smd visayasambhogd vihagah panjard iva / gato vanesu ramate sa sukhni samasnute / / p.29.7-8

yoninm sapramnnm samyanmrge niyojant / srotasm ca visuddhatvn nirasangamatis caret / / p.253.14-15

rajovisaktir angesu vaivarnyam mlnapuspat / patisyatm devalokt prninm upajyate / / p.259.20-21

laksanavisayasatattvam traigunyasamanvayam ca pancnm / yoninm yo vidyd yativrsabham tarn tv aham manye / / p.210.19-20

laghni scitrthni svalpksarapadni ca / sarvatah srabhtni strny hur manlsinah / / p.4.2-3

varstapbhym kirn vyomnas carmany asti tayoh phalam / carmopamas cet so 'nityah khatulyas ced asatsamah / / p. 182.4-5 vci karmani samkalpe pratijnm yo <Jnu>raksati / tannisthas tatpratijnas ca dhrter etad dhi laksanam / / p.210.1-2

vidvn karmni kurvitety etad uktam kila srutau / sa ca panddir eva syd yo 'tyantam karmanas cyutah / / p.54.7-8

vin sargena bandho hi purusasya na yujyate / sargas tasyaiva moksrtham aho smkhyasya sktat / / p. 185.12-13

318

APPENDIX V vividhayasasokanam etad ayatanam mahat / dainyasramavisdnm etat ksetram apvrtam / / p.29.5-6 visapltasuptamattavad avividis dhyninm sad yonih / kryakaranaksayakari prkrtik<a>gatih* samkhyt / / p.210.13-14 visayendriyasamyogt pratyaksajnnam ucyate / tad evtindriyam jtam punar bhvanay smrtih / / p.212.20-21 vitvitavisnasya paksatvanasevinah / pravdh smkhyakarinah sallakisandabhangurh / / pp.1.3-4, 2.6-7 vrksgrc cyutapdo yadvad anicchan narah pataty eva / tadvad gunapurusajno 'nicchann api kevali bhavati / / p.50.10-11

vrttir antah samastnm karannm pradipavat / apraks kriyrp jivanam kyadhrik / / p.208.23-24 vedavedhgatarkesu vedasamjfi nirucyate / p.31.5

vaikrtam api ca dvividham svavaikrtam tatra trakam bhavati / syt saptavidham paravaikrtam <su>trdi nirdistam / / p.233.17-18 <vya>bhicrd visess tu pratith pratipdakh / / p.86.20

sisyair duravaghs te tattvrthabhrntabuddhibhih / tasmd Isvarakrsnena samksiptrtham idam krtam / / p.2.8-9

snyam dhytmikam pasya snyam pasya bahirgatam / na drsyate so 'pi kascid yo bhvayati snyatm / / p. 167.18-19 *A11 the Mss read prakrtika gatih

Index of the verses quoted or at any rate found in the Yuktidipika sesavrttir akartrtvam clikrthh smrt dasa / viparyayah pancavidhas tathokt nava tust ayah / / p.2.15-16

319

satsatni niyujyante pasnm madhyame 'hani / asvamedhasya vacand nni pasubhis tribhih / / p . 31.16-17

sa eva vartyatm prjnaih kirn nyyyo 'tha matibhramah / indriyrthnurgo v dveso v moksavartmani / / p.54.9-10

satyam jnnam anantam brahma / yo veda nihitam guhym parame vyoman / so 'snute sarvn kmn / saha brahman vipascit / / p.50.15-17 (metrically irregular)

satyavcah prasntasya sarvabhtny anicchatah / bhavndhakrntajnnam acirena pravartate / / p.250.20-21

saptatykhyam prakaranam sakalam sstram eva v / yasmt sarvapadrthnm iha vykhy karisyate / / p.2.10-11

samvid ahamkragat<>kryam k<a>ranam <ca> prayati yasmt / tasmt pur ity ukt pratyavabhsstamam bhoktuh / / p.209.2-3

samvedyatvd gurutvc ca ninditatvc ca sdhubhih / sarvatrsannidhnc ca na drsto hetur isyate / / p.27.14-15

samhatnm tu yat kryam smnyam te gavdayah/ itaretaradharmebhyo visesn ntra samsayah / / p.226.12-13

sarvatogatir avyho Viskambhas ceti te trayah / ksadharm vijfieyh prvadharmavirodhinah// p.226.9-10

320

APPENDIX V sarvesam vyadhirupanam nidanam trividham smrtam / hras ca vihras ca karma prvakrtam tath / / p.26.6-7

s yvad aniruddh tu hanti vyum rajo'dhik / dharmdyanvrttivast tvaj jivati mnavah / / p.208.25-26

sukham ca duhkham <cnu>sayam ca vrenyam sevate tatra tatra / / p.261.1

sukhrthi yas tu seveta vidym karma tapmsi v / pryascittaparo nityam sukhym sa tu vartate / / p.210.7-8

strapramnvayavopapattir anynat samsayanirnayoktih / uddesanirdesam anukramas ca samjnopadesv iti tantrasampat / / p.3.10-11

seyam visayargndhair viparitrthavdibhih / vidy kanyeva pandya dlyamn na sobhate / / p.54.13-14

sopadravah sarvarpo balammsendriypahah / sristas caiva yo vydhis tarn bhisak parivarjayet / / p.26.11-12

snehah sauksmyam prabh sauklyam mrdavam gauravam ca yat / saityam raks pavitratvam santnas caudak gunh / / p.226.1-2

sphutbhidhey madhurpi bhratl manisino nopakhalam virjate / krsnugarbhpy abhito himgame kadusnatm yti divkaradyutih / / p.270.17-18

Pada Index of verses found in the Yuktidipika Appendix Pda VI of the verses quoted or at any

321

Index

rate

found in the

YuktidTpika p.138.6 p. 138.14 p. 2 9.3 p.250.21 p.270.13 p.228.18 p.249.28 p.37.6 p.210.4 p.50.11 p. 189.11 p.3.10 p.250.17 p.30.13-14 p.185.16 p.54.16 p.208.24 p.50.18 p.l5,fn.(l) p.29.1 p.29.1 p.51.11 p.23.6 p. 13.14 p.2.12 p.171.15 p.70.21 p.3.1 p.3.2 p.3.28 p.54.5 p.210.13 p.226.9 p.31.17 p.2.19 p.2.18 p. 118.6 p. 118.7 p.250.2 p.3.29

angabhavam vrajat sattvam (a) ahgabhvnapeksam <tu> agdham et at ptlam (a) acirena pravartate / / (d) ajnnadhvntasntyartham (a) andajam caiva paksinm / (b) ato 'pi yena purusah (a) athpara rsayo manisinah (c) anasy brahmacaryam (a) anicchann api kevali bhavati / / (d) anityam nityam eva v / (b) anynat samsayanirnayoktih / (b) apaghtas tadangnm (c) apma somam amrt abhma / apeks sstratattvajiiair (c) apohya matimn yukty (c) apraks kriyrp (c) aprpya manas saha / (b) -(a)bhimnndha jan vrth / (b) ayam tyantiko jvarah / (b) ayam sa ksetriyo vydhir (a) arke cen madhu vindeta (a) arthatas tv asamnnm (c) arthavatt na labhyata / / (d) arthavattvam athnyat / (b) arthkra ivbhati (a) arthpattir abhvas ca (c) alam nntvasiddhaye / / (d) alpagrantham analprtham (a) alpksaram asandigdam (a) avasnesu pathyate / (b) avividis dhyninm sad yonih / (b) aviskambhas ceti te trayah / (b) asvamedhasya vacand (c) astbhih saha siddhibhih / / (d) astviinsatidh matam / (b) asattvn nsti sambandhah (a) asambandhasya cot pat t im (c) asamartham nivartane / (b) astobham anavadyam ca (c)

322 aho samkhyasya suktata / / (d)

Appendix VI p. 185.13 p.248.18 p.225.24 p.226.10 p.226.6 p.2.4 p.167.13 p.23.6 p.50.19 p.lO4,fn.(l) p.171.16 p.28.10 p.118.11 p.26.7 p.118.7 p.89.3 p.226.13 p.248.19 p.225.27 P .12,fn.(6) p.270.20 p.2.19 p.270.15 p.29.2 p.46.17 p.250.3 p.13.12 p.54.10 p.51.12 p.2.11 p.122.16 p.122.15 p.l,fn.(l) p.3.11 p.243.5 p.27.9 pp.111.21, 163.12 p.31.17 p.226.4 p.13.12

a brahmanah parijnaya (c) kro gauravam rauksyam (a) ksadharm vijneyh (c) ksepo nodanam balam / (b) cryaih sksmabuddhibhih / (b) tmaiva hy tmano nsti (a) nantarye 'py asambhavah / / (d) nandam brahmano vidvn (c) ptnptagirm srutau / (b) bhsamno buddhyto (c) yss ca vights ca (a) rambhya prasrt yasmin (a) hras ca vihras ca (c) icchato na vyavasthitih / / itarah parisesatah / / (d) itaretaradharmebhyo (c) itas tyam sadbhir diptam (a) iti te prthiv dharms (a) iti na syuh prayuktayah / / (d) iti praytv esa mama sramah satm (c) iti sastih padrthnm (c) iti sadbhir asambhrntaih (a) idam spadam Itlnm (c) idam brahmeti manyate / (b) indriynm parijnya (c) indriynm yath kryam (c) indriyrthnurgo v (c) istasyrthasya samprptau (c) iha vykhy karisyate / / (d) utpattis te prasajyate / / (d) utpattau hetur isyate / (b) utplutyoccaih saklau pad_su(?) dandahrte 'gnih / (b) uddesanirdesam anukramas ca (c) unmdakaustyakaunyni (c) upabhogena smyati / (b) updatte yad param / (b) nni pasubhis tribhir / / (d) rdhva<gam> pvakam (a) rte dehan na labhyate / / (d)

Pada Index of verses found in the Yuktidipika rddhasya rjamtang (c) rsaye paramyrka-(a) rsicandramasas cyut / (b) etac chvabhram bhayvaham / / (d) etat ksetram apavrtam / / (d) et ad y at an am mahat / (b) etad uktam kila srutau / (b) evam vinpi sargen a (a) esa panko duruttarah / (b) esa yonih sappmanm / / (d) esa samksepato dharmah (c) kadusnatam yti divkaradyutih / / (d) kapilya mahtmane / / (d) karannm asmarthyam (a) karannm pradipavat / (b) kartum varsasatair api / (b) kartrsv avasthitas ctm (c) karma prvakrtam tath / / (d) karman mrtyum rsayo nisedhuh (a) kmd anyah pravartate / / (d) krakaih sattvasangibhih / (b) krunyd apy ayuktm tm (c) krtsnyenehbhidhsyate / (b) kryam k<a>ranam <ca> prayati yasmt / (b) kryakaranaksayakari (c) kryasy nis<n>ts tarn (c) kle bhavanti kartrah / (b) kimartham parvatam vrajet / (b) kirn nyyyo ? tha matibhramah / (b) kudrstitimirpah / (b) kurvann eveha karmni (a) kuhetuprtanm imm / (b) -krtam <su>trdi nirdistam (d) / / krsnugarbhpy abhito himgame (c) kaivalyaprptihetutvd (a) ko vidvn yatnam caret / / (d) kriy prvajvarnug / klesavydhibhaykirnam (c) klaibyodvartapanguth / / (d) kvacid evvatisthate / / (d) khatulyas ced asatsamah / / (d) gato vanesu ram ate (c) p.l2,fn.(6) p. 1.5 p.270.13 p.29.4 p.29.6 p. 29.5 p.54.7 p. 185.17 p.29.3 p.29.2 pp.34.18, 248.13 p.270.18 p.l,fn.(l) p.2.18 p.208.23 p. 1.9 p. 181.12 p.26.7 p.37.5 pp.34.18, 248.13 p. 118.6 p.3.5 p.2.21 p.209.2 p.210.14 p. 118.12 p. 118.11 p.51.11 p.54.9 p.270.15 p.35.15 p.54.15 p.233.18 p.270.18 p.54.11 p.51.12 p.26.16 p.29.4 p.243.5 p.28.6 p.182.5 p. 29.8

323

324

Appendix VI p.246.12 p.270.19 p.1.11 p.138.14 p.172.7 p.182.4 p.182.5 p.2.15 p.171.18 p.181.11 p.181.11 P .12,fn.(6) p.270.14 p.225.25 p.221.13 p.228.19 P .104,fn.(l) p.l,fn.(l) p.lO4,fn.(l) p.228.18 p.225.28 pp.111.21, 163.12 p.35.15 p.208.24 p.212.22 p.172.6 p.28.11 p.1.7 p.233.14 pp.111.22, 163.13 p.2.8 p.233.14 p.26.8 p.212.23 p.190.27 p.13.13 p.172.7 p.250.17 p.2.16 p.1.11 p.154.6 p.212.22

garbhe bhavati purusah / (b) gunam paresm tanum apy udratm / (b) granthenlpena samksipya (a) grahanam nasty rser api / grhyagrhakabhvena (c) carmany asti tayoh phalam / (b) carmopamas cet so 'nityah (c) clikrthh smrt dasa / (b) cetanatvt parsrayam / / (d) cetandhisthit buddhis (a) cetaneva vibhvyate / (b) caitrasya dsabhryeyam (a) chdyate jnnacandrik / / (d) -cchy sarvopabhogyat / / (d) jagma tarn vanoddesam -jantnm svedajam smrtam / / (d) janmatulyam hi buddhinm (a) janman jiinam ptavn (b)/ janmdikopayogam ca (c) jaryujam gavdlnm (a) j algnipavanksa- (c) jahad dharmntaram prvam (a) jijlvisec chat am samh / (b) jlvanam kyadhrik / / (d) -jnnam klntare punah / (b) jnnavijiieyayor yadvad (a) tat kmebhyah pravartate / / (d) tattvam jijnasamnya (a) tattvasamam vaivartam (a) tattvd apracyuto dharmi (c) tattvrthabhrntabuddhibhih / (b) tatrbhisyandikam dvitiyam syt / (b) tatrhravihrotthn (a) tatraiva sendriyam jtam (c) tath dhir iti grhyatm / / (d) tathaiva sarvasabdnm (a) tathaivtmapraksayoh / / (d) tathaivsya vivardhate / / (d) tathokt nava tustayah / / (d) tad rsam anusasanam / (b) tad eva csya vikrntam (c) tad eva bhvanpeksa-(a)

Pada Index of verses found in the Yuktidipika tad evatmdriyam jatam (c) tad evaitac chirogrivam (a) tad evaism vinsitvd (c) tadasya <tesv> abhipryah (c) tadvad gunapurusajiio (c) tadvad dvandvni sarvajne / / (d) tadvisists tathpare / (b) tannisthas tatpratijnas ca (c) tapahsraddhe ye hy upavasanty aranye (a) tarn eva viditvmrtatvam eti tarn bhisak parivarjayet / / (d) tarunyo vrsalibhryah (a) tarhi laksanayuktatvt (c) tasmt pur ity ukt (c) tasmt sahghtamtratvt (a) tasmd atah sstram idam (c) tasmd anicchann anyesm (a) tasmd Isvarakrsnena (c) tasmd rgnugair uktm (a) tasmd vinsisv saktm (a) tasmd viphalatm ytu (c) tasmd visayasamparkam (a) tasmd vai vidvn purusam (a) tasya vykhym karisymi (a) tvaj jivati mnavah / / (d) tirascm api tadvast / / (d) tiryakptah pavitratvam (a) tisthati na sksmabhvt (c) trndes codbhijjam ksudra- (c) trnolkcapalam sukham / (b) tesm icchvightrtham (a) tau bh parighopamau / (b) tyaktasarvaparicchadah / / (d) tygenaikenmrtatvam nasuh / (b) traigunyasamanvayam ca paiicnm / (b) <trai>rpyasyopasamhrt (c) dnam pratigrahah saucam (c) disty saphalat sruteh / / (d) dlyamn na sobhate / / (d) duhkham sampadyate yadi / (b) duhkhatrayanivrttaye / / (d) duhkhair dehntarodbhavaih / / (d) drasthasypi tasya tat / (b) drsyadarsanabhvena (a) dedhiyante 'thavantar miladalaghujalasaptaku_^?) (c) p.212.21 p.154.5 p.249.11 p.249.27 p.50.11 p.182.1 p.225.27 p.210.2 p.41.11 p.51.1 p.26.12 P .12,fn.(6) p.137.23 p.209.3 p.248.17 p.3.1 p.250.18 p.2.9 p.54.15 p.249.16 p.185.18 p.250.2 p.46.17 p.3.4 p.208.26 p.75.13 p.226.6 p.182.1 p.228.19 p.248.19 p.2.4 p.154.5 p.250.19 p.37.1 p.210.19 p.138.7 p.210.5 p.54.6 p.54.14 p.138.6 p.1.8 p.248.20 p.23.5 p.185.15 p.l,fn.(l)

325

326

Appendix VI p.248.18 p.29.6 p. 167.15 p. 210.10 p.54.10 p.211.11 p.208.26 p. 167.14 p.270.16 p.210.2 p.211.10 p.37.1 p.28.5 p.27.9 pp.34.17, 248.12 p.249.14 p.1.9 p. 167.19 p.27.14 p.211.12 p.50.19 p.209.22 p. 180.28 p.83.5 p. 180.28 p.270.19 p. 189.11 p. 189.12 p.180.27 p.51.1 p.28.5 p. 154.6 p.210.10 p.189.12 p.26.6 p.27.14 p.2.1 p. 125.6 pp.250.3, 253.15 p.l04,fn.(l) p.250.1 p. 167.14 p.1.3, 2.6

dehanam anavasthitim / / (d) dainyasramavisdnm (c) dvdasaiva <bh>avngni (a) dvitvaikatvaprthaktvam (a) dveso v moksavartmani / / (d) dharmdinimittatm ca samsthpya / (b) dharmdyanvrttivast (c) dharms tv ete sahetukh / / (d) dhryatm yuktidipik / / (d) dhrter etad dhi laksanam / / (d) dhruvam amrtam sthnam abhyeti / / (d) na karman na prajay dhanena (a) na ca sauryam apeksate / (b) na jtu kmah kmnm (a) na tat parasya sandadhyt (a) na tad asti jagaty asmin (a) na tasydhigamah sakyah (a) na drsyate so 'pi kascid (c) na drsto hetur isyate / / (d) na punas tadbhvito gacchet / / (d) na bibheti kutascana / / (d) na prpto jnnalaksanam / (b) <na> vyapadesn na cobhayatah / / (d) na seso <'gne> ? nyajtam <asti> na svtmano na parato (c) nayanti santas ca yatah svasaktito (a) nastotpannam ananyatvd (a) nastotpannvinastnm (c) ndhyavasyam kurute (a) nnyah panth ayanya vidyate / nbhijtim na vijnnam (a) nyam anyo dhananjayt / / (d) nityam cetanam acetanam sksmam / (b) nityam no nsti caikad / / (d) nidnam trividham smrtam / (b) ninditatvc ca sdhubhih / (b) nibaddham amalaprajfiaih (c) nirtmakatvd asatm (a) nirsahgamatis caret / / (d) nnumne trilaksanah / / (d) nendriyny upabhogena (c) naiveha sattvam tmasti (c) paksatvanasevinah / (b)

Pada Index of verses found in the Yuktidipika pancavimsatitattvesu (a) pancnm yoninm (a) panddyartham tad istam ced (c) patisyatm devalokt (c) param karmabhyo 'mrtatvam nasuh / / (d) param tvam visvatomukha / / (d) param rahasyam vednm (a) parinmah sa ucyate / / (d) paripakvam ity adhastn (c) parena nkam nihitam guhym (c) pasnm madhyame 'hani / (b) pasyatm eva nasyanti (c) pcakam laghu bhsvaram / (b) paramarsasya tantrasya (c) prrthyam ca tathnaikyam (c) putradragrhdisu / (b) pudgalo nopalabhyate / / (d) punar jvare samutpanne punar bhvanay smrtih / / (d) purusasya na yujyate / (b) purusesnuvdinah / (b) puruso ?pi tath tath / (b) puruso naiva sthitim prayogam v / (b) prvadosnivartanam / / (d) prvadharmavirodhinah / / (d) prvbhym <sa>vilaksanam / / (d) prthagarthbhidhyinm / (b) prthagarthbhiptinm / (b) prthannivistatattvnm (a) praksikeyam sarvasya (c) prakrteh purusasya ca / (b) pracyuto mahato yas tu (a) prajvanto dravinam icchamnh / (b) pratiklam yad tmanah / (b) pratijnm yo <?nu>raksati / (b) pratinandantu srayah / / (d) pratipaksh punas tasya (a) pratipattir anekadh / / (d) pratiyogipadd anyad (a) pratith pratipdakh / / pratyaksajnnam ucyate / (b) pratyaksato 'numnd v (c) pratyaksam anumnam ca (a) pratyabhijfinam ucyate / / (d) pratyavabhsstamam bhoktuh / / (d) pradhnstitvam ekatvam (a)

327

p.l,fn.(l) p.211.11 p.54.6 p.259.21 p.37.6 p.l5,fn.(l) p.54.5 pp.111.22, 163.13 p.211.12 p.37.2 p.31.16 p.249.13 p.226.4 p.3.3 p.2.13 p.249.16 p. 167.16 p.26.16 p.212.21 p. 185.12 p.2.2 p. 171.17 p. 180.27 p. 138.7 p.226.10 p.226.5 p.13.13 p.13.11 p. 13.11 p.270.16 p. 185.15 p.209.22 p.37.5 pp.34.17, 248.12 p.210.1 p.3.5 p.2.2 p.75.6 p.l2,fn.(6) p.86.20 p.212.20 p.249.15 p.70.20 p.212.23 p.209.3 p.2.12

328

Appendix VI p.226.5 p.75.12 P-l-4, 2.7 p.l2,fn.(6) p.54.12 p.210.14 p.248.15 p.259.21 p.250.18 p.210.8 p.185.16 p.26.11 p.243.4 p.211.9 p.3.3 p.249.17 p. 171.18 p.249.13 p. 171.16 p.249.11 p.250.21 p. 137.22 p.249.14 p.27.10 p.l,fn.(l) p.1.10 p.181.12 p.l5,fn.(l) p.118.12 p.270.17 p.185.18 p.249.17 p.26.9 p.1.5 p.270.14 p.226.1 p.137.22 p.1.10 p. 181.34 p.243.4 p.l,fn.(l)

pradhvamsy ojasvita jyotih (c) pramnatvena tm lokah (a) pravdh smkhyakarinah (c) praviram putrakmyati / (b) prasast yjiiavalkydyair (c) prkrtik<a>gatih samkhyt / / (d) prninm upaghtena (a) prninm upajyate / / (d) prninm dehapidanam / (b) pryascittaparo nityam (c) bandha ity abhidhiyate / / (d) balammsendriypahah / (b) bdhiryam ndhyam aghratvam (a) bhym prnavivrttim (a) bimbam darsagam yath / / (d) buddhimn vinivartayet / / (d) buddhirpam avpnoti (c) budbu<d>h salile yath / / (d) boddh manivad ucyate / / (d) bhavaty aratikranam / / (d) bhavndhakrntajnnam (c) bhinn laksanabheds cen (a) bhtam sthvarajangamam / (b) bhya evbhivardhate / / (d) bhyah prottapakss(?) cyutabahusilh ksobhayanty adrayas ced (a) bhyastvd iti samcintya (c) bhokt karteva laksyate / / (d) matabhedesu pathyatv-(?) (a) madhy am am klam icchanti / / ( d ) manisino nopakhalam virjate / (b) manorathimanorathah / / (d) mameti buddhim yatnena (e) marant sa nivartate / / (d) -marlcisamatejase / (b) malinais tirthajaladais (c) mrdavam gauravam ca yat / (b) mithah sattvdayo gunh / (b) munibhih sksmabuddhibhih / / (d) mustir yath vikirnah (a) mkat jadat ca y / (b) ya disrstau(?) namas tasmai (c)

Pada Index of verses found in the Yuktidipika yac cnyad asivam loke (c) yajanam yajanam tapah / (b) yat <anyat> krakd api / (b) yativrsabham tarn tv aham manye / / (d) yato ghattakutibhvah (c) yato vco nivartante (a) yatnoptth sugupts ca (a) yatrmrtah sa puruso <hy> a v y a y t m / / ( d ) yath bhydyavasthsu (a) yath buddhis tath pumn / (b) yath yath manovrttih (a) yath yath hi visayo (a) yathkramam laksanatah (a) yathnyyopapattaye / (b) yathbhysam hi vkyebhyo (a) yad uvca mahat tantram (c) yad prabandhd visayi (a) yad hetuh svarpena (a) yady asattvam ghatdinm (a) yadvad anicchan narah pataty eva / (b) yas tu karmakrto vydhir (c) yasmt sarvapadrthnm (c) yasmd baddhah pumn gunaih / (b) yasya yenbhisambandho (a) y vedavihit stutih / (b) yarn eva prathamm rtrim (a) yena dravyena mohndh (a) yo 'tyantam karmanas cyutah / / (d) yo 'rthah samupajyate / (b) yo 'smd visayasambhogd (a) yo bhvayati snyatm / / (d) yo veda nihitam guhym parame vyoman / (b) yonlnm yo vidyd (c) yoninm sapramnnm (a) racith svesu tantresu (c) rajovisaktir angesu (a) rantum icchanti dehinah / (b) rp<>bhede ?pi bhinnat / (b) rogn dravyam apohati / (b) rauksyam acchyat saityam (c) laksanavisayasatattvam (a) laksmih samskrayogc ca (c) laghni scitrthni (a) lnacakraratho may / (b) p.28.11 p.210.4 p.l2,fn.(6) p.210.20 p.l5,fn.(l) p.50.18 p.249.12 p.41.14 p. 190.26 p. 171.15 p.171.17 p.250.16 p.2.21 p.3.4 p.75.5 p. 1.8 p.249.26 p.89.2 p. 122.15 p.50.10 p.26.9 p.2.11 p.185.17 p.23.5 p.54.11 p.246.12 p.249.10 p.54.8 p.248.15 p.29.7 p. 167.19 p.50.16 p.210.20 p.253.14 p.2.5 p.259.20 p.249.10 p.172.6 p.26.8 p.226.7 p.210.19 p.28.6 p.4.2 p.l2,fn.(6)

329

330 lokantaravighatakrt / / (d)

Appendix VI p.248.16 p.225.24 p. 182.4 p.13.14 p.210.1 p.226.7 p.261.1 p.2.3 p.270.20 p. 167.16 p.190.27 p.54.14 p.210.7 p.54.7 p. 185.12 p.75.5 p.249.15 p.211.10 p.54.13 p.167.13 p.2.16 p.28.10 p.1.7 p.37.2 p.2.13 p.210.11 p.29.5 p.54.12 p. 125.7 p.226.13 p.210.13 p.2.5 p.249.12 p.249.26 p. 212.20 p.250.1 p.29.7 p. 1.3, 2.6 p.50.10 p.l2,fn.(6) p.208.23 p.l2,fn.(6) p.250.16 p.31.5 p.31.5

varanam sthairyam eva ca / (b) varstapbhym kirn vyomnas (a) vkyebhyah pravibhaktnm (c) vci karmani samkalpe (a) vyor dharmh prthagvidhh / / (d) vrenyam sevate tatra tatra / / vikrapuruss tath / / (d) vicrannugrahamtraptratm / / (d) vicintya sarvny etni (c) vidyate bijamtr vas (c) vidy kanyeva pandya (c) vidym karma tapmsi v / (b) vidvn karmni kurvltety (a) vin sargen a bandho hi (a) vinpy arthena jyate / (b) vinso yasya neksyate / / (d) vinivrttavikharakaluso (c) viparitrthavdibhih / (b) viparitena kalpyate / (b) viparyayah paficavidhas (c) vipralambhabhayni ca / (b) viprysuraye munih / (b) vibhrjate yad yatayo visanti / / (d) viyogo yoga eva ca / / (d) vividisitavyam vividisyh / / (d) vividhysasoknm (a) visistais tattvaniscayt / / visesanam ced bhinnam te (c) visesn ntra samsayah / / (d) visapitasuptamattavad (a) visams tarkagahvarh / / (d) visay visayaisinm / (b) visayn upasevate / (b) visayendriyasamyogt (a) visayebhyo nivartayet / / (d) vihagah panjard iva / (b) vitvitavisnasya (a) vrksgrc cyutapdo (a) vrksd iti satm matam / / (d) vrttir antah samastnm (a) vrttisabdakadambasya (c) vrddhim gacchati dehinm / (b) vedavedngatarkesu vedasamjii nirucyate /

Pada Index of verses found in the Yuktidipika vaikrtam atas trtiyam (c) vaikrtam api ca dvividham (a) vainsikh prkrtik (c) vaivarnyam mlnapuspat / (b) <vya>bhicrd visesas tu vyavahrh pravartante vykr cittasantatih / (b) -vypakas tan nibodhata / / (d) vypro jnnayonitvt (c) vyasah saha maharsibhir / sabda<s> copamay saha / (b) samayed vadavnalam / (b) sarlre 'dhisamhith / / (d) saraih stitapatro ' y a m (c) sasasrnge 'pi tulyatvd (c) snt vidvmso bhaiksacarym carantah / (b) sisynm hitakmyay / / (d) sisyair duravaghs te (a) snyam dhytmikam pasya (a) snyam pasya bahirgatam / (b) sesavrttir akartrtvam (a) saityam raks pavitratvam (c) sraddhy laksanam smrtam / / (d) satsatni niyujyante (a) sad gunh prpnuvanti te / / (d) stk<au>sikam etad khytam / / (d) sa eva vartyatm prjfiaih (a) sa gacchan na nivartate / / (d) sa ca panddir eva syd (c) sa vito ?rthntar<a>ksepd (c) sa sukhni samasnute / / (d) samksiptrtham idam krtam / / (d) sakalam sstram eva v / (b) samjiiopadesv iti tantrasampat / / (d) satkryam asatkryam (c) sattvam abhyupagamyatm / / (d) sattvdinm ghatdivat / (b) satyam jnnam anantam brahma / (a) satyavcah prasntasya (a) santnas caudak gunh / / (d) santosenaiva varteta (c) saptatykhyam prakaranam (a) samprasthitas tarn bhavati (c) p.233.15 p.233.17 p.2.3 p.259.20 p.86.20 p.75.13 p.190.26 p.225.28 p.209.23 p.221.13 p.70.20 p.249.28 p.47.1 p.l2,fn.(6) p. 122.16 p.41.12 p.2.1 p.2.8 p. 167.18 p. 167.18 p.2.15 p.226.2 p.210.5 p.31.16 p. 137.23 p.233.15 p.54.9 p.246.13 p.54.8 p.89.3 p.29.8 p.2.9 p.2.10 p.3.11 p.210.11 p. 125.7 p.248.17 p.50.15 p.250.20 p.226.2 p.250.19 p.2.10 p.246.13

331

332

Appendix VI p.l2,fn.(6) p.253.14 p.211.9 p. 185.13 p.75.12 p.4.3 p.226.9 p.27.15 p.250.20 p.47.1 p. 125.6 p.26.6 p.3.2 P-l-4, 2.7 p.209.2 p.27.14 p.1.6 p.226.12 p.50.17 p.208.25 p.209.23 p.89.2 p.226.12 p.3.28 p.26.12 p.261.1 p.210.8 p.210.7 p.249.27 p.248.20 p. 181.34 p.3.10 p.3.29 p.4.3 p.41.13 p.1.6 p.54.13 p.248.16 p.50.17 p.26.11 p. 167.15 p.225.25 p.226.1 p.270.17 p.233.18 p.253.15

sambandhas tena nesyate / / (d) samyanmrge niyojant / (b) samyanmrge budhah pratisthpya / (b) sargas tasyaiva moksrtham (c) sarvah samanugacchati / (b) sarvatah srabhtni (c) sarvatogatir avyho (a) sarvatrsannidhnc ca (c) sarvabhtny anicchatah / (b) sarv hy asmin devath (c) sarvesm avisistat / (b) sarvesm vydhirpnm (a) sarvais tantragunair yutam / (b) sallakisandabhahgurh / / (d) samvid ahamkragat<> (a) samvedyatvd gurutvc ca (a) samsragahanadhvnta- (c) samhatnm tu yat kryam (a) saha brahman vipascit / / (d) s yvad aniruddh tu (a) s yonih kukkutndavat / / (d) sdhyasiddhau prayujyate / (b) smnyam te gavdayah/ (b) sravad visvatomukham / (b) sristas caiva yo vydhis (c) sukham ca duhkham <cnu>sayam ca sukhym sa tu vartate / / (d) sukhrthlyas tu sevate (a) sutarm sampravartate / / (d) sudrdhair na niptavyam (c) scyagre sarsapdinm / (b) strapramnvayavopapattir (a) stram stravido viduh / / (d) strny hur manisinah / / (d) sryadvrena te <virajh> praynti (c) -sryya gurave namah / / (d) seyam visayargndhair (a) so 'napeksaih prahtavyo (c) so 'snute sarvn kam an / (c) sopadravah sarvarpo (a) skandhyatanadhtavah / (b) sthitir bhedah ksam krsna- (c) snehah sauksmyam prabh sauklyam (a) sphutbhidhey madhurpi bhrati (a) syt saptavidham paravai- (c) srotasm ca visuddhatvn (c)

Pada Index of verses found in the Yuktidipika svapratyaynukrena (c) svalpksarapadni ca / (b) svavaikrtam tatra trakam bhavati / (b) svasthnj jtucin me pracalati na mano vlradhiram tathpi / / (d) hanti vyum rajo'dhika / (b) havis krsnavartmeva (c) hetavah sdhyasdhakh / / (d) hy sramd sramam vrajet / / (d) p.75.6 p.4.2 p.233.17 p.l,fn.(l) p.208.25 p.27.10 p.70.21 p.54.16

333

334 Appendix VII

Appendix.VII

Index of the prose passages quoted or referred in the YuktidTpika and Kashmir and Delhi Mss. in t h e Marginal in alphabetical p.60.1 Notes order

to of

akrasya vivrtopadesah (cf.MBhsya.I.1.2,1.15.2)

agunavato dravyasya gunrambh<t> karmagun agunh (VS.7.1.12) p.116.17 agnihotram juhuyt svargakmah / ajdi gunavacand eva (Pn.5.3.58) pp.38.13-14 (vidhih), 232,26 (tadyath) p.64.22

atha ye ime grme istprte dattam ity upsate / te dhmam abhisambhavanti / dhmo bhtvbhram bhavati / megho bhtv pravarsati / ta iha vrihiyava osadhivanaspatayas tilams iti jyante / <ato> vai yo <hy> annam atti yo retah siiicati tad bhya eva bhavati (cf.Chnd.U.5.10.3,5,6) pp.43.12-44.1 atha sabdnussanam, kesm sabdnm (cf.MBhsya.I.1.1-2) p.24.6

anadvham udahrini bhagini vahasi y tvam siras kumbham avcinam abhidhvantam adrksih (cf.MBhsya.I.152.26fF.) p.23.14-15 anantarasya vidhir v bhavati pratisedho v (cf.MBhsya.I.101.12) anantasaktih (cf.Mait.U.7.2) p.159.10 p.20.13-14

animitto 5py evam avasthitasya jnnasya vrttih pratyayah prdus tiras ca <bhavati> vrttyarthe na bhavaty animitto Jpity angatavyavahitavisayajnnam tu linggambhym (tath ca vrsaganavirenpy uktam bhavati) p.212.17-19 ambha iti gunalingasannicayam evdhikurute (sstram ha) p.244.13-14

amrtam v mrtam atijivo m te hsisur asavah sariram (AV(S).8.2.26) p.45.6-7 arthakriy ca na syt (cf.Vims.3,4) alug uttarapade (cf.Pn.6.3.1) p.219.6

p.23.13

<a>sad iti bhtapratyaksbhvd bhtasmrter virodhapratya<ksatvc> ca (cf.VS.9.6) p.151.22-23 asti karmsti vipkah krakas tu nopalabhyate ya <imms ca skandhn niksipaty> anyms ca pratisandadhty anyatra dharmasamkett (cf.AKBh. p.468.20-22;TSP.p.l73.6-7) p.167.21-23 ahims satyam asteyam akalkat brahmacaryam iti panca yamh (cf.YS.2.30)

Index of the prose passages in alphabetical order

335

pp.191.37-192.1 javanjavlbhvo (cf.MV.25.9) p.232.19 p.204.8

an abhividhyarthe (cf.Pn.2.1.13)

tmendriyamano'rthasannikarsd yan nispadyate tad anyat (VS.3.1.13) p.76.18-19 daiksu (cf.Pan. 1.1.1) p. 102.10

<nyabhvyam> tu klasabdavyavyt (Vr.ll on Sivastra 1, MBhsya.I.18.5) p.205.10-11 vahanti (cf.Tai.Br.3.2.5.6) p.52.12 hamkriknm tu tesm vypakatvd visaykraparinmtmik vrttir vrttimato 'nany sati sambhavaty eveti suvacam prpyakritvam / api ca mahadanugrahanam hamkrikatve tesm kalpate na bhautikatve / bhautikatve hi yatparimnam <graha>nam tatparimnam grhyam grhniyd <iti> (see NM.part2,p.49.5-10) p.203.28-32 hamkriknlndriyny artham sdhayitum arhanti nnyath (evam hi smkhyavrddh huh) p.203.25-26 haranam karmendriyni kurvanti, dhranam mano ^hamkras ca, praksanam buddhindriyni buddhis ca (apara ha) p.216.10-12 icchdvesaprayatnasukhaduhkhadharmdharmajnnasamskrnm tvam (cf.NS.1.1.10) p.16.10-11 icchdvesaprayatnadharmdharmajnnasannskrnm (cf.NS. 1.1.10) iti ha uvca yjnavalkya (Brh.U.2.4.13 et passim) p.71.4 tmagunap. 179.13

indriyrthasannikarsotpannam jnnam avyapadesyam avyabhicri vyavasytmakam pratyaksam (NS.1.1.4) p.76.17-18 istprte samupsya te dhmam abhisambhavanti (yac ca sstram) (cf.Chnd.U.5.10.3) p.52.1-2 upabhogasya sabddyupalabdhir dih, gunapurusopalabdhir antah chuh) p.223.20-21 upalambhau yatnah kriyatm (cf.MBhsya.I.9.19fF.) p.41.1 p.59.7 (tath

upasarjanam prvam (Pn.2.2.30) nipatati (MBhsya.II.355.9)

ekam eva darsanam khytir eva darsanam (sstram) (cf.YBh.on YS.1.4) pp.79.25-26, 222.5

336

Appendix. VII p.82.21-22

ekasesanirdesat (cf.MBhasya.I.88.25 et passim)

etam eva viditv munir bhavati, etam eva pravrjino lokam icchantah pravrajanti / et ad vah sarve prve vidvmsah prajm nkmayanta prajay kirn karisymo yesm nyam tm nyam loka iti te ha sma putraisanys ca vittaisanys ca lokaisanys ctha bhikscaryam caranti (cf.Brh.U.4.4.25) p.38.2-6 etasmd dhi mahata tmana ime traya tmnah srjyante vaikrikataijasabhtdayo 'hamkralaksanh / aham ity evaism smnyalaksanam bhavati / gunapravrttau ca punar visesalaksanam (tath ca sastram ha) p.194.12-14 kadcid guno gunivisesako bhavati kadcit tu gunin guno visisyata (cf.MBhsya.II.356.8-9) karanasdhano lyut(cf.Pn.3.3.117) p.67.6-7 p.ll.15-16

kartari yau trjakau tbhym saha sasthi na samasyate (Ksik2.2.16, Pn.2.2.15) karmavat karman tulyakriyah (Pn.3.1.87) kalpanpodham (cf.PS.1.3) p.76.21 p.157.6 p.59.25 p.ll.10-11

kranbhvt krybhvah (VS.1.2.1)

krttivash pinkahasto vitatadhanv nilasikhandi (cf.Tai.S.1.8.6.2) p.159.19-20 kriygunavyapadesasambhavah (cf.VS.9.1) p . l l 1.5 p.235.1

ksiram pitv garbhim gauram putram janayati (cf.Brh.U.6.4.14) guns ca gunntaram (VS.1.1.9) p.126.5

grhasthah sadrslm bhrym vindetnanyaprvikm / (GDhS. 1.4.1)

p.34.4-5

gaur anbandhyo 'ajo 'gnisomiya iti na bhiko 'nubadhyate (cf.MBhsya.I.71.18ff. et passim) p.80.14-15 grmagamanam bhavatah sobhanam ity atrntarena vidhim stutir eva devadattam grmagamanya prarocayati (tath ca sbarh pathanti) p.40.8-9 ghrnarasanacaksustvakcchrotrnindriyni bhtebhyah (naiyyiks tv evam huh) (cf.NS.1.1.12) p.203.15-16 nypprtipadikt (cf.Pn.4.1.1) p.23.11-12

caturbhih prakrair vidyopayuktbhavaty gamaklena svdhyyaklena <pravacanaklena) prayogaklena ca / tatra csygamaklenaivyuh paryupayuktam syt (ha ca) (cf.MBhsya.l.6.1ff.) p.269.17-19

Index of the prose passages in alphabetical order cittam mano vijfinam (Vims.p.3.3, AKBh.p.62.1-2) jagadvaicitryopalambht (cf.AK.p.192.5) p.154.24 p.170.14

337

jarmaryam etat sattram yad agnihotradrsapaurnamsau jaray ha etasmt sattrd vimucyate mrtyun ca (cf.SPBr.12.4.1.1) p.35.12-13 jtivcakatvt (Vr.7 on Pn.4.1.14, MBhsya.II.206.23; Vr.l on Pan. 1.2.10, MBhsya.I.107.21) p.11.14 tatprayojako hetus ca (Pn.1.4.55) tad asya parimnam (Pn.5.1.57) p.11.13 p.63.25

tad etat trailokyam vyakter apaiti na sattvt / apetam apy asti vinsapratisedht / samsargc csya sauksmyam sauksmyc cnupalabdhih / tasmd vyaktyapagamo vinsah / sa tu dvividhah / sargapralayt tattvnm kimcitklvasthnd itaresm (tath ca vrsaganh) (cf.YBh.onYS.3.13, NBh.1.2.6) pp.128.23-129.3 tad etasmin vaikrike sraksyamna esa bhtdis taijasenopastabdha etarn vaikrikam abhidhvati / tathaiva tasmin bhtdau sraksyamna esa <vaikrikas> taijasenopastabdha etam bhtdim abhibhavati (sstram caivam ha) pp.196.32-197.3 taj jnpayati (cf.MBhsya.I.33.17,1.35.9 et passim) p. 106.18 tad dha smaitad runir auddlakir jyesthya putrya provca / idam <vva> jyesthya putrya pit brahma prabryt pranyyya cnte vsine nnyasmai yasmai kasmaicana / ya imm adbhih parigrhitm vasun vasumatlm prnm dadyd etad eva tato bhyah (ha) (cf.Chnd.U.3.11.4-6) pp.53.23-54.3 tad ya ittham viduh / ye ceme <'ranye> sraddh tapa ity upsate / te 'rcisam abhisambhavanti / arciso 'hah / ahna pryamnapaksam / pryamnapaksd yn sad udann eti msms tn / msebhyah samvatsaram / samvatsard dityam / dityc candramasam / candramaso vidyutam / tat puruso 'mnavah / sa etn brahma gamayati (Chnd.U.5.10.1-2) pp.37.7-38.2 tadyath dadhitrapusam <pratyakso> jvarah (tadyath ) (cf.MBhsya.1.156.8) p.213.33 tarati mrtyum (cf.Mund.U.3.2.9) p.45.9 p.43.7-8

tarati mrtyum tarati ppmnam (cf.Mund.U.3.2.9) tarati sokam tmavit (Chnd.U.7.1.3) p.51.3

te dhmam abhisambhavanti (cf.Chnd.U.5.10.3)

p.45.2

trividh bhvh smsiddhikh prkrtik vaikrtiks ca (crya ha)

338

Appendix.VII (cf.SK43ab) p.233.27

tvstriyam sma bhavati <indram v ksymayinam> na sarvabhtni prasvpayitum nsaknuvams tarn etena smn tvstriyam svpayat (evam hy ha) (Tn.Br.12.5.18,19) p.259.22-24 dadhi brhmanebhyo diyatm takram kaundinyya passim) pp.33.17-18, 81.20 dadhn juhoti payas juhoti (tadyath) p.53.5-6 p.48.3 (cf.MBhsya.1.115.2-3 et

duhkhahetuh kryakaranasaktih (tath ca tantrntaresv apy uktam) devadattasya gurukulam (yath) (cf.MBhsya.I.361.13ff.) p.59.15

devnm ha v paiicadasasatny sams tni brahmakilbisd aksiyanta / tatas trayastrimsad evsta / tad etad rcpy uktam / ^sodarynm pancadasnm satnm trayastrimsad udasisyanta devh / sesh prslyanta' (tath gopathabrhmanam) p.260.10-13 dravyam anekadravyam adravyam v (sstram) (cf.Vyo.p.231.5-6; VSC. on VS.2.1.11) p.114.6 dravyni dravyntaram rabhante (VS.1.1.8) pp.121.14, 126.5 p.52.21

dve vidye veditavye par caivpar ca y (cf.Mund.U.1.1.4)

dharm vedan samjii cetan sparso <manaskra> evamdayah (cf.AK.II.24) p.170.18-19 dharmotpattivinse dharmyutpattivinsaprasangah (cf.AKBh.p.159.24) p.163.27-29 na prthakpratipattihet vltvitau (uktam tantrntariyaih) p. 107.2-3

nah kye (Pn.1.4.15) p.64.20-21 navadhtharvano <v>edah sahasravartm smaveda ekasatam adhvaryuskhs caturvimsatidh b<>hvrcyam (cf.MBhsya.I.9.21fF.) p.41,fn.(l) ntrsy kartavy (cf.MBhsya.II.356.1ff) p.60.2 p.45.11

nityaprahasito nityajalpitah (cf.MBhsya.I.7.4) niravayavo 'nantasaktih (cf.Mait.U.7.2)

p. 159.9-10 p.64.7

panca pancanakh bhaksyh (cf.MBhsya.I.5.15) parimnam asya (cf.Pn.5.1.57) p.195.3

pasubandhena sarvml lokn jayati (cf.SPBr.11.7.1.1, SBh.1.2.4)

p.30.2

Index of the prose passages in alphabetical order pcako lvakah (cf.gh. on MS.1.1.5) p.7.19-20

339

putraisanys ca vittaisanys ca vyutthytha bhaiksacaryam caranti (cf. Brh.U.3.5.1, 4.4.22) p.53.19-20 puri sete (cf.e.g. Gop.Br.1.1.39) p.7.25

prvam updnt paksah prvasabdenocyate / so <'stu eva> yasya tat prvavat paksavypakam Ungarn ucyate / sesa iti sapaksa uktt paksc chisyamnatvd atah sesavad iti / sapaksavad iti uktam bhavati / smnyatodrstam iti vipaksa ity adhyhryam / smnyena <adrstam> vipaksasabdbhidheye sarvatrdrstam ity arthah (see NBhs. p.l91.2i-26) p.83,fn.(l) prvavad iti kevalnvayi anumnam, sesavad iti kevalavyatireki, smnyatodrstam ity anvayavyatirekiti / katham / prvasabdennvaya upadisyate prgadhyavasiyamnatvt / na hi yvan ngnibhve dhmabhvo 'dhyavasiyate tvad agnyabhve dhmabhvo drsto 'py <adhyavastum> sakyate / vidhyadhyavasyaprvakatvt / nisedhdhyavasyasya prvam eva vidyate 'nvaya evsti yasynumnasya tat prvavat / seso vyatirekah / sa eva yasysti tac chesavat / bdhakopakrtasya kevalavyatirekasya gamakatvam na vyatirekamtrasyeti pradarsanrtham sesavad ity uktam na vyatirekavad iti / anvayavyatirekayoh sdhanngayos smnyena yad anumnam drstam tat smnyatodrstam / et ad uktam bhavati: yathnvayenaitad anumnam <upakrtam> tath vyatirekenpy <anvayavyatirekivad> itarayor api gamakatvam astiti nyyabhsane / skyh khalu kevalnvayinah kevalavyatirekinas ca gamakatvam nstity huh / (see NBhs. p.190.16-26) p.83,fn.(l) prthivydlnm <dhrtisangrahapaktivyhvaksadnair> gavdibhvah (cf.NS. 3.1.26(c)) prthivydini manahparyantni navaiva dravyni (cf.VS. 1.1.4) prthivyaptejo vyur ksam iti bhtni (cf.NS. 1.1.13) praksavrttir dharmah (tantrntare ?py uktam) p.148.10-11

p. 160.8-9

p.203.18

p.195.26

prajpatir vai somya rjne duhitrr adn naksatrni sa rohinym evvasat / tny anupeyamnni punar agacchams tasmt stry anupeyamn punar gacchati tny anvgacchat tni punar aycata / tny asmai na punar adadt / so 'bravit sarvesv eva samvad vastha te punar dsymiti sa rohinym evvasat <tam> tasminn anrte yaksmo 'grhnt / candram vai somo rj yad rjnam yaksmo 'grhnt / tad rjayaksmasya janma / sa trnam ivsusyat sa prajpat anthata / so 'bravit sarvesv eva samvad vastha tvto moksymiti / tasmc candramh sarvesu naksatresu samvad vasati / tarn vaisvadevena carunmvasym rtrim ayyajat / tenainam yaks<md> amuncat (Kth.S.11.3) pp.259.26-260.7

340

Appendix.VII p.44,fn.(2)

prajapatyam <tu>param ajam alabheta (cf.Tai.S.2.1.1.5)

pratigra<hane> punah kriyamne pratir bhimukhye vartate (see NM.part 1. p.100.17) pratyaksaprvakatvd v samjnkarmanah (VS.2.1.19) pratyaksnumnopamnasabdh pramnni (NS.1.1.3) p.81.10-11

p.160.16-17 p.70.18-19 p.70.26

prasiddhasdharmyt sdhyasdhanam upamnam (NS.1.1.6)

prnpnasamnodnavynh pafica vyavah, sastham manah, saptamlph, astami vk / (sstram caivam aha) p.209.11-12 bahusu bahuvacanam (cf.Pn.1.4.21) p.23.12 p.51.3-4

brahmavid brahmaiva bhavati (brhmane 'py uktam) brhmanam labheta (Tai.Br.3.4.1) p.31.15

mangaldini hi sstrni prathante virapurusni ca bhavanti / adhyetras ca mangalenbhihitasamskrh sstrrthn su pratipadyante (cf.MBhsya.I.40.7-9) p.12.4-6 mahaddivisesntah sargo buddhiprvakatvt / utpannakryakaranas tu mhtmyasarira ekkinam tmnam aveksybhidadhyau 'hantham putrn sraksye ye me karma karisyanti / ye mm param cparam ca jiisyanti' / tasybhidhyyatah pafica mukhyasrotaso devh prdurbabhvuh / testpannesu na tustim lebhe / tato 'nye tiryaksrotaso 'stvimsatih prajajfie / tesv apy asya matir naiva tasthe / athpare navordhvasrotaso devh prdurbabhvuh / tesv apy utpannesu naiva krtrtham tmnam mene / tato 'nye 'stv arvksrotasah utpeduh (evam hi sstram) p.239.11-18 <m tri(?)> srutau bhaktih sahasaiva mahtmanm (tath ca sati yad uktam) p.40.12-13 middhopaghtt tadvisesa(h) (Vims.18) p.219.26

mukuti kundall vydhoraskas tmryatksa(h) (cf.MBhsya.I.259.20fF.) p.72.14-15 mrtimatm asamnadesatvam (sstram) p. 114.4

ya tmpahatappm vijighatso vipipso vijaro vimrtyur visokah <satya>samkalpah so 'nvestavyah sa jijnsitavyah / sa sarvms ca kam an avpnoti sarvms ca lokn yas tarn tmnam anuvidya vijntlti prajpater vacanam sryate (cf.Chnd.U.8.7.1) p.52.17-20 yamarjyam agnistomenbhijayati (tadyath) p.232.26

Index of the prose passages in alphabetical order

341

yasya gunasya hi bhvd dravye sabdanivesas tadabhidhne tvatalau (cf.Vr.5 on Pn.5.1.119, MBhasya.II.366.10) p.23.9-10 yasya yasyendriyasya visayam mano dhyyaty abhisampattyarthena tasya tasyautsukyam pravrttis ca bhavati (tantrntare 'py uktam) p.214.28-29 yasya hi pratiksanam anyathtvam nsti tasya bhyapratyayo bhedah / pascd visesagrahane nsti tadyath bhmer apacyamnyh pkajnm / na ca bhmeh pratiksanam anyathtvam nsti aksanikatvaprasangt (ksanabhangdhikre bhavadbhir apy uktam) p. 169.10-13 yo yatrbhiyuktah karmani cdustah sa tatrptas tasyopadesah ptavacanam (cf.SV(I).onSK4)' p.5.13-14 yo 'lam sann agnihotrygnihotram na juhoti tarn es devatparuddhparunaddhy asmc ca lokd amusmc cobhbhym (Ai.Br.5.30=25.5.12) p.36.9-10 yogapramne ca tadabhve 'darsanam syt (cf.Pn.1.2.55) rt sasya (Pn.8.2.24) p.64.21 p.24.5

rptisay vrttyatisays ca virudhyante / smnyni tv atisayaih saha vartante / (vrsaganyah pathati) (cf.YBh.on YS.2.15, 3.13) p.137.15-16 vasantya kapinjaln labhate (e.g.Vj.Sam.24.20) p.216.29 p.261.24-25 p.38.14

vahanti nadyah tisthanti parvath (cf.MBhsya.II.123.6ff.)

vyavyam svetam [ajam] labheta bhtikma (cf.Tai.S.2.1.1.1)

vyur vai ksepisth devat vyum eva svena bhgadheyenopadhvati sa evainam bhtim gamayati (cf.Tai.S.2.1.1.1) pp.38.16-39.1 vidvn yajeta vidvn yjayet (iti vacant) p.51.17-18

vidvn yajeta vidvn yjayet srotriyasya ca karmany adhikrah (idam ucyate) p.53.7-8 vidvmsah prajm na kmayante kirn prajay karisymah (Brh.U.4.4.22) p.53.18-19 visamo ' y a m upanysah (cf.MBhsya.I.16.13,1.18.18 et passim) p.106.12

vrddhir daic (Pn. 1.1.1) p.lO2,fn.(3) vrstir vrstir iti sriya evopaniptam adhikurute / s hi vrstivat sarvam pyyati (sstram apy ha) p.247.2-3 vykhynato visesapratipattir na hi sandehd alaksanam (MBhsya.I.6.26 et passim) p.80.4-5

342 vyapi (Svet.U.3.11 et passim)

Appendix.VII p.159.9

sabdapramnak vayam / yac chabda ha tad asmkam pramnam (cf.MBhsya.I.ll.lff.,i.366.12ff.) p.43.6 sabde 'ham sparse 'ham rpe 'ham rase 'ham gandhe 'ham iti (cf.TSV. p.76.1; Math, on SK24) p.195.6 savatir gatikarm kmbojesv eva bhsyate / ramhatih prcyesu tath dtir lavanrtho <prcyesu> dtram udicyesu (tadyath) (cf.MBhsya.I.9.25ff.) p.102.4-5 simsapdisabdnm nirvikalpam anumne 'ntarbhvas trilaksanatvt (yad uktam tantrntariyaih) p.87.14-15 srotrdivrttih (vrsaganyh) p.76.21

srotrdivrttih pratyaksam (cf.e.g.PS.:Peking.Ce.3bl, Derge.Ce.3a3; NV. and NVTT. on NS.1.1.4) ' p.5.11 svetranye cntakasya rudrena krtam duhkham asti (cf.Rm.3.29.27cd) p.260.13-14 sasthy vysraye (cf.Pn.5.4.48) p.25.9 p.44.8 p.63.26 p. 160.16

sa tmano vapm udakhidat (Tai.S.2.1.1.4)

samkhyyah samjiisanghastrdhyayanesu (Pn.5.1.58) samjnkarma <tv> asmadvisistnm Ungarn (VS.2.1.18) samjnym (cf.Pn.4.3.147) p.252.18

sattmtro mahn (sstram tvat) (cf.YBh. on YS.2.19)

p.263.15 p.211.2

sattvrmah sattvamithunas ca sad syd (yasmc chastram ha)

satsamprayoge purusasyedriynm buddhijanma tat pratyaksam (MS. 1.1.4) p.76.19-20 sad anityam dravyavat krya<m> kranam smnyavisesavad iti dravyagunakarmanm avisesam (cf.VS.1.1.7) p.126.3-4 sandehamtram etad bhavati / sarvasandehesu cedam upatisthate (MBhsya.I. 42.11fF., I.119.23fF. et passim) sambandhd ekasmt sesasiddhir anumnam (cf.e.g.NV. on NS.1.1.5) sarpnm ekasesah (cf.Pn.1.2.64) p.82.23-24 p.7.6-7 p.80.3-4 p.5.12

sarvo dvandvo vibhsayaikavad bhavati (cf.MBhsya.I.476.1) savisesannm vrttir na (MBhsya.I.361.5 cf.ibid.II.18.7)

p.59.3, 22

Index of the prose passages in alphabetical order

343

skstkrtadharmna rsayo babhvuh / te 'parebhyo 'skstkrtadharmebhya upadesena mantrn samprdur upadesya glyanto 'pare bilmagrahanyemam grantham sammnsisuh vedam ca vedngni ca (ha ca) (Nir.1.20) pp.251.22-252.1 smnyajiinam indriynm visesajnnam buddheh (uktam anyair cryaih) p.201.22 smnyavihitam ca visesavihitena (cf.MBhsya.I.383.25f. et passim) smnyavihitasya visesavihitena (cf.MBhsya.I.383.24ff. et passim) p.81.19 p.81.16

siddham nimittam naimittakasynugraham kurute nprvam utpdayati (ha) ' (cf.YBh. onYS.4.12) siddhasuskapakvabandhaih (cf.Pn.2.1.41) sldinmjalabhml (cf.YBh.onYS.3.14) supo dhtuprtipadikayoh (cf.Pan.2.4.71) p.70.2 p.150.19 p.23.12-13 p.233.23-24

sksmebhyah sksmatamo mahadbhyo mahattamo (cf.Kath.U.2.20) p.159.10-11 sodarynm pancadasnm satnm trayastrimsad udasisyanta devh / sesh prsiyante (rcpy uktam) p.260.12-13 stenam mano 'nrtavdini vk (cf.SBh.1.2.2) p.44.8-9

stautinyor eva sanyabhysd (Pn.8.3.61) p.64.22-23 hantham putrn sraksye ye me karma karisyanti / ye mm param cparam ca jiiasyanti / p.239.13-14 hantham putrn <sra>ksye ye me karma karisyanti ye mm param <cparam> ca jiiasyanti / sa ydrk sargam abhidhyyati tdrk pradhnd utpadyate tadyath mahesvarasya rudrakotisrstau / p.234.26-29

344 Appendix VIII

APPENDIX VIII

Index of the prose passages quoted or referred in the YuktidTpik a n d in the Kashmir and Delhi Mss. AK.II.24 p.170.18-19 p.154.24 p.170.14 p.111.16 p.163.27-29 p.167.21-23 p.51,fn.(2) p.40,fn.(l) Marginal Notes

to of

according to the Tai.S.2.1.1.5 TSP.(p.l73.6-7) TSV.(p.76.1) Nir.1.20 Nir.3.2 Nir.5.6 p.44,fn.(2)

sources

AK.(p.l92.5)

p.167.21-23 p.195.6

AKBh.(p.62.1-2) AKBh.(p.l59.19) AKBh.(p.l59.24)

pp.251.22-252.1 p.83.5 p.268.17 p.83,fn.(l) p.83,fn.(l)

AKBh.(p.468.20-22) Amarakosa 3.3.4 Arnarakosa 3.3.78 AV(S).8.2.26

NBhs.(p.l90.16-26) NBhs.(p.l91.21-26) NBh.1.2.6

p.45.6-7 p.36.9-10

pp.128.23-129.3 p.81.10-11 p.203.28-32

Ai.Br.5.30=25.5.12 Kath.U.2.20 Kth.S.11.3 Ksik 2.2.16 Gop.Br.1.1.39 GDhS.1.4.1

NM.(partl.p.l00.17) NM.(part2.p.49.5-10) NS.1.1.3 NS.1.1.4 NS.1.1.6 NS.1.1.10 NS.1.1.12 NS.1.L13 NS.3.1.26(c) p.70.18-19 p.76.17-18 p.70.26

p.159.10-11 pp.259.26-260.7 p.ll.10-11 p.7.25 p.34.4-5 pp.53.23-54.3 pp.37.7-38.2 pp.45.2, 52.1-2 pp.43.12-44.1

Chand.U.3.11.4-6 Chand.U.5.10.1-2 Chand.U.5.10.3

pp.16.10-11, 179.13 p.203.15-16 p.203.18 p.148.10-11 p.5.11 p.5.12 p.5.11

Chand.U.5.10.3,5,6 Chand.U.7.1.3 Chand.U.8.7.1

p.51.3 p.52.17-20 p.259.22-24

NV. on NS.1.1.4 NV. on NS.1.1.5

Tan.Br.12.5.18,19 Tai.Br.3.2.5.6 Tai.Br.3.4.1 Tai.S.1.8.6.2 Tai.S.2.1.1.1 Tai.S.2.1.1.4

NVTT. on NS.1.1.4 Pan.1.1.1 Pan.1.1.8 Pn.1.2.55 Pn.1.2.29-31 Pn.1.2.64

p.52.12 p.31.15 p.159.19-20 pp.38.14, 38.16-39.1 p.44.8,44,fn.(2)

p.102.10, 102,fn.(3) p.224.26 p.24.5 p.224.26 pp.82.23-24,87.7

Index of prose passages according to Tfche sources Pan.1.4.15 Pn.1.4.21 Pn.1.4.55 Pn.2.1.13 Pan.2.1.41 Pan.2.2.15 Pn.2.2.28 Pan.2.2.30 Pan.2.2.34 Pn.2.4.71 Pan.3.1.87 Pan.3.3.104 Pan.3.3.117 Pan.4.1.1 Pan.4.3.53 Pan.4.3.120 Pan.4.3.147 Pn.5.1.57 Pn.5.1.58 Pn.5.1.115 Pn.5.1.119 Pn.5.2.127 Pn.5.3.58 Pan.5.4.48 Pn.5.4.154 Pn.6.3.1 Pan.8.2.24 Pan.8.3.61 PS.1.3 p.64.20-21 p.23.12 p.11.13 p.204.8 p.70.2 p . l l . 10-11 p.221.9 p.59.7 p.49.2 p.23.12-13 p.59.25 p.259.17 pp.67.6-7, 204.5, 216.4 p.23.11-12 p.30.19 p.180.2 p.252.18 pp.63.25, 195.3 p.63.26 p.30.20 pp.l4,fn.(l), 69.21 p.87.5-6 p.64.22 p.25.9 p.213.31 p.23.13 p.64.21 p.64.22-23 Brh.U.2.4.13 Brh.U.3.5.1 Brh.U.4.4.22 Brh.U.4.4.25 Brh.U.6.4.14 Math, on SK24 Mund.U. 1.1.4 Mund.U.3.2.9 Mait.U.7.2 p.71.4 p.53.19-20

345

p.53.18-19,53.19-20 p.38.2-6 p.235.1 p.195.6 p.52.21 pp.43.7-8,45.9 p.159.9-10, 159.11 p.24.6 p.60.1 p.64.7 p.269.17-19 p.80.4-5 p.45.11 p.41.1 p.41,fn.(l) p.102.4-5 p.43.6 p.4.15 p.60.1 p.106.12 p.205.10-11 p.106.12 p.106.18 p.106.18 p.7.16 p.12.4-6 p.80.3-4 p.80.14-15 p.82.21-22

MBhsya.1.1.1-2 MBhasya.I.1.2 MBhasya.I.5.15 MBhsya.I.6.1f. MBhsya.I.6.26 MBhasya.I.7.4 MBhsya.I.9.19ff. MBhasya.I.9.21ff. MBhsya.I.9.25ff. MBhsya.I.ll.lff. MBhsya.1.12.27 MBhasya.I.15.2 MBhsya.I.16.13 MBhsya.I.18.5 MBhasya.I.18.18 MBhsya.I.33.17 MBhsya.I.35.9 MBhsya.I.38.20 MBhasya.I.40.7-9 MBhsya.I.42.11ff. MBhsya.I.71.18fF. MBhsya.I.88.25

p.76.21

PS.(Peking.Ce.3bl,Derge.Ce.3a3) pp.5.11, 76.21

346 MBhsya.I.101.12 MBhsya.1.107.21 MBhsya.I.119.23ff. MBhsya.L 115.2-3 oi on

APPENDIX VIII p.20.13-14 p.11.14 p.80.3-4 pp.33.17-18, Rm.3.29.27cd Vj.Sam.24.20 p.260.13-14 p.216.29 p.11.14 p.23.9-10 p.11.14

Vr.l on Pn.1.2.10, Vr.5 on Pn.5.1.119 Vr.7 on Pn.4.1.14,

MBhisya.L152.26fF. p.23.14-15 MBhisya.I.156.8 pp.213.33 MBhasya.L259.20fF. MBhasya.I.361.5 MBhsya.I.361.13fF. MBhsya.I.362.27 MBhasya.L366.12fF. MBhsya.I.383.24fF MBhsya.I.383.25F. MBhsya.I.476.1 MBhsya.II.18.7 MBhasya.II.123.6ff. MBhasya.II.206.23 MBhsya.II.355.9 MBhsya.II.356.1fF. MBhsya.H.356.8-9 MBhsya.II.366.10 MV.25.9 MS.1.1.4
P .232.19

^ , . o Vims.3 Vims.4

)
Mne

p.72.14-15 p.59.3,59.22

p.219.6 p.219.6 p.219.26 p.114.6

p.59.15 Vims.18 p.59.18 Vyo. (p.231.5-6) p.43.6 VS.1.1.1 p.81.16 p.81.19 p.7.6-7 p.59.3,59.22 p.261.24-25 p.11.14 p.59.7 p.60.2 p.11.15-16 p.23.9-10 VS.1.1.4 VS.1.1.7 VS.1.1.8 VS.1.1.9 VS.1.2.1 VS.2.1.18 VS.2.1.19 VS.2.2.6 VS.3.1.13
VS 7 L2

p.160.24 p.160.8-9 p.126.3-4 pp.121.14, 126.5, 156.13-14 p.126.5 p.157.6 p.160.16 p.160.16-17 p.161.29-30 p.76.18-19
Pl16 p

- ' ' -

'17

p.76.19-20
P p.79.25-26,222.5

VS 9 1 VS

-11L5

YBh.onYS.1.4 YBh.onYS.2.15 YBh.cn YS.2.19 YBh.on YS.3.13 129.3, 137.15-16 YBh.on YS.3.14 YBh.on YS.4.12 YS.2.30

pl5L22 23 " p.137.15-16 VSC.on VS.2.1.11 pp.114.6, 160.6-7 pp.62.15,263.15 SPBr.11.7.1.1 P-30.2 pp.111.16, 128.23- ^ . 1 2 . 4 . 1 . 1 p.35.12-13

Bh. on MS.1.1.5 p.150.19 p.233.23-24 SBh.1.2.2 SBh.1.2.4 p.44.8-9 p.30.2

p.7.19-20

pp.191.37-192.1

SV.tmavda 62

p.230.6-7

Index of prose passages according to the sources Svet.U.3.11 p.159.9 SV(I). on SK4 p.5.13-14

347

ALT- UND NEU-INDISCHE STUDIEN Herausgegeben vom Institut fr Kultur und Geschichte Indiens und Tibets an der Universitt Hamburg 15. Kiyoaki Okuda, Hrsg.: Eine DigambaraDogmatik. Das fnfte Kapitel von Vattakeras Mlcra. bersetzung u. Kommentar. 1975. IV, 164 S., kt. ISBN 3-515-02139 - 6 16. Tapan Kumar Das Gupta: Der Vajra - eine vedische Waffe, (vergriffen) 2174 - 4 17. Klaus Rping: Studien zur Frhgeschichte der Vednta-Philosophie. Teil 1: Philologische Untersuchungen zu den BrahmastraKommentaren des Safikara und des Bhskara. 1977. VI,75S.,kt. 2409-3 18. Claus Oetke: Die aus dem Chinesischen bersetzten tibetischen Versionen des Suvarnaprabhsastra. Philologische und linguistische Beitrge zur klassifizierenden Charakterisierung bersetzter Texte. 1977. VI, 462 S., kt. 2600 - 2 19. Horst Brinkhaus: Die altindischen Mischkastensysteme. 1978. VI, 232 S., kt.2759 - 9 20. Axel Michaels: Beweisverfahren in der vedischen Sakralgeometrie. Ein Beitrag zur Entstehungsgeschichte von Wissenschaft, (vergriffen) 2978 - 8 21. Catharina Kiehnle: Vedisch uks und uks/ vaks. Wortgeschichtliche und exegetische Untersuchungen. 1979. V, 241 S., kt. 3149 - 9 22. Egon Brucker: Die sptvedische Kulturepoche nach den Quellen der rauta-, Grhyaund Dharmastras. Der Siedlungsraum. '1980. IV, 160S.,4Ktn.,kt. 2999-0 23. Klaus Bruhn/ Albrecht Wezler, Hrsg.: Studien zum Jainismus und Buddhismus. Gedenkschrift fr Ludwig Aisdorf, (vergriffen) 2874 - 9 24. Axel Michaels: A Comprehensive 6ulvastra Word Index. 1983. VII, 60 S., kt. 4157 - 5 25. S. A. Srinivasan: Studies in the Rama Story. On the irretrievable loss of Vlmiki's original and the operation of the received text as seen in some versions of the Vlin-Sugnva episode. 1984. Volume I. XII, 259 S.; Volume II. Notes, Index of References, Addenda. VI, 195 S., kt. zus. 3664 - 4 26. Leonard W. J. van der Kuijp: Contributions to the Development of Tibetan Buddhist Epistemology. From the eleventh to the thirteenth century. 1983. IX, 330 S., kt. 3584 - 2 27. Andreas Bock: Der Sgara-GangvataranaMy thus in der episch-puranischen Literatur. 1984. IX, 356S.,kt. 4222-9 28. Johannes Bronkhorst: The Two Traditions of Meditation in Ancient India, (vergriffen) 4238 - 5 29. Takashi Iwata: Sahopalambhaniyama. 1991. 2 Bde. XXVIII, 286 und V,246 S., kt. 4398 - 5 30. Caren Dreyer: Das Kthaka-Grhya-Stra. Mit Vivarana des dityadafsana, Btiasya des Devapla und GrhyapnciJ^ de&sBrhmanabala. Kritische Edition mit Anmerkungen. Teil I. 1. Kandik und Sandhyopsanamantrabhsya des Devapla. 1986. XXXV., 185 S., kt. 4532 - 5 31. Martin Mittwede: Textkritische Bemerkungen zur Maitryanl Samhit. Sammlung und Auswertung der in der Sekundrliteratur bereits geuerten Vorschlge. 1986. V,207 S., kt. 4620 - 8 32. Horst Brinkhaus: ThePradyumna-Prabhvafi Legend in Nepal. A study of the Hindu myth of the draining of the Nepal Valley. 1987. VIII, 398 S., kt. 4631 - 3 33. Claus Oetke: "Ich" und das Ich. Analytische Untersuchungen zur buddhistisch-brahmanischen tmankontroverse. 1988. VIII, 577 S., kt. 4675 - 5 34. Rahul Peter Das: Das Wissen von der Lebensspanne der Bume. Suraplas Vrksyurveda kritisch ediert, bersetzt und kommentiert. Mit einem Nachtrag von G. Jan Meulenbeld zu seinem Verzeichnis "Sanskrit Names of Plants and their Botanical Equivalents". 1988. IX, 598 S., kt. 4663 -1 35. Eli Franco: Perception, Knowledge and Disbelief. A Study of Jayarsi's Scepticism. 1987. VII, 584 S.,kt. 4879-0 36. Horst Brinkhaus: Jagatpraksamallas Mladevasasidevavykhynantaka. Das lteste bekannte vollstndig berlieferte Newari-Drama. Textausgabe, bersetzung und Erluterungen. 1987. VII, 207 S., kt.4976 - 2 37. Martin Mittwede: Textkritische Bemerkungen zur Kthak-Samhit. 1989. V, 160 S., kt. ' 5072 - 8 38. Thomas Oberlies: Studie zum Cndravykarana. Eine kritische Bearbeitung von Candra IV.4.52-148 und V.2.1989. XI, 295 S., kt. 5022-1 39. Almuth Degener: Khotanische Suffixe. 1989. LII, 349 S., kt. 5478-2 40,1+2. Hidenori S. Sakuma: Die srayaparivrtti-Theorie in der Yogcrabhmi. 199O.Teil I: VIII, 170 S. with Engl. Summary; Teil II: XVII, 243 S., kt. 5629-7 41. Christoph Cppers: The IXth Chapter of the Samdhirjastra. A Text-critical Contribution to the Study of Mahyna Stras. 1990. XXIX, 171 S., kt. 5649-1 42. Marek Mejor: Vasubandhu's Abhidharmakosa and the Commentaries Preserved in the Tanjur. 1991. XX, 115 S., kt. 5535-5 43. Yoshihito G. Muroji: Vasubandhus Interpretation des Pratityasamutpda. Eine kritische Bearbeitung der Pratityasamutpdavykh (Samskra- und Vijnnavibhanga). 1993. VIII, 259 D.,kt. 6119-3 44. Albrecht Wezler / Shujun Motegi, Ed.: Yuktidlpik. The Most Significant Commentary on the Smkhyakrik. Vol. I. 1998. XXXVII, 347 S., kt. 6132-0

45. Nalini Balbir (Tl. 1)/Thomas Oberlies (Tl. 48. Catharina Kiehnle: Jiindev Studies I, II 2): vasyaka-Studien. Tl. 1: Introduction v ,and III. generate et Traductions; Tl. 2: Glossar ausge(48,1* I and II: Songs on Yoga. Texts and whlter Wrter zu E. Leumanns Die vasyaTeachings of the Mahrstrian Nths. ka-Erzhlungen". 1993. Zus. 685 S.,kt. 48,2. Ill: The Conservative Vaisnava. 6149-5 Anonymous Songs of the Jnndev Gth. 46,1+2. Karin Preisendanz: Studien zu Ny1997. Zus. XII, 352 u. VII, 123 S., kt. 6922-4 yastra III.l mit dem Nyyatattvloka V- 49. Birte Plutat: Catalogue of the Papers of caspati Misras II. 1994. 2 Teile m. zus. LI I, Ernst Leumann in the Institute for the Culture VII, 858 S., kt. 6460-5 and History of India and Tibet, University of 47. Alexander von Rospatt: The Buddhist DocHamburg. 1998. 136 S., kt. 7096-6 trine of Momentariness. A Survey of the Origins and Early Phase of this Doctrine up to Vasubandhu. 1995. IX, 285 S., kt. 6528-8

FRANZ STEINER VERLAG STUTTGART ISSN 0170 - 3242