Sie sind auf Seite 1von 55

Kchen-Journal

Kitchen Journal
www.nolte-kuechen.de

Ihr Traum
ist eine Kche, die in allen Dimensionen und bis ins kleinste Detail perfekt zu Ihnen passt. Wir finden: Das darf kein Traum bleiben! Denn Nolte Kchen macht aus Wnschen Wirklichkeit. Die breite Auswahl an verschiedenen Fronten, Arbeitsplatten, Dekoren sowie eine Vielzahl von Griffen oder grifflosen Optionen trifft garantiert auch Ihren Stil.

Your dream
of a kitchen that suits you perfectly in all dimensions, right down to the very last detail. We believe that should not remain a dream! Nolte Kchen lets dreams come true. The large range of different fronts, worktops, decors and innumerable handles or handleless options are guaranteed to include something to meet your taste, too.

Kchen sind Lebensqualitt.


Kitchens mean quality of life
2|3

Seit ber 50 Jahren


steht Nolte Kchen fr hohe Qualitt und saubere handwerkliche Verarbeitung made in Germany. Unsere Innovationskraft haben wir in der Vergangenheit schon oft unter Beweis gestellt: Sei es durch das genial einfache Maraster MATRIX 150, das Innendekor oder durch einzigartige Gestaltungselemente wie SOFTform. Auch bei der Nutzung von Naturgtern setzen wir Mastbe: Seit 2010 verfgt Nolte Kchen ber FSC und PEFC Zertifizierung fr sozial vertrgliche und umweltgerechte Waldbewirtschaftung. Lassen Sie sich inspirieren von Kchen fr mehr Lebensqualitt!

For over 50 years,


Nolte Kchen has been synonymous with high quality and meticulously crafted kitchens made in Germany. In the past, we have demonstrated our innovative capacity on many occasions: be it through the astoundingly simple size grid MATRIX 150, the interior decor or such unique decorative elements as SOFTform. We also set standards in the use of natural raw materials: since 2010, Nolte Kchen has held FSCandPEFCcertifi cationforsociallycompatibleandenvironment-friendly forest management. Be inspired by kitchens for a better quality of life!

Ralf Jourdan

Manfred Wippermann

Hans-Heinrich Hagemann

4|5

Inhalt Contens
1 MANHATTAN 3 STAR 3 LUX 3 NOVA BRILLANT 4 SOFT LACK 4 TREND LACK 5 SPOT Die grifflose Kche The kitchen without handles 5 ALPHA LACK 5 VIENNA 6 WINDSOR 5 LAGO 7 NOVA LACK 7 GLAS TEC PLUS 8 ELEGANCE 8 NATURE 8 HIGH WOOD Motiv-Glasnischen Glass recesses with motif Dmpfung Cushioned closure Dicht ist dicht Sealed is well sealed Planung Planing 8- 13, 50 - 51 14 - 15 8 - 9, 16 - 21, 40 - 41 22 - 23 24 - 27 28 - 29 30 - 31 32 - 39 36 - 39 40 - 41 42 - 43 44 - 45 46 - 51 52 - 55, 58 - 59 56 - 57 58 - 59 60 - 61 62 - 63 64 - 65 66 - 67 68 - 73 ComfortLine Stauraum Storage space Innenorganisation Interior organisation Innenbeleuchtung Interior lighting Ausstattung Equipment Nolte Classic Korpus Carcases Arbeitsplatten Worktops Griffe Handles Fronten Fronts Verantwortung und kologie Responsibility and ecology Planung ist Trumpf Planning is trumps 74 - 75 76 - 77 78 - 79 80 - 81 82 - 85 86 - 87 88 - 89 90 - 93 94 - 99 100 - 105 106 107

Materialsysteme der Fronten System of materials for fronts


Die Kompet

Qualitt

ECHT HOLZ
enz in Sachen

KCHENFRONT

Echtholz Real wood Echtglas Real glass Echtlack Genuine lacquer

Die Kompet

Qualitt

STOFF
enz in Sachen

SCHICHT

KCHENFRONT

Schichtstoff Laminate Lacklaminat Laminate lacquer

Die Kompet

Qualitt

ECHT GLAS
enz in Sachen

KCHENFRONT

LACK
Die Kompet

KCHENFRONT

LAMINAT
enz in Sachen

Qualitt

Die Kompet

Qualitt

ECHT LACK
enz in Sachen

KCHENFRONT

6|7

MANHATTAN494
Provence Ulme Provence elm Lava Hochglanz High-glosslava U 10 50 mm Arbeitsplatte und Wange Provence Ulme 50 mm Worktop and Panel Provence elm KUM 50 mm Wange Kubanit metallic 50 mm Panel Metallic Kubanit

LUX367

Griff 486 Chrom glnzend, Metall Handle486Polishedchrome,metal

8 |9

MANHATTAN49W
Afrikanische Wenge African weng S 42 / PWD 50 mm Arbeitsplatte Wei und Wange Premiumwei 50 mm Worktop White and Panel Premium white W 14 50 mm Wange Afrikanische Wenge 50 mm Panel African weng

Knopf 132 Edelstahl Optik, Metall Knob 132 Stainless steel look, metal

10 | 11

Stauraum bis in den Sockel! Storagespacerightdowntothefl oor!

MANHATTAN496/497
M78

Holzpore Magnolia Wood pore Magnolia Holzpore Lava Wood pore lava

50 mm Arbeitsplatte Magnolia 50 mm Worktop Magnolia G78 50 mm Wange Magnolia glnzend 50 mm Panel gloss Magnolia HPL 50 mm Wange und Sichtseite Holzpore Lava 50 mm Panel and visible side Wood pore lava

Griff 491 Edelstahl Optik, Metall Handle491Stainlesssteellook

12 | 13

Mit der effizienten Splenunterschrank-Ausgleichsecke wird der vorhandene Platz perfekt genutzt. Theeffi cientspacefi llersinkbaseunitensuresthat the available space is used perfectly.

STAR27W
Wei White Groraumauszug fr Abfalleimer zur Mlltrennung. Largepull-outforseparatewastebins. S 42 / PWD 50 mm Arbeitsplatte Wei und Wange Premiumwei 50 mm Worktop White and Panel Premium white

Griffkombination 800 Chrom glnzend, Metall Handle combination 800 Polished chrome, metal

14 | 15

LUX 361

LUX361/36G
LUX 362

Wei Hochglanz High-glosswhite Quarzgrau Hochglanz High-glossquarzgrey Lemon Hochglanz High-glosslemon E 25 / KOD

LUX 368

50 mm Arbeitsplatte und Wange Kansas Oak sgerau 50mmWorktopandPanelKansasOakrough-sawn S 42 / PWG 50 mm Arbeitsplatte Wei, Korpus Premiumwei glnzend 50 mm Worktop White, Carcase gloss premium white

LUX 367

Griffleiste 530 Chrom glnzend, Metall Handle strip 530 Polished chrome, metal
LUX 36G

Die Kom

LAMINAT t Qualit
petenz in Sachen

LACK

KCHENFRONT

Lacklaminat
Eineextremfl chenruhigeHochglanz-Oberfl chemitoptimaler Widerstandsfhigkeit ist charakteristisch fr Lacklaminat. Diese Fronten bestehen aus einer Holzwerkstoffplatte, deren Beschichtung im Zuge des Produktionsprozesses hochglnzend lackiert wurde.

LUX 36V

LUX 364

Laminate lacquer
Anextremelycalmhigh-glosssurfacewithoptimumresilience istypicaloflacqueredlaminate.Thesefrontsconsistofawoodbasedpanelthatisgivenacoatingofhigh-glosslacquerduring the production process. 16|17

LUX 363

LUX361/36G/363

Wei Hochglanz High-glosswhite Quarzgrau Hochglanz High-glossquarzgrey Lemon Hochglanz High-glosslemon S42/G79

16 mm Arbeitsplatte Wei und Wange Wei glnzend 16mmWorktopwhiteandPanelGlosswhite

Knopf 136 Chrom glnzend, Metall Knob136Polischedchrome,metal

For those who like to fall out of line.


18 |19

Fr alle, die gerne aus dem Rahmen fallen.


LACK
Die Kom

KCHENFRONT

Qualit

LAMINAT t
petenz in Sachen

Kitchen front Laminate lacquer

Wei Hochglanz High-glosswhite Quarzgrau Hochglanz High-glossquarzgrey Lemon Hochglanz High-glosslemon Viola Hochglanz High-glossviola S42/G79

LUX361/36G/363/36V

16 mm Arbeitsplatte Wei und Wange Wei glnzend 16mmWorktopwhiteandPanelGlosswhite

Knopf 136 Chrom glnzend, Metall Knob136Polischedchrome,metal

LACK
Die Kom

KCHENFRONT

Qualit

LAMINAT t
petenz in Sachen

Kitchen front Laminate lacquer

20 | 21

NOVA BRILLANT29T/29W
A 18 / KAD 50 mm Arbeitsplatte und Wange Kernahorn 50 mm Worktop and Panel maple heart

Aqua Trkis metallic Hochglanz High-glossmetallicaquaturquoise Wei Hochglanz High-glosswhite

Griff 482 Chrom glnzend, Metall Handle 482 Polished chrome, metal

Die Kom

t Qualit
petenz

STOFF
in Sachen

SCHICHT

KCHENFRONT

Schichtstoff
Fronten aus Schichtstoff sind Plattenwerkstoffe gefertigt nach DIN438-3undDIN68861,dieausmehrlagigen,kunstharzgetrnktenPapierenundbedrucktenoderdurchgefrbtenDekorpapieren bestehen.

Laminate
Laminate fronts are bonded sheet materials manufactured to DIN438-3andDIN68861whichconsistofpapersimpregnatedwithartifi cialresinssandwichedtogetherwithprintedor through-dyeddecorativepapers.

22 | 23

SOFT LACK 76M


Magnolia softmatt Magnolia soft mat S 48 / W 48 50 mm Arbeitsplatte und Wange Alaska Lrche 50 mm Worktop and Panel alaskan larch LMM 50 mm Wange Lack, Magnolia softmatt 50 mm Panel lacquer, soft mat magnolia

Relinggriff 960 Edelstahl Optik, Metall, handgefertigt Railinghandle960Stainlesssteellook,handmade

Die Kom

Qualit

ECHT LACK
pet hen enz in Sac

KCHENFRONT

Echtlack
HochglnzendeEchtlack-Frontenwerdenmehrfachlackiert und danach poliert, um so eine geschlossene und besonders glatteOberfl chezuerzielen.

Genuine lacquer
Severalcoatsoflacquerareappliedtohigh-glossreal lacquerfrontsbeforebeingpolishedtoleaveasealed,ultrasmooth surface.

24 | 25

SOFT LACK 76W


Wei softmatt White soft mat S57/W57 50 mm Arbeitsplatte und Wange Java Schiefer 50 mm Worktop and Panel Java slate

Griffkombination 970Edelstahl-Optik,Metall Handlecombination970stainlesssteellook,metal

Die Kom

26|27

Praktischer Karussellschrank mit konkaver Ecke. Handy carousel base unit with concave corner.

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

TREND LACK 41R/411


Rosso Hochglanz High-glossRosso Wei Hochglanz High-glosswhite S 85 / W 85 S 42 / LUW 50 mm Arbeitsplatte Wei und Wange UV-Lack, Wei glnzend 50mmWorktopwhiteandPanelUV-lacquer,Glosswhite

Griffleiste 571 Edelstahl-Optik, Metall Handletrim571Stainlesssteellook,metal

Detail Griffleiste Detail of handle trim

28 |29

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

Die senkrechten Radien der SOFTform Wangen sorgen fr einen modernen und weichen Abschluss, der ber entsprechend angepasste Arbeitsplatten abgerundet wird. The vertically rounded edges of the SOFTform end panels make for a soft, modern feel that is rounded off by correspondingly shaped worktops.

Wei Hochglanz High-glosswhite E 14

SPOT 180

50 mm Arbeitsplatte Eiche Rauchsilber 50 mm Worktop Oak smoky silver G79 50 mm SOFTform Wange Wei glnzend 50 mm SOFTform Panel Gloss white

Griffleiste 501 Chrom glnzend, Metall Handle strip 501 Polished chrome, metal

30 | 31

Einfach fabelhaft
Weie, hochglnzend lackierte Fronten faszinierend durch ihre tadellose Oberflchenruhe. Mit dieser grifflosen Kche erzielen Sie eine klare Linienfhrung, die so nur bei Nolte Kchen mglich ist.

Simply fantastic...
White, high-gloss lacquered fronts with fascinatingly perfect surface finish. This handleless kitchen creates clear lines of a kind that only Nolte Kchen can offer.

Die grifflose Kche.


The kitchen without handles.
32 | 33

ALPHA LACK 551


Wei Hochglanz High-glosswhite E 25 50 mm Arbeitsplatte Kansas Oak 50 mm Worktop Kansas Oak LUW 50 mm Wange und Sichtseite UV-Lack, Wei glnzend 50mmPanelandVisiblesideUV-lacquer,Glosswhite S 42 100 mm Thekenelement Wei 100 mm counter element white

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

Die Unterschrank-Ausgleichsecke LE MANS nutzt jeden Raum. Spacefi llercornerbaseunit"LEMANS" makes use of every inch of space.

34 | 35

Wenn Sie eine Nolte Kche whlen


knnen Sie sicher sein, dass wir in puncto Design nichts dem Zufall berlassen. Denn gutes Design orientiert sich an Mensch und Zweck. So mssen neben der Optik auch alle Funktionen stimmen. Gerade in der Kche! Darauf achten wir und treiben unsere Philosophie immer noch ein Stckchen weiter: Fr klare Formen, die Trends widerstehen und das Zeug zum Klassiker haben!

When you choose a Nolte kitchen


you can be sure that we leave nothing to chance where the design is concerned. Good design focuses on the user and the intended use. The functions are just as important as appearance. Particularly in the kitchen! We pay attention to such points and always take our philosophy one stage further to create clear forms that outlive the trends and become classics!

Kchen fr hchste Ansprche.


Kitchens for the highest standards.
36 | 37

ALPHA LACK 55R


Rosso Hochglanz High-glossRosso S87 50 mm Arbeitsplatte Schwarz 50 mm Worktop Black G 53 50 mm Wange und Sichtseite Rosso glnzend 50 mm Panel and visible side Gloss Rosso ALU Korpus Aluminium-Optik Carcase Aluminium look

Intelligente Raumnutzung bis in die Ecke. Intelligent use of the available space, down to the smallest corner.

38 |39

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

VIENNA460/465
Wei softmatt White soft mat Chalet Eiche Chalet oak E 23 / CED 50 mm Arbeitsplatte und Wange Chalet Eiche 50 mm Worktop and Panel Chalet oak

Fr Liebhaber traditioneller Handwerkskunst ist diese 5-teilige Rahmenfront echter Genuss. This5-partframedfrontisasheerdelightforallfansoftraditionalcraftsmanship.

Griff 317 Edelstahl-Optik, Metall Handle317Stainlesssteellook,metal

40 | 41

Magnolia softmatt Magnolia soft mat S86 40 mm Arbeitsplatte Atlas Granit 40 mm Worktop Atlas granite LMM Sichtseite Lack, Magnolia softmatt Visible side lacquer, magnolia soft mat

WINDSOR722

Knopf 138 Edelstahl-Optik, Metall Knob 138 Stainless steel look, metal

Es sind die Details, die den mediterranen Charme unterstreichen. Details underline the kitchen's Mediterranean charm.

petenz Die Kom

Qualit

ECHT LACK Kitchen front


in Sachen

KCHENFRONT

Genuine lacquer

42 | 43

Savannen Akazie Savannah acacia S 84

LAGO 31S

40 mm Arbeitsplatte Colorado Schiefer 40 mm Worktop Colorado slate A16/SVD 50 mm Arbeitsplatte, Wange und Korpus Savannen Akazie 50 mm Worktop, Panel and Carcase Savannah acacia

Auszge bis unter den Backofen. Full-lengthpull-outsbelowtheoven.

Griff 323 Chrom glnzend, Metall Handle 323 Polished chrome, metal

44 | 45

NOVA LACK731
Wei Hochglanz High-glosswhite

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

46|47

NOVA LACK735
Terra Hochglanz High-glossTerra

MANHATTAN49S
Savannen Akazie Savannah acacia A16/SVD 50 mm Arbeitsplatte und Wange Savannen Akazie 50 mm Worktop and Panel Savannah acacia Glasline Auszge fr bessere bersicht. Glaslinepull-outsforabetteroverview. LGT 50 mm Wange Lack, Terra glnzend 50 mm Panel lacquer, gloss Terra

Griffkombination 830 Edelstahl Optik, Metall Handle combination 830 Stainless steel look, metal

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

48 |49

Genuine lacquer

NOVA LACK739
Magma Hochglanz High-glossMagma E 24 50 mm Arbeitsplatte Nebraska Oak sgerau 50mmWorktopNebraskaOakrough-sawn LG9 Sichtseite Magma Hochglanz Visiblesidehigh-glossMagma

Griffkombination 800 Chrom glnzend, Metall Handle combination 800 Polished chrome, metal

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

50 | 51

GLAS TEC PLUS16W


Wei HochglanzHigh-glosswhite S57 50 mm Arbeitsplatte Java Schiefer 50 mm Worktop Java slate

Griffleiste 560 Metall-Optik, Metall Handletrim560metallicfi nish,metal

Die Kom

Qualit

ECHT GLAS
in Sac petenz hen

KCHENFRONT

Echtglas
Echtglasfrontenluxurisundwohnlich.AufdashochwertigeTrgermaterialwirdeinevonhintenlackierteSicherheitsglasscheibe,fl chig geklebt. Die hochglnzende Glasfront mit hchster Strapazierfhigkeit verleiht der Kche eine moderne Transparenz und Weite.

Real glass
Realglassfrontsluxuriousandhomely.Aback-lacqueredpaneof safetyglassisbondedthroughouttothesurfaceofthehigh-quality substratematerial.Theextremelyhard-wearinghigh-glossglassfront gives the kitchen modern transparency and openness.

52 | 53

GLAS TEC PLUS16W/16S


Wei HochglanzHigh-glosswhite Nachtschwarz HochglanzHigh-glossnightblack E 14 16 mm Arbeitsplatte Eiche Rauchsilber 16mmWorktopOaksmokysilver EDS 50 mm Wange Eiche Rauchsilber 50 mm Panel Oak smoky silver Die elegante Griffleiste unterstreicht die perfekte Linienfhrung. The elegant handle trim reinforces the perfect lines.

Griffleiste 530 Chrom glnzend, Metall Handle trim 530 polished chrome, metal

54 | 55

ECHT Kitchen front GLAS


Real glass
Die Kom

KCHENFRONT

Qualit

petenz

in Sachen

ELEGANCE 340
Wei Hochglanz High-glosswhite Der Vitrinenschrank ist genau auf die Kche abgestimmt. Theglass-frontedcabinetmatchesthekitchenperfectly. S68 40 mm Arbeitsplatte Eisgranit saphirblau 40 mm Worktop sapphire blue ice granite LGW Sichtseite Lack, wei glnzend Visible side lacquer, gloss white

Knopf 130 Chrom glnzend, Metall Knob 130 Polished chrome, metal

Die Kom

Qualit

ECHT LACK Kitchen front


petenz in Sachen

KCHENFRONT

Genuine lacquer

56|57

NATURE 565
Eiche Cognac Cognac oak

GLAS TEC PLUS 16W


Wei Hochglanz High-gloss white Griffleiste 530 Chrom glnzend, Metall Handle strip 530 Polished chrome, metal

So modern kann Echtholz sein. Real wood can be this modern.

Die Kom

Qualit

ECHT GLAS Kitchen front


petenz in Sachen

KCHENFRONT

Real glass

Die Kom

Qualit

ECHT HOLZ Kitchen front


petenz in Sachen

KCHENFRONT

Real wood

58 | 59

HIGH WOOD 514/510


Provence Ulme Provence elm Magnolia Magnolia S57 50 mm Arbeitsplatte Java Schiefer 50 mm Worktop Java slate

Griff 317 Edelstahl Optik Handle317Stainlesssteellook

Die Kom

Qualit

ECHT HOLZ
petenz in Sachen

KCHENFRONT

Echtholz
Holz als ursprngliches und reines Naturprodukt vermittelt Wrme und Geborgenheit. Die natrlichen Changierungen in Farbe und Struktur, die in der Maserung sichtbar sind, sind Bestandteil des Holzes.

Real wood
Woodisanauthenticandall-naturalproductthatimparts warmthandinstilsasenseofwell-being.Thenaturalvariations in colour and texture shown in the grain are part of its natural appeal. 60|61

Cups

Motiv-Glasnischen
Die modernere und elegantere Alternative zur klassischen Nischengestaltung. Mal prickelnd frisch, mal eher ruhig und harmonisch whlen Sie aus neun stimmungsvollen Motiven, die fr mehr Wohlfhlatmosphre in Ihrer Kche sorgen, in den Maen von 60 - 180 cm! Auf Wunsch auch hinterleuchtet lieferbar.

Glass niches with motif


The more modern and more elegant alternative to classical recess panelling. Whether fresh and cheeky or quietly harmonious you can choose from nine evocative motifs to make you feel betterin your kitchen, in sizes from 60 to 180 cm! Also available with backlighting on request. Forks

Kiwi

Beach

Birch Forest

Orange

Lavender

Pepper

Lemon

Blueberry

Espresso

62 | 63

60

80 90 100

120

160

180

60

80 90 100

120

160

180

60

80 90 100

120

160

180

Silent Comfort: Sanft und leise


Tren schlieen sanft und geruschlos. Schubksten und Auszge werden mit diesem Selbsteinzug nahe zu automatisch geschlossen. Das nennen wir: Schlieen auf die elegante Art.

Silent Comfort: soft and quiet


Doorsclosesoftlyandsilently.Drawersandpull-outs closealmostautomaticallywiththisself-closingmechanism. We call it: The elegant way to close.

Dmpfung
Cushioned closure

64|65

Dicht ist dicht


Das knnen Sie bei uns wrtlich nehmen. Tren mit Dichtkante schlieen so perfekt, dass weniger Staub ins Schrankinnere dringt.

Sealed is well sealed


And we mean that literally. Doorswith sealed edge close tightly so that less dust enters the unit.

66 | 67

Planung
Planning
Exklusiv bei Nolte Kchen Kchenplanung auf Karopapier
MATRIX 150 steht fr ein exklusiv bei Nolte Kchen eingefhrtes Rasterma. Es beruht auf einer sehr simplen und klar nachvollziehbaren Malogik: Alle Breiten-, Hhen- und sogar Tiefenmae sind durch 150 mm teilbar. Das ergibt eine Vielfalt an schnen, funktionalen Kchen mit harmonischen Proportionen in allen Dimensionen. Und: Sie sind spielend leicht zu planen wenn Sie wollen, sogar auf Rechenkstchen. Da mssen andere erst noch hin!

900
750 600 450 300

225

0 210

195

0 0 150

135

Planen Sie mit unserem Kchenplaner. www.nolte-kuechen.de/de/Kuechenplaner3 Use our kitchen planner for your planning. www.nolte-kuechen.de/de/Kuechenplaner3

ExclusivetoNolteKchen- plan your kitchen on squared paper...


"MATRIX150"isanewgridsystemthathasexclusivelybeenintroducedat NolteKchen.Itisbasedonaverysimpleandeasy-to-followdimensioninglogic: All widths, heights and even depths are divisible by 150 mm. This produces awiderangeofattractive,practicalkitchenswithwell-balancedproportions in all dimensions. And they can be planned with effortless ease if you want, even using simple building blocks. Others have yet to achieve that!

750

600 450 300

39

50

60

Am bequemsten lsst es sich im Stehen arbeiten, wenn der Abstand zwischen Arbeitsplatte und abgewinkeltem Ellenbogen ca. 150 mm betrgt. The most comfortable working height when standing is with a distance of 150 mm between worktop and angled elbow.

68|69

150 mm

75

Alles passt.
Es gibt eine Unterschranklinie und eine Hngeschranklinie. Aus dem gesamten Programm an Kchenmbeln whlen zu knnen, und doch immer wieder auf diese beide Grundlinien zu kommen, das bietet Ihnen kein anderes Rasterma. Ergonomisch eingebaute Backfen mit einer Hhe von 600 mm lassen sich nur bei uns ohne strende Blende integrieren! Auch Dampfgarer, Kaffeemaschinen und vieles mehr passen mitsamt der Zubehrschublade immer ideal. Ein ruhiges, harmonisches Gesamtbild: MATRIX 150 machts mglich!

Hngeschrank-Linie
Wall unit line

Everything fits.
One base unit line and one wall unit line. Being able to choose from the entire range of kitchen units and still always arriving at these two base lines is something that no other grid system can offer. Ovens ergonomically installed at a height of 600 mm can only be integrated without interfering panel in one of our kitchens! Steam cookers, coffee machines and many other appliances always fit perfectly, complete with drawer for accessories. A calm and harmonious overall impression, thanks to "MATRIX 150".

600
Unterschrank-Linie
Base unit line

70 | 71

Die perfekte Stauraumnutzung.


150 mm mal x, das ist exakt das Ma der Dinge, die in der Kche unterzubringen sind. In 150, 300 und 450 mm hohen Schubksten und Auszgen findet jeder Vorrat und jedes Kchenutensil genau den richtigen Platz, ohne das Raum verschenkt wird. In den 150 mm hohen Schubksten des neuen Rastermaes MATRIX 150 finden sogar Suppenkellen und groe Konservendosen gengend Raum. Und auch die Getrnkekiste hat jetzt ihre mageschneiderte Auszugshhe.

The perfect use of storage space.


150 mm times x, that's the exact dimension of things that need to be accommodated in thekitchen.Drawersandpull-outsinheightsof150,300and450mmensureperfect highdrawersinthenew"MATRIX150"gridsizeevenprovideenoughspaceforladles andlargecans.Andthere'snowapull-outinaheighttailoredtobottlecratestoo. storage for any item of food and kitchen utensil without wasting space. The 150 mm

72|73

150

300

450

ComfortLine: Qualitt seit Jahren bewhrt und ungeschlagen!


serienmig integrierte Dmpfung serienmiger Vollauszug hohe, geschlossene Seitenzargen und Rckwnde aus Stahl 16 mm Spanplattenboden prismengelagerte Fhrungen aus stabilen Stahlzargen ab einer Breite von 800 mm bis max. 80 kg belastbar und vieles mehr unterstreichen die Kompetenz in Qualitt von Nolte Kchen.

ComfortLine: Quality that has been proven and unbeaten for decades!
Integrated cushioning as standard Standard full extension High, closed side frames and rear panels in steel 16 mm chipboard base Guides running in prismatic bearings with robust steel frames Load-bearing capacity max. 80 kg from a width of 800 mm upwards These are just a few of the details underscoring Nolte Kchen's excellence in quality.

ber 13 Mio. mal erfolgreich in Gebrauch!


74 | 75

Over 13 million in successful use!

Ein Raumwunder bei der Arbeit.


Nur 15 cm mehr Platzbedarf im Raum, aber ber 32% mehr Stauraum: In Unterschrnken mit Planungstiefe 75 cm findet alles seinen Platz und der vorhandene Raum wird bis in die letzte Ecke effektiv genutzt.

The wondersome creation of space.


Just 15 cm more space required in the room yields over 32% morestoragespace:Baseunitswithaplanningdepthof75cm provide space for everything and the space available in the room is effectively used down to the very last corner.

Stauraum
Storage space
76|77

Alles in Ordnung? Organisieren mit Komfort.


Die hohe Schule der Kchenplanung: Besteck, Geschirr und Vorrte so unterzubringen, dass kein Raum verschenkt wird. Das nichts im Wege steht, alles seinen Platz hat unsere Innenorganisationen erleichtern ihr Arbeiten und schaffen Ordnung. Hier bieten wir eine groe Auswahl an praktischen und formschnen Lsungen, wahlweise in Kunststoff metallic, Echtholz Buche und Wenge-Optik mit Einteilungen in Aluminium.

Everything in order? Convenient organization


Thefi neartofkitchenplanning:storingcutlery,tablewareand provisions without wasting an inch of space so that nothing is in the way and everything in its place. Our interior organizers make the work easier for you and keep everything neat and orderly. We can offer you a large selection of practical and aesthetic solutions,inmetallic-fi nishplastic,genuinebeechwoodand weng look with partitions in aluminium.

Innenorganisation
Interior organisation
78|79

Finden, nicht suchen


Licht schafft in der Kche eine wohnliche Atmosphre und setzt Akzente. Ganz besonders praktisch und berraschend elegant kommt es aber in unseren Schubksten und Auszgen zum Einsatz. Da strahlen, selbst in unseren hohen und bis zu 75 cm tiefen Raumwundern, Geschirr und Tpfe um die Wette.

Find what you are looking for...


Light gives the kitchen a homely atmosphere and creates highlights. Particularlyconvenient-andastonishinglyelegant-itisusedinour drawersandpull-outs.Eveninourtallandupto75cmdeepwonders of storage space, tableware, pots and pans shine brightly.

Innenbeleuchtung
Interior lighting
80 | 81

Ausstattung
Equipment
ChromLine: Wertigkeit & Eleganz
Chrom das Thema, mit dem wir wieder einen Trend gesetzt haben: Dieses edle Material verleiht dem bestens organisierten Inneren eines Schubkastens oder Auszugs eine noch glanzvollere Aussage.

GlasLine: Stil & Stabilitt


GlasLine Seitenzargen aus Glas. Unten edles Metall, oben klares, stabiles Glas. Bei Nolte Kchen gibt es diese hochwertige Materialkombination fr die Seitenzargen von Schubksten in 300 und 450 mm Hhe.

ChromLine: value & elegance


Chrome a material with which we have once again set a trend: nomatterhowwellorganisedtheinteriorofadrawerorpull-out may be, it shines even more brightly with this elegant material.

GlasLine: style & stability.


GlasLine Glass side frames. Elegant metal at the bottom, robust clearglassontop.Thishigh-qualitycombinationofmaterialsis exclusively available from Nolte Kchen for the sides of 300 and 450 mm high drawers.

82 | 83

Ausstattung
Equipment
Eine gute Planung zeigt sich an vielen durchdachten Ausstattungselementen, die Ihnen die Handgriffe im Alltag erleichtern: Ob Groraumauszge fr Getrnkekisten, die ElektroElektrischer Allesschneider Electricmulti-purposeslicer Einbau-Toaster Built-intoaster Einbau-Waage Built-inscales Organisation, der Apotheker- oder der praktische Besenschrank: Sie haben die Wahl. Goodplanningisrefl ectedinnumerouscarefullydesignedequipmentelementstomakeyour everydayworkeasier.Beitlarge-capacitypull-outdrawersforbottlecrates,theelectrical organization,apharmacy-stylelarderunitorahandybroomcupboard:thechoiceisyours. Vorratsschrank Le Mans Larder unit Le Mans

Groraum-Sockelauszug fr Mlltrennung Large-capacityplinthpull-outforsortingwaste

Stollenschrank mit Vorratskrben Stile unit with storage baskets

Stollenschrank mit Handtuchhalter Stile unit with towel rail

Auszugsschrank mit Flaschenkorb Pull-outunitwithbottleholder

Mlltrennung direkt unterhalb der Arbeitsplatte Separate waste collection directly under the worktop

Elektrogerte-Organisation Electrical appliance organisation

Auszugsschrank mit Groraum-Sockelauszug Pull-outunitwithlargecapacityplinthpull-out

Sockelschubkasten Plinth drawer

Vorratsschrank mit Vorratskrben Larder unit with storage baskets

Vorratsschrank mit Innenschubksten Larder unit with interior drawers

Vorrats-Auszugsschrank (Apothekerschrank) Pull-outlarderunit(pharmacyunit)

Besenschrank Broom unit

84 | 85

Fr alle, die optisch mehr erwarten.


Nolte Kchen bietet Ihnen zwei unterschiedliche SchrankInnenausstattungen: Hier sehen Sie die hochwertige, optisch ansprechende und funktionale Innenausstattung, die Sie auf Wunsch ber ChromLine noch zustzlich aufwerten knnen.

Funktion, einfach wie nie!


Mit Nolte Classic bieten wir Ihnen alternativ eine einfache Innenausstattung, bei der Sie keinerlei Stauraumeinbuen hinnehmen mssen. Entscheiden Sie selber, welche Variante fr Sie die Richtige ist.

For all who expect to see more.


Nolte Kchen offers you two different unit interiors: High-quality,attractive,functionalinteriorequipmentwhich can also be additionally upgraded with ChromLine on request.

Fully functional, simpler than ever before!


Nolte Classic is our alternative, simple interior that does not require you to compromise with storage space. You decide which version is right for you.

86|87

Innen wie auen perfekt.


Egal, fr welche unserer Kchen Sie sich entscheiden: Perfekt ist sie erst, wenn sie auch hinter den Fronten den hchsten Qualittsstandards gengt. Fr ein homogenes Gesamtbild sind deshalb die 18 verschiedenen Korpusse in jeder von uns gefertigten Kche innen und auen im selben Dekor.
VDR Vanille Vanilla SHD Sahara KUM Kubanit metallic Metallic Kubanit ALU Aluminium-Optik Aluminium look

Perfect inside and outside.


Whichever kitchen you choose: it is only perfect when it also meets the highest quality standards on the inside too. To create a homogeneous overall picture, all 18 carcase units feature the same decor inside and outside in every single kitchen built by Nolte.

PWD Premiumwei Premium white

PWG Premiumwei glnzend Gloss premium white

SVD Savannen Akazie Savannah acacia

ULD Provence Ulme Provence elm

CED Chalet Eiche Chalet oak

BBD Birnbaum Nature Pear-wood Nature

EDS Eiche Rauchsilber Oak smoky silver

Korpus
Carcases
AWD Magnolia AWG Magnolia glnzend Gloss Magnolia SAD Silberahorn Nature Silver maple Nature WND Italienischer Walnuss Nature Italian walnut Nature NAD Noce Amador BCD Boston Cherry WED Afrikanische Wenge African weng

88 |89

Italienischer Walnuss italian walnut

Savannen Akazie savannah acacia

Kanadischer Apfel canadian apple

Alaska Lrche alaskan larch

Provence Ulme provence elm

N 13

A 16

A 15

S 48

U 10

E 20

16

40

50

A 13

40

50

A 18
40 50 16 40 50 40 50 16 40 50 16 40 50

40

50

Nebraska Oak sgerau Nebraska Oak, rough-sawn

Kansas Oak sgerau Kansas Oak, rough-sawn

Grey Canyon Oak Grey Canyon Oak

Noce Amador Noce Amador

Eiche Rauchsilber oak smoky silver

E 51 E 24 E 25 E 13 A 27 E 14
40 50

E 22

40

50

B 17
40 50 40 50 40 50 16 40 50 16 40 50 40 50

Chalet Eiche Chalet oak

Nussbaum stabverleimt Walnut, glued wood blocks

Amazonas Teak Amazon teak

Boston Cherry Boston Cherry

Afrikanische Wenge african weng

P 83

E 23

N 20

T 22

B 20

W 14
40 50

Arbeitsplatten
Worktops
Arbeitsplatten in Holz-Optik sthetisch und stark. Worktopsinwoodeffectaesthetic and evocative.
Our worktops in wood effect are just as varied as the forests oftheworld.Theyfeelsofantasticallynatural-exactlyasyou would expect. Best of all: we can offer you a matching worktop for every carcase.
50

E 21

16

40

So facettenreich wie die Wlder der Welt so vielfltig sind auch unsere Arbeitsplatten in Holz-Optik. Sie fhlen sich naturnah und fantastisch an da bleiben keine Wnsche offen. Und das Beste: Zu jedem Korpus

E 74

40

50

40

50

40

50

40

50

40

50

40

50

gibt es immer auch die passende Arbeitsplatte.

90|91

16

40

50

Arbeitsplatte Worktops

16

50

Wange Panel

Korpus Carcase

Wei White

Kubanit

Granit Veneziano granite veneziano

Oxid bianco

Steingranit granite stone

Colorado Schiefer colorado slate

S 42

S 13

S 73

S 56

S 50

S 84

S 24

40

S 52

40

50

16

40

50

40

50

40

40

50

16

40

50

40

50

S 53

Magnolia

Grau metallic metallic grey

M 78

S 41

Arbeitsplatten
Worktops
Arbeitsplatten in Uni oder Stein-Optik einfach perfekt.
Unsere Arbeitsplatten sind Qualittsprodukte! Und ganz gleich ob Ihre Wahl auf die eleganten einfarbigen Uni Dekore fllt oder auf realistisch
Schwarz Black

Schiefer anthrazit slate anthracite

Dark Glitterstone Dark Glitterstone

Granit tiefschwarz granite jet black

Black Travertin Black Travertin


40 50

S 43

S 81

G 71

S 49

S 36

40

S 86

40 40 40 50 40 16 40 50

16

40

50

16

40

50

S 85
Oxid Nero Oxid marone Java Schiefer Java slate Granit Kristall Titan granite crystal titanium

Sahara

Terra Plus

nachgebildete Steindekore mit innovativer Oberflche: Alle bestechen durch auergewhnliche Optik und machen Ihre Kche zum Erlebnis!

S 51

S 83

S 87

S 47

S 55

S 57

S 64

40

50

Worktops in plain colour or stoneeffect-simplyperfect.


Our worktops are quality products! Regardless of whether you choose the elegant, plain coloured decors or one of the realistically reproduced stonedecorswithinnovativesurfacefi nish:theyallstandoutthrough
16 40 50 40 50 40 50

S 54

40

50

S 68

their exceptional appearance and make your kitchen something special!

16

40

50

40

50

40

50

40

40

92|93

16

40

50

Arbeitsplatte Worktops

16

50

Wange Panel

Korpus Carcase

Perfekt im Griff.
Verleihen Sie ihrer Kchenplanung eine individuelle Aussage exakt die, die zu Ihnen passt! Bei Nolte Kchen und nur da ist der entscheidende Vorteil, dass die Optik dieses Relinggriffes perfekt auf die Siemens Einbaugerte abgestimmt ist.

A perfect grip on things.


Plan your kitchen with a unique look which makes it absolutely perfect for you. The decisive - and exclusive - advantage of a Nolte kitchen is that this railing handle perfectly matches the Siemens built-in appliances.

94 | 95

Sonderausstattung Special handle options

Griffkombination 960 Handlecombination960

Griffleiste 530* Handle trim 530*

Griffkombination 970 Handlecombination970

Griffleiste 560* Handletrim560*

Der Griff als Gestaltungselement.


Griffe sind das i-Tpfelchen fr eine gelungene Kchenplanung. Verleihen Sie Ihrer Kche mit dem passenden Griff die individuelle Aussage genau die, die zu Ihnen passt. Und zu Ihrer Kche.
Griffkombination 990 Handlecombination990 Griffleiste 502* Handle trim502* *fr GLAS TEC PLUS lieferbar available for GLASS TEC PLUS Griffkombination 980 Handlecombination980 Griffleiste 501* Handle trim 501*

The handle as a decorative element.


Handlesputthefi nishingtouchesoneverysuccessfullyplanned kitchen. Plan your kitchen with the matching handle to give it a unique look making it absolutely perfect for you. And your kitchen.
Griffkombination 800 fr Auszge Handlecombination800forpull-outs

Griffkombination 830 fr Auszge Handlecombination830forpull-outs

Griffleiste 571 Handletrim571

Griffkombination 912 Handlecombination912

Griffe
Handles
96|97

Griffkombination 925 Handlecombination925

Griffleiste 510 Handle trim 510

Griffkombination 945 Handlecombination945

Griffleiste 932 Handletrim932

Ausfhrung Griffkombination 800/830 fr Tren Version Handle combination 800/830 for doors

192 mm Bohrabstand 192 mm Hole spacing

160 mm Bohrabstand 160 mm Hole spacing

224 mm Bohrabstand 224 mm Hole spacing

Standartausstattung Standard handle options

G 317

G 311

G 472

G 440

G 350

G 483

G 325

G 347

G 332

G 431

G 482

G 302

Sonderausstattung Special handle options

G 322

G 352

G 447

G 319

G 493

Griffkombination 818 Handle combination 818

G 333

G 323

G 474

G 316

G 494

G 471

G 349

G 348

G 481

128 mm Bohrabstand 128 mm Hole spacing

96 mm Bohrabstand 96 mm Hole spacing

Griffkombination 815 Handle Kombination 815


Knpfe Knob

G 430

G 426

G 490

G 308

G 429

K 132

K 130

G 425

G 449

G 485

G 306

G 489

K 136

K 133

G 310

G 469

G 486

G 452

K 137

K 139 Griffkombination 816 Handle combination 816

G 416

G 351

G 491

G 324

K 138

K 116

98 | 99

100 | 101
Preisgruppe 1 Pricecategorie 1
MANHATTAN 49R Eiche Rauchsilber Oak smoky silver MANHATTAN 490 Wei White

Fronts

MANHATTAN 49P Eiche Polarsilber Oak polar silver

MANHATTAN 491 Magnolia Magnolia

MANHATTAN 49S Savannen Akazie Savannah acacia

MANHATTAN 496 Holzpore Magnolia Wood pore Magnolia

MANHATTAN 494 Provence Ulme Provence elm

MANHATTAN 498 Sahara Sahara

MANHATTAN 495 Chalet Eiche Chalet oak

MANHATTAN 497 Holzpore Lava Wood pore lava

Fronten

MANHATTAN 49N Italienischer Walnuss Italian walnut

MANHATTAN 493 Kubanit metallic Metallic Kubanit

MANHATTAN 492 Noce Amador Noce Amador

MANHATTAN 49Q Quarzgrau metallic Metallic quarz grey

MANHATTAN 49C Boston Cherry Boston Cherry

MANHATTAN 49W Afrikanische Wenge African weng

Preisgruppe 2 Pricecategorie 2
BICOLOR 5WA Wei/Savannen Akazie White/Savannah acacia STYLE 121 Perlmutt glnzend metallic Glossmetallicmother-of-pearl

Preisgruppe 2 Pricecategorie 2

Preisgruppe 3 Pricecategorie 3

Die

K CH EN

CK LA MINAT
LA litt Qua
Komp etenz in Sa chen

FRO NT

BICOLOR 5WN Wei/Noce Amador White/Noce Amador

LUX 361 Wei Hochglanz High-glosswhite

BICOLOR 5WR Wei/Eiche Rauchsilber White/Oak smoky silver

LUX 362 Magnolia Hochglanz High-glossMagnolia

BICOLOR 5MA Magnolia/Savannen Akazie Magnolia/Savannah acacia

LUX 368 Sahara Hochglanz High-glossSahara

BICOLOR 5MN Magnolia/Noce Amador Magnolia/Noce Amador

LUX 367 Lava Hochglanz High-glossLava

BICOLOR 5MR Magnolia/Eiche Rauchsilber Magnolia/Oak smoky silver

Die

K CH EN

SCHICHT
Qua
Komp etenz

litt

in Sa

FRO NT

chen

Preisgruppe 2 Pricecategorie 2

STOFF

LUX 36G Quarzgrau Hochglanz High-glossquartzgrey

LUX 36V Viola Hochglanz High-glossViola

TOUCH 44W Wei softmatt White soft mat

LUX 364 Orange Hochglanz High-glossorange

TOUCH 44M Magnolia softmatt Magnolia soft mat

Die

K CH EN

Qua

Komp

etenz

lit

in Sa

FRO NT

chen

Preisgruppe 2 Pricecategorie 2

SCHICHT

F STOF t

LUX 363 Lemon Hochglanz High-glosslemon

SATIN GLASART 28W Wei softmatt White soft mat

SATIN GLASART 28M Magnolia softmatt Magnolia soft mat

Preisgruppe 2 Pricecategorie 2

The choice is yours.

Sie haben die Wahl.

handles-sortedaccordingtopricegroups.

For a quick recap: all the fronts in our large

die im innovativen Rasterma MATRIX 150

Fronten aus unserem vielfltigen Programm,

NOVA BASIC 13P Eiche Polarsilber Oak polar silver

Noch einmal zur schnellen Orientierung: Alle

and varied range based on the innovative grid

gefertigt und mit Griffen nach Ihrer Wahl aus-

gestattet werden nach Preisgruppen sortiert.

systemMATRIX150andfi ttedwithyourchosen

NOVA BASIC 13R Eiche Rauchsilber Oak smoky silver

102 | 103
Preisgruppe 4 Pricecategorie 4 Preisgruppe 3 Pricecategorie 3
STAR 27W Wei White CHICAGO 540 Magnolia Hochglanz High-glossMagnolia CHICAGO 543 Kubanit metallic Hochglanz High-glossmetallicKubanit STAR 271 Magnolia Magnolia CHICAGO 541 Quarzgrau metallic Hochglanz High-glossmetallicquartzgrey STAR 276 Vanille Vanilla CHICAGO 544 Purpur Hochglanz High-glosspurple STAR 275 Aluminium-Optik Aluminium look
K CH EN

Preisgruppe 4 Pricecategorie 4

Die

ECHT K LAtC t
FRO NT
chen

Qua
Komp etenz

li
in Sa

STAR 27A Silberahorn Nature Silver maple Nature

TREND LACK 411 Wei Hochglanz High-glosswhite

STAR 27N Italienischer Walnuss Italian Walnut

Die

K CH EN

Qua

Komp

etenz

lit

che in Sa

Preisgruppe 3 Pricecategorie 3

SCHICHT

F STOF t

TREND LACK 412 Magnolia Hochglanz High-glossMagnolia

FRO NT

TREND LACK 418 Sahara Hochglanz High-glossSahara

NOVA BRILLANT 29W Wei Hochglanz High-glosswhite

TREND LACK 41B Azzurro Hochglanz High-glossAzzurro

NOVA BRILLANT 29M Magnolia Hochglanz High-glossMagnolia

TREND LACK 41R Rosso Hochglanz High-glossRosso

NOVA BRILLANT 29T Aqua Trkis metallic Hochglanz High-glossmetallicaquaturquoise

K CH EN

Preisgruppe 4 Pricecategorie 4

Die

ECHT K LAtC t
Qua
Komp etenz

li

in Sa

FRO NT

chen

NOVA BRILLANT 29R Monzarot Hochglanz High-glossmonzared

SOFT LACK 76W Wei softmatt White soft mat

NOVA BRILLANT 29G Quarzgrau Hochglanz High-glossquartzgrey

Preisgruppe 3 Pricecategorie 3

SOFT LACK 76M Magnolia softmatt Magnolia soft mat

SOFT LACK 76S Sahara softmatt Sahara soft mat

STAR PUS 278 Sahara Brettoptik Sahara plank look

K CH EN

Preisgruppe 4 Pricecategorie 4

Preisgruppe 5 Pricecategorie 5

Die

ECHT K LAtC t
Qua
Komp etenz

li

in Sa

FRO NT

chen

ALPHA LACK 551 Wei Hochglanz High-glosswhite

COMO 31A Silberahorn Nature Silver maple Nature

ALPHA LACK 552 Magnolia Hochglanz High-glossMagnolia

COMO 318 Birnbaum Nature Pear-woodNature

Preisgruppe 5 Pricecategorie 5

ALPHA LACK 558 Sahara Hochglanz High-glossSahara

ALPHA LACK 55R Rosso Hochglanz High-glossRosso

SPOT 180 Wei Hochglanz High-glosswhite

Preisgruppe 5 Pricecategorie 5

SPOT 18M Magnolia Hochglanz High-glossMagnolia

LAGO 31W Wei White

SPOT 186 Vanille Hochglanz High-glossvanilla

LAGO 31S Savannen Akazie Savannah Acacia

SPOT 18S Sahara Hochglanz High-glossSahara

LAGO 31A Silberahorn Nature Silver maple Nature

SPOT 18T Terra Hochglanz High-glossTerra

LAGO 31N Italienischer Walnuss Italian Walnut

SPOT 189 Rubinrot Hochglanz High-glossrubyred

LAGO 31B Birnbaum Nature Pear-wood Nature

SPOT 188 Nachtschwarz Hochglanz High-glossnightblack

K CH EN

Die

Qua
in etenz Komp

li
n Sache

FRO NT

104 | 105
ECHT K LAtC t
VIENNA 460 Wei softmatt White soft mat VIENNA 465 Chalet Eiche Chalet oak WINDSOR 722 Magnolia softmatt Magnolia soft mat WINDSOR 728 Sahara softmatt Sahara soft mat

Preisgruppe 6 Pricecategorie6 Preisgruppe 6 Pricecategorie6 Preisgruppe 6 Pricecategorie6


TREND LINE PLUS 53M Magnolia Hochglanz High-glossMagnolia

Preisgruppe 5 Pricecategorie 5

CASTLE 33M Magnolia Hochglanz High-glossMagnolia

Preisgruppe 7 Pricecategorie7

TREND LINE PLUS 53T Terra Hochglanz High-glossTerra

Preisgruppe 6 Pricecategorie6

COUNTRY 641 Altwei handpatiniert braun Off-white,hand-patinatedbrown

K CH EN

Preisgruppe 7 Pricecategorie7

Die

ECHT K LAtC t
FRO NT
chen

Qua
Komp etenz

li
in Sa

VERONA 231 Magnolia Magnolia

NOVA LACK 731 Wei Hochglanz High-glosswhite

VERONA 236 Vanille Vanilla

Preisgruppe 6 Pricecategorie6

NOVA LACK 732 Magnolia Hochglanz High-glossMagnolia

NOVA LACK 738 Sahara Hochglanz High-glossSahara

MONTREAL 501 Wei Hochglanz High-glosswhite

NOVA LACK 733 Kubanit Uni Hochglanz High-glossplainKubanit

MONTREAL 500 Magnolia Hochglanz High-glossMagnolia

Preisgruppe 6 Pricecategorie6

NOVA LACK 739 Magma Hochglanz High-glossMagma

NOVA LACK 735 Terra Hochglanz High-glossTerra

ROMANTICA 190 Altwei handpatiniert blau Off-white,hand-patinatedblue

NOVA LACK 734 Purpur Hochglanz High-glosspurple

ROMANTICA 191 Altwei handpatiniert braun Off-white,hand-patinatedbrown

NOVA LACK 737 Lichtgrau Hochglanz High-glosslightgrey

K CH EN

Preisgruppe 7 Pricecategorie7

Preisgruppe 8 Pricecategorie 8

Die

Die

ECHT LZ HO tt
Qua
Komp etenz

Qua

Komp

etenz

K CH EN

ECHT S GLtA t

li

li

in Sa

in Sa

FRO NT

chen

FRO NT

chen

NATURE 564 Eiche Platin Oak platinum

GLAS TEC PLUS 16W Wei Hochglanz High-glosswhite

NATURE 565 Eiche Cognac Cognac oak

GLAS TEC PLUS 16M Magnolia Hochglanz High-glossMagnolia

K CH EN

Preisgruppe 8 Pricecategorie 8

Die

ECHT LZ HO tt
Qua
Komp etenz

li

in Sa

FRO NT

chen

GLAS TEC PLUS 16S Nachtschwarz Hochglanz High-glossnightblack

K CH EN

Die

Qua

Komp

etenz

li

in Sa

FRO NT

chen

Preisgruppe 7 Pricecategorie7

ECHT LZ HO tt

HIGH WOOD 510 Magnolia Magnolia

HIGH WOOD 514 Provence Ulme Provence elm

RAVENNA 855 Birnbaum Pear-wood

K CH EN

Die

Qua

Komp

etenz

li

in Sa

FRO NT

chen

Preisgruppe 8 Pricecategorie 8

ECHT K LAtC t

HIGH WOOD 51C Boston Cherry Boston Cherry

ELEGANCE 340 Wei Hochglanz High-glosswhite

Verantwortung und kologie.


Unser Unternehmen verfgt ber die Zertifizierung PEFC und wir sind darber hinaus als einer der Ersten unserer Branche FSC -zertifiziert. Und Nolte Kchen denkt weiter: Seit Januar

Planung ist Trumpf Qualitt selbstverstndlich.


Mit unseren Kchen setzen wir Mastbe! Und damit auch bei den Themen Planung und Beratung alles stimmt, sind unsere Kchen nur ber den qualifizierten Kchen-Fachhandel erhltlich. Ihr Berater bietet mageschneiderte Lsungen, Kompetenz, Engagement und Service. Er hat Antworten auf Ihre Fragen: Damit Sie genau die Kche erhalten, die zu Ihnen passt!

2012 nutzen wir in Verwaltung und Produktion 100% kostrom! Mit dem Kauf einer Nolte Kche helfen Sie also aktiv dabei, Klima und Umwelt zu schonen.

Responsibility and ecology.


Ourcompanyhasbeencertifi edaccordingtoPEFC.What'smore,we wereoneofthefi rstinthisindustrystoobtainFSCcertifi cation. Nolte Kchen goes further: since January 2012 we have used 100% ecologicallyproducedelectricityforouroffi cesandproduction! By buying a Nolte kitchen, you can actively help to protect our environment and the climate.

Planning is trumps quality a matter of course


Our kitchens set standards! And to ensure that the planning and advice you get are nothing less than perfect, our kitchens are only soldthroughqualifi ed,specialistretailoutlets.Theiradvisersoffer made-to-measuresolutions,competence,commitmentandservice. They can answer all your questions, so that you get exactly the kitchen you want!

106|107

Wo Form, Farbe und Funktion so perfekt harmonieren wie in einer Nolte Kche, da lsst sich mit leichter Hand Wohlfhlatmosphre schaffen. Fr jede Situation, jede Stimmung und jede Tageszeit. Nolte Kchen: Raum fr Leben. Creating an atmosphere in which to feel at home is easy whe form, colour and function harmonize as perfectly as in a Nolte kitchen. For every situation, every mood and every time of day. Nolte kitchens space for living.

Die Kompetenz in Qualitt Excellence in quality


Nolte Kchen Anni-Nolte-Strae 4 32584 Lhne Fon +49 5732 899-0 Fax +49 5732 899-265
Schutzgebhr 5 Fee 5 Technische nderungen vorbehalten. Aus druck- und fototechnischen Grnden knnen Farbtne in diesem Katalog gelegentlich geringfgig von den Originalfarben abweichen. We reserve the right for technical alterations. The colours of the pictures shown and the original colours may vary slightly due to the printing process.

Besuchen Sie unseren neuen Internetauftritt. Visit our new website.

www.nolte-kuechen.de

VF-KJ13-D