Sie sind auf Seite 1von 164

Explotacin de oro de aluvin

Evidencias a partir de percepcin remota

Junio 2016

Explotacin de oro de aluvin


Evidencias a partir de percepcin remota

Junio 2016

MINISTERIO DE JUSTICIA Y DEL DERECHO:


Jorge Eduardo Londoo Ulloa, Ministro de Justicia y del Derecho.
Carlos Medina Ramrez, Viceministro de Poltica Criminal y Justicia Restaurativa.
Javier Andrs Flrez Henao, Director de Poltica contra las Drogas y Actividades Relacionadas.
Martha Paredes Rosero, Subdirectora Estratgica y de Anlisis.
Apoyo tcnico y temtico:
Alexander Rivera lvarez.
Carlos Andrs Mora Gonzlez.
Diana Katherine Velsquez Aguirre.
Erika Yadira Padilla Rodrguez.
Herbert Augusto Infante Romero.
Marye Saenz Suazo.
Viviana Gmez Forero.
UNODC:
Bo Mathiasen, Representante en Colombia.
Hyarold Leonardo Correa Fajardo, Coordinador Tcnico SIMCI.
Sandra Constanza Rodrguez Castillo, Analista Senior en Procesamiento Digital.
Orlando Gonzlez, Analista Senior en Procesamiento Digital.
Zully Clara Sossa Surez, Analista Senior en Procesamiento Digital.
Mara Isabel Velandia Casallas, Analista Senior en Procesamiento Digital.
Daniel Oswaldo Len Prieto, Analista Junior en Procesamiento Digital.
Jerson Andrs Achicanoy Chicaiza, Analista Junior en Procesamiento Digital.
Germn Andrs Clavijo Hincapi, Lder rea SIG.
Omar Favin Pachn Quevedo, Analista SIG y Sensores Remotos.
Guillermo Arturo Barbosa, Analista SIG y Sensores Remotos.
Mauricio Gonzlez Caro, Ingeniero de Soporte PDI.
Nelson Rafael Palacios Ibarra, Ingeniero de Soporte SIG.
Lina Paola Arvalo Mndez, Analista e Investigadora de Apoyo.
Mara Ximena Gualdrn Parra, Ingeniera de Campo.
0DUWKD/LOLDQD0DUWtQH]9HOiVTXH]'LVHxDGRUD*UiFD
Angela Me, Jefe, Seccin de Investigacin y Anlisis de Tendencias, Viena.
Coen Bussink, Experto en Sensores Remotos, SIG, Seccin de Investigacin y Anlisis de Tendencias, Viena.

AGRADECIMIENTOS

Las siguientes organizaciones e individuos contribuyeron con la realizacin del estudio Explotacin de oro de aluvin.
Evidencias a partir de percepcin remota, ao 2014 y la preparacin del presente informe:
Gobierno de Colombia:
Ministerio de Ambiente y Desarrollo Sostenible.
Ministerio de Minas y Energa.
Ministerio de Salud y Proteccin Social.
Polica Nacional Direccin de Carabineros y Seguridad Rural DICAR.
Armada Nacional de Colombia.
Instituto de Hidrologa, Meteorologa y Estudios Ambientales IDEAM.
,QVWLWXWR*HRJUiFR$JXVWtQ&RGD]]L,*$&
Departamento Nacional de Planeacin DNP.
Direccin de Inteligencia Policial, Centro de Inteligencia Prospectiva CIPRO.

Otros
Daniel M. Rico, Consultor en poltica antinarcticos e investigador de la Universidad de Maryland.
Fiscala General de la Nacin, Direccin Seccional Guana Vaups.
Gobernacin del Guaina.
3UR\HFWR&RQVHUYDFLyQGHODELRGLYHUVLGDGHQSDLVDMHVLPSDFWDGRVSRUODPLQHUtDHQOD5HJLyQGHO&KRFy%LRJHRJUiFR
a cargo de World Wildlife Fund WWF, Programa de las Naciones Unidas para el Desarrollo PNUD y Fondo para
el Medio Ambiente Mundial GEF (por sus siglas en ingls).

La implementacin del estudio Explotacin de oro de aluvin. Evidencias a partir de percepcin remota, para el ao
KDVLGRSRVLEOHJUDFLDVDODSRUWHQDQFLHURGHO*RELHUQRGH&RORPELD
$PHQRVTXHVHHVSHFLTXHRWUDWRGDVODVJUiFDVWDEODVLOXVWUDFLRQHV\JXUDVGHHVWHLQIRUPHWLHQHQFRPRIXHQWH
el Gobierno de Colombia dentro del contexto del Sistema de Monitoreo apoyado por UNODC.
)RWRJUDItDV812'&6,0&,DPHQRVTXHVHHVSHFLTXHRWUD

TABLA DE CONTENIDO
EXECUTIVE SUMMARY ...................................................................................................................

RESUMEN EJECUTIVO ...................................................................................................................

11

RESUMEN DE RESULTADOS ..........................................................................................................

13

PRINCIPALES HALLAZGOS ............................................................................................................

15

INTRODUCCIN...............................................................................................................................

17

ALCANCES .......................................................................................................................................

19

SECCIN

MODELO DE MONITOREO ..............................................................................................................

25

LNEA BASE: EVIDENCIAS DE EXPLOTACIN DE ORO DE ALUVIN CON USO DE


MAQUINARIA EN TIERRA EN EL TERRITORIO COLOMBIANO ....................................................

31

TERRITORIO AFECTADO POR EVIDENCIAS DE EXPLOTACIN DE ORO DE ALUVIN Y


CULTIVOS DE COCA ...........................................................................................................................
ZONAS DE MANEJO ESPECIAL..........................................................................................................
Parques Nacionales Naturales .....................................................................................................
Consejos comunitarios de comunidades afrodescendientes ......................................................
PRDIDA DE COBERTURAS DE ALTO VALOR AMBIENTAL POR ACTIVIDADES DE
EXPLOTACIN DE ORO DE ALUVIN ...............................................................................................
CUENCAS HIDROGRFICAS ..............................................................................................................
RELACIN ENTRE EVOA Y FIGURAS AUTORIZADAS POR LA LEY PARA EXPLOTACIN DE ORO
EL SECTOR MINERO EN LOS LTIMOS TIEMPOS ...........................................................................

35
37
37
43
44
46
52
52

SECCIN II
DETECCIN DE ALTERACIN EN SEDIMENTOS EN SUSPENSIN MEDIANTE NDICES
ESPECTRALES (ESTUDIO DE CASO) ............................................................................................

61

LNEA BASE: COMPORTAMIENTO ESPECTRAL NATURAL DE SEDIMENTOS EN SUSPENSIN


DETECCIN DE CAMBIOS EN EL COMPORTAMIENTO NATURAL MEDIANTE LA OBSERVACIN
Y ANLISIS DE NDICES ESPECTRALES ..........................................................................................

66
69

DINMICA ESPACIAL DE COBERTURAS EN TORNO A ACTIVIDADES DE EXPLOTACIN DE


ORO DE ALUVIN CON USO DE MAQUINARIA EN TIERRA EN LA REGIN PACFICO
(ESTUDIO DE CASO) .......................................................................................................................

75

RIESGO DE AFECTACIN EN LAS POBLACIONES POR ACUMULACIN DE SLIDOS EN


SUSPENSIN POR PRESENCIA DE ACTIVIDADES DE EXPLOTACIN DE ORO DE ALUVIN
EN EL PACFICO COLOMBIANO (ESTUDIO DE CASO).................................................................

96

SECCIN III
ANEXO 1 METODOLOGA PARA EL MODELO DE MONITOREO ................................................. 109
INTERPRETACIN VISUAL DE EVOA CON USO DE MAQUINARIA EN TIERRA .............................
INTEGRACIN DE INFORMACIN .....................................................................................................

113
126

ANEXO 2: EVOA CON USO DE MAQUINARIA EN TIERRA EN RESGUARDOS INDGENAS, 2014 137
ANEXO 3: SELECCIN DE NDICES ESPECTRALES PARA LA DETECCIN DE
ALTERACIN DE SEDIMENTOS SUSPENDIDOS. ......................................................................... 139
ANEXO 4: VISORES GEOGRFICOS ............................................................................................. 146
GLOSARIO ........................................................................................................................................ 150
BIBLIOGRAFA.................................................................................................................................. 154

EXECUTIVE SUMMARY
There is a growing concern among citizens about the
expansion and increase of alluvial gold exploitation
activities taking place in Colombia that are not properly
established within existing normative frameworks, and
ZKLFKLQPDQ\FDVHVQDQFHVDQGVWUHQJWKHQVRUJDQL]HG
crime groups.
Given this development, the Colombian government
through the Ministry of Justice and Law, in alliance with
UNODC, designed and built a baseline of evidences of
alluvial gold exploitation by using machinery on land in
the Colombian territory. This project is comprised of two
SKDVHV 7KH UVW SKDVH  DQG WKH DLP RI WKLV UHSRUW 
focuses primarily on geographical factors and develops
a methodology based on remote sensing techniques,
oriented towards detecting evidences of alluvial gold
exploitation AGE (EVOA by its Spanish acronym)
at the national level, as well as integrating information
and constructing a geographical framework for the
characterization of this phenomenon.
In 2014, the results showed that 78,939 hectares of land
were affected by alluvial gold exploitation at the national
level, distributed over 17 of Colombias 32 departments.
However, 79% of this detected area was concentrated in
the departments of Antioquia and Choc. The municipality
of Nech (Antioquia) represented the most affected area
with 6,232 ha (8% of the total area at the national level).
0RUHRYHUWKH3DFLFUHJLRQRI&RORPELDDSSHDUVWREH
the most affected by AGM activities, a similar trend as
seen with coca crops.
The study warns about the presence of AGE in special
territories within Colombia. In this sense, Afro-Colombian
common lands were the most impacted of the special
territories, with 46% of the AGE evidences. It is necessary
that the special circumstances of these areas be taken

into consideration in the design of public policies. The


overall impact of AGM on indigenous reservations is
less than other special territories, nonetheless the lands
belonging to the Ember Kato communities (Choc and
Antioquia departments) were highly vulnerable to AGE
activities. Regarding the National Parks, 5 of these had
AGM evidences within the parks and 9 of these showed
evidences in their direct vicinity.
Furthermore, the results of the study provide evidence
that alluvial gold exploitation is one of the main drivers
of deforestation in Colombia. The total loss of vegetation
cover - that is of high environmental value - due to AGE
activities was calculated to be 24,450 ha in 2014; and
mainly concentrated in the department of Choc with
77% of the respective loss. Choc is considered to be
one of the most biodiverse areas in the world; and in
addition to losing forest cover to AGE, it was estimated
that 15,404 hectares of vegetation cover - that is of high
environmental value - were cleared to make way for coca
crops in 2013 at the national level.
Regarding the relationship between AGE and coca crops,
the study highlights that in the departments of Caquet,
Putumayo and Nario, over 80% of the detected AGE
activities are found in territories affected by coca crops,
meanwhile Bolvar has 45% of the AGE in territories
affected by coca crops, while in Choc, Valle and
Antioquia this percentage is between 30 and 35%.
The study also looked at the relationship between AGE and
formal procedures authorized by law for gold exploitation
(environmental licenses, mining titles unlicensed,
requests for legalization, and contract proposals) related
to legal mining operations. In this regard, it was found that
60% of the detected AGE did not match any records of
formal procedures, 40% did partially match with a formal
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

procedure, but only 2% of these matched fully with all the


formal procedures for extraction.
The project will develop tools that are applicable to a
larger monitoring scheme that integrates the monitoring
of illicit crops, the monitoring of evidences of alluvial gold
exploitation as well as other forms of illicit activities in the
territory. It will also provide a research framework to focus
political efforts, and promote applied research.
The second phase of the project that will be implemented
in 2016 will generate an analytical report that looks at
socio-economic dimensions for measuring the degree
of vulnerability of the territory in relationship to this
phenomenon, as well as a methodology for characterizing
the spatial dynamics of chemical substances involved in
extraction activities.
The Ministry of Justice and Law and UNODC hope to
contribute to a better understanding of alluvial gold
exploitation activities in the country, hereby offering
objective information that contributes towards the
formulation of more specialized public policy regarding
this phenomenon, and in addition, offers a georeferenced
IUDPHZRUN IRU UHVHDUFK WKDW FODULHV WKH UHODWLRQVKLS
between this mineral exploitation modality and illegal and
criminal activities.

10

UNODC - MINJUSTICIA

RESUMEN EJECUTIVO
Existe preocupacin de los ciudadanos en general por
el reciente auge de la explotacin de oro de aluvin en
el territorio colombiano, que no est enmarcado en la
normatividad vigente para el desarrollo de esta actividad
y que en muchos casos implica la creacin de una
FDGHQDSURGXFWLYDTXHQDQFLD\IRUWDOHFHODGHOLQFXHQFLD
organizada.
En este sentido el Gobierno de Colombia en cabeza del
Ministerio de Justicia y del Derecho y en alianza con
UNODC desarrollaron el diseo y construccin de una
lnea base de evidencias de explotacin de oro de aluvin
con uso de maquinaria en tierra en el territorio colombiano.
El Proyecto se desarrolla en dos fases. La primera fase,
objeto de este informe, tiene un nfasis principalmente
JHRJUiFR \ GHVDUUROOD XQD  PHWRGRORJtD EDVDGD HQ
sensores remotos orientada a deteccin nacional de las
evidencias de explotacin de oro de aluvin (EVOA),
integracin de informacin y construccin del marco
JHRJUiFRSDUDODFDUDFWHUL]DFLyQGHOIHQyPHQR
Los resultados sealan que para el ao 2014 Colombia
tena 78.939 hectreas con EVOA, distribuidas en 17 de
los 32 departamentos del pas. El 79% se encuentra en
dos departamentos: Antioquia y Choc. Nech (Antioquia)
es el municipio que presenta la mayor rea afectada
(6.232 ha) que representa el 8% de la afectacin nacional.
$OLJXDOTXHFRQFXOWLYRVGHFRFDOD5HJLyQ3DFtFRHVOD
ms afectada con EVOA.
El estudio alerta sobre la presencia de EVOA en territorios
especiales. Los Consejos comunitarios resultaron ser los
ms afectados, el 46% de las EVOA se encuentra en
este tipo de territorios por lo cual el diseo de poltica
pblica debera considerar sus particularidades. Aunque
la afectacin en resguardos indgenas es mucho
menor, se focaliza en comunidades Ember Kato,

en los departamentos de Choc y Antioquia altamente


vulnerables. Respecto a Parques Nacionales, 5 de ellos
ya tienen EVOA al interior del parque y 9 ms en zonas
cercanas.
El estudio tambin demuestra que la explotacin de oro
de aluvin es uno de los principales motores de prdida
de coberturas en Colombia. La prdida total de coberturas
de alto valor ambiental asociada a las actividades de
explotacin de oro de aluvin fue de 24.450 ha para el
ao 2014 y se concentr en Choc (77%), uno de los
hotspots de biodiversidad ms importantes del mundo;
como referencia vale la pena mencionar que en 2013
fueron transformadas 15.404 ha de coberturas de alto
valor ambiental para sembrar coca.
Respecto a la relacin entre EVOA y cultivos de coca,
el estudio indica que en los departamentos de Caquet,
Putumayo y Nario ms del 80% de las EVOA se localizan
en territorio afectado por cultivos de coca, Bolvar por
su parte presenta el 45% de las EVOA en territorios
afectados por cultivos de coca (2014), mientras que en
Choc, Valle y Antioquia este porcentaje se encuentra
entre 30 y 35%.
El estudio desarrolla la relacin entre EVOA y las
JXUDVDXWRUL]DGDVSRUODOH\SDUDODH[SORWDFLyQGHRUR
(Licencias ambientales, Amparo de Ttulos sin licencia,
Solicitudes de legalizacin y Propuestas de contrato),
que reglamentan la produccin minera; se encontr que
HOGHODV(92$QRFRLQFLGHFRQQLQJXQDJXUDHO
SUHVHQWDUHODFLyQFRQDOJXQDJXUDSHURVRORHO
cumple con todos los requisitos para la explotacin.
El proyecto desarrolla herramientas aplicables en un
sistema de monitoreo que integre los cultivos ilcitos con
las evidencias de explotacin de oro de aluvin y otras
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

11

formas de ilegalidad en los territorios. Ofrece un marco


de investigacin que permitir focalizar los esfuerzos de
poltica y promover investigaciones aplicadas.
La segunda fase del proyecto se ejecutar durante el
2016 y contempla un informe analtico que involucra la
dimensin socioeconmica para la medicin del grado de
vulnerabilidad del territorio frente al fenmeno, as como
una metodologa para la caracterizacin espacial de la
dinmica de las sustancias qumicas involucradas en las
actividades de explotacin.
El Ministerio de Justicia y del Derecho y UNODC esperan
de esta manera, contribuir a una mejor caracterizacin de
la explotacin de oro de aluvin, ofreciendo informacin
objetiva y robusta, que contribuya a la formulacin y
focalizacin de la poltica pblica y que ofrezca un marco
georreferenciado de investigacin para dar claridad a las
relaciones de esta modalidad de explotacin mineral con
las actividades ilegales y criminales.

12

UNODC - MINJUSTICIA

RESUMEN DE RESULTADOS
Departamentos afectados por EVOA
rea de EVOA detectada nacional
Departamento
Choc
Antioquia
Bolvar
Crdoba
Nario
Valle
Cauca
Otros

78.939 hectreas
EVOA (ha)
36.185
26.323
7.361
3.544
1.676
1.570
1.408
872

Porcentaje total
nacional (EVOA) 2014
46%
33%
9%
4%
2%
2%
2%
1%

Cultivos de
coca (ha)
1.741
2.293
1.565
560
17.285
561
6.389
18.167

Porcentaje total
nacional (coca)
3%
3%
2%
1%
25%
1%
9%
38%

Municipios con mayor afectacin por EVOA


Municipio
Nech
Nvita
Istmina
Zaragoza
Condoto
Zonas de Manejo Especial

Departamento
EVOA (ha)
Antioquia
6.232
Choc
5.175
Choc
5.069
Antioquia
4.887
Choc
4.543
EVOA (porcentaje del total nacional)

Porcentaje
8%
7%
6%
6%
6%
Coca (Porcentaje del total nacional)

Consejos comunitarios

46%

15%

Resguardos Indgenas

1%

11%

Parques Nacionales Naturales

Menos del 1%

8%

Parques Nacionales Naturales con EVOA


Nombre del PNN

EVOA dentro del parque (ha)

Puinawai
25
Paramillo
14
Los Katos
5
Munchique
2
Selva de Florencia
1
Otros
0
Total
47
Prdida de coberturas de alto valor ambiental 2013-2014*
Prdida total en el
periodo
24.450 ha
15.404 ha
6XSHUFLHGHIRUHVWDGDHQ&RORPELDUHSRUWDGDSDUDHODxR ,'($0 140.356 ha

(92$HQiUHDGHLQXHQFLDGHOSDUTXH
0-20 km (ha)
0
450
84
145
108
1.230
2.017
24.450 hectreas
Tasa mensual

Prdida asociada a EVOA


Prdida asociada a coca

( 2.038 / ha/mes)
( 1.284 / ha / mes)

(92$EDMRJXUDVDXWRUL]DGDVSRUODOH\SDUDODH[SORWDFLyQGHRUR
6LQJXUDVDXWRUL]DGDV
Propuestas de contrato**
Solicitudes de legalizacin***
Amparo de ttulos sin licencia****
Licencias ambientales *****

60%
4%
14%
20%
2%

$QDOLVLVREWHQLGRSDUDHOSUHVHQWHHVWXGLR/DWHPSRUDOLGDG\PHWRGRORJtDQRVHKRPRORJDFRQORVGDWRVRFLDOHVGHO,'($0SDUD&RORPELD
$TXHOODVVROLFLWXGHVSUHVHQWDGDVSRUSDUWLFXODUHVDQWHHOHVWDGRFRQHOQGHRSWHQHUODFRQFHVLyQGHXQiUHDOLEUHSDUDODUHDOL]DFLyQGHDFWLYLGDGHVGHH[SORUDFLyQ\H[SORWDFLyQ
minera.
*** Aquellas solicitudes hechas por explotadores de minas de propiedad estatal sin ttulo minero inscrito en el Registro Minero Nacional, y que llevan a cabo explotaciones de depsitos
y/o yacimientos mineros.
(QHO&yGLJRGH0LQDVVHGHQHHO7tWXORPLQHURFRPRHOGRFXPHQWRHQHOFXDOVHRWRUJDHOGHUHFKRDH[SORUDU\H[SORWDUHOVXHOR\HOVXEVXHOR/RVWtWXORVPLQHURVVHFODVLFDQ
en: i) Licencias de exploracin y explotacin, ii) Aportes mineros, iii) Contratos mineros. Se incluyen solamente aquellas reas que no cuentan con licencia ambiental.
***** Autorizacin que otorga la autoridad ambiental competente, mediante acto administrativo, a una persona, para la ejecucin de un proyecto, obra o actividad que conforme a
ODOH\\DORVUHJODPHQWRVSXHGHSURGXFLUGHWHULRURJUDYHDORVUHFXUVRVQDWXUDOHVUHQRYDEOHVRDOPHGLRDPELHQWHRLQWURGXFLUPRGLFDFLRQHVFRQVLGHUDEOHVRQRWRULDVDOSDLVDMH\
HQODTXHVHHVWDEOHFHQORVUHTXLVLWRVREOLJDFLRQHV\FRQGLFLRQHVTXHHOEHQHFLDULRGHOD/LFHQFLD$PELHQWDOGHEHFXPSOLUSDUDSUHYHQLUPLWLJDUFRUUHJLUFRPSHQVDU\PDQHMDUORV
efectos ambientales del proyecto, obra o actividad autorizada.(Decreto 1753 de 1994, artculo 2).

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

13

PRINCIPALES HALLAZGOS
Los resultados de la deteccin de EVOA sealan que
para el ao 2014 Colombia tena 78.939 hectreas,
distribuidas en 17 de los 32 departamentos del pas. El
24% de los departamentos afectados se ubica en el litoral
3DFtFR (O  VH HQFXHQWUDQ HQ GRV GHSDUWDPHQWRV
Antioquia (33%) y Choc (46%). Nech (Antioquia) es el
municipio que presenta la mayor rea afectada (6.232
ha), que representa el 8% de la afectacin nacional. En
Choc, 27 de los 30 municipios del departamento estn
afectados por EVOA.
Los Consejos comunitarios resultaron ser los territorios
especiales ms afectados: el 46% de las EVOA se
encuentra en este tipo de territorios, por lo cual el diseo
de poltica pblica debera considerar las particularidades
de estas unidades. Aunque la afectacin en resguardos
indgenas es mucho menor que en Consejos comunitarios,
est focalizada en territorio de las comunidades Ember
Kato, altamente vulnerables. Respecto a Parques
Nacionales, 5 de ellos ya presentan EVOA al interior del
parque y 9 ms en zonas cercanas.
Se destaca que el 51% del rea nacional de EVOA se
concentra en las subcuencas de los ros Quito, Bajo
Nech, Directos Bajo Nech y Taman - Directos San
Juan.
La prdida total de cobertura de alto valor ambiental
(bosque natural, vegetacin secundaria y otros tipos
de coberturas leosas) asociada a las actividades de
explotacin de oro de aluvin fue de 24.450 ha para el
ao 2014 y se concentr en Choc (77%).
Al nivel nacional, el 38% del territorio afectado con
EVOA registra presencia de cultivos ilcitos. En los
departamentos de Caquet, Putumayo y Nario, ms del
80% de las EVOA se localizan en territorio afectado por

cultivos de coca, Cauca por su parte presenta el 64% de


las EVOA en territorios afectados por cultivos de coca y
Bolvar el 45%, mientras que en Choc, Valle y Antioquia
este porcentaje se encuentra entre 30 y 35%.
Se encontr que el 60% del rea de EVOA no coincide
espacialmente con reas autorizadas por la ley para
explotacin de oro (Licencias ambientales, amparo
de Ttulos sin licencia, Solicitudes de legalizacin y
Propuestas de contrato), mientras que el 40% se encuentra
en zonas que presentan algn tipo de autorizacin.
Solo el 2% coincide con licencias ambientales mineras,
que son el requisito ltimo mediante el cual se puede
iniciar el proceso de explotacin (incluye ttulo y licencia
ambiental). Antioquia es el departamento que presenta
mayor coincidencia de EVOA con reas en las que se
KD\DQFRQFHGLGROLFHQFLDVDPELHQWDOHV3DUDODJXUDGH
Amparo de Ttulos sin licencia (no presenta coincidencia
espacial con licencias ambientales), Antioquia es el
departamento que concentra el mayor porcentaje
(48%) del total de ttulos relativos a explotacin de oro
en el territorio nacional. En el caso de las Solicitudes
de legalizacin Choc ocupa el primer lugar con 84%,
mientras que para las Propuestas de contrato Antioquia
y Choc representan la mayor proporcin de EVOA bajo
HVWDJXUDFRQ\UHVSHFWLYDPHQWH3RU~OWLPR
HQODFDWHJRUtDGRQGHQRKD\FRLQFLGHQFLDJHRJUiFDFRQ
QLQJXQDJXUDDXWRUL]DGDSRUODOH\SDUDODH[SORWDFLyQGH
oro, Choc (47%) y Antioquia (33%) ocupan los primeros
lugares.
Los resultados del piloto de dinmica multitemporal en la
5HJLyQ3DFtFRLQGLFDQTXHHOiUHDDIHFWDGDDFXPXODGD
entre el periodo 2001-2014 es de 44.746 ha. Durante
el periodo 2001 solo se encontraron EVOA en 637 ha,
mientras que para el 2014 se encontraron 40.839 ha.
Se encontr que el 50% de las subcuencas afectadas
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

15

en el 2014 ya presentaban EVOA en el 2001; sobresale


la subcuenca del Ro Quito por presentar la mayor
expansin del fenmeno y porque representa el 30% de
EVOA en la regin para el 2014.
Los resultados del estudio piloto de aplicacin de ndices
espectrales para la deteccin de alteracin de sedimentos
HQVXVSHQVLyQHQFXHUSRVKtGULFRVSHUPLWLHURQLGHQWLFDU
las zonas con alteracin de sedimentos en el ro Inrida
por causa de actividades de explotacin de oro. Estas
fueron contrastadas en talleres con mineros de la
zona y con representantes de las instituciones con
resultados positivos de la aplicacin metodolgica. Los
resultados permiten concluir la viabilidad tcnica para su
implementacin y monitoreo en el territorio nacional.
En el desarrollo de la investigacin se encontraron serias
GLFXOWDGHV HQ HO PDQHMR GH OD LQIRUPDFLyQ JHRJUiFD
disponible sobre el fenmeno. Problemas de completitud,
estandarizacin, topologa y periodicidad estn presentes
en casi todas las fuentes de informacin. Un esfuerzo
para mejorar la informacin existente, pero sobre todo
para mejorar la nueva captura, es absolutamente
recomendable.
El documento desarrolla algunas herramientas que
podran ser implementadas en un sistema de monitoreo
que integre el monitoreo de cultivos ilcitos con el
monitoreo de EVOA, y ofrece un marco de investigacin
que permitir focalizar los esfuerzos y promover
investigaciones aplicadas como:
Generacin de alertas tempranas de actividad
basada en ndices espectrales.
,GHQWLFDFLyQGHSREODFLRQHVULEHUHxDVHQULHVJR
por contaminacin de sedimentos en suspensin
originados aguas arriba en zonas de explotacin.
'LQiPLFDKLVWyULFDGHODVJXUDVGHIRUPDOL]DFLyQ
de la explotacin de oro de aluvin para la
generacin de ndices de alerta y monitoreo de las
actividades en las mismas.
Estudio de las dinmicas de los mercados
asociados a la explotacin de oro de aluvin.
Monitoreos ambientales orientados a registrar
la prdida de Coberturas de la Tierra, y la
LGHQWLFDFLyQGH]RQDVGHULHVJRSRUDOWHUDFLyQGH
los cauces.

16

UNODC - MINJUSTICIA

INTRODUCCIN
(O0LQLVWHULRGH-XVWLFLD\GHO'HUHFKR\OD2FLQDGHODV
Naciones Unidas contra la Droga y el Delito observan
con preocupacin, al igual que muchos sectores del
pas, el crecimiento de las actividades de explotacin
de oro de aluvin y su relacin cada vez ms evidente
con un entorno de ilegalidad y criminalidad. Ya en 2012,
el Sistema Integrado de Monitoreo de cultivos ilcitos SIMCI, alert que la vulnerabilidad de los territorios
afectados por cultivos de coca segua siendo alta a pesar
de la reduccin de los cultivos; en 2013 se present una
alerta por la expansin de las actividades de explotacin
de oro de aluvin en territorios afectados por cultivos
ilcitos; en 2014 se present un primer ejercicio de
deteccin basado en sobrevuelos de reconocimiento
FRQDSR\RGHLPiJHQHVVDWHOLWDOHVQDOPHQWHHQ
el SIMCI present el primer ejercicio de deteccin de
evidencias de explotacin de oro de aluvin en territorios
afectados por cultivos de coca y propuso estrategias para
monitorear el fenmeno a partir de percepcin remota.

DPELHQWDOHV GH FRQWURO GH VFDOL]DFLyQ \ JHVWLyQ


territorial, as como para la formulacin de poltica pblica
\ RIUHFHU XQ PDUFR GH LQYHVWLJDFLyQ SDUD FODULFDU ODV
relaciones de esta modalidad de explotacin mineral con
las actividades ilegales y criminales.

Por esta razn y en el marco del convenio de cooperacin


589 de 2015, el Ministerio de Justicia y del Derecho propuso
a UNODC el desarrollo de una investigacin dirigida
a: 1) construir e implementar un modelo de deteccin
EDVDGRHQVHQVRUHVUHPRWRVTXHSHUPLWDLGHQWLFDUODV
evidencias de explotacin de oro de aluvin; 2) integrar
en la plataforma de investigacin del proyecto SIMCI, la
LQIRUPDFLyQ JHRJUiFD VREUH DFWLYLGDGHV UHODFLRQDGDV
con la explotacin de oro de aluvin; y 3) evaluar la
viabilidad de implementar un sistema de monitoreo
para explotacin de oro de aluvin que aproveche los
desarrollos y capacidades del sistema de monitoreo de
cultivos ilcitos y potencialice la calidad de la informacin
y las investigaciones basadas en evidencia. El Ministerio
y UNODC esperan de esta manera, contribuir a una
mejor caracterizacin de la explotacin de oro de aluvin,
que brinde informacin objetiva y robusta a las entidades

Por ltimo, es pertinente sealar que en este documento,


por tratarse del primer informe de lnea base nacional,
la primera parte presenta los resultados del estudio
de la lnea base de EVOA con uso de maquinaria
en tierra en el territorio Colombiano, junto con las
investigaciones complementarias. La segunda parte
presenta investigaciones complementarias y por ltimo
una tercera parte que expone de manera detallada la
batera metodolgica utilizada para la realizacin del
HVWXGLRFRQHOQGHTXHWRGDVODVSHUVRQDVLQWHUHVDGDV
tengan acceso a la informacin sobre los procedimientos
tcnicos aplicados. Este apartado contiene informacin
de carcter especializado que se presenta de la manera
ms sencilla posible para llegar a un pblico extendido.

Dadas las condiciones de la explotacin y las


posibilidades de deteccin, el proyecto est dirigido al
monitoreo de la explotacin de oro de aluvin, dejando de
ODGRHOPRQLWRUHRGHH[SORWDFLRQHVGHRURHQYHWDROyQ
Se propone una metodologa basada en interpretacin
visual de imgenes de satlite del tipo Landsat para
la deteccin de evidencias de explotacin de oro de
aluvin en tierra (EVOA) y una metodologa basada en
ndices espectrales para la deteccin de actividades de
explotacin de oro de aluvin directamente en agua. Los
resultados tienen cobertura nacional para el caso de las
EVOA y una aplicacin piloto para el caso de ndices
espectrales.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

17

ALCANCES
El panorama actual de la explotacin aurfera en
Colombia contempla dos tipos de yacimiento de acuerdo
con las condiciones geolgicas de formacin: i) primarios,
FRQRFLGRV FRPR GH OyQ R YHWD1, caracterizados por
explotacin de tipo subterrneo, y ii) secundario o de
aluvin2, con explotacin de tipo cielo abierto [1] [2] [3]. El
Sistema de Informacin Minero Colombiano - SIMCO3 [4]
reporta que durante el ao 2011 el 18% de la produccin
de oro4HQ&RORPELDSURYLQRGHH[SORWDFLRQHVGHOyQ\
el 82% de explotaciones de aluvin. En la misma lnea,
con respecto al carcter de legalidad de la explotacin en
ambos tipos de yacimientos, de los datos reportados por
el censo minero se deduce que el 95% de las minas de
aluvin censadas carece de titulacin5, mientras que el
SRUFHQWDMHVLQWLWXODFLyQSDUDPLQDVGHOyQHVGH
/DH[SORWDFLyQGHORV\DFLPLHQWRVWDQWRGHORVGHOyQ
como de los de aluvin, presenta dos modalidades
EiVLFDVHQFXDQWRDODH[SORWDFLyQ\EHQHFLRGHDFXHUGR
con el nivel tecnolgico aplicado: la que emplea tcnicas
y herramientas rudimentarias y la que usa maquinaria
pesada (retroexcavadoras, dragas etc.). La minera
de subsistencia corresponde a la primera modalidad,
y se lleva a cabo por personas naturales que dedican
su fuerza de trabajo a la explotacin de algn mineral
mediante mtodos rudimentarios para generar ingresos
1. Yacimientos primarios hacen referencia a depsitos de mineral in situ donde la
H[SORWDFLyQLQLFLDOVHOOHYDDFDERHQ]RQDVVXSHUFLDOHV\SRVWHULRUPHQWHHQSURIXQGLGDG
mediante trabajos subterrneos en sistema de galera.
2. Yacimientos secundarios son aquellos que posterior a procesos de meteorizacin de
un yacimiento primario hay una disgregacin mecnica natural y por accin del agua las
partculas de oro son transportadas a ciertas distancias estas tienden a concentrarse en
cauces hdricos, dando lugar a los conocidos placeres aurferos [77].
3. Sistema de Informacin Minero Colombiano, que contiene la informacin integrada,
FRQDEOH\RSRUWXQDGHOVHFWRUPLQHURFRORPELDQR\DGHPiVVXPLQLVWUDODVHVWDGtVWLFDV
RFLDOHVGHOVHFWRU(O$GPLQLVWUDGRUHVHO0LQLVWHULRGH0LQDV\(QHUJtD>@
4. Las producciones reportadas no discriminan el carcter legal o ilegal de la explotacin
SXHVWR  TXH   PLQHURV LQIRUPDOHV R LOHJDOHV SXHGHQ UHJLVWUDU SURGXFFLyQ FWLFLD HQ XQ
PXQLFLSLRGLIHUHQWHGHOFXDOVHSURGXMRODH[SORWDFLyQFRQHOQGHHYDGLUHOFRQWUROGHODV
autoridades. [98].
5. Se hace referencia a titulacin en las modalidades de exploracin y explotacin
indistintamente para el aprovechamiento de recursos minerales.

El proyecto:
Desarrolla lineamientos metodolgicos para
la deteccin nacional basada en evidencia
fsica de las actividades de explotacin de oro
de aluvin con uso de maquinaria en tierra
(retroexcavadoras)
Implementa en zona piloto en Guaina de la
deteccin de alteraciones en los sedimentos
suspendidos en los cuerpos hdricos, como EVOA
con uso de maquinaria en agua, tipo dragas y
balsas.
No pretende caracterizar la actividad de
explotacin de oro de aluvin, sino la relacin
entre este fenmeno y el territorio afectado
,GHQWLFDODViUHDVGH(92$VLQUHODFLRQDUFRQ
nmero de frentes o minas en explotacin.
de subsistencia; este tipo de minera est contemplado
como Minera artesanal [5]. En esta actividad no se utiliza
maquinaria especializada (retroexcavadoras, dragas,
etc.) sino que por el contrario es la mano del hombre
la que extrae de manera muy artesanal el mineral y en
pequeas cantidades [6]; algunas modalidades de esta
minera son el barequeo, el machaqueo, y el descue6[4].
Para el caso del barequeo7, se plantea que es una
6. Barequeo en ros y quebradas, el machaqueo en sitios de explotacin con depsitos
residuales in situ o como sobrantes de las pilas de estriles de minera de mayor
envergadura, el monitoreo de terrazas y aluviones, el descue de explotaciones
abandonadas o en proceso de cerramiento y la explotacin bajo tierra de yacimientos
recin descubiertos [76].
7. (Artculo 155 del Cdigo de Minas). Actividad popular de los habitantes de terrenos
aluviales actuales. De acuerdo al citado precepto legal, esta actividad esta exclusivamente
supeditada al lavado de arenas por medios manuales, quedando prohibida la utilizacin
de maquinaria o medios mecnicos para su ejercicio. La minera de barequeo tiene como
REMHWLYRHVSHFtFRVHSDUD\UHFRJHUPHWDOHVSUHFLRVRVFRQWHQLGRVHQHVDVDUHQDV>@

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

19

El estudio genera informacin espacial de evidencias


de explotacin de oro de aluvin (EVOA) con uso de
maquinaria en tierra en el territorio nacional, sin considerar
o profundizar el carcter legal o ilegal de las mismas, cuya
determinacin est en competencia de Instituciones del
Gobierno. Sin embargo se provee un marco de informacin
que contempla la integracin de informacin primaria como
la espacializacin de EVOA, y secundaria como informacin
GH JXUDV DXWRUL]DGDV SRU OD OH\ SDUD H[SORWDFLRQ GH RUR
de aluvin (Licencias ambientales, mparo de Ttulos
sin licencia, Solicitudes de legalizacin y Propuestas de
contrato) que permitir al Gobierno Nacional tener una visin
ms integral del territorio y facilitar la comprensin del
fenmeno, la gestin, el control y la formulacin de poltica
basada en evidencia.

explotacin de subsistencia en condiciones amigables


con el medio ambiente, ya que no utiliza ningn qumico
para la recuperacin del oro y el rea intervenida es
imperceptible. La minera de subsistencia es un fenmeno
frecuente y no se aborda en el presente estudio. [7]
De otra parte, la utilizacin de maquinaria pesada ha
ganado protagonismo en las explotaciones aurferas
como herramienta que mejora la rentabilidad en la
explotacin, al remover grandes volmenes de material
en poco tiempo, pero que repercute con mayor impacto
si no se sigue un plan de manejo ambientalmente
sostenible.

En consecuencia, el tipo de explotacin, las herramientas


y maquinaria utilizadas generan en el territorio evidencias
fsicas8: En el caso de la explotacin tipo subterrneo
VH LGHQWLFDQ SULQFLSDOPHQWH FRPR DTXHOODV GHULYDGDV
de la contaminacin atmosfrica, auditiva, hdrica y de
desestabilizacin del medio subterrneo, mientras que
la explotacin a cielo abierto genera evidencias fsicas
sobre la cobertura terrestre, con fuerte impacto visual
por cambios en el paisaje circundante relacionado con
alteraciones en los cuerpos de agua, deforestacin y
degradacin de suelos, entre otros.
Las evidencias fsicas pueden detectarse por tcnicas
in situ y mediante tcnicas de percepcin remota9
de acuerdo con el objetivo de estudio. Las tcnicas in
VLWX VH IRFDOL]DQ HQ ]RQDV \ HVWXGLRV HVSHFtFRV GH
contaminacin atmosfrica e hdrica debido al alto costo
de implementacin. Por otra parte, la percepcin remota
ofrece herramientas que permiten, entre otros, mayor
cubrimiento de territorio a menor costo, con tiempos de
visita cortos que potencian su utilidad en estudios de
monitoreo. La aplicabilidad de esta tcnica en estudios
relativos a explotacin mineral va desde la deteccin de
reas potenciales en minerales (con el uso de imgenes
hper- espectrales), hasta la deteccin y monitoreo de la
dinmica de las actividades de explotacin basada en
evidencias fsicas sobre el paisaje.

Ilustracin 1. Distribucin de las explotaciones segn tipo de yacimiento (Fuente SIMCO).


  /D HYLGHQFLD ItVLFD HV WRGR PDWHULDO VHQVLEOH VLJQLFDWLYR TXH VH SHUFLEH FRQ ORV
sentidos y que tiene relacin con un hecho [78].
/DSHUFHSFLyQUHPRWDVHGHQHFRPRODFLHQFLD\DUWHGHREWHQHULQIRUPDFLyQ~WLOVREUH
los objetos, reas o fenmenos bajo investigacin mediante anlisis de datos adquiridos
por dispositivos que no estn en contacto fsico con estos por intermedio de imgenes
TXHRIUHFHQREVHUYDFLyQSHULyGLFD\DPSOLDSHUVSHFWLYDGHODVXSHUFLHWHUUHVWUH/DV
imgenes satelitales se han convertido en una fuente valiosa de informacin para
QXPHURVDV DSOLFDFLRQHV WDOHV FRPR HO LQYHQWDULR GH UHFXUVRV QDWXUDOHV SODQLFDFLyQ
urbana y rural, monitoreo y gestin del medio ambiente, agricultura, infraestructuras, obras
civiles, exploraciones mineras, respuestas rpidas a desastres y operaciones militares,
entre muchas otras [94].

20

UNODC - MINJUSTICIA

El proyecto desarrolla la deteccin de evidencias


fsicas caracterizadas por cambio de paisaje generadas
en las explotaciones en tierra con maquinaria tipo
UHWURH[FDYDGRUDV\GHQHORVOLQHDPLHQWRVPHWRGROyJLFRV
para la deteccin de EVOA en cuerpos de agua con
alteracin de los sedimentos en suspensin, resultante
del empleo de maquinaria tipo dragas. La deteccin
de EVOA generada por ambos tipos de explotacin se
aborda mediante tcnicas de percepcin remota.

En cuanto a la deteccin de evidencias fsicas visibles


sobre el terreno circundante por cambio de paisaje,
se aborda una primera lnea metodolgica mediante
interpretacin visual y su cubrimiento es todo el territorio
nacional.
Para la deteccin de EVOA en cuerpos de agua con
base en la alteracin de los sedimentos suspendidos, se
aborda una segunda lnea metodolgica a travs del uso
de algebra de bandas (ndices espectrales). Esta lnea
metodolgica se implementa como estudio-caso en una
zona piloto en la que predomina este tipo de explotacin
(Ro Inrida).

*UiFR'LVWULEXFin porcentual de encuestas realizadas en el


marco del censo minero de acuerdo a la titulacin (Fuente SIMCO).

Explotacin de oro

Baraqueo, mazamorreo, etc

Cuerpos
de Agua
Alteracin
sedimentos_dragas

Aluvin
Cambio de paisaje

Alcance
del estudio

Terrenos
aluviales
Herramientas manuales,
min-incipiente

Filn
Ilustracin 2. Alcance del estudio.

Aunque la evidencia fsica visible ms caracterstica


de la utilizacin de maquinaria pesada en tierra es la
alteracin del paisaje circundante a los cuerpos hdricos
o en terrenos aluviales, la naturaleza de la explotacin
UHPRFLyQ GH PDWHULDO EHQHFLR FRQ DJXD HWF  DOWHUD
los sedimentos en suspensin en el medio acutico; esto
quiere decir que las actividades de explotacin con uso
de maquinaria en tierra dejan evidencias detectables tanto
por interpretacin visual como por ndices espectrales10.
10. Los ndices espectrales se basan en la combinacin algebraica de bandas con valores
HVSHFWUDOHV FRUUHJLGRV \ FDOLEUDGRV UDGLRPpWULFDPHQWH UHHFWDQFLDV  HO REMHWLYR HV
agrupar y minimizar las diferentes respuestas de los sensores en un nico valor por pxel,
que pueda relacionarse con xito con un fenmeno a investigar [28].

Sin embargo, la aplicabilidad de los ndices espectrales


se concentra en indicar los sitos de alteracin de los
sedimentos.
Adicionalmente se desarrollar una aplicacin piloto para
LGHQWLFDUODGLQiPLFDHVSDFLDOTXHKDWHQLGRHOIHQyPHQR
de la explotacin de oro de aluvin en la Regin
3DFtFRHQFXDWURFRUWHVGHWLHPSR
y 201411. Esta aplicacin tiene los siguientes propsitos:
L  LGHQWLFDU HO iUHD DIHFWDGD GXUDQWH HO SHULRGR GH
11. La seleccin de periodos se estableci con base en el conocimiento general de la
zona adquirido a travs del monitoreo del fenmeno de cultivos ilcitos en el territorio,
TXHSHUPLWLyLGHQWLFDUSHULRGRVGHHVFDVDRQXODSUHVHQFLDGHOIHQyPHQR\SHULRGRVGH
aumento de la misma.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

21

El estudio contempla las evidencias fsicas


caracterizadas por cambio en el paisaje dejadas por
actividades de explotacin. Sin embargo, es necesario
precisar que existen explotaciones que cumplen con los
requerimientos y manejos ambientales necesarios y no
dejan evidencia en el paisaje. Estas explotaciones no
son consideradas en el presente estudio.

estudio; ii) determinar las coberturas vegetales con


mayor afectacin por el establecimiento del fenmeno;
LLL  LGHQWLFDU OD GLQiPLFD GH DIHFWDFLyQ GH VXEFXHQFDV
KLGURJUiFDV DIHFWDGDV LY  HVWDEOHFHU ORV HIHFWRV HQ
la prdida de coberturas vegetales asociada con las
actividades de explotacin de oro de aluvin y con cultivos
LOtFLWRV Y  LGHQWLFDU HO FRPSRUWDPLHQWR HVSDFLDO GH ORV
cultivos ilcitos y las evidencias de explotacin de oro de
aluvin en el territorio; vi) establecer el rea afectada por
actividades de explotacin de oro de aluvin durante el
periodo de estudio.
Por otra parte, el estudio desarrolla una propuesta
PHWRGROyJLFD SDUD LGHQWLFDU ORV GUHQDMHV TXH KDQ
SUHVHQWDGR SRVLEOH DIHFWDFLyQ SRU HO XMR \ DUUDVWUH GH
sedimentos originados en la explotacin de oro de aluvin,
y determinar la direccin en la que se van acumulando
dichos sedimentos.
Este informe contempla la primera fase del estudio, cuyo
pQIDVLVHVWiHQODGHWHFFLyQFRPRFRPSRQHQWHJHRJUiFR
e insumo base para la caracterizacin del fenmeno en
HO WHUULWRULR \ OD FRQVWUXFFLyQ GHO PDUFR JHRJUiFR GH
referencia, apoyado en un modelo de integracin de
informacin primaria y secundaria con el marco de reas
de SIMCI12.

12. Sistema de grillas de 1km x 1 km que contiene toda la informacin recopilada sobre
el territorio en relacin con el fenmeno de cultivos ilcitos.

22

UNODC - MINJUSTICIA

SECCIN

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

23

MODELO DE MONITOREO
El Gobierno de Colombia, en cabeza del Ministerio de
Justicia y del Derecho, en alianza con UNODC, han
diseado una plataforma para deteccin y monitoreo
de actividades de explotacin de oro de aluvin en el
territorio colombiano, para generar evidencia que mejore
la comprensin del fenmeno y la toma de decisiones.
(VWHPRGHORSDUWHGHODLGHQWLFDFLyQ\JHRUHIHUHQFLDFLyQ

de las manifestaciones fsicas del fenmeno, sigue con


la conformacin de un marco de estudio sobre el cual
disear investigaciones que mejoren la caracterizacin
del fenmeno y permitan retroalimentar el sistema, y
QDOPHQWH WHUPLQD FRQ OD SXHVWD D GLVSRVLFLyQ GH ORV
datos. La plataforma consta de 6 ejes que se desarrollaran
en dos fases:

Patronamiento
espectral de alertas
regin piloto

Informe rbol de
decisin

Evidencias de agua

Deteccin basada
en ndices
espectrales

Evidencias en Tierra

Deteccin basada
en interpretacin
visual

Documentos

Resumen
documental

Biblioteca

Tipo

GDB

Deteccin

Fase 1

Informacin
secundaria

Fase 2

Aplicativo consulta

Diseo estadstico

Vulnerabilidad del
territorio
Caractersticas
socioeconmicas de los
territorios afectados por
explotacin de minerales

Formulario de
entrevista

Dinmica de las
sustancias qumicas

Figura 1. Esquema plataforma de investigacin.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

25

FASE I: Esta fase, objeto del presente informe, tiene


XQ pQIDVLV SULQFLSDOPHQWH JHRJUiFR \ GHVDUUROOD HO
diseo e implementacin de la metodologa orientada
a: i) deteccin; ii) integracin de informacin primaria
(deteccin de evidencias fsicas) y secundaria (datos
JHQHUDGRV SRU LQVWLWXFLRQHV RFLDOHV WtWXORV OLFHQFLDV
RSHUDWLYRVHWFLLL DQiOLVLVJHRJUiFRVHVSHFtFRVSDUD
la caracterizacin del fenmeno.

evidencias son detectables mediante la interpretacin


de imgenes satelitales usadas en la plataforma de
monitoreo desarrollada por SIMCI.

(QHOFDPSRHVSHFtFRGHODH[SORWDFLyQPLQHUDO
a cielo abierto, la percepcin remota se ha incorporado
a los sistemas de gestin ambiental de las operaciones
mineras y reas afectadas por stas, principalmente
en las economas ms desarrolladas [8]. Diversos
DETECCIN
PpWRGRVVHKDQLPSOHPHQWDGRSDUDLGHQWLFDU\HYDOXDU
los impactos causados por la explotacin de minerales,

El dimensionamiento espacial del fenmeno de empleando imgenes de satlite. En este contexto las
la explotacin de oro de aluvin se basa en la deteccin aplicaciones tienden a ser altamente especializadas,
mediante percepcin remota de las evidencias fsicas de utilizando datos de alta resolucin hiperespectral para
las actividades de explotacin del mineral. Esta etapa se OD LGHQWLFDFLyQ GHO FRPSRQHQWH PHWiOLFR GH ODV iUHDV
FRQVWLWX\HHQODEDVHSDUDODFDUDFWHUL]DFLyQJHRJUiFD de residuos mineros, la cartografa de la distribucin de
del fenmeno en el territorio y se complementa con los componentes generadores de cido en el material de
un estudio multitemporal de la dinmica espacial del desecho, y la evaluacin de los impactos de los desechos
IHQyPHQRHQOD5HJLyQ3DFtFR
mineros en la vitalidad de las diferentes comunidades
vegetales [9].

El monitoreo del territorio afectado por cultivos


ilcitos que realiza SIMCI anualmente, incluye en
La explotacin de oro de aluvin en el territorio
su metodologa sobrevuelos de reconocimiento y colombiano se efecta en dos modalidades generales:
YHULFDFLyQ UHDOL]DGRV FRQ DSR\R GH OD 'LUHFFLyQ explotacin mediante el uso de maquinaria en tierra
Antinarcticos de la Polica Nacional - DIRAN. Durante (retroexcavadoras) y explotacin mediante el uso
los ltimos aos, en estos sobrevuelos se ha podido de maquinaria en agua (dragas, dragones, balsas);
constatar la creciente aparicin y expansin de EVOA en cada modalidad de explotacin ocasiona diferentes
el territorio afectado por cultivos de coca, principalmente perturbaciones, las cuales generan evidencias fsicas
en terrenos aluviales sobre mrgenes y terrazas aledaas de diversa naturaleza de acuerdo al medio en el que se
a los cuerpos de agua. Se comprob por parte de los PDQLHVWDQ
expertos en procesamiento digital del SIMCI que estas

a) Retroexcavadora

b) Draga

c) Dragones

d) Balsas

Ilustracin 3. Maquinaria usada en la explotacin de oro de aluvin.

Fuentes: Fotos tomadas de: a) http://elmanelin.blogspot.com.co/2012_05_01_archive.html b) KWWSZZZHOHVSHFWDGRUFRPOHVHVSHFLDOHVULRTXLWRLQGH[KWPO c) http://www.semana.


com/nacion/articulo/los-dragones-del-oro/100811-3 d) http://unriodesal.blogspot.com.co/2008/05/minera-de-retro-pequea-escala.html

26

UNODC - MINJUSTICIA

En este sentido, las evidencias fsicas se convierten en


instrumento para la deteccin y espacializacin de las
actividades de explotacin mediante sensores remotos.
6LQ HPEDUJR OD QDWXUDOH]D WHPSRUDO GLHUH HQ FDGD
modalidad de explotacin.
La explotacin en el lecho de los cuerpos hdricos
mediante el uso de maquinaria en agua genera
evidencias efmeras, caracterizadas por la alteracin de
los sedimentos suspendidos en el agua, que se relacionan
con el momento de la explotacin y no son duraderos. Los

cambios en el medio ocasionados por la explotacin de


oro en el lecho de los ros mediante el uso de maquinaria
en agua, involucran la alteracin de las propiedades
pticas del medio hdrico las cuales no se detectan
con precisin mediante las tcnicas tradicionales de
interpretacin, y deben ser abordadas mediante tcnicas
especializadas de explotacin de informacin, como el
lgebra de bandas (ndices espectrales), que resaltan las
caractersticas del objeto de estudio y se complementan
FRQ VREUHYXHORV GH YHULFDFLyQ H LQFRUSRUDFLyQ GH
informacin secundaria.

Ilustracin 4. Deteccin de cambios con imgenes de satlite Landsat (visualizadas en falso color CC 543. Evidencias fsicas visibles sobre el
SDLVDMHJHQHUDGDVSRUHOXVRGHPDTXLQDULDHQWLHUUD(92$HQWRQRD]XOFODURFRQODJXQDVGHEHQHFLR

Por otra parte, las evidencias generadas por las


actividades de explotacin mediante el uso de maquinaria
en tierra se caracterizan por cambios en el paisaje
circundante a los cuerpos hdricos, debido entre otros a
la remocin de la capa vegetal, la proliferacin de suelos
desnudos, y la alteracin de cauces. Estas se consideran

evidencias duraderas por su permanencia en el tiempo,


y se detectan por medio de percepcin remota mediante
interpretacin de imgenes satelitales. Sin embargo, la
naturaleza de la explotacin tambin genera alteracin
en los sedimentos suspendidos en el medio hdrico, por
lo que esta modalidad genera los dos tipos de evidencia.

Ilustracin 5. Evidencias fsicas detectadas mediante el uso de ndices espectrales generadas por el uso de maquinaria en tierra. Izquierda
imagen satelital en la cual no se observan perturbaciones en el medio hdrico. Derecha, ndice espectral aplicado a la imagen. En la imagen
de la derecha, las zonas del ro en color naranja o rojo, indican alteraciones en los sedimentos.

Lo anterior implica que las evidencias fsicas detectadas


mediante imgenes satelitales deben tener una lectura de
interpretacin de acuerdo con las siguientes precisiones:
i) Evidencias detectadas por alteracin del paisaje
circundante, corresponden a evidencias duraderas que

pueden estar relacionadas con actividades en progreso


o con actividades de explotacin en perodos anteriores.
ii) Evidencias detectadas por alteracin de sedimentos
en suspensin, corresponden a evidencias efmeras
relativas a actividades de explotacin en progreso, con
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

27

movilidad a lo largo del cuerpo hdrico afectado, segn


corresponda con el sitio de explotacin.

La deteccin se aborda en dos marcos de ejecucin de


acuerdo con el desarrollo y madurez metodolgica:

De acuerdo con lo anterior, la metodologa para la


deteccin EVOA se basa en percepcin remota mediante
el uso de imgenes satelitales, por medio de dos lneas
metodolgicas que presentan un eje comn, pero
TXH DERUGDQ SURFHVRV HVSHFtFRV GH DFXHUGR FRQ OD
naturaleza de la evidencia, tal como se observa en la
siguiente ilustracin.

1.
Lnea base de evidencias de actividad de
explotacin de oro de aluvin con el uso de maquinaria
en tierra en mbito nacional.
2.
Implementacin y validacin metodolgica de la
deteccin de EVOA con el uso de maquinaria en agua en
una zona piloto del departamento de Guaina.

Ilustracin 6. Esquema modelo de deteccin basado en percepcin remota.

28

UNODC - MINJUSTICIA

INTEGRACIN DE INFORMACIN
Hace referencia a la estandarizacin y consolidacin
de la informacin primaria (deteccin) y secundaria
recolectada, relativa al fenmeno de explotacin mineral
en la base de datos del SIMCI. Los datos consolidados
permiten el acceso a informacin estructurada de tipo
multidisciplinario, recolectada por el SIMCI durante ms
de 10 aos en el monitoreo de fenmenos de ilegalidad
en el territorio, y facilita, entre otros, la construccin del
marco de referencia espacial para las reas de evidencia
de explotacin de oro de aluvin.

distribucin y localizacin, su dinmica de expansin,


y las relaciones de asociacin con otros procesos
econmicos y sociales. Para este estudio se aborda la
dinmica espacial del fenmeno en una regin piloto,
con un anlisis de vectores de expansin como alertas
de movilidad.

FASE II: Esta fase, de carcter ms integral, se ejecutar


durante el primer semestre del 2016, e involucra la
dimensin socioeconmica para el desarrollo de anlisis
espaciales que permitan profundizar en la caracterizacin
del fenmeno, con el diseo e implementacin de
una metodologa de aproximacin que considere los
(OSUR\HFWR6,0&,KDLQWHJUDGRODLQIRUPDFLyQJHRJUiFD siguientes elementos:
en un sistema de grillas de cinco kilmetros cuadrados y
de un kilmetro cuadrado; esta cuadricula se conoce con VULNERABILIDAD DEL TERRITORIO
el nombre de marco de reas. Cada grilla tiene asociada
informacin de atributos como municipio y departamento, El establecimiento del grado de vulnerabilidad del
consejo comunitario, resguardo indgena, Parque Nacional territorio frente al fenmeno de explotacin de oro de
1DWXUDO]RQDGHUHVHUYDIRUHVWDO\FXHQFDKLGURJUiFD aluvin a cielo abierto fuera del marco de legalidad, y su
entre otros. El inters de tener los lmites administrativos relacin con otras formas de ilegalidad, se aborda por
y zonas de manejo especial se centra en la necesidad PHGLRGHXQHVWXGLRSLORWRTXHSHUPLWHODLGHQWLFDFLyQ
de agregar la informacin construida y recolectada para y caracterizacin de variables socioeconmicas y
diferentes investigaciones. Los datos de cultivos de coca, GHPRJUiFDVSUHVHQWHVHQHOWHUULWRULRDIHFWDGR\VREUH
estudios de produccin de la transformacin de hoja de las que se pueden establecer relaciones de asociacin
coca a clorhidrato de cocana, anlisis multi-temporales consistentes con dicho fenmeno. El estudio se proyecta
de coberturas, y ahora los datos de EVOA, se encuentran HQOD5HJLyQ3DFtFR
en este marco nico de referencia, el cual permite la
comparabilidad tanto temporal como espacial.
DINMICA DE LAS SUSTANCIAS QUMICAS
Este marco se ha utilizado en el anlisis y clculo de
afectacin por presencia de evidencias de explotacin La caracterizacin espacial de la dinmica del uso de
de oro de aluvin, e igualmente para establecer las las sustancias qumicas involucradas en las actividades
relaciones entre EVOA y presencia de cultivos de coca; de explotacin de oro de aluvin (mercurio metlico y
la informacin integrada ser el insumo para construir un cianuro) se llevar a cabo para todo el territorio nacional,
PRGHOR SUREDELOtVWLFR TXH SHUPLWD LGHQWLFDU ODV ]RQDV por medio del anlisis de las bases de datos relacionadas
GRQGH VH GHED UHDOL]DU WUDEDMR GH FDPSR FRQ HO Q GH con la introduccin de estas sustancias al territorio en los
caracterizar las poblaciones inmersas en la actividad de procesos de importacin, as como a travs del anlisis
explotacin de oro de aluvin. Los datos se encuentran de la informacin de uso lcito de las mismas.
disponibles en un archivo de tipo geodatabase -GDB,
nativo del software ArcGis de ESRI, con un sistema de SERVICIOS GEOGRFICOS
coordenadas planas, transversa de Mercator con origen
en Bogot13.
/DV FDUDFWHUtVWLFDV GH ORV 6HUYLFLRV :HE *HRJUiFRV
hacen interoperable la informacin con desarrollos que
MONITOREO GEOGRFICO
estn registrando entidades gubernamentales y privadas,
\SHUPLWHQLQWHJUDUODLQIRUPDFLyQJHRJUiFDGHPDQHUD
/D FDUDFWHUL]DFLyQ JHRJUiFD GH OD H[SORWDFLyQ GH que los anlisis y estudios tengan una visin integral de
oro de aluvin no slo involucra su localizacin y la situacin en el territorio. Los cuatro escenarios posibles
dimensionamiento, sino que requiere de una mirada de acceso a la informacin son: i) pblico en general; ii)
integral a los diversos fenmenos presentes en el GHVDUUROODGRUHVGHDSOLFDFLRQHVJHRJUiFDVLLL XVXDULRV
territorio, de manera que permitan adquirir el conocimiento especializados; iv) entidades productoras de informacin
y la comprensin de las variaciones asociadas a su TXHSURSRUFLRQDQ\RDFFHGHQDUHFXUVRVJHRJUiFRV(O
(OSUR\HFWR6,0&,GHQLyHVWHVLVWHPDGHVGHHO/DHVFDODHQODFXDOVHREWLHQHQ proyecto contempla este servicio durante la segunda fase
los datos permite utilizar el origen Bogot para todo el territorio colombiano, los errores por
de ejecucin.
asumir este nico origen no son representativos para la escala.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

29

30

UNODC - MINJUSTICIA

LNEA BASE: EVIDENCIAS DE


EXPLOTACIN DE ORO DE ALUVIN
CON USO DE MAQUINARIA EN
TIERRA EN EL TERRITORIO
COLOMBIANO
Los resultados de la deteccin de EVOA a cielo abierto
con uso de maquinaria en tierra, sealan que para el ao
2014 Colombia tena 78.939 hectreas con evidencias
fsicas de explotacin de oro de aluvin, distribuidas
en 17 de los 32 departamentos del pas. El 24% de los
GHSDUWDPHQWRVDIHFWDGRVVHXELFDHQHOOLWRUDO3DFtFR
El 79% de las EVOA en el pas se encuentra en dos
departamentos, Antioquia (33%) y Choc (46%).
DEPARTAMENTO
Choc
Antioquia
Bolvar
Crdoba
Nario
Valle
Cauca
Otros

2014
36.185
26.323
7.361
3.544
1.676
1.570
1.408
872

% del total
46
33
9
4
2
2
2
1

Aunque el mayor porcentaje de EVOA se encuentra en el


departamento del Choc, es Antioquia donde se registra
la mayor produccin14, tal como se puede observar
HQ HO VLJXLHQWH JUiFR  /DV GLIHUHQFLDV UHJLVWUDGDV
pueden obedecer, entre otras razones, a la incidencia
GH OD SURGXFFLyQ HQ OyQ TXH HVWi FRQVLGHUDGD HQ ODV
estadsticas de produccin pero no produce evidencias de
actividad registrables por teledeteccin), a las diferencias
en productividad, y a que el oro no siempre se registra
en la zona de explotacin, o simplemente no se registra,
como fue posible comprobar por medio de informacin
obtenida en terreno.
(O VLJXLHQWH JUiFR PXHVWUD HO iUHD GH (92$
obtenida en el presente estudio, en relacin con el
registro de produccin de oro por departamento15

Tabla 1. EVOA con uso de maquinaria en tierra (hectreas) por


departamento.

*UiFR(92$\SURGXFFLyQGHRUR )XHQWH830( 
14. El Reporte de produccin nacional se obtiene en funcin del recaudo de regalas
VXVWHQWDGR HQ HO )RUPDWR %iVLFR 0LQHUR TXH HV XQD KHUUDPLHQWD GH VFDOL]DFLyQ GHO
gobierno, donde el titular indica, entre otros, los volmenes producidos semestral y
anualmente. Sin embargo, esta informacin no es totalmente consolidada por parte de
la autoridad minera [89].
6HWRPDODIXHQWHRFLDOVXPLQLVWUDGDSRUOD8QLGDGGH3ODQHDFLyQ0LQHUR(QHUJpWLFD
(UPME) que es una Unidad Administrativa Especial del orden nacional, de carcter
tcnico, adscrita al Ministerio de Minas y Energa, entre cuyas funciones se encuentra
la de desarrollar anlisis econmicos de las principales variables sectoriales y evaluar el
comportamiento e incidencia del sector minero energtico en la economa del pas. [86].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

31

En el caso de Huila, Caldas, Tolima, Risaralda,


Santander y Quindo, la informacin disponible registra
una predominancia de actividades de explotacin
DVRFLDGDVDOyQ>@ORTXHH[SOLFDUtDXQDSURGXFFLyQ
relativamente alta, a pesar de unas evidencias bajas;
por el contrario, en Cauca y Antioquia slo el 4 % y 14
% respectivamente de los encuestados por el censo
PLQHURHQUHSRUWDURQH[SORWDFLRQHVHQOyQSRUOR
cual se esperara una mayor relacin entre las EVOA y
la produccin. Desafortunadamente no existen reportes
sobre productividad para soportar la hiptesis de que
en esos departamentos se obtiene ms oro con menos
afectacin. Mineros entrevistados por UNODC en Cauca,
Choc y Guaina, reportaron a Medelln como el destino
QDO GHO RUR TXH H[WUDtDQ (V LPSRUWDQWH DQRWDU TXH HO
censo minero no incluy al departamento de Nario,
por lo cual no existe informacin disponible sobre este
aspecto.

32

UNODC - MINJUSTICIA

8124'W

1324'N

1236'N
1324'N

1236'N

8142'W

8121'W

75W

70W

1230'N

1230'N

1321'N

1321'N

Colombia

8124'W

Mar Caribe

8121'W

Sur Amrica

La Guajira

8142'W

Magdalena

10N

Atlntico

a
Ro M

10N

Cesar

d al

PA
N

ena

Sucre

VENEZUELA

Crdoba

Bolvar

Norte de
Santander

Antioquia
o
trat
Ro A

Ro Ca uca

Santander

Arauca
R o Meta

Boyac

Casanare
eta

Choc

Ro Orin
o

co

Caldas
Risaralda

Ocano
Pacfico

5N

5N

oM

Vichada

Cundinamarca

Quindo

ichada
R o V

Tolima
re
avia
Gu
Ro

Valle

na

Meta

le

Ma
g da

a
nrid
oI
R

Ro

Cauca

Guaina

Huila
Guaviare
Nario

Vaups

Caquet

Putumayo

Ro
Ca

R o

utu
ma

quet

yo

ECUADOR
0

150

Amazonas

300
km

BRASIL

Coordenadas geogrficas WGS 84

PER
o

Am
a

zo
na
s

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Densidad de Evidencia
de Explotacin

(ha/km)

0.1 - 1.0
1.1 - 5.0
> 5.0

Lmites internacionales
Lmites departamentales

Mapa 1. Densidad de EVOA en Colombia, 2014.

La afectacin por EVOA abarca 147 municipios (13%)


del total de 1.127 en el pas. Antioquia tiene afectados el
37% de los municipios, y se ubica en el primer lugar en
cantidad de municipios afectados con 46 municipios. Las
EVOA se concentran en 10 municipios: Nech, Zaragoza,
Cceres, El Bagre, Taraz, Caucasia, Segovia, Remedios,
Anor y Amalf, los cuales aportan el 92% de las EVOA del
departamento y el 31% del dato nacional.

Conceptos:
Municipio afectado: Municipio que presenta EVOA
con uso de maquinaria en tierra mediante percepcin
remota.
Evidencia:
Evidencia
detectada
mediante
interpretacin y procesamiento digital de imgenes
satelitales y que se caracteriza por alteracin del
paisaje en terrenos aluviales.

Foto 1. EVOA en Cauca (izquierda) y Bolvar (derecha).

Por otra parte, 27 municipios del Choc (90%) reportan


evidencias del fenmeno, y solo los municipios de
Acand, Baha Solano y Jurad no presentan afectacin.
Las EVOA se concentran en 11 municipios: Nvita,
Istmina, Condoto, Cantn de San pablo, Quibd, Unin
Panamericana, Medio Atrato, Tad, Ro Quito, Medio San
Juan y Certegu. En este departamento se encuentra el
18% del total de municipios afectados en el pas.

El fenmeno est fuertemente concentrado. El siguiente


JUiFRPXHVWUDORVPXQLFLSLRVFRQPD\RULQFLGHQFLD
de EVOA con uso de maquinaria en tierra. El 55% se
concentra en 10 municipios de los departamentos de
Antioquia, Choc, Crdoba y Bolvar.

*UiFR/RVPXQLFLSLRVFRQPD\RUDIHFWDFLyQGH(92$FRQXVRGHPDTXLQDULDHQWLHUUD

Antioquia y Choc aportan 4 municipios cada uno a esta


lista, con el 22% y el 24% del rea nacional afectada,
respectivamente. Nech, en el departamento de Antioquia,
es el municipio que presenta la mayor rea reportada
(6.232 ha), que equivale al 8% del total nacional, seguido

34

UNODC - MINJUSTICIA

de Nvita, en Choc, con 5.175 ha. El departamento


de Bolvar se integra a esta lista con el municipio de
Montecristo, y el departamento de Crdoba con Ayapel.
Todos estos municipios, excepto Ayapel (Crdoba), estn
afectados tambin por la presencia de cultivos de coca.

Foto 2. Explotacin de oro de aluvin en Antioquia.

TERRITORIO AFECTADO POR


EVIDENCIAS DE EXPLOTACIN
DE ORO DE ALUVIN Y
CULTIVOS DE COCA

para la captacin de recursos que carece de un control


efectivo del Estado y que, en la actualidad, no es objeto
GHXQDUHSUHVLyQWDQVLJQLFDWLYDFRPRVtORVRQ
RWUDVDFWLYLGDGHVFRPRHOQDUFRWUiFR>@
En consecuencia, las mismas condiciones de
vulnerabilidad que han caracterizan al territorio
afectado por cultivos ilcitos, han facilitado la aparicin
y crecimiento de esta nueva forma de ilegalidad en los
mismos territorios, lo que evidencia de manera ms
marcada las condiciones de aislamiento de la oferta
estatal, la precariedad institucional, las bajas condiciones
de accesibilidad, y las fallas de gobernabilidad.

SIMCI viene realizando monitoreo del territorio por ms


de 10 aos en reas afectadas por cultivos de coca.
Una de las conclusiones es que el rea sembrada se
ha reducido en algunas regiones, pero los territorios
no logran liberarse de fenmenos de ilegalidad [11]. En
estos territorios el fenmeno de la explotacin de oro de
aluvin se viene manifestando cada vez con ms fuerza,
\ ORV VREUHYXHORV GH UHFRQRFLPLHQWR \ YHULFDFLyQ KDQ
permitido comprobar una relacin espacial entre estos El anlisis espacial de la asociacin entre produccin
de cultivos ilcitos y EVOA se realiza sobre un marco de
fenmenos.
rea con grillas de 5 km2. El 38% del territorio afectado
De acuerdo con el Informe Preventivo de la Procuradura actualmente por EVOA, coincide con el territorio afectado
sobre minera ilegal, esta se suele asociar al patrocinio SRU FXOWLYRV GH FRFD (O VLJXLHQWH JUiFR UHSUHVHQWD HO
de otras actividades ilcitas como son, por ejemplo, la territorio (porcentaje de grillas de 5km) donde se observan
QDQFLDFLyQ GHOWHUURULVPR\GHODVEDQGDVFULPLQDOHV las EVOA y el porcentaje del mismo en el que tambin
Ello obedece a que se trata de una importante fuente hay cultivos de coca.

*UiFR7HUULWRULRDIHFWDGRSRU(92$\UHODFLyQFRQFXOWLYRVGHFRFD

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

35

8124'W

1324'N

1236'N
1324'N

1236'N

8142'W

8121'W

75W

70W

1230'N

1230'N

1321'N

1321'N

Colombia

8124'W

Mar Caribe

8121'W

Sur Amrica

La Guajira

8142'W

Magdalena

10N

Atlntico

ag
Ro M

10N

Cesar

da

PA
NA

len a

Sucre

VENEZUELA

trato
Ro A

Ro Ca uca

Crdoba

Norte de
Santander

Bolvar

Antioquia

Arauca

Santander

R o Meta

Ro Orin
o

co

Boyac

Casanare
eta

Choc
Caldas
Risaralda

Ocano
Pacfico

5N

5N

oM

Vichada

Cundinamarca

Quindo

ichada
Ro V

Tolima
Valle

Ro

av
Gu

iare

na

Meta

le

Ma
gda
Ro

Cauca

Guaina

a
nrid
oI
R

Huila
Guaviare
Nario

Vaups
Caquet

Putumayo

R o

Caq u
et

R o

utu
m

a yo

ECUADOR

Amazonas

BRASIL
PER
0

150

300
km
R

Coordenadas geogrficas WGS 84

Ama
z

75W

on
as
70W

Fuentes: Gobierno de Colombia - Sistema de monitoreo apoyado por UNODC


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Territorios afectados por evidencia


de explotacin de oro de aluvin
y cultivos de coca 2014

Solo EVOA
Solo cultivos de coca
Cultivos de coca y EVOA

Lmites internacionales
Lmites departamentales
Nota: La representacin de la evidencia
de explotacin y cultivos de coca
se realiza en grillas de 5km x 5km

Mapa 2. Territorio afectado por EVOA y cultivos de coca, 2014.

En los departamentos de Putumayo, Nario y Caquet,


ms del 80% del territorio afectado con EVOA coincide
con territorio afectado con cultivos de coca; estos
departamentos registraron tambin aumentos del rea
sembrada con coca durante el periodo 2013-2014. La
mayor rea en territorios afectados por ambos fenmenos
se localiza en los municipios de Barbacoas, Magui
y El Charco, en el departamento de Nario, y Puerto
Guzmn y Puerto Ass en el Putumayo. De los municipios
afectados con EVOA en estos departamentos, tres estn
incluidos en la lista de los 10 municipios con mayor rea
cultivada con cultivos de coca: Tumaco (Nario) ocupa el
primer lugar, Puerto Ass (Putumayo) el segundo, y Orito
(Putumayo) ingres a la lista durante el ltimo periodo y
ocupa el sptimo lugar. [11].
En Cauca el 70% de EVOA se presenta en territorios
afectados por cultivos de coca, concentrados en Timbiqu
y en Lpez donde se encuentran los dos fenmenos,
el primero de ellos mantuvo su rea sembrada de coca
estable durante el periodo 2013-2014 mientras que el
segundo la aument en el mismo periodo.
En los departamentos de Choc, Valle y Antioquia, entre
el 30 y el 35% de las EVOA se encuentran en territorios
afectados por cultivos de coca. En el Valle del Cauca,
de acuerdo con el censo de cultivos 2014, las EVOA
se localizan en reas con tendencia a reduccin o a la
estabilidad de la produccin cocalera, mientras que en
Choc (municipios de Nvita, Condoto, Medio San Juan
y Cantn de San Pablo), Antioquia (Cceres y Taraz)
y Bolvar (Montecristo, Santa Rosa del Sur y Simit)
las EVOA se localizaron en zonas que presentaron
incremento en el rea sembrada. En municipios como
el Bagre y Nech, en Antioquia, las EVOA se ubican en
zonas donde se registra una tendencia a la reduccin de
la produccin cocalera.
Llama la atencin que los departamentos de Antioquia,
Cauca, Choc, Nario y Putumayo reportan evidencias
de actividad de explotacin de oro en veredas focalizadas
para desarrollo alternativo durante el 2014.

los Parques Nacionales Naturales16, Los Resguardos


Indgenas17 y los Consejos comunitarios18.
El 47% de las EVOA se encuentra en alguna de estas
categoras. En particular los Consejos comunitarios estn
fuertemente afectados: el 44% (70 de 158 consejos) tiene
EVOA, y el 46% del total del rea con EVOA se encuentra
en esta categora. Aunque menos del 1% de la deteccin
para el ao 2014 se encuentra en Zonas de Resguardos
Indgenas, llama la atencin que el 93% afectan a
comunidades Ember Katio.

Parques Nacionales Naturales


Segn el atlas de justicia ambiental 2014 (Environmental
Justice Organizations, Liabilities and Trade), Colombia
HV HO SDtV TXH PiV FRQLFWRV DPELHQWDOHV HQIUHQWD HQ
el continente, [13]. La destruccin de ecosistemas ha
aumentado en los ltimos aos de forma alarmante a
causa de diversos frentes de presin, cultivos ilcitos,
presencia de grupos armados, pesca y ganadera
extensiva, avance de frontera agrcola y, durante los
ltimos aos, minera ilegal.
Las EVOA detectadas en zonas de Parques Nacionales
Naturales aportan informacin de alertas por presencia
de la actividad y por vulnerabilidad al fenmeno, que
permitirn a las instituciones competentes mejorar la
caracterizacin que se tiene del fenmeno en estas reas
de alta riqueza en biodiversidad y oferta de servicios
ambientales. De los 59 Parques Nacionales Naturales,
en 2014 en 5 de ellos se detectaron EVOA con uso
de maquinaria en tierra, totalizando 47 hectreas que
representan el 0.06% del rea total nacional detectada.
La presencia de EVOA en Parques Nacionales Naturales,
independientemente de su magnitud, genera alertas por
los efectos que se ocasionan sobre los ecosistemas19. El
siguiente cuadro presenta los parques con EVOA en tres
rangos de proximidad: a) al interior de los parques, (b)
a menos de 10 km de sus lmites, y (c) a una distancia
entre 10 km y 20 km de los lmites.

ZONAS DE MANEJO ESPECIAL


Uno de los nfasis de la poltica pblica promovida por
el Gobierno de Colombia es el reconocimiento de las
particularidades del territorio y la necesidad de que las
polticas pblicas incorporen estas particularidades. La
observacin de las zonas de manejo especial contribuye
a la focalizacin de esfuerzos, pero sobre todo al diseo
GH HVWUDWHJLDV HVSHFtFDV SDUD HQIUHQWDU SUREOHPDV HQ
estos territorios. En el presente documento se presentan
datos sobre EVOA para 3 zonas de manejo especial:

/DFREHUWXUDJHRJUiFDGH3DUTXHV1DFLRQDOHV1DWXUDOHVFRUUHVSRQGHDLQIRUPDFLyQ
RFLDOGH8$(6311DxRFXDQGRVHUHDOL]yHO~OWLPRDMXVWHHQGHOLPLWDFLyQ
  /D FREHUWXUD JHRJUiFD GH 5HVJXDUGRV ,QGtJHQDV FRUUHVSRQGH D LQIRUPDFLyQ
reportada por el IGAC ao 2009.
  /D FREHUWXUD JHRJUiFD GH &RQVHMRV FRPXQLWDULRV FRUUHVSRQGH D OD GHOLPLWDFLyQ
JHRJUiFDUHSRUWDGDSRUHO,*$&
19. Se propone el concepto de afectacin en parques por el impacto ambiental que
genera en estos territorios protegidos. Por otra parte, el estudio plantea una metodologa
para la posible contaminacin por sedimentos en las poblaciones aguas abajo, pero no
incluye aun el tema de contaminacin por mercurio, pues el tema de sustancias qumicas
utilizadas en el proceso de transformacin forma parte de la segunda fase del proyecto.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

37

Parque Nacional Natural

EVOA en PNN

EVOA en ZI_10Km

EVOA en ZI_20Km

Puinawai

25

Paramillo

14

73

377

Los Katios

84

Munchique

11

134

Selva de Florencia

93

15

10

884

91

64

78

Alto Fragua - Indiwasi

Yaigoj Apaporis

Las Orqudeas
Los Farallones de Cali
Serrana de los Churumbelos

Utra

17

Complejo Volcnico Doa Juana Cascabel*

Plantas Medicinales Orito Ingi Ande**

32

Tatama

23

Total

47
*Parque con cubrimiento de nubes y sombras entre 30% y 40%
** Parque con cubrimiento de nubes y sombras de 80%

Tabla 2. EVOA detectada en Parques Nacionales Naturales (ha).

Aunque solo en cinco parques se encontraron


evidencias de alteracin directa del paisaje, al tomar
HQFRQVLGHUDFLyQ]RQDVGHLQXHQFLDGHORVSDUTXHVVH
revela que cinco parques adicionales se encuentran en
riesgo por presentar EVOA a menos de 10 km, y cuatro
parques ms a menos de 20 km.

38

UNODC - MINJUSTICIA

1143

874

8124'W

1324'N

1236'N
1324'N

1236'N

8142'W

8121'W

75W

70W

1321'N

1321'N

Colombia

1230'N

1230'N

La Guajira
8124'W

8121'W

Providencia

Sur Amrica

LOS FLAMENCOS

TAYRONA

Barranquilla

Mar Caribe

SIERRA NEVADA
DE SANTA MARTA

CINAGA GRANDE
DE SANTA MARTA

Cartagena

Atlntico
Cesar
ag
Ro M

10N

LOS CORALES DEL ROSARIO


Y DE SAN BERNARDO

10N

8142'W

San Andres

CORALES DE PROFUNDIDAD

da
len a

PA
NA

CATATUMBO - BARI

Sucre

VENEZUELA

ACANDI PLAYON
Y PLAYONA

Crdoba

Bolvar

LOS ESTORAQUES

LOS KATIOS

Ccuta
PARAMILLO

Santander

TAM

Arauca

Ro Ca uca

Antioquia
R o Meta

Medelln

Boyac

SELVA DE FLORENCIA

Casanare

oM

Vichada

Bogot

LOS NEVADOS

Valle

ichada
Ro V

CHINGAZA

Quindo

URAMBA BAHA MLAGA

5N

Cundinamarca

TATAMA

EL TUPARRO

5N

Risaralda Caldas

Ocano
Pacfico

co

GUANENT-ALTO RO FONCE
IGUAQUE

Choc

Puerto
Carreo
Ro Orin
o

UTRA

Arauca

EL
COCUY

SERRANA DE
LOS YARIGUES

eta

Ro

rato
At

LAS
ORQUDEAS

Tolima
SUMAPAZ

Cali

LAS HERMOSAS - GLORIA


VALENCIA DE CASTAO

G
Ro

Meta

iare
uav

LOS FARALLONES DE CALI

Guaina

NEVADO DEL HUILA

na

GORGONA

Cauca

a
nrid
oI
R

SIERRA DE
LA MACARENA

TINIGUA

Ro

Popayn

le

Ma
gda

MUNCHIQUE
SANQUIANGA

CORDILLERA DE
LOS PICACHOS

PUINAWAI

Huila
Guaviare
Nario

NUKAK

COMPLEJO VOLCANICO
DOA JUANA CASCABEL
SERRANIA DE LOS
CHURUMBELOS

Mit

Pasto

Mocoa

Vaups

PLANTAS MEDICINALES
ORITO INGI ANDE

Puerto
Ass

Caquet

Putumayo

SERRANA DE CHIRIBIQUETE

LA PAYA

Ro

R o

ECUADOR

Caqu
e

t
YAIGOJE
APAPORIS

utu
m

a yo

Amazonas
CAHUINAR

RO PUR

BRASIL
0

150

300
km

PER

Coordenadas geogrficas WGS 84

PER

AMACAYACU

Am
a

zo
na
s

Leticia
70W

75W

Fuentes: para evidencia de explotacin: Gobierno de Colombia - Sistema de monitoreo apoyado por UNODC;
para Parques Nacionales: Parques Nacionales Naturales de Colombia
Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas
Evidencia de explotacin en 2014
PNN con evidencia de explotacin
PNN en cercanias (0 a 20 km) de evidencia de explotacin
PNN sin evidencia de explotacin

Grilla 1k con evidencia de explotacin en PNN


Grilla 1k con evidencia de explotacin de 0 a 10 km de PNN
Grilla 1k con evidencia de explotacin de 10 a 20 km de PNN
Area de influencia de PNN a 10 km

Mapa 3. Parques Nacionales Naturales y EVOA, 2014.

Area de influencia de PNN a 20 km


Lmites internacionales
Lmites departamentales

La Reserva Nacional Natural Puinawai registra la mayor


afectacin, con 25 hectreas que representa el 53% del
total detectado en el SNPNN; las EVOA se concentran
principalmente en la Serrana Naqun. Sin embargo, el
Parque Nacional Natural Farallones de Cali se puede
considerar en alto riesgo debido a que existen fuertes
evidencias de explotacin de oro a menos de 10 km de
sus lmites. Esta actividad se desarrolla principalmente
en el ro Anchicay, que est totalmente incluido en el
parque, y en los ros Mallorqun, Cajambre, Guapi y Juan
Lpez, que nacen al interior del parque.
Parque Nacional Natural
Las Orqudeas
Selva de Florencia
Munchique
Utra

Los Farallones de Cali


Serrana de los Churumbelos
Serrana de los Yarigues

(OULHVJRDVRFLDGRDODSUHVHQFLDGH(92$VHUHHUHQR
solo a la proximidad respecto al parque sino al hecho de
TXHODHYLGHQFLDVHHQFXHQWUDHQFXHQFDVKLGURJUiFDV20
incluidas parcialmente en el mismo. De esta manera,
las EVOA en reas cercanas a los PNN Farallones de
Cali, Serrana de los Churumbelos y Serrana de los
Yarigues, presentan mayor riesgo de afectacin por
estar conectados directamente hacia el interior de los
SDUTXHV D WUDYpV GH DOJXQRV UtRV R VXV DXHQWHV WDO
como se presenta en el siguiente cuadro.21

&RQHFWLYLGDGXYLDO

NOMSZH21 Subcuenca

5tR&DUDXWDDXHQWHGHO5tR&KDTXHQRGi

Ro Murr

5tR6DPDQi\DXHQWHVGHO5tR'XOFH

Ro Saman

5tR6DQ-XDQGHO0LFD\\DXHQWHV5tR
Huesito

San Juan del Micay

Ro Bojay

Ro Bojay

Ro Boroboro

3DFtFR\IURQWHUD3DFtFR

Ro Anchicay

Anchicay

Ro Mallorqun, Ro Cajambre, Ro Guapi,


Quebrada Juan Lpez

Ro Timba y directos al
3DFtFR

5tR&DTXHWi\DXHQWHV4XHEUDGD
Pacayaco y Santa Luca

Alto Caquet

$XHQWHVGHO5tR7DPDQi

Ro Taman y otros directos


San Juan

7DEOD&RQHFWLYLGDGXYLDOHQWUH(92$GHWHFWDGDV\311

20. Se toma como referencia la informacin 2013 del Instituto de Hidrologa, Meteorologa
y Estudios Ambientales de Colombia, IDEAM.
1206=+1RPEUH6XE]RQD+tGURJUiFD,'($0

40

UNODC - MINJUSTICIA

Ro Dagua
77W

Punta Soldado

Cisneros

7630'W

San Antonio
De Anchicaya Zabaletas

Ocano
Pacfico

Guabas
Mar Caribe

Lobo
Guerrero

Gine

Venezuela
Vijes

San Antonio El Cerrito

Pavas
Dagua

Ocano
Pacfico
San Marcos

La Cumbre
Lomitas

Mulalo
Santa Ines
Rozo

Bitaco

Ro
Dagua

Obando
Matapalo

Borrero Ayerbe
Dapa

El Carmen

Yumbo Ecuador

Directos
alEl Ro
Pedregal
San Bernardo
Dolores
CaucaLa(mi)

El Queremal

330'N

El Pla
Amai
La B
Manuelita

Ro Timba y
otros directos
al Pacifico

Per
Palmaseca

Gu
Palmira
Brasil
La Orlidia B
La Herradura

330'N

Ro
Anchicay

R
o

La Bu
GuanabanalRo Fraile y
Bolodirectos
San Isidro
otros

Monte Bello
Juanchito

Bolo Alizal

al Cauca

Cali
Santiago De Cali

Valle

Prad
La G

El Carmelo

Candelaria
San Joaquin
La Gorgona
Buchitolo El Arenal La Regina
San Antonio
El Tiple

LOS FARALLONES DE CALI


Veneral

Cascajal

Ro
Pance

San Antonio
De Yurumagu

Hormiguero
Tarragona
Chococito
Ortigal Santa A

Jamundi
Potrerito

Puerto Tejada
Yarumales

La Primavera

Ro
Claro

Ro Naya

Villa Rica

Villa Paz
Quinamayo
Robles
Timba
La Balsa

Ro
Timba

Cor

Guachene
Huasano

Ro Palo
El Palo
Caloto

3N

3N

Buenos Aires

goza

Ro
Suarez

Quinamayo
y otros directos
al Cauca

San Isidro

Playa
Grande
San Antonio De Chuare
Lopez
Micay
Santa Cruz De Siguin

Toribio
San Francisco

Mondomo

Cauca

Ro
Saija

Ro
Ovejas

Rio Salado
y otros
directos Cauca

Caldono
Jambalo

Ro San
Juan del
Micay

Morales

MUNCHIQUE
Quichaya

Pitayo

Tunia

El Carmelo
La
Pedregosa

Piendamo
Cajibio

Usenda
Silvia

El Rosario

La Capilla

Ro Piendamo

La Venta

Uribe

Ro
Purace
El Plateado

Paniquita
Totoro

Gabriel L

Popayan

El Tambo
Piagua

Ro
Patia
Alto

Sinai

77W

Poblazon
Purace
Timbio

Coconuco

Alto Ro
7630'W
Cauca

PURAC

Drenajes

Evidencia de explotacin en PNN


Evidencia de explotacin de 0 a 10 km de PNN
Evidencia de explotacin de 10 a 20 km de PNN

Lmite de Subcuenca Hidrogrfica

Area de influencia de PNN a 10 km

Lmites internacionales
Lmites departamentales

Area de influencia de PNN a 20 km

Parques Nacionales Naturales


Centros poblados

0DSD(92$GHWHFWDGDVHQUHODFLyQFRQEXIIHUVGHLQXHQFLDHQORV3DUTXHV)DUDOORQHVGH&DOL\0XQFKLTXH

230'N

230'N

Calibio

Mar Caribe

San Vicente

Sotara
Paispamba

Rosas

PURAC

El Socorro

La Gran V
Gigante 7530'
La Gran Via
El Porvenir

Alto Ro
Cauca

Piedrasentada
Ocano

Pacfico
El Bordo

Moscopan

Ros Directos
al Magdalena (mi)

Zuluaga

Plazuela

Belen
La Sierra

Ros dire
El Ja
Magdale
Silva
(md)

Rioloro

Huila

Villa Losada
Gallego

Santa
Leticia

Venezuela

Parraga

San Andres

La Plata

Ro Pez
76W

Ma
g da
lena

Ro
atia
Alto

Ro
Purace

Purace

7630'W
Coconuco
Rio Salado
y otros
directos Cauca

Timbio

Ro

Poblazon

Garzon
La Canada
La Jagua

La Argentina

Tarqui
Rio Blanco
Quituro

2N

Barbillas
La Cabana

La Vega

Ecuador

Lerma

Altamira
San Antonio Del Pescado

El Vergel
Guachicono

Brasil

Pancitara

Guadalupe

Miraflores

Suaza
Timana

La Laguna
Guacamayo

El Palmar

Per

Llacuanas
El Tablon
Almaguer
Caquiona

Naranjal
El Viso

Elias
Saladoblanco

2N

Santa Rita
El Palmar
Santa Barbara
Sucre
chicono

San Jose De Isnos


Isnos

Puerto Quinchana
Pradera
Villa Fatima

Valencia

Resina

Ro Timan y otros
Gallardo
directos al Magdalena

San
Agustin

La Herradura

Guayabal

Pitalito

El Morro
Bolivar

San Sebastian
Santiago

El Carmen

Acevedo

El Rosal

n Lorenzo

Ro
Suaza

La Espera

Bruselas
Los Milagros
San Juan

o
icono

Cauca

Alto
Magdalena

Santa Rosa

Santana Las Her

Palestina

ablo
San Antonio De A

a Briceno COMPLEJO VOLCANICO


ayo
San Gerardo

DOA JUANA CASCABEL

Florencia

ruz

sas

130'N

do

CUEVA DE LOS
GUACHAROS

Alto
Caqueta

Ro
Orteguaza
Morelia

Los Aletones

130'N

mbina

Santu

Belen De Los Andaquies


ALTO FRAGUA - INDIWASI
Caquet
San Jose De
La Fragua

nanb

San Jose Del Fragua

Albania

El Portal
La Mono
Milan

Puerto Torres

SERRANIA DE LOS
CHURUMBELOS

Sibundoy

Colon

Yurayaco
Versalles

San Francisco

Valparaiso
Dorado

Fraguita
Mocoa

tiago
an Andres

Ro
Pescado

La R

Sabaleta

El Pepino

Santiago De La Selva
San Roque Curillo

Piamonte
Puerto Limon

1N

Villagarzon

KilMetro 18 Playa Rica

Curillo

El Juano
Santa Lucia Puerto Guzman
La Castellana

Ro
Caqueta
Medio

El Cedro
Puerto Rosario

1N

an Pedro

Kilometro 30

Jose Maria

Galilea

Solita
El Gallinazo

Alto Ro
Putumayo

Villa Flor

Putumayo

ITO INGI ANDE

Puerto Caicedo

Orito

Ro
Mecaya

El Cedral
San Pedro
Santana

030'N

030'N

Ro
Putumayo
Medio
Puerto Asis

El Placer

o San_Miguel
Valle Del
uguameuez

7630'W

Parques Nacionales Naturales


Centros poblados
Drenajes

Puerto Vega

76W

Ro
Sencella

Evidencia de explotacin en PNN


Evidencia de explotacin de 0 a 10 km de PNN
Evidencia de explotacin de 10 a 20 km de PNN

Lmite de Subcuenca Hidrogrfica

Area de influencia de PNN a 10 km

Lmites internacionales
Lmites departamentales

Area de influencia de PNN a 20 km

0DSD(92$GHWHFWDGDVHQUHODFLyQFRQEXIIHUVGHLQXHQFLDHQHO3DUTXH1DFLRQDO1DWXUDO6HUUDQtDGHORV&KXUXPEHORV

LA 7530'
PAYA

en Choc son los ms afectados, con 499 hectreas


(62%) distribuidas en 27 resguardos. El segundo lugar
El 7% del total de resguardos indgenas en el pas est en afectacin corresponde al departamento de Antioquia,
DIHFWDGR SRU (92$ VH LGHQWLFDURQ HQ HVWRV WHUULWRULRV con 156 ha (19%) distribuidas en 13 resguardos, que
803 hectreas de EVOA para el 2014. Los resguardos representan el 20% del total en el departamento.
Resguardos indgenas

*UiFR/RV5HVJXDUGRVFRQPD\RUDIHFWDFLyQGH(92$FRQXVRGHPDTXLQDULDHQWLHUUD

Los 10 resguardos ms afectados renen el 70% (565


ha) de EVOA detectadas, y estn ubicados en los
departamentos de Choc, Antioquia, Cauca y Guaina. 7
de los 10 resguardos en esta lista se ubican en Choc y
representan el 48% del total detectado en resguardos en
todo el pas. El 89% de estos pertenecen a etnias Ember
Katios. Anexo 2

Consejos comunitarios
Las EVOA detectadas en zonas de Consejos comunitarios
reportan 36.381 ha para el ao 2014; esta cifra representa
el 46% del total detectado en todo el territorio nacional.
Este dato debe tomarse como una alerta nacional por
la afectacin de la biodiversidad ambiental y cultural
presente en estas zonas.

*UiFR3DUWLFLSDFLyQSRUFHQWXDOGH&RQVHMRVSRUGHSDUWDPHQWR

Choc se posiciona nuevamente en primer lugar en


afectacin, y concentra el 90% del rea de EVOA
detectadas en estas zonas de manejo especial. De los 67
consejos del departamento, 24 (36% de los consejos del
departamento) presentan evidencias del fenmeno.

Foto 3. Explotacin de oro de aluvin en Choc.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

43

El 88% del territorio afectado en estos territorios se


focaliza en 10 consejos comunitarios ubicados en el
departamento del Choc. Es importante resaltar que
Choc representa el 46% de deteccin de EVOA en
Consejo Comunitario

todo el territorio nacional. El 42% del dato nacional de


EVOA fue detectado en Consejos comunitarios de este
departamento y solo el 4% fuera de ellos.

EVOA (ha)

Mayor del Medio Atrato Acia

5.074

Istmina y Parte del Medio San Juan

4.932

Mayor del Municipio Condoto e Ir

4.744

Mayor del Cantn San Pablo ACISANP

4.051

Mayor de Unin Panamericana

3.453

Acadesn

3.440

Mayor de Nvita

3.152

Mayor del Alto San Juan ASOCASAN

1.313

Crtegui

985

Paimad

757

Total

31.900

Tabla 4. Los 10 Consejos comunitarios de comunidades afrodescendientes con mayor rea de EVOA en el territorio nacional.

En Choc, el acceso y desplazamiento por el territorio PRDIDA DE COBERTURAS


presentan graves limitaciones; ms de la mitad de los
municipios no se encuentran conectados por red vial, y DE ALTO VALOR AMBIENTAL
DXQTXHODUHGXYLDOGHOGHSDUWDPHQWRHVDPSOLD\SHUPLWH POR ACTIVIDADES DE
la comunicacin al interior de las cuencas, presenta EXPLOTACIN DE ORO DE
restricciones de calado para las embarcaciones, por lo
que una parte importante del territorio puede conectarse ALUVIN
solo por medio de barcas de baja capacidad. [14]. Este
factor limita el acceso de actores de desarrollo y control Uno de los impactos de la explotacin mineral en terrenos
al territorio, facilita el establecimiento de fenmenos de aluviales es la perdida de cobertura boscosa, puesto que
para su explotacin se requiere de la remocin de grandes
ilegalidad y aumenta las condiciones de vulnerabilidad.
reas de tierra [15]. El documento de preparacin para
22
De acuerdo con entrevistas realizadas por el SIMCI REDD+ cita la minera como uno de los motores de
GXUDQWHHODxRODFXHQFDKLGURJUiFDHVHOHOHPHQWR deforestacin, que de acuerdo con estudios realizados
territorial primario para la realizacin de actividades de es uno de los temas ms preocupantes en relacin con
H[SORWDFLyQGHRURGHDOXYLyQHQHOSDFtFR/RVUtRVREUDQ la deforestacin en el pas con efectos nocivos para el
como ejes de conectividad entre zonas de explotacin y PHGLRDPELHQWHHVSHFLDOPHQWHHQHO3DFtFR$PD]RQtD
sitios de abastecimiento y se constituyen en ncleo de y Magdalena Medio [16]. Por otra parte, el informe
Monitoreo de Bosques y Carbono
avance del fenmeno. En este sentido, la Cuenca debe 2014 del Sistema de 23
y el Ministerio de Ambiente y
(SMBYC)
del
IDEAM
observarse como territorio base para comprender la
Desarrollo Sostenible (MADS), seala a la minera ilegal
dinmica del fenmeno en regin.
como uno de los factores de deforestacin con mayor
El 54% de las EVOA en Consejos comunitarios en Choc
se focalizan en dos subcuencas: Ro Quito y Ro Taman
- otros directos San Juan, que representan el 22% del
total detectado en todo el territorio nacional e integran los
municipios de Certegu, Istmina, Medio San Juan, Ro Ir,
Tad, Unin Panamericana, Condoto, Nvita y San Jos
del Palmar.

44

UNODC - MINJUSTICIA

22. REDD+ (Reduccin de Emisiones por Deforestacin y Degradacin) es un mecanismo


de compensacin econmica por la conservacin del carbono que capturan los bosques
en pie. Colombia ha avanzado en su proceso como pas REDD+, dentro del marco de las
negociaciones internacionales sobre el cambio climtico. Para lograr la construccin de
la Estrategia Nacional REDD+ los gobiernos de cada pas deben desarrollar un esquema
de salvaguardas ambientales y sociales, orientado a garantizar los derechos tanto de los
actores que habitan las reas boscosas como de todos los involucrados en el proceso
(privados, inversionistas, etc.). [96].
23. Cobertura de bosque: Tierra ocupada principalmente por rboles que puede contener
arbustos, palmas, guaduas, hierbas y lianas, en la que predomina la cobertura arbrea
con una densidad mnima del dosel de 30%, una altura mnima del dosel (in situ) de 5 m
DOPRPHQWRGHVXLGHQWLFDFLyQ\XQiUHDPtQLPDGHKD6HH[FOX\HQODVFREHUWXUDV
arbreas de plantaciones forestales comerciales (conferas y/o latifoliadas), plantaciones
comerciales de Palma, y rboles sembrados para la produccin agropecuaria, y rboles
en parques urbanos [101].

SUHVHQFLD HQ HO 3DFtFR FRORPELDQR \ QRURULHQWH GHO ha se pierden en Choc, que se ubica en el corredor
departamento de Antioquia [17].
ELRJHRJUiFR XQD GH ODV  ]RQDV PHJDGLYHUVDV GHO
mundo con varios endemismos, ecosistemas estratgicos
Mucho se ha escrito sobre los efectos de la prdida de para la conservacin de la oferta hdrica, y cientos de
cobertura boscosa y sus implicaciones para el medio HVSHFLHVGHRUD\IDXQDTXHDFWXDOPHQWHHVWiQLQFOXLGDV
ambiente; entre los principales se sealan: alteracin del en los libros rojos de especies en peligro.
paisaje, erosin, fragmentacin de hbitats, prdida de
corredores naturales, alteracin de ecosistemas, prdida
de biodiversidad, y aumento de las emisiones de carbono
a la atmsfera que contribuyen al cambio climtico.
Si bien el alcance de este documento no incluye una
evaluacin de impacto ambiental, las EVOA constituyen
un insumo fundamental para aportar informacin y hacer
evaluaciones que contribuyan de manera prctica a
dimensionar el problema.
Cobertura de bosque: /D GHQLFLRQ GH OD FREHUWXUD
presentada ante la Convencin del Marco de Naciones
Unidas sobre el Cambio Climatico es la tierra ocupada
principalmente por rboles que puede contener
arbustos, palmas, guaduas, hierbas y lianas, en la
que predomina la cobertura arbrea con una densidad
mnima del dosel de 30%, una altura mnima del dosel
LQVLWX GHPDOPRPHQWRGHVXLGHQWLFDFLyQ\XQiUHD
mnima de 1,0 ha. Se excluyen las coberturas arbreas
de plantaciones forestales comerciales (conferas y/o
latifoliadas), plantaciones comerciales de Palma, y
rboles sembrados para la produccin agropecuaria, y
rboles en parques urbanos [101].

La prdida total de coberturas (bosque natural y otros tipos


de Coberturas de la Tierra como vegetacin secundaria)
de alto valor ambiental asociada a las actividades de
explotacin de oro de aluvin para 2014 fue de 24.450 ha,
es decir, la tasa mensual total de prdida de coberturas de
interes ambiental asociadas al fenmeno fue de 2.038 ha.
La prdida de cobertura de bosque asociada a las
actividades de explotacin de oro de aluvin para el ao
2014 fue de 2.681 ha, y se concentr en el departamento
del Choc con 2.300 ha, el 86% de la prdida asociada
a esta actividad; departamentos como Valle, Antioquia,
Cauca, Bolvar y Putumayo, registran menor participacin.
El panorama se oscurece un poco ms al considerar
la prdida de cobertura de vegetacin secundaria24
o en proceso de sucesin vegetal, con una prdida
de cobertura de 21.768 ha, que representan una tasa
mensual de prdida de 1.814 ha, de las cuales 1.378

*UiFR'LVWULEXFLyQSRUFHQWXDOGHSpUGLGDGHFREHUWXUDGHERVTXH
natural por actividades de explotacin de oro de aluvin con uso de
maquinaria en tierra.

(VGHHVSHFLDOUHH[LyQQDFLRQDOODWDVDGHSpUGLGDGH
bosques naturales por esta actividad para el periodo
2013-2014, que reporta 223 ha de bosques eliminados
mensualmente, y de las cuales 192 ha se localizan en el
Choc. El 55% de la prdida de coberturas de alto valor
ambiental (bosque natural y otros tipos de Coberturas
de la Tierra como vegetacin secundaria) se concentra
en jurisdiccin de los Consejos comunitarios Mayor del
Medio Atrato Acia, Mayor del municipio Condoto e Ir,
Istmina y parte del medio San Juan, Mayor del Cantn
San Pablo ACISANP, Acadesn y Mayor de Nvita.

24. Vegetacin secundaria comprende aquella cobertura vegetal originada por el


proceso de sucesin de la vegetacin natural que se presenta luego de la intervencin
o por la destruccin de la vegetacin primaria, que puede encontrarse en recuperacin
tendiendo al estado origial. Se desarrolla en zonas desmontadas para diferentes usos, en
reas agrcolas abandonadas y en zonas por donde la ocurrencia de eventos naturales
la vegetacin natural fue destruida. No se presentan elementos intencionalmente
introducidos por el hombre. [87]

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

45

*UiFR3pUGLGDGHFREHUWXUDVGHDOWRYDORUDPELHQWDODVRFLDGDD(92$

La informacin empleada para el clculo de prdida de


bosque y anlisis relacionados corresponde a los datos
reportados por el IDEAM para el ao 2014.

(OSUHVHQWHLQIRUPHXWLOL]DFRPRLQVXPRODLQIRUPDFLyQRFLDOGHPRQLWRUHRGHODVXSHUFLHGHERVTXHJHQHUDGDSRU
el Ministerio de Ambiente y Desarrollo Sostenible (MADS) a travs del Sistema de Monitoreo de Bosques y Carbono
operado por el Instituto de Hidrologa, Meteorologa y Estudios Ambientales (IDEAM), que se constituye en el referente
GHLQIRUPDFLyQRFLDOHQHVWDPDWHULDSDUDHOSDtV(VWDLQIRUPDFLyQHVFRPSDWLEOHFRQORVHVWiQGDUHVQDFLRQDOHVGH
monitoreo de Coberturas de la Tierra a travs de la adaptacin de la metodologa CORINE Land Cover para Colombia.
(QHVWHVHQWLGRODGHQLFLyQGHERVTXHXWLOL]DGDHQHVWHHVWXGLRFRUUHVSRQGHDODGHQLFLyQRFLDOGHOSDtVDQWHOD
Convencin Marco de Naciones Unidas sobre el Cambio Climtico (CMNUCC).

En consecuencia, la caracterizacin espacial para


mejorar la comprensin del fenmeno de explotacin de
/DFXHQFDKLGURJUiFDVHFRQFLEHFRPRXQLGDGGHPDQHMR oro de aluvin, debe involucrar estas unidades como
por excelencia del recurso hdrico, y en ella se produce la reas independientes con caractersticas homogneas
interrelacin e interdependencia entre los sistemas fsicos TXHSXHGHQLGHQWLFDUGLQiPLFDV\DFWRUHVHVSHFtFRV
y biticos y el sistema socio econmico. De forma anloga, El trabajo de campo con mineros en Cauca permiti
la dependencia de un sistema hdrico compartido y de LGHQWLFDUODLPSRUWDQFLDSDUWLFXODUPHQWHSDUDOD5HJLyQ
los caminos y vas de acceso, y el hecho de que deban 3DFtFR GH ODV FXHQFDV KLGURJUiFDV /RV PLQHURV
HQIUHQWDUULHVJRVVLPLODUHVFRQHUHDORVKDELWDQWHVGH mencionaron que tanto la mano de obra no especializada
una cuenca caractersticas socioeconmicas y culturales como el abastecimiento de insumos, y las autorizaciones
comunes. Adicionalmente, los cambios en el uso de los para desarrollar la actividad, se gestionan siguiendo las
recursos naturales, principalmente la tierra, acarrean cuencas; incluso la comercializacin de los productos
DJXDV DUULED GH OD FXHQFD XQD PRGLFDFLyQ GHO FLFOR sigue los cursos hdricos.
hidrolgico que tiene efectos aguas abajo en cantidad
y calidad. Por ltimo, las caractersticas fsicas del agua En este contexto, desde el punto de vista hidrolgico el pas
generan un grado extremadamente alto y en muchos HVWiFRQIRUPDGRSRUFLQFRUHDV+LGURJUiFDV &DULEH
casos imprevisible, de interrelacin e interdependencia 0DJGDOHQD&DXFD2ULQRFR$PD]RQDV\3DFtFR TXH
entre los usos y los usuarios de agua en una cuenca. D VX YH] HVWiQ GLYLGLGDV HQ  =RQDV +LGURJUiFDV \
VXEGLYLGLGDVHQ6XE]RQDV+LGURJUiFDV>@
[18] .

CUENCAS HIDROGRFICAS

46

UNODC - MINJUSTICIA

Para el ao 2014, se encontraron EVOA en cuatro de las


FLQFR UHDV +LGURJUiFDV R PDFURFXHQFDV  =RQDV
+LGURJUiFDVRFXHQFDV\6XE]RQDV+LGURJUiFDVR
subcuencas (ver tablas 5 a 8).
Como se observa en el siguiente mapa, la mayor
concentracin de reas con EVOA se encuentra en
la macrocuenca Magdalena-Cauca, especialmente
al nororiente del departamento de Antioquia y sur de
Bolvar, en los municipios de Zaragoza, El Bagre, Nech25,
Caucasia, Segovia y Montecristo y Santa Rosa del Sur,
respectivamente, Las subcuencas donde se ubican estos
municipios tienen en su mayora ms de 1000 ha en
EVOA.
Se observan dos focos de alta concentracin en la
PDFURFXHQFDGHO3DFLFR(OSULPHURHQODSDUWHQRUWHHQ
municipios de Istmina, Medio San Juan, Nvita, Condoto
y Tad, del departamento del Choc, y el segundo en la
parte sur de los municipios de Barbacoas y Magi, del
departamento de Nario, en la cuenca del Pata.
La macrocuenca del Caribe, por su parte, tiene alta
concentracin de EVOA al norte del departamento del
Choc en los municipios del Medio Atrato, Ro Quito,
Cantn de San Pablo y Unin Panamericana, de la
cuenca Atrato- Darin.

/DFXHQFD$WUDWR'DULpQSHUWHQHFHDOUHD+LGURJUiFD
del Caribe a la cual aporta 36% del rea total; tiene una
VXSHUFLH DSUR[LPDGD GH  NP \ VH HQFXHQWUD
limitada por la cordillera Occidental, la serrana del
Baud y las prominencias del istmo de San Pablo. El
ro Atrato nace en los farallones de Citar, cerro del
Plateado, sobre una cota de 3700 m, en el municipio
del Carmen de Atrato, en el departamento del Choc.
$HVWDIXHQWHYLHUWHQVXVDJXDVQXPHURVRVDXHQWHV
entre los que se destacan: Cab, Negua, Quito,
Munguid, Bet, Buey, Bebar, Bebaram, Tagach,
Murry, Arqua, Buchad, Bojay, Murind, Opogad,
Montao, Curvarad, Domingod, Truand, Salaqu, La
Larga, Cacarica y el Len.
/DFXHQFDGHO5tR1HFKtSHUWHQHFHDOUHDKLGURJUiFD
GHO0DJGDOHQD&DXFD\WLHQHXQDVXSHUFLHGH
km. El ro Nech nace en la jurisdiccin del municipio
de Yarumal y sirve de lmite entre diversos municipios
de Antioquia, como Campamento, Angostura, Anor,
Yarumal, Valdivia, Taraz, Cceres, Zaragoza, El Bagre,
Caucasia y Nech
La cuenca del Ro San Juan aporta el 24,5% (en un rea
aproximada de 15.858 km2) del rea de la macrocuenca
GHO 3DFtFR QDFH HQ ]RQD DOWD GHO 0XQLFLSLR GH
Mistrat en el Departamento de Risaralda, en el
Cerro de Caramanta, en la cordillera occidental. Sus
aguas corren en direccin sur Occidente atravesando
el departamento del Choc y desembocando en el
3DFtFRHQHO0XQLFLSLRGHO/LWRUDOGHO6DQ-XDQHQXQ
delta de unos 300 km2 denominado Siete Bocas, y
que est situado a unos 60 km al noroeste del puerto de
Buenaventura, e incluye numerosas islas rodeadas de
manglares. [103]

1HFKtHVXQDSDODEUDGHRULJHQFDWtRTXHVLJQLFD2URQDWXUDO1HVLJQLFDRUR\&Kt
QDWXUDO\HQOHQJXD\DPHVtVLJQLFD5tRGHRUR

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

47

8124'W

1324'N

1236'N
1324'N

1236'N

8142'W

8121'W

75W

70W

1230'N

1230'N

1321'N

1321'N

Colombia

8124'W

Mar Caribe

8121'W

Sur Amrica

La Guajira

8142'W

Magdalena

10N

Atlntico

a
Ro M

10N

Cesar

d al

PA
N

ena

Sucre

VENEZUELA

Crdoba

Bolvar

Norte de
Santander

Santander

Ro Ca uca

o
trat
Ro A

Antioquia
Arauca
R o Meta

Casanare
eta

Choc

Ro Orin
o

co

Boyac
Caldas
Risaralda

Ocano
Pacfico

5N

5N

oM

Vichada

Cundinamarca

Quindo

ichada
R o V

Tolima
re
avia
Gu
Ro

Valle

na

Meta

le

Ma
g da

a
nrid
oI
R

Ro

Cauca

Guaina

Huila
Guaviare
Nario

Vaups
Caquet

Putumayo

Ro
Ca

R o

utu
ma

quet

yo

ECUADOR

Amazonas

BRASIL
PER
0

150

300
km

PER
R

Coordenadas geogrficas WGS 84

Am
a

75W

zo
na
s
70W

Fuentes: Gobierno de Colombia - Sistema de monitoreo apoyado por UNODC; Para subuencas hidrogrficas: IDEAM
Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Subcuencas hidrogrficas
afectadas con evidencia de
explotacin de oro de aluvin

Evidencia explotacin en 2014


0 - 100 ha

100,1 - 1000 ha
1000,1 - 5000 ha
> 5000,1 ha

0DSD6XEFXHQFDVKLGURJUiFDV\(92$

Lmite subcuenca hidrogrfica


Lmites internacionales
Lmites departamentales

UHD+LGURJUiFD

=RQD+LGURJUiFD

6XE]RQD+LGURJUiFD

0DFURFXHQFD

&XHQFD

6XEFXHQFD

Apaporis

Bajo Ro Apaporis
Directos Ro Taraira

Caquet

Alto Caquet
Ro Caquet Medio
Ro Mecaya

Amazonas

Guaina

Bajo Rio Guaina


Ro Cuiary

Putumayo

Alto Ro Putumayo
Ro Putumayo Medio
Ro San Miguel

7DEOD=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO$PD]RQDV
UHD+LGURJUiFD

=RQD+LGURJUiFD

6XE]RQD+LGURJUiFD

(Macrocuenca)

(Cuenca)

(Subcuenca)

Atrato - Darin

Alto Atrato
Directos Atrato (md)
Directos Atrato (mi)
Ro Andgueda
Ro Bebaram y otros Directos Atrato
Ro Bojay
Ro Cacarica
Ro Murind - Directos al Atrato

Caribe

Ro Murr
Ro Quito
Ro Salaqu y otros directos Bajo Atrato
Ro Sucio
Ro Tanela y otros Directos al Caribe
Caribe- Urab

Ro Len

Alto Sin - Urr

Alto Sin - Urr

7DEOD=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO&DULEH

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

49

UHD+LGURJUiFD

=RQD+LGURJUiFD

6XE]RQD+LGURJUiFD

0DFURFXHQFD

&XHQFD

6XEFXHQFD

Alto Magdalena

Ro Pez

Bajo Magdalena- Cauca Alto San Jorge


-San Jorge
Bajo San Jorge - La Mojana
Directos Bajo Cauca - Cga La Raya
Cauca

Directos al Cauca (md)


Directos Ro Cauca (md)
Directos Ro Cauca (mi)
Ro Chinchin
Ro Fro y Otros Directos al Cauca
Ro La Vieja
Ro Palo
Ro Quinamayo y otros directos al Cauca
Ro Risaralda
Ro San Juan
Rio Tapias y otros directos al Cauca
Ro Taraza - Ro Man

Magdalena Cauca

Medio Magdalena

Brazo Morales
Directos Magdalena (mi)
Directos Magdalena Medio (mi)
Ro Carare (Minero)
Ro Cimitarra
Ro Gual
Ro Guarin
Ro Lebrija
Ro Nare
Ro Opn
Ro Saman
Ro San Bartolo y otros directos al Magdalena Medio

Nech

Alto Nech
Bajo Nech
Directos al Bajo Nech
Ro Porce

Saldaa

Medio Saldaa

Sogamoso

Ro Sogamoso

7DEOD=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO0DJGDOHQD&DXFD

50

UNODC - MINJUSTICIA

UHD+LGURJUiFD

=RQD+LGURJUiFD

6XE]RQD+LGURJUiFD

0DFURFXHQFD

&XHQFD

6XEFXHQFD

Amarales - Dagua - Directos Ro Anchicay


Ro Dagua
Ro Guapi
Ro Iscuand
Ro Naya
Ro Saija
Ro San Juan del Micay
Ro Tapaje
5tR7LPED\RWURVGLUHFWRVDO3DFLFR
Ro Timbiqu
%DXGy'LUHFWRV3DFLFR

Ro Baud
5tR'RFDPSDGy\'LUHFWRV3DFtFR

3DFLFR
3DFtFR'LUHFWRV

'LUHFWRV3DFLFR)URQWHUD3DQDPi

Pata

Ro Guachicono
Ro Pata Alto
Ro Pata Medio
Ro Telemb

San Juan

Ro Cajn
Ro Calima
Ro Capoma y otros directos al San Juan
Ro San Juan
Ro Sip
Ro Taman y otros Directos San Juan

7DEOD=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO3DFtFR
Se destaca que el 51% del total de rea con EVOA
se concentra en las subcuencas de los ros Quito
-perteneciente a la Cuenca Atrato Darin, con 12.137 ha
(15%)-, Bajo Nech (14%) y Directos al Bajo Nech (12%)
-de la Cuenca Nech con reas de 10.690 ha y 9.748 ha

respectivamente- y Ro Taman y otros directos San Juan


de la cuenca del Rio San Juan con participacin en rea
de 7.337 ha correspondiente al 9%, como se observa en
HOVLJXLHQWHJUiFR

*UiFR'LVWULEXFLyQSRUFHQWXDOHQ6XEFXHQFDVFRQ(92$

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

51

La Subcuenca del Ro Quito, de la cuenca Atrato-Darin,


se ubica a 30 kilmetros de Quibd y alberga el pueblo
ms pobre del pas. Sus tres corregimientos, Villa Conto,
San Isidro y Paimad, registran un 98% de necesidades
bsicas insatisfechas segn el DANE. La explotacin
GH RUR GH DOXYLyQ VH KD LQWHQVLFDGR HQ ORV ~OWLPRV
diez aos fragmentando el curso del ro, desviando su
cauce, y provocando inundaciones por la destruccin
de sus meandros. [20] La contaminacin del agua por
actividades de explotacin de oro de aluvin ha afectado
la produccin pisccola, debido a la alta sedimentacin
del Rio Quito; especies como el bocachico, el dentn y
la mojarra, han registrado una progresiva reduccin [20].
Las subcuencas Bajo Nech y Directos al Nech estn
categorizadas como zonas con alta amenaza por
contaminacin de mercurio, de acuerdo con el ndice
Subcuenca

de prioridad para determinar los planes de restauracin


ecolgica de los ecosistemas intervenidos, afectados y
abandonados por la explotacin mineral descrito en el
Plan Estratgico Macrocuenca Magdalena- Cauca [21], el
cual se elabor teniendo en cuenta la produccin de oro
en la subcuenca y, con ello, su potencial contaminacin
por mercurio.
El incremento de los slidos suspendidos que llegan
a estos ros por el lavado del material procedente de
las reas de explotacin mineral, ha disminuido la
disponibilidad de alimento, y las posibilidades de captura
de las especies de hbitos acuticos como el Bocachico,
Bagre tigre, Doncella, Pacora y Dorada. Para todas ellas,
se ha registrado una progresiva reduccin no slo en el
volumen de pesca, sino tambin en el tamao y peso de
captura. [22].

Produccin Oro (kg/ao)


2012

Descarga Potencial Mercurio


(kg/ao) 2012

Poblacin total Subcuenca 2013

Bajo Nech

5.623

28.113

84.340

Directos al Bajo Nech

2.113

10.566

26.890

Tabla 9. Produccin de oro, descarga potencial de mercurio y poblacin de subcuencas afectadas por EVOA en Nech (Fuente: EOT Nech,
Antioquia).

La Subcuenca del Ro Taman tiene como rea de


LQXHQFLD ORV 0XQLFLSLRV GH &RQGRWR 0HGLR 6DQ -XDQ
Nvita y San Jos del Palmar, en el Departamento del
Choc; su nacimiento se da en la zona alta del Municipio
GHO6DQ-RVpGHO3DOPDU7LHQHFRPRDXHQWHVSULQFLSDOHV
los Ros Pogod, Agua Clara, Sesego, Igar y Urabar.

RELACIN ENTRE EVOA Y


FIGURAS AUTORIZADAS POR
LA LEY PARA EXPLOTACIN
DE ORO
Antes de exponer los resultados de la relacin entre EVOA
\ODVJXUDVDXWRUL]DGDVSRUODOH\SDUDHOGHVDUUROORGH
cualquiera de los procesos de explotacin minera, es
pertinente tener un acercamiento a la dinmica del sector
minero del pas.

EL SECTOR MINERO EN LOS


LTIMOS TIEMPOS
Viceministerio de Minas y Energia
Como sealan las bases del Plan Nacional de Desarrollo
2014-2018, el sector minero energtico jugar un papel
clave en garantizar el desarrollo econmico sostenido
e inclusivo. Su tarea ser, por un lado, asegurar que la
economa tenga fuentes de energa competitivas que le
permitan crecer y generar empleo, mientras que al dar
acceso a energa y combustibles contribuir de forma

52

UNODC - MINJUSTICIA

directa en la reduccin de la pobreza. Por otro lado, el


VHFWRU JHQHUDUi LPSRUWDQWHV UHFXUVRV SDUD QDQFLDU ODV
inversiones que van a requerir la construccin de la paz,
la educacin y las polticas sociales en la lucha contra
de la desigualdad. Para lograr este objetivo sectorial
se est trabajando en una poltica minera que tenga en
FXHQWD OD FODVLFDFLyQ GH OD PLQHUtD \ TXH D WUDYpV GH
una institucionalidad minera fortalecida, se pueda tener
un sector minero competitivo, incluyente, y legtimo.
&ODVLFDFLyQGHODPLQHUtD
Segn las bases del Plan Nacional de Desarrollo 2014 GH FRQIRUPLGDG FRQ OD FODVLFDFLyQ GHO &HQVR
Minero de 2010, y segn el nmero de trabajadores
empleados, solo el 1% de las Unidades de Produccin
Minera UPM- son consideradas grandes empresas,
26% medianas y 72% pequeas. Este factor es el que nos
lleva a la necesidad de una poltica pblica diferenciada
por escala minera que tenga en cuenta las necesidades y
requerimientos de cada caso.
En el marco de lo establecido por el PND 2014-2018, la
primera tarea para la organizacin del sector minero, es
VXFODVLFDFLyQGHSHQGLHQGRGHVXHVFDODGHSURGXFFLyQ
Por esto el PND determin que existen 4 escalas de
minera: pequea, mediana, grande y de subsistencia.
Dentro de la poltica minera y la organizacin que se
viene liderando por parte del Ministerio de Minas y

Energa al sector, la formalizacin para la pequea


minera se enfoca en el cumplimiento por parte de las
Unidades de Produccin Minera (UPM) de los estndares
legales, tcnicos, ambientales, econmicos, sociales
y laborales que permiten que la pequea minera
sea una actividad econmica legal, viable, rentable,
ambientalmente sostenible y que contribuya al desarrollo
de las comunidades y sus regiones.
Por otro lado, para la minera de subsistencia, dado
que el objetivo del Estado colombiano es fomentar un
desarrollo adecuado de la actividad minera, las acciones
se enfocarn en que los mineros de subsistencia ejerzan
su actividad bajo condiciones de legalidad, seguridad y
sostenibilidad ambiental. De igual forma, se pretende
que los programas sociales que conforman la oferta
institucional del Estado formen parte de las estrategias
de apoyo a este tipo de minera.

SROtWLFDGHIRUPDOL]DFLyQFRQHOQGHORJUDUODVPHMRUHV
prcticas mineras.
Ingreso a la formalizacin de pequea minera: Todo
titular de pequea minera o quien trabaje bajo el amparo
de un ttulo minero, con instrumento ambiental en
trmite o aprobado, puede hacer parte de los programas
desarrollados en aplicacin de la poltica de formalizacin
minera.
Procesos de construccin e implementacin de la
formalizacin de pequea minera en el pas: A partir del
ao 2013, se inici la implementacin de la Poltica de
Formalizacin Minera, la cual fue adoptada mediante
Resolucin 90719 del 08 de julio de 2014, trabajando en
tres lneas principales.

Caracterizacin: 6H GHQH FRPR XQ SURFHVR GH


recoleccin de informacin bsica, que permite establecer
En 2016, el Gobierno Nacional expedir la reglamentacin un marco de referencia sobre el desarrollo de la actividad
TXH GHQLUi OD JUDQ PLQHUtD OD PHGLDQD PLQHUtD OD minera en una determinada regin. Su objetivo es el
pequea minera y la minera de subsistencia26 Para GH HVWDEOHFHU SDUiPHWURV TXH SHUPLWDQ FODVLFDU ODV
este trabajo, el Ministerio de Minas y Energa adelant condiciones en que se desarrollan las actividades
talleres con ms de 200 expertos en varias regiones mineras, de tal manera, que dichas actividades puedan
del pas (empresas, asociaciones, gremios, mineros, ser categorizadas en regularizadas y no regularizadas,
corporaciones regionales, entre otros), as como acciones siendo las primeras, aquellas que cuentan con ttulo
de trabajo de campo en 8 departamentos (Tolima, minero e instrumento ambiental aprobado o en trmite.
Huila, Guajira, Antioquia, Quindo, Valle del Cauca, A 31 de diciembre de 2015 se haban caracterizado 7326
Cundinamarca y Boyac) y grupos de trabajo entre las 8QLGDGHVGH3URGXFFLyQ0LQHUDFRQODLGHQWLFDFLyQGH
18383 mineros.
instituciones relacionadas (MME, ANM, UPME).
Acompaamiento integral: Es uno de los principales
instrumentos de formalizacin que contempla la Poltica,
aplicable solamente a unidades regularizadas, el cual
Regularizacin: Es la etapa preliminar en donde las cuenta con dos elementos esenciales: la asistencia
unidades de produccin de pequea minera, evalan tcnica prctica y la asistencia para la eliminacin del uso
los diferentes mecanismos que segn sus condiciones del mercurio. El primero, busca fortalecer las condiciones
les brinde la posibilidad de trabajar bajo el amparo de tcnicas, ambientales, econmicas y sociales de las
un ttulo minero y cuente con un instrumento ambiental UPM objeto del programa de formalizacin, generando
aprobado, de acuerdo con la normatividad vigente, recomendaciones prcticas para el mejor desarrollo de
para posteriormente poder hacer parte del programa de las labores mineras, tendientes a un avance porcentual
en materia de formalizacin. El segundo como su nombre
formalizacin minera.
lo indica, corresponde a talleres terico prcticos para la
Formalizacin: Es el conjunto de acciones o actividades HOLPLQDFLyQGHOXVRGHOPHUFXULRHQSODQWDVGHEHQHFLR
desarrolladas, enfocadas a las unidades de produccin de oro que usen dicho elemento dentro de sus procesos.
minera de pequea minera que trabajen bajo el amparo de A 31 de diciembre de 2015 el Ministerio de Minas se
un ttulo minero y cuenten con instrumento ambiental o lo encontraba apoyando a 597 UPM con asistencia tcnica
WHQJDQHQWUiPLWH/RVEHQHFLDULRVGHHVWDVXQLGDGHVGH prctica, en la cual se han intervenido 4267 mineros,
produccin minera debern comprometerse previamente as mismo la Gobernacin de Antioquia ha apoyado a
a dar cumplimiento a los estndares establecidos en la 808 UPM en este proceso. Dentro de la asistencia para
la eliminacin del uso del mercurio se han intervenido 32
 (O$UWtFXOR  GH OD /H\  GHO  HVWDEOHFLy FODVLFDU OD PLQHUtD HQ JUDQGH
PHGLDQD SHTXHxD \ PLQHUtD GH VXEVLVWHQFLD FRQ HO Q GH LPSOHPHQWDU XQD SROtWLFD
SODQWDV GH EHQHFLR GH RUR DVLVWLHQGR D  PLQHURV
GLIHUHQFLDGD DFRUGH D ODV FDUDFWHUtVWLFDV GH FDGD XQD GH ODV FODVLFDFLRQHV TXH VH
y capacitando a 25000 entre comunidades mineras y
GHQDQ3RUHVWR&RORPELDHQORV~OWLPRVPHVHV IHEUHURRFWXEUHGH KDYHQLGR
DGHODQWDQGRXQWUDEDMRULJXURVRSDUDGHQLUODVHVFDODVGHODPLQHUtDFRQEDVHHQFULWHULRV
autoridades locales.

5HJXODUL]DFLyQ 0HFDQLVPRV
)RUPDOL]DFLyQ

de produccin anual y rea, segn lo estipulado en el Plan Nacional de Desarrollo (PND).

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

53

Mediacin y regularizacin:
re
Son procesos que buscan
que aquellas UPM que no se encuentren amparadas
bajo un ttulo minero, trabajen bajo el amparo del mismo,
de tal forma que ingresen al Programa de Formalizacin
PHGLDQWHPHFDQLVPRVGHQLGRVSDUDHOOR(VDVtFRPR
en los casos donde un minero no regularizado se
encuentra desarrollando su actividad dentro de un rea
ya concesionada, el paso a seguir es la mediacin.
La metodologa empleada para la deteccin de EVOA, tal
como se relaciona en el alcance metodolgico, no pretende
caracterizar la actividad de explotacin de oro de aluvin
ni la legalidad de la misma. El objetivo es fortalecer a las
entidades competentes encargadas del manejo, gestin
y control de los recursos, con informacin que permita
mejorar la caracterizacin del fenmeno en el territorio.
Para este propsito, observar el carcter espacial de las
(92$\ODV]RQDVEDMRJXUDVGHDXWRUL]DFLyQSRUODOH\
para la explotacin de oro como: Amparo de Ttulos sin
licencia27, Solicitudes de legalizacin28, Propuestas de
contrato29 y Licencias ambientales30, permite obtener una
visin territorial de esta variable.
La informacin relativa a Propuestas de contrato,
Solicitudes de legalizacin y Amparo de Ttulos sin
licencia tiene como fuente la Agencia Nacional Minera
ANM, que es la entidad encargada de administrar los
UHFXUVRVPLQHUDOHVGHO(VWDGRGHIRUPDHFLHQWHHFD]
y transparente a travs del fomento, la promocin, el
otorgamiento de ttulos, y el seguimiento y control de la
H[SORUDFLyQ \H[SORWDFLyQPLQHUDDQGHPD[LPL]DU OD
contribucin del sector al desarrollo integral y sostenible
del pas [23] . Para las Licencias Ambientales la fuente
es la Autoridad Nacional de Licencias Ambientales
ANLA, como entidad encargada de que los proyectos,
obras o actividades sujetos de licenciamiento, permiso o
trmite ambiental, cumplan con la normativa ambiental,
de tal manera que contribuyan al desarrollo sostenible
ambiental del Pas (Decreto 3573) [24]. La informacin
ms reciente de Licencias disponible para este estudio
se obtuvo por fuentes secundarias para el ao 2011.
(QHO&yGLJRGH0LQDVVHGHQHHO7tWXORPLQHURFRPRHOGRFXPHQWRHQHOFXDOVH
otorga el derecho a explorar y explotar el suelo y el subsuelo. Los ttulos mineros se
FODVLFDQHQL /LFHQFLDVGHH[SORUDFLyQ\H[SORWDFLyQLL $SRUWHVPLQHURVLLL &RQWUDWRV
mineros. [90].
28. Aquellas solicitudes hechas por Explotadores de minas de propiedad estatal sin ttulo
minero inscrito en el Registro Minero Nacional, y que llevan a cabo explotaciones de
depsitos y/o yacimientos mineros. [91].
29. Aquellas solicitudes presentadas por particulares ante el Estado para celebrar
un contrato de concesin minera para la ejecucin de estudios, trabajos y obras de
exploracin de minerales de propiedad estatal en lugares donde no se llevan a cabo an
explotaciones de depsitos y/o yacimientos mineros. [102].
30. Autorizacin que otorga la autoridad ambiental competente, mediante acto
administrativo, a una persona, para la ejecucin de un proyecto, obra o actividad que
conforme a la ley y a los reglamentos, puede producir deterioro grave a los recursos
QDWXUDOHV UHQRYDEOHV R DO PHGLR DPELHQWH R LQWURGXFLU PRGLFDFLRQHV FRQVLGHUDEOHV R
notorias al paisaje, y en la que se establecen los requisitos, obligaciones y condiciones
TXHHOEHQHFLDULRGHOD/LFHQFLD$PELHQWDOGHEHFXPSOLUSDUDSUHYHQLUPLWLJDUFRUUHJLU
compensar y manejar los efectos ambientales del proyecto, obra o actividad autorizada.
(Decreto 1753 de 1994, artculo 2).

54

UNODC - MINJUSTICIA

Mediante la superposicin de las EVOA con informacin


de la ANM31 y de ANLA, se estableci la relacin espacial
de interseccin entre las mismas. Para el anlisis se
PDQHMDQFXDWURJXUDV
Licencias ambientales: Para poder sacar usufructo de
una mina se debe tener ttulo minero y licencia ambiental.
[25]. Por tanto, esta modalidad hace referencia a ttulos
con licencia ambiental
Amparo de Ttulos sin licencia:(VWDJXUDKDFHUHIHUHQFLD
a ttulos que no intersectan el archivo de licencias
ambientales (2011)32. Sin embargo, puesto que la licencia
ambiental es un requisito previo para el otorgamiento de
un ttulo, puede presentarse inconsistencias en el archivo
de licencias por falta de actualizacin en la ANLA de
los reportes generados por las autoridades ambientales
competentes. Solicitudes y legalizaciones de ttulo
minero.
6ROLFLWXGHV GH OHJDOL]DFLyQ (VWD JXUD FRPSUHQGH
las reas correspondientes a las solicitudes hechas
por explotadores de minas de propiedad estatal sin
ttulo minero inscrito en el Registro Minero Nacional en
lugares donde se adelanta un proceso de exploracin o
explotacin mineral.
SURSXHVWDV GH FRQWUDWR (Q HVWD JXUD VH LQFOX\HQ
solamente las zonas que han sido objeto de solicitud para
celebrar un contrato de concesin minera entre el Estado
y particulares para la ejecucin de estudios, trabajos y
obras de exploracin de minerales de propiedad estatal
en lugares donde no se llevan a cabo an explotaciones
de depsitos y/o yacimientos mineros
(O VLJXLHQWH JUiFR LOXVWUD OD  UHODFLyQ SRUFHQWXDO
HQWUH (92$  \ ODV JXUDV GH IRUPDOLGDG UHODFLRQDGDV

31. La informacin de la ANM fue suministrada por la Direccin de Carabineros y seguridad


rural, DICAR. Se obtuvo informacin acerca solicitudes a Noviembre de 2014, Ttulos
para los departamentos de Putumayo, Caquet, Choc, Nario, Cauca y Valle a marzo
2015 y para el resto del pas a noviembre 2014. La tabla de datos adjunta no diferencia
modalidades de explotacin, ni tipos de yacimientos, por cuanto los archivos representan
HOXQLYHUVRGHODVJXUDVGHIRUPDOLGDGSDUDODH[SORUDFLyQGHRURVLQGLIHUHQFLDFLyQSRU
OyQRDOXYLyQ
32. Artculo 206 de la Ley 685 de 2001 exige la licencia ambiental como requisito de la
explotacin de minerales: Requisito ambiental: Para las obras y trabajos de la explotacin
temprana, el interesado deber obtener Licencia Ambiental, que posteriormente podr
VHU PRGLFDGD SDUD DPSDUDU ORV WUDEDMRV GHQLWLYRV GH H[SORWDFLyQ FRQ HO OOHQR GH ORV
requisitos legales.

de oro y el 40% restante de las EVOA coincide con alguna


GHODVJXUDVDXWRUL]DGDV
El 20% del rea detectada se encuentra bajo la modalidad
de Amparo de Ttulos sin licencia y se concentra en
los departamentos de Antioquia (48%), Bolvar (27%)
y Choc (21%), mientras que el 14% corresponde a
Solicitudes de legalizacin33, donde el 84% se focaliza
en Choc, aunque tambin registran evidencias bajo esta
JXUD $QWLRTXLD 1DULxR 9DOOH \ &DXFD SULQFLSDOPHQWH
Por su parte, el 4% de las EVOA se encuentran en reas
UHJLVWUDGDV EDMR OD JXUD GH 3URSXHVWDV GH FRQWUDWR
concentradas en Choc (39%) y Choc (38%), con
presencia en menor proporcin en Nario, Cauca y
Bolvar especialmente.
Finalmente, el 2% del rea de EVOA se encuentra bajo
la modalidad de Licencias ambientales, es decir cuenta
con todos los requisitos para desarrollar actividades de
explotacin minera de oro (Ttulo y Licencia ambiental).
De este 2%, el 81% se concentra en Antioquia, mientras
que el restante 19% se distribuye en Choc, Crdoba,
Santander y Caldas.
$ SHVDU GH HVWD FRLQFLGHQFLD JHRJUiFD QR HV SRVLEOH
determinar que la explotacin se est haciendo en un
PDUFRSOHQRGHIRUPDOLGDG(QHIHFWRH[LVWHRWUDJXUDTXH
vincula la formalidad de estos ttulos con perturbaciones
El 60% del rea de EVOA no est asociada espacialmente en los mismos, los Amparos administrativos34. Para el
FRQQLQJXQDJXUDDXWRUL]DGDSRUODOH\SDUDODH[SORWDFLyQ estudio no fue posible acceder a esta informacin.
*UiFR  'LVWULEXFLyQ SRUFHQWXDO GH iUHD GH (92$ UHVSHFWR D
JXUDVDXWRUL]DGDVSRUODOH\

*UiFR'LVWULEXFLyQSRUFHQWXDOGHODVJXUDVDXWRUL]DGDVSRUODOH\VHJ~Q(92$DQLYHOQDFLRQDO

En el siguiente mapa se resumen los resultados


GHSDUWDPHQWDOHV KD  GH (92$ SRU JXUD DXWRUL]DGD
D QLYHO QDFLRQDO \ D FRQWLQXDFLyQ HO JUiFR PXHVWUD OD
SDUWLFLSDFLyQ SRUFHQWXDO GH FDGD JXUD DXWRUL]DGD SRU
departamento:

33. Bajo esta modalidad puede existir ms de una solicitud de ttulo minero sobre una
PLVPDiUHDJHRJUiFDDXQTXHSXHGHQGLIHULUHQGHOLPLWDFLyQ\iUHDVROLFLWDGD
/DDFFLyQGHDPSDURDGPLQLVWUDWLYRWLHQHFRPRQDOLGDGLPSHGLUHOHMHUFLFLRLOHJDOGH
actividades mineras, la ocupacin de hecho o cualquier otro acto perturbatorio, actual
o inminente contra el derecho que consagra el ttulo. El carcter de esta garanta de
ORV GHUHFKRV PLQHURV IUHQWH D DFWRV GH SHUWXUEDFLyQ X RFXSDFLyQ GH KHFKR VH UHHMD
en un procedimiento previsto por el legislador en el que no se vislumbra ni se articula
confrontacin alguna entre el particular y el Estado, sino amparo de los derechos de un
sujeto privado ante los actos perturbadores de otro u otros, todo lo cual hace de ste un
proceso de naturaleza eminentemente policiva. [92].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

55

1230'N

1230'N

1324'N

8121'W

75W

8124'W

70W

Mar Caribe

1321'N

1236'N
1324'N

8124'W

1321'N

1236'N

8142'W

Colombia

8121'W

La Guajira
Sur Amrica

Magdalena
8142'W

10N

0
0
0
0
35

Atlntico

ag
Ro M

10N

Cesar

da
lena

Sucre
Crdoba

VENEZUELA

0
4.272
123
5
2.961

76
34
2
12
3.419

PA
N

Norte de
Santander

Bolvar

Choc
Santander
52
86
0
0
26

1.006
7.559
1.185
973
15.600

o
trat
R o A

Ro Ca uca

Arauca
R o Meta

co

Casanare
eta

15
139
1
2
69

Boyac

oM

5N

Caldas

0
0
0
0
10

89
3.276
1.143
9.535
22.142

5N

Ocano
Pacfico

Risaralda

Ro Orin
o

Antioquia

Vichada

Cundinamarca
Quindo
Tolima
Valle

na

ichada
R o V

0
0
59
177
1.334

Ro
Ma
gd

le

re
avia
Gu
Ro

Meta

Guaina

0
418
222
172
595

0
0
0
0
15

a
nrid
oI
R

0
0
0
0
37

Huila
Cauca

0
0
267
415
994

Guaviare

Nario
0
8
0
0
6
0
0
0
0
5

0
0
0
0
365

Caquet

Vaups

Putumayo
Ro
Ca

R o

utum
a

quet

yo

ECUADOR

Amazonas

BRASIL

* En las reas donde figuran Propuestas de contrato


no debera presentarse explotacin mineral porque
apenas est en trmite un contrato de concesin
minera.
** En las reas donde figuran Solicitudes de
legalizacin se presentan explotaciones que eran
ilegales pero se encuentran en trmite de
formalizacin.

PER
o

Am
a

zo
na
s

150

300
km

Coordenadas geogrficas WGS 84

70W

75W
Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC - ANLA - ANM
Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Distribucin departamental de
EVOA 2014 (ha) y
figuras autorizadas por la ley
para explotacin de oro

Licencias ambientales

Solicitudes de legalizacin **

Amparo de Ttulos sin licencia

Sin figura autorizada por la ley


Departamentos afectados
con EVOA 2014

Propuestas de contrato *

Lmites internacionales
Lmites departamentales

0DSD'LVWULEXFLyQGHSDUWDPHQWDOGH(92$ KD HQUHODFLyQFRQJXUDVDXWRUL]DGDVSRUODOH\SDUDH[SORWDFLyQGHRUR

*UiFR3DUWLFLSDFLyQSRUFHQWXDOGHSDUWDPHQWDOGHODV(92$GHDFXHUGRFRQJXUDVDXWRUL]DGDVSRUODOH\

De las EVOA detectadas en Resguardos indgenas, el


VHHQFXHQWUDEDMRODJXUDGHDPSDURGH7tWXORVVLQ
licencia, el 7% bajo Solicitudes de legalizacin y el 2%
bajo Propuestas de contrato. En territorios de Consejos
comunitarios de comunidades afrodescendientes, el
 VH HQFXHQWUD EDMR OD JXUD GH 6ROLFLWXGHV GH
legalizacin, el 9% bajo Amparo de Ttulos sin licencia
y el 4% bajo Propuestas de contrato.
En el Sistema de Parques Nacionales Naturales no se
HQFXHQWUDQ(92$EDMRDOJXQDJXUDGHIRUPDOLGDG6LQ
HPEDUJRVHHQFXHQWUDQKDGH(92$EDMRODJXUDGH
Propuestas de contrato que se encuentran en el rea de
LQXHQFLDHQWUHNPGHORVSDUTXHVGH/RV)DUDOORQHV
de Cali, Munchique, Selva de Florencia, Paramillo. En
la misma condicin, bajo la modalidad de Amparo de
Ttulos sin licencia se encuentran 102 ha en el rea de
LQXHQFLDGHORVSDUTXHV/DV2UTXtGHDV/RV)DUDOORQHV
de Cali, Selva de Florencia, Yaigoj Apaporis, Paramillo,
Tatama y Munchique.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

57

SECCIN

II

DETECCIN DE ALTERACIN EN
SEDIMENTOS EN SUSPENSIN
MEDIANTE NDICES ESPECTRALES
(ESTUDIO DE CASO)
La explotacin aurfera que se lleva a cabo en el lecho
de los ros comprende las siguientes actividades:
SUHSDUDFLyQ \ DFFHVR D OD ]RQD RSHUDFLyQ EHQHFLR
o transformacin del mineral, transporte del material y
abandono.
3URFHVRGHH[SORWDFLyQHQFXHUSRVGH
agua
Etapa 0: Sin afectacin. Seleccin de los depsitos de
sedimentos propicios para la explotacin de oro de aluvin.
Etapa 1: La preparacin y acceso a la zona de explotacin
aurfera en ros est condicionada al tipo de plataforma o
terreno sobre el cual se hace el montaje y se establece la
maquinaria para llevar a cabo los procesos de explotacin
mediante dragado, en razn de que, dependiendo de la
HVFDODGHODSURYHFKDPLHQWRSXHGHQH[LVWLUGUDJDVMDV
ancladas a tierra o dragas mviles35; estas ltimas tienen
un impacto sobre el paisaje que es muy difcil de percibir
en imgenes provenientes de sensores remotos, pues no
es una actividad esttica que deja evidencia porque acta
en funcin de la dinmica de la corriente hdrica.
Etapa 2: En cuanto a las operaciones de dragado para la
explotacin de oro de aluvin, existe una gran variedad
de tcnicas segn las caractersticas de la maquinaria
empleada; sin embargo, independientemente del tipo
de draga utilizada y de la escala del aprovechamiento,
cualquier proceso de dragado comprende tres
actividades: explotacin del material del lecho del ro
VHJ~QHOPpWRGRHVSHFtFRGHH[FDYDFLyQWUDQVSRUWHGH
ORV VHGLPHQWRV H[WUDtGRV WDQWR SDUD HO EHQHFLR FRPR
para el vertimiento posterior) de acuerdo con los medios
en los que se desarrolla este movimiento de material,
35. Las dragas ancladas a tierra tienen una estructura mucho ms compleja que soporta
grandes operaciones de explotacin, mientras que las dragas mviles se encuentran en
embarcaciones de distinto calado de acuerdo con la capacidad requerida [2].

\ QDOPHQWH HO YHUWLPLHQWR GHO PDWHULDO UHVLGXDO  DO UtR


nuevamente36.
/DVODERUHVGHEHQHFLRGHORURH[WUDtGRHQUtRVPHGLDQWH
dragas cumplen con los mismos principios que las de
mineral extrado en terrazas aluviales, puesto que se
emplean los mismos materiales y tcnicas, y lo nico
que vara es el lugar donde se realiza. Generalmente en
las embarcaciones se acondiciona un espacio junto a la
maquinaria de dragado en el que se utilizan elementos
como canecas y baldes con agua para el proceso
de amalgamamiento con mercurio y lixiviacin por
cianuracin, y las aguas residuales son descargadas al
ro. En el caso de las dragas ancladas a tierra, se dispone
un espacio sobre la terraza aluvial al borde del ro para
realizar estas labores. [26].
Etapa 3 y 4: Estas etapas estn relacionadas con
la magnitud de la explotacin, relacionada a su vez
con la cantidad de maquinaria en una seccin del ro,
dependiendo de la riqueza del depsito aluvial. Algunos
procesos pasan de la etapa 2 a la 5.
Etapa 5: Es complejo determinar si un rea que ha sido
sometida a dragado ha sido abandonada, debido a que el
material removido es reintegrado casi en su totalidad al
ro; adems, este es un proceso dinmico que se presenta
en distintos puntos de un mismo ro. Sin embargo, si con
HOGUDJDGRGHOOHFKRGHOUtRHQXQSXQWRHVSHFtFRQRVH
sigue encontrando oro, se cambia el lugar de explotacin.
De acuerdo con la siguiente ilustracin, despus de
encontrar los depsitos de sedimentos propicios para la
explotacin de oro de aluvin en los lechos del ro (etapa
0) y de realizar el montaje de las dragas en los terrenos o
 /D FODVLFDFLyQ GH ODV GUDJDV HV 0HFiQLFDV 'UDJDOLQD &XFKDUD 3DOD 5RVDULR  H
+LGUiXOLFDV 6XFFLyQHQPDUFKDFRUWDGRUDVXFFLyQHVWDFLRQDULD\'XVWSDQ HVWDFODVLFDFLyQ
depende principalmente de su complejidad, tamao, capacidad y tecnologa [83].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

61

plataformas a que haya lugar (etapa 1), las mquinas de maquinaria y de mayor capacidad (etapa 3 y 4). Si se
dragado comienzan las actividades de explotacin (etapa agota el oro en un sitio, las mquinas se desplazan a
2), hasta llegar a consolidarse grandes extensiones a nuevas reas para explorar y explotar (5).
lo largo del ro para el dragado con mayor cantidad de

Etapa 0: Ro sin afectacin

Etapa 1: Preparacin y acceso


(Montaje)

Etapa 2: Operacin
(Activacin minidraga)

Etapa 3: Operacin
(Dragas capacidad media)

Etapa 4: : Operacin
(Dragas alta capacidad)

Etapa 5: Reinicio operaciones

Ilustracin 7. Etapas del proceso de explotacin de oro de aluvin con uso de maquinaria en agua.

62

UNODC - MINJUSTICIA

Como se mencion anteriormente, aunque las imgenes


de satlite capturan informacin en diferentes rangos del
espectro electromagntico y permiten estudiar diversas
Los cuerpos de agua en las imgenes satelitales son uno coberturas sobre la Tierra, existen zonas de confusin
de los elementos que mejor explican las propiedades espectral que no permiten discriminar con precisin
ySWLFDV GH UHHFWDQFLD WUDQVPLWDQFLD \ DEVRUFLyQ HO una cobertura o caracterstica en particular mediante el
agua absorbe o transmite la mayor parte de la radiacin uso de bandas individuales; en este sentido, el uso de
visible que recibe, siendo mayor su absortividad37 algebra de bandas (ndices espectrales), cuyo objetivo
cuanto mayor sea la longitud de onda. La mayor es realzar y suministrar informacin sobre una cobertura
UHHFWLYLGDG38 del agua clara se produce en el rango del HVSHFtFD SHUPLWH REWHQHU GH XQD IRUPD REMHWLYD \
espectro electromagntico que comprende desde 0,45 precisa informacin cuantitativa del objeto de estudio.
hasta 0,52 m, reduciendo su valor paulatinamente
hacia el infrarrojo cercano, donde ya es prcticamente En la siguiente imagen se presenta una comparacin
QXOR/DUHHFWLYLGDGVHYHDIHFWDGDSRUIDFWRUHVFRPRHO HQWUHHOFRPSRUWDPLHQWRGHODUHHFWLYLGDGHQDJXDFODUD
FRQWHQLGRGHFORURODVyOLGRVHQVXVSHQVLyQUXJRVLGDG (sin turbidez) y agua turbia afectada por sedimentos
suspendidos, donde se observa que a mayor cantidad
VXSHUFLDO\SURIXQGLGDG>@
GHVyOLGRVHQVXVSHQVLyQKD\PD\RUUHHFWLYLGDG
Comportamiento espectral de los cuerpos
de agua.

Figura 2. Comportamiento espectral del agua (Fuente: Aligarh Muslim University).

ndices espectrales
Los ndices espectrales se basan en la combinacin
algebraica de bandas en sus valores espectrales
FRUUHJLGRV\FDOLEUDGRVUDGLRPpWULFDPHQWH UHHFWDQFLDV 
mejorando la capacidad de interpretacin de resultados; el
objetivo es agrupar y minimizar las diferentes respuestas
de los sensores en un nico valor por pxel, que pueda
relacionarse con xito con un fenmeno a investigar [28].
Los sedimentos suspendidos presentes en los cuerpos
de agua por efecto de la actividad de explotacin de
oro de aluvin con uso de maquinaria especializada
para remocin de materiales, retroexcavadoras sobre
las orillas de los ros, y dragas que remueven enormes
cantidades de material de las riberas y del fondo de los
(QHOSURFHVRGHWHOHGHWHFFLyQUHODFLyQHQWUHHOXMRLQFLGHQWH\HOTXHDEVRUEHXQD
VXSHUFLH
 (Q HO SURFHVR GH WHOHGHWHFFLyQ UHODFLyQ HQWUH HO XMR LQFLGHQWH \ UHHMDGR HQ XQD
VXSHUFLH

FXHUSRV GH DJXD PRGLFDQ OD UHHFWDQFLD GHO FXHUSR


hdrico y hacen que puede ser detectado por medio de
tQGLFHVHVSHFWUDOHVHVSHFtFRV
En el mundo se han desarrollado diferentes
investigaciones que validan el uso de estos ndices para
OD GHWHFFLyQ PRQLWRUHR \ FXDQWLFDFLyQ VHGLPHQWRV
suspendidos, como el de la evaluacin y monitoreo del
ro Misisipi en Estados Unidos mediante la aplicacin
GH tQGLFHV HVSHFWUDOHV SDUD GHVFULELU \ FXDQWLFDU ORV
sedimentos suspendidos [29], el estudio de materiales
en suspensin en aguas costeras de Puerto Rico para
monitorear los cuerpos de agua [30], el uso de ndices
espectrales para el monitoreo del rio Amazonas en Brasil
realizando correlacin entre la concentracin de los
VHGLPHQWRVVXVSHQGLGRV\ODUHHFWDQFLDGHORVVHQVRUHV
remotos [31], entre otras; estos estudios realizan una
aproximacin a diferentes aplicaciones de los ndices
para la deteccin de sedimentos suspendidos.
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

63

Se evaluaron nueve ndices espectrales, cada uno de los


cuales est formulado para dar como resultado cocientes
que resaltan coberturas detectadas en las imgenes
satelitales; se realiz el clculo para cada uno de ellos y
se compararon entre s, para determinar cules son los
que permiten detectar sedimentos suspendidos, cules
VRQVXFLHQWHPHQWHVHQVLEOHVDFDPELRVHQHOWLHPSR\
que en s mismos permiten destacar zonas de cambios.
Los resultados fueron evaluados visualmente a travs de
mapas, y cuantitativamente a travs de tablas dinmicas
de comparacin de valores, ya que el resultado de los
cocientes de cada ndice es una fraccin, que comparado
con la medicin del mismo en un tiempo inicial, puede
determinar cambios con respecto a otro tiempo de
muestra. De los ndices analizados, cuatro presentaron
mayor robustez en sensibilidad de deteccin:
Normalized Difference Water Index (NDWI)
01':, 0RGLFDWLRQ IRU 1RUPDOL]HG 'LIIHUHQFH
Water Index
Normalize Difference Suspended Sediment
Index (NDSSI)
Normalized Suspended Material Index (NSMI)

SIGLA

NOMBRE

SAVI

Soil-Adjusted Vegetation Index

NDWI

Normalized Difference Water Index

MNDWI

0RGLFDWLRQIRU1RUPDOL]HG'LIIHUHQFH
Water Index

NDSSI

Normalize Difference Suspended Sediment Index

NSMI

Normalized Suspended Material Index

BR

Band Ratio

LSWI

Land Surface Water Index

TCBI

Tasseled Cap Brightness Index

TCWI

Tasseled Cap Wetness Index

DESCRIPCIN

NDICE
NDWI

ndices espectrales evaluados

FRMULA

(VWHtQGLFHHVWiGLVHxDGRSDUDPD[LPL]DUODUHHFWDQFLDGHODJXD NDWI = (JUHHQ 1,5) /


mediante el uso de las longitudes de onda de la banda verde.
(JUHHQ + 1,5) (1)
Como resultado, los valores bajos corresponden a agua con
sedimentos suspendidos y los valores altos corresponden a agua
clara [32].

MNDWI

Este ndice est diseado para discriminar los valores digitales MNDWI = ( D/Z) /
HQWUHORVFXHUSRVGHDJXD\ODUHHFWDQFLDGHORVVXHORVKDFLHQGR ( + D/Z)
uso de la banda del infrarrojo medio

NDSSI

Ha sido utilizado para desarrollar modelos de sedimentos en NDSSI = (EOXH 1,5) / (EOXH
suspensin en los ros, lagos, estuarios y muchos otros cuerpos + 1,5) (2)
de agua [33].

NSMI

Los valores obtenidos del ndice NDSSI son un rango de valores


del -1 al 1, donde los valores ms altos indican la presencia de
agua ms clara y los valores bajos indican la presencia de agua
ms turbia o con mayor contenido de sedimentos.
Fue desarrollado sobre la base de los principios i) agua limpia NSMI = (red +green blue) /
WLHQHXQSLFRGHUHHFWDQFLDHQODJDPDD]XOLL ODSUHVHQFLDGH (red +green + blue) (3)
PDWHULDOVXVSHQGLGRSURPXHYHXQDXPHQWRGHODUHHFWDQFLDHQ
todo el espectro visible, especialmente en la gama de verde y
rojo [104].
La ecuacin genera valores entre -1 a 1. Los valores ms
altos corresponden a agua ms clara y los valores ms bajos
corresponden a agua con ms sedimentos suspendidos.
Tabla 10. Principales caractersticas de los ndices espectrales empleados.

64

UNODC - MINJUSTICIA

La facilidad para generar nuevas imgenes a travs del


clculo de ndices espectrales ha hecho muy til esta
metodologa; sin embargo, los resultados obtenidos estn
circunscritos a las condiciones particulares de la toma de
ODLPDJHQGHVDWpOLWHHLQXHQFLDGRVSRUIDFWRUHVFRPR
el ngulo de incidencia, condiciones de luminosidad,
topografa, calidad de la calibracin, partculas de la
atmsfera, condiciones climticas, etc. [28].
El estudio compara los resultados obtenidos para cada
tQGLFH H LGHQWLFD FXiO SUHVHQWD PD\RU VHQVLELOLGDG
a la medicin de la alteracin en los sedimentos en
suspensin en la zona piloto. Los ndices fueron obtenidos
en imgenes Landsat 5 y Landsat 8.
Comportamiento espectral natural de
VHGLPHQWRVHQVXVSHQVLyQ
La metodologa propuesta no pretende caracterizar
espectralmente las actividades de explotacin de oro
de aluvin, sino evaluar, a partir del comportamiento
espectral, las alteraciones en los sedimentos suspendidos
en los cuerpos de agua atribuibles a actividades de
explotacin. En consecuencia, busca validar si el uso de
ndices espectrales es una herramienta para la deteccin
de este fenmeno en particular, y determinar as cul es
la relacin entre objetos (balsas, dragas usadas para
la explotacin de oro sobre ros) y variables (alteracin
de sedimentos suspendidos en los cuerpos de agua)
que caracterizan este tipo de explotacin de minerales
sobre cuerpos hdricos. La metodologa hace nfasis
en el establecimiento de una lnea base de sedimentos
en suspensin normales en el cuerpo de agua, que
permita la comparabilidad en el tiempo para la deteccin
de cambios. Se selecciona para este efecto un ro sin
afectacin por explotacin de oro de aluvin en la zona
de estudio.
Los periodos de anlisis, tanto para el establecimiento
del comportamiento espectral natural (sin afectacin
por actividades de explotacin) como para la dinmica
de afectacin, fueron seleccionados apoyados en
informacin secundaria de explotacin de oro en la
zona: 2002 (muy baja o nula afectacin), 2007 (inicio de
afectacin), 2011 (auge minero) y 2014 (tiempo actual).
Para garantizar la comparabilidad en funcin del caudal
hdrico, se estableci para cada periodo una ventana de
tiempo correspondiente a la estacin seca en funcin de
las siguientes premisas:

El menor caudal facilita la deteccin de alteraciones


en los sedimentos suspendidos.
El periodo lluvioso representa un rgimen fuerte
de precipitacin, lo cual conlleva un incremento

en los sedimentos trasportados, generados


tanto por el rgimen de lluvias como por otros
factores inherentes a derrumbes y arrastre de
material.
Informacin secundaria adquirida por instituciones
presente en la zona reporta que el mayor caudal
GLFXOWD HO DFFHVR DO \DFLPLHQWR SRU SDUWH GH OD
maquinaria utilizada

/D LGHQWLFDFLyQ GH OD OtQHD EDVH GH VHGLPHQWRV


en suspensin se realiz en el tramo del ro Inrida
comprendido entre las Comunidades El Zancudo y
Morroco, en el departamento de Guiana, mediante el
clculo de ndices en la corriente hdrica para diferentes
periodos de tiempo T0 (febrero 2002), T1 (febrero 2007),
T2 (enero 2011) y T3 (enero 2014). El ro objeto de
HVWXGLRVHVRPHWHDXQOWURGHSL[HOHVGHHIHFWRERUGH
para eliminar posibles ruidos exgenos en la lectura de
los ndices, y posteriormente se toman diferentes puntos
a lo largo del ro, espaciados 5 km entre s, como puntos
de muestra; con los valores obtenidos se construye una
curva de comportamiento natural. Los valores mnimos
y mximos de los ndices determinan el rango de anlisis,
TXHDVXYH]LGHQWLFDQORVFDPELRVHQORVVHGLPHQWRV
suspendidos.
&RQVWUXFFLyQGHFXUYDVGH
comportamiento espectral
Con base en la metodologa para el establecimiento de
la Lnea Espectral Natural39 se realiza el clculo de los
ndices seleccionados en la corriente hdrica a evaluar para
los diferentes periodos de tiempo T0 (2002), T1 (2007), T2
(2011) y T3 (2014); se eliminan los pixeles con efecto borde
y se toman puntos de muestra a lo largo del ro.
La explotacin de oro de aluvin en agua no se realiza
en una mina esttica, en razn a que las dragas y
maquinaria similar se mueven por el cuerpo del ro en
busca del mineral y slo se quedan cuando encuentran
volmenes rentables.

Los datos son comparados con la lnea base natural para


detectar los cambios en los sedimentos suspendidos;
este procedimiento espacial genera un mapa de cambios
con las variables estabilidad y aumento. La estabilidad
es considerada dentro del comportamiento natural de la
corriente hdrica y el aumento genera las primeras alertas
para una inspeccin.
Una vez generadas estas zonas alerta, se realiza un
anlisis visual cuantitativo y un anlisis espacial con
coberturas para eliminar zonas alerta por agentes
exgenos a la actividad de explotacin de oro de aluvin,
 +DFH UHIHUHQFLD DO FRPSRUWDPLHQWR GH OD OX] UHHMDGD SRU ORV FXHUSRV GH DJXD VLQ
alteraciones en los sedimentos suspendidos.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

65

y obtener as un mapa de consolidado de alertas para el


cuerpo hdrico.

calculado para el ndice. Se observa que la zona sin


afectacin presenta un comportamiento similar para
todos los periodos de anlisis, mientras que la zona
/DVLJXLHQWHJXUDPXHVWUDODFXUYDGHFRPSRUWDPLHQWR con afectacin permite ver, segn la interpretacin del
esperado para el ndice NDSSI en zona sin afectacin ndice, que para los periodos T2 y T3 hay un incremento
de explotacin de oro, y otra con afectacin. El eje en los sedimentos en suspensin que coincide con la
horizontal representa los puntos para lectura tomados informacin secundaria suministrada.
sobre la imagen a lo largo del ro, y el eje vertical el valor

Ilustracin 8. Curvas esperadas de afectacin, valores cercanos a 1,0 indican menos sedimentos en suspensin, basado en (Hossain, Jia &
Chiao; 2016)

La seleccin de la zona piloto se hizo teniendo en


FXHQWD FDUDFWHUtVWLFDV JHRJUiFDV KLGURJUDItD UpJLPHQ
(O PRGHOR HVWi EDVDGR HQ OD LGHQWLFDFLyQ GH FDPELRV de precipitaciones y climatologa; se seleccionaron
en el comportamiento natural de los sedimentos en ros dos ros para la construccin de la lnea base de
que se pueden medir a travs de cambios en los ndices comportamiento espectral natural: El ro Inrida a la altura
espectrales, y que se pueden asociar con actividades de las comunidades de Zancudo, Chorro Bocn, Huesito
de explotacin de oro de aluvin. Para la aplicacin del y Morroco, y el ro Orinoco a aproximadamente 55 km al
PRGHORVHVHOHFFLRQyHOtQGLFH01':, 0RGLFDWLRQIRU noroccidente de la provincia de Tama Tama, del estado de
Normalized Difference Water Index), el cual demostr Amazonas en Venezuela, donde no existen antecedentes
una mayor robustez y coherencia temtica con las de afectacin por explotacin mineral. Los hallazgos
condiciones del ro Inrida40.
obtenidos para ambos ros tienen una tendencia similar
por lo que se selecciona como lnea base el Ro Inrida,
El modelo de monitoreo para la deteccin de actividades por cuanto es donde se realiza la aplicacin del modelo.
de explotacin de oro de aluvin en agua basado en
En este captulo se presentan los principales hallazgos
ndices espectrales involucra tres etapas:
de la implementacin, con nfasis en los puntos claves
i) La construccin de la lnea de base para el ro en la para la implementacin de un sistema de monitoreo a
que se garantiza el comportamiento espectral natural, escala nacional.
es decir, sin intervencin de actividades de explotacin
de minerales.
Modelo

ii) La deteccin de cambios en el comportamiento natural


mediante la observacin y anlisis de ndices espectrales.
iii) Asociacin de los cambios con actividades de
explotacin de oro de aluvin.
40. Una descripcin ms detallada del proceso de seleccin de los ndices est disponible
en el anexo 3 Seleccin de ndices espectrales para la alteracin de sedimentos
suspendidos.

66

UNODC - MINJUSTICIA

LNEA BASE:
COMPORTAMIENTO
ESPECTRAL NATURAL
DE SEDIMENTOS EN
SUSPENSIN
La construccin de una lnea base para el ro establece
el comportamiento espectral natural, es decir, sin
afectacin por actividades de explotacin de oro.
Garantiza que los resultados de la comparacin con los
ndices en diferentes periodos de tiempo se relacionen
con alteraciones de los sedimentos en suspensin. La
validacin de las curvas obtenidas de acuerdo con los
ndices trabajados se realiz mediante anlisis de
congruencia con respecto a:
i) Informacin secundaria41: Cualitativa, relativa a
la presencia de la actividad en la regin durante el
periodo de estudio.
ii) Entrevistas a mineros de la regin realizadas
por el proyecto en el marco del presente estudio

GH FRQVWUXFFLyQ GH FRQRFLPLHQWR JHRJUiFR


basado en experiencia y percepcin realizados en
el marco del estudio.
De acuerdo a Montalvo, (2010) y con los resultados
obtenidos en el desarrollo del piloto, se estableci que
los ndices de mayor robustez son el NDWI, MNDWI,
NDSSI y NSMI. Las curvas de comportamiento obtenidas
para cada ndice se evaluaron teniendo en cuenta la
sensibilidad para la deteccin, y la sensibilidad a los
cambios en el tiempo; con ello, el ndice que mayor
robustez y sensibilidad presenta es el MNDWI, dado a que
aprovecha el uso del rango del espectro electromagntico
del infrarrojo medio, que permite diferenciar y resaltar
lugares donde el contenido de agua, humedad se ven
afectados por alguna alteracin. [34]; este se seleccion
tanto para la caracterizacin de la lnea base como para
el anlisis de los sedimentos.
(QHOVLJXLHQWHJUiFRVHSUHVHQWDHOtQGLFH01':,SDUD
los dos ros en condiciones previas a la intervencin,
los puntos de muestra de los valores resultantes para el
ndice se tomaron a una distancia media de 5 km entre
ellos.

iii) Conocimiento de las instituciones de la regin


sobre la dinmica de la actividad, mediante talleres

*UiFR/tQHDEDVHHVSHFWUDOQDWXUDO01':,

Se observa un comportamiento uniforme a lo largo del


ro, principalmente en el caso de ro Inrida-1996; en
el caso del ro Orinoco, si bien existe mayor variacin,
HVWDYDULDFLyQRFXUUHGHQWURGHUDQJRVELHQGHQLGRV\
constantes en los cuatro momentos de estudio.

41. Documentos descriptivos de la dinmica histrica de la actividad minera en el Guaina.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

67

Mar Caribe

Ocano
Pacfico

Ecuador

Per

.
!

.
!
2 Zancudo
.
!
!
.

.
!
.
!

Arenales

Venezuela

7
.
!

Brasil

. !
!
.8

Barranco
Mina

69W

Matraca

.
!

.
!

69W

.
.!
!
Sabanita
.
!
Sabanita
Nuevo

17

Cao
Via
.
!

16
.
!

.
!

Punta
Pava
Cao
Minas

.
!

.
!
14
10 13
. 15
!
. 12
!
.
!

9 !
. 11
Baquiro

.
!
.
!

MNDWI*
1996

.
!

Morroco
Nuevo

.
!

6830'W

20
km

Comunidades

68W

Cao

.
!

Almidn

.
!

50

49

. La
!

Caranacoa

.
!

.
!

.
!

Ceiba

Cacahual

46

.
!

48 !
.
47

Venado
!
.

.
!

36

Remanso
.
!
37

.
!

.
!
Tonina
43
45
.
!
.
!
.
!
42 !
. 44
.
!
.
Huesito !
. 41
!
. Paloma
!
.
!
39
! 38
.

.
!
Remanso

.
!

. 35
!

Puerto
Colombia

. 39
!

. 35 !
. !
!
. 37
.
!
34
.
!
36

34

68W

MNDWI: Modification for Normalized


Difference Water Index

Lmites departamentales

.
!

. Morroco
!
. !.
!

Santa
Rosa

Inrida

33

Cerro
!
.

.
!

.
33!.!
Punta de
.
!
Cerro
Yaca
.
!
Chorro 31
. Piedra Alta
!
Bocn !
.
.
!
. Sejalito
!
.
29 !
.!
30

Lmites internacionales

Ros
Unidad RAMSAR

Puerto
Colombia

.
!

32

25
.!.28
27!
.
!
24
! !
.
Zamuro
23 .
.
!
.
!
26 !. Sabanita
.
!

21

Morroco
22
Viejo .
.!
!

GUAINA

18
.
!

Danta

19 20
!
. .
!
.
!

.
!

Puntos de muestra

6830'W

Coordenadas geogrficas WGS 84

!
.

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC y SINCHI


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Sedimentacin
Baja
Media
Alta

Mapa 8. Distribucin de puntos de muestra a lo largo del ro Inrida 1996.

330'N

3N

330'N
3N

El ndice MNDWI, bajo condiciones de mnima alteracin


por explotacin mineral, registra que el ro se comporta
de manera uniforme en la mayora de los puntos tomados
como muestra. Como se puede observar en el mapa, el
ro Inrida presenta una coloracin azul, debido a su muy
baja alteracin en los sedimentos suspendidos, inclusive
en zonas de meandros donde por el comportamiento
del ro se deberan acumular sedimentos, lo cual
valida que para la fecha base del ro Inrida (1996),
este no estaba afectado por factores externos que
alteraran los sedimentos suspendidos sobre el lecho
del ro. Para efectos del monitoreo, se propone que las
variaciones a este comportamiento indican alteraciones
en los sedimentos en suspensin en el ro que pueden
asociarse con actividades de explotacin de oro de
aluvin en agua. En la siguiente seccin se aplica la
propuesta metodolgica para la deteccin de cambios
en el comportamiento natural mediante la observacin de
ndices espectrales.

reporta mnima actividad de explotacin mineral, y el ro


Orinoco como testigo, durante los aos 2002, 2007, 2011,
y 201442, en un tramo que no tiene antecedentes de este
WLSRGHDFWLYLGDG(OFRPSRUWDPLHQWRGHORVtQGLFHVUHHMD
el comportamiento de los sedimentos en el ro en una
condicin de no afectacin por actividades de explotacin
de oro de aluvin; para la construccin de las curvas
se seleccionaron puntos bajo los siguientes criterios: i)
los puntos de medicin se ubican en zonas diferentes a
meandros43; ii) los puntos deben abarcar la totalidad de la
zona de estudio, es importante destacar que estos puntos
son los mismos que se utilizan para la construccin de las
curvas en todos los momentos del estudio; iii) los puntos
estn distribuidos sistemticamente cada 5 km en el ro
de estudio, para abarcar la variabilidad de la zona.

DETECCIN
DE
CAMBIOS
EN EL COMPORTAMIENTO
NATURAL
MEDIANTE
LA
OBSERVACIN Y ANLISIS DE
NDICES ESPECTRALES
Los ndices se aplicaron en temporada seca en dos ros
de la regin, el ro Inrida en el ao 1996 cuando se

*UiFR&XUYDGHFRPSRUWDPLHQWRHVSHFWUDOGHVHGLPHQWRVHQVXVSHQVLyQPHGLDQWHDSOLFDFLyQGH01':,HQ]RQDSLORWR/RVVHJPHQWRV
de las curvas que se encuentran por fuera del recuadro amarillo, corresponden a alteraciones en los sedimentos suspendidos.
42. Para el ro Inrida la documentacin existente no relaciona actividad de explotacin
para este periodo, sin embargo se considera que pudo haber existido una mnima
actividad. Para el ro Orinoco se consider un tramo del rio fuera de la frontera, inmerso en
territorio selvtico que no evidencia perturbacin ni actividades de explotacin en ninguno
de los periodos estudiados.
43. Curva descrita por el curso de un ro donde los sedimentos suelen depositarse en la
parte convexa del mismo [97].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

69

Para los aos 1996 y 2002 los valores calculados se


encontraron dentro del comportamiento natural del ro;
para el 2007 se evidencia alteracin de los sedimentos
VXVSHQGLGRVHQSXQWRVHVSHFtFRVFHUFDQRVDODSREODFLyQ
de Matraca, y ms marcados en puntos cercanos a las
poblaciones de Chorro Bocn, Piedra Alta, Remanso y La
Ceiba; en el 2011 se evidencian valores ms bajos sobre
la comunidad de Morroco Viejo, puntos cercanos a la
comunidad Cerro, comunidad Paloma, Cao Tonina y La
Ceiba; en el 2014 se evidencia una afectacin acentuada
en las comunidades de Chorro Bocn, Zamuro, Sejalito,
Cerro, Remanso, Huesito y Morroco.

En el siguiente mapa se puede observar sectores del


ro donde se evidencia la alteracin de sedimentos
para el ao 2014 y la aplicacin del ndice MNDWI; las
tonalidades de rojo evidencian una mayor alteracin de
los sedimentos, y dichos sectores coinciden con zonas de
explotacin de oro sobre el ro Inrida segn informacin
secundaria.
La explotacin de oro de aluvin en agua no se
realiza en una mina esttica, en razn a que las
dragas y maquinaria similar se mueven por el
cuerpo del ro en busca del mineral. Y solo se
quedan cuando encuentran volmenes rentables.

MNDWI
Punto de Muestra

COMUNIDAD
1996

2002

2007

2011

12

Baquiro

0,770

0,830

0,470

**

0,590

14

Matraca

0,700

0,890

0,660

**

0,600

24

Morroco Viejo

0,660

0,830

0,480

0,850

0,380

26

Chorro Bocn

0,650

0,830

0,370

0,700

0,350

27

Sabanita

0,660

0,830

0,420

**

0,350

29

Zamuro

0,650

0,920

0,470

**

0,310

30

Sejalito

0,650

0,570

0,460

**

0,450

0,780

0,710

0,380

**

0,290

0,620

0,680

0,360

0,430

0,370

0,650

0,710

**

0,200

0,340

31
32

Piedra Alta

33
34

0,640

0,620

0,370

0,200

0,180

35

0,680

0,650

0,370

0,280

0,180

36

0,640

0,650

0,380

0,360

0,260

0,620

0,910

0,330

0,400

0,250

0,680

1,000

0,480

0,450

0,250

0,640

0,740

0,610

0,720

0,340

37
38

Cerro

Remanso

39
40
41
42

Paloma
Huesito

43
44
45

Cao Tonina

0,650

0,770

0,480

0,280

0,310

0,610

0,790

0,550

0,200

0,290

0,620

0,500

0,430

0,280

0,240

0,670

0,770

0,500

0,290

0,160

0,600

0,580

0,410

0,200

0,170

0,720

0,620

0,500

0,450

0,160

46

0,620

**

0,360

0,100

0,250

47

0,700

0,770

0,460

0,540

0,340

0,670

0,790

0,340

0,100

0,400

0,720

0,740

0,410

0,070

0,400

**

0,770

**

**

0,260

48

La Ceiba

49
50

Morroco

** Hace referencia a reas sin informacin por presencia de nubes en los perodos evaluados.

Tabla 11. Puntos rojos (hot spots) con evidencia de alteracin en sedimentos para el ndice MNDWI.

70

2014

UNODC - MINJUSTICIA

Mapa 9. Deteccin de la alteracin de sedimentos suspendidos mediante ndices espectrales (MNDWI 2014).

.
!

330'N

20
km

Baquiro

.
!

9 !
. 11

.
!

.
!

10

.
!

69W

.
!

.
!!
.

17
Sabanita
.
!
Sabanita
Nuevo

Punta
Pava
Cao
Minas

.
!

.
!

Cao
Via

16

!!.
13 .
14
. 15
. 12 .
!
! !

Matraca

Barranco
Mina

Coordenadas geogrficas WGS 84

. !
!
.8

.
!

Brasil

Venezuela

69W

18

.
!
.
!

Danta

.
!

Alta

Media

Sedimentacin
Baja

MNDWI*
2014

Comunidades
Puntos de muestra

.
!

!
.

6830'W

.
29 !
.!
30

Lmites internacionales

Unidad RAMSAR

Ros

6830'W

Puerto
32
.
!
Colombia

.
!

.
!
39

38

.
!

.
!

68W

34

.
!
36

! 35
.

MNDWI: Modification for Normalized


Difference Water Index

Venado
!
.

.
!

36

! 39
.

.
!

.
!

Cacahual

Ceiba

Remanso
.
!
37

. Paloma
!

Lmites departamentales

Cerro
.
!

33

.
!

. La
!

48 !
.
47

49

.
!

46
.
!
43
45
.
!
.
!
.
!
42 !
. 44
.
!
.
Huesito !
. 41
!

Cao
Tonina

68W

. Morroco
!
. !.
!

Rosa

!
.
Remanso
.
!
. 35
. 34!
! !
.
!
33!..
.
!
37

Inrida

Punta de
.
!
Cerro
Yaca
.
!
31
Chorro
. Piedra Alta
!
Bocn !
.
.
!
. Sejalito
!

25
.!.28
27!
.
!
24
. .
!
Zamuro
23 .
.
!
!
!
.
!
26 !. Sabanita

Morroco
Nuevo

19 !
. 20

.
!

.
!

21

Morroco
22
Viejo .
.!
!

GUAINA

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC y SINCHI


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

.
!

Arenales

Guacamaya

.
!

.
!

.
!

.
!

Per

.
!
.
!
2 Zancudo

Ecuador

Ocano
Pacfico

Mar Caribe

Morichal

3N

330'N
3N

5HVXOWDGRGHODHYDOXDFLyQGHtQGLFHV
HVSHFWUDOHVSDUDODGHWHUPLQDFLyQGH
DOWHUDFLyQGHVHGLPHQWRVHQHOUtR,QtULGD
Para la deteccin de las alteraciones en sedimentos se
realiz un proceso de modelamiento posterior al clculo

de los ndices; este modelo es capaz de extraer los


valores a tablas y generar una capa tipo raster de los
ndices que cumplan con los valores que determinan la
alteracin de sedimentos suspendidos44, como se indica
a continuacin.

Modelo.

Ilustracin 9. Modelo para la evaluacin de ndices espectrales.

8QDYH]HMHFXWDGRHOPRGHORVHUHDOL]yXQDFODVLFDFLyQ utilizando la distancia mnima entre los valores de


no supervisada de los raster resultantes, haciendo uso GDWRVSHUPLWLHQGRFODVLFDUORVUHVXOWDGRVH[WUDtGRVHQ
del algoritmo K-Means, el cual realiza la agrupacin diferentes clases.

Foto 4. Balsa de explotacin de oro de aluvin sobre el ro Inrida.

'HHVWDPDQHUDVHSXHGHQLGHQWLFDU]RQDVGHVWDFDGDV
(hot-spots) donde la alteracin de sedimentos es
claramente detectable. La informacin obtenida puede
VHU YHULFDGD \ YDOLGDGD FRQ LQIRUPDFLyQ VHFXQGDULD
(la maquinaria utilizada para explotacin de oro sobre
fuentes hdricas permanecen de 7 a 30 das en una misma
zona, por lo cual la evidencia de afectacin puede ser
detectable); el hallazgo de coincidencias satisfactorias
determinara que es posible la deteccin de la actividad
de explotacin de oro de aluvin sobre fuentes hdricas
usando la metodologa propuesta.

72

UNODC - MINJUSTICIA

$VRFLDFLyQGHGDWRVREWHQLGRVFRQ
LQIRUPDFLyQVHFXQGDULD
Como parte de la validacin de la robustez de la
aplicacin de ndices espectrales se obtuvo informacin
correspondiente a operaciones de control e interdiccin
de la Armada Nacional de Colombia, y se realizaron
talleres de aproximacin sobre lugares de exploracin y
explotacin de oro de aluvin con entidades y mineros de
la regin de estudio; utilizando los resultados obtenidos
44. Los valores correspondientes a alteracin de sedimentos suspendidos para el ro
Inrida y el ndice MNDWI son todos aquellos menores a 0,48.

en el piloto se realiz un anlisis de correspondencia


espacial entre la informacin obtenida de los ndices y la
informacin secundaria. En el siguiente mapa se pueden
observar sectores del ro donde se evidencia la alteracin
de sedimentos para el ao 2014 como evidencia de la
aplicacin del ndice MNDWI. Las tonalidades de rojo
evidencian una mayor alteracin de los sedimentos;
dichos sectores coinciden con zonas de explotacin de
oro sobre el ro Inrida segn informacin secundaria.
Cabe destacar que, segn los mineros de la regin, para
la explotacin de oro se realizan labores de pesquisa
(las balsas exploran a lo largo del ro en busca de oro)
HQJUXSRVGHWUHVRFXDWUREDOVDVXQDYH]LGHQWLFDGRHO
sitio de explotacin se establecen durante el tiempo que
consideren que la produccin de oro es viable econmica
y productivamente (de 7 a 30 das); este tiempo es
VXFLHQWH SDUD TXH VH IRUPHQ DOWHUDFLRQHV HQ ORV UtRV
que se pueden detectar mediante percepcin remota y el
clculos de los ndices .
Conclusiones del estudio piloto
&RPRFRQFOXVLyQVHDUPDTXHGHDFXHUGRDODQiOLVLVGH
la regin del ro Inrida, es posible realizar la deteccin de
cambios por sedimentacin debidos a la explotacin de
oro de aluvin sobre fuentes hdricas; el ndice que mejor
representa las alteraciones y concuerda con informacin
secundaria es el MNDWI para la zona de estudio.
Los ndices manejan un rango espectral del visible y de los
infrarrojos, por lo que se pueden aprovechar an ms con
imgenes de mayor resolucin espacial y radiomtrica.
El uso de ndices espectrales es aplicable a nivel
nacional, salvo que para ello se deben tener en
FXHQWD ODV FDUDFWHUtVWLFDV JHRJUiFDV KLGURJUiFDV \
meteorolgicas de cada regin de estudio, as como los
tiempos de seleccin de imgenes para la extraccin de
valores digitales con la menor afectacin espectral.
Es importante validar la metodologa con talleres de
campo en cada zona de estudio, para que la aplicacin
de ndices espectrales como metodologa de deteccin
de alteracin de sedimentos por causa de la explotacin
mineral sobre cuerpos de agua sea extendida y replicada,
DXPHQWDQGRVXFRQDELOLGDG\UREXVWH]

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

73

6820'W
Mar Caribe

Ocano
Pacfico

Per

!
.

Venezuela

Brasil

Sejalito

!
.

Chorro
!
.
Bocn

!
.
!
.

Ca

o Sa n J oaq u n
6810'W

Piedra
Alta

!
.

Inrida

pina
Ca o Es

6810'W

Ca

nrida
R o I
Cerro

GUAINA

!
.

To

ni

Ca

!
.

68W

Remanso

Ca
o

G en
t

a o
C as

abi

C ao G en t e

ac
uas avi
R o G

Ca

Puerto

a
o S
nt
a

** La informacin que hace parte de


cartografa social fue obtenida mediante
talleres con instituciones y
mineros de la regin.

Venado

!
.

68W

!
.

.
!
. !

MNDWI: Modification for Normalized


Difference Water Index

Lmites internacionales
Lmites departamentales

14 Balsas

Zona de minera indgena - 2010


Zona de mineria - Mineros
Ros

10

Operaciones Armada 2011 - 2015


Zona de mineria - Instituciones

Comunidades

Cartografa social**

!
.
!
.
!
.

320'N

310'N

Ecuador

Zamuro

!
.

Coordenadas geogrficas WGS 84

6820'W

MNDWI*
2014

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC y SINCHI


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Sedimentacin
Baja
Media
Alta

Ca

320'N
310'N

Mapa 10. Deteccin de la alteracin de sedimentos suspendidos mediante ndices espectrales (MNDWI 2014) con superposicin de cartografa social.

DINMICA ESPACIAL DE
COBERTURAS EN TORNO A

ACTIVIDADES DE EXPLOTACIN DE ORO DE


ALUVIN CON USO DE MAQUINARIA EN TIERRA
EN LA REGIN PACFICO (ESTUDIO DE CASO)
El anlisis multitemporal es una evaluacin de tipo
HVSDFLDOTXHFRQVLVWHHQLGHQWLFDUQRVRORORVFDPELRV
que presenta en s un fenmeno en particular, sino
tambin en relacin con las coberturas terrestres, a travs
de observaciones o lecturas que se hacen en diferentes
periodos de tiempo.

El anlisis de la dinmica espacio-temporal en la Regin


3DFLFR HVWi RULHQWDGR D L  LGHQWLFDU HO iUHD DIHFWDGD
durante el periodo de estudio; ii) determinar las coberturas
vegetales con mayor afectacin por el establecimiento
GHOIHQyPHQRLLL LGHQWLFDUODGLQiPLFDGHDIHFWDFLyQGH
VXEFXHQFDVKLGURJUiFDVLY HVWDEOHFHUORVHIHFWRVHQOD
prdida de cobertura vegetal asociada con las actividades
de explotacin de oro de aluvin y con cultivos ilcitos;
Y  LGHQWLFDU HO FRPSRUWDPLHQWR HVSDFLDO GH ORV FXOWLYRV
ilcitos y las evidencias de explotacin de oro de aluvin
en el territorio.

El permanente monitoreo durante los ltimos aos ha


evidenciado alta dinmica y expansin de las actividades
de explotacin de oro de aluvin en buena parte del
territorio colombiano, coincidiendo principalmente con la
5HJLyQ3DFtFR\&HQWUDOHQHOiUHDDIHFWDGDSRUFXOWLYRV
ilcitos [11].
(OHVWXGLRSLORWRHQOD5HJLyQGHO3DFLFRFRQWHPSODWUHV
lneas de evaluacin y anlisis. La primera tiene que ver
Con el propsito de analizar la dinmica temporal de FRQ OD  FXDQWLFDFLyQ GH ORV FDPELRV HQ iUHD XWLOL]DGD
coberturas en torno al fenmeno de explotacin de oro para el establecimiento de explotacin de oro de aluvin;
GH DOXYLyQ VH VHOHFFLRQy OD 5HJLyQ GHO 3DFLFR FRPR SDUDHVWRVHGHQLHURQODVVLJXLHQWHVWUHVFDWHJRUtDV
zona piloto. El estudio contempla cuatro cortes de tiempo: rea estable: Es el rea con evidencias de explotacin de
oro de aluvin presentes en el periodo actual (T) y en el
2001, 2006, 2011 y 2014.
periodo anterior (T-1).
Las condiciones atmosfricas que dominan la Regin
3DFtFR OD FDOLFDQ FRPR XQD GH ODV ]RQDV FRQ PD\RU rea nueva: Es el rea con evidencias de explotacin de
nubosidad en el territorio colombiano, y a que la evidencia oro de aluvin presentes en el periodo actual (T) pero no
fsica permanece visible por varios aos debido a la en el periodo anterior (T-1).
perturbacin causada en el paisaje que involucra prdida
de cobertura boscosa y alteracin de las condiciones rea abandonada: Es el rea con evidencias de
fsicas de los suelos. Por lo anterior, se usaron diferentes explotacin de oro de aluvin no presentes en el periodo
imgenes tomadas en un lapso de dos aos para las actual (T) pero presentes en el periodo anterior (T-1).
iUHDVTXHSUHVHQWDEDQQXERVLGDGFRQHOQGHUHGXFLU
las reas sin informacin por presencia de nubes y
establecer una base por periodo de evaluacin45. Los
resultados de anlisis se presentan en un marco maestro
de grillas de 1km x 1 km.
45. El monitoreo multitemporal permite realizar detecciones de acuerdo con la resolucin
temporal de las imgenes. Sin embargo se debe tener en cuenta que la regin de estudio
SHUPDQHFH JUDQ SDUWH GHO DxR FRQ FREHUWXUD GH QXEHV OR TXH GLFXOWD OD GHWHFFLyQ
Tecnologas como la de radar pueden mejorar la deteccin en estas zonas.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

75

Ilustracin 10. Dinmica del fenmeno en tres momentos.

/D VHJXQGD OtQHD VH UHHUH D OD FXDQWLFDFLyQ GH ORV rea de EVOA nueva: es el rea de evidencia presente
cambios en rea de la evidencia de explotacin de oro en el periodo actual (T) pero no en el periodo anterior
GH DOXYLyQ SDUD  HVWR VH GHQLHURQ  ODV  VLJXLHQWHV (T-1).
categoras:

rea de EVOA abandonada: es el rea de evidencia no presente en el periodo actual (T) pero presente en el periodo anterior (T-1).

Ilustracin 11. Categoras de las reas interpretadas.

76

UNODC - MINJUSTICIA

Dinmica de la EVOA
reas de anlisis

EVOA
nueva por perodo

EVOA
2001

Deteccin
de cambios

EVOA
2006

EVOA
abandonada por
perodo

GDB

EVOA
2011

Lmites
administrativos

Interseccin
zonas de inters

Zonas de manejo
especial

EVOA
2014

Subcuenca

rea afectada
2001 - 2014

Por ltimo, la tercera lnea de anlisis est relacionada explotacin de oro de aluvin, en trminos espaciales,
con el comportamiento espacial de las reas con EVOA se presenta conjuntamente en el territorio con cultivos de
dentro del territorio afectado por cultivos de coca entre coca, o por el contrario los han sustituido o relegado.
6HEXVFDLGHQWLFDUVLHOIHQyPHQRGHOD

Ilustracin 12. Esquema de procesos dinmica espacial de coberturas con nfasis en EVOA.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

77

comportamiento de las EVOA en trminos de rea durante


el periodo de estudio, a travs de las diferentes unidades
Anualmente, y desde el ao 2000, el proyecto SIMCI de territorio (Administrativas y reas de manejo especial);
KD UHDOL]DGR OD LGHQWLFDFLyQ GH FREHUWXUDV GHO VXHOR LL LGHQWLFDUODGLQiPLFDGHODV(92$H[DPLQDQGRTXp
presentes en el territorio afectado por cultivos de coca. cantidad de estas aparece en cada periodo de estudio
La interpretacin de estas coberturas se realiza por (EVOA nuevas), y cunto de la evidencia desaparece
medio de imgenes satelitales de resolucin espacial con el tiempo (EVOA abandonada); iii) examinar cmo
media, informacin con la se construye el mosaico de las EVOA interacta con el territorio de cultivos de coca.
coberturas, insumo bsico para el anlisis multitemporal. En este captulo se presentan los principales hallazgos
del anlisis.
(O3UR\HFWRFRQVWUX\yXQDOH\HQGDSURSLDSDUDLGHQWLFDU
las coberturas vegetales que pueden ser afectadas El rea afectada acumulada durante el periodo de
por la presencia de cultivos de coca, para hacer un estudio fue de 44.746 ha, pasando de 637 ha en 2001,
seguimiento de la dinmica y los cambios sobre el a 40.839 ha en 2014; esto quiere decir que 3.907 ha,
paisaje dentro del territorio. De igual manera, la leyenda estuvieron afectadas por EVOA en algn momento en
contempla coberturas de carcter antrpico (cultivos HO SHULRGR GH HVWXGLR SHUR QR OR HVWiQ PiV DO QDO GHO
lcitos, vas, centros poblados) que en conjunto apoyan la mismo. La construccin peridica de este dato permite el
caracterizacin de estas zonas.
seguimiento en la tendencia de crecimiento y expansin
del fenmeno en nuevos territorios.
MOSAICO DE COBERTURAS

Hallazgos
A partir de la deteccin de EVOA en cuatro momentos
(2001, 2006, 2011 y 2014), se construy un anlisis
multitemporal con 3 propsitos: i) analizar el

El rea afectada por periodo es equivalente al territorio


nuevo con EVOA; en este sentido, el periodo 2011 - 2014
es el de mayor expansin del fenmeno en la regin, con
KDGHQXHYDV(92$VLWXDFLyQTXHVHYHULFDHQ
el siguiente mapa.

Conceptos:
rea afectada acumulada: FRUUHVSRQGHDODVXPDJHRJUiFDGHODViUHDVDIHFWDGDVSRUSHULRGR
rea afectada por periodo: corresponde a zonas de la regin que presentaron evidencias de
explotacin de oro de aluvin y que en periodos anteriores no se detectaron.

78

UNODC - MINJUSTICIA

200176W

78W

200676W

78W

Acandi

Acandi

Unguia

Unguia

8N

Crdoba

PANAM

8N

8N

8N

PANAM

Crdoba

Riosucio

Riosucio

Jurado

Jurado
Carmen del
Darien

Carmen del
Darien

Antioquia

Antioquia
Bojaya

Bojaya

Bahia
Solano

Bahia
Solano

6N

Medio
Atrato

6N

6N

6N

Medio
Atrato

Quibdo

Quibdo

Ocano
Pacfico

Alto
Baudo
Nuqui

Rio
Quito

Atrato

Ocano
Pacfico

Lloro
Bagado

Bajo
Baudo

Tado

Alto
Baudo
Rio
Quito

Nuqui

Condoto

Risaralda

Tado

Condoto

San Jose
del Palmar

San Jose
del Palmar
Novita

Sipi

Sipi

Istmina

rea afectada con evidencia


de explotacin entre 2001 - 2006

Valle

Litoral del
Bajo San

Lmites departamentales

Litoral del
Bajo San

Valle

Lmites departamentales

Lmites municipales

78W

76W

4N

4N

Risaralda

Rio Iro

Istmina

Lmites municipales

78W

201176W

78W

76W

201476W

78W

Acandi

Acandi

Unguia

Unguia

8N

PANAM

8N

8N

PANAM

8N

Bagado

Medio
Baudo

Novita

rea afectada con evidencia


de explotacin en 2001

Lloro

Bajo
Baudo

Rio Iro
Medio
Baudo

Atrato

Crdoba

Crdoba

Riosucio

Riosucio

Jurado

Jurado
Carmen del
Darien

Carmen del
Darien

Antioquia
Antioquia
Bojaya

Bojaya

Bahia
Solano

Ocano
Pacfico

Quibdo

Medio
Atrato

Ocano
Pacfico

Quibdo

Alto
Baudo

Alto
Baudo
Rio
Quito

Nuqui

Atrato

Rio
Quito

Nuqui

Lloro
Bagado

Bajo
Baudo

Tado

Atrato

Risaralda

Bagado

Tado

Condoto

Medio
Baudo

Caldas

Litoral del
Bajo San

Novita

Sipi

Istmina

rea afectada con evidencia


de explotacin entre 2001 - 2014

Valle

78W

Litoral del
Bajo San

Sipi

Valle

Lmites departamentales
76W

4N

4N

Lmites departamentales
Lmites municipales

Caldas

Condoto
San Jose
del Palmar

Novita

Istmina

Risaralda

Rio Iro

San Jose
del Palmar

rea afectada con evidencia


de explotacin entre 2001 - 2011

Lloro

Bajo
Baudo

Rio Iro
Medio
Baudo

6N

6N

6N

Medio
Atrato

6N

Bahia
Solano

Lmites municipales

78W

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

0DSDUHDDIHFWDGDDFXPXODGDSRUSHULRGR5HJLyQ3DFtFR

76W

Por otra parte, la diferencia entre EVOA y el rea afectada


por periodo, indica la cantidad de rea que ya haba sido
afectada por EVOA y que se mantiene afectada en el
SHULRGRGHUHIHUHQFLDORDQWHULRUVLJQLFDTXHOD(92$
perdura en el tiempo. A manera de ejemplo, la diferencia

entre EVOA y rea afectada en el ao 2014, corresponde


a 5.408 ha que en algn periodo anterior ya haban sido
afectadas para el establecimiento de actividades de
explotacin antes del 2014.

*Se considera el 2001 como el periodo de inicio del estudio esto no implica que en aos anteriores no se realizaran actividades de minera

*UiFR(92$DIHFWDFLyQSRUSHULRGR\DIHFWDFLyQDFXPXODGD3DFtFR

/DH[SORWDFLyQGHRURGHDOXYLyQHQHO3DFtFRFRORPELDQR
ha existido desde la poca de la conquista [35]. Sin
embargo, como resultado de la deteccin de EVOA,
se concluye que esta actividad se ha incrementado de
manera exponencial en la ltima dcada (Ver siguiente
JUiFR SXHVWRTXHSDVyGHWHQHUKDHQHOD
40.839 en el 2014. El comportamiento del incremento
durante el primer quinquenio se multiplic por 10,
mientras que al tomar todo el periodo como referencia se
increment 65 veces.

(VWHLQFUHPHQWRGHiUHDVHPDQLHVWDHQHODXPHQWRGHO
nmero de zonas continuas intervenidas para actividades
de explotacin mineral: mientras en el ao 2001 se
detectaron 259 sitios de evidencia que representan 637
hectreas, para el ao 2014 se increment a 2.559
sitios que cubrieron un total de 40.839 ha. Por otra parte,
durante el periodo de estudio se pas de un promedio en
rea de EVOA de 2,5 ha a 16 ha.

*UiFRUHDGH(92$SRUDxR5HJLyQ3DFtFR

El incremento de EVOA en la regin coincide con que


el precio del oro experiment una tendencia alcista;
segn el Banco de la Republica, el gramo paso de valer
$16.700 en enero del 2.000 a $20.025 un ao despus,
en 2004 alcanz los $37.300 y en 2.013 los $86.900.

80

UNODC - MINJUSTICIA

El alza se congel en 2014 y el gramo bajo a $70.000,


pero el aumento del precio del dlar termin disparando
nuevamente el precio del oro, que en agosto del 2015
DOFDQ]yORV(VWDWHQGHQFLDDOFLVWD JUiFR 
gener una avalancha de poblacin proveniente de otras

regiones del pas con retroexcavadoras y dragas que


permiten extraer el mineral en grandes cantidades [36].
Segn Codechoc, en el 2013 haba 54 dragas trabajando
en la explotacin aurfera en todo el departamento, 184
% ms en relacin con el nmero que haba en el 2012
[37]. Esta llegada masiva de maquinaria ha conducido
a que las prcticas artesanales sean desplazadas

por la explotacin mecanizada, y ejerzan presin en


la transformacin de la relaciones de los pobladores
originales con el territorio.

*UiFR5HODFLyQ(92$SUHFLRV\SURGXFFLyQGHORUR

Fuente produccin: Banco de la Repblica, Ministerio de Minas y Energa, Minercol, Ingeominas (2004-2011), Servicio Geolgico Colombiano (2012 en adelante). Nota: Los datos del
2015 actualizados a primer trimestre. Fuente precios: Departamento Tcnico Industrial de la Subgerencia Industrial y de Tesorera del Banco de la Repblica.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

81


Cesar
78W

8N

Sucre

76W

Bolvar

Crdoba

PANAM

Cesar

74W
2006

8N

74W
2001
Bolvar

Crdoba

PANAM

8N

Sucre

76W

8N

78W

Antioquia
Antioquia

Medelln

Medelln

6N

Santander

6N

6N

6N

Santander

Boyac

Boyac
Choc

Choc

Caldas

Risaralda

Caldas

Risaralda

Ocano
Pacfico

Cundinamarca
Bogot

Cundinamarca
Bogot

Quindo

Quindo

4N

Tolima

4N

4N

4N

Ocano
Pacfico
Tolima

Valle

Valle

Cali

Cali

Cauca

Neiva

Meta

Neiva

Meta

Huila

Huila

Popayn

Popayn

2N

Tumaco

2N

2N

2N

Cauca

Tumaco

Florencia

Florencia

Nario

Nario
Pasto

Caquet

Pasto

Mocoa

ECUADOR

ECUADOR

Putumayo

78W

Caquet

Mocoa

76W
Puerto Ass

Putumayo

74W

78W

Cesar
74W

78W

76W
Puerto
Ass

74W

Sucre

76W

Antioquia

Cesar

74W
2014
Bolvar

Crdoba

PANAM

8N

Bolvar

Crdoba

PANAM

2011

8N

Sucre

76W

8N

8N

78W

Antioquia

Medelln

Medelln

Santander

6N

6N

6N

6N

Santander

Boyac

Choc

Boyac
Choc
Caldas

Risaralda

Caldas

Cundinamarca

Cundinamarca
Bogot

Risaralda
Bogot
Quindo

Quindo

4N

4N

4N

Tolima

Tolima
Valle

Valle
Cali

Cali

Neiva

Meta

Neiva

Cauca

2N

2N

2N

Popayn

Cauca

2N

Popayn

Tumaco

Tumaco
Florencia

Florencia
Nario

Nario
Pasto

Caquet

Mocoa

Pasto

ECUADOR

Putumayo
78W

Meta

Huila

Huila

ECUADOR

4N

Ocano
Pacfico

Ocano
Pacfico

76W
Puerto
Ass

74W

Caquet
Mocoa

Putumayo

78W

76W
Puerto
Ass

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Densidad Evidencia Explotacin

(ha/km)

0.1 - 1.0

1.1 - 5.0

Mapa 12. Densidad de EVOA en la regin de estudio.

> 5.0

74W

'HSDUWDPHQWRGHO&KRFy
Los resultados para Choc muestran que el departamento
ha tenido un incremento de EVOA superior al de los dems
departamentos de la regin, al pasar de 302 hectreas en
el 2001, a 36.185 en el 2014. Choc est conformado
por 30 municipios, de los cuales 28 han tenido EVOA en
algn momento durante el perodo de estudio; solo los
municipios de Baha Solano y Jurad no han presentado
EVOA durante el periodo 2001-2014.
7DOFRPRVHREVHUYDHQHOJUiFRUHDGH(92$SRU
DxR5HJLyQ3DFtFRHQHOSULPHUTXLQTXHQLROD(92$
se multiplic 19 veces, lo que representa el mayor
incremento en trminos de porcentaje frente a los dems
periodos; ahora bien, al analizar todo el periodo de estudio
(2001 y 2014) el fenmeno se multiplic 120 veces. En
trminos generales, el incremento en el departamento del
Choc representa el de la regin; en efecto, a partir del
ao 2006, estos aumentos han llevado a que en promedio

el rea de EVOA del departamento corresponda al 90 %


del total de la regin, y la evidencia del periodo 2014
represente el 46% del rea en todo el pas. Un efecto
inmediato del incremento es la generacin de grandes
cantidades de parches en los bosques del departamento,
principalmente en direccin suroriente, que una dcada
atrs eran constituidos por grandes bloques continuos
de masas boscosas climcicas. Como resultado de
este incremento se concluye que en el departamento se
concentra tanto la expansin del rea afectada, como las
nuevas reas de EVOA de la regin.
En referencia al periodo de estudio, el comportamiento
de expansin del fenmeno en el departamento tiene
como foco de inicio el municipio de Nvita, junto a lo
que hoy se conoce como el distrito minero de Istmina
(Bagad, Condoto, Istmina, Sip y Tad), a lo largo del
Ro San Juan en direccin norte por los municipios que
atraviesan los ros Quito (Quibd, Cantn de San Pablo)
y Atrato, principalmente en el municipio de Medio Atrato.

*UiFR(92$SRUGHSDUWDPHQWR3DFtFR

Departamento de Nario
El departamento de Nario es el segundo en rea de
EVOA dentro de la regin, al pasar de 242 hectreas
en el 2001 a 1.676 en el 2014; su mayor incremento,
aproximadamente de 4,5 veces, se present en el
periodo 2011-2014, mientras que en los primeros periodos
mantuvo una tendencia de estabilidad.
En referencia al periodo de estudio, el comportamiento
de expansin del fenmeno dentro del departamento
tiene sus inicios de focalizacin en los municipios
de Barbacoas y Mag, en riveras del Ro Telemb,
XWLOL]DQGRDXHQWHVGHO5tR7HOHPEtFRPR5tR<DFXOD\
Ro Gelmamb para expandirse. Otro foco de expansin

se encuentra entre los lmites de los municipios de Santa


Brbara y el Charco.
Barbacoas es el municipio de mayor crecimiento en el
departamento, pasando de 94 hectreas en el 2001, a
966 en el 2014.
Departamento del Valle
El departamento del Valle es el tercero en crecimiento
en rea de EVOA dentro de la regin, al pasar de 20
hectreas en el 2001 a 1.570 en el 2014. Su mayor
incremento, aproximadamente 4,5 veces, se present en
el periodo 2011-2014.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

83

En referencia al periodo de estudio y a diferencia de los


dems departamentos, el comportamiento del fenmeno
est concentrado principalmente en el municipio de
Buenaventura. Los inicios de la actividad se dieron en
las riveras del Ro Dagua, y su expansin se dio en la
direccin sur del municipio a travs de los ros Anchicay,
Mayorqun y Raposo.
Departamento del Cauca
El departamento del Cauca es el de menor crecimiento en
rea de EVOA en la regin, al pasar de 74 hectreas en el
2001 a 1.408 en el 2014. Al igual que los departamentos
de Nario y Valle, su mayor incremento, aproximadamente
4 veces, se present en el periodo 2011-2014.
La expansin del fenmeno dentro del departamento
durante el perodo de estudio tiene sus inicios en
el municipio de Lpez, a lo largo de la rivera del Ro
Micay. Su principal expansin se dio en direccin sur del

departamento, afectando principalmente los municipios


costeros de Timbiqu y Guapi a travs de los ros
7LPELTXtH,VFXDQGp\DOJXQRVGHVXVDXHQWHVFRPR
se observa en el mapa.
Un aspecto importante de la dinmica de este
departamento tiene que ver con la dispersin del
fenmeno; el Cauca es el de mayor dispersin dentro de
la regin, existiendo focos del fenmeno en municipios
del norte (Buenos Aires), centro (Pata) y sur (Santa
Rosa), focos que pueden ser considerados como alerta
para hacer el respectivo seguimiento.
$EDQGRQR\H[SDQVLyQGHODV(92$
El anlisis a realizar en este apartado corresponde a los
cambios del rea que contiene la EVOA para cada uno
de los periodos examinados a nivel del polgono en dos
aspectos: EVOA abandonada46 y EVOA nueva47.

*UiFR'LQiPLFDGHOiUHDGH(92$SRUGHSDUWDPHQWR\SRUSHULRGR3DFtFR
*Cerca de 40 % de EVOA detectada en el ao 2006 se encontr bajo nubes del ao 2011.

&RPR VH  DSUHFLD HQ HO JUiFR DUULED  HV HQ HO
departamento de Choc donde principalmente se
conjugan las diferentes dinmicas de EVOA; sobresale
la evidencia nueva entre el periodo 2011-2014, mientras
que para los dems departamentos la dinmica de EVOA
abandonada y EVOA nueva son muy similares para cada
periodo.

los cultivos de coca se presentan en los departamentos


de Choc y Valle, que mantienen una tendencia similar
durante el periodo de estudio, con excepcin del caso del
Valle del Cauca en 2008.

El departamento de Nario desde el 2006 ocupa el primer


lugar en el pas con mayor rea sembrada, y en el 2014
concentra el 67% de la regin [11]; durante el periodo de
([SORWDFLyQGHRURGHDOXYLyQ\FXOWLYRVGH estudio la variacin porcentual del rea sembrada para
coca
Nario y Cauca es similar, y de igual forma sucede con la
(OVLJXLHQWHJUiFRLQGLFDODYDULDFLyQSRUFHQWXDOGHOiUHD
sembrada con cultivos de coca con referencia al ao 2001;
al analizarlo, se observa que las mayores variaciones de

84

UNODC - MINJUSTICIA

46. Evidencia de explotacin de oro de aluvin abandonada es el rea con actividad de


explotacin no presente en el periodo actual (t) pero presente en el periodo anterior (t-1).
47. Evidencia de explotacin de oro de aluvin nueva es el rea con actividad de
explotacin presente en el periodo actual (t) pero no en el periodo anterior.

EVOA en los aos 2011 y 2014 en estos departamentos.


En el 2014 Nario presenta una relacin de 10:1 entre

rea cultivos de coca y EVOA, mientras que en Choc


esta relacin es de 1:20

*UiFR&RPSRUWDPLHQWRKLVWyULFRGHOiUHDVHPEUDGDFRQFXOWLYRVGHFRFDIUHQWHD(92$3DFtFR

Al analizar la ubicacin espacial de EVOA en los


municipios de los departamentos de Nario y Cauca, se
observa que comparte territorio con los cultivos de coca,
mientras para el departamento de Choc las EVOA en
gran proporcin no coinciden con territorios afectados por
cultivos de coca; en Choc, mientras las reas sembradas
con coca se ubican principalmente hacia el oeste, las
EVOA tienden hacia el Noreste del departamento a
travs de las zonas aluviales de los ros San Juan, Quito
y Atrato, susceptibles de inundacin, que afectaran los
cultivos de coca. (Ver Mapa de territorios afectados por
evidencias de explotacin de oro de aluvin y cultivos de
coca.)

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

85

80W

78W

76W

Crdoba
8N

8N

PANAM

Mar Caribe

Venezuela

Ocano
Pacfico

Choc
Ecuador

Brasil
Per

6N

6N

ra t o
Ro A t

Ro Cauca

Antioquia

Caldas

Risaralda

Ocano
Pacfico

4N

4N

Quindo

Tolima
Valle

R o

Ma
gd a
le na

Cauca

2N

2N

Huila

Nario
Caquet

ECUADOR
0

Putumayo

100
km
Coordenadas geogrficas WGS 84

80W

78W

76W

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Territorios afectados por evidencia


de explotacin de oro de aluvin y
cultivos de coca 2014

Sin cultivos de Coca / Con evidencia de explotacin de oro de aluvin


Con cultivos de coca / Sin evidencia de explotacin de oro de aluvin
Con cultivos de coca / Con evidencia de explotacin de oro de aluvin

Lmites internacionales
Lmites departamentales
Nota: La representacin de la evidencia de explotacin
de oro de aluvin y cultivos de coca
se realiza en grillas de 5km x 5km

0DSD7HUULWRULRDIHFWDGRSRU(92$\FXOWLYRVGHFRFD5HJLyQ3DFtFR

Departamento

* Choco

Nario

Valle

Cauca

Municipio

EVOA 2014
(ha)

Cultivos de coca 2014


(ha)

Nvita

5.175

53

Istmina

5.069

517

Condoto

4.543

10

Cantn del San Pablo

4.024

50

Quibd

2.840

Unin Panamericana

2.468

Medio Atrato

2.405

Barbacoas

966

1.130

Mag

306

586

Santa Barbara

179

368

Roberto Payn

89

1.147

Tumaco

79

8.963

El Charco

56

1.263

1.542

539

Timbiqu

458

572

Lpez

341

686

La Sierra

139

El Tambo

104

2.522

Buenaventura

Tabla 12. Principales municipios con EVOA y su relacin con cultivos de coca en 2014.
*Las reas de EVOA nueva superior a 2.000 hectreas representa el 72 % de EVOA nueva del departamento

(O VLJXLHQWH JUiFR PXHVWUD GRV DVSHFWRV HO SULPHUR


la participacin de la presencia de EVOA dentro de los
Consejos comunitarios a nivel porcentual, que pas
De los 16 Parques Nacionales Naturales que se de 73% a 90% entre el 2001-2014; el segundo, que el
HQFXHQWUDQGHQWURGHOD5HJLyQ3DFtFRVyORHQGRVGH nmero de Consejos comunitarios afectados se triplic.
ellos se detect EVOA, representada en 7 hectreas que Como resultado de este incremento para el ao 2014,
corresponden al 0.02% del total de la regin, donde el de los 144 consejos que se encuentran en la regin, el
Parque Nacional Natural Los Katos es el ms afectado 49% est afectado. Con respecto a las EVOA que no se
con 5 ha en 2014. La principal afectacin se present encuentra al interior de los Consejos comunitarios, la
en el ao 2014. Durante los aos 2006 y 2011 no se mayor parte se encuentra ubicada a lo largo de los ros
detectaron EVOA. Para esta unidad de manejo especial, Atrato y Andagueda, en territorios donde el fenmeno se
se increment en 4 ha la afectacin entre el 2001 y 2014. expande.
=RQDVGHPDQHMRHVSHFLDOHQOD5HJLyQ
3DFtFR

Respecto a resguardos indgenas, el mayor incremento de


EVOA se presenta entre los aos 2011 y 2014, pasando
de 201 ha a 610 ha, lo que equivale a un aumento mayor
al 300%. Este incremento se observa principalmente en
los lmites de los resguardos de Ro Icho y la Quebrada
Baratudo, Ro Negua y Urada Jiguamiand. En el ao
2006 se registran las primeras EVOA, que representaron
un total de 178 ha. El 34% de los resguardos indgenas
afectados en 2014 ya estaban afectados en 2006.

Los resguardos indgenas Ro Negua ,Ro Icho


y la Quebrada Baratudo estn ubicados en una
zona de expansin de EVOA.

Uno de los principales hallazgos es que las EVOA


detectadas en la regin se encuentran ubicadas
principalmente en los Consejos comunitarios durante
todo el periodo de estudio.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

87

*UiFR3DUWLFLSDFLyQSRUFHQWXDOGH(92$HQ&RQVHMRVFRPXQLWDULRVFRQUHVSHFWRDOWRWDOGHODUHJLyQ\Q~PHUR
GH&RQVHMRVFRPXQLWDULRVDIHFWDGRV3DFtFR

88

UNODC - MINJUSTICIA

Bolvar

Crdoba

78W

2006
2006
Bolvar

Crdoba

PANAM

Cesar
74W

Sucre

76W

8N

74W
2001
2001
8N

8N

PANAM

Cesar

Sucre

76W

8N

78W

Antioquia
Antioquia

Medelln

Medelln

6N
Boyac

Boyac
Choc

Choc

Caldas

Risaralda

Santander

6N

6N

6N

Santander

Caldas

Risaralda

Ocano
Pacfico

Cundinamarca

Cundinamarca

Bogot

Bogot

Quindo

Quindo

4N

Tolima

4N

4N

4N

Ocano
Pacfico
Tolima
Valle

Valle
Cali

Cali

Cauca

Meta

Neiva

Neiva

Meta

Huila

Huila
Popayn

Popayn

2N

Tumaco

2N

2N

2N

Cauca

Tumaco
Florencia

Florencia
Nario

Nario
Caquet

Pasto

Mocoa

ECUADOR

Putumayo

78W

76W
Puerto Ass

2011
2011

78W

74W

8N

2014
2014
Bolvar

Crdoba

PANAM

Cesar
74W

Sucre

76W

Bolvar

Crdoba

PANAM

76W
Puerto
Ass

Cesar
74W

Sucre

76W

8N

8N

78W

Putumayo
78W

74W

Antioquia

8N

ECUADOR

Caquet
Mocoa

Antioquia

Medelln

Medelln

6N

Santander

6N

6N

6N

Santander

Boyac

Boyac

Choc

Choc
Caldas

Risaralda

Caldas

Risaralda

Cundinamarca

Cundinamarca
Bogot

Bogot

Quindo

Quindo

Tolima

Ocano
Pacfico
4N

4N

4N

Ocano
Pacfico

4N

Pasto

Tolima

Valle

Valle

Cali

Cali

Meta

Neiva

Meta

Neiva

Huila

Huila

Popayn

Popayn

Cauca

2N

Tumaco

2N

2N

2N

Cauca

Tumaco
Florencia

Florencia

Nario

Nario
Pasto

Caquet
Mocoa

ECUADOR

Pasto

ECUADOR

Putumayo
78W

76W
Puerto
Ass

74W

Caquet
Mocoa

Putumayo
78W

76W
Puerto
Ass

Fuentes: para evidencia de explotacin: Gobierno de Colombia - Sistema de monitoreo apoyado por UNODC. Para Consejos comunitarios: IGAC 2010
Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas.

Evidencia de explotacin
0 - 25 ha

25,1 - 100 ha
100,1 - 250 ha

> 250,1 ha
Sin evidencia de explotacin

0DSD&RQVHMRVFRPXQLWDULRVGHFRPXQLGDGHVDIURGHVFHQGLHQWHV(92$\VXEFXHQFDVHQHOSHULRGRGHHVWXGLR3DFtFR

74W

A pesar de que el nmero de subcuencas afectadas por


EVOA se duplic, pasando de 19 subcuencas en 2001 a
39 subcuencas en 2014, el fenmeno est focalizado en
las 19 subcuencas que ya estaban afectadas por EVOA
en 2001; estas se incrementaron en 38.016 ha en el
2014, con una tasa de crecimiento anual de 2.924 ha. En

las subcuencas afectadas en el ltimo perodo la tasa de


crecimiento anual fue del 8%. Es importante destacar que
mientras la expansin de las EVOA sucedi entre 2011
y 2014, la expansin de la afectacin en el nmero de
subcuencas sucedi en el periodo 2001 2006.

*UiFR(YROXFLyQGHOSRUFHQWDMHGHVXEFXHQFDVDIHFWDGDVSRU(92$3DFtFR

La siguiente tabla presenta las principales subcuencas


afectadas. Sobresale la del Ro Quito no solo por tener
la mayor rea de EVOA (30% en la regin), sino porque
all se present la expansin en mayor proporcin; en
consecuencia, para el ao 2014 el 33% de la EVOA
nueva se detect en esta cuenca.

suman 11.258 ha con EVOA, es decir que 879 ha se


encuentran fuera de los Consejos Comunitarios pero al
interior de la subcuenca. El Consejo Comunitario que
sobresale en la subcuenca es Mayor del Cantn San
Pablo Acisanp, el cual pas de 36 ha en 2001 a 4.051
ha en 2014.

Por otra parte, la subcuenca Ro Quito tiene un total


de 12.137 ha de EVOA para el 2014; en ella tienen
jurisdiccin 10 Consejos Comunitarios que en conjunto

Las 19 subcuencas afectadas con EVOA en 2001


concentran el 95% de EVOA detectada en 2014

rea de la
subcuenca ha

EVOA
2001 ha

EVOA 2006
ha

EVOA 2011
ha

EVOA 2014
ha

Ro Quito

181.666

109

1.380

2.562

12.137

Ro Taman y otros Directos San Juan

282.633

57

2.076

1.236

7.337

Ro Bebaram y otros Directos Atrato

306.640

13

321

955

5.438

Ro San Juan

298.903

42

1.234

1.452

5.231

Ro Cajn

74.293

60

432

174

3.983

SUBCUENCA

7DEOD(YROXFLyQGH(92$HQODVSULQFLSDOHVVXEFXHQFDVDIHFWDGDV5HJLyQ3DFtFR

0RGHORGH9HFWRUHVGHH[SDQVLyQFRPR
DOHUWDVGHPRYLOLGDGGHOIHQyPHQR
La informacin de EVOA en diferentes periodos de tiempo
determina la dinmica del crecimiento del fenmeno en
la regin; esto permite conocer si la actividad presenta
un patrn de expansin, y de este modo determinar qu
territorios podran ser afectados por esta actividad en el
futuro.
Los vectores de expansin son generados a partir de
la capa de los polgonos de EVOA de un tiempo inicial,
T0, en comparacin con la capa de los polgonos de un

90

UNODC - MINJUSTICIA

tiempo T1. El modelo actual compara dos aos y solo


considera como expansin si la EVOA se encuentra en el
ao base; cuando se detecta un rea con evidencia en el
DxRQDO 7 TXHQRWLHQHUHJLVWURHQDODxRLQLFLDO 7 
se marca como una nueva actividad sobre el territorio y
SRUORWDQWRQRVHLGHQWLFDQYHFWRUHV
Se consideran como expansin al aumento en rea
en cualquier direccin de EVOA ya detectadas. Las
detecciones nuevas se consideran como ampliacin
a nuevos territorios.

3DUD GHQLU XQ YHFWRU GH H[SDQVLyQ VRQ QHFHVDULD GRV


variables: 1) Direccin y 2) Magnitud. Para las evidencias
de explotacin de oro de aluvin podran encontrarse
vectores de crecimiento en todas las direcciones, por
lo cual se divide el crculo en octantes y se determina
un vector de expansin en cada octante, partiendo del
centro del polgono de la EVOA base, como se ilustra en
ODJXUDVLJXLHQWH

Octante 8

Luego, por la complejidad en la geometra de cada una


de las capas, se realiza un proceso de generalizacin y
posteriormente se obtienen los centros de los polgonos
de EVOA en el tiempo T0, y los puntos de los vrtices de
los polgonos en T1, lo que permite optimizar los clculos
en el modelo.

Octante 1

Octante 7

respecto al ao de estudio (T1); este proceso se realiza


PHGLDQWHODFRPSDUDFLyQHQWUHODSRVLFLyQJHRJUiFD\
el rea detectada de ambos aos. Como resultado se
REWLHQHQ GRV FDSDV OD SULPHUD LGHQWLFD ORV SROtJRQRV
del tiempo T0 que presentaron expansin, y la segunda
los polgonos del tiempo T1 que corresponden a las reas
de expansin. Tambin se localizan las nuevas reas con
EVOA que no tienen referencia en el tiempo T0.

Octante 2

Octante 6

Octante 3

Octante 4
Octante 5

EVOA tiempo T0
EVOA tiempo T1
Vector de expansin por octante

Figura 3. Determinacin de un vector de expansin de EVOA.


Figura 5. Ejemplo vector de expansin principal.

Una vez se tienen los puntos de las capas T1 y T0 se


calculan las distancias desde el centro del polgono en T0
hasta cada uno de los vrtices en T1, lo que genera una
WDEODGHGLVWDQFLDV&RQHVWDWDEODVHJUDFDQORVYHFWRUHV
puesto que contiene los datos de las coordenadas de los
SXQWRVLQLFLDOHVORVQDOHVODGLVWDQFLD\HOiQJXORSDUD
cada punto.

EVOA tiempo T0
EVOA tiempo T1
Zona de expansin respecto a T0
rea nueva de EVOA
Figura 4. Ejemplo expansin EVOA entre T0 y T1.

El proceso comienza al reconocer qu reas con


EVOA en el ao base (T0) presentaron un crecimiento

'HORVSRVLEOHVYHFWRUHVVHOWUDHOPD\RUYHFWRU PD\RU
distancia) por octante (segmentos de ngulo cada 45
hasta completar 360) con respecto a cada punto de
origen, es decir, con respecto a cada punto de la capa
7(VRVYHFWRUHVSDVDQSRUXQVHJXQGROWURVLPLODUDO
anterior, pero con respecto a los puntos de destino (capa
7 FRQHOQGHTXHFXDQGRH[LVWDPiVGHXQSROtJRQR
T0 incluido dentro de un polgono T1 solo queden los
8 mayores vectores dentro de ese polgono T1. Como
~OWLPRSDVRVHLGHQWLFDDOYHFWRUGHPD\RUWDPDxRSRU
capa T1, y se almacena en el atributo de tipo de vector
como principal. Este es considerado como el vector
predominante de expansin de la explotacin a cielo
abierto de oro de aluvin.
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

91

De manera general, se encontr que en el perodo 20012006 el nmero de polgonos se increment en un 119%,
El estudio de la dinmica espacial de las EVOA en en el perodo 2006-2011 en un 32%, y en el perodo
diferentes periodos de tiempo permite caracterizar el 2011- 2014 en un 241%, siendo este ltimo el de mayor
FRPSRUWDPLHQWR GHO IHQyPHQR H LGHQWLFDU UDVJRV \ incremento para el estudio, al pasar de 751 polgonos
patrones de crecimiento de la explotacin de oro de en 2011 a 2.559 polgonos en 2014. Por lo anterior, el
aluvin en los departamentos afectados, para de esta anlisis que aqu se presenta se enfoca en este ltimo
forma contar con informacin que sirva de alerta sobre lapso por la representatividad del fenmeno.
los sitos hacia los que se est moviendo la actividad.
Como se explica en la metodologa, solo se considera el
El anlisis que se propone tiene como insumo los anlisis de vectores si el polgono del ao base tiene un
SROtJRQRV GH (92$ LGHQWLFDGRV HQ ODV LPiJHQHV GH crecimiento de 90% y se sobreponen con otro respecto al
satlite para los aos del anlisis del multitemporal (2001 DxRQDO/RVUHVXOWDGRVREWHQLGRVPXHVWUDQTXHGHORV
a 2006, 2006 a 2011 y 2011 a 2014).
SROtJRQRVLGHQWLFDGRVHQHOSHULRGR
presentaron expansin.
Hallazgos

2001
Nmero de polgonos

2001-2006

2007-2011

2012-2014

259

568

751

2559

Porcentaje de incremento de polgonos

No Aplica

119%

32%

241%

Nmero de polgonos con expansin

No Aplica

148

82

464

Porcentaje de polgonos con expansin

No Aplica

57%

14%

62%

Tabla 14. Cambios en EVOA 2001, 2006, 2011 y 2014.

(Q UHODFLyQ FRQ ODV iUHDV VH LGHQWLFy TXH   
de los 51 municipios de la zona de estudio con EVOA
en 2014 presentaron expansin. El 95% de esta rea
se ubica en el departamento de Choc, consolidndolo
como el departamento con mayor expansin de EVOA,
y donde el 50% detectado en 2014 es considerado como
de expansin. El municipio de Cantn del San Pablo
presenta el 14% de dicha rea, seguido de Istmina (12%)
y Condoto (12%).
Segn los datos, Choc tiene el vector de mayor
expansin, el cual alcanz 31 kilmetros; dicha evidencia

92

UNODC - MINJUSTICIA

parti del municipio de Itsmina y lleg hasta el Cantn


de San Pablo. Para este departamento las EVOA que
presentaron una expansin promedio de 860 metros. Si
se comparan los datos regionales con este valor, el valor
promedio de expansin est 527 metros por encima de
las reportadas en los dems departamentos.
Con los vectores principales de crecimiento, en rojo en
la imagen, los ros de la zona (azul) y EVOA (naranja,
T0 y verde, T1), se construyeron vectores de tendencia,
en morado. Este ejercicio busca encontrar en lneas
generales el crecimiento del fenmeno por departamento.

Rio
Quito

Venezuela

Atrato

Mar Caribe

Venezuela

Alto
Baud

El Cantn
Del San
Pablo

CHOC

Ocano
Crtegui
Pacfico

Bagad
Ecuador

Brasil
Per

Ecuador

Brasil
Per

Tad

Rio Ir

Condoto

Istmina
Medio
San Juan
Nvita

San Jos
Del Palmar
0

10
km

Coordenadas geogrficas WGS 84

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Evidencia de explotacin T- 0

Vectores de expansin 2009-2014

Ros

Principal

Evidencia de explotacin T- 1

Vector de tendencia

Ilustracin 13. Vectores de tendencia.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

93

&KRFy
a
ad
br da
ue za
Q ue
Q

u o
e
y

Ro
Bebar

Ro Bebaram
6N

6N

Medio
Atrato

CHOC

R
o

A
t r a

o P
u

Ro
ot
Nem

Alto
Baud

Quito

Ta

El Cantn
Del San
Pablo

ri

Atrato

co o
d

t o

Para Choc se evidencian tres procesos de expansin.


El primero en los municipios de Medio Atrato y Quibd,
principalmente por los ros Negu, Berbaram y Bebar,
de la misma subcuenca; para los dos primeros ros la
direccin de expansin es en sentido noreste, con lmites
en el municipio de Urrao (Antioquia); para el ltimo la direccin es suroriental, aguas abajo del ro Berbar hacia
su desembocadura en el Atrato.

Crtegui

Ce

rt

eg

u
Bagad

Figura 6. Vectores de tendencia EVOA en Choc (1); rojo (principal),


morado (secundario).

Tad

Rio
Ir

Istmina

Ta

an

ar

ra

CHOC

Nvita

am

nc

Medio
San Juan

El segundo proceso de expansin se concentra entre los


municipios de Cantn de San Pablo, Unin Panamericana, Medio San Juan, y el norte de Istmina. Los vectores
tienen una tendencia en sentido sureste, pasando por las
cuencas de los ros Quito, San Juan y Taman. Esta zona
presenta los mayores vectores de expansin de todo el
pas.

Figura 7. Vectores de tendencia EVOA en Choc (2); rojo (principal),


morado (secundario).

Valle del Cauca

VALLE

Quebrada P
o

Rio

le

ic

Za

ba

Ro A
g

Ro
Ag

ua

cl

ar

it

ua

ca

ta

b
ra

da
So

UNODC - MINJUSTICIA

94

ta

Buenaventura

Ro Raposo

Es este departamento la expansin est asociada al creFLPLHQWR GH SHTXHxRV Q~FOHRV LGHQWLFDGRV HQ HO 
en los ros Dagua, Anchicay, Raposo y Mayorqun, que
fueron creciendo a lo largo de los cauces. Es de resaltar
que en el Valle no se evidencian grandes procesos de
H[SDQVLyQSXHVWRTXHFDGDXQRGHORVYHFWRUHVLGHQWLFDGRVQRDWUDYLHVDFXHQFDVQLEXVFDQXHYRVDXHQWHV\
las direcciones del proceso se presentan linealmente por
el cauce del ro afectado.

le

ay

En el Valle del Cauca la mayor expansin alcanz 5 kilmetros y se ubic en el municipio de Buenaventura. Es el
segundo departamento con vectores de expansin ms
largos (590 metros en promedio).

Por ltimo, en el municipio de Nvita se presenta una tendencia expansiva en sentido suroeste, aguas abajo del
7DPDQiSDVDQGRSRUDXHQWHVSHTXHxRVSDUDXQLUVH
a ro Cajn y afectar otra subcuenca ms.

Figura 8. Vectores de tendencia EVOA en Valle del Cauca; rojo


(principal), morado (secundario).

Cauca
a
ad
br al
ue roz
o
C

Timbiqu

Lpez

ada a
ebr
s
Qu a Ro
nt
Sa
ito
ac
Br
a
ad
br
ue
Q

El

Ac

hi

ot

Quebrada
Cupi

CAUCA

Ro
ija

Ro Jo
li

Sa

o
Sa
n
J

e
a d

fi

qu

or
l N

Y
a

Estero
El Loro

at
o P

In

bi

t
n

te

Q
ue
b
Ti Bra ra
d
m
bi zo a
qu

Guapi

Ro

Q
.
et
e

Ti

o
R ey
bu

Bu

Se evidenci un crecimiento de la EVOA en los ros Micay (Brazo Noanamito), Saija y Timbiqu; al igual que en
el departamento del Valle, los vectores no traspasan las
FXHQFDV QL EXVFDQ QXHYRV DXHQWHV /D WHQGHQFLD HQ
los dos primeros ros es aguas arriba, mientras que en el
ro Timbiqu se dirige hacia el centro poblado de Coteje,
siendo esta ltima la lnea de expansin ms representativa del departamento.

a
d o
ra lag
b
e i
u
Q rc
u
M

En el Cauca el vector de expansin ms grande alcanz


1.5 kilmetros, ubicado en el municipio de Timbiqu. Para
este departamento los polgonos con crecimiento solo alcanzaron 272 metros.

Ro

Mer
aj

Figura 9. Vectores de tendencia EVOA en Cauca; rojo (principal),


morado (secundario).

Nario
Por ltimo, en Nario los vectores de expansin son
de magnitudes muy pequeas, por lo cual no se logr
LGHQWLFDU YHFWRUHV GH WHQGHQFLD HQ HO GHSDUWDPHQWR
Segn los datos de permanencia, en el perodo
analizado se present un proceso de colonizacin que
desencaden una mayor cantidad de polgonos nuevos
que de procesos de expansin; para este departamento
los polgonos que reportaron crecimiento fueron de 230
metros en promedio.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

95

RIESGO DE AFECTACIN EN LAS


POBLACIONES POR ACUMULACIN

DE SLIDOS EN SUSPENSIN POR PRESENCIA


DE ACTIVIDADES DE EXPLOTACIN DE ORO
DE ALUVIN EN EL PACFICO COLOMBIANO
(ESTUDIO DE CASO)
Las actividades de explotacin mecanizada de oro
de aluvin alteran la carga normal de sedimentos en
suspensin en los cuerpos hdricos. Esta alteracin por
s sola, sin tener en cuenta sedimentos contaminados
por el uso de sustancias qumicas en las actividades
de explotacin, genera mltiples efectos sobre el medio
ambiente, entre ellos:

La perturbacin fsica de las caractersticas


hidrulicas de los cauces que favorecen las inundaciones
y prdida de navegabilidad por reduccin de la
profundidad. [38].

El aumento de los sedimentos en suspensin,


lo que genera mayor turbidez y por ende reduccin de
la penetracin de la luz necesaria para los procesos
de fotosntesis y cambios en el calor de radiacin. La
turbidez es el cambio fsico ms importante generado
sobre la calidad del agua [39].

En niveles altos de turbidez, el agua pierde


la habilidad de apoyar la diversidad de organismos
acuticos, aumenta la temperatura al sostener partculas
que absorben el calor de la luz solar y el agua caliente
conserva menos oxgeno que el agua fra, as al entrar
menos luz disminuye la fotosntesis necesaria para
producir oxgeno [40]. Otro efecto asociado a la turbidez
es la obstruccin de las agallas de los peces por los
slidos suspendidos, reduccin del crecimiento y la
resistencia a las enfermedades, al igual que limita el
desarrollo de huevos y larvas [41].

Acumulacin de sedimentos aguas abajo de las


actividades de explotacin, lo que repercute directamente
sobre las poblaciones ribereas que se surten de los
cuerpos hdricos para el consumo de agua, riego,
mantenimiento de animales y pesca, entre otros.

96

UNODC - MINJUSTICIA

Lo anterior se relaciona directamente con los


ecosistemas de manglar, que se encuentran a lo largo
GH OD IUDQMD GHO OLWRUDO SDFtFR \ FRQVWLWX\HQ ]RQDV GH
desove y desarrollo de gran variedad de fauna asociada
y los hacen uno de los ecosistemas ms productivos del
SODQHWD 3DUD HO 3DFtFR FRORPELDQR VH KDQ UHSRUWDGR
380 especies de peces que entran a los estuarios o
habitan en ellos [4].
El presente estudio desarrolla una propuesta metodolgica
RULHQWDGD D LGHQWLFDU HO ULHVJR SRWHQFLDO GH DIHFWDFLyQ
SRUXMRV\DFXPXODFLyQGHVHGLPHQWRVGHULYDGRVGHOD
explotacin de oro de aluvin, en funcin de la longitud
GHORVUtRVSHUWHQHFLHQWHVDXQDPLVPDXQLGDGJHRJUiFD
GH DQiOLVLV =XE]RQD +LGURJUiFD VXEFXHQFD  SDUD
determinar posteriormente las poblaciones que pueden
presentar riesgos por la acumulacin de slidos en el
agua mediante el anlisis de las capas resultantes. Esta
metodologa parte de los siguientes insumos: i) Modelo
Digital de Elevacin (DEM)48, ii) Deteccin de EVOA,
LLL  /tPLWHV GH PLFURFXHQFDV KLGURJUiFDV \ LY  &HQWURV
poblados. En general, se puede dividir en cuatro etapas:
la primera es la generacin de drenajes a partir del modelo
digital de elevacin, la segunda el clculo de afectacin
HQORVUtRV\HOFiOFXORGHDFXPXODFLyQGHXMRODWHUFHUD
determinar las microcuencas de descarga, y la cuarta el
anlisis de los datos resultantes. El siguiente esquema
presenta dicho procedimiento.

48. Estructura numrica de datos que representa la distribucin espacial de la altitud de


ODVXSHUFLHGHOWHUUHQR>@

EVOA

EVOA

EVOA

relacin con los centros poblados. Anlisis del Riesgo de


afectacin en las poblaciones por acumulacin de slidos
en suspensin por presencia de EVOA en las fuentes
hdricas

Ilustracin 14. Riesgo de afectacin en las poblaciones por acumulacin de slidos en suspensin por presencia de EVOA en las fuentes
hdricas50

debajo. Luego se agrupan los pixeles que en el valor


GHDFXPXODFLyQHVWpQSRUDUULEDGHXQOtPLWHHVSHFtFR
Para obtener los drenajes a partir del modelo digital de SDUD SRVWHULRUPHQWH GHQLU ORV GUHQDMHV OD FDQWLGDG
HOHYDFLyQHVQHFHVDULRGHWHUPLQDUORVXMRVGHGLUHFFLyQ de drenajes es inversamente proporcional al lmite de
\ ORV XMRV GH DFXPXODFLyQ GH ODV DJXDV (O PDSD GH acumulacin, de modo que mientras ms alto sea el valor
DFXPXODFLyQ GH ORV XMRV VH FRQVWUX\H  D SDUWLU GH ORV de acumulacin menor cantidad de drenajes secundarios
valores de pxeles segn la pendiente y la direccin; VHREWLHQHQ\YLFHYHUVD3DUDHVWHHVWXGLRVHGHQLyXQ
este mtodo contabiliza la cantidad de pxeles que valor superior a 5.000 pxeles.
estn por encima, segn la elevacin, que vierten sobre
cada uno de los vecinos que estn inmediatamente por Por ltimo, se segmentan los drenajes mediante el
&RUHPD5HSUHVHQWDFLRQHVJUiFDVPX\HVTXHPiWLFDVEDVDGDVHQVHQFLOODVJXUDV mtodo de Horton-Strahler51TXHFRGLFDFDGDWUDPRGH
geomtricas de los elementos que conforman un espacio y de las relaciones que se
ro de manera ascendente, es decir: cuando dos drenajes
HVWDEOHFHQ HQWUH HOORV UHDOL]DGDV FRQ OD QDOLGDG GH FUHDU XQ PRGHOR HVSDFLDO SDUD
HO DQiOLVLV JHRJUiFR (VWD WpFQLFD HV PX\ HPSOHDGD HQ YDULDV UDPDV GH OD JHRJUDItD GH XQ PLVPR RUGHQ FRQX\HQ DXPHQWD HO RUGHQ GHO
humana. Tomado de: http://www.ecured.cu/index.php/Corema.
siguiente tramo de drenaje; de lo contrario, el drenaje que
50. Se basa en la adaptacin de la metodologa utilizada con la herramienta Hidrology
de ArcGIS.

Generar drenajes a partir del49DEM50

'HQHHOWDPDxRGHXQDFRUULHQWHEDViQGRVHHQODMHUDUTXtDGHORVDXHQWHV

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

97

le sigue a dos drenajes de diferente orden conservar el


orden del mayor de los drenajes que lo precede para que
DOQDOVHREWHQJDHOPDSDGHUHGGHGUHQDMHVFRGLFDGD

se podrn determinar las direcciones en las cuales los


drenajes estn aportando sedimentos que pueden ser
arrastrados a travs de la red hdrica.

$IHFWDFLyQHQORVUtRV\DFXPXODFLyQGHXMRV

Para determinar la afectacin de los ros se realiz la


interseccin entre los drenajes y las EVOA 201452, con
estos datos se asign un peso en funcin de la longitud
del ro afectado y del rea de la EVOA que lo cubre, as:

Anlisis de los resultados

Por ltimo se realiza un cruce con la capa de centros


SREODGRVSDUDLGHQWLFDUODVSREODFLRQHVDRULOODVGHORV
ros que estaran afectadas por el arrastre de sedimentos
DWUDYpVGHODUHGGHGUHQDMHVGHDFXHUGRFRQHOXMRGH
los mismos. Se espera esquematizar todo este resultado
en un corema de fcil explicacin.

Peso 1 = (a / b) * c, donde:
a: Long (m) del segmento de ro intersectado con EVOA
b:/RQJ P UtRVGHODPLFURFXHQFDGRQGHHVWiHOUtR Hallazgos
intersectado
c: rea (ha) de EVOA del tramo
Como se considera que la mayor afectacin y aporte de
sedimentos al rio est relacionada con las EVOA que
se intersectan directamente con los drenajes, el peso1
tendr una ponderacin del 75%.
Como no en todos los casos se intersectan las EVOA con
los drenajes, puesto que la metodologa para obtener los
ros puede omitir fuentes hdricas pequeas, es necesario
calcular las distancias entre estas evidencias y el ro ms
cercano53.

Peso 1 = d * e, donde:
d: rea total (ha) EVOA distanciada de un ro
e: Promedio distancias (m) de las EVOA distanciadas de
un ro
A este peso se le dar una ponderacin del 25%; as la
SRQGHUDFLyQQDOGHSHVRVHUi

El rea delimitada para el estudio comprende 8 zonas


KLGURJUiFDV TXH D VX YH] VH GLYLGHQ HQ  VXE]RQDV
KLGURJUiFDV54 que ocupan totalmente la jurisdiccin
de Choc, Valle y Quindo, as como parte de los
departamentos de Nario, Cauca, Risaralda, Caldas y
Antioquia.
El riesgo potencial para cada subcuenca al que se
exponen las poblaciones que se encuentran aguas
DEDMR GH (92$ SRU HIHFWR GH XMR \ DFXPXODFLyQ GH
sedimentos, se determina a partir de los resultados de la
deteccin55. Sin embargo, se debe tener en cuenta que la
remocin de la cobertura vegetal en el desarrollo de este
tipo de actividad extractiva aumenta la susceptibilidad
a la erosin. La susceptibilidad a la erosin es mucho
mayor en comparacin a suelos con cobertura vegetal, lo
que genera un arrastre de sedimentos hacia la corriente
hdrica as no exista actividad extractiva posterior (FAO,
1997).

La dinmica de sedimentos en una corriente hdrica


contempla la deposicin o asentamiento de una parte de
ellos, en funcin de factores asociados al tipo de suelo y
$OQDOVHREWLHQHXQDVHULHGHGUHQDMHVFRQXQRVSHVRV a las caractersticas propias de cada caudal (FAO, 1997).
que hacen referencia a la afectacin directa por presencia El presente estudio no contempla esta caracterizacin de
de evidencias de explotacin de oro de aluvin, as como la sedimentacin.
a la afectacin indirecta por cercana a EVOA.

3HVRQDO 3HVR3HVR

98

Microcuencas de descarga

La afectacin a las poblaciones considera dos premisas:

Para su determinacin es necesario calcular la cantidad de


XMRVDFXPXODGRVSRUPLFURFXHQFDSDUDSRVWHULRUPHQWH
comparar cada una, lo cual permitir conocer las que
presentan los mayores valores de acumulacin. As

1. Afectacin por distancia a las evidencias de explotacin,


es decir entre ms cerca est el centro poblado o cabecera
municipal de la evidencia mayor puede ser la afectacin.
2. Afectacin por acumulacin de descargas en varios
puntos de explotacin ubicados aguas arriba.

6HUHDOL]yXQEXIIHURiUHDGHLQXHQFLDGHPSDUDODV(92$WHQLHQGRHQFXHQWDOD
resolucin espacial del DEM y las imgenes de satlite utilizadas, el margen de error que
tiene la delimitacin de reas de explotacin de oro de aluvin, y la omisin de algunos
drenajes en la capa obtenida a partir del DEAM que pueden estar en zonas de explotacin
de oro de aluvin.
53. Se considera que las reas con evidencias de explotacin de oro de aluvin estn
aportando sedimentos a un pequeo ro que se conectar con el drenaje ms cercano
LGHQWLFDGRHQODSULPHUDSDUWHGHHVWHHMHUFLFLR

+DFHUHIHUHQFLDDOQLYHOGHMHUDUTXtDTXHVHGHQHHQODHVWUXFWXUDKLGURJUiFDSDUD
ODSODQLFDFLyQGHFXHQFDVXQD]RQDKLGURJUiFDHVWiFRPSXHVWDSRUYDULDVVXE]RQDV
KLGURJUiFDV 0LQLVWHULRGH$PELHQWH\'HVDUUROOR6RVWHQLEOH 
55. Las EVOA que involucran la explotacin aurfera con uso de maquinaria en tierra se
consideran como evidencias duraderas en razn a su permanencia en el tiempo. Es decir
la evidencia queda aunque ya no se est realizando la explotacin.

UNODC - MINJUSTICIA

Se establecieron cinco categoras relativas al riesgo de


DIHFWDFLyQ SRU XMRV \ DFXPXODFLyQ GH VHGLPHQWDFLyQ56
derivados de las actividades de explotacin de oro de
aluvin, de acuerdo con los pesos relativos calculados
para las subcuencas en relacin al peso total del rea
de estudio; los pesos fueron calculados en funcin de la
longitud de toda la red hdrica y de la extensin de las
EVOA detectadas. En la siguiente tabla se presentan las
categoras:
Riesgo de afectacin

Peso relativo

Nulo

0,00

Muy bajo

0,01 1,00

Bajo

1,01 2,00

Medio

2,01 5,00

Alto

5,01 10,00

Muy alto

> 10,00

(OPD\RUULHVJRGHDIHFWDFLyQGHULYDGRSRUORVXMRVGH
sedimentos originados en las actividades de explotacin
GHRURGHDOXYLyQHQOD5HJLyQGHO3DFtFRVHFRQFHQWUD
principalmente en las subcuencas del Atrato-Darin y del
San Juan, ubicadas respectivamente al norte y centro
GH OD 5HJLyQ GHO 3DFtFR /DV VXEFXHQFDV GHO 3DWtD \
algunas del Amarales - Dagua registran igualmente una
condicin alta de riesgo. Existen otros puntos en zonas
KLGURJUiFDVGHO&DXFD\GHO%DXGyHQODVTXHHOULHVJR
HV PHQRU HQ FRPSDUDFLyQ FRQ ODV ]RQDV KLGURJUiFDV
mencionadas inicialmente. En la siguiente tabla se
presentan los pesos relativos con su respectiva categora
de riesgo de afectacin para 41 subcuencas57, indicando
ODFRUUHVSRQGLHQWH]RQDKLGURJUiFDDODTXHSHUWHQHFHQ

Tabla 15. &DWHJRUtDVGHULHVJRSRWHQFLDOGHDIHFWDFLyQSRUXMRV\


acumulacin de sedimentos.

=RQDKLGURJUiFD

Subcuenca

Peso relativo

Categora riesgo de
afectacin

Atrato - Darin

Ro Bebaram y otros Directos Atrato

19,87

Muy alto

Atrato - Darin

Ro Quito

19,28

Muy alto

San Juan

Ro Taman y otros Directos San Juan

17,35

Muy alto

Pata

Ro Telemb

10,29

Muy alto

San Juan

Ro Cajn

3,01

Medio

%DXGy'LUHFWRV3DFtFR

Ro Baud

2,67

Medio

Amarales - Dagua - Directos

Ro San Juan del Micay

2,50

Medio

San Juan

Ro Sip

2,07

Medio

Atrato - Darin

Ro Murind - Directos al Atrato

1,48

Bajo

Pata

Ro Pata Medio

1,47

Bajo

Atrato - Darin

Ro Murr

1,27

Bajo

Atrato - Darin

Directos Atrato (mi)

0,99

Muy bajo

Pata

Ro Pata Alto

0,98

Muy bajo

Amarales - Dagua - Directos

Ro Dagua

0,97

Muy bajo

Amarales - Dagua - Directos

5tR7LPED\RWURVGLUHFWRVDO3DFtFR

0,92

Muy bajo

Amarales - Dagua - Directos

Ro Iscuand

0,86

Muy bajo

San Juan

Ro Calima

0,83

Muy bajo

Atrato - Darin

Alto Atrato

0,58

Muy bajo

Amarales - Dagua - Directos

Ro Guapi

0,54

Muy bajo

Amarales - Dagua - Directos

Ro Anchicay

0,53

Muy bajo

3DFtFR'LUHFWRV

'LUHFWRV3DFtFR)URQWHUD3DQDPi

0,46

Muy bajo

Atrato - Darin

Directos Atrato (md)

0,44

Muy bajo

Atrato - Darin

Ro Andgueda

0,43

Muy bajo

Amarales - Dagua - Directos

Ro Timbiqu

0,32

Muy bajo

56. No se calcula el volumen de sedimentos vertidos a los ros que llegan a las poblaciones.

57. No se consideran 35 subcuencas que presentaron en el estudio categora Nulo.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

99

=RQDKLGURJUiFD

Subcuenca

Peso relativo

Categora riesgo de afectacin

Amarales - Dagua - Directos

Ro Saija

0,26

Muy bajo

Atrato - Darin

Ro Tanela y otros Directos al Caribe

0,25

Muy bajo

Amarales - Dagua - Directos

Ro Naya

0,21

Muy bajo

Atrato - Darin

Ro Sucio

0,20

Muy bajo

Amarales - Dagua - Directos

Ro Tapaje

0,17

Muy bajo

%DXGy'LUHFWRV3DFtFR

5tR'RFDPSDGy\'LUHFWRV3DFtFR

0,16

Muy bajo

Atrato - Darin

Ro Bojay

0,16

Muy bajo

Atrato - Darin

Ro Salaqu y otros directos Bajo Atrato

0,15

Muy bajo

Cauca

Ro Quinamayo y otros directos al Cauca

0,14

Muy bajo

San Juan

Ro Capoma y otros directos al San Juan

0,11

Muy bajo

Cauca

Ro Palo

0,08

Muy bajo

Pata

Ro Guachicono

0,06

Muy bajo

Cauca

Ro Risaralda

0,03

Muy bajo

Cauca

Ro La Vieja

0,03

Muy bajo

Atrato - Darin

Ro Cacarica

0,01

Muy bajo

Cauca

Ro San Juan

0,01

Muy bajo

San Juan

Ro San Juan

0,01

Muy bajo

7DEOD3HVRVUHODWLYRV\FDWHJRUtDVGHULHVJRGHDIHFWDFLyQHQODVVXEFXHQFDVGHO3DFtFR

Como se mencion anteriormente, en el sector norte


GHO3DFtFRFRORPELDQRHQODV=RQDV+LGURJUiFDVGHO
Atrato-Darin y San Juan se concentra el mayor riesgo de
DIHFWDFLyQDODVSREODFLRQHVSRUORVXMRVGHVHGLPHQWRV
D WUDYpV GH ORV DXHQWHV KtGULFRV HQ IXQFLyQ GHO iUHD
con EVOA; en ambos casos las EVOA se encuentran
HQODVSDUWHVDOWDV\PHGLDVGHODV]RQDVKLGURJUiFDV
razn por la cual existe mayor riesgo de afectacin de las
poblaciones ubicadas aguas abajo.
En la siguiente pgina se presenta el mapa del riesgo
GHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRVSRU
subcuenca y posteriromente se presentan los resultados
SULQFLSDOHVDJUXSDGRVSRUFXHQFD =RQD+LGURJUiFD 

100

UNODC - MINJUSTICIA

78W

76W

Mar
Caribe

Mar
Caribe

Venezuela

Ecuador

PANAM

Brasil

8N

8N

Ocano
Pacfico

Crdoba

Per

Riosucio

a
Murind
Antioquia

Vigia del
Fuerte
Bojay

Ro Cauca

o
Ro Atrat

6N

6N

Choc

Ocano
Pacfico

Medio Atrato

Quibd

Atrato
Ro Quito
Cantn de
San Pablo

Bajo
Baud

Medio
Baud

Risaralda

Condoto

Caldas

Nvita

a
a
0

50

Sip

100
km

Quindo

Coordenadas geogrficas WGS 84

Valle

78W

76W

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC - IDEAM.


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Riesgo de afectacin
porflujos y acumulacin
de sedimientos
(subzona hidrogrfica)

Nulo
Muy bajo
Bajo
Medio
Alto
Muy alto

Direccin del riesgo del


flujo y acumulacin
de sedimentos

a
a
a
a
a

Muy bajo
Bajo
Medio
Alto
Muy alto

Zona hidrogrfica

Evidencia de explotacin en 2014


Lmites internacionales
Lmites departamentales

0DSD5LHVJRGHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRVSRUDFWLYLGDGHVGHH[SORWDFLyQGHRURGHDOXYLyQ 3DFtFRQRUWH 

x =RQD+LGURJUiFD$WUDWR'DULpQ
(QODSDUWHDOWDGHOD=RQD+LGURJUiFD$WUDWR'DULpQ
se concentra la explotacin de oro de aluvin en las
VXE]RQDVKLGURJUiFDVGHOUtR4XLWR\GHOUtR%HEDUDPi
ODVGRVSUHVHQWDQULHVJRGHDIHFWDFLyQPX\DOWRSRUXMRV
y acumulacin de sedimentos. En total existen all cinco
cabeceras municipales (Medio Atrato, Quibd, Atrato, Ro
Quito y Cantn de San Pablo) y 23 centros poblados que
se encuentran en las riberas de los ros que arrastran
sedimentos provenientes de las reas con EVOA aguas
arriba. Las cabeceras de Ro Quito y Cantn de San Pablo
estn localizadas en reas con EVOA, mientras que los
otros tres municipios mencionados estn ms alejados
SRU YtD XYLDO GHO iUHD GH (92$ XELFDGD DJXDV DUULED
ms cercana (ver la siguiente tabla); sin embargo, es en
la cabecera municipal Quibd, y posteriormente en la
FDEHFHUDGHOPXQLFLSLRGH0HGLR$WUDWRGRQGHFRQX\HOD
acumulacin del arrastre de sedimentos generado aguas
arriba en el rea de mayor concentracin de EVOA.
Ms abajo del municipio del Medio Atrato el riesgo de
afectacin es muy bajo porque la EVOA disminuye en

este sector; sin embargo, a la altura de Bojay y Viga


GHO)XHUWHGRQGHFRQX\HQODVDJXDVGHODV6XE]RQDV
+LGURJUiFDV GHO UtR %RMD\i ULHVJR GH DIHFWDFLyQ PX\
bajo) y Murr (riesgo de afectacin bajo), presentan
algunos puntos con EVOA. Un poco ms adelante,
OD FDEHFHUD PXQLFLSDO GH 0XULQGy UHFLEH ORV XMRV GH
sedimentos mencionados anteriormente, adems de
ORV XMRV GH VHGLPHQWRV JHQHUDGRV HQ OD 6XE]RQD
+LGURJUiFD GHO UtR 0XULQGy ULHVJR GH DIHFWDFLyQ
bajo). Despus de Murind, el ro Atrato (que arrastra
los sedimentos acumulados que no se han asentado)
contina su curso pasando por Riosucio en un tramo que
no reporta deteccin (riesgo de afectacin muy bajo), pero
al llegar al Golfo de Urab hay un pequeo sector con
(92$HQOD6XE]RQD+LGURJUiFDGHOUtR7DQHOD ULHVJR
de afectacin muy bajo), que pasa posteriormente junto
a un centro poblado en la costa caribe. Mientras que la
cabecera municipal de Bojay se encuentra localizada en
un rea con EVOA, Viga del Fuerte est un poco ms
alejado de reas con EVOA aguas arriba, y los otros dos
municipios mencionados estn mucho ms alejados (ver
siguiente tabla).

Cabecera municipal

Distancia a EVOA
aguas arriba

6XE]RQD+LGURJUiFD

Medio Atrato

8,4 km

Ro Bebaram y otros Directos Atrato

Quibd

4,9 km

Ro Bebaram y otros Directos Atrato

Atrato

3,2 km

Ro Bebaram y otros Directos Atrato

Ro Quito

0,0 km

Ro Quito

Cantn de San Pablo

0,0 km

Ro Quito

Riosucio

29,6 km

Ro Sucio

Murind

16,1 km

Ro Murind Directos Atrato

Viga del Fuerte

3,7 km

Ro Murind Directos Atrato

Bojay

0,0 km

Directos Atrato (mi)

7DEOD'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQD+LGURJUiFD$WUDWR'DULpQ\6XE]RQDV
+LGURJUiFDVFRUUHVSRQGLHQWHV 

x =RQD+LGURJUiFDGHO6DQ-XDQ

HQ FDGD XQD GH ODV VXE]RQDV KLGURJUiFDV UHIHULGDV


DQWHULRUPHQWHUD]yQSRUODFXDOORVXMRVGHVHGLPHQWRV
(Q OD SDUWH PHGLD GH OD ]RQD KLGURJUiFD GHO UtR 6DQ FRQX\HQDJXDVDEDMRGHHVWDVFDEHFHUDVSRUORTXHOD
Juan se concentra la explotacin de oro de aluvin en acumulacin del arrastre de material es menor al pasar
ODVVXE]RQDVKLGURJUiFDVGHOUtR7DPDQiUtR&DMyQ\UtR por esas cabeceras dado que las tres vertientes se unen
Sip, de las cuales las dos primeras tienen un riesgo de ms abajo.
DIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRVPX\
alto, mientras que la ltima tiene un riesgo de afectacin 'HVSXpV GH FRQXLU ORV UtRV 7DPDQi &DMyQ \ 6LSt
medio; en total existen all tres cabeceras municipales para convertirse en el brazo principal del ro San Juan,
(Condoto, Nvita y Sip) y nueve centros poblados que el riesgo de afectacin es muy bajo porque la EVOA
se encuentran en las riberas de los ros que arrastran disminuye en este sector. Solo hay algunos puntos
sedimentos provenientes de las reas con EVOA UHJLVWUDGRVGHVSXpVGHODFRQXHQFLDGHHVWRVWUHVUtRV
ubicadas aguas arriba. Las tres cabeceras municipales DVtFRPRDOVXUGHOD]RQDKLGURJUiFDGHO6DQ-XDQHQOD
mencionadas estn localizadas en reas con EVOA parte alta del ro Calima, en rea rural de Buenaventura.
(ver tabla siguiente), y cada una de ellas se encuentra Antes de llegar a la cabecera municipal del Litoral del San

102

UNODC - MINJUSTICIA

Juan, en una zona de riesgo de afectacin nulo porque


no hay EVOA (la ms cercana est a una gran distancia
XYLDOYHUVLJXLHQWHWDEOD HOUtR6DQ-XDQ TXHDUUDVWUD
los sedimentos acumulados que no se han asentado)
VHDEUHHQYDULRVDXHQWHVTXHGHVHPERFDQDORFpDQR

3DFtFRUD]yQSRUODFXDOORVVHGLPHQWRVTXHSXHGHQVHU
arrastrados hasta all y que provienen de las reas con
(92$DJXDVDUULEDVQRX\HQHQVXWRWDOLGDGKDFLDGLFKD
cabecera municipal.

Cabecera municipal

Distancia a EVOA aguas arriba

6XE]RQD+LGURJUiFD

Condoto

0,0 km

Ro Bebaram y otros Directos Atrato

Nvita

0,0 km

Ro Bebaram y otros Directos Atrato

Sip

0,0 km

Ro Bebaram y otros Directos Atrato

Litoral del San Juan

72,3 km

'LUHFWRV6DQ-XDQ\3DFtFR

7DEOD'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQD+LGURJUiFDGHO6DQ-XDQ\6XE]RQDV+LGURJUiFDV
correspondientes).

x 2WUDV =RQDV +LGURJUiFDV HQ HO VHFWRU QRUWH GH OD (92$ \ QR HVWiQ HQ ULHVJR SRU XMRV \ DFXPXODFLyQ
de sedimentos, aunque hay otros municipios y centros
5HJLyQGHO3DFtFR
poblados que s estn expuestos a dicho riesgo. En la
3ULQFLSDOPHQWH VH GHVWDFD OD =RQD +LGURJUiFD GHO siguiente pgina se presenta el mapa del riesgo de
%DXGy'LUHFWRV3DFtFRTXHSUHVHQWDXQULHVJRPHGLR DIHFWDFLyQ SRU XMRV \ DFXPXODFLyQ GH VHGLPHQWRV SRU
GH DIHFWDFLyQ SRU XMRV \ DFXPXODFLyQ GH VHGLPHQWRV 6XE]RQD +LGURJUiFD FRQ XQ ]RRP UHDOL]DGR DO VHFWRU
puesto que existen algunas reas menores a lo largo del VXU GHO 3DFtFR &RORPELDQR \ VH DQDOL]DQ WDPELpQ ORV
UtRSULQFLSDO\VXVDXHQWHVDIHFWDQGRIXQGDPHQWDOPHQWH SULQFLSDOHVKDOOD]JRVDJUXSDGRVSRU=RQDV+LGURJUiFDV
las cabeceras municipales de Medio Baud y Bajo y sus respectivas subcuencas.
Baud, que se encuentran en la parte baja de esta Zona
+LGURJUiFD\UHFLEHQHODUUDVWUHGHORVVHGLPHQWRVTXH x =RQD+LGURJUiFDGHO3DWtD
no se han asentado y que se generaron en las reas con
EVOA aguas arriba (Medio Baud est aguas abajo, a (Q OD SDUWH PHGLD GH OD ]RQD KLGURJUiFD GHO 3DWtD
una menor distancia de reas con deteccin de lo que se se concentra la explotacin de oro de aluvin en las
encuentra Bajo Baud ver siguiente tabla). En el caso VXE]RQDVKLGURJUiFDVGHOUtR7HOHPEt\GHO3DWtD0HGLR
GHO VHFWRU QRUWH GH OD FRVWD 3DFtFD ORV DXHQWHV TXH /DSULPHUDWLHQHULHVJRPX\DOWRGHDIHFWDFLyQSRUXMR
YLHUWHQGLUHFWDPHQWHVREUHHORFpDQR3DFtFRSUHVHQWDQ y acumulacin de sedimentos, mientras que la segunda
un riesgo de afectacin nulo, puesto que no hay all EVOA; tiene un riesgo de afectacin bajo. En total existen all
ORPLVPRVXFHGHHQODSDUWHEDMDGHOD]RQDKLGURJUiFD tres cabeceras municipales (Roberto Payn, Barbacoas
y Mag) y 26 centros poblados que se encuentran
del ro Cauca que hace parte del rea de estudio.
en las riberas de los ros que arrastran sedimentos
provenientes de la explotacin de oro de aluvin aguas
Cabecera
Distancia a EVOA
Subzona
arriba. Las cabeceras municipales de Barbacoas y Mag
municipal
aguas arriba
+LGURJUiFD
estn localizadas en reas con EVOA, mientras que
Medio Baud
6,3 km
Ro Baud
Roberto Payn est muy cerca aguas abajo de estas
Bajo Baud
28,1 km
Ro Baud
reas (ver tabla siguiente); sin embargo, es en Roberto
3D\iQHQODSDUWHEDMDGHOD6XE]RQD+LGURJUiFDGHO
Tabla 19. Distancia SRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD
(92$ =RQD+LGURJUiFDGHO%DXGy'LUHFWRV3DFtFR\6XE]RQDV UtR7HOHPEtGRQGHFRQX\HODDFXPXODFLyQGHODUUDVWUH
+LGURJUiFDVFRUUHVSRQGLHQWHV 
de sedimentos generado aguas arriba, mientras que
%DUEDFRDVSRUHQFRQWUDUVHPiVDUULEDUHFLEHXQXMRGH
(QUHODFLyQFRQHOVHFWRUVXUGHOD5HJLyQGHO3DFtFR sedimentos menor. Por su parte, la cabecera municipal
VH HQFXHQWUDQ ODV ]RQDV KLGURJUiFDV GHO 3DWtD \ GH0DJtUHFLEH~QLFDPHQWHORVXMRVSURYHQLHQWHVGHOD
Amarales Dagua, que presentan un riesgo menor de 6XE]RQD+LGURJUiFDGHO0HGLR3DWtD
DIHFWDFLyQ SRU XMRV \ DFXPXODFLyQ GH VHGLPHQWRV HQ
FRPSDUDFLyQ FRQ ODV =RQDV +LGURJUiFDV UHIHULGDV 0iVDEDMRGH5REHUWR3D\iQ\0DJtFRQX\HQORVUtRV
anteriormente, que se localizan hacia el norte; en ambos Telemb y Medio Pata para formar el brazo principal del
casos las EVOA se encuentran en las partes medias de Pata en un tramo en el que no se reportan ms EVOA,
ODV]RQDVKLGURJUiFDVUD]yQSRUODFXDOH[LVWHQYDULDV UD]yQ SRU OD FXDO HO ULHVJR SRU XMRV \ DFXPXODFLyQ GH
SREODFLRQHVDJXDVDUULEDGHODViUHDVLGHQWLFDGDVFRQ sedimentos es muy bajo. Antes de llegar a la cabecera

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

103

municipal de Mosquera, en una zona de riesgo de


afectacin nulo porque no hay EVOA (la evidencia
PiV FHUFDQD HVWi D XQD JUDQ GLVWDQFLD XYLDO YHU
siguiente tabla), el ro Pata (que arrastra los sedimentos
acumulados que no se han asentado) se abre en varios

DXHQWHVTXHGHVHPERFDQDORFpDQR3DFtFRUD]yQSRU
la cual los sedimentos que pueden ser arrastrados hasta
all y que provienen de las reas con EVOA aguas arribas
QRX\HQHQVXWRWDOLGDGKDFLDGLFKDFDEHFHUDPXQLFLSDO

Cabecera municipal

Distancia a EVOA aguas


arriba

Subzona
+LGURJUiFD

Roberto Payn

0,4 km

Ro Telemb

Barbacoas

0,0 km

Ro Telemb

Mag

0,0 km

Ro Pata Medio

Mosquera

141,3 km

Ro Pata Bajo

7DEOD'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQD+LGURJUiFDGHO3DWtD\VXEFXHQFDV
correspondientes).

104

UNODC - MINJUSTICIA

78W

76W

Mar Caribe

Risaralda
Venezuela

Caldas

Ocano
Pacfico

Choc

Ecuador

Brasil

Quindo

4N

4N

Per

Buenaventura

Valle

Ocano
Pacfico

a
Cali

Cali

Tolima

Lpez de Micay

Timbiqu

Guap
Mosquera

El Charco

Popayn

Santa Brbara

2N

2N

Cauca

Huila

Tumaco

Roberto
Payn

Mag
Barbacoas

Nario

Caquet
Pasto
Mocoa

ECUADOR
0

50
Coordenadas geogrficas WGS 84

100
km

Putumayo

78W

76W

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC - IDEAM.


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Riesgo de afectacin
porflujos y acumulacin
de sedimientos
(subzona hidrogrfica)

Nulo
Muy bajo
Bajo
Medio
Alto
Muy alto

Direccin del riesgo


del flujo y acumulacin
de sedimentos

a
a
a
a
a

Muy bajo
Bajo
Medio
Alto
Muy alto

Zona hidrogrfica

Evidencia de explotacin en 2014


Lmites internacionales
Lmites departamentales

0DSD5LHVJRGHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRVSRUH[SORWDFLyQGHRURGHDOXYLyQ 3DFtFRVXU 

x =RQD+LGURJUiFD$PDUDOes Dagua
(VWD]RQDKLGURJUiFDVHFDUDFWeriza porque la mayora de
VXVDXHQWHVQRFRQX\HQHQWUHVtVLQRTXHGHVHPERFDQ
GLUHFWDPHQWH\SRUVHSDUDGRHQHORFpDQR3DFtFRHQ
WRGDVVXV6XE]RQDV+LGURJUiFDVH[LVWHQ(92$SHURHV
HQ OD 6XE]RQD +LGURJUiFD GHO UtR 6DQ -XDQ GHO 0LFD\
donde se concentra la mayor parte de EVOA, lo que hace
TXHGLFKDVXE]RQDKLGURJUiFDSUHVHQWHXQULHVJRPHGLR
GHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRV(Q
OD6XE]RQD+LGURJUiFDGHOUtR6DQ-XDQGHO0LFD\H[LVWHQ
en total una cabecera municipal (Lpez de Micay) y siete
centros poblados, los cuales se encuentran en las riberas
de los ros que arrastran sedimentos provenientes de la
explotacin de oro de aluvin aguas arriba. La cabecera
municipal de Lpez de Micay se encuentra localizada en
un rea con EVOA (ver siguiente tabla), pero se ubica en
ODSDUWHPHGLDGHOD6XE]RQD+LGURJUiFDPHQFLRQDGD
lugar donde se reportan las EVOA que estn ms arriba
HQOD6XE]RQD+LGURJUiFDUD]yQSRUODFXDOHODUUDVWUH
de sedimentos hacia esta cabecera municipal es mucho
menor en comparacin con seis de los siete centros

poblados referidos anteriormente y que estn aguas


abajo.
/DVRWUDVQXHYH6XE]RQDV+LGURJUiFDVSHUWHQHFLHQWHV
DOD=RQD+LGURJUiFD$PDUDOHV'DJXD 'DJXD7LPED
Iscuand, Guap, Anchicay, Timbiqu, Saija, Naya
\ 7DSDMH  SUHVHQWDQ ULHVJR GH DIHFWDFLyQ SRU XMRV \
acumulacin de sedimentos muy bajo; en total existen all
cinco cabeceras municipales (Buenaventura, Timbiqu,
Guap, El Charco y Santa Brbara) y 30 centros poblados
que se encuentran en las riberas de los ros que arrastran
sedimentos provenientes de la explotacin de oro de
aluvin aguas arriba. En el caso de las cinco cabeceras
municipales mencionadas, la EVOA ms cercana aguas
DUULED HVWi D XQD JUDQ GLVWDQFLD XYLDO YHU VLJXLHQWH
tabla), y adicionalmente se encuentran antes de la
apertura de los ros correspondientes en mltiples brazos
TXH GHVHPERFDQ DO RFpDQR 3DFtFR UD]yQ SRU OD FXDO
los sedimentos que pueden ser arrastrados hasta all y
TXHSURYLHQHQGHODViUHDVDJXDVDUULEDVQRX\HQHQVX
totalidad hacia dichas cabeceras municipales.

Cabecera municipal

Distancia EVOA aguas arriba

6XE]RQD+LGURJUiFD

Lpez de Micay

0,0 km

Ro San Juan del Micay

Buenaventura

18,4 km

Ro Dagua

Timbiqu

9,9 km

Ro Timbiqu

Guap

19,5 km

Ro Guap

El Charco

57,3 km

Ro Tapaje

Santa Brbara

31,0 km

Ro Iscuand

7DEOD'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQDKLGURJUiFD$PDUDOHV'DJXD\6XEFXHQFDV
correspondientes).

x 2WUDV =RQDV +LGURJUiFDV HQ HO VHFWRU VXU GH OD VRVWHQLEOH VHFUHWDUtDV GH DPELHQWH \ RFLQDV GH
5HJLyQGHO3DFtFR
planeacin, principalmente), en razn de que es necesario
LGHQWLFDUORVDFXHGXFWRVTXHVXUWHQDODSREODFLyQTXH
(Q OD SDUWH DOWD GH OD =RQD +LGURJUiFD GHO UtR &DXFD toman agua directamente de las fuentes de los ros
que hace parte del rea de estudio, ms exactamente con algn riesgo de afectacin por sedimentacin, para
HQ OD 6XE]RQD +LGURJUiFD GHO UtR 4XLQDPD\R H[LVWH contemplar las medidas de saneamiento o alternativas
un pequeo foco con EVOA que hace que all se tenga a que haya lugar. De igual manera sera muy valioso
XQ ULHVJR GH DIHFWDFLyQ SRU XMRV \ DFXPXODFLyQ GH LPSOHPHQWDU DFFLRQHV SDUD FXDQWLFDU ORV YRO~PHQHV
sedimentos muy bajo, a diferencia de las otras Subzonas de material que son vertidos a los ros mencionados,
+LGURJUiFDV SHUWHQHFLHQWHV D HVWD SDUWH GH OD =RQD en especial en aquellas zonas donde aguas abajo hay
+LGURJUiFDGHOUtR&DXFDGRQGHHOULHVJRGHDIHFWDFLyQ centros poblados y cabeceras municipales muy cercanas,
es nulo. La cabecera ms cercana que est aguas abajo FRQHOQGHHVWDEOHFHUHVWUDWHJLDVSDUDSUHYHQLURPLWLJDU
del rea de EVOA es la ciudad de Cali (96,5 km por el ro posibles aumentos en el nivel de los ros ms all de lo
&DXFD (QHOFDVRGHOD=RQD+LGURJUiFDGHOUtR0LUD normal para la regin.
DOH[WUHPRVXUGHOD5HJLyQGHO3DFtFRQRVHUHSRUWD
deteccin, razn por la cual el riesgo de afectacin all Se debe tener en cuenta que en este estudio no se ha
es nulo.
desarrollado la informacin concerniente a los factores
GHULHVJRGHFRQWDPLQDFLyQXYLDOSRUHOSRVLEOHXVRGH
La informacin suministrada en este tem es de gran sustancias qumicas implementadas en la explotacin
importancia para la generacin de alertas tempranas para de oro de aluvin, proceso totalmente diferente pero de
la institucionalidad de las entidades territoriales (salud, acuerdo a la documentacin existente muy nocivo para la
servicios pblicos, corporaciones autnomas y desarrollo SREODFLyQHQHOiUHDGHLQXHQFLD

106

UNODC - MINJUSTICIA

SECCIN

III

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

107

ANEXO 1 METODOLOGA PARA EL


MODELO DE MONITOREO
estudiar la dinmica y tendencias de expansin de
fenmenos de inters. Un ejemplo de esta posibilidad
/DSHUFHSFLyQUHPRWDWLHQHYDULDVGHQLFLRQHVTXHWLHQHQ de observacin peridica es el monitoreo de la dinmica
que ver con la posibilidad de observar detalladamente en la siembra de cultivos ilcitos realizado desde 1998
objetos sin necesidad de estar en contacto con ellos. por el Proyecto SIMCI [11] en varios pases en donde
As entonces, esta disciplina es llamada tambin la produccin de cultivos ilcitos constituye un problema
teledeteccin (Tele= lejos -- teledeteccin= detectar poltico y social, con monitoreos anuales en Colombia,
de lejos). Segn Bakker et al, [42] esta disciplina hace Per, Bolivia, Afganistn, Brasil, Mxico, Laos y Myanmar.
alusin al proceso de adquisicin de informacin a
distancia, sin que exista contacto fsico entre la fuente de $OJXQDV YHQWDMDV HVSHFtFDV GHO XVR GH LPiJHQHV GH
informacin (objeto) y el receptor de la misma (sensor). satlite como fuente de informacin sobre los recursos
De igual manera, Chuvieco [43] asegura que en el naturales y del ambiente son: i) el cubrimiento de
sentido ms amplio la teledeteccin no engloba slo los escenas permite obtener una visin sinptica de grandes
procesos que permitan obtener una imagen desde el iUHDV GH OD VXSHUFLH WHUUHVWUH OR TXH SRVLELOLWD XQD
aire o el espacio sino tambin su posterior tratamiento, mejor comprensin de la organizacin espacial; ii) la
en el contexto de una determinada aplicacin. Esto periodicidad de tomas permite el seguimiento y monitoreo
implica que no solamente el proceso aislado forma parte de procesos dinmicos, con esta caracterstica es posible
GH OD GHQLFLyQ \D TXH pVWH LQFOX\H SURFHVDPLHQWR realizar anlisis de tipo espacial y temporal mediante la
interpretacin, anlisis y aplicacin. [44].
comparacin entre dos o ms imgenes de un mismo
lugar en diferentes fechas (anlisis multitemporal); iii) la
La teledeteccin permite capturar informacin mediante capacidad de captura de datos en diferentes rangos de
ODLGHQWLFDFLyQDJUXSDFLyQDQiOLVLVHLQWHUSUHWDFLyQGH ORQJLWXGGHRQGDIDFLOLWDODLGHQWLFDFLyQ\GLVFULPLQDFLyQ
los datos provistos por sensores remotos, encargados de de las coberturas analizadas en la imagen y permiten
captar seales que se traducen en imgenes, como por acceder a informacin que nuestra visin no capta, tal
ejemplo las fotografas areas o las imgenes satelitales. como las bandas del infrarrojo; iv) rpida actualizacin
[45].
de la informacin por la periodicidad de las tomas
(resolucin temporal); v) cubrimiento territorial, que
Uno de los aportes de mayor relevancia de la percepcin permite accesibilidad a datos en zonas aisladas, por
remota (teledeteccin) es su capacidad para monitorear lo que hace que sean menos costosas por unidad de
procesos dinmicos. La informacin adquirida por las VXSHUFLH TXH ODV IRWRJUDItDV DpUHDV R OD LQIRUPDFLyQ
imgenes de satlite constituye una fuente importante y tomada en el terreno [46]; vi) disponibilidad de imgenes
valiosa para estudiar los cambios que se producen en la del sistema de teledeteccin Landsat de forma gratuita.
VXSHUFLH WHUUHVWUH \D VHD GHELGR D IDFWRUHV QDWXUDOHV
o por accin humana. Las caractersticas orbitales de
los satlites de observacin terrestre permiten adquirir
imgenes repetitivas de cualquier lugar, en condiciones
comparables de observacin lo que resulta idneo para
PERCEPCIN REMOTA

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

109

6HOHFFLyQ\DGTXLVLFLyQGHLPiJHQHV
satelitales

Lnea Base Nacional:

Para la obtencin de la cobertura de EVOA se emplearon


Se procesaron e interpretaron 58 Path Row que cubren
imgenes de resolucin media del sistema de
todo el territorio nacional (1.142.000 km2) a excepcin de
las islas de San Andrs y Providencia. Se descargaron
teledeteccin Landsat58. El 85% de las imgenes
imgenes Landsat 7 y Landsat 8 (LDCM) con fechas
empleadas se encontraron en el Banco de Informacin
entre marzo de 2013 y marzo de 2015.
Espacial de SIMCI, ya que haban sido usadas
anteriormente para establecer el territorio afectado por
cultivos de coca. En ese sentido se obtuvo optimizacin y
Comportamiento espectral de los ros
HFLHQFLD HQ HO XVR GH UHFXUVRV (VWDV LPiJHQHV
en la regin del estudio piloto:
ampliamente conocidas y utilizadas para la construccin
de los mosaicos usados en los censos de cultivos de
Para el establecimiento base del comportamiento
coca desde el 2001, presentan condiciones adecuadas
espectral natural en ro control se proces el Path Row
de periodicidad, disponibilidad, cobertura, resolucin
3-58 y para el anlisis temporal de cambios espectrales
espectral y gratuidad, las cuales representan una
en los sedimentos suspendidos se proces el Path Row
4-58.
herramienta valiosa para la realizacin de estudios de la
dinmica de los recursos naturales, facilitando la
sostenibilidad de los monitoreos implementados.
de dos aos (2013- 2015). Los datos obtenidos no tienen
ajustes por reas sin informacin o temporalidad.
Los datos de Landsat 7 ETM+ se obtienen de 6 bandas
espectrales con una resolucin espacial de 30 metros, Por otra parte, para establecer la lnea base de
dos bandas termales con resolucin espacial de 60 comportamiento espectral del ro piloto en la metodologa
metros y una banda adicional pancromtica con una basada en ndices espectrales de sedimentacin, se
resolucin espacial de 15 metros. El satlite tiene un ciclo procesaron 2 path rows. Los periodos de anlisis son
de repeticin de 16 das, lo cual permite obtener imgenes 2002, 2007, 2011 y 2014.
con diferente cubrimiento de nubes. Su ancho de banda
de 185 km es apropiado para estudios regionales. Desde 0LQLPL]DFLyQGHiUHDVVLQLQIRUPDFLyQ
mayo de 2003 existen fallas en el corredor de escaneo
lineal (SLC) de Landsat 7 ETM+, produciendo prdida La presencia constante de nubes en el territorio
de informacin en las imgenes que se reduce hacia el FRORPELDQRGLFXOWDODREWHQFLyQGHLPiJHQHVOLEUHVGH
centro de la escena; los lotes ubicados en estas franjas nubosidad. Para minimizar estas reas sin informacin
VH FDOLFDQ FRPR JDS 3RU OD UD]yQ DQWHULRU HO XVR GH se realiza una bsqueda permanente de las imgenes
estas imgenes se restringe exclusivamente a reas sin disponibles en los portales de descarga59 y se construyen
informacin por nubes en imgenes Landsat 8.
mosaicos utilizando varias imgenes de la misma zona
Landsat 8 (LDCM) captura datos en 8 bandas espectrales
con resolucin espacial de 30 metros, dos bandas
termales con resolucin de 100 metros y una banda
pancromtica de 15 metros. Al igual que el Landsat 7, el
satlite tiene un ciclo de revisita de 16 das. Su resolucin
radiomtrica es de 16 Bits con un cubrimiento de 185 km.
Este sensor fue lanzado el 11 de febrero del ao 2013
para dar continuidad a la captura, archivo, procesamiento
y distribucin de datos del sistema Landsat 7.
Para elaborar la lnea base nacional de EVOA con uso de
maquinaria en tierra para el ao 2014 y con soporte en
la temporalidad de esta modalidad, se tom una ventana
58. La constelacin de satlites LANDSAT (LAND=tierra y SAT=satlite), que inicialmente
se llamaron ERTS (Earth Resources Technology Satellites), fue la primera misin de
los Estados Unidos para el monitoreo de los recursos terrestres. Su mantenimiento y
operacin est a cargo de la Administracin Nacional de la Aeronutica y del Espacio
(NASA) en tanto que la produccin y comercializacin de las imgenes depende del
Servicio Geolgico de los Estados Unidos (USGS).

110

UNODC - MINJUSTICIA

con fechas cercanas.


3UHSURFHVDPLHQWRGHLPiJHQHV
El preprocesamiento de imgenes agrupa una serie de
tcnicas orientadas a: i) corregir o remover efectos en la
imagen por errores del sensor o por factores ambientales,
ii) realzar el contraste para facilitar la interpretacin, iii)
incrementar la resolucin espacial para mejorar la
delimitacin y deteccin de objetos.
x Mejoramiento en resolucin espacial (pansharpening)
En la actualidad, el procesamiento digital permite integrar
las caractersticas espectrales con las caractersticas
espaciales al fusionar imgenes pancromticas de
alta resolucin espacial (15 metros) con imgenes
59. Portales para descargar imgenes Landsat: http://glcfapp.glcf.umd.edu/, http://
earthexplorer.usgs.gov/, http://glovis.usgs.gov/.

Para construir los mosaicos y reducir las reas sin


informacin de la lnea base nacional se descargaron
y procesaron 237 imgenes, 40 Landsat 7 ETM+
y 197 Landsat 8 (LDCM). Solo 3 departamentos
superan el 10% de reas sin informacin por nubes:
Cauca (11%), Nario (11%) y Huila (20%).
Por regin se descargaron 13 imgenes para Sierra
Nevada, 48 imgenes para la Regin Central, 35
SDUD HO 3DFtFR  HQ 0HWD*XDYLDUH  SDUD OD
Amazonia, 25 imgenes para AraucaVichada
y 23 para PutumayoCaquet. De otra parte,
para el establecimiento de la lnea base espectral
se descargaron y procesaron 8 imgenes entre
Landsat 5, Landsat 7 y Landsat 8 y para la deteccin
de cambios en los sedimentos en suspensin 14
imgenes distribuidas en cuatro periodos de anlisis
2002-2007-2011 y 2014.
multiespectrales de resolucin media (30 metros). Este
algoritmo se denomina pansharpening.
El resultado es una imagen multiespectral con resolucin
espacial a 15 metros. Este proceso permite una mejor
delimitacin e interpretacin visual de las coberturas
terrestres y por consiguiente de reas con EVOA.
x Correccin atmosfrica: Este procedimiento
reduce el efecto de la dispersin de la radiacin
electromagntica originada por parte de los gases y
partculas en suspensin de la atmsfera, para que
los valores sean independientes de las condiciones
atmosfricas [46]. Para este proceso se emple la
herramienta Atmospheric Correction del software PCI
Geomatics.
De acuerdo con los resultados de un estudio anterior
realizado por SIMCI [47], el uso del algoritmo ATCOR
como mtodo de correccin absoluta del efecto
atmosfrico sobre las imgenes satelitales permite su
comparabilidad, logrando valores de radiancia cercanos
a los absolutos, que representan de forma ms robusta
y precisa las dinmicas de los cuerpos de agua y dems
coberturas de la tierra.
x Mejoramientos radiomtricos
El mejoramiento radiomtrico est orientado a optimizar
el contraste espectral de los datos, para facilitar la
interpretacin visual.
x Filtros
Para mejorar las caractersticas espaciales de una
LPDJHQVHXWLOL]DQYDULRVOWURVTXHPRGLFDQHOYDORUGH

los pxeles utilizando los valores de los pxeles vecinos, y


cuya funcin es resaltar elementos lineales como redes
KLGURJUiFDV\YLDOHVSUHVHQWHVHQODLPDJHQ
*HRUUHIHUHQFLDFLyQ
La georeferenciacin de la imagen es imprescindible
para hacer mapas, superponer cualquier informacin
FDUWRJUiFD DX[LOLDU \ UHDOL]DU HVWXGLRV PXOWLWHPSRUDOHV
Una adecuada georeferenciacin permite controlar las
distorsiones en la imagen de satlite para garantizar
XQD FRUUHFWD SRVLFLyQ JHRJUiFD PHGLFLyQ GH iUHDV \
comparabilidad con otras capas de informacin.
Las imgenes de satlite utilizadas para la interpretacin
de evidencias de explotacin de oro de aluvin se
georreferenciaron a partir de una serie de puntos de
control, tomados en mosaicos construidos con las
imgenes ajustadas y empalmadas de menor nubosidad
utilizadas anteriormente en censos de cultivos de coca.
Para que el ajuste entre imagen y mapa sea correcto
se tuvieron en cuenta tres aspectos en la seleccin de
los puntos de control: nmero, rigor en su localizacin y
distribucin.
De otra parte, la evaluacin de la precisin
de la georeferenciacin se realiz mediante
el indicador error medio cuadrtico (RMS
por sus siglas en ingles) que representa el grado de
correspondencia de la transformacin entre los puntos
de control utilizados. El Proyecto SIMCI adopt como
valores aceptables de este indicador RMS60 menores a
un pixel en zonas planas y RMS menores a tres pixeles
en zonas montaosas. A continuacin se muestran los
parmetros adoptados61.
,QIRUPDFLyQVHFXQGDULD
Los datos obtenidos con la interpretacin de imgenes
de satlite son contrastados y complementados con
informacin secundaria proporcionada por la Direccin
de Carabineros y Seguridad Rural (DICAR) de la Polica
60. El RMS se calcula como la raz cuadrada de las desviaciones entre los valores
observados y los estimados por la regresin cuando se hace la correccin geomtrica
de la imagen.
61. Para realizar el clculo de reas se deben cumplir ciertas condiciones: 1) la proyeccin
de los datos debe ser plana y acorde con la ubicacin del pas dentro del planeta; la
proyeccin trasversa de mercator cumple con estas condiciones; 2) se debe homogenizar
el cubrimiento de todo el pas con dicha proyeccin, es decir con las imgenes utilizadas;
esto evita tener inconvenientes y errores asociados a los empalmes entre imgenes
al momento de la construccin del mosaico. Considerando los dos criterios anteriores
se opt por utilizar la misma base de georreferenciacin que se utiliza en el censo
de cultivos de coca, en el que los errores por deformacin debido a la curvatura de
la tierra son despreciables a la escala de trabajo. Adems, el uso del mismo sistema
de georreferenciacin permitir la comparabilidad con toda la informacin en el marco
de reas de SIMCI. El proyecto SIMCI est trabajando en la migracin de los datos al
VLVWHPDSUR\HFFLyQRFLDOGH&RORPELD 0DJQD6,5*$6 VLQHPEDUJRD~QQRVHKDQ
completado las pruebas tcnicas que permitan utilizar dicho sistema y no se tiene una
EDVHGHJHRUUHIHUHQFLDFLyQGHQLGD

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

111

CARACTERSTICAS DEL SISTEMA DE PROYECCIN EMPLEADO PARA LA GEORREFERENCIACIN


WKID: 21897 Autoridad: EPSG
Proyeccin: Transversa de Mercator (Gauss_Krueger)
Falso Este: 1000000
Falso Norte: 1000000
Meridiano Central: -74,08091666666667
Factor de escala: 1,0
Latitud del Origen: 4,599047222222222
Datum: Observatorio Bogot
Elipsoide Internacional 1924.
Toda la informacin secundaria fue reproyectada a este Sistema.

Nacional, y por la Armada Nacional de Colombia, en


cuanto a operaciones contra la minera ilegal. Tambin
se cuenta con datos del Censo Minero62 publicado
por el Ministerio de Minas y Energa. La informacin
de Amparo de Ttulos sin licencia, Solicitudes de
legalizacin y Propuestas de contrato fue suministrada
por la Agencia Nacional de Minera, y la correspondiente
a Licencias Ambientales relativas a las explotaciones de
oro otorgadas por la Autoridad Nacional de Licencias
Ambientales. Finalmente, se cuenta con puntos
georreferenciados de explotaciones mineras reportados
por la Unidad de Planeacin Minero Energtica (UPME)63.

oblado
Centro p

6REUHYXHORVGHUHFRQRFLPLHQWR
Como soporte a la interpretacin en imgenes de satlite
\ FRQ HO Q GH FRQVWUXLU FRQFHSWXDOPHQWH SDWURQHV
SDUD LGHQWLFDFLyQ GH (92$ OD PHWRGRORJtD FRQWHPSOD
VREUHYXHORV GH UHFRQRFLPLHQWR \ YHULFDFLyQ (VWH
reconocimiento se basa en la inspeccin visual del
terreno de zonas afectadas por el fenmeno desde una
aeronave. Los sobrevuelos cuentan con registro de
informacin de este fenmeno desde el ao 2012 para el
territorio afectado por cultivos de coca.

oblado
Centro p

EVOA
EVOA

EVOA

Ilustracin 15. Comparacin Imagen de satlite (Landsat 8, verdadero color RGB 432) (izquierda) y fotografa tradicional (derecha) tomada en
sobrevuelo. Puerto Claver (El Bagre, Antioquia).

 (O &HQVR 0LQHUR    IXH HODERUDGR FRQ HO Q GH FRQRFHU ODV FRQGLFLRQHV
tcnicas, socioeconmicas, organizacionales y administrativas, entre otras, de las
Unidades de Produccin Minera de 23 departamentos del territorio nacional.
63. En este captulo se hace referencia al uso de informacin secundara como apoyo a la
GHWHFFLyQ(OXVRGHHVWDLQIRUPDFLyQSDUDDQiOLVLVHVSHFtFRVVHGHVDUUROODHQFDStWXORV
posteriores.

112

UNODC - MINJUSTICIA

En esta etapa la deteccin se divide en dos lneas


metodolgicas como se mencion anteriormente:
1. Lnea metodolgica basada en Interpretacin visual de
EVOA con uso de maquinaria en tierra.

mina (estas dos ltimas actividades no se abordan en


el presente estudio). [48], [49], [50]. A continuacin se
describen las principales actividades para la explotacin
de oro en terrenos aluviales.
Proceso de exSORWDFLyQHQWHUUHQRVDOXYLDOHV

2. Lnea metodolgica basada en deteccin de EVOA con


uso de maquinaria en agua mediante ndices espectrales.
Control de calidad de procesos

Etapa 0: Cobertura sin afectacin. Seleccin de los


depsitos de sedimentos propicios para la explotacin de
oro de aluvin.

Etapa 1: Inicialmente, se prepara el terreno donde se


realiza la explotacin del mineral; lo anterior consiste
en adecuar las reas circundantes a los ros donde se
presume la disposicin de oro para su explotacin, en
zonas que generalmente se encuentran con cobertura
vegetal. De esta manera, se cambia la cobertura con
En general, este control de calidad est basado en vegetacin por un suelo desnudo mediante tala rasa
HYDOXDFLRQHV HVSHFtFDV GH ODV GLIHUHQWHV DFWLYLGDGHV \ UHPRFLyQ GH ORV KRUL]RQWHV VXSHUFLDOHV GHO VXHOR
involucradas en la deteccin de EVOA, especialmente en En cuanto al acceso a las reas de produccin para el
los procesos de georreferenciacin e interpretacin. La personal y para el transporte del mineral extrado, en
DOJXQDV]RQDVGHOSDtVVHKDFHSRUODPLVPDUHGXYLDO
calidad se controla en:
en otros lugares es necesario construir trochas, caminos
Seleccin de imgenes: el rea sin informacin o carreteras pequeas, o adecuar la infraestructura
se reduce al mximo posible utilizando varias existente.
imgenes de la misma zona y conformando
Etapa 2: Una vez exista acceso a la zona de explotacin
mosaicos
y el terreno est preparado, se inicia la operacin de
Georreferenciacin: se adopt como indicador las actividades de explotacin del mineral, que consiste
el error medio cuadrtico, que es el ms utilizado en la excavacin de arenas, gravas y cantos rodados,
para medir la calidad del ajuste, cuyos parmetros ORV FXDOHV VH PRYLOL]DQ \ DFRSLDQ LQ VLWX (O EHQHFLR
puede realizarse en el mismo lugar mediante tcnicas
se mencionaron en un apartado anterior
ItVLFDV PHFiQLFDV R DUWHVDQDOHV  FRPR FODVLFDFLyQ
64
Interpretacin: para evaluar este parmetro y separacin por tamaos y gravedad , y/o mediante
65
66
se realiza una validacin de los datos entre tcnicas qumicas como amalgamacin y lixiviacin
intrpretes en diferentes zonas. De igual manera, con el uso de sustancias como mercurio y cianuro;
se realiz una confrontacin de la informacin HV LPSRUWDQWH UHVDOWDU TXH HO EHQHFLR QR HVWi OLJDGR
REWHQLGDSRUPHGLRGHYHULFDFLyQGHFDPSRHQ exclusivamente al uso de sustancias qumicas. Esta etapa
corresponde a procesos pequeos de explotacin que en
sobrevuelos e informacin secundaria.
estados incipientes no es detectado por interpretacin
visual en imgenes satelitales. La deteccin de esta
INTERPRETACIN VISUAL
etapa mediante ndices espectrales constituye la alerta
DE EVOA CON USO DE
temprana.
El control de calidad realizado por el proyecto SIMCI busca
garantizar la estandarizacin de los procedimientos, de
manera que los datos generados cumplan los estndares
de calidad, precisin y comparabilidad requeridos por el
Gobierno de Colombia y los usuarios de la informacin.

MAQUINARIA EN TIERRA
Para el abordaje de esta lnea se realiz un trabajo
de patronamiento espacial de las etapas del proceso
documentadas en la teora acadmica, mediante
sobrevuelos de reconocimiento, documentacin
IRWRJUiFD H LGHQWLFDFLyQ HVSHFWUDO  /D H[SORWDFLyQ
aurfera que se lleva a cabo en terrazas aluviales
comprende las siguientes actividades: preparacin y
DFFHVRDOD]RQDRSHUDFLyQEHQHFLRRWUDQVIRUPDFLyQ
del mineral; transporte del material y abandono de la

Etapa 3 y 4: En la medida en que la actividad de


explotacin se consolida en el sitio, el patronamiento
JHRJUiFR HV PiV HYLGHQWH SRU OD H[SDQVLyQ HQ iUHD
 +DFH UHIHUHQFLD D OD VHOHFFLyQ GH ORV PDWHULDOHV QRV SRU JUDYHGDG PHGLDQWH OD
utilizacin de zarandas, mallas, bateas, canaletas, estanques, entre otros [81].
 &RQVLVWH HQ DJUHJDU H[FHVRV D ORV PLQHUDOHV SUHYLDPHQWH FODVLFDGRV SXHGH VHU
al interior de estanques de agua o en canalones), de tal manera que se aproveche la
propiedad fsica del mercurio de ligarse fcilmente con los metales preciosos, proceso en
el que se obtiene una pasta combinada (mercurio y oro) que es expuesta al fuego para
liberar el mercurio en forma de vapor [76].
6HEDVDHQODXWLOL]DFLyQGHHVWDQTXHVFRQVROXFLRQHVGHFLDQXUR\PHGLRVOWUDQWHV
donde se agregan las colas de amalgamacin mezcladas para facilitar que por gravedad
se generen precipitados de cianuracin que posteriormente deben ser fundidos a fuego
OHQWRSDUDQDOPHQWHVHSDUDUHORUR>@

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

113

de las evidencias, que se traduce en mayor escala de


aprovechamiento, con mtodos ms mecanizados para
la extraccin y movilizacin de materiales67\WHFQLFDFLyQ
HQ OD FODVLFDFLyQ \ HO EHQHFLR GH WDO PDQHUD TXH VH
obtiene un producto ms puro. Adicionalmente, como
subproductos de la explotacin tambin se obtiene
plata y platino, por cuanto los yacimientos aurferos
estn relacionados con estos metales. Estas etapas se
UHFRQRFHQ SRU VX PD\RU WDPDxR  UHHMDGR HQ DPSOLDV
zonas de suelos desnudos provenientes de la remocin
de material y excavaciones, y tambin incluye varias
ODJXQDV SDUD HO EHQHFLR (VWDV HWDSDV QR VLHPSUH VH
presentan y se relacionan con la riqueza del yacimiento.
Etapa 5: Debido a que el oro es un recurso natural no
renovable, en algn momento las reas de explotacin
de este mineral son abandonadas para encontrar
nuevos frentes de exploracin y aprovechamiento. De
acuerdo con la normatividad vigente en Colombia, la
minera regulada debe contemplar medidas restaurativas
despus de las operaciones de explotacin una vez se d
HODEDQGRQRGHQLWLYRGHODPLQDGHWDOPDQHUDTXHVH
procure restablecer la capa vegetal.
'HDFXHUGRFRQODJXUDGHVSXpVHQFRQWUDUORVGHSyVLWRV
de sedimentos propicios para la explotacin de oro de
aluvin (etapa 0) y de cambiar las coberturas existentes
en la etapa de preparacin (etapa 1), las actividades
GH RSHUDFLyQ \ EHQHFLR RFXUUHQ VLPXOWiQHDPHQWH HQ
el lugar de explotacin; generalmente se comienza
con pequeas reas aprovechadas (etapa 2) que
posteriormente se expanden en tamao y cantidad a
ncleos aislados (etapa 3), hasta llegar a consolidarse
en grandes extensiones de aprovechamiento de oro de
aluvin (etapa 4). Generalmente cuando se abandona
la mina de oro de aluvin por agotamiento del recurso
se buscan reas prximas para reiniciar el proceso de
explotacin (etapa 5).

67. La operacin mecanizada incluye retroexcavadoras, buldceres, motobombas,


monitores y distintos tipos de dragas, mientras que la operacin artesanal se ejecuta con
herramientas convencionales como picos, barrenos, palas y carretillas [26] [82].

114

UNODC - MINJUSTICIA

Etapa 0: Cobertura sin afectacin

Etapa 1: Preparacin y acceso

(WDSD2SHUDFLyQ\EHQHFLR
(Explotacin puntual)

(WDSD2SHUDFLyQ\EHQHFLR
(Expansin zonas de Explotacin)

(WDSD2SHUDFLyQ\EHQHFLR
(Consolidacin zonas de Explotacin)

Etapa 5: Abandono de operaciones

Ilustracin 16. Etapas del proceso de explotacin de oro de aluvin con uso de maquinaria pesada en tierra.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

115

EHQHFLRSXHGHQVHUGHVGHXQDVSRFDVDPXFKDVFRQ
distribucin irregular, similar a la presencia de jageyes
/DV GLIHUHQWHV HWDSDV GHO SURFHVR LGHQWLFDGDV o estanques; en consecuencia, el Proyecto desarroll
generan evidencias fsicas en el paisaje caracterizadas una clave de interpretacin para la deteccin de EVOA
por un patronamiento espectral. Sin embargo este con uso de maquinaria en tierra, que permite detectar
patronamiento presenta confusin espectral con otras de manera objetiva y tcnica las EVOA mediante la
coberturas como suelo desnudo, zona de jageyes o LGHQWLFDFLyQGHHOHPHQWRVGHLQWHUSUHWDFLyQ
estanques pisccolas, eriales, centros poblados pequeos
y vegetacin herbcea difusa; esta condicin descarta el
Las composiciones a color que resaltan
XVR GH XQD FODVLFDFLyQ DXWRPiWLFD SDUD VX REWHQFLyQ
los elementos de inters son:
3RU HVWD UD]yQ OD LGHQWLFDFLyQ VH UHDOL]D PHGLDQWH
interpretacin visual a travs de la aplicacin de una

Composicin 4,3,2 (3,2,1 en Landsat 7).


clave de interpretacin desarrollada por el proyecto para
Constituye
la combinacin ms prxima a la percepcin
HVWHQFRQEDVHHQFRPSRVLFLRQHVDFRORUTXHSHUPLWHQ
de
la
tierra
con
nuestros ojos en el espacio, de all nombre
resaltar caractersticas de inters en la imagen.
,QWHUSUHWDFLyQ

La interpretacin visual de EVOA se realiza mediante


barrido sistemtico de las imgenes con nfasis en la
UHG KtGULFD \ SDLVDMHV DOXYLDOHV /D LGHQWLFDFLyQ VH
lleva a cabo mediante delimitacin de los polgonos que
circunscriben estas reas, los cuales son digitalizados en
pantalla con ayuda de herramientas manuales (bitmaps68)
y semi-automticas de software (semilleo de pxeles),
consistente en agrupar automticamente los pxeles
de valor espectral similar, para que posteriormente
el intrprete determine el umbral de similitud para la
agrupacin de los pxeles.
El comportamiento espectral de las reas de explotacin
de oro de aluvin, como se mencion anteriormente, es
similar al del suelo desnudo o con escasa vegetacin,
OR TXH TXLHUH GHFLU TXH SUHVHQWD DOWD UHHFWLYLGDG HQ
todas las bandas visibles. De igual forma, las lagunas de

de color verdadero. Las bandas visibles dan respuesta


a la luz que ha penetrado ms profundamente, y por
tanto sirve para discriminar agua poco profunda, aguas
turbias, corrientes, batimetra y zonas con sedimentos.
La explotacin mineral a cielo abierto se observa con
tonalidades blancuzcas y plateadas.

Composicin 5,6,4 (4,5,3 en Landsat 7). Realza


con gran detalle los lmites de agua y tierra. El agua se ve
de color azul intenso. Los diferentes tipos de vegetacin se
muestran en colores marrones, verdes y naranja. Realza
las diferencias de humedad en el suelo. La explotacin
mineral a cielo abierto tiende a una tonalidad azul clara.

En la combinacin RGB6,5,2 (5,4,1 en Landsat


7) los suelos desnudos se observan de color violeta y las
piscinas de color azul oscuro.

Ilustracin 17. Ejemplos de diferentes composiciones de color a partir de una imagen Landsat 8 ETM+, (a) Color real, RGB(4,3,2), (b)Falso
color, RGB(5,6,4), (c) Falso color, RGB(6,5,2).

8QPDSDGHELWVR%LWPDSDFW~DFRPRXQDFDSDJUiFDTXHSXHGHVHUXWLOL]DGDSDUD
crear mscaras de regiones en las imgenes para diversos propsitos.

116

UNODC - MINJUSTICIA

&ODYHGHLQWHUSUHWDFLyQSDUDGHWHFFLyQGH
EVOA
Dentro de las metodologas que se agrupan en el concepto
Clave de interpretacin69, se encuentra el modelo de
rbol de decisin, que se conoce como un conjunto de
condiciones organizadas en una estructura de gua
jerrquica multiva70GHWDOPDQHUDTXHODGHFLVLyQQDO
a tomar se puede determinar siguiendo las condiciones
que se cumplen desde la raz del rbol hasta alguna de
sus terminaciones. [51]. Este tipo de clave se desarroll
con apoyo de Department of Landscape, Spatial and
Infrastructure Sciences (BOKU) of the University of
Natural Resources and Applied Life Sciences in Vienna,
Austria [52].
Los arboles de decisin se constituyen como un modelo
predictivo basado en reglas, que sirve para representar y
categorizar una serie de condiciones secuenciales para la
solucin de un problema [53]. Un rbol de decisin tiene
unas entradas, las cuales pueden ser un objeto o una
Caracterstica
Pictrico - morfolgica

situacin descrita por medio de un conjunto de atributos,


a partir del cual se obtiene una respuesta (decisin) como
consecuencia de las entradas. De esta forma, ilustran la
manera en que se pueden desglosar los problemas y la
secuencia del proceso de decisin. [54]
Esta estructura de anlisis de datos jerrquica y objetiva
permite para el monitoreo, la automatizacin del proceso
de deteccin de las evidencias con continuidad histrica
\SURYHHLQIRUPDFLyQUREXVWD\YHULFDEOHGHODDFWLYLGDG
JHRJUiFDGHOIHQyPHQRHQHOWHUULWRULR
(OHPHQWRVGHLQWHUSUHWDFLyQ
Son conocidos como caractersticas pictricomorfolgicas, que determinan la interpretacin de un
objeto por su forma, tamao, textura, tono y color, patrn
HVSDFLDO\SRVLFLyQJHRJUiFD
3DUD LGHQWLFDU (92$ \ KDFLHQGR XVR GH ODV
caractersticas pictrico - morfolgicas se tiene:
Se observa

Forma

Su forma es irregular, generalmente dendrtica por estar asociado a ros en zonas de


pendientes planas.

Tamao

Variable, desde pequeas reas en estados iniciales de explotacin a grandes reas de


explotacin.

Tono y color

Depende del sensor y resolucin espectral. Para Landsat 8 RGB 5,6,4, se observa de
color azul claro con incrustaciones de colores azul oscuro, representando los suelos
desnudos y las piscinas de lixiviacin respectivamente. En la combinacin RGB 652 los
suelos desnudos se observan de color violeta y las piscinas de color azul oscuro.
Estos colores se deben al comportamiento espectral del suelo desnudo, indicando alta
UHHFWLYLGDGHQWRGDVODVEDQGDVGHOHVSHFWURYLVLEOH

Patronamiento espacial

La explotacin de oro de aluvin se encuentra en reas de pendientes suaves y planas,


generalmente en reas de vegetacin natural (bosques) aunque vara segn la regin;
se observa una incipiente infraestructura vial, reas pequeas de asentamientos humanos discontinuos, normalmente alejados de los centros poblados principales.
/DVHYLGHQFLDVGHH[SORWDFLyQGHRURGHDOXYLyQVRQLGHQWLFDEOHVSRUODDOWDUHHFWDQFLD
de los suelos desnudos (presencia de minerales compuestos de materiales sueltos o
segmentados como piedras, guijarros y arena, entre otros) y los cuerpos de agua.
La expansin del fenmeno se caracteriza por transformacin drstica del paisaje por
deforestacin, erosin y cambio en el curso de los ros.

Textura

/DWH[WXUDHQODLPDJHQVHREVHUYDGHQDDPHGLDGHSHQGLHQGRGHOQ~PHURGHSLVFLQDV
GHOL[LYLDFLyQ\DFXPXODFLyQGHUHVLGXRVGHODUHPRFLyQGHOVXVWUDWRHGiFR

3RVLFLyQJHRJUiFD

La actividad de explotacin de oro de aluvin se localiza principalmente en valles y


terrazas aluviales, en reas remotas con bajo desarrollo y presencia institucional, que
HQDOJXQRVFDVRVSXHGHFRUUHVSRQGHUJHRJUiFDPHQWHFRQHOWHUULWRULRDIHFWDGRKLVWyricamente con cultivos de coca.
Tabla 22. Caractersticas pictorico - morfolgicas de los elementos para deteccin de EVOA.

  /D FODYH GH LQWHUSUHWDFLyQ VH UHHUH D OD FDUDFWHUtVWLFD R FRPELQDFLyQ GH
FDUDFWHUtVWLFDVTXHSRVLELOLWDQODLGHQWLFDFLyQGHXQREMHWRHQSDUWLFXODUSRUHMHPSORHO
tamao, la forma, el tono, el color. [80].
70. Guas jerrquicas multiva porque pueden existir ms de dos opciones y es una gua
porque al responder una pregunta se llega a una decisin [79].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

117

Con base en las caractersticas pictrico-morfolgicas


GHQLGDV \ OD LQIRUPDFLyQ VHFXQGDULD VH FRQVWUX\y HO
rbol de decisin para la interpretacin de evidencias
de explotacin a cielo abierto de oro de aluvin para la
modalidad de explotacin con maquinaria en tierra. El
objetivo de esta herramienta es la documentacin del
SURFHVR TXH VH UHDOL]D  SDUD FDOLFDU XQ REMHWR HQ OD
imagen de satlite como evidencia de explotacin de oro
de aluvin con todas las variaciones posibles dentro de la
dinmica que se presenta en cada una de las regiones.
La herramienta hace nfasis en la discriminacin de
coberturas con confusin espectral; sin embargo, es
importante resaltar que el rbol de decisin para deteccin
de evidencias de explotacin de oro de aluvin con uso
de maquinaria en tierra basado en sensores remotos no
SHUPLWHLGHQWLFDUODYLJHQFLDGHODDFWLYLGDGQLODVHWDSDV
iniciales de explotacin.

del mineral. Las zonas de explotacin de oro de aluvin


SXHGHQSUHVHQWDUWH[WXUDVQDVFXDQGRODVDFWLYLGDGHVGH
explotacin y remocin son homogneas y los minerales
son menos densos, o texturas medias a gruesas cuando
las actividades son heterogneas y el material es ms
denso.
Algunas coberturas terrestres responden espectralmente
de manera similar a las reas afectadas por explotacin
de oro de aluvin en las imgenes satelitales. Para
establecer las diferencias en la visualizacin del paisaje
y en las imgenes satelitales de las coberturas con
respuesta similar a las evidencias de explotacin de oro
de aluvin, se presentan a continuacin los casos con
probabilidad de confusin al momento de interpretar y
delimitar.
Bancos de arena

Las reas con explotacin de oro de aluvin presentan


una respuesta espectral alta debido a la remocin total
de la cobertura vegetal en el proceso de preparacin
y acceso a las zonas de explotacin, que hace que
VH SLHUGDQ ORV KRUL]RQWHV VXSHUFLDOHV GHO VXHOR \ OD
absorcin de luz sea muy escasa. Otra caracterstica
que facilita la interpretacin de la cobertura asociada a
las actividades de explotacin de oro de aluvin es la
SUHVHQFLDGHSHTXHxDViUHDVFRQDJXDSDUDHOEHQHFLR
Evidencia de explotacin de oro de
aluvin

Banco de arena

Los bancos de arena se caracterizan por presentar una


DOWD UHHFWDQFLD HVSHFWUDO GHELGR D OD SRFD DEVRUFLyQ
de la luz, como consecuencia de la exposicin del
PLQHUDO 3UHVHQWDQ WH[WXUDV QDV SHUR VH GLIHUHQFLDQ
porque sus formas son ms suavizadas por efecto de
la sedimentacin por el movimiento del agua, y no son
evidentes en la imagen satelital cuerpos de agua en su
interior.
Banco de arena

Evidencia de explotacin de oro de


aluvin

Ilustracin 18. Izquierda EVOA y bancos de arena, (Landsat 8, falso color RGB 652). Derecha Foto banco de arena y EVOA, sobrevuelo
SIMCI.

&HQWURVSREODGRV
Los centros poblados se caracterizan por presentar una
DOWD UHHFWDQFLD HVSHFWUDO GHELGR D OD SRFD DEVRUFLyQ
de la luz, como consecuencia de la exposicin de los
materiales de construccin. Presentan texturas gruesas,
pero se diferencian por el patronamiento geomtrico
externo (lmites del casco urbano) e interno (red vial).

118

UNODC - MINJUSTICIA

Evidencia de explotacin de oro de


aluvin

Centro poblado

Centro poblado

Evidencia de explotacin de oro de


aluvin

Ilustracin 19. Izquierda EVOA y centro poblado, (Landsat 8, falso color RGB 547). Derecha Foto centro poblado y EVOA, sobrevuelo SIMCI.

la capa de suelo que haya quedado expuesta, pero se


diferencian porque estos se producen en pendientes ms
Los derrumbes se caracterizan por presentar una alta pronunciadas que los terrenos donde generalmente hay
UHHFWDQFLDHVSHFWUDOGHELGRDODSRFDDEVRUFLyQGHODOX] explotacin de oro de aluvin, adems que no existen
como consecuencia de prdida de la cobertura vegetal. cuerpos de agua en su interior.
Presentan texturas medias a gruesas dependiendo de
'HUUXPEHV

Evidencia de explotacin de oro de


aluvin

Derrumbes

Evidencia de explotacin de oro de


aluvin

Derrumbes

Ilustracin 20. Izquierda EVOA y derrumbe,(Landsat 8 , falso color RGB 652) . Derecha Foto derrumbe y EVOA, sobrevuelo SIMCI.

vegetacin de porte bajo, pero se diferencian porque


no se evidencia respuesta espectral de agua, sino del
Los eriales se caracterizan por presentar una alta suelo y de la escasa vegetacin. Los eriales tienen
UHHFWDQFLD HVSHFWUDO GHELGR D OD SRFD DEVRUFLyQ GH un origen natural (geologa y clima) y no se generan
la luz, como consecuencia de la escasa vegetacin como consecuencia de actividades antrpicas. [55].
SRUWDQWH 3UHVHQWDQ WH[WXUDV QDV \DOJXQDV ]RQDV FRQ
Eriales71

Evidencia de explotacin de oro de


aluvin

Erial

Evidencia de explotacin de oro de


aluvin

Erial

Ilustracin 21. Izquierda EVOA y erial (Landsat 8 falso color RGB 547). Derecha Foto derrumbe (Fuente Diario El TIEMPO) y EVOA,
sobrevuelo SIMCI.
71. Zonas secas sujetas a erosin elica con vegetacin incipiente de bajo desarrollo, sin
uso [85]De acuerdo con el DANE tienen un origen geolgico distinto a los suelos desnudos
debido a los tiempos de formacin [93].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

119

rodean los estanques, pero se diferencian porque existe


un claro diseo rectangular en el rea de produccin,
Los estanques para produccin pisccola se caracterizan evidenciable principalmente en imgenes de resolucin
SRU SUHVHQWDU XQD EDMD UHHFWDQFLD HVSHFWUDO GHELGR espacial (<15m). Debido a los requerimientos de agua de
a la alta absorcin de la luz, como consecuencia de la la actividad pisccola en muchos casos estos estanques
existencia de cuerpos de agua. En algunos casos estos estn localizados en valles y llanuras aluviales, y pueden
estanques estn inmersos en zonas sin cobertura vegetal, coincidir en las mismas zonas donde se presenta la
lo que responde a altas respuestas espectrales que actividad de explotacin de oro de aluvin.
Estanques pisccolas

Estanques pisccolas

Evidencia de explotacin de oro de


aluvin

Evidencia de explotacin de oro de


aluvin

Estanques pisccolas

Ilustracin 22. Izquierda EVOA y estanques pisccolas (Landsat 8 falso color RGB 652). Derecha Foto Estanques (fuente ICA) y EVOA,
sobrevuelo SIMCI.

agua, pero se diferencian porque stos estn rodeados


por algn tipo de cobertura herbcea que genera una
respuesta espectral ms baja que la que muestran
Los jageyes se caracterizan por presentar una baja los suelos desprovistos de vegetacin que rodean los
UHHFWDQFLD HVSHFWUDO GHELGR D OD DOWD DEVRUFLyQ GH OD estanques en las zonas de explotacin de oro de aluvin.
luz como consecuencia de la existencia de cuerpos de
-DJH\HV72

Jageyes

Evidencia de explotacin de oro de


aluvin

Jageyes

Evidencia de explotacin de oro de


aluvin

Ilustracin 23. Izquierda EVOA y Jageyes,(Landsat 8 , falso color RGB 564) . Derecha Foto jageyes y EVOA, sobrevuelo SIMCI.

Suelos desnudos
Los suelos desnudos se caracterizan por presentar una
DOWDUHHFWDQFLDHVSHFWUDOGHELGRDODSRFDDEVRUFLyQGH
la luz, como consecuencia de la exposicin del horizonte

72. Depresiones sobre el terreno que permiten almacenar agua proveniente de


HVFXUULPLHQWRVVXSHUFLDOHV>@

120

UNODC - MINJUSTICIA

VXSHUFLDO GHO VXHOR 3UHVHQWDQ WH[WXUDV QDV SHUR VH


diferencian porque no son evidentes en la imagen satelital
cuerpos de agua en su interior.

Suelo desnudo

Evidencia de explotacin de oro de


aluvin

Suelo desnudo

Evidencia de explotacin de oro de


aluvin

Ilustracin 24. Izquierda EVOA y suelo desnudo (Landsat 8, falso color RGB 564). Derecha Foto Suelo desnudo y EVOA, sobrevuelo SIMCI.

su interior, y porque el patrn de las reas es regular.


Tambin se pueden diferenciar en muchos casos estas
Las zonas de preparacin para actividades agropecuarias zonas de las reas de explotacin de oro de aluvin
VH FDUDFWHUL]DQ SRU SUHVHQWDU XQD DOWD UHHFWDQFLD porque no siempre estn localizadas al margen de los
espectral debido a la poca absorcin de la luz, como ros; adicionalmente, al revisar imgenes satelitales de
consecuencia de las actividades de labranza y arado que fechas previas se pueden observar los mismos lotes
JHQHUDQODH[SRVLFLyQGHOKRUL]RQWHVXSHUFLDOGHOVXHOR productivos en ciclos diferentes cuando no se trata de
3UHVHQWDQWH[WXUDVQDVSHURVHGLIHUHQFLDQSRUTXHQR reas agrcolas nuevas.
son evidentes en la imagen satelital cuerpos de agua en
=RQDVSUHSDUDFLyQSDUDSDVWRV\FXOWLYRV

Evidencia de explotacin de oro de


aluvin

Preparacin pastos y cultivos

Evidencia de explotacin de oro de


aluvin

Preparacin pastos y cultivos

Ilustracin 25. Izquierda EVOA y suelo desnudo (Landsat 8, falso color RGB 652). Derecha Foto preparacin de terreno y EVOA, sobrevuelo
SIMCI.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

121

Media - Gruesa

Presenta
patronamiento interno
lineal o de redes?
SI

Centro
Poblado
SI

NO

SI

SI

Descripcin
Tonalidad clara que representa alta reflectancia del suelo por las
excavaciones y la remocin de la capa vegetal, de igual manera
esta tonalidad se presenta en suelos desnudos o con mnima
vegetacion herbacea, en distintos tipos de minas y canteras, en
bancos de arena y en suelos en preparacin para cultivos.
Composiciones a color utilizadas 564 y 654 satelite Landsat 8T

Fina

SI

NO

Se encuentra en
llanuras y/o valles
aluviales (zonas
colindantes a ros)?

Cultivos
Pastos

VERIFICACIN
CON
SOBREVUELO

Suelos en
preparacin para
cultivos y/o pastos

NO

Derrumbe, suelo desnudo,


suelos en preparacin
para cultivos y/o pastos,
explotacin de minerales
diferente al oro de aluvin,
jageyes, eriales

Otras coberturas

VERIFICACIN
CON
SOBREVUELO

Evidencia de
explotacin de
oro de aluvin

Nubes y Gaps

SI

reas con
estanques para
piscicultura

Cobertura existente en
los ltimos 2 aos

NO

Existe informacin secundaria?


(DICAR, Ministerio Minas y
Energa, UPME)

SI

Se presenta patronamiento regular


o geomtrico (discriminable en
imgenes de alta resolucin espacial)
asociado a las reas con agua
evidenciadas en la imgen Landsat?

NO

Evidencia de
explotacin de
oro de aluvin

Evidencia de
explotacin de
oro de aluvin

SI

Existe deteccin minera


en el censo anterior?

NO

Hay presencia interna de


pequeas reas con agua?

Evidencia de
explotacin de
oro de aluvin

SI

Brillante, claro ( azul, rosado)

Textura

NO

NO

Existe deteccin
minera en el censo
anterior?

SI

Existe informacin
secundaria? (DICAR,
Ministerio Minas y Energa,
UPME)

Hay presencia interna de


pequeas reas con agua?

Evidencia de
explotacin de
oro de aluvin

NO

VERIFICACIN
CON
SOBREVUELO

NO

reas con
estanques para
piscicultura

UNODC - MINJUSTICIA

122

Se presenta patronamiento regular o


geomtrico (discriminable en imgenes
de alta resolucin espacial) asociado a
las reas con agua evidenciadas en la
imgen Landsat?
Evidencia de
explotacin de
oro de aluvin

Ilustracin 26. rbol de decisin para deteccin de EVOA con uso de maquinaria en tierra.

&RQDELOLGDGde la metodologa
La aplicabilidad de la metodologa de espacializacin
de EVOA por deteccin remota est subordinada
D OD FRQDELOLGDG GH ORV KDOOD]JRV 'HELGR D TXH HO
monitoreo propuesto est centrado en variables proxy
o instrumentales de la explotacin mineral, es muy
LPSRUWDQWHHYDOXDUODFRQDELOLGDGSDUDHVWHHMHUFLFLRQR
se han realizado mediciones en terreno para contrastar las
iUHDVFRQ(92$LGHQWLFDGDVSRUWHOHGHWHFFLyQUHVSHFWR
de las reas en campo; sin embargo, se realizaron
VREUHYXHORV VREUH  KHFWiUHDV LGHQWLFDGDV SRU
teledeteccin (el 26% del rea total de EVOA detectadas),
encontrando que la correspondencia fue del 95%. Para
UHIRU]DU HO DQiOLVLV GH FRQDELOLGDG GH OD WHOHGHWHFFLyQ
se hizo uso de la informacin secundaria disponible y
particularmente un anlisis de correspondencia entre los
puntos de georeferenciacin de las encuestas del Censo
Minero (CM) respecto de los hallazgos por teledeteccin,
encontrando que el 90% de los puntos de localizacin
de explotaciones registrados por el CM corresponden a
]RQDVTXHWDPELpQIXHURQLGHQWLFadas por teledeteccin.

Departamentos como Bolvar, Antioquia, Choc y Cauca


pueden presentar explotacin de oro de aluvin con uso
de maquinaria en tierra y en agua en el mismo territorio,
por lo que las evidencias en tierra pueden coincidir con
encuestas del censo minero con explotacin mediante
maquinaria en agua.

como fuente de caracterizacin de las EVOA, no solo


por el hecho de que no cubre todos los departamentos,
sino porque el marco no incluye toda la informacin del
universo minero.

El marco de estudio del censo minero se bas en el nmero


de ttulos mineros vigentes en el Registro Minero Nacional.
No se tuvieron en cuenta ttulos con registro menor
D XQ DxR SRU OD HVFDVD H[SHULHQFLD GH OD UPD PLQHUD
y porque en la mayora de los casos las actividades se
inician al segundo ao de ser otorgado el ttulo, una vez
se obtiene la aprobacin de la documentacin tcnica y
ambiental requerida. [56] Adicionalmente, la informacin
relacionada con minera ilegal75 no estuvo completa por
falta de informacin. Esto quiere decir que la informacin
del censo minero puede usarse como puntos de verdad
En este captulo se presentan de manera detallada los de campo (se hicieron encuestas georreferenciadas en
KDOOD]JRVUHVSHFWRDODFRQDELOLGDGGHODPHWRGRORJtDGH ODVTXHVHYHULFyODDFWLYLGDGPLQHUD SHURQRFRPRXQD
deteccin que permiten proponer su implementacin como representacin plena de las actividades de minera.
modelo de monitoreo de las evidencias de explotacin de
De las 14.357 encuestas del Censo Minero, el 29%
oro de aluvin.
(4.121) se realiz en Unidades de Produccin Minera
(UPM) relativas a explotacin de oro; el 8% de estas
El 95% de los puntos detectados en sobrevuelos de
4.121 se realiz en UPM de explotacin por barequeo,
YHULFDFLyQIXHURQLGHQWLFDGRVPHGLDQWHODPHWRGRORJtD
mazamorreo, manual, artesanal o tradicional, 48% se
planteada y cubren un rea de 21.000 ha, el 26% de
concentr en minas de tipo subterrneo76, con yacimientos
evidencias para el 2014.
SULPDULRVWLSRYHWDROyQ\HOUHVWDQWHVHFRQFHQWUD
en explotaciones de yacimientos secundarios o de aluvin;
Censo minerR\(92$GHWHFWDGDV
20% relativo a explotacin en el lecho de los ros (uso
Durante el periodo 2010-2011 el Ministerio de Minas y de maquinaria en agua)77 y 24% en UPM relacionadas
Energa realiz el Censo Minero73 con el propsito de con explotacin en terrenos aluviales (uso de maquinaria
conocer acerca de las condiciones tcnicas, ambientales, en tierra y tcnicas de explotacin que alteran el paisaje
socioeconmicas, organizacionales y administrativas, en circundante); este 24% (964 encuestas) se utilizaron como
las Unidades de Produccin Minera. Aunque inicialmente SXQWRV YHUGDG GH FDPSR SDUD HYDOXDU OD FRQDELOLGDG
se contempl su desarrollo en 31 departamentos, en ocho temtica de las EVOA.78
de ellos (Vichada, Amazonas, Guaina, Vaups, Sucre, 75. Para establecer la magnitud de las encuestas, se solicit informacin primaria sobre
Quindo, Nario y Guaviare) no se pudo llevar a cabo, minera ilegal a las entidades competentes, sin embargo el informe precisa que no todas
las entidades suministraron la informacin. El informe logr establecer que son pocos
debido principalmente a factores de orden pblico, minera los trmites desarrollados por estas entidades y no hay un consolidado que permita dar
precisin referente a la ubicacin de las unidades de explotacin. [56].
incipiente y altos costos [56].
El censo minero ofrece una fuente de informacin
YDOLRVD SDUD HYDOXDU OD FRQDELOLGDG PHWRGROyJLFD GH
la teledeteccin de las EVOA, ya que las encuestas
fueron realizadas en el sitio de explotacin y estn
georreferenciadas74; sin embargo la cobertura del censo
minero tiene limitaciones importantes para su aplicacin
73. Censo Minero realizado por el Ministerio de Minas y Energa- MME , 2011.
74. La base de datos del Censo Minero se encuentra en formato Excel e incluye
informacin de coordenadas en grados, minutos y segundos que fueron georreferenciadas
para la obtencin del archivo espacial. La informacin no relaciona la precisin de los
dispositivos de captura, ni el sistema de proyeccin empleado. Para la transformacin se
asumieron como base coordenadas en WGS84.

76. El mtodo de explotacin reportado en las encuestas del CM como de tipo subterrneo
se focaliza en Bolvar, Caldas, Tolima, Huila, Antioquia y Santander, mientras que la
minera tradicional, artesanal o mediante barequeo est reportada segn las encuestas
principalmente en Putumayo, Tolima y Bolvar. Sin embargo entrevistas realizadas
D PLQHURV HQ OD 5HJLyQ GHO 3DFtFR PHQFLRQDQ TXH HVWD PRGDOLGDG VH GHVDUUROOD
simultneamente en el mismo territorio con explotaciones mecanizadas (dragas,
retroexcavadoras) y es desarrollada por las comunidades que se ubican en la periferia de
las explotaciones mecanizadas. Estas encuestas no se tuvieron en cuenta para el anlisis
de coherencia temtica.
77. La explotacin de oro en el lecho de los ros mediante uso de maquinaria en agua
reportada por el CM se concentra en el ro Caquet entre los departamentos de Putumayo y
Caquet, Ro Ir, Ro San Juan y Ro Andagueda en Choc y Ro Porce y Nech en Antioquia.
78. Las encuestas realizadas por el CM en UPM de explotaciones de aluvin con uso de
maquinaria en tierra, se focalizan en Choc, Antioquia, Crdoba y Bolvar. La explotacin
de oro de aluvin en Antioquia y Choc se realiza mediante maquinaria en agua y
mediante maquinaria en tierra.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

123

Magdalena
Cesar

!
!(
(
! 74W
(
!
(
!
(

75W

77W

76W

!
(

Sucre

!
(
#
*
!
(
#
*
#
*
!
(
#
*

#
*
!
(
!
(

!
!
!( #
(
(
!
(
*
#
#
*
#*
*
#*#
**
#
*#
#
*
#
#
*
#
*
#
** #
*
!
(
#
*

Crdoba

#
*#
*

!
(
!
(

#
#
*
*
*
#
*
!#
(

#
*
!
(

#
*#
*
#
*
!
(

Ocano
Pacfico

!
(

#
*
!
(
!
(
#
!
*(
(
!
!
(
!
!
(
(
#
!
!*
*
(
(
!
(
#
!
(
#
#
*
!#
*
(
#
*
*
#
*
!
!
!
(
(
(
!
(
!
(
#
*
#
*
!(
*
(
!
!#
#
(
*(
!
(
!
#
*
*
!#
(
#
*
#
*
!(
(
!
(
#
*
#
*
#
*(
#
! (
!
*(
!
!
#
*
!
!
#
(
(
*
!!(
!(
(
#
!#
*
(
!
(
!
*
(
!
!
(
(
#
!
*
(
!
!
!
!
(
(
#
(
(
*
#
!
*
(
#
*
!
(
!
(
#
#
#
*
*
*
!
!
(
(
#
#
*#
*
*
#
*
!
(
#
#
*
*
!
(
#
!(
!
*
#
(
#
#
*
*
*
!(
(
#
*#
#
!*
!(
(
(
!(
!
!(
!
#
!
*
(
*
#
!(
!(
!
#
#
*
*#
(
!
(
*
*
!
#
!
(
*
#
!
#
#
*
#
!
(
!#
*
*
*#
#
(
(
!
(
*
#
!
!
*
(
(
!
!
!
!
#
#
*(
(
!
!
(
(
(
*
*
(
#
#
!
!
*(
*
(
(
!(
*
*
#
!
(
#
(
!*
! #
!
!#
(
(
(
*
!
(
*
!
!
!(
(
#
*
(
!(
*
!#
(
#
*
*#
! # #
!
*
#
(
*(
*
!
#
(
*#
#
*#
!*
(
*#
!
!
(
!#
*
!
!
(
(
(
! (
(
#
#
*
*
!
*
(
!
*
#
(
*
!(
#
(
#
*
!#
!
#
*
(
!
(
*
#
#
!
! (
(
*
*
(
! (
!
#
(
!
*
!
!
(
(
#
*
#
*
#
*
*
!
(
!#
(
#
*
!
! #
(
!
(
*
!
(
#
*#
* (
*#
#
*
Choc

!
(

#
*
!
(
!
(
#
*
!
(
#
!
*
(
!
(
#
* (
!

#
*#
**
!
(
#
!
(
#
!
*
(
#
*
!
(

Santander

Boyac

76W

74W

#
*

#
*
#
#
**
#
*

#
*

Meta

!
(

3N

3N

#
*
!
(
Neiva

Cauca

Caldas

Valle

77W

76W
Quindo

Mar
Caribe

!
(

#
*

!
!(
!(
(
#
*
#
*

75W

Valle
Tolima

Risaralda

#
*
#
*
!
(
#
* #
*

#
*

#
*
#
#
*
*
#
*
*
#
*#
#
*#
*
#
*
*#
#
!#
*
*
(
!
(

6N

6N

(
!
!
(

75W

Cali

#
*
#
*
*
!
(
#
*#
*#
##
*
*
#
*
!
(
#
*
#
*
#
*
!
(
#
*

#
*

!(
#(
#
*
!
*
(
!
!
(
#
*
Medelln

#
*

5N

#
*

6N

#
*
#
*
#
*

5N

7N

#
!
*
(
!
(

#
*

7N

#
*

#
*

6N

8N

#
!
*
(
#
*
!
#
!
(
*
#
(
*
#
!
#
*
!
(
*
(
!
#
#
!
(
*
*
(
! (
(
!
#
!#
!
*
(
(
!
*
(
!
#
!
*
(
!
*
!
(
#
(
*
!(
!
(
(
#
!#
*
(
#
!
*#
(
#
#
!
*
!
(
(
!
*
(
!
*
(
#
!(
!
*
(
(
!
!
(
#
#
!
*
*#
(
#
#
*
!
!
**
!((
(
!
*
(
#
*
!
#
#
!
!
(
*
#
#
*
(
!
(
!
*
*
!
#
#
!((
(
*
*
(
#
!
*
(
#
*
!
!
#
(
*
!
(
!
(
!
!
(
(
#
*
!
(
!#
!
(
!
*
(
!(
(
#
!
!
*
!
(
(
!(
(
!
!
(
(
!
#
!(
(
(
*
#
!
!
*
(
!
!(
(
#
*
!
(
#
!
*
!
(
(
!
(
!
#
!
(
#
*
!
(
*
(
#
*
!
!
(
(
!(
#
!
(
*
(
!
!
(
!
#
!
(
*
(
#
#
*
#
*
*(
#
!
*
!
!(
!
(
(
#
*
#
#
!
*
*
(
!
#
!
#
*
!
(
*
#
(
#
*
*
!(
#
(
*
#
*
#
*
#
#
* (
#
*
!(
*
(
#
!
*
!
(
(
!
#
#
#
*#
(
*
*
#
!
*
! *
#
*
#
#
!
*
*
(
#
#
*
*
#
*
#
!
*
(
#
!
! !(
*
(
!
(
#
!
#
*
!
(
(
!
!#
(
#
*
!( (
!
(
#
(
*
!
!
!*
(
(
*
!
!(
(
#
(
*
!
(
!
#
(
*
!
!
(
#
#
((
*
*
!
#
(
!
*
!
(
!
!
(
!(
!
!
!
#
#
(
#(
*
*
(
! (
*
(
#
*
#
*
!(
#
(
*(
!
*#
!
*
(
!
!
(
#
*
!#
(
#
*
!
#
(
!
*
(
!
!
!
(
(
(
#! (
!#
#
!(
! (
*
(
!
(
#
*
!
(
! *(
!
*
(
!
(
!
!
!#
(
(
(
!
#
(
*
#
#
!
!
*
* (
*
(
(
!
#
(
*
!(
! #
#
*
(
(
*
!(
!
#
!
*
(
!#
!
(
#
(
*
#
!
!
*
#
*
(
#
*
!
(
#
*
*
!
#
(
!
*
(
#
*
#
!
*
!
(
(
#
#
*
#
*
!
*
!
!
(
(
(
!
#
(
*
#
*#
*
!
#
*
! *#
!
(
#
*
#
*
(
(
!
#
(
*
*
#
! (
#
*
!
*
*#
(
#
!
*
*
(
#
#
#
!(
!
*
#
*
*
*#
(
!
(
#
* #
#
*
*
!
(
#
!
(
#
#
*
*
#
#
!
*
*
(
#
!
*
(
!
#
(
*
!
! (
(
#
(
!
*
#
*
!
#
(
*
!
#
#
(
!
(
(
!
*
*
!
#
*
!
(
#
*
* ##
*
##
#
*
#
*
!* *
(
Antioquia
#
*

!
#
*(
!
(

#
*

Bolvar

#
#
*
#
*
*
#
#
*
*
#
#
*
*
#
#
#
#
*
#
*
*
#
*
*
#
#
#
#
#
#
*
*
*
*
#
*
*
*
*
#
#
*
*
#
#
*
* #
#
*
*#
!
#
#
#
(
*
*
*
*
#
*
#
#
*#
*
*
#
*#
#
* *

!
(

8N

*
#
*#
#
*
*#
#
*
*
##
*
*#
*#
*
*
#
#
*#
*#
#
*#
*

Antioquia

Panam
Venezuela

*
!
(
!#
!
!(
(
!
(
Huila

2N

2N

Ocano
Pacfico

Florencia

Ecuador

Brasil

Caquet

Per

Puerto
Ass

Putumayo

1N

1N

!
(
!
(
!
(
!
(
!
(
!
(
!(
(
!(
! !
!
(
!(
(
!(
!
!(
(
!
!(
!(
!
(
!(
(
!(
!
(
!
(
!
!
(
(

#
*
#
*#
*#
*#
*
#
*
#
*
#
*
#
*

!
(

#
*

con uso de maquinaria en tierra

!
(

con uso de maquinaria en agua

Densidad evidencia explotacin 2014 (ha/km)

!
(

0-1
!
(
!
(
!
(
!(
!(
! (
!
(

76W

75W

!(
(
!
!
(
!
(
!
!(
!(
(
!
(

1.1 - 5
>5

ECUADOR
0

Censo minero de Oro, Metodo de explotacin

Fuentes: para evidencia de explotacin: Gobierno de Colombia - Sistema de monitoreo apoyado por UNODC; para censo minero: Ministerio de Minas y Energa
Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas.

Mapa 17. Densidad EVOA 2014 y sitios de encuesta censo minero 2011, modalidad explotacin con maquinaria en tierra y con maquinaria en agua.

Las encuestas en UPM relacionadas con explotacin


en terrenos aluviales con uso de maquinaria en
tierra y tcnicas de explotacin que alteran el paisaje
circundante, se realizaron en los departamentos de
Antioquia (40%), Choc (26%), Bolvar (25%); el resto
en los departamentos de Cauca, Crdoba, Putumayo,
Santander y Tolima (9%).

de los polgonos detectados, y el 23% en un radio de


LQXHQFLDGHP79 a una evidencia detectada.

El 10% de los sitios de la encuesta del CM restante,


no fue detectado por la metodologa aplicada en este
estudio. Al comparar los datos del CM correspondientes
a esta fraccin de encuestas con imgenes satelitales, se
encuentra que el 8% de los mismos no presenta EVOA
El 80% de las encuestas realizadas en UPM en con correspondencia espectral; los puntos caen en zonas
Antioquia se focalizan en los municipios de Anor, de coberturas vegetales de bosques, rastrojos y cuerpos
=DUDJR]D (O %DJUH 6HJRYLD \ $PDO /RV PXQLFLSLRV hdricos. De este modo, la omisin de la metodologa
de Condoto, Cantn de San Pablo, Nvita, Tad y Unin corresponde slo al 2% del total de sitios relacionados en
Panamericana en Choc, concentran el 70% de las la encuesta del CM.
encuestas realizadas, mientras que para el departamento
de Bolvar las encuestas se centralizaron en el municipio El 10% que no fue detectado se distribuye en los
departamentos de Bolvar (4%), Choc (3%), Antioquia
de Montecristo (80%).
(2%) y Crdoba (1%). En la base de datos del CM estn
El 90% de los sitios de la encuesta del Censo Minero en relacionados con mtodos de explotacin de Bancos,
UPM relacionadas con explotacin en terrenos aluviales Drsenas y Corte y relleno. Las omisiones por la
(uso de maquinaria en tierra y tcnicas de explotacin aplicacin de la metodologa diseada para este estudio
que alteran el paisaje circundante), coinciden con EVOA no son sistemticas. Del total de sitios con estos mtodos
detectadas en el estudio. El 67% se encuentran al interior de explotacin, se registr el 77%.

Ilustracin 27. Distribucin porcentual de encuestas del Censo Minero relativas a oro segn modalidades de explotacin, 2011.
79. Con base en la informacin disponible en el censo minero se considera esta distancia
FRPRHOUDQJRQRUPDOGHLQXHQFLDGHFDSWXUDPHGLDQWHGLVSRVLWLYRVPyYLOHV

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

125

Censo Minero a menos de 300m de evidencias

Coherencia temtica Censo


Minero con Evidencias

Censo Minero a mas de 1000m de evidencias


,OXVWUDFLyQ&RQDELOLGDGPHWRGROyJLFDDQiOLVLVGHFRUUHVSRQGHQFLDHQWUHHQFXHVWDVFHQVRPLQHUR\(92$(QDPDULOORSXQWRV
de encuestas del censo minero; en negro, polgonos de EVOA detectados.

INTEGRACIN DE
INFORMACIN
En los ltimos aos el modelo de investigacin del
proyecto SIMCI ha evolucionado, al pasar de limitar sus
esfuerzos a la construccin de datos sobre los fenmenos
y problemticas presentes, como hectreas sembradas
con cultivos de coca, rea asperjada y rea erradicada,
para convertirse en un modelo de investigacin donde el
eje integrador es el territorio, el cual se constituye en el
marco de los anlisis. Este cambio de enfoque, asociado
a la incorporacin de la teora del riesgo, ha mostrado
que la integracin de informacin sobre las amenazas
y las vulnerabilidades permite entender de una manera
ms consistente y productiva las dinmicas presentes en
los territorios.
La construccin de este modelo requiere de la integracin
de informacin, y la estandarizacin de los datos y la
FRPSDUDELOLGDGWHPSRUDO\JHRJUiFDVRQFDUDFWHUtVWLFDV
necesarias. Para presente el estudio se ha abordado la
perspectiva de integracin mediante el uso del marco de
reas.

126

UNODC - MINJUSTICIA

&RQ HO Q GH TXH RWURV LQYHVWLJDGRUHV FRQR]FDQ ODV


ventajas y limitaciones del uso este marco, se describen a
continuacin los procesos tcnicos para la integracin de
la informacin disponible dentro del marco de reas. Para
asignarle a las grillas de un kilmetro cuadrado los lmites
administrativos se utilizan las coordenadas del centro del
polgono de la grilla. Con los datos de EVOA se realiza
una interseccin con la grilla. Finalmente, al realizar este
proceso es necesario calcular las reas de los nuevos
polgonos de EVOA y as conocer el cubrimiento de esta
capa por grilla; los datos de cultivos de coca, al estar
en el mismo formato, ingresan directamente a la base
de datos, y los anlisis para conocer las coberturas de
la tierra se realizan mediante interseccin espacial con
las coberturas interpretadas a partir de las imgenes
GHVDWpOLWH\ODJULOODQDOPHQWHVHFDOFXODHOiUHDGHOD
FREHUWXUD SUHGRPLQDQWH SDUD FDGD JULOOD /DV JXUDV D
continuacin presentan un ejemplo de cada caso.

Asignacion de informacion de los lmites administrativos mediante las coordenadas del centro dela grilla (a)

Lmites administrativos (municipios) y grilla de 1 kilometro2

Asignacin de los lmites segn el centro de la grilla

Asignacin de las rea interpretadas de EVOA por interseccin con la grilla (b)

EVOA (polgonos) y grillas 1 kilmetro2

EVOA discriminado por grillas 1 kilmetro2

Asignacin de cobertura de la tierra predominante a la grilla (c)

Coberturas de la tierra (Choc - Quibd)

El apartado anterior describe la integracin de la


informacin que genera el proyecto SIMCI y que se
integra al marco de reas; sin embargo, para el anlisis

Grillas con coberturas predominantes: naranja (intervenido), verde (bosque), gris ()

de las dinmicas de la minera en Colombia es necesario


complementar la informacin anterior con la informacin
RFLDOVREUHPLQHUtD(OVLJXLHQWHDSDUWDGRVHHQIRFDHQ
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

127

OD GHVFULSFLyQ GH OD LQIRUPDFLyQ JHRJUiFD GLVSRQLEOH 0LQLVWHULRGH0LQDV\(QHUJtD&HQVR


sobre minera, con nfasis en los datos disponibles de 0LQHUR&0
minera de oro de aluvin.
El Ministerio de Minas y Energa se encarga de gestionar las
,QIRUPDFLyQJHRJUiFDGLVSRQLEOHUHODWLYD polticas relacionadas con las actividades de exploracin
DPLQHUtDGHRURGHDOXYLyQ
y explotacin del potencial minero en Colombia. En 2010
VHUHDOL]yHO&HQVR0LQHURFRQHOQGHFRQRFHU
/DVHQWLGDGHVHQFDUJDGDVGHJHQHUDULQIRUPDFLyQRFLDO las condiciones de las Unidades de Produccin Minera
de minera en Colombia son el Ministerio de Minas -UPM del pas. El CM cubri 23 departamentos y 527
y Energa, la Agencia Nacional de Minera (ANM), la PXQLFLSLRVGHOSDtVHQODJXUDDOFRVWDGRHQFRORUYHUGH
Autoridad Nacional de Licencias Ambientales (ANLA), se presentan los ocho departamentos en los cuales no
la Direccin de Carabineros y Seguridad Rural (DICAR), se pudo realizar el censo minero. El objeto de medicin
las Corporaciones Autnomas y las Fuerzas Armadas y fueron las unidades de explotacin minera de tipo frente
de Polica, en relacin con las operaciones interdictivas de explotacin o bocamina, canteras, material de arrastre
a la minera ilegal. Cada una de estas entidades, en y en general en todo tipo de explotaciones subterrneas
cumplimiento de su misin, han georreferenciado y a cielo abierto80.
su informacin y en algunos casos creado visores
JHRJUiFRV TXH SHUPLWHQ FRQVXOWDU OD LQIRUPDFLyQ GH Como resultado se obtuvo un archivo de Excel con 322
campos y 14.357 registros correspondientes al total de
inters relacionada con minera.
las UPM censadas; adicionalmente se cuenta con el
GLFFLRQDULR GH GDWRV HO FXDO SUHVHQWD HO VLJQLFDGR GH
cada uno de los campos de la base de datos, informacin
que facilita su comprensin.

Figura 10. Cobertura del Censo Minero por departamento (Fuente:


MME, 2011).

El archivo contiene datos de ubicacin como el municipio,


HOGHSDUWDPHQWR\DGHPiVODVFRRUGHQDGDVJHRJUiFDV
(longitud y latitud) en grados, minutos y segundos
capturados en sistema de referencia WGS8481; con estos
datos se georreferenciaron y crearon puntos conservando
los dems atributos. El resultado es un archivo de tipo
vector con geometra de punto; en este formato se
depur la informacin relacionada con minera de oro
y se consolid una base de datos espacial con 4.121
registros, lo que representa el 29% de las UPM censadas.
Mediante las consultas a cada uno de los campos es
posible saber para estos puntos si la actividad minera se
realiza mediante bombas sumergibles, con compresores,
con dragas, con elevadores, retroexcavadora o con algn
tipo de maquinaria; adicionalmente, si las operaciones
se realizan de forma subterrnea o a cielo abierto entre
otros.

80. Censo minero departamental 2010-2011, Ministerio de Minas y Energa.


81. Sistema de referencia mundial en el cual por defecto se captura la informacin
mediante dispositivos GPS o navegadores. No se tienen certeza de la exactitud ni mtodo
de levantamiento de las coordenadas reportadas en el archivo de Excel.

128

UNODC - MINJUSTICIA

Figura 11. Ubicacin de puntos de encuesta del Censo Minero (Fuente, MME, 2011).

Al comparar la ubicacin reportada en hoja de datos


de Excel y la calculada mediante georreferenciacin
se presentan diferencias en los campos de municipio y
departamento; estas diferencias son comunes cuando el
trabajo de campo requiere de una digitacin posterior de
la informacin, como es el caso del CM. Por lo anterior,
se recomienda realizar una validacin de la informacin e
LGHQWLFDFLyQGHSRVLEOHVGLIHUHQFLDVSDUDHYLWDUDQiOLVLV
errados o ubicaciones incorrectas de puntos en futuras
investigaciones. Para los anlisis espaciales adelantados
Departamentos con datos de oro
Antioquia

en este documento se asumi como cierta la ubicacin


VHJ~Q ODV FRRUGHQDGDV JHRJUiFDV UHSRUWDGDV HQ HO
archivo original.
6H ORJUy LGHQWLFDU TXH  GH ORV  GHSDUWDPHQWRV \
124 de los 527 municipios censados presentaron por lo
menos un dato de oro; adems, el 73% de los puntos
de encuesta se encuentran entre los departamentos de
Antioquia (37%), Bolvar (23%) y Choc (12%).

Numero de UPM
censadas

% respecto del
total

1.520

37

Bolvar

964

23

Choc

507

12

Santander

254

Putumayo

209

Caldas

181

Cauca

170

Tolima

94

Huila

83

Risaralda

51

Caquet

42

Crdoba

32

Norte de Santander

0,12

Magdalena

0,10

Valle Del Cauca

0,10

Boyac

0,02

TOTAL

4.121

98.34

Tabla 23. Distribucin de encuestas del CM relativas a explotaciones de oro (Fuente: MME, 2011).

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

129

$JHQFLD1DFLRQDOGH0LQHUtD$10
LA ANM es la entidad encargada de administrar los
recursos minerales del Estado y es responsable del
otorgamiento de ttulos y control de la exploracin y
explotacin minera [57]. En cumplimiento de su misin la
$10JHQHUDLQIRUPDFLyQJHRJUiFDFRQODXELFDFLyQGH
ttulos, solicitudes y legalizaciones mineras, considerados
GXUDQWH ORV DQiOLVLV GHVDUUROODGRV FRPR JXUDV GH
formalidad ante el gobierno colombiano. Estos datos
YLHQHQ HQ DUFKLYRV GH WLSR YHFWRU HQ IRUPDWR VKDSHOH
La siguiente tabla resume las caractersticas de los
archivos entregados a UNODC/SIMCI82 que sirvieron
para la realizacin de los ejercicios de anlisis espacial.
Autoridad Nacional de Licencias
$PELHQWDOHV$1/$
La Autoridad Nacional de Licencias Ambientales ANLA es
la encargada de que los proyectos, obras o actividades
sujetos de licenciamiento, permiso o trmite ambiental,
cumplan con la normativa ambiental, de tal manera que
contribuyan al desarrollo sostenible ambiental del pas
(Decreto 3573) [24] 83. Estos datos vienen en archivos de
WLSRYHFWRUHQIRUPDWRVKDSHOHTXHVHGHWDOODQWDPELpQ
en la tabla siguiente.

82. La informacin de la ANM fue suministrada por la Direccin de Carabineros y seguridad


rural, DICAR. Se obtuvo informacin acerca de Solicitudes de legalizacin y Propuestas
de contrato a noviembre de 2014; Amparo de Ttulos sin licencia para los departamentos
de Putumayo, Caquet, Choc, Nario, Cauca y Valle a marzo 2015. Para el resto del
pas se obtuvo informacin de Amparo de Ttulos sin licencia a noviembre 2014 mediante
consulta en pgina web [88]. Las tablas de datos anexas no diferencian modalidades de
explotacin, ni tipos de yacimientos, por cuanto los archivos representan el universo de
ODVJXUDVGHIRUPDOLGDGSDUDODH[SORUDFLyQGHRURVLQGLIHUHQFLDFLyQSRUOyQRDOXYLyQ
83. La informacin relativa a licencias ambientales se obtuvo con corte a 2011 por fuentes
secundarias de otras organizaciones.

130

UNODC - MINJUSTICIA

5HVXPHQGHODLQIRUPDFLyQJHRJUiFDGLVSRQLEOHGHOD$10\$1/$

Nombre

Licencias ambientales
Archivo: LA_WWF_NAL

Geometra tipo

Polgono

Formato

Vector
Shape

Caractersticas

Cubrimiento
*HRJUiFR

Contiene informacin a 2011 de las


licencias ambientales discriminadas por
estado, modalidad, mineral y titular, se
encuentra organizada en 32 campos. Tiene
informacin para 28 departamentos.
Nmero de registros: 2.374.
Sistema de coordenadas planas origen
Magna - Bogot.
Escala: nacional.

Licencias ambientales
de oro

Polgono

Archivo: LA_ORO_2014

Vector
Shape

Luego de depurar los datos de licencias para


solo obtener las relacionadas a explotacin
de oro se tiene un archivo de 179 registros,
lo que equivale al 7,5% del total de las
licencias del pas. Tiene cubrimientos
en 14 departamentos concentrndose
principalmente en Antioquia.

Contiene informacin actualizada a agosto


de 2015, de amparo de ttulos discriminados
por modalidad, mineral y titular. El archivo
se encuentra organizado con 12 campos.

Amparo de ttulos
Archivo: Titulos_
sep2015

Polgono

Vector
Shape

Contiene informacin para 30 de los


32 departamentos de Colombia; solo
Amazonas y San Andrs y Providencia no
presentan informacin de amparo de ttulos.
Nmero de registros: 9.670.
Sistema de coordenadas planas origen
Bogot.
Escala: nacional.

Amparo de ttulos
Archivo: Amparo_Titulo_
Oro_Nal_2014

Polgono

Vector
Shape

Se depur la informacin de amparo de


ttulos para dejar solo los relacionados con
explotacin de oro de aluvin. El resultado
fue un archivo con 1.969 polgonos, lo que
representa el 20% del total de los ttulos en
Colombia. Contienen informacin para 22
departamentos

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

131

Nombre

Geometra tipo

Formato

Contiene informacin actualizada de propuestas de contrato a 2014. El archivo


se encuentra organizado con 7 campos.
Contiene informacin para 26 de los 32
departamentos.

Propuestas de contrato
Archivo:

Caractersticas

Polgono

Propuesta_contrato_Oro_Nal_2014

Vector
Shape

Nmero de registros:465
Sistema de coordenadas planas origen
Bogot.
Escala: nacional.

Propuestas de contrato
de oro
Archivo:

Polgono

Propuesta_contrato_Oro_Nal_2014_PaciFRB

Vector
Shape

Se obtuvo luego de depurar los datos para


obtener solo la informacin relacionada
con explotacin de oro. Para completar
el archivo ms actualizado de propuestas
de contrato de oro fue necesario agregar
informacin adicional actualizada a agosto
de 2015.
Qued un archivo con 942 registros, con
cobertura en 26 departamentos.

Solicitudes de legalizacin
Archivo:
Antioquia_Legalizacion_1382

Antioquia_Legalizacion_685

Polgono

Vector
Shape

Para completar el archivo ms actualizado


de solicitudes de legalizacin fue necesario agregar la informacin de diferentes
archivos (legalizacin 1382, 685, Antioquia
1382, Antioquia 685). Contiene informacin
actualizada de las solicitudes de legalizacin a 2014. El archivo se encuentra
organizado en 11 campos. Contiene informacin para 12 departamentos.
Sistema de coordenadas planas origen
Bogot.

Solcitudes_Legalizacion_
Ley_1382_Oro_Nal_2014

Escala: nacional.
Solcitudes_Legalizacion_
Ley_685_Oro_Nal_2014

Solicitudes de legalizacin de oro


Archivo:
Solicitudes_Legalizacion_Nal_2014

Polgono

Vector
Shape

Luego de consolidar y depurar la informacin de los diferentes archivos de


legalizaciones se obtuvo un archivo con
939 registros

Tabla 24. Informacin espacial disponible ANM-ANLA.

132

UNODC - MINJUSTICIA

Cubrimiento
*HRJUiFR

Para el uso adecuado de esta informacin fue necesario


realizar validaciones topolgicas, ya que se evidenciaron
superposiciones y duplicidad de informacin que podra
alterar los resultados. Para realizar los ejercicios de
anlisis espacial se utilizaron los archivos depurados
con solo los datos de minera relacionada a oro. En
estos ejercicios se dio prioridad de la informacin de la
siguiente manera: 1. Licencias ambientales 2. mparo de
Ttulos sin licencia84, 3. Solicitudes de legalizacin y 4.
Propuestas de contrato.
'LUHFFLyQGH&DUDELQHURV\6HJXULGDG
5XUDO ',&$5
La Direccin de Carabineros y Seguridad Rural (DICAR)
de la Polica Nacional tiene a su cargo la Unidad
Nacional contra la Minera Ilegal (UNIMIL), encargada de

liderar institucionalmente la lucha contra la minera ilegal


y adems contra aquellos que no cumplan los requisitos
legales y exploten recursos naturales y minerales85, en
coordinacin con los diferentes organismos estatales. En
cumplimiento de su misin, la DICAR genera informacin
con las coordenadas en grados, minutos y segundos
de las operaciones interdictivas contra la minera ilegal.
Mediante acuerdos institucionales fue posible tener
acceso a la informacin sobre las operaciones de las
incautaciones o destrucciones realizadas durante 2012,
2013, 2014 y 2015 (septiembre) en formato Excel.
Los archivos suministrados no discriminan el tipo de
explotacin, sino que relacionan en general campos con
minas intervenidas, retroexcavadoras, buldcer, motores,
motobombas, volquetas, incautaciones de oro, mercurio,
gasolina, acpm, arena, entre otros.

Nombre

Caractersticas

Operaciones 2012

Contiene informacin de incautaciones.

(archivo: DICAR_2012)

Nmero de registros: 5
Escala: nacional.

Operaciones 2013

Contiene informacin de incautaciones/destrucciones.

(archivo: DICAR_2013)

Nmero de registros: 12
Los puntos son los mismos que los suministrados para 2014.
Escala: nacional.

Operaciones 2014

Contiene informacin de incautaciones/destrucciones.

(archivo: DICAR_2014)

Nmero de registros: 12
Los puntos son los mismos que los suministrados para 2013.
Escala: nacional.

Operaciones 2015

Contiene informacin de operaciones organizada en 35 campos.

(archivo: DICAR_Op_2015)

Nmero de registros: 249


Escala: nacional.
Observaciones:
x

1RH[LVWHXQGLFFLRQDULRGHGDWRVTXHHVSHFLTXHDTXH
hacen referencia los campos reportados y las unidades.

x

Hay 49 puntos mal georreferenciados.

Consolidado de Operaciones 2015

Contiene informacin de operaciones organizada en 35 campos.

(archivo: Consolidado_OperDICAR_Minera_2015

Nmero de registros: 512


6LVWHPDGHFRRUGHQDGDVJHRJUiFDV:*6

cons_ptos_oper_dicar_2015)

Escala: nacional.
Observaciones:
x

No existe uQGLFFLRQDULRGHGDWRVTXHHVSHFLTXHDTXH
hacen referencia los campos reportados y las unidades.

Tabla 25. Informacin disponible DICAR (Fuente DICAR).


(VWDJXUDKDFHUHIHUHQFLDDODUFKLYRGHPSDURGHWtWXORVTXHQRVHLQWHUVHFWDFRQ
el archivo de Licencias ambientales. En este sentido pueden considerarse como ttulos
en exploracin.

85. http://www.policia.gov.co/.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

133

Con la informacin anterior es posible ubicar los puntos


de las operaciones realizadas. En este proceso, conocido
como georreferenciacin, se presentan errores en algunos
puntos que no se encuentran en el territorio nacional;
esto puede deberse a errores en la captura o digitacin
de coordenadas, casos comunes al momento de realizar
trabajo de campo; por lo tanto se recomienda estandarizar
el formato de recoleccin de informacin de operaciones
interdictivas de la minera ilegal, adems de la creacin
de un manual de usuario para llenar la informacin de
manera estandarizada, y un diccionario de datos que
permita analizar los datos a personal diferente al que
realiz la operacin. Para poder obtener un producto con

Departamento

Nmero de
operaciones

estas caractersticas se recomienda la creacin de un


aplicativo que funcione en dispositivos portables como
los celulares o GPS de ltima generacin, mediante el
cual la informacin capturada sea guardada en una base
de datos con una estructura clara y sin errores asociados
a la ubicacin de los puntos.
$O FRQVWUXLU HO DUFKLYR JHRJUiFR VH HYLGHQFLD XQD
cobertura nacional con actividades realizadas en 22
departamentos del pas; el 74% de las operaciones se
concentran entre los departamentos de Antioquia (49%),
Valle del Cauca (13%), Crdoba (8%) y Cauca (4%).

% respecto al
total

Antioquia

207

49

Valle del cauca

54

13

Crdoba

33

Cauca

17

Santander

15

Nario

13

Caldas

12

Huila

12

Choc

10

Putumayo

10

Magdalena

Tolima

Bolvar

Cesar

Atlntico

Caquet

Casanare

0,2

Guaina - Vichada

0,2

Guajira

0,2

Sucre

0,2

Urab

0,2

Vichada

0,2

Ilustracin 29. Cobertura de las operaciones de interdiccin


relacionadas a minera realizadas por la DICAR en el pas (Fuente
Armada Nacional).

Construido mediante el archivo: Consolidado de Operaciones 2015

$UPDGD1DFLRQDOGH&RORPELD
La Armada Nacional de Colombia realiza operaciones
de control contra minera ilegal en ros y reporta las
coordenadas de dichas operaciones en grados, minutos y
segundos. Mediante acuerdos institucionales fue posible
tener acceso a las coordenadas de las operaciones
realizadas durante los ltimos 5 aos. Los datos
suministrados corresponden a las coordenadas, municipio

134

UNODC - MINJUSTICIA

y departamento de las 13 operaciones realizados por la


Fuerza Naval de Oriente en los ltimos 5 aos en los
departamentos de Guaina, Vichada y Casanare. La
Fuerza Naval del Sur no cuenta con datos estadsticos
de operaciones.

Ilustracin 30. Cobertura de las operaciones interdictivas de la Armada a minera (Fuente Armada Nacional).

Los diferentes datos relacionados en el apartado siguiente esquema presenta toda la informacin que
DQWHULRU ,QIRUPDFLyQ JHRJUiFD GLVSRQLEOH GH PLQHUtD qued integrada en el marco de reas para el estudio de
de oro de aluvin) se integraron al marco de reas. El explotacin de oro de aluvin.

Ilustracin 31. Marco de reas EVOA.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

135

Recomendaciones
Actualmente existen diferentes instituciones
generando informacin de minera, de acuerdo
FRQODPLVLyQ\REMHWLYRVHVSHFtFRVGHFDGDXQD
Es recomendable la creacin de una instancia del
Gobierno que centralice la informacin disponible
en el pas; se recomienda igualmente que la
estructura de este modelo de integracin est
enfocada en una infraestructura de datos que
soporte tanto informacin alfanumrica como
LQIRUPDFLyQJHRJUiFDHQGRQGHFDGDXQDGHODV
instituciones represente un nodo de informacin
disponible.
En cada una de las instituciones es necesario
generar mecanismos que aseguren la correcta
geometra y topologa respecto a la informacin
JHRJUiFDGHORVGDWRVSXEOLFDGRV
Al recolectar informacin en campo se deben
GHMDU GHQLGRV ORV IRUPXODULRV GLFFLRQDULRV GH
datos y manuales de recoleccin de informacin,
FRQ HO Q GH HVWDQGDUL]DU XQLGDGHV GH PHGLGD
y conceptos; adems, si se requiere tener la
ubicacin de esta informacin se recomienda
la creacin de un aplicativo que funcione en
dispositivos portables como los celulares o GPS
de ltima generacin, mediante los cuales la
informacin capturada sea guardada en una base
de datos con una estructura clara y sin errores
asociados a la ubicacin de los puntos.
9LVRUHVJHRJUiFRVGLVSRQLEOHVHQPLQHUtD
$OJXQDV HQWLGDGHV KDQ JHQHUDGR YLVRUHV JHRJUiFRV86
que permiten realizar consultas generales a travs de las
pginas web. A continuacin se describen los principales
encontrados y que tienen relacin con minera. ANEXO 4

86. Con los visores se puede tener acceso a todas las funcionalidades de visualizacin
GH LQIRUPDFLyQ JHRJUiFD FRPR DFHUFDU DOHMDU SDQHR DFWLYDU \ GHVDFWLYDU FDSDV
FRQVXOWDU PHGLDQWH FOLF HQ HO YLVRU UHDOL]DU LPSUHVLRQHV GH OD LQIRUPDFLyQ JHRJUiFD
Adicionalmente en algunos casos se pueden agregar ms capas WMS para aumentar el
nivel de anlisis e informacin desplegada y construir mapas mediante fuentes remotas
GH LQIRUPDFLyQ JHRJUiFD ,*$& KWWSZZZLFGHRUJFRZHEJXHVWYLVRUBJHRJUDFR
consultado 06/12/2015.

136

UNODC - MINJUSTICIA

ANEXO 2: EVOA CON USO DE


MAQUINARIA EN TIERRA EN
RESGUARDOS INDGENAS, 2014
Departamento

Antioquia

Cauca

Resguardo

ha

RO CHAJERAD

70

YABERARAD

22

TAGUAL-LA PO

15

JENGADO APARTAD

13

RO MURIND

12

RO JARAPET

MURRI-PANTANOS

MAJOR-AMBUR

PABLO MUERA

JAI-DUKAMA

ANDAB

AMPARRADO ALTO Y MEDIO Y QUEBRADA CHONTADURO

CAAVERALES-ANTADO

HUELLAS

11

LA IGUANA

85

PLAYA BENDITA

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

137

Departamento

Resguardo

'h>Zz>>>h>Z1KDWKZ
Z1KE'h
Z1K/,Kz>YhZZdhK

'
E
s

62

E'h

38

Z1K^dZhh^zEK^K

36

Z1KZ

35

WhM>>ZDDdZzdZK

29

YhZYhZ

24

Z1KWhZZ/,

18

,hZdKzd'sZ

13

Z1K^dKZZ/Mz,/DE/

>s/EdW>z>dz>EKsEd
WhZdK>'Zz>/s/^

7
6

^Ed/>/>YhZKZK,KM

Z1K^hszWK'hYhZdWZ>

>>s/^dhE/MEW/d>/dK

h,MDWZZM

Z/</Zh

WhZdK>//dZ/W/z

>s/Ed/hEK

,/'KZKKDD

>>KD/d

WhZdK>/Z>Z1KWW

>dKZ1KK:z
^E:K^D/WdK

2
1

dhZKdzhZK>hz

Z1K^h/Z//^E

25

dKE/E^:>^E:K^zKdZ^
dKZdh'H d>D/ WhE W/dZK ZsK dZKEYhZ/ z
>d

12

,KEZ,hE

14

Tabla 26. Resguardos Indgenas con EVOA (ha).

UNODC - MINJUSTICIA

5
109
75

hZ:/'hD/EM

TOTAL

138

ha

803

ANEXO 3: SELECCIN DE
NDICES ESPECTRALES PARA LA
DETECCIN DE ALTERACIN DE
SEDIMENTOS SUSPENDIDOS.
Para la seleccin de los ndices espectrales que
evidencien la alteracin de sedimentos suspendidos
se tomaron nueve ndices basados en los alcances de
discriminacin de coberturas que los mismos poseen. Los
cinco primeros ndices (ver tabla) fueron descartados por
SIGLA

no presentar sensibilidad en la alteracin de sedimentos


en ros blancos y negros87. El ro Inrida pertenece a la
categora de ros de aguas negras. Los cuatro restantes
se aplicaron sobre las imgenes de satlite en los cuatro
periodos de tiempo seleccionados.

Nombre

Frmula

SAVI

Soil-Adjusted Vegetation Index

SAVI = [(1,5 UHG  1,5red+/ @ /

BR

Band Ratio

BR = (JUHHQEOXH

LSWI

Land Surface Water Index

LSWI = ((1,5  6:,5  1,5  6:,5 

TCBI*

Tasseled Cap Brightness Index

T.C. = A1*(L7_1) + A2*(L7_2) + A3*(L7_3) + A4*(L7_4) + A5*(L7_5)


+ A7*(L7_7)

TCWI**

Tasseled Cap Wetness Index

T.C. = A1*(L7_1) + A2*(L7_2) + A3*(L7_3) + A4*(L7_4) + A5*(L7_5)


+ A7*(L7_7)

NDWI

Normalized Difference Water Index

NDWI = (JUHHQ1,5  JUHHQ1,5

MNDWI

0RGLFDWLRQIRU1RUPDOL]HG'LIIHUHQFH:DWHU,QGH[

MNDWI = (JUHHQ0,5  JUHHQ0,5

NDSSI

Normalize Difference Suspended Sediment Index

NDSSI = (EOXH1,5  EOXH1,5)

NSMI

Normalized Suspended Material Index

NSMI = (UHGJUHHQEOXH  UHGJUHHQEOXH

*Brightness A1=0.3037 A2= 0.2793 A3=0.4743 A4= 0.5585 A5= 0.5082 A7=0.1863
**Wetness A1= 0.3191 A2=0.5061 A3=0.5534 A4=0.0301 A5=-0.5167 A6=-0.2604
Los datos de Brightness y Wetness hacen referencia a metadatos de captura en la imagen satelital
Tabla 27. ndices espectrales evaluados para la deteccin de alteracin de sedimentos en suspensin

Los ndices que presentaron sensibilidad a la deteccin


de alteracin de sedimentos en suspensin fueron:
NDWI, MNDWI, NDSSI y NSMI. A cada uno de estos
ndices se le cre curvas de comportamiento natural
de sedimentos en suspensin tal como se observa en el
VLJXLHQWHJUiFR

87. De acuerdo con las caractersticas de las aguas, se encuentran ros blancos cuyas
aguas son barrosas, amarillentas, ricas en nutrientes, arenas y limos y tienen un pH o
grado de acidez neutro. Ros negros pocos sedimentos y gran cantidad de materia
orgnica, lo que les genera una coloracin caf oscura; son pobres en nutrientes y sus
aguas tienden a ser cidas. [99]. Ros de aguas claras contienen muy pocos nutrientes y
son completamente claros y ntidos [100].

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

139

89

*UiFR&XUYDVGHFRPSRUWDPLHQWRQDWXUDOGHVHGLPHQWRVHQORVFXDWURtQGLFHVVHOHFFLRQDGRV

Como 88resultado de la evaluacin del ro Inrida en


temporada seca y sin antecedentes de actividad de
H[SORWDFLyQPLQHUDOVHLGHQWLFyXQDEDUUHUDGHDQiOLVLV
determinada por la lectura de los ndices que tanto
para NDWI, MNDWI y NDSSI se da a partir de valores
por debajo del comportamiento natural y en el caso del
NSMI valores por encima [46]. Esta lectura determina
la evidencia marcada en cambios en el comportamiento
natural del ro de estudio.
NDICE

VALOR

NDWI

< 0,17

MNDWI

< 0,48

NDSSI

< 0,19

NSMI

> 0,39

Tabla 28. Valores de ndices espectrales que determinan alteracin


de sedimentos suspendidos en el ro Inrida.

En el siguiente anlisis para cada ndice se utilizaron


los resultados de extraer los valores de los ros donde
la sedimentacin es evidente con la ayuda de los ndices

NDWI, NDSSI y NSMI; el ndice MNDWI se describi


previamente en los hallazgos.
NDICE NDWI: Para este ndice se evidencia que para los
aos 1996 y 2002 los valores calculados se encontraron
dentro del comportamiento natural del ro con excepcin en
el 2002 en puntos cercanos a las comunidades de Piedra
Alta y Paloma; para el 2007 se evidencia alteracin de los
sedimentos suspendidos a lo largo del ro mostrando un
comportamiento homogneo desde los puntos cercanos
a la comunidad de Bquiro hasta La Ceiba con puntos
destacados sobre la comunidad de Chorro Bocn y
Remanso; el 2011 se caracteriz por una acentuacin del
fenmeno en puntos cercanos a la comunidad de Cerro,
Remanso, Paloma, Cao Tnica y La Ceiba; en el 2014
se evidencia alteracin de los sedimentos suspendidos
cercanos a la poblacin de Bquiro hasta la poblacin de
La Ceiba, con puntos destacados sobre las poblaciones
de Morroco Viejo, Cerro, Remanso, Cao Tonina y La
Ceiba.

*UiFR&XUYDGHFRPSRUWDPLHQWRHVSHFWUDOGHVHGLPHQWRVHQVXVSHQVLyQPHGLDQWHDSOLFDFLyQGH1':,HQ]RQDSLORWR
88. La caja amarilla hace referencia al rango de comportamiento natural espectral
del ro, los valores por debajo de dicha caja representan alteracin en los sedimentos
VXVSHQGLGRV/RVSXQWRVGHWRPDGHYDORUHVSDUDHOJUiFRVHHQFXHQWUDQGLVWULEXLGRVHQ
la zona de estudio a 5 km entre s.

140

UNODC - MINJUSTICIA

WD

KDhE/

Et/
1996

2002

2007

2011

2014

10 

11

12

**

**

44

**

45 d

**

46

**

**

47

**

48 >

**

49

**

23
24
25
26
32
33
34
35
40
41

Ds

W

W

** Hace referencia a reas sin informacin por presencia de nubes en los perodos evaluados.

Tabla 29. Puntos rojos (hot spots) con evidencia de alteracin en sedimentos para el ndice NDWI.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

141

.
!

Per

Venezuela

.
!

Brasil

. !
!
.8

69W

.
.!
!

.
!

.
!

Puntos de muestra

Comunidades

6830'W

6830'W

68W

Cao

34

.
!

Almidn

.
!

50

49

! La
.

Caranacoa

.
!

.
!
36

. 35
!

.
!

. 39
!

36

Puerto
Colombia
Remanso

Venado
!
.

.
!

Ceiba

37

.
!

.
!

Cacahual

46

.
!

48 !
.
47

.
!

. Morroco
!
. !.
!

Santa
Rosa

.
!

.
!
Tonina 43
45
.
!
.
!
.
!
42 !
. 44
.
!
Huesito !
.
. 41
!
.
!
. Paloma
!
39
. 38
!
.
!
Remanso
.
!
. 35
. 34!
!
! 37
. .
!

Inrida

33

Cerro
!
.

.
!

.
33!.!
Punta de
.
!
Cerro
Yaca
.
!
Chorro 31
. Piedra Alta
!
Bocn !
.
.
!
. Sejalito
!
.
29 !
.!
30

32

.
!

68W

Lmites departamentales

NDWI:
Normalized Difference Water Index

Puerto
Colombia

Lmites internacionales

Ros
Unidad RAMSAR

25
.!.28
27!
.
!
24
! !
.
Zamuro
23 .
.
!
.
!
26 !. Sabanita
.
!

Morroco
Nuevo

19 20
!
. .
!
.
!

.
!

21

Morroco
22
Viejo .
.!
!

GUAINA

18
.
!

Danta

20
km
Coordenadas geogrficas WGS 84

Sabanita
.
!
Sabanita
Nuevo

17

Cao
Via
.
!

16

.
!

Punta
Pava
Cao
Minas

.
!

.
!
Matraca
.!.
13 !
14
! 15
. 12 .
!
! .

Barranco
Mina

10
.
!

9 !
. 11
.
!

Baquiro
.
!

69W

!
.

Mapa 18. Aplicacin del ndice NDWI para la determinacin de alteracin de sedimentos en el ro Inrida. 2014.

Mar Caribe

Ocano
Pacfico

Ecuador

.
!

3
4
. !. !
!
.
2 Zancudo

.
!

.
!

Arenales

NDWI*
2014

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC y SINCHI


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Sedimentacin
Baja
Media
Alta

330'N

3N

330'N
3N

NDICE NDSSI: Para este ndice se evidencia que


para los aos 1996 y 2002 los valores calculados se
encontraron dentro del comportamiento natural del ro,
con excepcin en el 2002, en puntos cercanos a las
comunidades de Chorro Bocn, Cerro y Paloma. Para
el 2007 se evidencia para el ndice valores en el umbral
de comportamiento normal natural del ro en cuanto

a alteracin de los sedimentos suspendidos; el 2011


se caracteriz por una acentuacin del fenmeno en
puntos cercanos a la comunidad de Baquiro, Matraca,
Sabanita, Choro Bocn, Cerro y Huesito; para el 2014
las comunidades de Bquiro, Sabanita Nuevo, Morroco
Nuevo y ms acentuado en las comunidades de Chorro
Bocn, Zamuro, Cerro, Paloma, Huesito y Cao Tonina.

*UiFR&XUYDGHFRPSRUWDPLHQWRHVSHFWUDOGHVHGLPHQWRVHQVXVSHQVLyQPHGLDQWHDSOLFDFLyQGH1'66,HQ]RQDSLORWR

Punto de Muestra

COMUNIDAD

NDSSI
1996

2002

2007

2011

2014

0,358

0,468

0,406

0,095

0,160

0,418

0,388

0,402

0,156

0,161

10 Baquiro

0,418

0,359

0,406

0,071

0,107

11

0,374

0,374

0,431

0,041

0,106

12

0,412

0,344

0,332

**

0,114

0,360

0,328

0,358

**

0,139

13
14

Matraca

0,399

0,399

0,460

**

0,160

17 Sabanita Nuevo

0,353

0,293

0,427

**

0,087

18

0,419

0,366

0,520

0,140

0,182

0,391

0,208

0,401

**

0,069

22 Morroco Nuevo

0,405

0,288

0,395

0,135

0,049

25

0,331

0,266

0,344

0,150

-0,021

0,331

0,163

0,317

0,170

0,002

0,323

0,310

0,378

**

0,002

0,356

0,288

0,406

**

0,018

0,356

0,216

0,465

**

-0,051

0,383

0,216

0,416

**

-0,032

0,348

0,137

0,357

-0,116

-0,128

0,332

0,189

0,395

-0,093

-0,140

0,359

0,254

0,428

0,007

-0,141

0,412

0,266

0,411

0,015

-0,130

0,340

0,078

0,427

-0,052

-0,176

0,340

0,216

0,427

-0,056

-0,114

44

0,375

0,288

0,401

0,015

-0,170

45 Cao Tonina

0,375

0,189

0,376

-0,105

-0,094

46

0,348

**

0,376

-0,062

-0,191

19

26
27
28
29
30
34
35
40
41
42
43

Sabanita

Chorro Bocn
Sabanita
Zamuro
Cerro
Paloma
Huesito

** Hace referencia a reas sin informacin por presencia de nubes en los perodos evaluados.

Tabla 30. Puntos rojos (hot spots) con evidencia de alteracin en sedimentos para el ndice NDSSI.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

143

.
!

Venezuela

.
!

Brasil

. !
!
.8

Barranco
Mina

69W

Matraca

69W

.
!

.
.!
!

17

Cao
Via

.
!

16
.
!

Sabanita
.
!
Sabanita
Nuevo
Punta
Pava
Cao
Minas
.
!

!!.
.
14
10 13
! 15
. 12 .
!
! .
.
!

9 !
. 11

Baquiro

.
!
.
!

20
Coordenadas geogrficas WGS 84

.
!

Puntos de muestra

Comunidades

Danta

6830'W

Lmites internacionales

Ros
Unidad RAMSAR

6830'W

Inrida

Rosa

34

.
!
36

68W

50

. 35
!

49

. La
!

Ceiba

. 39
!

36

Venado
!
.

.
!

Remanso
!
.
37

.
!

.
!

Cacahual

46

.
!

48 !
.
47

.
!

. Morroco
!
. !.
!

68W

Cao

.
!

.
!
Tonina 43
45
.
!
.
!
.
!
42 !
. 44
.
!
Huesito !
.
. 41
!
. Paloma
!
.
!
39
. 38
!
.
!
Remanso
.
!
. 35
! 34!
.
! 37
. .
!

.
33!.!
Punta de
.
!
Cerro
Yaca
.
!
Chorro 31
. Piedra Alta
!
Bocn !
.
.
!
. Sejalito
!
.
29 !
.!
30

33

.
!

Cerro
!
.

NDSSI: Normalize Difference Suspended


Sediment Index

Lmites departamentales

Puerto
Colombia

.
!

32

25
.!.28
27!
.
!
24
! !
.
Zamuro
23 .
.
!
.
!
26 !. Sabanita
.
!

Morroco
.
!
Nuevo

.
!

21

Morroco
22
Viejo .
.!
!

GUAINA

18
.
!

.
!

19 !
. . 20
!

!
.

Mapa 19. Aplicacin del ndice NDSSI para la determinacin de alteracin de sedimentos en el ro Inrida.

Mar Caribe

Ocano
Pacfico

Ecuador

.
!

Per

.
!
2 Zancudo
.
!
!
.

.
!
.
!

Arenales
Guacamaya

.
!

Morichal

NDSSI*
2014

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC y SINCHI


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Sedimentacin
Baja
Media
Alta

330'N

3N

330'N
3N

Mapa 20. Aplicacin del ndice NSMI para la determinacin de alteracin de sedimentos en el ro Inrida 2014.

. !
!
.8

.
!

Brasil

Venezuela

.
!

.
!

Baquiro

.
!

9 !
. 11

.
!

69W

.
!

.
.!
!

17
Sabanita
.
!
Sabanita
Nuevo

Punta
Pava
Cao
Minas

.
!

.
!

Cao
Via

16

.
!
14
10 13
. 15
. 12 .
!
! !
.
!

Matraca

Barranco
Mina

VICHADA
69W

.
!

18
.
!

Danta

.
!

Alta

Media

Sedimentacin
Baja

NSMI*
2014

Comunidades
Puntos de muestra

.
!

!
.

6830'W

.
29 !
.!
30

Lmites internacionales

Ros
Unidad RAMSAR

6830'W

32

.
!

Cerro
.
!

33

NSMI:
Normalized Suspended Material Index

Lmites departamentales

Puerto
Colombia

.
!

68W

50

38

. Paloma
!

.
!

.
!

68W

. 35
!

Venado
!
.

.
!

36

Puerto
Colombia
Remanso

36

! 39
.

.
!
Remanso

.
!

.
!
39

.
!
. 35
. 34!
!
! 37
. .
!
.
!

34

.
!

Ceiba

37

.
!

.
!

Cacahual

46
.
!
43
45
.
!
.
!
.
!
42 !
. 44
.
!
.
Huesito !
. 41
!

Cao
Tonina

. La
!

48 !
.
47

49

.
!

Caranacoa

.
!

Sabanita

.
!

Almidn

.
!

. Morroco
!
. !.
!

Santa
Rosa

Inrida

.
33!.!
Punta de
.
!
Cerro
Yaca
.
!
Chorro 31
. Piedra Alta
!
Bocn !
.
.
!
Sejalito
.
!

25
.!.28
27!
.
!
24
. .
!
Zamuro
23 .
.
!
!
!
.
!
26 !. Sabanita

Morroco
Nuevo

19 !
. 20

.
!

.
!

21

Morroco
22
Viejo .
.!
!

GUAINA

Fuente: Gobierno de Colombia - Sistema de monitoreo Apoyado por UNODC y SINCHI


Los lmites, nombres y ttulos usados en este mapa no constituyen reconocimiento o aceptacin por parte de las Naciones Unidas

Arenales

Per

. !. !
!
2 Zancudo
.
.
!
.
!

Ecuador

Ocano
Pacfico

Mar Caribe

330'N
3N

330'N

3N

NDICE NSMI: Este ndice no evidenci cambios en


el 2007 y 2011 en cambio para el 2002 y 2014 marc
alteraciones pero con una distribucin atpica a como
se evidenci en los otros ndices, por este motivo no
se recomienda realizar un anlisis de este ndice su
FRQDELOLGDG HV GLVWLQWD D ORV DQWHULRUHV (Q HO PDSD
se puede observar que la representacin en rojo
marca valores de sedimentacin, pero en esta ocasin
relacionados con los meandros.

ANEXO 4: VISORES GEOGRFICOS


Visor 1: Mapa de regalas
Descripcin:
Es una herramienta para la gestin transparente de la actividad Minero Energtica, desde la explotacin de los recursos
QDWXUDOHVKDVWDODQDQFLDFLyQ\HMHFXFLyQGHORVSUR\HFWRVGHLQYHUVLyQTXHEHQHFLDQDWRGRVORVFRORPELDQRV
&RQVWDGHPyGXORVSUR\HFWRVUHFXUVRVSURGXFFLyQVFDOL]DFLyQ89. Los relacionados con minera de oro son:
x Produccin: permite conocer la produccin de oro (gramos) por departamento y municipio.
x )LVFDOL]DFLyQSHUPLWHFRQRFHUODVDFWLYLGDGHVVHKDQUHDOL]DGRSDUDYHULFDUODVH[SORWDFLRQHVSRUGHSDUWDPHQWR\PXQLFLSLRSHUPLWHOWUDUSRURURRURGHDOXYLyQOyQ\YHWD
Fuente: DNP SGR, Produccin Minera, Fuente: ANM-Produccin, ltima actualizacin: 21/05/2015, Corte de los datos: 31/12/2014

Enlace: http://maparegalias.sgr.gov.co/#/produccion/
VFalizacion/

http://maparegalias.sgr.gov.co/#/

Vista: de los datos de produccin asociados a oro


89.
Consulta
web
http://maparegalias.sgr.gov.co/#/?zoom=6&center=4.3344012216447965,-77.76142578125&topLeft=12.907166580077373,-98.668408203125&bottomRig
ht=-4.33651170402878,-56.854443359375, realizada 06/12/2015.

146

UNODC - MINJUSTICIA

$OKDFHUFOLFNVREUHHOERWRQYHUPDVVHDFWLYDXQDQXHYDSDJLQDHQODFXDOVHSXHGHOWUDUODLQIURPDFLRQGHVFDOL]DFLRQGHWLWXORV

9LVWDGHORVGDWRVGHVFDOL]DFLyQ

9LVRU0LQDV\WtWXORVPLQHURV
Descripcin:
Permite la visualizacin del censo minero (minas por tipo de mineral) vs ttulos mineros.
El Sistema de informacin minero energtico de Colombia -SIMEC est compuesto por 9 mdulos: 1) Sistema De
Informacin Elctrico Colombiano, 2) Sistema De Informacin Ambiental Minero Energtico, 3) Balances, 4) Sistema
'H,QIRUPDFLyQ0LQHUR&RORPELDQR 6LVWHPD'H,QIRUPDFLyQ'H(FLHQFLD(QHUJpWLFD<(QHUJtDV$OWHUQDWLYDV 
Mdulo De Documentos, 7) Sistema De Informacin De Petrleos, 8) Catalogo De Mapas Y 9) Boletines. Informacin
de minera se encuentra en los mdulos 2 y 4.
Fuente : Sistema de Informacin Minero Energtico de Colombia -SIMEC

Enlace: http://sig.simec.gov.co/UPME_MI_minas/

9LVWDGHOYLVRUJHRJUiFRGHO6LVWHPDGH,QIRUPacin Minero.

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

147

Vista del sistema de informacin ambiental minero energtico

9LVRU,QIRUPDFLyQ&DWDVWUR0LQHUR&RORPELDQR
Descripcin:
Permite la visualizacin de solicitudes, ttulos, ttulos preliminares, zonas de minera especial.
Fuente Ministerio de Minas y Energa - SIMCO

Enlace: http://www.simco.gov.co/Inicio/CatastroMineroColombiano/MapaIngeominas/tabid/376/Default.aspx

9LVWDGHOYLVRUJHRJUiFR

Al hacer clic en el botn de informacin se pueden consultar los datos de las capas disponibles en el visor.

148

UNODC - MINJUSTICIA

9LVRU,QIRUPDFLyQJHRJUiFDPLQHUtD
Descripcin:
Presenta informacin de produccin, exportacin y regalas de minerales.
Fuente Ministerio de Minas y Energa

Enlace: http://geoportalsme.minminas.gov.co/geoportalsme/34

9LVWDGHOYLVRUJHRJUiFR3URGXFFLyQGHRURSRUDxR

2009

2010

2011

2012

9LVRUHVJHRJUiFRVUHODFLRQDGRVFRQPLQHUtD

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

149

GLOSARIO
Anlisis multitemporal. Es una evaluacin de tipo espacial
TXH FRQVLVWH HQ LGHQWLFDU QR VROR ORV FDPELRV  TXH
presenta en s un fenmeno en particular, sino tambin
en relacin con las coberturas terrestres, a travs de
observaciones o lecturas que se hacen en diferentes
periodos de tiempo. [58]

GH HQHUJtD \ OD UHHMDQ R HPLWHQ GH DFXHUGR D VXV


caractersticas fsicas y qumicas. [60]
Color. Elemento bsico de la interpretacin visual de
imgenes, se origina de las diferentes longitudes de onda
TXHFDSWDQORVRMRVFRPRFDUDFWHUtVWLFDGHODUHHFWLYLGDG
VHOHFWLYDGHODVFRVDV3RUHMHPSORVLXQREMHWRUHHMDHQ
longitudes de onda 0.5 a 0.6 mm, entonces lo que se vea
ser de color verde. [60]

rbol de decisin. Conjunto de condiciones organizadas


en una estructura de gua jerrquica multiva, de tal
PDQHUDTXHODGHFLVLyQQDODWRPDUVHSXHGHGHWHUPLQDU
siguiendo las condiciones que se cumplen desde la raz Composicin a color. Proceso de formacin de una
del rbol hasta alguna de sus hojas. [51].
imagen en color mediante la composicin de tres
bandas, en donde a cada una de las cuales se les hace
Amalgamacin. Proceso de aleacin del mercurio corresponder uno de los caones primarios (rojo, verde y
con otros metales. En el caso de la explotacin de azul, RGB). [61]
oro, se realiza por adicin de mercurio a los minerales
SUHYLDPHQWH FODVLFDGRV SXHGH VHU DO LQWHULRU GH Corema. 5HSUHVHQWDFLRQHV JUiFDV PX\ HVTXHPiWLFDV
estanques de agua o en canalones), proceso en el que de los elementos que conforman un espacio y de las
se obtiene una pasta combinada (mercurio y oro) que es relaciones que se establecen entre ellos, basadas en
expuesta al fuego para liberar el mercurio en forma de VHQFLOODVJXUDVJHRPpWULFDV\UHDOL]DGDVFRQODQDOLGDG
GHFUHDUXQPRGHORHVSDFLDOSDUDHODQiOLVLVJHRJUiFR
vapor. [4]
Esta tcnica es muy empleada en varias ramas de la
Banda. Intervalo de longitud de onda dentro del espectro geografa humana. [62]
electromagntico. Por extensin, se denomina banda a
cada uno de los canales de adquisicin de datos de un Erial. Zonas secas sujetas a erosin elica con vegetacin
incipiente de bajo desarrollo, sin uso. [63]
sistema sensor. [46]

150

Clave de interpretacin. 6H UHHUH D OD FDUDFWHUtVWLFD


o combinacin de caractersticas, que posibilitan la
LGHQWLFDFLyQ GH XQ REMHWR SDUWtFXODU SRU HMHPSOR HO
tamao, la forma, el tono, o el color. [59]

Filtro. Operador local mediante el cual se resalta o


suprime, de forma selectiva, la informacin contenida en
una imagen para destacar algunos de sus elementos, o
tambin para ocultar valores anmalos [43]

Cobertura terrestre. Formada por diferentes tipos de


REMHWRVRFXHUSRVTXHVHHQFXHQWUDQVREUHODVXSHUFLH
terrestre (vegetacin, suelos, agua, entre otros) que
reciben la seal energtica procedente de la fuente

Forma: 6HGHQHFRPRFRQJXUDFLyQH[WHUQDGHDOJR
[64]. La forma de un determinado objeto es una clave
GHWHUPLQDQWH SDUD LGHQWLFDUOR \D TXH VX FRQWRUQR
permite asimilarlo a alguno de los patrones que resultan
familiares. [46]

UNODC - MINJUSTICIA

Georreferenciacin. Es el procedimiento mediante el


FXDOVHGRWDGHYDOLGH]FDUWRJUiFDDXQDLPDJHQGLJLWDO
corrigiendo geomtricamente la posicin de las celdas
y atribuyndoles coordenadas en algn sistema de
referencia [65].
Hot spot. Anglicismo utilizado con frecuencia en idioma
espaol, es un punto o zona de alta actividad dentro de
un rea mayor de baja actividad. El trmino se aplica a
diferentes cosas en diferentes contextos.
Imgenes de Satlite. Son productos de sensores pasivos
y trabajan en el rango ptico del espectro electromagntico
de 0.4 m a 15 m. El sistema de captura de informacin
se combina con una ptica similar a la de la fotografa y
un sistema de deteccin electrnica. [43]
ndice espectral. Combinaciones algebraicas de dos
o ms bandas que sirven para realzar espectralmente
determinada cobertura. El resultado de estas operaciones
permite obtener una nueva imagen donde se destacan
determinados pxeles relacionados con parmetros de la
cobertura analizada. [66]
Interpretacin. )RUPDOPHQWH LQWHUSUHWDFLyQ VH GHQH
como explicar o declarar el sentido de algo. [64]. En el
contexto de la teledeteccin, la interpretacin consiste
en la utilizacin de tcnicas, sistemas y procesos de
anlisis de imgenes por personal capacitado, para dar
informacin segura y detallada acerca de los objetos
QDWXUDOHV R DUWLFLDOHV FRQWHQLGRV HQ OD VXSHUFLH FX\D
imagen se analiza, y determinar los factores que implican
la presencia, condicin y uso de ellos. [67]
Jagey. Depresin sobre el terreno que permite almacenar
DJXDSURYHQLHQWHGHHVFXUULPLHQWRVVXSHUFLDOHV>@
LandSat. Programa civil de informacin satelital. La
constelacin de satlites LANDSAT (LAND=tierra y
SAT=satlite), que inicialmente se llamaron ERTS (Earth
Resources Technology Satellites), fue la primera misin
de los Estados Unidos para el monitoreo de los recursos
terrestres. Su mantenimiento y operacin est a cargo de
la Administracin Nacional de la Aeronutica y del Espacio
(NASA) en tanto que la produccin y comercializacin
de las imgenes depende del Servicio Geolgico de los
Estados Unidos (USGS). [43].

gravedad se generen precipitados de cianuracin que


posteriormente deben ser fundidos a fuego lento para
QDOPHQWHVHSDUDUHORUR>@
Llanura aluvial. Zonas planas o ligeramente planas
que bordean un ro, que se han formado debido a la
acumulacin de materiales sedimentarios derivados de
ORV SURFHVRV XYLDOHV GRQGH KD\ XMRV HQ PRYLPLHQWR
[70]
Modelo Digital de Elevacin - DEM. Estructura numrica
de datos que representa la distribucin espacial de la
DOWLWXGGHODVXSHUFLHGHOWHUUHQR>@
Multiespectral. Imagen registrada pticamente en ms de
un espectro o intervalo de longitud de onda. Cada imagen
individual es usualmente de la misma rea fsica y escala
pero de una diferente banda espectral. [72]
Nivel digital. Valor numrico discreto que traduce la
intensidad radiomtrica recibida por un sensor electroptico. Se le conoce tambien como nivel de gris,
luminancia, nmero digital, valor de pixel, etc. [73]
Pancromtica. Imagen colectada dentro del amplio rango
de longitudes de onda visibles pero producida en blanco
y negro. El trmino ha sido histricamente referido a la
HPXOVLyQIRWRJUiFDHQEODQFR\QHJURVHQVLEOHDWRGRV
los colores visibles, aunque no necesariamente de forma
uniforme. [72]
Pan-Sharpening: Es el acrnimo para Panchromatic
sharpening, proceso en el cual se emplea una imagen
pancromatica de alta resolucion para ajustar una imagen
multiespectral incrementando su resolucin espacial.
Patrn. Arreglo espacial de un conjunto o asociacin
de objetos similares, as como la repeticin sistemtica
de formas. Tiene en cuenta la organizacin espacial
particular de los objetos de una cobertura. [65]
Percepcin remota (teledeteccin). Consiste en el
proceso de adquisicin de informacin a distancia, sin
que exista contacto fsico entre la fuente de informacin
(objeto) y el receptor de la misma (sensor). [42]

Procesamiento Digital de Imgenes de Satlite. Disciplina


que desarrolla las bases tericas y algortmicas mediante
Lixiviacin. La lixiviacin es una tcnica ampliamente las cuales puede extraerse informacin del mundo real,
utilizada en metalurgia extractiva que convierte los de manera automtica, a partir de una imagen observada.
metales en sales solubles en medios acuosos. Proceso Tal informacin puede relacionarse con el reconocimiento
basado en la utilizacin de estanques con soluciones de objetos, descripciones tridimensionales, posicin y
GH FLDQXUR \ PHGLRV OWUDQWHV GRQGH VH DJUHJDQ ODV orientacin de los mismos, o con la medicin de cualquier
colas de amalgamacin mezcladas para facilitar que por

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

151

propiedad espacial tal como la distancia entre dos puntos


o la seccin transversal del objeto. [67]

en las imgenes, haciendo ms fcil la discriminacin de


patrones. [43]

3UR\HFFLyQ FDUWRJUiFD Sistema de representacin


JUiFD TXH HVWDEOHFH XQD UHODFLyQ RUGHQDGD HQWUH
ORV SXQWRV GH OD VXSHUFLH FXUYD GH OD 7LHUUD \ ORV
GH XQD VXSHUFLH SODQD PDSD  SDUD OR FXDO XWLOL]D
transformaciones matemticas [46]

Resolucin temporal. 6HUHHUHDODSHULRGLFLGDGFRQOD


que el sensor adquiere imgenes de la misma porcin
GH OD VXSHUFLH WHUUHVWUH (VWH FLFOR HVWi HQ IXQFLyQ GH
las caractersticas orbitales de la plataforma (la altura, la
velocidad, el ngulo, la hora de captura, la inclinacin),
as como el diseo del sensor. [43]

Puntos de control: (OHPHQWRV JHRJUiFRV MRV \


localizables con precisin en imagen y documento de Respuesta espectral. 7DPELpQ GHQLGD FRPR UPD
referencia para ser empleados durante la etapa de la espectral o signatura espectral, es la expresin de un
REMHWRGHODVXSHUFLHWHUUHVWUHTXHSHUPLWHUHFRQRFHUOR
georreferenciacin. [46]
en una imagen satelital de acuerdo con las caractersticas
Radiancia. Es la cantidad de energa radiada desde un SURSLDV TXH FRQJXUDQ VX LQWHUDFFLyQ FRQ OD HQHUJtD
objeto en la unidad de tiempo por cada unidad de ngulo electromagntica y con sus longitudes de onda. [46]
VyOLGR\GHXQLGDGGHVXSHUFLHGHOREMHWRSHUSHQGLFXODU
a la direccin de propagacin. [46]
6KDSHOH Formato de representacin vectorial
Raster. Forma de tratamiento y representacin espacial desarrollado por ESRI (Enviromental Systems Research
de las entidades mediante la disposicin de celdas o Institute). Consta de un nmero variable de archivos, en
pixeles en forma de matriz numrica de Niveles Digitales los que se almacena digitalmente la localizacin de los
[46]
HOHPHQWRV JHRJUiFRV DUFKLYR VKDSH VKS  MXQWR FRQ
sus atributos o caractersticas (tabla dBase *.dbf).
5HHFWDQFLD0HGLGDGHODFDSDFLGDGGHXQDVXSHUFLH
SDUDUHHMDUHQHUJtDHOHFWURPDJQpWLFDHQXQDGHWHUPLQDGD Sistema de referencia: conjunto de convenciones y
ORQJLWXG GH RQGD (V OD UD]yQ H[LVWHQWH HQWUH HO XMR conceptos adecuadamente modelados que permiten
UHHMDGR\HOLQFLGHQWHVREUHGLFKDVXSHUFLH$SOLFDGRDO GHQLU OD RULHQWDFLyQ XELFDFLyQ \ HVFDOD GH WUHV HMHV
coordenados (x,y,z). [65]
espectro visible, suele hablarse de albedo. [46]
Resolucin espacial. Este trmino designa al objeto ms
pequeo que puede ser distinguido sobre una imagen
[43]. En otras palabras, es la distancia que corresponde
a la unidad mnima de informacin incluida en la imagen
(pxel). As, a menor tamao del pxel mayor ser la
resolucin espacial, lo que implica que el sensor obtendr
ms detalle de los objetos.

6LVWHPDVGH,QIRUPDFLyQ*HRJUiFD 6,*  En su sentido


ms amplio, un SIG es un grupo de procedimientos
utilizados para almacenar y manipular datos referenciados
JHRJUiFDPHQWH\DVHDHQIRUPDPDQXDOREDVDGDHQ
computador. [75]

Sistema de Referencia Mundial (Worldwide Reference


System - WRS). Es un sistema global de numeracin que
Resolucin espectral. Indica el nmero y ancho de las permite al usuario obtener la ubicacin de una imagen
bandas espectrales que puede discriminar el sensor satelital obtenida por los satlites Landsat de cualquier
[74]. Entre ms bandas del espectro discrimine un SDUWH GHO SODQHWD HVSHFLFDQGR HO SDU RUGHQDGR GH OD
sistema sensor, mayor ser su resolucin espectral. HVFHQD LPDJHQ  TXH HVWi GHQLGR SRU HO 3$7+ yUELWD
(VWD SDUWLFXODULGDG IDFLOLWD OD LGHQWLFDFLyQ GH FLHUWDV aproximada del satlite) y ROW (centro nominal de la
caractersticas en una imagen, ya que discrimina escena o imagen). [46]
informacin dependiendo de la longitud de onda entre
HOYLVLEOH\HOLQIUDUURMRORTXHSHUPLWHGHWHUPLQDUUPDV Tamao. El tamao de un objeto es uno de los ms tiles
LQGLFLRVTXHOOHYDQDVXLGHQWLFDFLyQ3RUODPHGLGDGHXQ
espectrales de las coberturas terrestres. [46]
objeto, el intrprete puede eliminar de su consideracin
Resolucin radiomtrica. 6H UHHUH D OD FDSDFLGDG gran parte de las posibilidades de confusin. [67]
del sensor para detectar las variaciones de luz o de
radiacin traducidas en niveles de gris. De esta manera, Territorio afectado. Grillas del marco de reas de 1km*
se puede concluir que entre ms bits, ms tonos de gris 1 km que presentan EVOA de acuerdo a la metodologa
equivalentes a una mayor resolucin radiomtrica. Esta establecida basada en percepcin remota.
FDUDFWHUtVWLFD SHUPLWH TXH KD\D HO VXFLHQWH FRQWUDVWH

152

UNODC - MINJUSTICIA

Textura. La textura de una imagen est referida al


contraste espacial entre los distintos elementos presentes
en la imagen, y procede de la relacin entre el tamao
de los objetos y la resolucin del sensor. Se relaciona
con la aparente rugosidad o suavidad de una regin de
la imagen. [67]
Tono.  6H GHQH FRPR ORV JUDGRV GH YDULDFLyQ GH
gris que existe entre el negro y el blanco [67]. Esta
caracterstica hace referencia a la intensidad de energa
recibida por el sensor para una determinada banda del
espectro, es decir, se relaciona con el comportamiento
espectral de las distintas coberturas, para la banda
particular del espectro sobre la que se est trabajando.
[65]
Valle aluvial. Llanuras o depresiones alargadas e
inclinadas por las cuales generalmente se da el curso de
un ro, bien sea hacia el ocano o hacia otros ros de
mayor jerarqua, y se caracterizan por situarse en medio
de montaas u otras formaciones de mayor altura. [70]

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

153

BIBLIOGRAFA
[1]
[2]
[3]
[4]
[5]
[6]
[7]
[8]
[9]
[10]
[11]
[12]
[13]
[14]
[15]
[16]
[17]
[18]
[19]
[20]
[21]
[22]

[23]
[24]

154


DDDs
/WZKZ

WEhDD^^

DD'
>W/
hWDW
>
Mining Technology, 
''WD
'/
    WKDWdE/
>>^
hEK^/D/DhEK
W'ED//W

'D

DhEK

^W>
hEW/
/DD^^D
'
/DE
ZYEl Espectador, 
D  D    ^ W  D
D
KdDE
DW&

ED     

E>

UNODC - MINJUSTICIA

[25]
[26]
[27]
[28]
[29]
[30]
[31]
[32]

[33]

[34]

[35]
[36]
[37]
[38]
[39]
[40]
[41]
[42]
[43]
[44]
[45]
[46]
[47]
[48]

[49]
[50]

DDW
Dj
/  /    W D   D   
>EW
,D,DZ&^
W
WDdE^h
^
,yz:<DZ^/D
^^Z>
EZ<ZDK/^
/:Z^
>D^

^ D& h      Et/   

Z^:
 , z :  y    Z ^  /  
D^^Z>/
^^<dhD
' s < ' W < D W   D   ^ t 
 h tZ/ Et/ DEt/ ^   <d d
Ws
D:hEK

 D  ' Z Y           

:^,Wd
&K>Z,
D'
d
d/d
DD<tDWZ
Zh^
DW/&
^d>Kd
D
/'/'/'
D  D  s E     ^ Z   Z E >
&&hE^
&dDZ^
hEK^/D/W/'
  ^    Z h       
&h
E
K'DD
ED:
/d
WsK>///K
Explotacin de oro de aluvin Evidencias a partir de percepcin remota

155

[51]
[52]
[53]

[54]
[55]
[56]
[57]
[58]
[59]
[60]
[61]
[62]
[63]
[64]
[65]
[66]
[67]

[68]
[69]
[70]
[71]
[72]
[73]
[74]

[75]
[76]
[77]

156

:,K/W
hEK^/D/D
Z  & ,  D >       

'
  hD    

EEE
DDD
ED     

^     

&^ZEz
/'    

^Z'/^EzWEz
>D
j
KW/Z,W>
Z
/' / '      

/'WD1
DK/^'
D,D/
/'

^'ZWKD
D^

EE'

 &         
Dddj
D/ '    '    
'W'
:Z:ZZWh^
ZE:W,
t ,  : >>& t D ' , W  t d , :  Z s
Wd/d
d^
^^WEW
Dd
WEhD D^ ^          

'DW

UNODC - MINJUSTICIA

[78]
[79]
[80]
[81]

[82]
[83]
[84]
[85]
[86]
[87]

[88]
[89]
[90]
[91]
[92]
[93]
[94]
[95]
[96]
[97]
[98]
[99]
[100]
[101]

[102]
[103]

   

Z
&^ZEz
:
^dd
'/
//WDDDh

>Kd
^'ZWKD
KW/Z,W>
hWD     
Yh
/D>EdDKZ/E>
     /  , D  

d
hWDWED
hWD
WD
DD
       
d
E K>KD/    E     E

/'/& D         Z^ /D'/E

DD

tt&
Z
^'K
> / >         

K
j
,d
''K:Z:W&sZ:>Z,s
<DWW^&'/s><D

W
ED'^ED

//WWD
WY

Explotacin de oro de aluvin Evidencias a partir de percepcin remota

157

[104]

&   ^     ^ ^ W    
'ZKZ&h
/^^

NDICE DE MAPAS
Mapa 1.
Mapa 2.
Mapa 3.
0DSD
0DSD
0DSD
0DSD
Mapa 8.
Mapa 9.
Mapa 10.
0DSD
Mapa 12.
0DSD
Mapa 14.

0DSD

0DSD

Mapa 17.
Mapa 18.
Mapa 19.
Mapa 20.

Densidad de EVOA en Colombia, 2014. ................................................................................... 33


Territorio afectado por EVOA y cultivos de coca, 2014. ............................................................ 36
Parques Nacionales Naturales y EVOA, 2014.......................................................................... 39
(92$GHWHFWDGDVHQUHODFLyQFRQEXIIHUVGHLQXHQFLDHQORV3DUTXHV)DUDOORQHVGH&DOL\
unchique. .................................................................................................................................. 41
(92$GHWHFWDGDVHQUHODFLyQFRQEXIIHUVGHLQXHQFLDHQHO3DUTXH1DFLRQDO1DWXUDO
Serrana de los Churumbelos. .................................................................................................. 42
6XEFXHQFDVKLGURJUiFDV\(92$ ................................................................................ 48
'LVWULEXFLyQGHSDUWDPHQWDOGH(92$ KD HQUHODFLyQFRQJXUDVDXWRUL]DGDVSRUODOH\SDUD
explotacin de oro..................................................................................................................... 56
Distribucin de puntos de muestra a lo largo del ro Inrida 1996............................................. 68
Deteccin de la alteracin de sedimentos suspendidos mediante ndices espectrales
(MNDWI 2014). ...................................................................................................................... 71
Deteccin de la alteracin de sedimentos suspendidos mediante ndices espectrales
(MNDWI 2014) con superposicin de cartografa social........................................................ 74
UHDDIHFWDGDDFXPXODGDSRUSHULRGR5HJLyQ3DFtFR .......................................................... 79
Densidad de EVOA en la regin de estudio.............................................................................. 82
7HUULWRULRDIHFWDGRSRU(92$\FXOWLYRVGHFRFD5HJLyQ3DFtFR .................................. 86
Consejos comunitarios de comunidades afrodescendientes, EVOA y subcuencas en el periodo
GHHVWXGLR3DFtFR.................................................................................................................. 89
5LHVJRGHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRVSRUDFWLYLGDGHVGHH[SORWDFLyQ
GHRURGHDOXYLyQ 3DFtFRQRUWH  ............................................................................................ 101
5LHVJRGHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRVSRUH[SORWDFLyQGHRURGH
DOXYLyQ 3DFtFRVXU  ............................................................................................................... 105
Densidad EVOA 2014 y sitios de encuesta censo minero 2011, modalidad explotacin con
maquinaria en tierra y con maquinaria en agua........................................................................ 124
Aplicacin del ndice NDWI para la determinacin de alteracin de sedimentos en el
ro Inrida. 2014. ........................................................................................................................ 142
Aplicacin del ndice NDSSI para la determinacin de alteracin de sedimentos en el
ro Inrida. .................................................................................................................................. 144
Aplicacin del ndice NSMI para la determinacin de alteracin de sedimentos en el
ro Inrida 2014. ......................................................................................................................... 145

NDICE DE TABLAS
Tabla 1.
Tabla 2.
7DEOD
Tabla 4.
7DEOD
7DEOD
7DEOD
7DEOD
Tabla 9.
Tabla 10.
Tabla 11.
Tabla 12.
7DEOD
Tabla 14.
7DEOD
7DEOD
7DEOD

7DEOD

7DEOD

7DEOD
7DEOD
Tabla 22.
Tabla 23.
Tabla 24.
Tabla 25.
Tabla 26.
Tabla 27.
Tabla 28.
Tabla 29.
Tabla 30.

EVOA con uso de maquinaria en tierra (hectreas) por departamento. ..................................


EVOA detectada en Parques Nacionales Naturales (ha). ........................................................
&RQHFWLYLGDGXYLDOHQWUH(92$GHWHFWDGDV\311 ................................................................
Los 10 Consejos comunitarios de comunidades afrodescendientes con mayor rea de EVOA
en el territorio nacional..............................................................................................................
=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO$PD]RQDV .....
=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO&DULEH ...........
=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO0DJGDOHQD
Cauca........................................................................................................................................
=RQDV\6XE]RQDV+LGURJUiFDVDIHFWDGDVFRQ(92$UHD+LGURJUiFDGHO3DFtFR .........
Produccin de oro, descarga potencial de mercurio y poblacin de subcuencas afectadas
por EVOA en Nech (Fuente: EOT Nech, Antioquia)................................................................
Principales caractersticas de los ndices espectrales empleados. ..........................................
Puntos rojos (hot spots) con evidencia de alteracin en sedimentos para el ndice MNDWI. .
Principales municipios con EVOA y su relacin con cultivos de coca en 2014. .......................
(YROXFLyQGH(92$HQODVSULQFLSDOHVVXEFXHQFDVDIHFWDGDV5HJLyQ3DFtFR ....................
Cambios en EVOA 2001, 2006, 2011 y 2014. ..........................................................................
&DWHJRUtDVGHULHVJRSRWHQFLDOGHDIHFWDFLyQSRUXMRV\DFXPXODFLyQGHVHGLPHQWRV ..........
3HVRVUHODWLYRV\FDWHJRUtDVGHULHVJRGHDIHFWDFLyQHQODVVXEFXHQFDVGHO3DFtFR ...........
'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQD+LGURJUiFD
$WUDWR'DULpQ\6XE]RQDV+LGURJUiFDVFRUUHVSRQGLHQWHV  .................................................
'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQD+LGURJUiFD
GHO6DQ-XDQ\6XE]RQDV+LGURJUiFDVFRUUHVSRQGLHQWHV  ....................................................
'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$ =RQD+LGURJUiFDGHO%DXGy
'LUHFWRV3DFtFR\6XE]RQDV+LGURJUiFDVFRUUHVSRQGLHQWHV  .............................................
'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQD+LGURJUiFD
del Pata y subcuencas correspondientes). .............................................................................
'LVWDQFLDSRUYtDXYLDOGHFDEHFHUDVPXQLFLSDOHVD(92$DJXDVDUULED =RQDKLGURJUiFD
Amarales Dagua y Subcuencas correspondientes). ..............................................................
Caractersticas pictorico - morfolgicas de los elementos para deteccin de EVOA. ..............
Distribucin de encuestas del CM relativas a explotaciones de oro (Fuente: MME, 2011). .....
Informacin espacial disponible ANM-ANLA. ...........................................................................
Informacin disponible DICAR (Fuente DICAR). ......................................................................
Resguardos Indgenas con EVOA (ha). ...................................................................................
ndices espectrales evaluados para la deteccin de alteracin de sedimentos en suspensin
Valores de ndices espectrales que determinan alteracin de sedimentos suspendidos en el
ro Inrida. ..................................................................................................................................
Puntos rojos (hot spots) con evidencia de alteracin en sedimentos para el ndice NDWI. .....
Puntos rojos (hot spots) con evidencia de alteracin en sedimentos para el ndice NDSSI. ...

31
38
40
44
49
49
50
51
52
64
70
87
90
92
99
100
102
103
103
104
106
117
129
132
133
138
139
140
141
143

NDICE DE ILUSTRACIONES
Ilustracin 1.
Ilustracin 2.
Ilustracin 3.
Ilustracin 4.

Distribucin de las explotaciones segn tipo de yacimiento (Fuente SIMCO). ........................ 20


Alcance del estudio. .................................................................................................................. 21
Maquinaria usada en la explotacin de oro de aluvin. ............................................................ 26
Deteccin de cambios con imgenes de satlite Landsat (visualizadas en falso color CC 543.
Evidencias fsicas visibles sobre el paisaje, generadas por el uso de maquinaria en tierra.

(92$HQWRQRD]XOFODURFRQODJXQDVGHEHQHFLR ................................................................. 27
Ilustracin 5. Evidencias fsicas detectadas mediante el uso de ndices espectrales generadas por el uso de
maquinaria en tierra. Izquierda imagen satelital en la cual no se observan perturbaciones en
el medio hdrico. Derecha, ndice espectral aplicado a la imagen. En la imagen de la derecha,
las zonas del ro en color naranja o rojo, indican alteraciones en los sedimentos. .................. 27
Ilustracin 6. Esquema modelo de deteccin basado en percepcin remota. ............................................... 28
Ilustracin 7. Etapas del proceso de explotacin de oro de aluvin con uso de maquinaria en agua. .......... 62
Ilustracin 8. Curvas esperadas de afectacin, valores cercanos a 1,0 indican menos sedimentos en
suspensin, basado en (Hossain, Jia & Chiao; 2016) .............................................................. 66
Ilustracin 9. Modelo para la evaluacin de ndices espectrales. .................................................................. 72
Ilustracin 10. Dinmica del fenmeno en tres momentos. ............................................................................. 76
Ilustracin 11. Categoras de las reas interpretadas. ..................................................................................... 76
Ilustracin 12. Esquema de procesos dinmica espacial de coberturas con nfasis en EVOA. ..................... 77
Ilustracin 14. Riesgo de afectacin en las poblaciones por acumulacin de slidos en suspensin por
presencia de EVOA en las fuentes hdricas50.......................................................................... 97
Ilustracin 15. Comparacin Imagen de satlite (Landsat 8, verdadero color RGB 432) (izquierda) y fotografa
tradicional (derecha) tomada en sobrevuelo. Puerto Claver (El Bagre, Antioquia). .................. 112
Ilustracin 16. Etapas del proceso de explotacin de oro de aluvin con uso de maquinaria pesada en tierra. 114
Ilustracin 17. Ejemplos de diferentes composiciones de color a partir de una imagen Landsat 8 ETM+, (a)
Color real, RGB(4,3,2), (b)Falso color, RGB(5,6,4), (c) Falso color, RGB(6,5,2)...................... 116
Ilustracin 18. Izquierda EVOA y bancos de arena, (Landsat 8, falso color RGB 652). Derecha Foto banco
de arena y EVOA, sobrevuelo SIMCI. ...................................................................................... 118
Ilustracin 19. Izquierda EVOA y centro poblado, (Landsat 8, falso color RGB 547). Derecha Foto centro
poblado y EVOA, sobrevuelo SIMCI. ........................................................................................ 119
Ilustracin 20. Izquierda EVOA y derrumbe,(Landsat 8 , falso color RGB 652) . Derecha Foto derrumbe y
EVOA, sobrevuelo SIMCI. ........................................................................................................ 119
Ilustracin 21. Izquierda EVOA y erial (Landsat 8 falso color RGB 547). Derecha Foto derrumbe
(Fuente Diario El TIEMPO) y EVOA, sobrevuelo SIMCI. ......................................................... 119
Ilustracin 22. Izquierda EVOA y estanques pisccolas (Landsat 8 falso color RGB 652). Derecha Foto
Estanques (fuente ICA) y EVOA, sobrevuelo SIMCI. .............................................................. 120
Ilustracin 24. Izquierda EVOA y suelo desnudo (Landsat 8, falso color RGB 564). Derecha Foto Suelo
desnudo y EVOA, sobrevuelo SIMCI. ....................................................................................... 121
Ilustracin 25. Izquierda EVOA y suelo desnudo (Landsat 8, falso color RGB 652). Derecha Foto
preparacin de terreno y EVOA, sobrevuelo SIMCI. ................................................................ 121
Ilustracin 26. rbol de decisin para deteccin de EVOA con uso de maquinaria en tierra........................... 122
Ilustracin 27. Distribucin porcentual de encuestas del Censo Minero relativas a oro segn modalidades
de explotacin, 2011. ................................................................................................................ 125
,OXVWUDFLyQ&RQDELOLGDGPHWRGROyJLFDDQiOLVLVGHFRUUHVSRQGHQFLDHQWUHHQFXHVWDVFHQVRPLQHUR
2011 y EVOA 2014. En amarillo, puntos de encuestas del censo minero; en negro, polgonos
de EVOA detectados................................................................................................................. 126
Ilustracin 29. Cobertura de las operaciones de interdiccin relacionadas a minera realizadas por la
DICAR en el pas (Fuente Armada Nacional). .......................................................................... 134
Ilustracin 30. Cobertura de las operaciones interdictivas de la Armada a minera (Fuente Armada Nacional). 135
Ilustracin 31. Marco de reas EVOA. ............................................................................................................. 135

NDICE DE GRFICOS
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR
*UiFR

*UiFR
*UiFR
*UiFR
*UiFR

'LVWULEXFLyQSRUFHQWXDOGHHQFXHVWDVUHDOL]DGDVHQHOPDUFRGHOFHQVRPLQHURGHDFXHUGR
a la titulacin (Fuente SIMCO).................................................................................................. 21
(92$\SURGXFFLyQGHRUR )XHQWH830(  ............................................................................ 31
/RVPXQLFLSLRVFRQPD\RUDIHFWDFLyQGH(92$FRQXVRGHPDTXLQDULDHQWLHUUD ..... 34
7HUULWRULRDIHFWDGRSRU(92$\UHODFLyQFRQFXOWLYRVGHFRFD ................................................. 35
/RV5HVJXDUGRVFRQPD\RUDIHFWDFLyQGH(92$FRQXVRGHPDTXLQDULDHQWLHUUD .. 43
3DUWLFLSDFLyQSRUFHQWXDOGH&RQVHMRVSRUGHSDUWDPHQWR ...................................................... 43
'LVWULEXFLyQSRUFHQWXDOGHSpUGLGDGHFREHUWXUDGHERVTXHQDWXUDOSRUDFWLYLGDGHVGH
explotacin de oro de aluvin con uso de maquinaria en tierra................................................ 45
3pUGLGDGHFREHUWXUDVYHJHWDOHVGHDOWRYDORUDPELHQWDODVRFLDGDD(92$ .......................... 46
'LVWULEXFLyQSRUFHQWXDOHQ6XEFXHQFDVFRQ(92$ ................................................................. 51
'LVWULEXFLyQSRUFHQWXDOGHODVJXUDVDXWRUL]DGDVSRUODOH\VHJ~Q(92$DQLYHOQDFLRQDO ... 55
3DUWLFLSDFLyQSRUFHQWXDOGHSDUWDPHQWDOGHODV(92$GHDFXHUGRFRQJXUDVDXWRUL]DGDVSRU
la ley. ......................................................................................................................................... 57
/tQHDEDVHHVSHFWUDOQDWXUDO01':, ................................................................................... 67
&XUYDGHFRPSRUWDPLHQWRHVSHFWUDOGHVHGLPHQWRVHQVXVSHQVLyQPHGLDQWHDSOLFDFLyQGH
MNDWI en zona piloto. Los segmentos de las curvas que se encuentran por fuera del
recuadro amarillo, corresponden a alteraciones en los sedimentos suspendidos. .................. 69
(92$DIHFWDFLyQSRUSHULRGR\DIHFWDFLyQDFXPXODGD3DFtFR .......................... 80
UHDGH(92$SRUDxR5HJLyQ3DFtFR ................................................................................ 80
5HODFLyQ(92$SUHFLRV\SURGXFFLyQGHORUR ......................................................................... 81
(92$SRUGHSDUWDPHQWR3DFtFR ........................................................................................... 83
'LQiPLFDGHOiUHDGH(92$SRUGHSDUWDPHQWR\SRUSHULRGR3DFtFR ................................. 84
&RPSRUWDPLHQWRKLVWyULFRGHOiUHDVHPEUDGDFRQFXOWLYRVGHFRFDIUHQWHD(92$3DFtFR . 85
3DUWLFLSDFLyQSRUFHQWXDOGH(92$HQ&RQVHMRV&RPXQLWDULRVFRQUHVSHFWRDOWRWDOGHODUHJLyQ
\Q~PHURGHFRQVHMRVFRPXQLWDULRVDIHFWDGRV3DFtFR ......................................................... 88
(YROXFLyQGHOSRUFHQWDMHGHVXEFXHQFDVDIHFWDGDVSRU(92$3DFtFR ................................ 90
&XUYDVGHFRPSRUWDPLHQWRQDWXUDOGHVHGLPHQWRVHQORVFXDWURtQGLFHVVHOHFFLRQDGRV ........ 140
&XUYDGHFRPSRUWDPLHQWRHVSHFWUDOGHVHGLPHQWRVHQVXVSHQVLyQPHGLDQWHDSOLFDFLyQGH
NDWI en zona piloto. .............................................................................................................. 140
&XUYDGHFRPSRUWDPLHQWRHVSHFWUDOGHVHGLPHQWRVHQVXVSHQVLyQPHGLDQWHDSOLFDFLyQGH
NDSSI en zona piloto............................................................................................................. 143