Sie sind auf Seite 1von 256

Morpheus

DIE REALITTENMACHER
Physik des Bewutseins

Vom Autor ist auerdem erschienen:

Matrix Code, 2003, Trinity-Verlag

Copyright 2005 by TRINITY-Verlag Postfach 8 A-1015 Wien trinity@matrix-code.com www.matrix-code.com

Druck: Ebner & Spiegel, Ulm Satz und Layout: Trinity-Verlag

ISBN 3-9501801-3-3
Scan & OCR von Shiva2012

DIE MATRIX DES BUCHES


Vorwort............................................................................................................................... Vorwort von Morpheus................................................................................................ Dank und Sinn................................................................................................................. Einleitung........................................................................................................................... S. 8 S. 9 S. 10 S. 11

ABSCHNITT 1
1 2 3 4 5 6 7 8 9 10 11 12 Die erdachte Welt........................................................................................... Gedanken steuern Materie.................................................................... ..... Entstehung unserer Realitt....................................................................... Molekle der Gefhle.................................................................................... Steuerung aus dem Hyperraum................................................................ Interaktion zwischen Geist und Materie................................................ Was ist Leben?.................................................................................................. Bewutsein und Realitt.............................................................................. Materie und Bewutsein.............................................................................. Gehirn und Hyperraum................................................................................ Ist unsere Realittsbhne ein Hologramm?......................................... Materie ist verfestigter Gedanke.............................................................. S. 16 S. 18 S. 28 S. 58 S. 75 S. 86 S. 93 S. 116 S. 138 S. 151 S. 157 S. 176

ABSCHNITT 2
13 14 15 16 17 18 19 20 21 Fundament des materiellen Seins............................................................ Virtuelle Photonen als Basis........................................................................ Was ist Zeit?....................................................................................................... Funktion eines Hologramms im Gehirn................................................. Supraleitfhigkeit der Mikrotubuli........................................................... Mikrotubuli als Hardware............................................................................. Verbindungen zur DNS durch Supraleitung?...................................... Wurmloch innerhalb Neuronen................................................................ Das Wunder ist beweisbar....................................................................... S. 180 S. 188 S. 193 S. 198 S. 199 S. 201 S. 201 S. 203 S. 204

Glossarium......................................................................................................................... S. 216 Literatur- und Quellenverzeichnis........................................................................... S. 236 Bildquellen........................................................................................................................ S. 253

VORWORT
Ich schtze mich glcklich, Ihnen ein Werk vorzustellen, das meiner Ansicht nach eine bahnbrechende Wirkung im Bereich der Wissenschaft haben wird. Es wird dem empirischen Materialismus und Behaviorismus seine Existenzberechtigung entziehen und zwar auf eine leise, aber um so zwingendere Art. Ein altes Paradigma - aus der Not geboren, es gab nmlich nichts Besseres - wird ersetzt durch einen gelungenen wissen schaftlichen Erklrungsweg, der zudem den Vorteil hat, da die Rech nung im wahrsten Sinne des Wortes aufgeht und Basis wird fr eine berechenbare Humanitt und Menschenfreundlichkeit. In der Ge schichte war oft Unwissenheit die Ursache fr Machtexzesse und Grau samkeiten. Dumpfer sich selbst beschrnkender Materialismus wird in Zukunft nicht mehr ohne Widerspruch bleiben knnen, auer als eine Faulheit nicht weiterrechnen zu wollen. Der Lack des hohen Lehrstuhls mancher Akademiker ist ab und wird ersetzt, zwangslufig durch die Besinnung der wissenschaftlichen Gemeinde auf gemeinsames dazuler nen vom Studenten bis zum Ordinarius. Der Lohn wird sein, wie der weite Blick vom Gipfel, nach einem mhsamen Aufstieg. Natrlich kann man fr sich auch beschlieen, gleich im Tal zu bleiben und die Transzendenz zu meiden, man mu schlielich ohnehin wieder absteigen. In einer Epoche massiver Umwlzungen kann dieses Werk jedoch Antwort auf die Fragen nach dem warum der menschlichen Existenz geben. Die Antwort darauf, die persnliche Verantwortung, wird durch die sichtbare effektive Verknpfung mit den Wesenheiten und Wirkmchten, die uns umgeben, fr das soeben wieder Anschlu findendes Individuum akzeptierbar. Eine neue Seite im Buch des menschlichen Bewutseins ist aufschlagen, lesen wir darin! Dr. med. L. S.

VORWORT VON MORPHEUS


Dieses Buch setzt sich im Schwerpunkt mit dem Thema Befreiung des Geistes auseinander. Das tatschliche Verstehen der Beschaffen heit des Denkens ermglicht uns den Weg zur wahren Freiheit. In den Matrix-Filmen kamen einige bedeutsame Dialoge vor, wie zum Beispiel: Wir knnen niemals hinter die Entscheidungen blicken, die wir nicht verstehen, sagte das Orakel zu Neo. Der berwiegend extrem einge schrnkte Freie Wille kommt nur deswegen scheinbar zum Tragen, weil wir die Hintergrnde hierzu nicht verstehen {Das Wieso ist die wahre Quelle der Macht. Merowinger). Im Dialog zwischen dem Merowinger und Neo ging es um diesen Punkt - die eigenen Wahl mglichkeiten. Neo: Alles beginnt mit einer Entscheidung. Merowinger: Nein, falsch... Entscheidung ist eine Illusion, entstanden zwischen denen mit Macht und ohne.... Sind hiermit die Elohim aus dem Alten Testament gemeint oder die Anunnaki, wie sie in den sumerischen Schrifttafeln beschrieben wer den? Bei diesen handelt es sich um die Wesen, die einst vom Himmel kamen und den homo sapiens schufen, damit er ihnen im Garten Eden (als primitiver Arbeiter - Sklave) dient. Sind sie es, die Macht ber uns haben und uns seit Jahrtausenden steuern? In jedem Fall wird mit dieser Aussage die Ausgrenzung des Freien Willens beschrieben. Der Merowinger hierzu weiter: Kausalitt... es gibt kein Entrinnen davon, unsere einzige Hoffnung ist, zu verstehen... das Wieso zu verstehen, das Wieso ist das, was uns von ihnen unterscheidet. Die Kausalitt kann als ein Hauptmerkmal des Ur-Programms, welches das materielle Sein erschuf, den gesamten Kosmos, verstanden werden. Tatschlich liegt die geistige Seinsebene auerhalb dieser Kausalitt. Der Merowinger uert sich hierzu: Das Wieso ist die wahre Quelle der Macht. Im tatschlichen Verstndnis dieser Hintergrnde liegt der Schlssel zur Befreiung des Geistes! 9

DANK UND SINN


Auf meinem unwegsamen Feldzug durch das Labyrinth der geistlo sen Naturwissenschaft (im wahrsten Sinne des Wortes) stie ich er freulicherweise auf einige Arbeiten von auergewhnlichen Naturfor schern. Sie waren auf meiner Reise diejenigen, die meine inzwischen aufgekommene Resignation mit neuem Elan belebten. Ohne einen Louis de Broglie, Richard Feynman, Jean-Emile Charon und Burkhard Heim, ebenso einen Ulrich Warnke, William Tiller, Roger Penrose, Jack Sarfatti und David Lapierre wren meine Fragen unbeantwortet geblieben und letztlich dieses Buch nicht entstanden. Als besonders herausragende Zusammenfassungen im themenbezogenen Kontext mchte ich die Arbeiten von Ulrich Warnke, Andre Waser und Werner Held benennen, die in diese Publikation mit einflossen. Ihnen gilt mein ganz besonderer Dank und meine hchste Anerkennung, schaffen sie es doch, eine Naturwissenschaft im ganzheitlichen Sinne, transparent und deutlich darzustellen. Ich mchte jedem Leser dieses Buches nahelegen, seine neu erwor benen Erkenntnisse zu vertiefen und sich der Arbeiten dieser Pioniere zuzuwenden. Des weiteren sind im Glossar diejenigen Basisliteratur quellen aufgefhrt, die als Grundlage fr dieses Buch dienten.

Morpheus

10

EINLEITUNG
Mit der Ruhe der Seele und einem gelassenen Herzen wirst du auch die schwierigsten Hrden meistern. Kennen wir nicht alle die Bedeutung dieser Aussage, verstehen sie, lesen hnliches in unterschiedlichen Formulierungen wieder und wie der? Doch was ndert sich dabei fr uns tatschlich? Besteht berhaupt eine Aussicht auf Befreiung, Weisheit oder Erleuchtung durch unsere gelesenen Bcher, besuchten Seminare, mglicherweise persnlichen Begegnungen mit Meistern oder gar Erleuchteten? Wissen wir ber haupt, wonach wir suchen? Wir Menschen sind eingebunden in unsere persnlichen Lebenspro zesse, die uns vergessen machen, ber die genaueren Wirkungsmecha nismen und Wechselwirkungen unseres Erschaffungsorgans Gehirn und seine Realitt nachzudenken. Unsere Alltglichkeit, die sich im Rhythmus der Routine zu einer Normalitt ausprgt, fhrt durch ihre scheinbare Selbstverstndlichkeit zu einem Leben, welches uns zu ro boterhaften Entitten degradiert. Ein Leben, welches uns unbemerkt zu Reagierenden macht, fhrt naturgem zu einer inneren Vereinsamung. Diese Vereinsamung fhrt, wiederum unbemerkt, zu einem kompen satorischen Verhalten durch Pseudo-Freuden. Wir kennen es doch alle: Unsere erfllten Wnsche oder erfllten Ziele sind in der Regel nicht von dauerhafter Glckseligkeit begleitet. Kaum erreichte Ziele fhren automatisch zu einer Neuorientierung an weiteren Flhepunkten. Nur manchmal, wenn beispielsweise traumatische Schicksalsschl ge uns an die Grenzen des Schmerzes fhren, kann dieser circulus vitiosus unterbrochen werden. Innerhalb dieser Erfahrungen besteht die Mglichkeit einer Standpunktbestimmung, die eine komplexere Sicht weise ermglicht. Hier verlieren wir, zumindest kurzzeitig, unsere eindimensionale Perspektive. Das erfahrene Leid und die scheinbare Unlsbarkeit der entsprechenden Situation zeichnet unserem Verstand seine eigene Grenze auf. Hier offenbart sich das Phnomen, das wir mit loslassen beschreiben. Erst in dem Moment, in dem sich die Hoch

11

herrschaft des Verstandes aus seiner dominierenden Rolle zurckzieht, erffnen sich dem unpersnlichen Selbst Aspekte der Ganzheitlichkeit des Seins. Bereits im alten China (und Japan) setzten Zen-Meister sogenannte Koans ein, um ihre Schler zu einer blitzartigen Erleuchtung zu fhren. Koans sind Meditationsaufgaben, die nicht durch logische berlegun gen gelst werden knnen, und werden sehr wirkungsvoll eingesetzt, um die Begrenzungen von Ego und Intellekt zu durchbrechen. Diese ber 2500jhrige Weisheit enthlt einen Erfahrungsschatz, welcher un serer neuzeitlichen Gesellschaft verloren gegangen zu sein scheint. Auch wenn wir nicht unbedingt als Erleuchtete aus unseren Le benskrisen entsprungen sein mgen, so befanden wir uns mglicher weise doch sehr nahe am Ziel auf unserer Suche nach erlsender Glck seligkeit. Diese Glckseligkeit hat etwas mit Befreiung zu tun. All das, was wir unter dem Begriff Freiheit zu verstehen glauben, ist doch letzt lich eine Freiheit, die von einem Pseudo-Selbst gefhrt wird, und die es zu erreichen gilt. Diese Befreiung erffnet eine Perspektive der Wahr nehmung, welche das Erkennen naturgegebener Zusammenhnge zwi schen uns, und dem Ganzen ermglicht. Eine ganzheitliche Sichtweise fhrt im Idealfall zu einer Erkenntnis, die unsere Denk- und Hand lungsweise fundamental verndert. Erkennen und auflsen sind die Etappen zur wahrhaften Befreiung. Aus dieser Befreiung agieren wir weder als Suchende noch als automatisierte Wesen, die sich als aktiver Teil eines kosmischen Ganzen verstehen. Hier existiert weder Bedarf noch Wunsch, hier pulsiert lebendige Freude in schpferischer Aktion. Das Hindernis liegt jedoch in unserer beschrnkten Wahrneh mungsfhigkeit, die bekanntlich von unserem Ego bestimmt wird. Die ses verstanddominierte Ego scheint zu erkennen, wo seine Hochherr schaft in Gefahr ist. In Funktion einer leitenden Regie wird es sich sei ner Mglichkeiten bedienen, seinem naiven Partner, dem unpersnli chen Selbst, glaubhaft eine Unntzlichkeit dieses Erlsungsmodells vorzugaukeln. Sein Einflubereich reicht gar so weit, da er - in be sonderer Gefahr - sogar krperliche Beschwerden hervorzaubert.

12

Wie ist es nun dennoch mglich, diesem circulus vitiosus zu ent kommen, ohne sich der mhseligen Tortur eines Koans zu bedienen, oder auf weitere Traumata zu warten? Nach dem Motto erkennen und auflsen wird in den folgenden Kapiteln ein Schwerpunkt auf die ge naueren Wirkungsmechanismen und Wechselwirkungen unseres Ge hirns und unserer Realitt gesetzt. Hierzu werden Sachverhalte aus unterschiedlichen Fachbereichen der Natur- und Geisteswissenschaft herangetragen, die in einigen Pas sagen zu schockierenden Reaktionen des Lesers fhren knnen. Diese Reaktionen sollten als ein untrgliches Zeichen fr das Erreichen eines ersten Etappenzieles zur Auflsung der eingefahrenen Muster gedeutet werden. Sicherlich wird unser Ego immer wieder, auf seine, ihm eigene Verstandesart, uns relativierende oder herunterspielende Argumente hierzu anbieten, jedoch wird sich ebenfalls etwas innerhalb unserer Wahrnehmung verndern, etwas, was uns erkennen lt, da auer dem, mit dem wir uns bisher identifiziert hatten, es fr uns selbst hiel ten, existiert - quasi ein anderer Seins-Aspekt von uns. Das, was wir bisher fr uns selbst hielten, war/ist letztlich nichts anderes als eine ge deutete, knstlich erschaffene Wesensart, die uns vorspielte, da auer diesem Aspekt von uns nichts anderes existiert. Innerhalb dieses Erkenntnisprozesses, welcher in der Regel von tie fen Emotionen begleitet sein wird, ist erkennbar, da der Proze der Auflsung bereits begonnen hat. Dieser Auflsungsproze entspricht zunchst einer Demaskierung unseres knstlichen Selbstes. Sie legt den wahrhaften, den naturgegebenen Aspekt frei, der uns tatschlich aus macht. Unabhngig von unserer bewut erfahrenen Seinsform gestalten unsere Gedanken unsere Realitt. Der bedeutungsvolle Unterschied hierbei besteht allerdings darin, ob wir uns unseres Erschaffungspoten zials tatschlich bewut sind oder nicht! Unsere allgemeine Realitts bhne reprsentiert das, was wir bisher selbst (mit-)erschaffen haben. Selbst wenn uns eine solche Aussage in diesem Moment plausibel er scheinen mag, so behaupte ich, da uns die tatschliche Bedeutung und Tragweite hiervon nicht bewut ist.

13

An dieser Stelle mag es uns noch erstaunlich erscheinen, da all das, was wir bisher durch unsere inneren Bilder und Gedanken manifestiert haben, was also unserer Realittsbhne entspricht, erheblich von dem abweichen wrde, wenn wir diese Bhne nicht durch unsere Verstan des/Ego-Ebene erschaffen htten. Bewute, emotionsgetragene Vor stellungen, die einer ausgeglichenen Einheit zwischen Verstand und intuitivem Selbst entspringen, werden sich ungleich schneller und pr gender manifestieren, als einseitig verstandesgetragene Gedankenbilder. Wenn ich beispielsweise einen Zaubertrick vermittelt bekme, durch den all das, was ber meinen Willen, mein Gefhl und durch das ent sprechende Gedankenbild sich tatschlich umgehend realisierte, werde ich dieses anschlieend auch ohne den Zaubertrick knnen. Ich verfge dann ber ein gesichertes, verinnerlichtes Wissen meines Schpfungs potenzials, welches mich demzufolge zu einem wesentlich bewuteren Menschen emporhebt. Bedauerlicherweise sind die Ebenen des Wissens auf der Verstandesebene unterschiedlich aufgebaut. Simpel ausge drckt: einfach nur zu verstehen, reicht nicht aus. Von hier aus, bis zu einer Verinnerlichung des Verstehens, welches unsere Ergebnisse un mittelbar erkennbar werden lt, besteht offenbar ein groer Unter schied. Was unterscheidet uns beispielsweise von einem Uri Geller oder einem Sai Baba? Worin besteht der Unterschied zwischen einem nor malen und einem Klartraum? Es ist das verinnerlichte Wissen um seine eigenen Fhigkeiten. Aus diesem Grunde erscheint es von besonderer Bedeutung, sich die gesi cherten Ebenen des Verstehens, der Verinnerlichung unseres Schp fungspotenzials, zu erschlieen. Wozu unser gedanken- und emotionsgeleitetes Gehirn tatschlich fhig ist, bestimmt unsere persnliche Einstellung zu unseren eigenen Fhigkeiten und Begrenzungen. Um die Unbegrenztheit der Mglich keiten in all ihrem Potenzial zu erfassen, bedarf es einer glaubhaften Darstellung gegenber der Ratio und der intuitiven Ebene. Tatschlich existieren solche berzeugenden und glaubhaften Belege aus der Na turwissenschaft, die eine willkrlich gesetzte Grenze zwischen Geist und Materie aufheben, und hierdurch sehr wirkungsvoll zu einer Ver

14

einheitlich- und einer Verinnerlichung der eigenen Fhigkeiten beitra gen. Die folgenden zusammengetragenen Forschungsmodelle aus un terschiedlichsten Fachbereichen mgen in dieser Form, und in diesem Kontext gestellt, einzigartig sein. Zu keinem bisherigen Zeitpunkt be stand ein solcher Fundus der ffentlichkeit zur freien Verfgung... Nutzen wir die Chance, die sich uns hierdurch bietet!

Abb.l: Der Mensch als Schnittstelle zwischen Mikro- und Makro-Kosmos.

15

DIE ERDACHTE WELT


Ich denke, also bin ich, genauer: ich bin, weil ich denke
Das denkende und fhlende neuro-chemische Netzwerk eines Men schen erzeugt eine Realitt, welche dem jeweils Gedachten entspricht. Dieser realittsgenerierende Schpfungsproze - Denken genannt erschafft sowohl die geistige als auch die materielle Ebene des Seins. Die Wahrnehmung dessen, was wir als unsere Realitt bezeichnen, ist die Summe aller bisherigen Denkprozesse - unserer eigenen und der von allen anderen (Denken im Sinne von inneren Bildern, Vorstellun gen, Visualisationen und den hieran geprgten Wort-Konstrukten). Smtliche gemachte Erfahrungen sind direkt an entsprechende Ge fhlszustnde gekoppelt. Alle gegenwrtigen Wahrnehmungen, die ber die Sinnesorgane aufgenommen werden, werden mit lteren Er fahrungen verglichen und entsprechend zugeordnet. Da die tatschlich gegenwrtig wahrgenommenen Ereignisse in der Regel niemals in Echtzeit erfahren werden, unterliegt der Vorgang des Denkens grund stzlich einer Zeitversetzung. In dem Moment, in dem das Denken einsetzt, ist der Augenblick, der das Denken bewirkte, bereits vergan gen. Genau genommen ist der Denkproze das Vergleichen von Erin nerungen. Die ersten Prgungen eines Menschen - die eines Suglings - werden ber die Gefhlsebenen erfahren. Hier werden wahrgenom mene Bilder entsprechenden Gefhlen zugeordnet. In diesem Fall wird, hnlich wie bei den soeben beschriebenen Denkprozessen, ber das Vergleichen der lteren Bilder eine Meinung abgespeichert. Medien knnen als Realittsverstrker verstanden werden. Knstlich erschaffene Meinungen und Bilder werden durch wachbewute Zustn de von Menschen aufgenommen und durch innere Reflexionen in die Welt der Realitt transportiert, wobei Emotionen die jeweiligen Dinge entsprechend verstrken. Akzeptanz, innere berzeugung und Glauben bleiben von einer tatschlichen Umsetzung (Manifestation) der aufge nommenen Informationen (Meinungen) unbercksichtigt.

16

Hierzu ein Beispiel: Durch das Lesen eines Artikels in einer Tages zeitung wird das entsprechende Informationsgut durch unsere innere Reflexion in die Realitt transformiert, ungeachtet davon, ob wir diesen Artikel fr glaubhaft halten oder uns mit seinem Inhalt identifizieren knnen. Lediglich die mit der aufgenommenen Information entstande nen Emotionen dienen als Verstrkungsfaktor fr den Proze der Ma nifestation. Somit folgen wir Menschen einem Placebo-Mechanismus, der als Realittsgenerator verstanden werden kann (fungiert). Den Quantenphysikern ist seit ber fnfzig Jahren bekannt, da der geistige Einflu eines Beobachters auf die elementarsten Prozesse der Materie seine Spuren hinterlt. Was jedoch den Magiern seit je be kannt ist, wird von Milliarden von Menschen unbewut praktiziert: Gedanken erschaffen Realitt. Je zielgerichteter und fter ein Gedan kenkonstrukt gedacht wird, desto schneller vollzieht sich seine Umset zung in die Realitt. Werden wir also hufiger mit gleichen oder hnli chen Informationsbildern konfrontiert, ist davon auszugehen, da die ser Transformationsproze um so fester eine reale Gestalt hervorbringt (Rupert Sheldrake nennt es das Prinzip des hundertsten Affen). Ein einheitliches Modell von Geist und Materie ist unerllich zur vollstndigen Beschreibung dieser Wechselwirkungen, weil ein Mensch immer nur seine eigenen geistigen, inneren Erlebnisse als Vernderun gen in seiner einzelnen Psyche erfhrt. Was wir gewohnt sind als uere physikalische Erscheinungen zu bezeichnen, ist in Form materieller Ob jekte konditioniert und mu definitionsgem intersubjektiv in jeder Psyche existieren.

17

GEDANKEN STEUERN MATERIE

Abb.2: Interaktion zwischen Geist und Materie.

Unser Gehirn funktioniert aufgrund der Kraftwirkung durch Quantenaustausch. Uns allen drfte bekannt sein: Alle subatomaren Teilchen haben die Eigenschaft eines Spins, so auch Elektronen und Quarks. Die Achse des Spins zeigt in eine Richtung, die man bestim men kann. Jedoch geschehen bei derartigen Messungen kuriose Dinge. Paul Davies bemerkte hierzu sehr treffend: Der Experimentator baut ein magnetisches Feld auf und legt damit eine bestimmte Richtung der Spin-Achsen fest. Relativ zu dieser Referenzrichtung sollen die Richtungen anderer Spin-Achsen ohne Feld bestimmt werden. Wenn der Versuchsleiter nun mit, zeigen die Achsen zufllig genau in dieselbe Richtung, die vorher von ihm als Referenz innerhalb des aufgebauten Feldes festgelegt wurde. Der Experimentator wiederholt die Messung mehrfach, aber immer wieder zeigen die Achsen parallel zum Feld. Er baut daraufhin das ma gnetische Feld mit neuer Richtung auf aber nun zeigen die Achsen der untersuchten Teilchen ebenfalls in die neue Richtung. Die vorgenommene Drehung ist also von den Teilchen nachvollzogen worden. Das Teilchen scheint demnach die Absicht des Experimentators zu kennen und whlt dementsprechend immer die Richtung, die vorher als Referenz willkrlich festgesetzt wurde. Zur Umgehung dieser merkwrdigen Situation baut der Wissenschaftler zwei verschiedene Referenzrichtungen auf und mchte die Richtung der festzulegenden Spin-Achsen relativ zu beiden Referenzen angeben. Tatschlich ist es unmglich, da das Teilchen zwei verschiedene

18

Richtungen gleichzeitig einnimmt, also mchte er den Winkel registrieren, den die Spin-Achse relativ zur Mitte beider Referenzrichtungen einnimmt. Wieder geschieht das Unglaubliche: Die gemessene Spin-Achse zeigt zuerst in Richtung der ersten Referenzrichtung, dann in Richtung der zweiten Referenzrichtung, dann wieder in Richtung der ersten und so weiter... Die Interpretation dieses Versuchsergebnisses, die Davies (ein Schler von Hawking) gibt, erscheint geradezu magisch: Wenn der Spin eines Teilchens auf ewig dazu bestimmt ist, der zu flligen Wahl einer Vorzugsrichtung durch einen Experimentator zu folgen, dann dringt auf diese Weise der freie Wille eines Physikers in die Mikrowelt ein. Die unheimliche Sklaverei, die alle mit Spin ausgestat teten Teilchen zwingt, den vom Experimentator festgelegten Winkel einzunehmen, erweckt den Eindruck, als ob der Geist die Materie be herrsche. Als erstes stellt sich natrlich die Frage, wie kann etwas, was in mei nem Gehirn als Gedanke wirkt, eine Funktion auerhalb meines Kr pers steuern? Das Thema der spukhaften Fernwirkungen, wie Albert Einstein dieses Phnomen nannte, das heute als Nichtlokalitt bezeichnet wird, wurde von den Physikern Einstein, Podolsky und Rosen (EPR) aufgegriffen. Diese Physiker hatten sich bereits 1935 ein Experiment ausgedacht, welches 1964 John Stewart Bell (Bell'sche Ungleichung) weiterfhrte, und erst 1982 von der Pariser Arbeitsgruppe um Alain Aspect herum besttigt wurde. Heute ist das Experiment bereits mehr fach in unterschiedlichen Variationen verifiziert worden und gehrt zum Stand der Technik. Im National Institute of Standards and Tech nology in Boulder, Colorado, wurden Beryllium-Ionen in einem Behl ter energetisch angeregt. Dafr wurden die Ionen mit Radiowellen 256 msec lang bestrahlt. Diese Zeitspanne wird gewhlt, weil danach die Ionen mit 100% Wahrscheinlichkeit alle angeregt sind. Andere Quan ten haben andere spezifische Zeiten. Die Ionen entscheiden sich aber fr einen hheren Anregungszustand erst in dem Augenblick, in dem sie beobachtet, also beispielsweise gemessen werden. Dieses wurde mit 19

einer speziellen Lasertechnik vorgenommen. Das Ergebnis war eine absolute Sensation: Warfen die Wissenschaftler bereits nach 128 msec einen Blick auf die Ionen, so waren erwartungsgem etwa die Hlfte der Ionen angeregt; warfen sie jedoch viermal in gleichen Zeitabstnden innerhalb 256 msec einen kurzen Blick auf die Ionen, so waren nur noch 1/3 der Ionen angeregt, 2/3 blieben dagegen so, als ob keine anre genden Manahmen vorhanden wren. Wurde gar 64 mal in den Behl ter geschaut, (alle 4 msec), so hatten nur sehr wenige Ionen die Anre gung angenommen. Fast alle blieben im Ruhebereich und das, obwohl der reine Absorptionsvorgang der Radiowellenenergie in krzester Zeit erledigt war. Der Grund fr dieses phantastische Verhalten hat Konsequenzen, die unser alltgliches Weltbild revolutionieren. Ein Ion mu sich, wenn es beobachtet wird, entscheiden, welche der vorgegebenen Quantenan regungsstufen es einnehmen wird. Entscheidungshilfe fr die Stufen ist die Wahrscheinlichkeitswelle, die sich im Behlter ausbreitet. Wird es zu hufig beobachtet (in diesem Versuch alle 4 msec), dann hat die Wahrscheinlichkeitswelle nicht gengend Konzentration, um sich von einer Anregungsstufe zur nchsten zu begeben. Sie kollabiert infolge der Beobachtung immer wieder und befindet sich deshalb nach Ablauf der Versuchszeit immer noch auf der Grundstufe. Nach 4 msec kann laut Wahrscheinlichkeit nur ein Ion von 10.000 Ionen die Anregungs stufe erreichen. Wenn alle 4 msec beobachtet wird, dann hat kaum ein Ion eine Chance die nchste Anregungsstufe zu erreichen, da das nur unbeobachtet geschehen kann. Die Konsequenz hieraus: Dauernd beobachtete Quantenzustnde knnen sich niemals ndern, auch dann nicht, wenn Anregungse nergien resonant einwirken. Wenn wir Quantenzustnde nicht aus den Augen lassen, sind ihre Energiestufen eingefroren. Nur unbeob achtete Quantenzustnde knnen sich wandeln. Die Beobachtung, die Messung, das Erkennen verhindert die Ausbreitung von Wahr scheinlichkeitswellen. Es existieren demnach fr einen bestimmten Zeitraum keine Neuzustnde mehr.

20

Auf uns Menschen bertragen bedeutet das: Durch die Entstehung des Menschen allein werden durch laufend neu gebildete Zellen - einschlielich fortlaufend neu eingebauter Mole kle - regelmig Neuzustnde erschaffen. Es entsteht also eine stn dige nderung. Eine Dauerbeobachtung ist demzufolge ausgeschlossen. Ist der Mensch fertig entwickelt, so bleiben die Resonanzen unter allen Umstnden an jedem Ort erhalten (das System retardiert). Prgungen als ausgezeichnete Dauerbeobachtungen werden mglich (Pubertt und Menopause sind kritische Phasen). Alterung entspricht im gleichen Modell der Vernderung der Reso nanzkrper durch Freie Radikale, Noxen oder Mutationen. Das be deutet: die Dauerbeobachtung fllt aus. Die Erhaltung des Zustandes ist nicht mehr gegeben. Neuzustnde entstehen, die keine Optimierung mehr darstellen, da sie nicht der DNS-Matrix entsprechen.

Die Rolle der Psyche


Bewutsein lt die Wellenfunktion kollabieren. Die Superposition (siehe Glossarium) mit potentieller Energie und Information im Vaku um wird auch als virtuell bezeichnet. Experimente zum TeilchenWellen-Dualismus zeigen, da der Beobachter ganz offenbar eine zen trale Rolle bei der Festlegung der Natur der Wirklichkeit auf der Quantenebene spielt (zum Beispiel beim Placebo-Effekt). Die Umschaltung von virtueller auf reale Information und Energie geschieht immer erst lokal durch Beobachtung, Messung, Aufzeich nung (engl, record), Resonanz und das Geben von Sinn und Bedeu tung (the it from the bit laut Wheeler). In der Vorquanten-ra der Physik war es selbstverstndlich, da die Welt da drauen, auerhalb von uns sich in einem festgefgten, von uns unabhngigen Zustand befindet. Der Beobachtungsvorgang dringt zwar in diese Wirklich keit ein - denn wir knnen nichts beobachten, ohne in einem gewis sen Ma mit ihm in Wechselwirkung zu treten aber jeder ging da von aus, da diese Wechselwirkung entweder beliebig klein gehalten oder vollkommen kalkulierbar ist. 21

Die Quantenphysik entwirft aber ein Bild von der Wirklichkeit, in dem Beobachter und Beobachtetes untrennbar miteinander ver bunden sind. Die Auswirkungen der Beobachtung sind fr die zum Vorschein gebrachte Realitt fundamental und knnen weder redu ziert noch kontrolliert werden. Eine Quantum-Superposition, die von der Umgebung isoliert ist, bleibt in diesem Stadium, bis ein bewuter Beobachter auftritt. Ex perimente haben erstaunlicherweise ergeben: Wenn eine Maschine Quantensysteme mit, bleiben die Ergebnisse solange in einer Su perposition, bis ein bewuter, intelligenter Mensch die Messung der Maschine beobachtet. berraschenderweise ist also nicht nur das Bewutsein fr das Zusammenbrechen der Wellenfunktion verantwortlich, sondern sogar Intelligenz ist ein wesentlicher Bestandteil des Schalters. Betrachten wir uns hierzu ein Beispiel: Wenn wir eine Impuls-Eigenschaft eines Elektrons messen, erfahren wir immer nur die Antwort des Elektrons auf unsere gestellte Frage. Der gemessene Impuls ist eine Art Tuschung, die von der Wechselwir kung der Quantenentitt mit der Versuchsanordnung hervorgerufen wird, und die dann von einer Intelligenzeinheit in unserem Gehirn in terpretiert wird. Das nennen wir Erkenntnis und erst jetzt ist die Virtualitt in die Realitt umgesprungen. Aufregend sind die Ver suchsergebnisse, wonach eine konkrete Messung sich erbrigt und al lein das Wissen des Experimentators Realitt schaltet. ndert sich das Wissen ber einen Versuchsvorgang und ziehen wir daraus vernderte Schlsse, dann ndert sich auch das untersuchte Quantensystem und liefert eine vernderte Realitt! Jedes Ergebnis hat den Anstrich der Frage, die das Experiment her vorgerufen hat. Ein Elektron, das gefragt wird, ob es ein Teilchen ist, ist ein Teilchen. Wenn aber das Elektron gefragt wird, ob es eine Welle ist, dann ist es eine Welle.

22

Der Nobelpreistrger fr Physik, Werner Heisenberg, bemerkte hier zu: Auch in der Naturwissenschaft ist also der Gegenstand der Forschung nicht mehr die Natur an sich, sondern die der menschlichen Fragestellung ausgesetzte Natur. Ungestrte Phnomene sind nur die, die unbeobachtet bleiben. Das unbeobachtete Universum kann daher nicht so betrachtet werden, als htte es eine vllig vom Nachweis unabhngige Existenz. Eine Welle wird im universellen Kontext dann zu lokaler, konkreter Information, wenn wir Menschen als eine Raum-Zeit-Konstruktion, die wir darstel len, bewut fragen, um Erfahrung und Erkenntnis zu erzeugen. Nicht lokale Gesetzmigkeiten, wie sie die Welle reprsentiert, verknpfen die Dynamik universell und virtuell verborgener Information mit der lokalen Materie und schalten damit reale semantische Information. Nehmen wir alle Versuchsergebnisse zusammen, dann zeigt sich: Der Geist kreiert Realitt (Kopenhagener Interpretation, Bohr). Dies ist alltgliche Erfahrung. Wenn ich spreche und den Arm hebe, beein flusse ich mit einem geistigen Prinzip, was wir bewuten Willen nennen, die Materie spezieller Muskelgruppen, also Massen-Krfte. Wenn Bewutsein meine Massen-Matrix moduliert, wenn ich also aufgrund meines Willens meinen Arm hebe, dann hat der Entitten komplex Geist eine Interaktion mit dem Entittenkomplex Raum-Zeit-Krmmung (Massen) durchgefhrt. Das aber heit, beide mssen sich erkennen und gemeinsame Eigenschaften (Teil mengen) aufweisen. Fazit: Die Physik mute mit der Quantenphysik und Quantenphilo sophie eine nichtlokale, in ihren Teilen verknpfte Quantenwelt akzep tieren, die sich nur manifestieren kann, wenn wir an ihr partizipieren. In der Quantenphysik existieren in mancher Hinsicht alle mglichen knftigen Ereignisse, bis die Beobachtung das Mgliche ins Tatsch liche umsetzt.

23

Das neue Bild der Materie-Organisation


Bercksichtigt man die bisherigen Erkenntnisse, dann ergibt sich folgendes Bild: Die Materie baut sich durch Krfte und Zeitoperationen auf. Diese Krfte und Zeitoperationen sind die Folge von Potenzialen mit impliziten Entitten. Diese Entitten sind durch Bewutsein und Geist beeinflubar. Wissenschaftler sehen das physikalische Universum nicht mehr als eine Ansammlung von Zahnrdern in einer Maschine, sondern als ein informationsverarbeitendes System. Fr unsere Funkti on sind anstelle der Materie Informationsbits getreten. Im neuen Para digma des Universums sind Geist, Intelligenz und Information wichti ger als Hardware. Unterschieden werden Programme (Information), welche die Hardware (Zusammenschlu der Massen) steuern, elektri sche Potenziale mit impliziten Strukturen und Programmen (Informa tion), welche die Software, also die zugrundeliegende Funktionssteue rung modulieren. Psyche: wie Geist/Wille/Gefhl.

Die Bausteine des Lebens oder die Trger des Geistes.


Wir Menschen bestehen aus einer kaum vorstellbaren Anzahl von Elektronen. Diese Elektronen in uns sind an allem beteiligt. Es gibt keinen Aufbau in unserem Krper, keine Funktion, die ohne Elektro nen stattfnde. Sie sind es, die dem Atomkern die Mglichkeit geben, sich mit anderen Atomkernen zusammenzuschlieen; sie sind es, die Krfte entwickeln, um das aufzubauen, was wir Materie nennen, und sie sind es auch, die der Umgebung Nachrichten zukommen lassen, um Funktionen zu koordinieren. Die Vielzahl der Verbindungen kommt allein dadurch zustande, da die Elektronenzahl in den Atomen ver schieden und die Ausrichtung des Spins der Elektronen unterschiedlich ist. Die Gesamtheit smtlicher Elektronen, die gegenwrtig existieren und die unseren Krper aufbauen und funktionieren lassen, sind in 0 bis 0,1 Sekunde nach dem Schpfungsakt unseres Universums entstanden (Urknall). Prinzipiell ist kein einziges Elektron bis heute dazugekom

24

men oder verloren gegangen. Obwohl sich Elektronen in sehr kurzen Zeiteinheiten in andere Quantenteilchen verwandeln knnen, behalten sie doch ihre Identitt. Was viele von uns verwundern mag: Elektronen sind absolut unsterblich. Alle Protonen und Neutronen sind 1 msec nach dem Urknall aus ei ner Quarkgemeinschaft heraus als Erstarrung gebildet worden. Diese Kernteilchen sind die eigentlichen Bausteine heutiger Materie. Auch sie sind quasi von ewiger Dauer. Etwa 2080 Sekunden nach der Zeit Null entstanden die Wasserstoff-Atome, die zirka 93% aller Atome des Kosmos ausmachen. Die nchst-hufigen Elemente im Universum sind Sauerstoff und Kohlenstoff. Auch Kohlenstoff hat eine unendliche Exi stenzdauer, welches uns im folgenden Verlauf noch von besonderer Bedeutung deutlich werden wird. Tatschlich besteht unser Krper aus Elementen des Urknalls. Die Bausteine in uns bauen uns nicht nur auf, sondern sie sind auch beteiligt an der Aufgabe, uns funktionieren zu lassen. Das, was wir unter Biochemie verstehen, ist nichts anderes als wiederum die bertragung unterschiedlicher Krfte mithilfe elektro magnetischer Schwingungen unterschiedlicher Frequenzen, ausgehend von Elektronenansammlungen. Bindungen zwischen zwei Teilchen besitzen, entsprechend ihrer Ener gie, eine sehr verschiedene Lebensdauer; Bindungsenergien von: 0,9 eV: mittlere Lebensdauer 0,1 sec 1,5 eV: mittlere Lebensdauer 1,3 Jahre 1,8 eV: (Bindungen der DNS) mittlere Lebensdauer 30.000 Jahre Unsere Empfindungen, indem wir beispielsweise unsere Fingerspit zen ber ein Blatt gleiten lassen, sind Wechselwirkungen zwischen den Elektronenwolken unserer Finger und den Elektronenwolken des Blattes. Elektronenwolken kommunizieren bekanntermaen mit Hilfe von Photonen. Wir fhlen also die elektromagnetischen KraftWechselwirkungen der Photonen. Wir spren den Widerstand der elektromagnetischen Bindungskrfte zwischen den Atomen und den Moleklen. Wir fhlen auerdem die Wrme beispielsweise unserer

25

Haut. Auch hier sind es die elektromagnetischen Schwingungen, die uns das fhlen lassen, was wir als Wrme bezeichnen. Unsere Wahr nehmung ist also in erster Linie abhngig von elektromagnetischen Sensoren. Das, was wir als bewute und unbewute Information aufnehmen, also insgesamt alles, womit wir unsere Welt, unsere Realitt beschreiben, wird vermittelt von diesen Sensoreigenschaften der Elektronen. Eine Kommunikation zwischen unserer Innen- und Auenwelt er folgt durch Photonen, die als Botenstoffe fungieren. Die Trennung zwischen der Innen- und Auenwelt wird durch die besonderen Eigen schaften der Elektronen hervorgerufen. Sie stellen eine Art Raum-ZeitMembran dar. Wollen wir die Wechselwirkung nur zweier Teilchen beschreiben, dann mten wir bereits eine sechsdimensionale Welle bercksichtigen; drei Teilchen bentigen bereits eine neundimensionale Welle. Um diese phantastisch erscheinenden, hherdimensionalen Ebe nen besser verstehen zu knnen, ist diesem Thema ein eigenes Kapitel gewidmet. Nur hierdurch ist ein ganzheitliches Verstndnis der geistig materiellen Strukturen zu verstehen. An dieser Stelle soll zunchst nur zum Ausdruck gebracht werden, wie auerordentlich komplex es in uns arbeitet. Das ganze Universum, die ganze Erdenwelt, die gesamte Natur und unser ganzes Leben beruhen unter anderem auf der unentwegt ab laufenden Wiederholung von nur drei elementaren Vorgngen: Der elektromagnetischen Welle, welche die Bewegung der Elektronen kennzeichnet, der elektromagnetischen Welle, welche die Bewegung des Pho tons/ der Photonen kennzeichnet, und der Wechselwirkung dieser beiden Wellen (Feynman).

Prinzipiell haben alle Krper eine Quantenenergie und entsprechend eine de Broglie-Quantenwellenlnge, somit auch der Mensch. (Interes santerweise entspricht die Wellenlnge eines Menschen einer Wellen lnge von 10-35 Metern, was der Plancklnge gleichkommt. Bei diesen

26

kleinen Distanzen verlieren unsere bekannten Konzepte von Raum und Zeit ihre Sinnhaftigkeit). Alle sich ungleichfrmig bewegenden Elektronen und alle elektrisch nicht neutralen - also alle geladenen Teilstrukturen oder Krper - sind Sender elektromagnetischer Felder mit Kraftwirkung. Ein vlliges Still stehen gibt es nicht, was bedeutet: Alle Molekle und Krper haben eine Quantenenergie. Aus den sehr zahlreichen Mglichkeiten der Be wegungen werden ganz spezielle zur Verwendung herausgehoben. Alle verwirklichten Bewegungen der elementaren Strukturen sind gequantelt, wie Umdrehungszahl, Schwingungsweite, Bahnradius, Neigung der Bahn im Raum, selbst die Ellipse einer Bahn mit groer und kleiner Achse. Zu jedem Bewegungszustand als Kombination aller verbleibender Mglichkeiten gehrt eine ganz bestimmte Energie. Dementsprechend strahlt jede Atom- und jede Moleklkombination, auch aufgrund ihrer jeweilig manifesten Umgebungseinflsse nur eine ganz bestimmte fr sie charakteristische Quantenenergie aus - eine individuelle Darstel lungsform.

27

ENTSTEHUNG UNSERER REALITT


Alle biologischen Regulatoren wie Hormone, Neurotransmitter, Antigene oder Substrate der Enzyme haben elektrische Eigenladungen, die meistens asymmetrisch ber das Molekl verteilt sind (Dipol). Gleichzeitig haben alle diese Molekle eine mechanische Eigenschwin gung. Beides zusammen genommen (zum Beispiel Dipolmoment und Vibration) fungiert als Sender von elektromagnetischen Wellen. Ihre Partner wie Rezeptoren, Antikrper oder Enzyme, fungieren als spezi fische Empfnger dieser Wellen. Der spezifische Empfang der gesen deten Welle, das heit, der Empfang von Information als codierte Energie, geschieht dabei ber Resonanz, also ber eine Feld-Kraftbertragung und -wirkung. So entsteht das, was wir als Realitt be zeichnen (Quantenphysik = Verfestigung).

Hellseherische Elektronen
Die Wheeler-Feynman-Absorber-Theorie gilt unter den modernen Physikern als das Beste, was jemals erdacht wurde. Diese Theorie wur de 1941 in einem Vortrag in Princeton von Richard Feynman vor Al bert Einstein und Wolfgang Pauli verffentlicht. Die WheelerFeynman-Theorie erlaubt es den Teilchen, die vergangenen und zu knftigen Schicksale des ganzen Universums zu kennen. Wenn Elek tronen miteinander wechselwirken, gibt cs zwei stabile Situationen: 1. Energiewelle in der Zeit vorwrts, also in die Zukunft strahlend, oder 2. rckwrts in der Zeit, also in die Vergangenheit. Diese Darstellung geht absolut konform mit der Maxwell'schen Gleichung und mit der Schrdinger-Gleichung sowie deren Spiegelbild. Bisher hatten die Physiker die in der Zeit rckwrts laufende Lsung dieser Gleichung beharrlich ignoriert. Genauer: Ein Elektron (fungierend als Sender oder Emitter) emit tiert eine elektromagnetische Strahlung. Diese Strahlung ist gekenn zeichnet von einem Feld, das aus einer zeitsymmetrischen Mischung 28

einer retardierten (in die Vergangenheit laufenden) Welle und einer avancierten (in die Zukunft laufenden) Welle besteht. Die Konsequen zen, die sich hieraus ergeben sind: Jede elektromagnetische Wahr scheinlichkeitswelle wei bereits, welches Ziel sie hat und welche Resonanzstruktur (Absorber) sie erwartet. Der Grund hierfr ist, da mit der Absendung der Welle (Angebotswelle) bereits das Echo von der Resonanzstruktur (Besttigungswelle) eingetroffen ist. Jedes emittierte Photon wei bereits, wo es absorbiert werden wird. Da nun Quantenenergie-Empfnger unausweichlich immer wieder selbst Sender von Quantenenergie werden, demzufolge jeder jedem etwas sendet und empfngt und wieder sendet, ergibt sich eine unvorstellbar komplexe Vernetzung. Die Selektion der Kommunikation tritt durch die Anzahl der resonanten Absorber ein (Frequenzspezifitt). Bei Elektronen sind es quasi unendlich viele, bei Enzymen beispielsweise nur wenige. Aus der Perspektive eines Photons haben weder Zeit noch Raum eine Bedeutung. Fr diese Quanten existiert immer nur der IstZustand. Dieses bedeutet, da alles in unserem Universum energetisch zeitlos und raumlos verknpft ist und jeder von jedem unmittelbar alles energetisch Wichtige wei. Eine notwendige Chaos-Ordnung ent steht dadurch, da sich ein Groteil der Wellen und Quanten innerhalb des Wechselspiels auslscht und dadurch, da das Skalarfeld (Sub quanten- oder Higgs-Feld) eine Matrix vorgibt. Keine der avancierten Wellen lt sich spren, auer in der Wirkung als Strahlungswider stand. Weil wir nichts von den avancierten Wellen mitbekommen, existieren fr uns lediglich die retardierten Wellen. Die avancierte Welle hat zwei Weg-Mglichkeiten: Entweder sie luft in die Vergangenheit, regt dort ein Elektron an und kommt dann als Echowelle in die Gegenwart, also als retardierte Welle; oder sie kommt aus der Zukunft als Echo der retardierten Welle. In beiden Fllen wird unser Elektron aktiv. Das wre dann sprbar, wenn viele Elektronen in gleicher Weise betroffen sind (was dem Zu stand der Kohrenz entspricht). Da bei der Aussendung der Welle gleichgltig ob in die Zukunft oder in die Vergangenheit - und bei

29

Eintreffen der Besttigung exakt die gleiche Zeit gilt, spielen die zu rckgelegten Entfernungen der Welle im Raum nicht die geringste Rolle. Aus diesem Modell erklren sich unter anderem die Nichtlokalitts-Experimente nach Aspect. Ein angeregtes Atom ist im Begriff zwei Photonen zu emittieren: 1. 2. dafr werden Angebotswellen in verschiedene Richtungen gesen det. Die Photonen werden jedoch erst dann emittiert, wenn besttigen de avancierte Wellen rechtzeitig von einem Absorberpaar (Beob achter) zu dem Atom zurckgeschickt wurden. Ist dieser Vorgang in der Zeit hin und in der Zeit zurck abge schlossen, werden die Photonen bertragen (Beobachtung). Da das Paar ein einziger Quantenzustand ist, mssen Spin und Polarisation immer miteinander korreliert sein, unabhngig von Raum und Zeit. Sind die Polarisationsmglichkeiten fr das Photon beim Abtasten der Umgebung mit der retardierten Welle nicht gegeben, dann werden auch keine Photonen abgeschickt. Das bedeutet, da die Absorptionsmglichkeiten erst eruiert werden mssen. Sie be stimmen dann die Polarisation der abgeschickten Photonen.

2. 3.

4.

In dem bedeutenden Aspect-Experiment kann also kein Photon abgesendet werden, das nicht den Absorptions-Mglichkeiten der De tektoren bei der Messung entspricht. Das bedeutet, die Elektronen ta sten mit Hilfe ihrer Schwingungen die komplette Umgebung ab und geben erst dann die Kraftbertragung frei, wenn alles dafr stimmt. Der Nobelpreistrger Ilya Prigogine uerte sich hierzu folgendermaen: Erstaunlich ist, da jedes Molekl wei, was die anderen Molekle zur selben Zeit und ber makroskopische Entfernungen hinweg tun werden. Unsere Experimente zeigen, wie die Molekle miteinander kommunizie ren. Jeder akzeptiert diese Eigenschaft bei lebenden Systemen, aber da auch nicht belebte Systeme sie aufweisen, ist zumindest unerwartet.

30

Die Konsequenzen aus diesen Ergebnissen sind eine wissenschaftli che Sensation. Stoen wir beispielsweise ein Elektron hier auf der Erde an, dann wei offenbar jedes geladene Teilchen - sei es gar am Ende unseres Universums augenblicklich, was geschehen ist, obwohl jede Welle fr diese Reise beispielsweise 14 Milliarden Jahre bentigen wr de. Umgekehrt bedeutet dies: Wei unser Elektron, wo das Ende un seres Universums ist, dann wei das Ende des Universums-Elektron, wo sich unser Elektron befindet. Offenbar ist alles im Universum ver bunden mit allem anderen in einem totalen Gewebe wechselseitiger Wirkungen. Jean-Emile Charon uert sich hierzu wie folgt: Mein Denken ist das Denken meiner Elektronen, es herrscht also nicht blo Analogie, sondern Identitt. So unglaublich es auch erscheinen mag: Das Bewutsein steuert die Materie. Unser Bewutsein ist identisch mit den Aktivitten bestimm ter Elektronen in bestimmten Hirnregionen. Elektronen mssen ber Strukturen verfgen und sich durch Prgung dieser Struktur Erfah rungen merken knnen. Tatschlich kommen die Physiker David Bohm, Jean-Emile Charon und Louis de Broglie zu diesen Ergebnissen.

Fernkommunikation
Nur ein vollkommen freies Elektron kann sich beinahe alle mgli chen energetischen Zustnde leisten und somit auf alle mglichen Sen de- und Empfangsfrequenzen reagieren. Ideal funktioniert das im Welt all: Jedes freie Elektron kommuniziert mit fast allen anderen freien Elektronen. Dadurch sehen wir mit unseren Augen Sternenlicht (aus gehend von Elektronen der ueren Sternschichten, weitergeleitet von Elektron zu Elektron im Kosmos), dessen Sendequelle tausende Licht jahre entfernt ist. Wenn also ein freies Elektron sein Anregungssignal sendet, werden alle Elektronen des Universums mit passenden Eigen schaften (Polarisation) den Signalempfang melden. Eine selektive Aus wahl, ein spezifisches Adressieren an bestimmte ausgewhlte Elektro nenzentren scheint in diesem Prinzip unmglich. Wenn allerdings ein Organismus funktionieren soll, mu genau die Spezifitt einer Nach richt gewhrleistet sein. 31

Sende- und Empfangskanle


Die Frage an den Konstrukteur heit also: Welche Mglichkeiten sind fr den Aufbau spezifischer elektromagnetischer Sende- und Empfangskanle gegeben, wenn nichts anderes zur Verfgung steht als Atome und freie Elektronen? Und eine andere Frage drngt sich zu stzlich auf: Wenn ich viel Masse zusammenballe, wie in einem Orga nismus, wodurch kann ich dann bewerkstelligen, da eingekoppelte Energie als Information nicht gleich in der erstbesten Massestruktur stecken bleibt, also gar nicht weitergefhrt wird? Die Probleme sind gelst worden - wie immer bei den Konstruktio nen der Natur -, alle mglichen Probleme auf einmal. Wir wissen: Die Geometrie einer Antenne bestimmt die Eigenfrequenz und ist verant wortlich fr bestimmte resonante Sende- und Empfangsfrequenzen. Genauso wie dieses Prinzip in der Technik funktioniert, hat es auch in unserem Krper seine Bedeutung. Vor allem Proteinstrukturen, aber zum Beispiel auch Nukleotide und Glukosaminoglykane sind durch Bauplne der DNS zu Antennenstrukturen aufgebaut worden, die, ent sprechend ihrer geometrischen Spezifitten, ganz bestimmte elektro magnetische Schwingungen aufnehmen und weitersenden knnen! Betrachtet man alle Strukturen, die in uns verwirklicht sind, so wird deutlich, da die Bandbreite der Frequenzen riesengro ist. Spezifische Frequenzen werden ber groe Entfernungen geleitet, indem alle gleichgebauten Molekle die Schwingung absorbieren und nach Anre gung wieder zum nchsten gleichartigen Molekl absenden. Sehr schn sichtbar wird dieses Nehmen und Geben in der Wrmeleitung, insbe sondere bei der Wrmeleitung des Blutes. Damit sind aber die Mglich keiten des gesamten Systems noch lange nicht erschpft. Proteine ha ben die Angewohnheit, ihre geometrische Form zu ndern, indem sie Seitenketten um einen vorgesehenen Torsionswinkel verdrehen. Dies geschieht als Folge einer Energieabsorption. Damit verndert sich so fort die spezifische Sende- und Empfangsfrequenz des Proteins, wo durch die alte Resonanzfrequenz blockiert und neue Informationska nle aufgebaut werden.

32

So kann jede spezifische Nachricht (codierte Energie) ber resonante Weitergabe den Krperraum durchschreiten, bis sie in eine Ziel struktur umgesetzt wird. Die Elektronen dieser Molekle reagieren auf die Energiezufuhr im Kollektiv. Abhngig von der Anzahl der Elektro nen kann die Resonanzbreite sehr schmal werden und auerordentlich unterschiedlich von Molekl zu Molekl. Feinabstimmungen bei der bermittlung von Information sind kein Problem. Viel Masse ergibt viele Formen, das ergibt wiederum viele Resonanzmglichkeiten und eine hohe Bandbreite mglicher Frequenzen, also viel Differenzierung der bertragenen Information und hohe Fernwirkung innerhalb der Grenzen des Krpers. Erinnerung mit diesen umfassenden Mglichkeiten knnte dann folgendermaen aussehen: Die Kommunikationskrfte, hintereinander gestaffelt in Fluxen, formen Gebilde, die wie eine Diskette oder eine CD als eingefrorene Solitonenschwingung (Stehende Wellen mit Schallkomponente) abgelegt werden. Das Ergebnis davon ist die be kannte Konformation/Konfigurationsnderung der Proteine. Ein Pho tonenreferenzstrahl (Angebotswelle) kann analog zum Laserstrahl die Gebilde abtasten und dadurch moduliert werden. Eventuell werden die Gebilde auch durch den Strahl zum Schwingen gebracht. Die neu vom Gebilde ausgesandten Schwingungen modulieren, phasenanalog zur Angebotswelle, die Besttigungswelle, die zum Ursprung zurckkehrt und die Erinnerung darstellt.

Die Kraft des Pulsierens


Energie zeigt ja nur deshalb Wirkung, weil sie mit Quantensten identisch ist. Eine Wirkung der Energiebertragung ist aber schlechter, wenn sie aus einem kontinuierlichen Flu heraus entsteht; dagegen deutlich besser bei pulsierenden Sten. Fr dieses Wirkprinzip gibt es Beispiele: Ein kontinuierlicher sanfter Wasserstrahl auf eine Stelle des Kopfes gelenkt, wird von uns ohne weiteres toleriert. Die gleiche Wassermenge aber kontinuierlich als

33

Tropfen herunterfallend, erzeugt schon nach kurzer Zeit enorme Schmerzen (dies ist ein beliebter Test bei meditierenden Mnchen im ostasiatischen Raum). Hier spielen Oberflchenkrfte des Tropfens eine entscheidende Rolle. Eine Sge kann die Holzfasern nur dadurch zertrennen, weil zwischen den Zacken nichts ist, weil also die Kraft pulsierend gelenkt wird. Die Trommel hat deshalb eine so mchtige Rhythmuskraft, weil sie in Pulsen geschlagen wird. Musik mit pulsfr mig-rhythmischem Klang erzeugt offensichtlich eine gewisse Energie zufuhr in bestimmte Gehirnzentren, die sogar Kleinstkinder bereits phasenrhythmisch hopsen lt. Die Sprache und ihr Informationsgehalt ist eine Pulsfolge von T nen und Klngen. Die Wirkung der Pulsfolge der Sprache wurde an Kleinstkindern mit Hilfe von Computerbildern, die bereinandergelegt wurden, sichtbar gemacht. Die Babies machten fr das Auge unsichtba re Mikrobewegungen und zwar genau im Rhythmus des Tonfalls der mtterlichen Stimme. Tne beherrschen die Denkstrukturen, und fh ren in ihrer Fortsetzung zu Muskelbewegungen. Eine Nervenzelle er zeugt Pulse. Nur dadurch kann Information bermittelt werden. Auch der Muskel arbeitet nur mit Pulsen, ebenso der Herzmuskel. Unser Auge kann die Bilderzeugung nur ber ein pulsfrmiges Abtasten der Umgebung aufbauen. Der Riechvorgang hrt auf, sobald die Duftmo lekle kontinuierlich ankommen. Der Rezeptor adaptiert. In Pulsen abgegeben passiert das nicht. Temperatursprnge sind im Organismus berall anzutreffen und wichtig fr die Physiologie, zum Beispiel als Temperaturdifferenzen innerhalb der Zelle und zwischen Zellen und Zellzwischenraum, wo streng lokal und punktfrmig leicht mehrere 100C auftreten knnen. Wechselbder hei/kalt ist das Prinzip einer Therapie. Die unterschiedlichen Materieeigenschaften sind nur mglich durch die pulsartigen Vervielfltigungen einer Grundstruktur (Quanti fizierung) innerhalb des periodischen Systems der Elemente. Warum haben Pulse eine grere Wirkung als gleichmig einwir kende Krfte? Pulse sind dadurch gekennzeichnet, da kurze Pausen in der Kraftwirkung auftreten. Dadurch werden rhythmisch abwechselnd

34

verschiedene Quantenzustnde induziert. Jede lokale Vernderung des Quantenzustandes hat Kraftwirkungen in der Umgebung zur Folge (durch Neuzustnde von Photonen-/Quantenbertragung). Ein gleich bleibender Zustand (entsprechend der Dauerbeobachtung) hat dafr keine Chance. Gepulste Quantenzustnde sind gleichzusetzen mit co dierter Energie und das ist identisch mit Information (Nachricht). In formation ist also die Unterbrechung einer Dauerbeobachtung (ent sprechend der frheren Erinnerung) und somit unterliegt das System einer wirkungsvollen Vernderung. Unsere Elektronen steuern uns, fhren uns ber die Gefhle - um eine Dauerbeobachtung vorzunehmen. Ulrich Warnke

Bewutsein, Gefhl und Glaube sind Teil des Geistes


An dieser Stelle des Buches haben wir fast alle Komponenten zu sammen, um einen Versuch zu starten, ber den Geist zu spekulieren. Wenn - wie dargestellt - jedes Elektron von jedem anderen Elektron wei, in welchem Zustand es sich befindet, und wenn jedes Elektron ber das Adressing-Verfahren (Bewutsein) jedes Elektron beeinflus sen kann, dann kommt dies einem universellen Geist schon recht nahe. Der Heilige Dionysius, ehemals Bischof von Athen, von Paulus zum Christentum bekehrt, schreibt: Es (das Bewutsein -der Urgrund allen Seins) ist in unserem Geist, in unserer Seele und in unserem Krper. Es ist im Himmel wie auf Erden. Und doch bleibt es sich selbst immer gleich. Es ist in und ber der Welt, gleichzeitig rundherum. Es geht ber den Himmel hinaus, wie berhaupt ber alles Seiende. Es ist alles, was existiert, Sonne, Gestirn, Feuer, Wasser, Wind, Tau, Wolke, Fels, Stein. Wir wollen zuerst untersuchen, wie der Geist mit unseren menschli chen Gehirneigenschaften zusammenhngt. Wir mssen uns darber klar sein, da jede Aussage ber unsere Welt letztlich immer nur eine Aussage ber geistige Phnomene darstellt. Nicht nur, weil (wie Theo

35

logen und Philosophen sagen) die ganze Welt vom Geist durchdrungen scheint, sondern weil unsere Gedanken, Gefhle, Vorstellungen, Erin nerungen - also geistige Prozesse - alles beurteilen. Teilhard de Chardin meint dazu: In jedem Teilchen, jedem Atom, je dem Molekl, jeder Materiezelle leben und wirken im Verborgenen die Allwissenheit des Ewigen und die Allmacht des Unendlichen Auf den Menschen bezogen ist der Geist bergeordnet der Gesamt heit der Gedanken, Gefhle und Empfindungen, die demjenigen Teil des Gehirns bermittelt werden, der bei Bewutsein ist. Der Begriff Bewutsein heit lateinisch conscientia, aus dem Verb scire wissen und cum = mit; also mitwissen.

Demnach sind bewute Menschen Mitwisser.


Zur Bedeutung, zum Sinn in der Welt kommt es allein deshalb, weil sinnlich wahrnehmungsfhige Wesen die Dinge beobachten, Verfesti gungen aus Energiekomponenten hersteilen, und dadurch aus den un zhligen Mglichkeiten kausal Pfade zur Realitt, eben zur Wahrneh mung bilden.

Ich-Bewutsein
Wenn ich mich von den Inputs aller Sinnesorgane abschotten, also vllig den Kontakt zur Auenwelt und zu meinem Krper verlieren wrde, so wre ich mir meiner dennoch bewut. Descartes: Ich denke, also bin ich. Jeder hat ein Gefhl fr sein Vorhandensein, fr seine pure Existenz. Gefhle laufen zwar unbewut ab, aber das Erleben eines Gefhls un terliegt dem Bewutsein. Das heit, sobald ein Gefhl mich in einem Lebensmoment steuert, durch Raum und Zeit lotst, ist das Bewutsein als Beobachter und damit als Verfestiger des Weges dabei. 36

Bewutsein ist der Kitt, der die Folgen von aktuellen Inputs wie Se hen, Riechen, Hren, Fhlen einerseits, und Gefhl, Erinnern anderer seits mit zeitlichem Handeln und Entscheiden zusammenhlt und so Realitt erzeugt. Gefhle sind dabei Meinstrumente, Empfehlungen um Entscheidungen zu treffen. Das Bewutsein erzeugt also die sub jektive Realitt eines Geschehens innerhalb der Raum-Zeit, und das aufgrund einer Empfehlung (=Gefhl), die selbst als handelnde Energie (Elektron mit Photonboten) raum-zeitlos empfindet (da sie mit Licht geschwindigkeit handelt). Wir alle stehen uns durch Gefhle nher als durch andere Merkmale, die vererbt werden. Dementsprechend liegen wir untereinander hinsichtlich der Hauptgefhle in dauernder Reso nanz. Unsere ganze Gesellschaft ist von dem Suggestionseffekt bei der resonanten bertragung der Gefhle gesteuert, sogar der Geldmarkt. Gefhle sind innerhalb aller Menschenrassen nonverbale primre Kommunikationsmittel. Sie steuern als Emotionen (bersetzt: nach auen bewegen) die Mimik, Lachen, Krperhaltung, aber auch den Tonfall der Sprache - tief und ruhig oder schrill und aufgeregt. Darber hinaus sind wir ber die Gefhlswelt mit Tieren und sogar mit unseren Vorfahren innerhalb der Evolutionskette verknpft. Wie sonst sollten Gefhle vererbbar sein? Im genetischen Bauplan des Gehirns ist das Wissen aus Millionen von Jahren gespeichert. Durch vielleicht 80 Jahre Erfahrungen verfei nert der Mensch dieses Wissen. Ohne das Vorwissen der Gene wrden wir in einer fr uns sinnlosen Datenflut rettungslos untergehen. Wir werden also bereits mit unendlich groem Wissen geboren, ebenso wie alle anderen Lebewesen. (Selbst die Fliege bertrifft mit ihrem Na vigationsvermgen den Bordcomputer eines Flugzeuges). Lernen in unserem jetzigen Leben brauchen wir nur die Anwendung des angebo renen Gefhls auf die Situation. Fr dieses Lernen benutzen wir Vor bilder; nicht nur die Eltern und Lehrer, sondern auch Idole und Schau spieler, Politiker, Freunde. Da diese Prgung dauernd variiert, entste hen dauernd neue Prferenzen, zum Beispiel als Mode. Auch Gesell schaftsziele wandeln sich aufgrund des beschriebenen Mechanismus. Jede menschliche Wahrnehmung ist in Gefhle gebadet, jedes Gefhl 37

weckt Erinnerungen. Gefhle sind Krfte in uns. Sie sind im krperei genen Mikrokosmos energetisch wirkend, und gleichzeitig Krfte zwi schen Individuen, fernwirkende Krfte. Derartige nah- und fernwirken de Kraftpotenzen finden sich nur in der Wirkung von Elementarteil chen. Im Zusammenhang mit diesem Kapitel ist von Bedeutung, da Gefhle unbewut da sind. Sie sind mit dem Willen nicht beeinflubar. Mit meinen Gefhlen sprechen kann ich nur so, wie sie entstehen, durch Bilder und Imaginationen. Soll ein Gefhl sich ndern, brauche ich stimmungsbeeinflussende Vorstellungen, Dfte (auch Pheromone), Musik. Damit ndert sich auch unbewut jedes Mal der Tonus des ve getativen Nervensystems, der Hormonhaushalt, die Aktivitt des Im munsystems und der Gehalt der Zelle an Energie (ATP), also so ziem lich alles, was meinen Organismus weitgehend automatisch funktio nieren lt. Der Wille ist dagegen rein bewut gesteuert und hat Zugriff auf die intellektuellen Gedanken und auf die Skelettmuskulatur. Der Glaube (gemeint ist alltgliches Glauben) verwendet beides: das Gefhl und den Willen. Damit verwendet Glauben sowohl das unbe wute Unterbewutsein, als auch das Bewutsein. Diese Kombination ist bei der Beeinflussung des Krpers die strkste und wirkungsvollste Kraft. Jedes Gefhl, jeder Gedanke, der im Glauben mndet, ist ein Ganzkrpergeschehen. Die Zellen aller Organe fhlen und wollen. Mein Glaube ist krpereigenes Wissen. Mein Wissen beruht auf Glau ben. Glaube heit fr jeden von uns, es ist. Wenn ich also glaube, ist der Inhalt meines Glaubens eine Realitt fr meinen Krper. Realitt ist das Gegenteil von Wahrscheinlichkeit. Also wird beim Glauben entspre chend den Kapiteln Bewutsein steuert die Materie und weiteren die Kraftwirkung der Photonen ausgelst. Das heit, die virtuellen Photo nen sind energetisch aufgepfropft worden, damit sie als reale Photonen, in Resonanz mit der Nachbarschaft, Information senden knnen; Mate rie wird somit beeinflut. Deshalb: Der Glaube kann Berge versetzen.

38

Nun entsteht nicht jedes Mal, wenn wir glauben, eine makroskopi sche Vernderung der Materie (das wre fatal), obwohl dies im Prinzip mglich sein sollte. Machen wir etwas falsch? Wie sieht der Glaube aus, den Jesus laut Bibel bei einigen Menschen induzieren konnte und der dann tatschlich Heilung bewirkte, also ma kroskopisch Materie vernderte? Gehe hin, Dein Glaube hat Dir ge holfen. Glaube als Werkzeug zur Kollabierung der Wahrscheinlichkeitswelle (Realittserzeugung) erlaubt keinen Zweifel. Zweifel ist mit purem Glauben nicht vereinbar. Ich mu fest berzeugt sein, mehr noch: Ich mu wissen, da die Erfllung einer Beziehung (Verfestigung) existiert. Der Vorgang, der Realitt werden soll, darf keinesfalls analytisch zer legt werden, sondern mu, entsprechend der Hierarchiesprache (gleichzusetzen mit Verfestigungs-Kette), als Ergebnis feststehen. So wie glauben am Willen partizipiert, so wird der Wille vom Glauben mit gesteuert. Die Besonderheit des freien Willens ist, da er aus dem Nichts heraus entstehen kann. Das heit, die Entscheidung etwas zu tun, zum Beispiel den Arm zu heben, entsteht ohne Reiz, also ohne auslsende Energiezufuhr aus einer bereits vorhandenen Nervenerre gung. Das ist hchst sonderbar. Dieser Vorgang erinnert an eine Paral lelitt im Quantenbereich des Vakuums, an die Aussendung von virtu ellen Photonen aus dem Nichts ohne jede Energiezufuhr. Bei einer Iso lierung des Systems im leeren Raum geschieht dies als Wellenfunktion ununterbrochen ohne materielle Konsequenz, sozusagen als Stand bySignal. Aber sobald in der Umgebung Resonanz in Erscheinung tritt, wird aus dem Stand by der Mglichkeit Realitt. Bei der Mglichkeit einer Resonanz ergeben sich augenblicklich materielle Konsequenzen in Form von Bindungskrften zwischen Atomen, zwischen geladenen Strukturen, also auch zwischen Moleklen. Demnach wre der freie Wille die Ausnutzung des Stand by der Mglichkeiten unter Verwen dung des Bewutseins, das wir bereits als Hersteller von Beziehungen und der Steuerung der Vakuumenergie bezichtigt hatten. Die freie Wil

39

le-Funktion Arm heben ist gestartet und luft ber angeborene Struktur-Resonanz-Verstrker-Kaskaden automatisch weiter. Der Einsatz des Glaubens und des Willens knnte demnach iden tisch sein mit der Steuerung der virtuellen/realen Photonenausscht tung aus Elektronen heraus mit Hilfe der Skalarfeld-Matrix, wobei die Steuerung selbst ein Kohrenzphnomen darstellen mte. Ein Hin weis fr die Richtigkeit dieses Modells knnte die Spin-Stellung der Teilchen und das Verhalten der Elektronen aufgrund des Glaubens des Experimentators sein (siehe Kapitel Bewutsein steuert die Materie). Gefhl, Glaube und Bewutsein sind Teil des Geistes. Doch wo ist nun der Geist? Entsteht er in meinem Krper oder ist er unabhngig von mir bereits vorhanden? Habe ich Zugriff auf den Geist auch ohne Krper? Ist vielleicht mein Ich ein holographischer Ausschnitt eines universalen Geistes? Diese Fragen werden nicht das erste Mal gestellt. Grob genommen gibt es zwei Anschauungen hierzu: 1. Reduktionismus: Bewutsein ist eine zwangslufige Folge der Aktivitt von Nerven zellen im Gehirn. Bewutsein (und/oder Geist) ist ein Produkt der Materie ab einem gewissen Grad von Komplexitt. Einfache Organis men haben aufgrund simpler Informationsstrukturen deshalb auch kein komplexes Bewutsein. 2. Dualismus (Eccles): Der Geist existiert unabhngig vom materiellen Gehirn. Uber seine Entstehung wei man noch nichts, aber er ist nicht von der Entstehung des Gehirns abhngig. Beide Ebenen - Geistebene und Gehirnebene wechselwirken miteinander. Das heit, der Geist kann die Aktivitt von Neuronen im Gehirn steuern und so zum Beispiel Muskelbewegungen auslsen. Umgekehrt kann er den Nervenzellen Information entneh men, beispielsweise ber momentane sensorische Inputs der Sinnesor gane. 40

Die zweite Anschauung erinnert sehr an unsere intelligenten un sterblichen Elektronen. Was ist nun richtig? Wir mssen uns an die Antwort herantasten. Zuerst einmal gibt es ein Miverstndnis, das beseitigt werden mu. Das Wort Bewutsein wird zu breit benutzt. Wir wollen differenzieren:

Tages-Bewutsein
Das Gegenteil ist Bewutlosigkeit. Wir wollen dieses Bewutsein beschreiben als ein Wahrnehmen (Spren) der Ttigkeit der Grohirnatome, die Wechselbeziehung mit Quanten unserer Materie und Quanten auerhalb des Krpers. Ort des Primrgeschehens des Tagesbewutseins sind wahrschein lich die Mikrotubulisysteme. Alle Zellen haben Mikrotubuli. Sie bilden kilometerlange Hohlrhren, die als Hohlraumresonatoren elektroma gnetische Schwingungen leiten knnen. Durch Ansthetika, also durch Betubung, werden Mikrotubuli-Leitsysteme auer Gefecht gesetzt wir verlieren unser Bewutsein, einschlielich bewuter Erinnerung. Das Tagesbewutsein wird hauptschlich durch meine Erfahrungen beeinflut. Erfahrungen korrelieren mit meinem Glauben - es entsteht ein subjektives Wissen, das einen es ist - Zustand fr meinen Krper darstellt. Glaube lt keinen Zweifel zu, er verfestigt das subjektive Wissen und die Realitt. Der so entstandene Zustand entspricht der Dauerbe obachtung eines Quantensystems, das keine Wahrscheinlichkeitswellen zult. Das bedeutet: Tagesbewutsein moduliert, determiniert und organisiert mit Hilfe aller Urkrfte, also mit diversen Energien, mit Materie und mit Resonanz - das erschafft die Realitt. Das Wort Realitt entstand ursprnglich aus res (Ding) und revi (denken), und kann bersetzt werden als: Alles, woran du denkst.

41

Realitt ist, was wir als wahr seiend denken. Und was wir als wahr seiend denken, als wahr (an) nehmen, bestimmt unseren Glauben. Was wir glauben, basiert auf unseren Wahr-Nehmungen. WahrNehmungen basieren auf ausgewhlten Beziehungen. Beziehungen werden ber Ziele gesetzt. Ziele beruhen auf unserem Denken. Was wir denken, wird durch das bestimmt, was wir wahr-nehmen. Was wir wahr-nehmen, bestimmt was wir glauben. Was wir glauben, halten wir fr wahr, nehmen wir fr wahr. Was wir fr wahr nehmen, ist unsere Realitt. Wir kommen nicht aus dieser Mhle heraus. Andere Autoren haben diese Spirale in ganz hnlicher Weise auch schon dargestellt. Realitt ist Glaube; Glaube ist subjektive Realitt. Daraus besteht unser Alltagsbe wutsein. Objektive Realitt gibt es fr uns nicht.

Schlaf-Traum-Bewutsein
Hier dominiert das Entkoppeln der Inputs. Es ist ein Wahrnehmen (Spren) der Eigenbeziehungen der Atome einiger Gehirnareale mit einem Teil angeschlossener Krper-Verbindungen. Viele dieser Verbin dungen vom Gehirn in meinen Krper hinein sind, ebenso wie die In puts einiger Sinnesorgane, abgekoppelt, zum Beispiel die Verbindung der Skelettmuskel (Innervation). Traumgeschehnisse sind genau so subjektive Realitt fr den Krper, wie das Tagesbewutsein. Um zu verhindern, da wir uns im Traum verletzen, wird die Gehirnsteuerung der Arm- und Beinmuskulatur abgeblockt. Deshalb knnen wir im Traum nicht herumirren (Ausnahme sind Schlafwandler), aber alle an deren Aktivitten des Krpers sind subjektiv real. Die Folge der Entkopplungen sind weniger makroskopische Reso nanzbeziehungen, weniger Materiebindung und dafr mehr Freiheits grade fr Resonanzen mit freien Elektronen, ausgehend von Nervenmembranen, also mehr Fernwirkungsmomente.

42

Nahtod-Bewutsein
Diese Form des Bewutseins ist gekennzeichnet durch noch weiter gehende Entkopplung des Geistes vom materiegebundenen Resonanz geschehen. Zustzliche Aktivitt freier Elektronen (Freier Radikale) findet statt. Das bedeutet entsprechend dem vorher Erwhnten: ver mehrte Aktivitt im universellen Raum-Zeitgeschehen. Es ist ein Wahrnehmen (Spren) der Bewutseinssphre der Atome und Elek tronen auerhalb der Krpermaterie. Der Kardiologe Michael Sabom hat systematische Untersuchungen zu Nahtoderfahrungen angestellt. Er hat dabei alle strengen wissenschaftlich-methodologischen Kriterien, die heute bei psychologisch relevanten Experimenten anzulegen sind, beachtet. Wenn Lebensvorgnge sich dem Tod zuwenden, dann wird das Bewutsein von seinem materiellen Substrat im Gehirn befreit. Die Erfahrungssammlung gelangt in ein neues Stadium. Nerven bekommen keine Energie mehr und stoppen ihre Arbeit. Das allerdings ist kein Beweis dafr, da der menschliche Geist damit aufhrt zu existieren. Energie und Gefhl sind verknpft. Um weiterhin nach dem Geist in uns zu suchen, wollen wir in uns hineinhorchen, um herauszufinden, wie ein Gedanke entsteht: Das Gehirn, in dem wir die Entstehung eines Gedankens erwarten, ist beschreibbar - Milliarden Nervenzellen, Synapsen und Transmitter zaubern etwas zurecht. Nehmen wir an, wir bauen so ein System tech nisch analog mit knstlichen Teilen exakt funktionierend auf und lassen dieses Robotersystem auf Reize antworten. Lebt dieses Gehirn dann? Hat es ein Bewutsein, ein Tages-, Traum-, Nahtodbewutsein? Wrde es sich freuen und rgern ber sensorische Eingaben, so wie das biologi sche Gehirn? Wenn wir der Meinung sind, da dem nicht so ist, dann mssen wir herausfinden, was also die Erfahrung des Geistes ausmacht, denn das ist es ja wohl, was uns von der Erlebniswelt des Roboters trennt. Versu chen wir es. Analysieren wir einmal in Zeitlupe, wie so ein bewutes Erlebnis durchgesteuert wird:

43

1.

2.

3.

4.

5.

Wir denken, erkennen gedanklich, gefhlsmig (A-Gefhl) ein Ziel, eine Situation, ein Geschehen, zum Beispiel die Trennung einer engen Beziehung. Jetzt entwickelt sich ein neues Gefhl (B-Gefhl), das motivativ bewirken soll, die Situation dem Krpergeschehen anzupassen, das Geschehen zu wrdigen (das Ziel zu erreichen), zum Beispiel im hier dargestellten Fall Traurigkeit. Aufgrund des B-Gefhls wird jetzt (evtl. auerhalb des Gehirns) Materie gesteuert; periphere Nervenaktivitt, Transmitteraus schttung mit hoher Verstrkerwirkung, zum Beispiel werden Trnen gebildet und ausgeschttet, wir weinen. Aufgrund der Materiesteuerung mit Transmitterausschttung er geben sich Folgegefhle durch aktivierte Hormone im FeedbackLoop (C-Gefhl), zum Beispiel Erleichterung. Das Erleben und Wahrnehmen der Beziehungen 1. bis 4. wird zur Erfahrung.

Wir suchen nach Parallelen zwischen unserer Gefhlswelt und dem Quantengeschehen. Dabei stellen wir fest: nicht viel anders, als die oben aufgezeigten Geschehnisse 1. bis 5. verluft die Elektronenkom munikation aufgrund der Absorber-Theorie. Tatschlich haben Gefh le, Glaube und Geist einerseits und Elektron/Quant andererseits ver blffende Parallelen. Gefhle, Glaube und Geist unterliegen quanten mechanischen Gesetzen: Unschrfen, Komplementaritten, Quanten sprngen, Nichtlokalitten. Die Unschrfe knnen wir selbst auspro bieren: Stellen wir uns die Aufgabe, unser momentanes Gefhl zu ana lysieren. In dem Augenblick, in dem wir das machen, ist das Gefhl pltzlich verschwunden und hat einem neuen Gefhl Platz gemacht einer Art Neugier oder Motivation. So wird es uns immer ergehen. Ein Gefhl lt sich durch den Intellekt nicht bestimmen. Konzentrieren wir uns dagegen auf eine rein intellektuelle Handlung, dann werden die Gefhle verdrngt. Gefhl und Intellekt sind komplementr, es gilt die Unschrfe. Diese Unschrfe ist ber die Messung des Widerstandes an Schweidrsen sogar gut mebar.

44

David Bohm hat ein hnliches Beispiel: Wenn wir uns auf den Inhalt eines Gedankens konzentrieren, dann verlieren wir die Richtung aus dem Auge in die der Gedanke gerade gehen will. Konzentrieren wir uns allerdings auf die Richtung des Gedankens, sehen wir seinen Inhalt we niger genau. Ein Gefhl und eine Empfindung sind zwei vllig ver schiedene Vorgnge. Ein Gefhl wird nicht wahrgenommen, es ist ei genstndig agierend. Bei einer Empfindung wandern Elektronen von einem Ort zu einem anderen. Die Empfindung entspricht einer quan tenphysikalischen Ortungsmessung mit dem Wahrnehmungsapparat. Erinnern wir uns nochmals an das Modell, wonach Elektronen unter anderem uns Menschen aufbauen, um Erfahrungen zu sammeln. Fr uns Menschen (und fr Elektronen in uns) gibt es zwei Arten von Er fahrungen. a) Erfahrungen, wie sie bewut seit unserem hheren Embryostadi um gesammelt werden, b) Erfahrungen, die Jahrmillionen in die Vergangenheit reichen und als Erlebnisse unserer Vorfahren via Gefhlswelt vererbt werden. Diese Erfahrungen wirken im tglichen Leben unbewut als perma nente Gefhlsinduktoren und verwenden Symbolsprache.

Psychosomatik
Wir sind gewohnt, mit der Sprache zu kommunizieren. Worte haben Bedeutung, und das wird umgesetzt in Sinn und Aktion. Elektronen in uns produzieren zwar die Sprache und entschlsseln den Sinn, sie kn nen aber nicht direkt mitreden. Wenn Nachrichten von Elektronen direkt durchgesteuert werden sollen, gelingt dies durch das Gefhl. Wenn ich das Gefhl der Mattigkeit oder Erschpfung als Aufforde rung verstehe, werde ich, falls mglich, mit einer Entspannungspause antworten. Mache ich das rechtzeitig und ausreichend, so wird das Ge fhl gelscht und macht einem anderen Gefhl Platz, wie Leistungsbe reitschaft und Motivation, was wieder zu einer Antwort des Krpers fhrt. Die Unschrfetheorie ist anwendbar auf die Gefhlswelt: Intel lektuelles Denken und Gefhle schlieen sich aus, wie mit dem soge

45

nannten Lgendetektor mebar ist. Wir haben das Methodenprinzip optimiert und unser Gert zeigt jede Gefhlsregung an. Die Anzeige luft Richtung neutral, wenn dem Probanden (Versuchsperson) eine leicht zu bewltigende intellektuelle Aufgabe abverlangt wird.

Was ist Trger dieses Geschehens?


Wir wissen aus der Quantenphysik: Die Lage eines Objekts im Raum ist seinem Impuls komplementr. Um also zu erkennen, wo ein Ding ist, mu man auf die Erkenntnis verzichten, wie es sich bewegt und in welche Richtung es sich bewegt. Zwischen Impuls und Wellenlnge eines Quants existiert der gleiche Zusammenhang, wie zwischen Energie und Schwingungsdauer: 1/Wellenlnge = rumliche Frequenz (k) = Impuls; (I = hk) 1/Schwingungsdauer = zeitliche Frequenz (f) = Energie; (E = hf)\ h ist die Planck-Konstante (Wirkungsquantum). Wir knnen daraus das Analoge fr unsere Gefhlswelt ableiten: Gefhle entsprechen dem Impuls und der Energie. Gefhle sind elek tromagnetische Schwingung. Intellekt entspricht der Orientierung im Raum, der Ortsgenauigkeit. Weiterhin ist bekannt: Zeit ist nur bestimmbar, wenn die Energie unbestimmt bleibt und umgekehrt. Fr die Psyche gilt entsprechend den Ergebnissen der Methode Lgendetektor. Intellektuelles Denken ist nur bestimmbar (festlegbar), wenn Gefhle unbestimmt bleiben und umgekehrt. Analogisieren wir diese beiden Aussagen, dann folgt: Zeit und Ort = (intellektuelles) Denken.

Energie und Impuls = Gefhle


Wir wissen bereits aus unserer eigenen Erfahrung: Denken verluft folgerichtig, logisch, das heit, in der Zeit hintereinander und im Raum adquat. Gefhle dagegen steuern unsere Energie. Da Gefhle - wie 46

eben aufgezeigt selber mit Energie gleichzusetzen sind, funktioniert dies vllig problemlos. Die nderung der Zell-Energie korreliert mit der nderung eines Gefhls. Die nderung eines Gefhls korreliert mit der nderung der Zell-Energie. Energietransformation heit daher Gefhlstransformation. Ist die vorhandene Energie deutlich geringer als die fr die psychi sche Bewltigung der Situation notwendige Energie, dann wird das Gefhl nicht nur rechnerisch negativ, sondern auch psychisch. Das hat Konsequenzen fr alle Krperfunktionen. Wenn der Zustand ber ln gere Zeit anhlt, dann sieht die Zukunft fr den betroffenen Organis mus nicht gut aus. Negative Gefhle wirken nachweislich destruktiv, vor allem auf das Immunsystem. Ein niedriger Zellenergie-Level hat auch aus einem anderen Grund massive Auswirkungen auf die Psycho somatik (siehe auch Risiko Wohlstandsleiden): Unsere vegetativen und hormonellen Regulationen verlaufen normalerweise weitgehend automatisch ber Regelkreise. Gut funktionierende Regelkreise benti gen zur Stabilitt die laufende Zufuhr hoher Energiebetrge, und das ber die gesamte Regelkreisstrecke an jeder Stelle. Fllt nur an einer Stelle die Energieproduktion und Zufuhr aus, dann ist der Regelkreis nicht mehr geschlossen und ist auf Hilfe angewiesen oder bricht vllig zusammen. Gefhl und Glaube sind Teil der Psyche, also des Verhal tens. Die Psyche mit Gefhl und Glaube ist physiologischerweise ein starker Modulator der Regelkreisenergie. Ein stabiler Regelkreis lt sich durch die Psyche nicht durcheinanderbringen. Vllig anders ist ein energetisch geschwchter Regelkreis. Hier bernimmt fast ausschlie lich die Psyche das Sagen. Wenn also die Zellenergie ATP zur Auf rechterhaltung von Resonanzfunktionskreisen (das ist nichts anderes als ein Regelkreis) weniger wird, dann kommen die Psychokrfte str ker ins Spiel. Mit dem ganzen Register, das der Psyche zur Verfgung steht, kann dann zwischen Angst, Unruhe, Nervositt und - wenn strategisch trainiert - Gelassenheit, Selbstwertgefhl und Ruhe hinund hergeschaltet werden mit allen Folgeerscheinungen. Da mit hhe rem Alter die Regelkreise aufgrund von Energiemangel instabiler wer

47

den, ist bei lteren Menschen der Einflu der Psyche, der Gefhle, des Glaubens und - daran gekoppelt - der Erinnerung deutlich strker als bei jungen Menschen. Zu diesem Zeitpunkt besitzen die Alteren durch viele Jahre an Erfahrungen mehr oder weniger Weisheit. Sie gnnen sich durch mehr Erinnerung und Imagination vorrangig gute Gefhle, die der Regelung des Krpers nun zugute kommt. Die Verinnerlichung ist die Vorbereitung zum Ablsen von der Realitt, der Materiebildung und eine Hinwendung zur Energie. Alte Kulturen und Naturvlker weisen diesen Weg auf. Dieser Zusammenhang ist heute offensichtlich allgemein nicht erkannt worden, denn bei jungen und alten Menschen nehmen gleichermaen psychosomatische Funktionsstrungen rapide zu. Haben sich die Betroffenen in eine Angstspirale eingeklinkt, dann wird die Auenwelt abgeschottet, da die Krpersensationen aufgrund des Angstgefhls die ganze Aufmerksamkeit binden und damit unwei gerlich die Verfestigung bewirken. Ein Ausklinken aus der schdigen den Spirale ist nur mglich, wenn das Krperinteresse auf Auenkurs gebracht werden kann. Dann ergibt sich die Chance, da das Angstge fhl ausgetauscht wird, gegen Neugier, Explorationsdrang, Motivation und Interessen. Das heit, zur Auenwelt hin werden neue Realitten geschaffen, und die Dauerbeobachtung der Angstfolgen, die immer die Ausbreitung einer neuen Wahrscheinlichkeitswelle blockiert, wird ab geschaltet. Wenn alles gut geht, kann nun die Innenwelt auf einer fri schen Energiewelle laufen. Auch die Dominanz des negativ-psychisch kontrollierten Eigenfeedbacks wird abgebaut. Alles luft automatisch harmonisch bis zum nchsten Anfall. Die betroffenen Menschen sp ren intuitiv, da es etwas gibt, was ihnen die notwendige Ruhe bringen kann, knnen es aber nicht greifen. Weitgehend unbekannt ist auch, da es angeborene Glcksgefhle mit archaisch bestimmten Merkmalen gibt: Duft von Heu (Cumarin), grne Vegetation, klares und pltscherndes Wasser, Vogelgezwitscher... In Unkenntnis dessen, was ihnen fehlt, hngen die Menschen sich an

48

die Esoterik. Zweifellos nutzen die Gurus dieser Welle geschickt die natrliche Sehnsucht der Menschheit nach bersinnlichem aus, oft zum eigenen kommerziellen Vorteil. Unabhngig davon mu man sich fragen, ob die Sehnsucht nach Kenntnis der Krfte, die hinter unseren Lebensphnomenen stehen, nicht ernster genommen werden mu. So, wie das ganze Gebiet sich darstellt, knnte mglicherweise vielen Men schen in psychischer Not geholfen werden. Kehren wir nun zurck zur Projektion unserer Gefhlswelt aus der Quantenwelt heraus.

Was also ist der Geist?


Aus allem, was wir uns bisher spekulativ erarbeitet haben, ist folgen de Erklrung des Geistes plausibel: Der Geist ist die sich laufend verstrkende Asymmetrie in der Matrix des Subquantenfeldes und der Raum-Zeit (analog Gravi tation, analog Skalarfeld, analog Higgs-Feld). Der Geist ist eine intelligent sich fortentwickelnde Strung der Gleichfrmigkeit dieser Felder. Der Geist wirkt im Vakuum und baut Materie, einschlielich uns Organismen auf, um vielfltige Erfahrungen zu bercksichtigen. Der Geist hat Zugriff auf die Gesamtheit aller Elektronen.

In dieser Sichtweise sind wir Teil des Geistes und sind deshalb an seiner Universalitt beteiligt. Das Bewutsein ist allgemein der aktuelle Zugriff auf die Schaltstelle im Vakuum zur Herstellung von Beziehun gen und Erzeugung der Realitt. Die Gedanken und Vorstellungen sind die Momente, in denen in unserem Krper energetisch die virtuelle Welle zur Realitt, zur Manifestation aufgeladen wird (Spin-Beeinflus sung).

49

Der Wille adressiert die Angebotswelle und akzeptiert die Bestti gungswelle. Das heit, er dirigiert das Resonanzziel und die Reflexion, also das Feedback. Der Glaube, das krpereigene Wissen, die Erfah rung, manifestiert und verfestigt Quelle und Ziel einer Interferenz schwingung, reprsentiert also den Ist-Zustand durch eine Art Dauer beobachtung. Der Neurologe Bacsi Laszlo meint, da wir nur sensibel fr Quanten-Vakuum-Wechselwirkungen sind, wenn chaotische Mo mente und nicht stabile Regelmomente vorherrschen. Diese Meinung stimmt mit meiner Darstellung berein. Wenn stabile Regelkreise vor liegen, kann es keine Vernderung durch Einwirkung geben, da feste Resonanzbeziehungen (Verfestigungen, Beobachtungen) existieren. Drogenkonsum schafft Chaos in den mit Hilfe der DNS geordnet auf gebauten Organismus. Neue, ungebahnte Resonanzmglichkeiten wer den mglich. Deshalb werden beim Drogenkonsum vermutlich die Chancen zur Einwirkung in die Vakuumenergie erhht. Es sind nun zwei Mglichkeiten denkbar in der Beherrschung der Vakuumenergie: 1. Wille und Glaube des Individuums regeln selbstndig mit Hilfe des Gehirns die Energiezufuhr in das Vakuum, wobei ber den Vakuumschalter aus den vorhandenen, dauernd tastenden vir tuellen Quanten reale gemacht werden. In der Folge ergibt sich Realittsbildung (das entspricht einer Weiterfhrung des Reduk tionismus). Wille, Glaube, mglicherweise auch Gefhlskrfte sind Teile des Geistes und universell bereits vorhanden. Zur Steuerung der Va kuumenergie werden diese Muster mit Hilfe des Gehirns, als eine Art Kanalisierung, zum Nutzen des Individuums verwendet (das entspricht in etwa Eccles Vorstellungen, also einer Weiter fhrung des Dualismus).

2.

Welche dieser beiden Mglichkeiten stimmt, kann unmglich heute festgelegt werden. Alte Traditionen favorisieren die 2. These. Und wenn man daran denkt, da mehrere Nobelpreistrger und Erfinder 50

berichten, da ihnen der entscheidende Fortschritt ohne jede intelli gente Anstrengung, manchmal sogar im Traum ein-gefallen ist, dann ist die Vorstellung eines universell vorhandenen Geistmusters, das Wis sen und Glauben hervorbringen kann, nicht einmal ganz abwegig. Eini ge Zitate bedeutender Physiker zu diesem Komplex: Sarfatti: Wir haben erkannt, da Bewutsein und Energie eins sind... Jung: Psyche und Materie sind aus demselben Stoff. Eddington: Der Stoff der Welt ist Geist-Stoff. Jeans: Nimmt man die unterschiedlichen mglichen Beweisfhrungen zusammen, wird es immer wahrscheinlicher, da Realitt mit geistig treffender beschrieben wird als mit materiell. Das Universum scheint einem groen Gedanken hnlicher zu sein als einer groen Maschine. De Broglie: Physik, Metaphysik, Fakten und Ideen, Materie und Be wutsein sind ein und dasselbe. Planck: ...es gibt keine Materie, sondern nur ein Gewebe von Energi en, dem durch intelligenten Geist Form gegeben wird... Heisenberg: Die bliche Teilung der Welt in Subjekt und Objekt, In nenwelt und Auenwelt, Krper und Seele ist nicht mehr angemessen. Wenn unser Bewutsein im Experiment Spins ausrichten kann, dann heit das physikalisch, da unser Bewutsein Krfte sogar ber die Grenzen unseres Krpers hinaus dirigieren kann. Sind wir Wesen mit freiem Willen, die das Universum erkunden wollen, oder sind wir nur Werkzeuge, mit deren Hilfe das Universum sich selbst erkunden will? (vergl. Gribbin u.a.) Einstein: Jeder, der sich ernsthaft mit der Wissenschaft beschftigt, ge langt zu der berzeugung, da sich in den Gesetzen des Universums ein Geist manifestiert - ein Geist, der dem des Menschen weit berlegen ist, und angesichts dessen wir uns mit unseren beschrnkten Krften demtig fhlen mssen. 51

Wheeler: Wir erschaffen zwar subatomare Teilchen, und damit das ganze Universum - aber umgekehrt erschaffen sie auch uns. Eins erschafft das andere im Rahmen einer selbstregulierenden Kosmologie. Grobdarstellung: Teil des Geistes sind Gedanken, Vorstellungen, Gefhle und der Glaube. Der Geist kann Spin-Einstellungen beeinflussen. Die Energie, die notwendig ist, um Spin-Einstellungen zu beeinflussen, kann in be stimmten Fllen 10-13 mal kleiner sein, als bisher allgemein zu anderen Beeinflussungen verwendet. Ort der Energiebertragung ist das Vaku um. Elementare Wirkung der Beeinflussung: Aus virtuellen Energie phnomenen werden durch Energiezufuhr und Aufpfropfung auf virtu elle Photonen reale Zustnde. Die Beeinflussung der Vakuumenergie durch Gedanken, Vorstellun gen, Gefhle und Glauben funktioniert ber die Grenzen unseres Kr pers hinaus. Ursache fr die Fernwirkung ist die Nichtlokalitt. Nichtlokalittseffekte lassen sich mit Feynmans Absorbertheorie erkl ren. Sie werden besonders effektiv durch Kohrenz (Doppel- oder Mehrphotonen mit jeweils entgegengesetzten Spin-Ausrichtungen, die in der Summe null ergeben und eine Einheit darstellen). Modell der Verfestigungs-Kaskade (Realittsbildung) unter Beteiligung des Be wutseins Feindarstellung: Gedanken sind potentiell eingeprgt im Higgs-Feld (Subquantenfeld, Skalarfeld). Gedanken werden von Elektronen getragen, die ihre Eigen schaft verndern, zum Beispiel ihre Bewegungsrichtung, Polarisation, Spin. Die nderung der Eigenschaften der Elektronen ist mit der Aussendung von realen Photonen verbunden, die vorerst als kugelfr mig sich ausbreitende, elektromagnetische Schwingung betrachtet wer den mssen. Elektromagnetische Schwingungen breiten sich als Welle kugelfrmig aus und erhhen damit raumbergreifend die Wahrschein lichkeit auf Absorptionsstrukturen, auf Resonanz zu stoen. Die Welle trifft auf virtuell aktive, kurzlebige Vakuumeruptionen, die zum Teil in 52

Polarisation und Frequenz in Resonanz mit der eintreffenden Welle liegen. Es findet eine Energiebertragung statt. Die virtuell aktive, kurzlebige Vakuumeruption wird durch die Energieaufladung zu einer elektromagnetischen Welle mit Fernwir kung, die ihrerseits Elektronen anregen kann. Alle Elektronen knnen antworten. Durch die Echoaussendung der neu angeregten Elektro nen (avancierte Welle in die Vergangenheit) kommt es zur Verfesti gung, zur Realitt. Die Auswahl der geeigneten Elektronenkonfigura tionen, das heit, die Einengung der Mglichkeiten, geschieht durch Adressing. Der Verfestigung liegt primr eine Spin-Feinausrichtung zugrunde. Die Fernleitung im Organismus verluft konduktiv von Molekl zu Molekl mit jeweiliger Verstrkung ber die vorher darge stellte kugelfrmige Wellenausbreitung. Die molekulare Wirkung be steht im ffnen spezifischer Tore, wodurch eine Schar weiterer Si gnalgeber freigesetzt wird (zum Beispiel Neurotransmitter). Jeder Neu rotransmitter ist Sender neuer elektromagnetischer Wellen und bewirkt vielfltig weitere Verstrkung, das heit, da diverse Antennen reagie ren. Dieses Prinzip kann wieder und wieder fortgesetzt werden. Da durch entstehen makroskopisch projizierte Wirkungen. Warum nimmt das Gehirn eine Schlsselposition ein? In jedem menschlichen Gehirn befinden sich mehr als 1015 organische Gromo lekle. Allein in der Hirnrinde befinden sich pro Kubikzentimeter etwa sechs Kilometer Nervenleitung. Es gibt 10 Milliarden Hirnzellen, jede hat durchschnittlich 10.000 Verbindungen. Mglicherweise verlieren wir tglich 10.000 dieser Zellen, was bedeutet, da in 24 Stunden mehr als 100 Millionen Netzverbindungen ausgelscht werden. Im Alter macht sich der Verlust schlielich bemerkbar. Gliazellen (Glia, griech. Klebstoff) sind 10 mal mehr vorhanden als Nervenzellen. Die Gliazellen spielen sowohl im Gedchtnis, als auch als immunkompetente Zellen eine Rolle. Das Gehirn entspricht 2% unse res Krpergewichts, verbraucht aber 20% des aufgenommenen Sauer stoffs. Der Energieverbrauch betrgt zirka 20 Watt. Man kann leicht errechnen, da ein Gehirn in der spezifischen Dichte der Energieum wandlung 100.000 mal intensiver arbeitet als unsere Sonne. Bei einer 53

Gehirnmasse von 1,35 kg verarbeitet das Gehirn freie Energie mit einer Dichte von 20 Watt/1,35 kg; also betrgt die spezifische Dichte 15 Watt/kg. Die Sonne dagegen verwandelt nukleare Energie in elektro magnetische Strahlung mit der spezifischen Dichte von nur 0,2 mW/kg Sonnenmasse. Gehirnzellen sind Gliazellen und Nervenzellen. Was zeichnet eine Nervenzelle aus? Nervenzellen sind Zellen mit relativ langen Fortst zen. Diese Fortstze vergrern die Oberflche der Zelle. Die Oberfl che wird von funktioneilen Membranen reprsentiert. Die Membranen sind zur Abgabe niedrig gepulster Hochfre quenzschwingung fhig, die lokal kohrent ist. Stellen Sie sich einen Weihnachtsbaum im abendlich erleuchteten Stadtzentrum mit vielen knstlichen Lichtern vor. Wenn alle Kerzen zufllig durcheinanderblinken, dann ist der Weihnachtsbaum mit zu nehmender Entfernung im Lichtermeer der vorberfahrenden Autos bald nicht mehr erkennbar. Wenn aber 99% aller Kerzen zufllig anund ausschalten, dagegen 1% synchron als Gruppe blinkt, so werden wir die Gruppe noch aus groer Entfernung klar vor dem Hintergrund identifizieren knnen. Wenn ein groes Neuronenkollektiv im selben Takt, also kohrent funkt und sich mit einer anderen Neuronenkollek tivsendung berlagert, dann ergeben sich momentane Superpositionen. An den Stellen, bei denen sich alle Felder aufaddieren, wird es am hell sten (das bedeutet: hchste Leistung). Diese Muster sind das jeweilige Abbild subjektiver Wirklichkeit. Im gesamten Gehirnbereich befinden sich deshalb dauernd leistungsstarke Interferenzmuster. Gezielt modu liert wird diese von Membranen ausgehende Hochfrequenzschwingung von vielfltigen elektromagnetischen Schwingungen, die zustzlich von Neurotransmittern ausgehen. Das sind spezielle Molekle, die winzige Spalten zwischen den Fasern berbrcken. Whrend die berlagerun gen aller niederfrequenten Pulse im Gehirn als Elektroenzephalogramm (EEG) abgegriffen werden knnen, analog zum Elektrokardiogramm des Herzmuskels, werden die Hochfrequenz-Schwebungen bisher unbeachtet gelassen.

54

Die Methode zur gngigen Untersuchung der elektromagnetischen Eigenschaften des Gehirns ist dringend erweiterungsbedrftig. Die Signale des Herzens werden neuerdings auf Hochfrequenzanteile un tersucht mit einer unerwartet hohen Ausbeute an Zusatzinformation. Das wre auch beim Gehirn zu erwarten. Die Methoden befinden sich aber noch im Versuchsstadium. Gruppen von Neuronen feuern chao tisch. Das heit, dem Aktivittsmuster liegt eine verborgene Ordnung zugrunde. Wie alle chaotischen Systeme reagieren die Muster extrem empfindlich auf geringste Einflsse. Mit anderen Worten: Das Gehirn ist ein Konglomerat aus Schwin gungsmustern und Photonen/Quanten unterschiedlichster Energie mit der Tendenz zum pltzlichen Umkippen des Musters. Da diese Schwingungsmuster und Energien von wasserhaltigen Geweben absor biert werden knnen, gibt es Hohlleiterresonanzsysteme, welche die Energien kanalisieren und an die richtigen Zielstrukturen leiten. Nach Hameroff schaltet Ansthesie das Bewutsein dadurch aus, da die Bewegung von Elektronen in den Mikrotubuli gehemmt wird. Die Gehirnhlften der Hirnrinde verarbeiten Informationen verschieden. Die linke Hirnhlfte versucht die ankommende Information in Worte und Zahlen zu strukturieren und in die Zeitachse einzuordnen (ent spricht in unserer Darstellung dem rationalen Denken). Die rechte Hirnhlfte erzeugt aus den hereinlaufenden Informationen Bilder und weist den Bildern einen zeitlosen Raum zu (entspricht in unserer Dar stellung dem Gefhl). Zwischen beiden Gehirnhlften befindet sich ein dickes Verbindungskabel mit 250 Millionen einzelnen Verbindungsfa sern. Das Vorderhirn fungiert als Regieanleitung der Kommunikation zwischen beiden Hlften. Zwischen den Hirnhlften gibt es also eine Arbeitsteilung, die einerseits relativ streng Gefhl, Intellekt, Raum und Zeit auseinanderhlt, und andererseits diese Komponenten - ber das Vorderhirn gesteuert - verknpfen kann. Gefhl ist der elektromagne tischen Schwingungsenergie zuzurechnen, der Intellekt knpft direkt an Raum und Zeit, also an die Gravitation. Der Glaube, der sich sowohl des Gefhls als auch des Intellekts bedient, hat Zugriff auf die Energie

55

und fixiert einen Ist-Zustand in der Zeit, sozusagen als Dauerbeob achtung und Verfestigung. Das Limbische System ist der Gefhlsgenerator mit Zugriff auf alle Steuersysteme, die das Leben automatisieren knnen. Keiner von uns macht sich klar, was Gefhle als Manifestation im Gehirn eigentlich sind. Verfestigt werden Gefhle von einem aktuellen Mosaik bestimm ter Molekle - den Neurotransmittern (und Neuropeptiden). Diese Molekle werden freigesetzt aufgrund einer bestimmten Reizund/oder Erregungskonstellation des Neuronengeflechts, bevorzugt im Gehirn und im daran angeschlossenen Immunsystem. Die Neurotransmitter beinhalten Information, die an spezifischen Rezeptoren abgesetzt und in der Folge gelesen werden knnen. Jeder Transmitter hat seine ureigene Botschaft. Die Information ist - wie sollte es anders sein - als elektromagnetische Schwingung codiert. In jedem Moment werden so an Milliarden Stellen gleichzeitig in nerhalb unseres Gehirns elektromagnetische Signale ausgesandt. Alle elektromagnetischen Signale sind mit einem Feld verbunden. Alle Fel der berlagern sich gegenseitig, wodurch in jedem Augenblick ein ein maliges Interferenz-Hologramm entsteht. Dieses Hologramm, das auf Krften beruht, dirigiert die elektrischen Ladungen, also vor allem die freien Elektronen im Gewebe. Wer und was kann Hologramme abtasten und dadurch das Gesamt system erkennen? Sucht man die Antwort auf diese Frage, landet man entsprechend dem bisher dargestellten - unweigerlich bei den freien Elektronen. Sie knnen, verglichen mit Ionen, am schnellsten Reagie ren, um alle pltzlichen nderungen des Musters nachzuvollziehen. Elektronen sind imstande, alle Nachbarelektronen, die mit ihren be sonderen Zustnden das Hologramm nachkonstruieren, zu konsultie ren und insgesamt mit Angebotswellen abzutasten. Jedes Elektron, das den Abtaststrahl akzeptiert, sendet seinerseits einen Bericht ber seinen spezifischen Zustand innerhalb des Hologramms zurck als Bestti gungswelle. So wei jedes freie Elektron ber fast jedes andere freie

56

Elektron Bescheid. Damit entsteht fr alle die bersetzung des Origi nals vom Hologramm. Es gibt einen vagen Hinweis darauf, da dieses Abtasten als Vorleistung zum Bewutwerden tatschlich existiert. Libet und Feinstein (San Francisco) erhielten ein aufregendes Ergeb nis ihrer Experimente: Das Gehirn beginnt bereits bis zu 1,5 Sekunden bevor die Versuchsperson eine einfache willkrliche Handlung vor nimmt - wie beispielsweise eine Hand zu heben - entsprechende Wel len auszusenden, und dies vllig unbewut. Das Bewutwerden der Entscheidung passiert erst 2/10 sec vor Be ginn der Bewegung. Nur in dieser extrem kurzen Zeit des Bewutwer dens kann der Handlungsimpuls noch gestoppt werden. Die Interpretation dieses Ergebnisses ist: Die Absicht zu handeln entsteht aus einer Aktivitt, die nicht Teil unserer bewuten Wahrnehmung ist. Und: Das Bewutsein ist der Wchter ber die vom Gehirn erzeugten Absichten. Das pat zu meiner vorher vertretenen Interpretation, wonach das Bewutsein lediglich dem Zugriff zur Steuerung der Vakuumenergien entspricht.

57

MOLEKLE DER GEFHLE


Ein neues Modell des Informationsaustausches: In den sechziger Jahren konzentrierte man sich in der gerade entstehenden Disziplin der Neuropharmakologie auf die Neurotransmitter, die von Nervenendi gungen freigesetzt werden, die Synapsen berwinden und einen neuen elektrischen Impuls auslsen. Dieses Geschehen spielt sich in einem fest verdrahteten (Neuron-zu-Neuron) Punkt-zu-Punkt-Schaltschema von hin- und herwandernden Nervenimpulsen ab. Man nahm an, da alle Gehirnfunktionen, selbst auf den hchsten Ebenen geistiger Ttig keit, durch die synaptischen Verbindungen zwischen Milliarden von Neuronen bestimmt wrden. Danach bilden die Synapsen die Netz werke und definieren die neuronalen Schaltkreise, deren Aktivitt, wie man meinte, jeden Aspekt der Wahrnehmung, Integration und Lei stung bestimmt. An der Synapse schienen das elektrische und das che mische Hirnmodell miteinander zu verschmelzen. Es gab keine Diskre panzen, nur verblffende bereinstimmungen, als die Neurochemie, die neue Disziplin der Neurotransmitter-Kartierung, die Existenz der zuvor im Gehirn entdeckten neuroanatomischen Schaltkreise zu best tigen und neue zu entdecken schien. Beispielsweise hatten Arvid Carlson und seine Kollegen eine Methode zur Sichtbarmachung der Norad renalin enthaltenden Nervenendigungen im Gehirn entwickelt. Mit Hilfe des neuen Verfahrens konnten sie erkennen, da eine Ansamm lung bislang unsichtbarer Zellkrper im Rautenhirn (Locus caeruleus) ihre noradrenalinhaltigen Nervenendigungen ins Vorderhirn projiziert und da alles Noradrenalin im Vorderhirn aus dieser einen Quelle stammt. Weiter zeigte der Psychologe Larry Stein von Wyeth Labs und dem Bryn Mawr College, da das Lustzentrum einen Hirnbereich umfat, der bei elektrischer Stimulation Ratten (und Menschen) in einen berreizten Lustzustand versetzt, der sie ihr Bedrfnis nach Nah rung und Schlaf vergessen lt. Was die Forscher damals nicht wuten: Die Wirkung der elektri schen Reizung beruhte darauf, da sie entlang dieser Bahn die Freiset zung von Noradrenalin an den Nervenendigungen hervorgerufen hatte. Wie nachgewiesen werden konnte, verdanken auch Amphetamine und 58

Kokain ihre Wirkung der Verstrkung dieser Lustbahn, indem sie die Rckspeicherung des Neurotransmitters Noradrenalin blockieren und ihn dadurch zu viel grerem Kontakt mit seinen Rezeptoren veranlas sen, die man damals alle an der Synapse vermutete. Dies war einige Jahrzehnte lang der Stand der Dinge: Die Neurochemiker verifizierten und verfeinerten die Arbeit, die zuvor von den Neuroanatomen gelei stet worden war. Wie sich spter herausstellen sollte, war dieses jedoch zu einseitig betrachtet. In weiterer Folge kristallisierte sich eine neue Theorie des Informa tionsaustausches heraus. Sie berschritt die Grenzen des festverdrahte ten Nervensystems und konzentrierte sich auf eine rein chemische, nichtsynaptische Nachrichtenbertragung zwischen Zellen. Das US-Labor am National Institute of Mental Health (NIMH), das auf die Neuropeptide spezialisiert war, hatte nicht nur ihre Rezeptoren im gesamten Gehirn lokalisiert, sondern Anfang der achtziger Jahre auch ein neues autoradiographisches Verfahren erfunden, mit dem sich feststellen lie, wo die Neuropeptide gebildet wurden. Dank dieser Technik war es mglich, ein sehr viel umfassenderes Bild zu erhalten. Als David Miles die neu gewonnenen Daten ber zahlreiche Neuro peptide und ihre Rezeptoren untersuchte, ergab sich eine Nichtberein stimmung zwischen den neu gewonnenen Ergebnissen und dem bishe rigen Modell. Es stellte sich nun die Frage: Wenn Peptide und ihre Rezeptoren ber den Synapsenspalt mitein ander kommunizieren wrden, dann drften sie nur durch winzige Abstnde getrennt sein. Doch ihre Anordnung entsprach dieser Er wartung keineswegs. Viele der Rezeptoren befanden sich weit entfernt, durch viele Zentimeter von den Neuropeptiden getrennt. So blieb es zu hinterfragen, wie ihre Verbindung zustande kam, wenn es denn nicht ber den synaptischen Spalt geschah. Miles gelangte zu der berzeugung, da der grte Teil der Information, die im Ge hirn umluft, nicht von den synaptischen Verbindungen der Gehirn zellen, sondern von der Spezifitt der Rezeptoren organisiert wird - mit anderen Worten, von der Fhigkeit der Rezeptoren, nur an einem Li 59

gandentyp zu binden. Miles schtzte, da sich im Gegensatz zur herr schenden Auffassung der Neuropharmakologen und Neurowissen schaftler weniger als zwei Prozent der neuronalen Kommunikation tatschlich ber die Synapsen vollzieht. Diese Idee bedeutete einen so radikalen Bruch mit der Lehrmeinung, da seine Beobachtungen zur Nichtbereinstimmung einige Jahre lang ignoriert und auf Artefakte der Kartierungstechniken zurckgefhrt wurden. In der Art, wie die Peptide durch den Krper wandern und ihre Zielrezeptoren in Regionen finden, die viel weiter entfernt sind, als man jemals fr mglich hielt, hat das Kommunikationssystem des Gehirns groe hnlichkeit mit dem endokrinen System, dessen Hormone den Krper ebenfalls in jeder Richtung durchqueren knnen. Die allgemei ne Auffassung vom Gehirn und die Metapher, mit denen die Naturwis senschaftler es beschrieben, waren einem fortwhrenden Wandel un terworfen.

Die Krper-Geist-Verbindung: Peptide als Trger des Ge fhls


In weiterer Folge wurden zahlreiche Alternativen zu den synapti schen Nervenverknpfungen entwickelt. Allmhlich wurde transparent, was durch diese Verbindungen bertragen wurde. So handelt es sich bei den Rezeptoren fr Geschlechtshormone, die unerwarteterweise im Gehirn identifiziert und dann jahrelang ignoriert worden waren - of fenkundig, um den Mechanismus, durch den Testosteron oder Ostro gen, wenn sie whrend der Schwangerschaft in den Ftus ausgeschttet werden, die neuronalen Verbindungen im Gehirn bestimmen und die sexuelle Identitt des Kindes dauerhaft beeinflussen knnen. Der inter national bekannte Psychiater John Money von der Johns Hopkins University hatte nachgewiesen, da sich weibliche Ften unter dem Einflu von testosteronhnlichen Steroidhormonen (abnorme Produkte der mtterlichen Nebennieren whrend der Schwangerschaft) eher zu wil den Kindern mit jungenhaftem Verhalten entwickeln, die kein Interesse an Puppen zeigen. 60

Auerdem lieen sich jetzt dank der Erfindung neuer biochemischer Methoden zahlreiche weitere Nervenverbindungen entdecken. Einen nachhaltigen Einflu auf die Forschung hatten die wegweisenden Ar beiten, die Tomaas Hokfeldt Mitte der achtziger Jahre durchgefhrt hatte. Dabei hatte er in dem klassischen autonomen Nervensystem, wie es der Neurologe Stephen C. Cannon beschrieben hat, berraschender weise fast jedes Neuropeptid entdeckt, nach dem er dort gesucht hatte. Neuropeptide waren nicht nur in den Ketten von Nervenganglien zu beiden Seiten des Rckgrats zu finden, sondern auch in den Endorga nen selbst. Als die Neurowissenschaftler damit begannen, alle Verbin dungen zwischen den Teilen des Krpers exakt zu erfassen, setzte ein Zeitalter der Entdeckungen ein, das heute noch ungebrochen anhlt. Tag fr Tag gewinnen wir neue Erkenntnisse ber peptidhaltige An sammlungen von neuronalen Zellkrpern im Gehirn, sogenannte Kerne, die der Ursprung der meisten vom Gehirn zum Krper und vom Krper zum Gehirn verlaufenden Nachrichtenverbindungen sind. Wenn wir den Gedanken akzeptieren, da Peptide und andere Boten stoffe das biochemische Substrat des Gefhls sind, dann ist ihre Ver teilung im Krper von hchster Bedeutung. Die neuere Forschung lt darauf schlieen, da dem Bewutsein eine fast unendliche Zahl von Ubertragungswegen zur Verfgung steht, um das Unbewute und den Krper zu erreichen und zu verndern. Diese Ergebnisse liefern auch eine Erklrung fr zahlreiche Phnomene, ber die sich die Theoretiker des Gefhls schon lange den Kopf zerbrechen.

Thalamus - das Tor zum Tagesbewutsein


Der Thalamus mte eigentlich im Plural als Thalami genannt wer den, denn dieses seltsame Gehirnzentrum ist paarig angelegt, redun dant. Die bersetzung des Wortes heit Frauengemach. Mir ist un bekannt, was sich hinter dieser Namensgebung verbirgt. Thalamus und Gehirnrinde (Kortex) bilden somit eine Einheit. Der Thalamus bein haltet eigentmliche Kerne, die aus Neuronenzellen, aus Ganglien be stehen. Diese Kerne bilden das Tor zum Tagesbewutsein.

61

Vom gesamten Informationstransfer erhlt der Thalamus eine Ko pie. Derartige Kopien sind elektrische Interferenzfelder. Anhand der interferierenden Feldmuster wird entschieden, ob das Tor zum Be wutsein sich ffnet oder geschlossen bleibt. Das jeweilige Muster schlgt sich in einer ununterbrochenen Oszillatorrhythmik nieder, ganz hnlich wie der Herzrhythmus. Der Thalamus ist der Schrittmacher der elektrischen Gehirnaktivitt, des EEG Die Frequenzen des Thalamus variieren um 7,8 Hz herum. Langsame Frequenzen bis 15 Hz innerhalb des Gehirn werden vom Thalamus synchronisiert. Je langsamer und synchronisierter die Wellen (Schlaf, Entspannung, Meditation, Koma), um so mehr schliet sich das Tor fr den Weiterlauf der Information ins Bewutsein. Werden dagegen Informationen aus der Umwelt auf genommen und wird dadurch die Aufmerksamkeit auf diese Signale gelenkt (Vigilanz), dann wird das Tor zum Bewutsein weit geffnet. Ein weiterer Trffner ist das Vorderhirn, das uns bereits als Regie in der Kommunikation der beiden Gehirnhlften begegnet ist. Eine Beschdigung des Thalamus hat neben anderen Ausfllen auch eine Verwirrung des Zeitsinns zur Folge. Der Zeitsinn lt sich physiolo gisch nicht festlegen, angeboren gibt es keinen Zeitsinn. Vermutlich sind die Oszillationen des Thalamus mit der Zeit verbunden. Ich hatte bereits vorher dargestellt, wie unsere intellektuellen Gedanken die Zeit ins Spiel bringen, um Ordnung aufzubauen. Ein wichtiger Teil des Thalamus ist der Hippokampus, eine Art Lernzentrum. Die Nerven zellen des Hippokampus sind die Schrittmacher einer ganz bestimmten Oszillation, des Thetarhythmus (4-7 Hz). Bei Kindern ist dieser Rhythmus immer dominierend; bei Erwachsenen dagegen nur im Schlaf, bei tiefer Entspannung und beim Meditieren. Der Rhythmus bergreift neben dem Hippokampus auch die Teile des Limbischen Systems, welches die Gefhle mit Duft koppeln. Das bedeutet, da an einen Geruch immer Erinnerungen mit Ge fhlen geknpft sind. Diese interessante Kombination hat groe Be deutung fr die Steuerung von Lebensprozessen. Die enge Verknp fung von Hippokampus und Limbischem System ermglicht auch die Zuordnung von angebotenen Gefhlen mit bestimmten Situationen als

62

Prgung. Da das Limbische System einen direkten Zugriff zum Vegeta tiven Nervensystem und den Hormonhaushalt hat, wird mit jeder Ge fhlsregung der gesamte Krper beeinflut. Auerdem gibt es einen Zugriff auf bestimmte wichtige Zentren im Hals-Kopfbereich (Medulla oblongata mit Formatio reticularis). Gehirn (mediosagittaler Schnitt)
Grosshirnhemisphre

frontal >
III. Hirnventrikel

Hypophyse Kleinhirn pons medulla oblongata Rckenmark Wurzelfasern des 1. Spinalnervs Abb.3: Querschnitt des menschlichen Gehirns.

Deshalb beeinflut jedes Gefhlsniveau vorsorglich den Tonus un serer Skelettmuskulatur. Im Fall der Bedrohung und des Stresses wird der Muskel vorgespannt, um schneller reagieren zu knnen. Umgekehrt wirkt der so vernderte Krperstatus zurck auf die Ge nerierung der Gefhlsmuster. Wir knnen, wie bei den Elektronen, unterscheiden zwischen Angebotswelle und Besttigungswelle und schlielich Kraftbertragung. Wird zum Beispiel durch ein gewisses Unsicherheitsgefhl der Muskeltonus angehoben und der Blutdruck erhht, so erhht sich rckgekoppelt die Frequenz des ThetaRhythmus. Diese erhhte Frequenz hat frappierende Auswirkungen auf die Generierung von Folgegefhlen. Durch nun stattfindende Um schaltungen in bestimmten Zentren wird die Psyche von der Umwelt abgeschottet und die erhhte Frequenz kreist als Nervenerregung im Thalamus. Das ist die Voraussetzung, um in ein massives Angstgefhl

63

zu gleiten, das erst dann seine Macht auf den Krper verliert, wenn Au enreize wieder ins Bewutsein durchgesteuert werden. Uber die enge Verbindung zum Lernzentrum, den Hippokampus, kann die Auslsung von Angstgefhlen schnell gelernt werden archaisch sicherlich sinn voll, heute aber fr Betroffene eine Qulerei. Der Thalamus ist die Ko ordinationsstelle von Reizen und geistigen Prozessen, wie Gefhlen und Gedanken. Hier berschneiden sich nicht nur daraus resultierende magnetische Felder, sondern vermutlich nehmen wegen der strate gisch einmaligen Situation -, hier auch die geistigen Prozesse Einflu auf die Raum-Zeit - die Gravitation. An dieser Stelle soll sehr kurz ein Exkurs auf das Thema Unge klrte Phnomene gemacht werden. Zum Beispiel ist vllig ungeklrt, wie die Leistung von verschiedenen Tieren vollbracht werden kann, ber hunderte von Kilometern Distanz ber vllig unbekanntes Terrain nach Hause zu finden. In der Wissenschaft wird dieses Gebiet mit der Bezeichnung Psi-Trailing gefhrt.

Ungeklrte Phnomene
Das Bemhen, parapsychologische Geschehnisse einer wissenschaft lichen Deutung zuzufhren, hat Tradition. Einstein empfahl, auf para psychologische Phnomene zu achten; ebenso C.G. Jung und dr No belpreistrger fr Physik Wolfgang Pauli. Der berhmte Neurologe Wladimir Bechterew versuchte die Wissenschaft von der Existenz einer psychischen Fernwirkung zu berzeugen. Er hielt eine elektromagneti sche Theorie der Telepathie fr wahrscheinlich und arbeitete mit dem Nobelpreistrger Iwan Pawlow ber Hypnose und Telepathie bei Tie ren. Einer seiner Schler war der sptere russische Professor Wassiliew, der ausfhrliche Experimente nach wissenschaftlichen Kriterien durchfhrte und in einem Buch verffentlichte. Die Ergebnisse waren und sind heute noch uerst spektakulr. Die Telepathie als Fernwir kung konnte reproduzierbar bewiesen werden mit Distanzen von 1.700 Kilometern zwischen Sendern und Empfngern. 64

Von insgesamt 260 Versuchen zur telepathischen Befehlsinduzierung milangen 27. Als man aber die Hypothese einer elektromagneti schen bertragung auf ihre Richtigkeit hin berprfte, milang das vollstndig. Die Menschen als Sender bzw. Empfnger wurden in Bleikammern mit 12 cm dicken Wnden gesetzt. Derartige Wnde knnen nur ganz extrem kurzwellige oder ganz extrem langwellige, elektromagnetische Energien durchdringen. Beides ist mit der ntigen Leistung durch den menschlichen Organismus nachweislich nicht aussendbar. Dennoch funktionierte die Telepathie ohne Reduzierung. Kalkuliert man, was von allen heute bekannten physikalischen Gren fr den Effekt aus Bleikammern heraus mglich ist, dann bleibt nur die Gravitation brig. Die wellenlose Gravitation htte die beste Chance der Durchdringung. Dies widerspricht aber der gequantelten Energie, deshalb spricht Hans Werner Woltersdorf von auerphysikalisch. Die Theorie von Wolters dorf, die er extra fr die Parapsychologie formulierte, sollte man sich in der Wissenschaft genauer ansehen.

Motivation und Depression


Will man Erfahrungen in der Umwelt sammeln, dann mu man da fr motiviert sein. Drei Hormone im Gehirn ermglichen vorrangig die Verfestigung der Motivation: Dopamin, Noradrenalin und Serotonin. Fehlen diese Hormone, dann macht sich eine tiefe Depression breit. Die Synthesekaskade von Dopamin und Noradrenalin beginnt mit zwei Aminosuren: Phenylalanin und Thyrosin. Phenylalanin mu mit der Nahrung aufgenommen werden. Enthlt die Nahrung nicht gengend dieser Aminosure (tglich immerhin 2 Gramm sind notwendig), dann kommt es allein deshalb zum Motivationsdefizit. Genau so wichtig sind fr die Syntheseschritte Vitamin C, gengend Sauerstoff, Eisen und keine Kohlenmonoxidbelastung (wie sie heute im Straenverkehr hufig auftritt). Ist unsere Nahrung schlielich mit Schwermetallen belastet, so wandelt sich das Noradrenalin in unwirk 65

sames Noradrenochrom um. Sonnenbestrahlung stimuliert das Gehirn zur Bildung des aktivierenden, stimmungshebenden Noradrenalins. Sdlnder sind temperamentvoller und extrovertierter. In lichtarmen Regionen grassiert Depression und eine erhhte Selbstmordrate. Ein weiterer Grund fr depressive Zustnde in lichtarmer Zeit ist das Fehlen des Glckshormons Serotonin im Limbischen System. Es fehlt deshalb, weil aus Serotonin das wichtige Hormon Melatonin gebildet wird und die Melatoninproduktion bei zu wenig Licht auf Kosten des Serotonins hochgefahren wird (viel Melatonin hemmt dann zustzlich eine ganze Reihe anregender Hormone), und weil der Ausgangsstoff von Serotonin, das Tryptophan, zu wenig mit der Nahrung aufgenom men wird. Fehlt dann noch das B-Vitamin Niacin, kommt es unweiger lich zu Serotonin-Mangelerscheinungen. Bei Frauen sinkt innerhalb der Zyklus zwischen dem Eisprung und der Menstruation der Serotoninspiegel. Gleichzeitig stellt sich in dieser Zeit der Organismus von einem beruhigenden Parasympathicustonus auf einen hektisch machenden, erhhten Sympathicustonus um. Energielosigkeit, schlechte Laune und eventuell Depression sind die Folge. Das prmenstruelle Syndrom hat nun Chancen zu greifen. Dazu kommt, da zwar fr 48 Stunden um den Eisprung herum der stark motivierende Endorphinspiegel zu einer Woge aufluft, um danach allerdings rapide abzufallen. Zur Gegensteu erung erzeugen einige Frauen einen Heihunger auf Schokolade oder Zucker und strkehaltige Nahrung. Zucker im Blut lt Tryptophan, die Vorstufe von Serotonin, mit Hilfe von Insulin verstrkt ins Gehirn flieen und Ses stimuliert die Endorphinproduktion. Besonders schtig sind diese Frauen zwischen 14 und 16 Uhr, denn in dieser Zeit gibt das Gehirn den Stoff Galanin frei, der den Heihunger zustzlich anheizt. Eine besondere berraschung bringt schwarze Schokolade mit hohem Kakaogehalt, sie enthlt ausreichende Mengen von bestimmten Ethanolaminen, die eine hnliche psychoaktive Wirkung zeigen, wie Haschischgenu. Depressive Menschen regulieren die Substanz corticotropin releasing hormon (CRH) falsch. Normalerweise berschwemmt das Hormon bei

66

Stre das Gehirn mit der Aufgabe, das Interesse am Essen und an Sex zu blockieren. Werden zu hohe Mengen ausgeschttet, entsteht Angst. Ist die Situation unter Kontrolle, sinkt der Spiegel schnell wieder, wobei ein Gefhl der Entspannung und Erleichterung entsteht. Bei Depressiven funktioniert die Down-Regulation nicht. Selbst im Schlaf sind die Betroffenen in sinnloser Unruhe, was einer hohen Ener gieausgabe gleichkommt, die dann an anderen Stellen fehlt. Natrliche Abhilfe knnen hier nur suggestive Rituale in der Gemeinschaft schaf fen; auerdem Dfte, die aus der Prgung heraus motivieren, zusam men mit Musik, die ebenfalls aus der Prgung heraus positive Stimmun gen erzeugt, und immer wieder relativ anstrengende Bewegung (Sport). Schon ein ausgiebiger Sonnenspaziergang wrde helfen; am besten in machtvoller Natur mit strotzender Vegetation und frischem, klarem Wasser. Aber wo gibt es das noch in unserer nchsten Umgebung? Die se recht einfachen Zusammenhnge sind kaum bekannt. Gibt es deshalb so viele depressive Kinder und Erwachsene? Interessant ist auch das hyperkinetische Syndrom bei Kindern. Aus gelst wird das Syndrom ebenfalls durch ein pathologisches Defizit an Noradrenalin. Der Krper hilft sich selbst, indem er soviel wie mglich Bewegung veranlat. Dadurch wird verstrkt Dopamin aus der Reserve ausgeschttet, woraus Noradrenalin entsteht und die Chance besteht, da der Mangel ausgeglichen wird. Die Wirkung von Dopamin stellt eine besondere Erlebnisvariante dar. Im Normallevel erzeugt das Hor mon Geistesblitze, Selbstbewutsein und knstlerisches Empfinden, erweiterte Phantasie; im berschu aber Visionen und Grenwahn; manchmal hrt die Person fremde Stimmen. Permanente geistige Un terforderung, wie Fliebandarbeit und abstumpfendes Fernsehen lt den Dopaminspiegel absinken. Eine deutliche Steigerung entsteht durch Feinmotorik, wie Klavierund Geigespielen, Tanzen und Balancieren, vor allem auch durch das fernstliche Schattenboxen. Auch die japanischen Meditationskugeln und das permanente Schieben der Perlen der Gebetsketten dienen dem

67

gleichen Zweck. Auerdem wird die Ausschttung durch Yoga, Intui tion, Autosuggestion und Trance verstrkt. Dopamin stimuliert das Immunsystem und stabilisiert das Herz-Kreislaufsystem. Parkinson ist eine Dopaminmangelerkrankung, wodurch verkrampfte Bewegungen ausgelst werden. Es gibt eine Reihe gngiger Drogen, die in diesem Geschehen wirken. Kokain und Amphetamin verhindern den Rck transport von ausgeschttetem Noradrenalin, und Dopamin steht da mit lnger zur Verfgung. Die Folge ist eine gefhrliche, schtig ma chende, angenehme, gehobene Stimmung voller Aktivitt und geistiger Energie. LSD, Meskalin und Zauberpilze mobilisieren direkt Noradrenalin und Dopamin und lassen die Hormone in hchste Hhen schnellen, wodurch Visionen und intensive Wahrnehmungen erzeugt und Gefhle verstrkt werden.

Krpereigene Psychedelika
Krpereigene Psychedelika sind wichtig fr die Sensibilitt der eige nen Wahrnehmungen und Gefhle. Sie verstrken vorhandene Stim mungen. Selbsthypnose, Schlafentzug (in aller Stille und Dunkelheit), Meditation, Fasten, ekstatisches Tanzen, Litaneien und monoton rhythmische Gerusche, psychedelische Musik sind wirksame Metho den zur Erhhung der Level.

Endovalium
Synthetisches Valium ist weltweit die meist verbreitete Droge. Kaum bekannt ist, da wir im Gehirn selbst Valium herstellen. Rezeptoren fr die Droge finden sich im Stammhirn, in der Klein- und Grohirnrinde und im Stirnhirn. Schlafmittel und Alkohol erreichen ebenfalls die Re zeptoren. Die Wirkung besteht in einem starken Beruhigungseffekt - es wirkt antidepressiv, antiagressiv, schlaffrdernd und angstlsend. Eine

68

geringe Blockierung der Rezeptoren - zum Beispiel durch ZellEnergiemangel (Glucose-, Sauerstoffmangel) - erzeugt Angst und qulende innere Unruhe, die sich zur Panik ausweiten kann. Endovalium lt sich leicht stimulieren durch Entspannungsbungen, Tag traumtechnik oder Atembungen.

Glcklichsein
Die Fhigkeit zum Glcklichsein und unser Selbstwertgefhl hngen direkt miteinander zusammen. Damit wir nicht zu kurz kommen, hat sich die Natur einiges ausgedacht. Jeder kann Gebrauch davon machen. Nach allen bisherigen Untersuchungsergebnissen macht Reichtum und Geld keinesfalls glcklich. Es gibt krpereigene Drogen, die uns das Leben angenehm gestalten, und dies vor allem dann, wenn es mhsam wird. Krpereigene Opioide werden mit jeder krperlichen Anstren gung ausgeschttet. Werden weder Gehirn noch Krper gefordert, sind Opioide im Krper kaum vorhanden. Dann versumen wir viel, denn die Droge macht uns rundum glcklich. Sie wirkt antidepressiv, ver treibt die Melancholie, lst Angstzustnde und psychische Spannungen, wirkt antriebssteigernd, schmerzreduzierend und untersttzt das Im munsystem. Leider verwhnt uns die Natur nur kurze Zeit. Opioide haben eine Halbwertszeit von nur 5 Minuten nach Ausschttung. Danach mu eine neue Gelegenheit zur Stimulation gefunden werden. Die bekannte sten Opioide sind die Endorphine, Enkephaline, Dynorphine. Drogen abhngige und oftmals auch Alkoholiker haben einen Mangel an Endorphinen. Auch Schmerzen sind geeignet, Endorphine zu stimulieren. Die Folge ist eine Minderung der Schmerzen. Bei schweren Verletzun gen reicht das Entsetzen, der psychische Schock, bereits aus, schmerz frei zu sein. Dafr mu man sich in Erinnerung rufen, da wir in ar chaischen Zeiten Beute von Raubtieren waren, die uns nicht gleich t teten, sondern schwer verletzten. Schock und Endorphine halfen, die Qulerei zu mildern.

69

Eine weitere, hchst intelligente Eigenschaft ist den Endorphinen zuzuschreiben: sie verhindern Lernen und Einprgen. Das ist deshalb sinnvoll, weil schmerzhafte und mhsame Ttigkeiten ansonsten vom Krper vermieden wrden, zum Beispiel auch die Geburt. Wenn sich eine Frau an die Schmerzen whrend des Geburtsvorgangs dauernd erinnern wrde, dann wre die Wiederholung katastrophal. Der Krper wrde sich verkrampfen und psychische Abwehrmechanismen etablie ren. Wie knnen wir die Ausschttung von Opioiden positiv beeinflus sen? Wir brauchen zuerst einmal dringend gengend Ausgangssubstan zen, das sind die Aminosuren Phenylalanin und Thyrosin, Glycin, Me thionin, Leucin, von allen tglich zirka 2 Gramm. Dann mssen wir Techniken lernen, wie Autogenes Training, Yoga, Meditation, aktives Imaginieren und diverse Rituale. Leichter erfolgreich ist vielleicht Jog gen, ekstatisches Tanzen oder eine Extrembelastung. Endorphintter sind Kochsalz, Kaffee (auch koffeinfreier) und Fettverdauung. Opioide gehen eine Kooperation mit einer hochinteressanten Sub stanz ein: es ist das Delta-Sleep-Inducing-Peptid, kurz DSIP. Eigentlich ist dieses Peptid dafr da, die Produktion des wichtigen Hormons Me latonin zu modulieren. Je nach Zeitpunkt innerhalb eines Tages kann es die Hormonproduktion hemmen oder vergrern. Abends gebildet, zum Beispiel auch durch Reizung des Thalamus mit niederfrequenten Stromimpulsen, leitet es zusammen mit Melatonin (und Vasotocin) den Schlaf ein. Sind gleichzeitig Opioide in der Gehirnregion, verbindet sich DSIP mit ihnen und erzeugt ein Gefhl des Friedens und der wohltu enden Ruhe. Auch Schmerz reduziert sich. Erst diese Atmosphre ist geeignet, den Krper fr einen tiefen erholsamen Schlaf vorzubereiten. Gerade bei Kindern, mit der ihnen eigenen Phantasie und Imagination im Bett vor dem Einschlafen, und mit der dadurch induzierten Opioidund DSIP-Produktion, erbringen prinzipiell die optimale Vorausset zung fr die Schlafeinleitung - wenn das Fernsehen keinen Strich durch die Rechnung macht

70

Das Immunsystem sprt Gefhle


Das Immunsystem ist offensichtlich genau so intelligent, wie unser Gehirn. Es kann organisieren, Ordnung schaffen und hat ein lebenslan ges Gedchtnis. Neu ist die Erkenntnis, da das Immunsystem genau so fhlt, wie wir. Jedes Gefhl hat Auswirkungen. Sind es PositivGefhle, dann ist das Immunsystem freudig aktiv, sind es NegativGefhle, dann hat das Immunsystem keine Motivation zu arbeiten. Bisher ist nun folgendes dargestellt worden: Gefhle sind ein Netzwerk von elektromagnetischen Interferen zen, an dem urschlich intelligente Elektronenschwingungen be teiligt sind. Diese Interferenzen werden durch Situationen in der Umwelt oder Situationen in der Innenwelt des Krpers ausgelst. Die Interferenzen bilden eine Art Hologramm, das bei Abtastung (Angebotswelle und Bettigungswelle) Realitt (Verfestigung) schaffen kann. Dadurch entstehen resonanzspezifische Nervenaktivitten, die als erste lokale Verstrkerfront eingestuft werden mssen. Die Nervenak tivitten provozieren ein moduliertes Schwingungsbild, wodurch Neu rotransmitter und Neuropeptide freigesetzt werden. Das ist die zweite Verstrkerfront, die bereits eine gewisse Fernwirkung innerhalb des Krpers hat. Eine gute Fernwirkung wird dadurch erreicht, da ein Teil der Neurotransmitter in den Blutkreislauf abgegeben wird. Vorausset zung fr die Fernwirkung ist das Vorhandensein von entsprechenden Rezeptoren zum Empfang der Signale (wiederum elektromagnetischer Natur). Genau dieser Mechanismus ist fr das Immunsystem nachge wiesen worden. Damit existiert eine Kausalwirkung zwischen Gefhl und Immunsystem. Der Placebo-Effekt findet so seine Erklrung. Kennen wir das Neuropeptid-Mosaik eines gut funktionierenden Immunsystems, dann kennen wir auch die positiven Gefhlsqualitten des Gehirns und umgekehrt.

71

Tatschlich gibt es einen auergewhnlichen Zusammenhang. Auf dem Chromosom 6 ist die Bildung einer Moleklstruktur (major histocompatibility complex, MHC) genetisch verankert, mit deren Hilfe das Immunsystem unterscheidet, was zum Krper gehrt und was fremd ist. Exakt hier wird auch der Individualgeruch eines jeden Menschen festgelegt, der wiederum darstellt, was zum Krper gehrt und was fremd ist. Kann das Immunsystem also riechen, was zum Krper ge hrt und was nicht? So ganz abwegig ist diese Spekulation nicht, denn auch Dfte und Pheromone arbeiten nach dem gleichen Prinzip, wie Neurotransmitter - letztlich mit Hilfe elektromagnetischer Schwin gungen.

Differentielles Erleben
Wenn positive Gefhle nur Gutes in unserem Krper bewirken, dann erhebt sich die Frage, warum wir auch mit negativen Gefhlen ausgestattet sind. Die Antwort liegt auf der Hand. Das System Mensch wird nicht nur durch, von der Natur gesteuerten Gefhlen zur Vermehrung angehalten, sondern - und das ist das postulierte Hauptziel - zum Erfahrungen sammeln, zum Erleben aufgebaut. Die Verwertung dieser Erlebnisse entspricht einer Feinmodulation der an geborenen Strukturen ber Feedback mit laufend gesteigerter Selbstoptimierung. Erleben ist nur mglich bei gleichzeitiger Erfahrung von Hhen und Tiefen. Woher wei ich, wenn ich im Hoch bin, da ich im Hoch bin, wenn ich keine Tiefen erlebt habe. Erst durch Klte wei ich, was Wrme ist. Erst durch Dunkelheit wei ich, was Licht ist. Erst durch Armut wei ich, was Wohlstand ist. Erst durch Traurigkeit wei ich, was Freude ist. Das ist das Prinzip des Differenzerlebens. Ich mu dauernd verglei chen knnen, messen (Messen beruht immer auf einem Vergleich mit anderen Werten). Diese Verfahren sind absolut identisch mit Beobach ten und das ist - wie wir inzwischen glaubhaft darstellen konnten Realittsbildung, also Erleben. Aber die Gefahr liegt in der Dauerbeob achtung (siehe Kapitel Ein Experiment mit weitreichenden Folgen). 72

Die Dauerbeobachtung friert den Zustand ein. Das Erleben wird blokkiert. Nur eine dauernde nderung des Zustands lt ein weiteres Erle ben zu. Paradox genug: Die bewut wahrgenommene Erfahrung von Differenzen fhrt zu einer greren Freiheit und Zufriedenheit. Nicht Gleichklang, Gleichheit und Gewohntes ist die Wrze des Lebens, son dern Kontrast, Vielschichtigkeit, Differenzen und Polaritt. Wir sind so, weil die Gesetze der Quantenwelt so sind. Wir sind die Quantenwelt.

Elektromagnetische Schwingungen und magnetische Krfte wirken in Kombination


Magnetfelder beeinflussen elektromagnetische Schwingungen und die Wirkung ihrer Felder. Die Anwendung dieses Phnomens bei Or ganismen wird bisher nicht beachtet. Die bei der Anregung durch elek tromagnetische Felder (zum Beispiel Licht) entstehenden Termabstn de lassen sich durch uere Gleichmagnetfelder aufspalten. Drei Mglichkeiten der Beeinflussung organischer Strukturen sind bekannt: 1. Externe Magnetfelder bewirken, da rechts und links zir kular polarisiertes Licht unterschiedlich absorbiert wird; sie induzieren einen magnetic circular dichroism (MCD). 2. Magnetfelder bewirken auch, da rechts und links polarisiertes Licht unterschiedlich emittiert wird: magnetic circular emission (MCE). 3. Magnetfelder bewirken au erdem, da rechts und links polarisiertes Licht unterschiedlich ge streut wird. Die Folge dieses Effekts: Vorhandene Pumpfrequenzen (Mikrowellen oder thermischer Schwingungsbereich) und gesendete Signalfrequenzen sind durch Erhhen oder Vermindern der Amplitude des Magnetfeldes vernderbar und knnen beliebig durchmoduliert werden. Aus der Grundlagenforschung heraus haben wir nach vorliegendem Modell neue Akupunkturbehandlungsstbe entwickelt. Diese Stbe sind insgesamt phasenkohrent in der gleichzeitigen Emission von Photonen/Quanten, von Magnetfeldimpulsen und von Vibrations schall. Die Therapiestbe erwiesen sich in krzester Zeit als ungewhn-

73

lich effizient. Dies spricht fr die Verifizierungschance des Modells. Eine Therapienachweiskontrolle ist somit mglich. Folgende Beeinflussungen sind (rein empirisch bzw. teilweise hy pothetisch) zu erwarten: Reizung der Nervengeflechte unterhalb der Hautakupunktur punkte zwecks Auslsung der Membran-Mikrowellen-Strahlung durch: Licht mit spezifischen Photonenenergien - zur Membran-Melaninstrahlungsanregung, - zur Flavinmononucleotid-Anregung zur Anregung der Pump welle in Mikrotubuli; Magnetfelder mit sehr spezifischer Amplitudenmodulation und Frequenz zur Steuerung der Aufspaltung der Term-Energiestufen fr Maserstrahlung (Neuron, Mikrotubuli); Galvanische Stromzufuhr zur Auslsung der Nervenaktion und gekoppelte Mikrowellen-Strahlung, wie oben bereits dargestellt; Klassische invasive Nadelung zur Erzeugung einer VerletzungsDepolarisation an Membranen und Auslsung gekoppelter Mikro wellenstrahlung. Auerdem ist eine direkte Einkopplung von adquater Ouantenenergie mglich, die das Interferenzbild (Hologramm) beeinflussen: Weitgehende Beruhigung der Neuronenaktivitt durch spezifische Hochfrequenzstrahlung mit relativ hoher Amplitude; Stimulierung parasympathischer Neuronen durch bestimmte Fre quenzmuster und dadurch Abnahme eines adrenergen Tonus, auch der Muskulatur; Erreichen einer Hyperpolarisation durch ATPase-Enzym-Stimulierung durch spezifische Quantenenergie; Blockierung der Weiterleitung von Aktionen an Ganglien durch Auslsung eines peripheren Neuronenfeuers nach der GateControl-Hypothese; Stimulierung von opiathnlichen Neurotransmittern (Enkephalin, Dynorphin) durch bestimmte Quantenenergie und Impulsfre quenzkaskaden. 74

STEUERUNG AUS DEM HYPERRAUM


Der Hyper-Raum steht in Abhngigkeit mit den denkenden Wesen des Universums oder der Universen, da sie das Fundament neuer Schpfungsebenen bilden. Lediglich unsere Gedanken halten das mate rielle Universum aufrecht. Das Zitat von Rene Descartes: Ich denke, also bin ich, hat weitaus grere Bedeutung als von den meisten ange nommen. Tatschlich gilt der in der Physik so bekannte BeobachterEffekt als ein gesichertes Wissen um diese Dinge. Das Individuelle in sich selbst wiederum ist eine Illusion und lst sich auf, wenn man sei nen irdischen Krper ablegt, das heit, die Materie hinter sich lt. Wohl bleibt die Information und auch das dazugehrende Wissen (In formation ist Wissen). Das, was sich letztlich wahrnimmt, sind nicht die Gedanken. Es gibt vielmehr eine bergeordnete Ebene, die sich wahrnimmt und die Gedanken auch nur benutzt. Und das ist etwas, was praktisch unsterblich ist. Dieser unsterbliche Bereich der Wahrneh mung ist eine ganz andere Ebene. Da gibt es tatschlich etwas, was man auch als Seelenaspekt bezeichnen kann. Seele ist ja oft nur so ein schwammiger Begriff, der keine sichere Definition besitzt. Die Erkl-

Abb.4: Menschliches Gehirn mit WurmlochEigenschaften.

75

rung fr Seele ist theologisch mit bestimmten, meiner Ansicht nach verwsserten, unstimmigen Begrifflichkeiten belegt.

Informationen und Speicher


Auf die Arbeit von Diplom-Physiker Burkhard Heim bin ich bei meinen Recherchen zu den physikalischen Grundlagen des Lebensener gie-Begriffes und des Informationsbegriffes in der Homopathie ge stoen. Heims einheitliche Quantenfeldtheorie beschreibt fr mich erstmals in berzeugender Weise den Einflu nichtenergetischer Strukturen wie Bewutsein (Geist) auf die energetische/materielle Welt. Damit knnte sie meiner Ansicht nach geeignet sein, viele Rtsel der Grenzgebiete der Wissenschaft wie Geist-Krper-Interaktion, gei stiges Heilen oder parapsychologische Phnomene zu erklren. Aller dings mute Herr Heim als mathematischer Physiker einen beraus komplexen mathematischen und logischen Formalismus verwenden, um seine Theorie darzustellen - entsprechend anspruchsvoll sind seine Bcher.

Realitt und Wirklichkeit


Der Begriff Realitt wird im allgemeinen auf die Auenwelt bezie hungsweise auf Ereignisse der Auenwelt bezogen. Die Auenwelt als Realitt wird unabhngig vom Menschen (Beobachter) gesehen. Der Mensch kann die Auenwelt ber seine Sinne wahrnehmen. Der Um gang mit der Umwelt umfat also nur eine Untermenge von Realitten, eine eingeschrnkte Realitt, die den Sinnen zugnglich ist. Es ist hier angebracht, eine (logische) Unterscheidung zwischen den Begriffen Realitt und Wirklichkeit zu treffen. Realitten wirken auf Menschen ein. Die Einwirkung von Realitten auf den Menschen wird als Wirk lichkeit erfahren. Die Einwirkung von Realitten geschieht ber das Erleben von Ereignissen und deren physischer, psychischer und men taler Verarbeitung. Ereignisse finden im Raum und nacheinanderfol gend im Sinne einer Ereigniskette (Geschehen) statt; das heit, sie sind 76

Punkte einer vierdimensionalen Raum-Zeit. Diese Art von Ereignissen ist quantifizierbar. Sie betreffen die Physis. Es stellt sich nun die Frage, ob es auerhalb der Raum-Zeit logische Bereiche gibt, in denen ein Geschehen definierbar ist bzw. ob es andere logische Bereiche gibt, die nicht physischer Art sind. Ereignisse betref fen nicht nur die Auenwelt; sie knnen sich auch als Ereignisse des psychischen Innenraumes manifestieren. Ereignisse des Innenlebens, wie zum Beispiel Trume, sind nicht quantifizierbar, da sie allein quali tativer Art sind. Trotz der qualitativen Eigenschaften psychischer Er lebnisrume knnen die Ereignisse dieser Erlebnisrume die Auenwelt beeinflussen und somit quantifizierbare Auswirkungen haben (Beispiele hierfr sind Visionen, Trume und Vorstellungen). Es ergibt sich hier die Frage nach der Definierbarkeit qualitativer Bereiche auerhalb der Raum-Zeit. Zwei Hypothesen (im Sinne von Glaubensstzen) ber die Ganzheit der Welt, die beide wahr sein knnten, werden aufgestellt. Sie sind mit einer Entweder-Oder-Beziehung verknpft und bilden die Ausgangspunkte zur Entscheidung fr eine Weitsicht. Hypothese A: Die Welt ist Physis und als solche mathematisierbar und quantifizierbar. Was nicht mathematisierbar ist, existiert nicht. Hypothese B: Es existiert eine unbekannte, bergeordnete Welt ganzheit. Die Physis ist nur ein uns zugnglicher Teilbereich dieser Ganzheit. Ist der am leichtesten zugngliche Satz A wahr, so mu er das Welt ganze erklren knnen. Fr den Bereich Bios bedeutet diese Aussage, da Biochemie, Biophysik und Biologie den Lebensproze vollstndig erklren knnen. Die Quantentheorie der Valenzschalen der atomaren Elemente des Lebens mte alle Lebensprozesse beschreiben knnen. Zur Evaluierung der Hypothese A wurde der Darwinsche Evolutions proze ausgewhlt. Die Darwinsche Sicht der Evolution - Zufallspro zesse mit nachfolgender Selektion - lt einige Fragen offen. Die Zeit

77

frage (Entstehung und Entfaltung der Arten) ist nicht geklrt. Statisti sche Berechnungen widerlegen den Zeitraum, der zur Entstehung der Vielfalt der Arten notwendig war, als zu kurz. Aus der Altersbestim mung der Fossilien lt sich herleiten, da die Evolution typostrophenhaft und konvergierend erfolgt. Konvergenz bedeutet, da zu Be ginn einer Artenentwicklung unbrauchbare Formen vorausgehen. Die Natur sammelt Erfahrungen und probiert moderate Formen fr das endgltige Exemplar aus. Die typostrophenhafte Natur der Evolution bedeutet, da sich aus einer Art mit hoher Evolutionsgeschwindigkeit neue Arten entwickeln. Das heit, am Anfang der Artenentfaltung ist die Entwicklungs- und nderungsgeschwindigkeit sehr hoch (Typogenese); sie geht dann exponentiell nach unten. Auf die exponentielle Phase folgt die konstante Darwinsche Phase (Typostase) mit kon stanter nderungsgeschwindigkeit. Beim Aussterben einer Art kommt es zu einem steilen Anstieg der nderungsgeschwindigkeit der Art (Typolyse in relativ kurzem Zeitintervall). Nach Otto Schindewolf ent wickelt und ndert sich eine Art im Dreierschritt Typogenese-TypostaseTypolyse. Wenn ein neues Prinzip in die Natur eingebracht wird, ent wickelt sich zunchst ein Demonstrationstyp, der dieses Prinzip aus probiert. Die Artenentfaltung soll beispielhaft an den Vgeln dargestellt wer den: ihre Entwicklungsreihe begann mit den Reptilien. Es folgten Gro-Echsen mit Vogelskelett und Greifklauen. In einem kurzen Zeit intervall verwandelten sich die Greifklauen in abspreizbare Stummel (Vorformen des Flgels), die zur Stabilisierung sehr schnellen Laufens durch Luftkrfte geeignet waren. Der nchste Evolutionsschritt in Richtung Vogel war der Saurier mit Hautflgeln. Sein schwerer Kno chenbau bot allerdings keine gute Voraussetzung fr das Fliegen. Plump anmutende Flugbewegungen wurden durch die Entwicklung von Rhrenknochen ermglicht. Die Flugeigenschaften verbesserten sich mit den Segelflglern unter den Sauriern. Segelflgler besaen Gleitei genschaften; sie konnten sich den Luftstrmungen anpassen. Eine wei tere Verbesserung der Aerodynamik bildeten Borsten auf den Flgeln.

78

Da die Borsten innerviert waren, konnte das Tier aufgrund von Rck koppelungen mit Luftstrmungen die Anstellwinkel der Flgel verbes sern. Der letzte Schritt zum ersten Vogel war die Umwandlung der Borsten in Federn. Die Entwicklung der Prinzipien Rhrenknochen, Flgel, Regulierbarkeit der Flugeigenschaften ber Borsten, dann ber Federn, bilden eine konvergente Reihe. Die aufgezeigte Entwicklung schliet ein zielloses Herumexperimentieren der Natur mit nachfolgender Selektion als Evolutionsprinzip aus. Die hohe Komplexibilitt der Ar tenentwicklung, verbunden mit einer hohen Stabilitt der entwickelten Typen, wirft die Frage nach einem dahinterliegenden Motiv auf. Die Ergebnisse der Evolution setzen eine komplexe Organisation von In formationen voraus, welche die Artenentwicklung ausrichtet und steu ert. Fr die Entweder-Oder-Entscheidung in bezug auf die beiden Hy pothesen A und B bedeutet diese Herleitung folgendes: Der mathematisch-physikalische Ansatz der Hypothese A ist falsch, da sich die Ent wicklung des Bios - hier die Artenentwicklung - nicht allein durch quantifizierbare Elemente herleiten lt. Ein weiteres System logischer Aussagen wird bentigt. Da die beiden Hypothesen A und B mit einer Entweder-Oder-Verknpfung verbunden sind, folgt: Wenn Satz A nicht richtig ist, so ist Satz B richtig. Das bedeutet: Es existiert eine unbekannte, bergeordnete Weltganzheit, in der die Physis nur einen Teilbereich darstellt. Es mu nun mit Hypothese B weitergearbeitet werden. Hypothese B umfat zustzliche logische Aspekte, die nicht mathematisierbar sind. Die Psyche ist ein solcher logischer Aspekt. Der Aufbau der Welt wre nach Hypothese B folgendermaen zu erklren: Bezogen auf (materielle) Ereignisstrukturen existiert der Be reich der Physis in der Raum-Zeit. Diese ist quantifizierbar. Weiterhin existiert der Bereich der Psyche. Zwischen Physis und Psyche entfaltet sich der Bereich des Bios, das biologische Geschehen. Das Pneuma umfat den Bereich des Mentalen. Wahrnehmungs- und Bewut

79

seinsprozesse sind Querbeziehungen bzw. Kopplungen psychophysi schen Geschehens. Als Beispiel einer Querbeziehung dient der Proze des Sehens. Der physische Teil des Prozesses luft ab, indem ein Bild auf die Netzhaut projiziert wird. Das Bild wird in Untereinheiten zer legt. Jeder Untereinheit entspricht eine bestimmte Photonenfrequenz (Farbe) und eine bestimmte Photonenamplitude (Helligkeit). Der dar gestellte energetische Einflu wandelt sich um in Ionisationsschwin gungen des Optikus. Energie wandelt sich um in Wrme und chemische Potenziale. Der quantitative Vorgang schlgt jetzt um in einen qualititativen Proze des Erlebnisses eines psychischen Innenraumes. Der Mensch hat Anteil an allen vier logischen Bereichen. Materiell ist er fest in der Physis verankert (Biochemie, Biophysik), im Rahmen der Bioorganisation im Bios, mit seinen psychischen Eigenschaften Wahrnehmen, Erkennen, Empfinden und Mitfhlen im Bereich der Psyche. Als bewute Persnlichkeit erschliet sich ihm der Bereich des Mentalen. Aus dem beschriebenen Sachverhalt folgt, da auch die Phy sis als quantifizierbarer Bereich nicht allein durch die Gesetzmigkei ten der Physik der Raum-Zeit deutbar und berechenbar ist. Der zustz liche Bereich umfat die Information. Zur Beschreibung der Materie und ihrer Zustnde ist Information und Organisation notwendig. Nach Burkhard Heim hat die materielle Welt nicht nur vier, sondern sechs Dimensionen. Die zwei zustzlichen Dimensionen umfassen Organisa tionszustnde, Ideen und Prinzipien. Die fnfte Dimension wird relativ platonistisch gedeutet (als Seiendes im Sinne strukturierter Informati on). Die materielle Ebene ist der quantifizierbare Schatten der Welt. Nur dieser Schatten ist erkennbar. Die klassische Physik macht perfekte Aussagen ber eine eindeutige Vergangenheit. Klassische Prozesse sind Vorgnge, die, indem sie be wut werden, bereits vergangen sind. Die Quantentheorie macht futurische Aussagen ber eine mgliche Zukunft mit Hilfe von Wahr scheinlichkeiten. Der Mikrobereich ist nicht kausal zu verstehen. ber eine groe Anzahl von Mikrozustnden werden Wahrscheinlichkeits aussagen gemacht. Die Observable (als Summation ber alle EinzelWahrscheinlichkeiten) ist der Zustand grter Wahrscheinlichkeit.

80

Kausalitt ist im Mikrobereich durch die groe Anzahl atomarer Ele mente und ihrer Organisationszustnde nur vorgetuscht. Die holistische Physik (Heim, Drscher, Bohm) deduziert die Existenz eines Hyperraumes. Aus den Unterrumen dieses Hyper raums erscheinen Abbildungen zeitloser Funktionen und Strukturen in der Raum-Zeit. Die Abbildungen werden als Wahrscheinlich keitsfelder gedeutet, die den Mikro- und Makrobereich in der RaumZeit steuern. Die hier beschriebenen Anstze einer nicht kausalen Physik sind grundlegend fr den Geltungsbereich von Hypothese B: es existiert eine bergeordnete Weltganzheit. Die Physis ist nur ein Teilbereich dieser Ganzheit. Der platonistisch gedeutete Ansatz nach Heim und Drscher bietet eine Erklrung der Artenentwicklung. Nach Drscher sind Blaupau sen der Evolution im Hyperraum denkbar. In der Raum-Zeit stellt sich der Vorgang der Artenentwicklung, ins besondere die Ausbildung der Ubergangsformen, dann folgendermaen dar: bergangsformen treten in bestimmten Zeitabschnitten auf. In relativ kurzer Zeit werden neue ausgewhlte (passende) Informatio nen in Form von neuem genetischem Material der DNS einer be stimmten Lebensform hinzugefgt. Dieser Vorgang setzt ein ein deutiges, richtiges Schlieen der Phosphorsure-Diesterbrcken in der Doppelhelix der Desoxyribonukleinsure voraus. Das Schlieen der Brcken erfolgt durch gezielte Steuerung mittels quantentheo retischer Wahrscheinlichkeitsamplituden, die aus dem Hyperraum projiziert werden. Fr die Entstehung und Evolution der Lebewesen reichen die bisher entwickelten Hypothesen nicht aus. Ein weiterer wichtiger Faktor ist der kosmologische Hintergrund. Das uns bekannte Leben basiert auf Kohlenstoff und kann nur auf Kohlenstoff basieren. Die Kohlenstoff chemie erweist sich als uerst komplex und tragbar fr das Leben. Der Kohlenstoff bildet viele stabile, hochstrukturierte Verbindungen, eben so aber auch reaktionsfhige Strukturen. Die hohe Stabilitt gewhrlei

81

stet, da bei Reduplikationen von Moleklstrngen diese nicht reien. Andere Elemente, die ebenso komplexe Anordnungen wie Ringe, Ket ten und Raumstrukturen bilden, sind Bor und Silizium. Bor und Silizi um sind als Basis-Atome des Lebens aber nicht geeignet. Bor ist von der Besetzung seiner Elektronenhllen her nicht brauch bar. Die entsprechenden Verbindungen besitzen nicht die erforderliche Symmetrie. Auch Silizium bildet Ketten und Raumstrukturen. Die Sila ne sind als Verbindungen fr lebendige Strukturen nicht geeignet, da sie zu labil sind. Auch Siliziumoxide, die Raumstrukturen bilden, knnen fr die Chemie des Lebens nicht grundlegend sein, weil sie sehr reakti onstrge sind. Die Silikatchemie umfat die Chemie der Mineralien und Gesteine. Neben dem Kohlenstoff und seinen Verbindungen spielt das Lsungsmittel Wasser als zweiter Faktor fr den Aufbau lebender Strukturen eine wesentliche Rolle. Es ist als Lsungsmittel fr eine groe Anzahl von Verbindungen, zusammengesetzt aus fast smtlichen Elementen des Periodensystems, mehr oder weniger gut geeignet. Wird der Sauerstoff durch Schwefel ersetzt, der im Periodensystem direkt unter dem Sauerstoff steht, erweist sich die Kohlenstoff-Schwefel-Wasserstoff-Chemie gegenber der Kohlenstoff-Sauerstoff-WasserstoffChemie als nicht gengend reaktionsfhig fr biochemische Prozesse. Es gibt zwar Leben auf Schwefelbasis (anaerobe Bakterien), diese Art von Leben ist aber nicht evolutionsfhig, weil die Reaktionsge schwindigkeit der ablaufenden Prozesse zu niedrig ist. Entwicklung von Leben setzt folglich einen Wasserplaneten voraus, der berdies eine gewisse Gre besitzen mu, um eine sauerstoffhaltige Atmosphre zu bilden. Der Sauerstoff ist in der frhen Phase der Planetenentwicklung zunchst einmal nicht bzw. nur in Form von Wasser vorhanden. Gelangt Wasserdampf in die Hochstratosphre, erfolgt mit Hilfe der UV-Strahlung sowie mit weichem Rntgenlicht der Sonne eine Spal tung der Wassermolekle in gasfrmigen Sauerstoff und Wasserstoff. Ein bestimmter Gravitationswert ist eine wesentliche Voraussetzung fr die Ausbildung einer Sauerstoffatmosphre.

82

Der Planet darf weder zu gro, noch zu klein sein. Ist der Planet zu gro, so ist die maximale Wrmebewegung des Spaltprodukts Wasser stoff bzw. seiner Molekle kleiner als die Fluchtgeschwindigkeit (die Fluchtgeschwindigkeit ist die Geschwindigkeit, mit der ein Krper hier Gasmolekle - den Anziehungsbereich des Planeten verlassen kann). Das heit, die Molekle rekombinieren wieder zu Wasser. Eine Sauerstoffatmosphre kann nicht entstehen. Ist der Planet zu klein, kann Wasser nur als Eis vorliegen. Als flssi ges Wasser wrde es in den Raum abdampfen, die maximale Wrmebe wegung wre grer als die Fluchtgeschwindigkeit. Hat der Planet etwa Erdgre und befindet er sich in einem Abstand von der Sonne, der Temperaturen erlaubt, bei denen flssiges Wasser vorliegt, entsteht mit groer Wahrscheinlichkeit eine Sauerstoffatmosphre. Der kurzwellige Bereich des Sonnenlichts spaltet die Wassermolekle in Wasserstoff und Sauerstoff. Die maximale Wrmebewegung der gasfrmigen H2Molekle ist grer als die Fluchtgeschwindigkeit. Wasserstoff ver schwindet im Raum, die Atmosphre reichert sich mit Sauerstoff an. Die O2-Anreicherung bersteigt einen Wert von 22-23% nicht. Ist gengend Wasser gespalten, reagiert Sauerstoff zu Ozon. Es bildet sich eine Ozonschicht um den Planeten, welche die harte Strahlung aus dem Sonnenlicht zurckhlt. H2O wird nun nicht mehr gespalten bzw. es stellt sich ein Gleichgewicht der beteiligten chemischen Reaktionen ein. Der O2-Pegel bleibt konstant. Wird zuviel Sauerstoff verbraucht (zum Beispiel durch Verbrennen von Erdl), wird das Sauerstoff-OzonGleichgewicht gestrt. Nach dem Massenwirkungsgesetz zersetzt sich Ozon wieder zu O2, bis sich das neue Gleichgewicht eingestellt hat. Auerdem kann wieder mehr Wasser in H2 und O2 gespalten werden, weil weniger Ozon in der Stratosphre ist. Im makroskopischen Be reich zeigt sich die Zerstrung des Ozon-Schutz-Schildes der Erde; ber einen langen Zeitraum, bis zur Einstellung der neuen Gleichge wichtslage, gibt es diese Schutzschicht nicht mehr. Hartwelliges UVund weiches Rntgenlicht knnen ungestrt die Erdoberflche errei chen und pflanzliches und tierisches Leben schdigen.

83

Der beschriebene Gleichgewichts- und Selbstregulierungsproze hngt vom Mengenverhltnis Wasser/Kohlenwasserstoffe ab. Auf der Erde gab es mehr Wasser als Kohlenwasserstoffe. Die beschriebene Entwicklung fand statt. Auf der Venus kehrte sich das Mengenverhlt nis Wasser/Kohlenwasserstoffe um. Der Proze der Wasserzersetzung mittels hartwelliger Strahlung erfolgte zuerst einmal analog zur Erde. Der entstandene Sauerstoff reagierte nun aber mit geeigneten Kohlen stoffverbindungen praktisch vollstndig zu Kohlendioxid, einem relativ schweren Gas. Daher ist der Atmosphrendruck der Venus sehr hoch und der Boden trocken. Durch die fast 100%-ige CO2-Atmosphre mit hohem Treibhauseffekt herrschen auf der Venus Temperaturen von 400-500C. Lge das Mengenverhltnis Wasser/Kohlenwasserstoffe gnstiger, wre auch die Venus ein Lebenstrger mit ausreichender O2Atmosphre und einer Jahresdurchschnittstemperatur von 30-38C geworden. Ein wichtiger kosmologischer Faktor fr die Entwicklung des Lebens ist nicht nur die Art des Planeten, sondern ebenso die Be schaffenheit der dazugehrigen Sonne beziehungsweise Fixsterns. Die Frage stellt sich: Welche Sonne erzeugt berhaupt Planeten? Die Entstehung der Planeten ist eine Funktion der Drehzahl der jungen Sonne. Diese Betrachtung ist natrlich auch fr das Sonnensy stem zulssig. Hier stellte sich die Frage: Wo verblieb die hohe, ur sprngliche Drehzahl der Sonne? Es handelt sich um den Faktor 100200. Bei geeigneter Drehzahl des Fixsterns und vorhandenem Magnet feld tritt Materie als heie Plasmamasse bei hohem Strahlungsdruck und hoher Zentrifugalkraft aus seiner quatorialebene. Die festen schweren Anteile (hierbei ist zu bedenken, da schwerere Elemente als Helium nur in geringem Ausma vorhanden sind, da der Stern fast nur aus Wasserstoff und Helium besteht) verbleiben als kleinere, schwere Planeten in der Nhe der Sonne, die flchtigen Stoffe bilden die Gasrie sen (gefrorene Gase) am Rande des Planetensystems. Die Gasriesen stabilisieren mit ihrem Gravitationsfeld die Bahnen der inneren Plane ten.

84

Mgliche Lebenstrger sind geschtzt. Mit der Bildung des Plane tensystems verringerte sich die Drehzahl der jungen Sonne. Die Dreh zahl der Fixsterne lt sich mit Hilfe spektroskopischer Methoden be stimmen. Nun haben etwa 10% der Sterne die Drehzahl der Sonne. 10% der Sterne sind folglich ber ihr Planetensystem potentielle Lebenstrger. Bezogen auf unsere Galaxis betrifft dies 10 Milliarden Sterne. Legt man willkrlich fest, da auf unserem Planeten ein mittlerer Entwicklungs grad des intelligenten Lebens erreicht wurde, so kann man davon aus gehen, da Planeten von zirka 3 Milliarden Sternen als Lebenstrger unseres Entwicklungsniveaus existieren. Intelligenz und Bewutsein wre in den Galaxien ein weit verbreitetes Phnomen.

85

INTERAKTION ZWISCHEN GEIST UND MATE RIE


Die moderne Naturwissenschaft beschreibt die unbelebte und be lebte Natur und behandelt die vier Naturreiche Mineralreich, Pflanzen reich, Tierreich und Mensch mit den Disziplinen Physik, Biologie, Psychologie, Philosophie. (Da die Chemie nach heutiger Kenntnis ein Teil der Elektronenphy sik ist, gengt es, die Physik allein zu nennen). Dies entspricht den vier Wesensgliedern: Materieller Krper, vitaler Krper, emotionaler Krper, mentaler Krper. Da es darber hinaus weitere Wesensglieder gibt, soll zunchst un bercksichtigt bleiben. Jeder der Bereiche hat eine eigene Logikstruktur und die Bereiche stehen untereinander in Wechselwirkung. Bis vor kurzem und zum Teil auch heute noch galt die materielle Seinsschicht als die einzig existierende. Da jeder Vorgang in den hhe ren Seinsschichten wegen der Wechselwirkungen stets auch Begleiter scheinungen in der untersten, materiellen Schicht aufweist, kommt man leicht zu diesem Irrtum. Als wichtigster Vertreter dieses Materialismus wird meist Sir Isaak Newton bezeichnet, doch dies ist ebenfalls ein Irr tum. Newton war ein Esoteriker, der zwar auch die Physik ausfhrlich beschrieb, doch ebenso geistige Phnomene beachtete. Er war seiner Zeit weit voraus und wute bereits, da Lebensvorgnge im Organis mus von Biophotonen gesteuert werden.

86

Die moderne Quantenphysik hat gezeigt, da die zweiwertige Ari stotelische Logik (tertium non datur, der Satz vom ausgeschlossenen Dritten) nicht geeignet ist, den Kosmos richtig zu beschreiben. Daher wurde eine polyvalente Logik entwickelt, die zusammen mit der Quantenphysik in der Lage ist, die Gesetze in allen Seinsbereichen zu finden und auch die Entstehung des Kosmos zu beschreiben. Den we sentlichsten Beitrag hierzu hat der Schler von Werner Heisenberg und Carl Friedrich von Weizscker, Burkhard Heim gebracht. Seine beiden Lehrer haben bereits auf die Notwendigkeit einer po lyvalenten Logik hingewiesen und auch auf die Notwendigkeit, eine der Quantisierung Rechnung tragende neue Mathematik zu entwickeln, da die heute noch benutzte Infinitesimalrechnung im Mikrokosmos ver sagt, weil sie der Quantisierung von Raum und Zeit widerspricht. Hier auf aufbauend entwickelte Burkhard Heim einen zwlfdimensionalen Kosmos mit den physikalischen Dimensionen X1 bis X6: Raum (Lnge, Hhe, Tiefe), Zeit, Strukturmglichkeiten, Realisierung spezieller Strukturen und den nichtmateriellen Dimensionen X7 bis X12: Infor mation I (X7, X8) und geistiger Hintergrundraum G4 (X9 bis X12). Aus den Arbeiten des Mathematikers und Logikers Kurt Gdel hat der theoretische Physiker Wolfram Schommers klar erkannt, da die Physik mit der Metaphysik verwoben ist. Daraus ergibt sich, da die Entwicklung des Kosmos mit G4 begann und die Materie erst spter entstand. Die geistigen Urbilder waren zuerst da. Die Heim'sche Theo rie ist computergeprft und stimmt bis zur letzten Dezimale mit Me werten berein. Es ist die am grndlichsten geprfte Theorie und sie stimmt mit alten philosophischen Lehren in Ost und West berein, die in frheren Kulturen auf Grund von Eingebungen (Offenbarun gen) bekannt wurden. Die Entwicklung des Kosmos erfolgte somit in zwei Schritten: die Entstehung der geistigen Urbilder und die Entste hung der Materie. Die Urbilder werden in religisen Texten LOGOS genannt. In einer der Offenbarungen (die heute englisch channeling genannt werden), nmlich im Johannes-Evangelium, beginnt der Text richtig bersetzt

87

mit: Das Kopfwesen ist der LOGOS, wobei Kopfwesen ein alter Ausdruck fr Zentrum ist. Dies ist ein rumlicher und kein zeitlicher Begriff. Auch dies stimmt mit der modernen Naturwissenschaft ber ein, in der auch die Zeit als eine Raumkoordinate auftritt. Dies geht auf den Mathematiker Hermann Minkowski (1864-1909) zurck (Min kowski-Raum). Der Minkowski-Raum fat Raum und Zeit zu einem vierdimensionalen berraum zusammen, den auch Albert Einstein in seiner Relativittstheorie benutzte. Um die Zeit t in eine rumliche Di mension s zu verwandeln, wird sie mit der Lichtgeschwindigkeit c = s/t multipliziert: ct = s. Da es nicht vorstellbar ist, zu drei Raum-Dimensionen eine vierte hinzuzufgen, die auf allen drei Raumdimensionen senkrecht steht (in der Mathematik ist das mglich), wird die vierte Raumdimension mit der imaginren Einheit i = ...-1 multipliziert: ict = is. Es ist auerordentlich bemerkenswert, da sich diese von Minkows ki ad hoc eingefhrte Schreibweise logisch aus der Heimischen Theorie ergibt, also als richtig besttigt werden konnte. Tatschlich ergeben sich die Dimensionen X4 bis X12 mathematisch smtlich als mit i multipli ziert. Sowohl die moderne Naturwissenschaft als auch esoterische Schriften stimmen darin berein, da es die Zeit nur fr unser Bewut sein gibt, tatschlich aber alles gleichzeitig vorhanden ist. Was wir als Zeit empfinden, ist eine Bewegung durch Parallelwelten. Daher ist es auch fr begabte Menschen mglich, in die Zukunft zu schauen, da sie eigentlich gleichzeitig mit unserer Welt existiert. Hier mu eine Bemerkung zur Frage der Determination einge schaltet werden: Aus der modernen Naturwissenschaft (insbesondere der Heim'schen Theorie) folgt, da es - zufolge der Heisenberg'schen Unschrferelation - viele mgliche Strukturen in vielen Parallelwelten mit einer gewissen Unschrfe gibt. Was durch unseren Weg durch die Parallelwelten herausgenommen (realisiert) wird, hngt von unserem Verhalten ab, wobei insbesondere das kollektive Verhalten einer gre ren Anzahl von Menschen magebend ist. Daher ist ein Blick in die

88

Zukunft immer mit Unschrfe behaftet. Die oft behauptete Selbstor ganisation besteht nur scheinbar: alles wird vom G4 aus gesteuert. Wenn man heute immer wieder hrt, das Verhalten von Tieren ist ge netisch einprogrammiert, so ist das zwar richtig, aber die Frage: Von wem?, bleibt offen. Die richtige Antwort lautet: Vom G4." Auch die Frage, wie aus der Kohlenstoffchemie die groe Vielfalt der organischen Molekle entstehen kann, luft auf die Frage hinaus, woher die symmetrische Struktur des Kohlenstoff-Atoms kommt; das heit, woher die Gesetze der chemischen Bindungen stammen. Alles dies sind geistige Urbilder. Um die Materie zu verstehen, mu man im Mikrokosmos anfangen, nmlich bei den Elementarteilchen. Die hhe ren Seinsschichten benutzen die Gesetze der Physik fr ihre Belange, knnen aber auch ohne Materie existieren, wie auerkrperliche Erfah rungen zeigen, die heute mehr und mehr auftreten. Burkhard Heim ging in seiner Theorie zunchst von den Elemen tarteilchen aus, um spter auch die Strukturen in hheren Seinsschich ten zu ergrnden (wozu er seine polyvalente Logik brauchte). Grund stzlich unterscheidet man zwei Arten von Elementarteilchen: solche mit Ruhemasse, die auch in Ruhe eine Masse (und nahe der Erde ein Gewicht) haben, und masselose, das heit, die keine Ruhemasse haben. Die wichtigsten Quanten ohne Ruhemasse sind die Photonen. Die Ma sseteilchen sind hauptschlich im Atomkern (Nukleus) konzentriert (die Elektronen tragen nur zirka 0,5 Promille zur Atommasse bei). Vergrert man in Gedanken den Atomkern auf die Ausdehnung eines Stecknadelkopfes (zirka 1 mm Durchmesser), so betrgt der Durch messer des gesamten Atoms zirka zehn Meter! Der gesamte Raum der Materie besteht demnach nur aus winzigen Pnktchen mit Masse, die vergleichsweise riesengroe Abstnde voneinander haben. Der Zwi schenraum ist - materiell betrachtet - leer, jedoch angefllt mit Fel dern. Materie besteht somit im wesentlichen aus Feldern. Diese Felder werden durch Quanten ohne Ruhemasse zusammengehalten, vor allem durch virtuelle Photonen. Diese bestimmen auch die Struktur der Mate rie, sind also der Materie bergeordnet. In der Physik werden sie Wech selwirkungsquanten genannt. Der Physikochemiker Ilya Prigogine (geb.

89

1917) drckte die Bedeutung dieser Quanten einmal so aus: Wenn ich altere, ndern sich nicht meine Molekle, sondern die Wechselwirkungs quanten. Das Verhltnis der Anzahl von Ruhemasse-losen Quanten (Photo nen) zu Quanten mit Ruhemasse (Nukleonen) wird PhotonenNukleonen-Verhltnis genannt. Der Mewert dafr ist seit langem be kannt und wurde quantenphysikalisch von dem Physiker Jules T. Muheim an der ETH Zrich in bereinstimmung mit dem Mewert be rechnet. Dieses Verhltnis betrgt 9,746 x 108 oder ungefhr eine Milli arde zu eins. Im Kosmos und auch im menschlichen Krper gibt es nahezu eine Milliarde mal mehr Biophotonen als Materieteilchen! Wie eingangs erwhnt, hatte bereits Newton diese Vorstellung. Man stelle sich dies einmal plastisch vor: Unser Krper besteht fast nur aus Feldern, erscheint uns aber doch konkret und fest. Der Physi ker Friedrich Hund (1896-1997) schrieb ein interessantes Buch Materie als Feld, wobei er die physikalischen Konsequenzen aus obigem dar legte. Wenn zwei Krper Zusammensten, stoen sich lediglich Felder ab; die Atomkerne, also die eigentliche Materie, knnen sich auf unse rer Erde nie berhren (anders sieht es in Neutronensternen aus). Das Bohrsche Atommodell mit Elektronenbahnen um den Atom kern ist lngst berholt. Man mu sich die Atomhlle wie eine Wolke aus elektrischen Feldern vorstellen, die hnlich den Chladnischen Klangfiguren dreidimensionale Knotenflchen aufweisen. Die Schulphysik gibt heute zwei quivalente Gleichungen zur Be rechnung der Elementarteilchen an: die anschauliche Wellengleichung von Erwin Schrdinger und die abstrakte Matrizengleichung von Wer ner Heisenberg. Dies spiegelt den Welle-Teilchen-Dualismus wider, der von Burkhard Heim erklrt wurde. Seine Theorie ist die Synthese aus den beiden bekannten und geht noch darber hinaus, da sie als einzige in der Lage ist, smtliche Eigenschaften der Elementarteilchen exakt zu berechnen - wie schon erwhnt - in hundertprozentiger bereinstim

90

mung mit Mewerten. Die Heim'sche Theorie zeigt, da die oben ge nannten vier Seinsbereiche Unterschichten haben, die ihrerseits in Wechselwirkung stehen. Schlielich kann die Heim'sche Theorie auch Existenzhinweise auf hhere Seinsschichten geben.

Das einheitliche Beschreibungsmodell von Burkhard Heim


In der theoretischen Physik wurden wiederholt Versuche unter nommen, eine sogenannte Weltformel aufzustellen, mit der nahezu alles berechenbar sein soll. Tatschlich - davon gehen international renommierte Physiker derzeitig aus - ist dieses bereits seit geraumer Zeit gelungen (Ernst Senkowski, Wolfgang Ludwig usw.). Fern ab von der ffentlichkeit arbeitete Burkhard Heim, ein Schler vom Nobel preistrger Werner Heisenberg, eine physikalisch-mathematische Struktur aus, welche genau diesen Anforderungen gerecht wird. Was Insider seit geraumer Zeit bereits wissen und Kritiker, die seine Berechnungen widerlegen wollten (falsifizieren), erfahren muten: Burkhard Heim gilt als der herausragendste deutsche Physiker ber haupt. In einem Vortrag, gehalten von dem Physiker Illobrand von Ludwiger, am 22.1.2002 an der Universitt Sussex, England, in dem es um die Arbeit von Burkhard Heim ging, wurde dieser Mann als das Gegen stck zu Stephen Hawking bezeichnet. Burkhard Heim entdeckte die einheitliche Massenformel, was soviel bedeutet wie die von allen Physi kern gesuchte groe Vereinheitlichung, was einer Weltformel gleich kommt! Die Max Planck'sche Quantenphysik und die Theorien von Albert Einstein waren die bahnbrechenden, wissenschaftlich-physikalischen Erkenntnisse und Errungenschaften des letzten Jahrhunderts. Albert Einstein hatte Verhltnisse und Rume beschrieben, welche im mak rokosmischen Bereich, also im Groen, im Kosmologischen funk

91

tionieren. Max Planck ging genau in die andere Richtung. Er beschrieb Dinge, welche im Mikrokosmos, im ganz Kleinen ablaufen, auf ato marer Ebene, und nannte dies Quanten-Physik. Werner Heisenberg forderte die mit Einbeziehung des Geistigen nach dem Prinzip: Man kann keine Physik machen ohne den Geist (der Beobachter beeinflut das Experiment). Diese beiden Theorien standen eine lange Zeit lang einfach so ne beneinander, ohne da sie recht zusammen zu passen schienen. Burkhard Heim kreierte eine erweiterte Feldtheorie, in der er zunchst nicht nur von vier Dimensionen (Hhe x Breite x Tiefe = Raum) und der Zeit ausging, sondern noch eine fnfte und sechste Di mension mit einbaute, die als Steuerungsebene in Erscheinung tritt. Burkhard Heim erkannte, da jeder von uns einen eigenen Bewutse insraum hat, durch den er mit der Welt um ihn herum in Interaktion tritt. Jeder dieser Bewutseinsrume ist in sich vier-dimensional, also rumlich inklusive einer Zeitkomponente. Es gibt den ueren Bewut seinsraum, und den eigenen, inneren Bewutseinsraum. So hat jeder Mensch einen eigenen Bewutseinsraum, der mit dem allgemeinen in Kontakt tritt. Um all diese Bewutseinsrume zu beschreiben mu man mindestens eine fnfte Dimension mit einbauen, die all die Bewutse insrume miteinander verbindet. Die klassische Wissenschaft sagt, da das Lehen ein Produkt der Materie ist. Burkhard Heim hingegen erklrt: Der Lebensproze ist ein Aspekt, welcher der Physik zugrunde liegt, der sich vom physikalischen Universum nicht trennen lt.

92

WAS IST LEBEN?


Jeder von uns ist ein geistiges Wesen, demzufolge knnte Leben de finiert werden als eine Verbindung eines geistigen Wesens mit einem ma teriellen Krper. Der materielle Aspekt lt sich allerdings nicht voll stndig beschreiben, ohne seine Beziehung zum geistigen Aspekt zu verstehen. Der Proze, der Materie und Geist verbindet, mte nach diesem Verstndnis die Grundlage der Physik bilden, ohne den sich die Atomtheorie und die Kosmologie nicht verstehen lt. Dann kommen wir zu einem Weltbild, das mit unserem heutigen physikalischen Welt bild nichts mehr zu tun hat. Mit anderen Worten: keine Physik ohne die Miteinbeziehung des Geistes. Wenn wir durch die Welt schreiten, ver wechseln wir das Bild der Wirklichkeit mit der Wirklichkeit selbst. Wir leiten daraus ab, da es eine uere Wirklichkeit gibt. Die Kosmologie zum Beispiel zeigt, da es so nicht stimmt. Wenn wir einen Stern sehen, knnte es zum Beispiel sein, da dieser Stern schon seit Milliarden von Jahren nicht mehr existiert. Der private Bewutseinsraum (vierdimen sional) steht mit dem Welt-Bewutseinsraum in Beziehung. Jeder von uns hat einen solchen Bewutseinsraum, der sich im WeltBewutseinsraum befindet. Eine Kommunikation findet statt durch eine Interaktion in dem gesamten Bewutseinsraum. Um all die Rume zusammen zu bringen, braucht man mindestens fnf Dimensionen. Zustzlich existieren Parallel-Rume, auf denen wir theoretisch auch kommunizieren knnen (zum Beispiel durch Telepathie). Betrachten wir nun einmal das brillante physikalische Modell, von Burkhard Heim: sein Ausgangspunkt ist die Gravitation. Nach Einstein entspricht jeder Energie eine bestimmte Masse. Von dieser Masse wis sen wir, da sie ein Gravitationsfeld (e = mc2) hat. Das Gravitationsfeld hat eine Masse, und die Masse wieder ein Gravitationsfeld. Zwischen beiden Gravitationsfeldern besteht eine Wechselbeziehung. Heim ent wickelte mathematisch eine kleinste Flche, welche er als Metron be zeichnet. Es ist sozusagen die kleinste Flche, die vorstellbar ist (physi kalisch und mathematisch gesehen ergibt alles noch kleinere keinen

93

Sinn mehr). In Zahlen ausgedrckt ist diese Flche 6.15 x 10-70 m klein. Metronen sind mit den uns bekannten Neutrinos identisch. Das Univer sum ist vollstndig auf diesen Metronen (Neutrinos) aufgebaut, wobei ein Tau, wie Heim es nennt, den Flcheninhalt eines Metrons (Neu trino) ausmacht. Das Metronenmodell ist als die Quantisierung des Raumes zu bezeichnen. Es ist durchaus mathematisch nachzuvollzie hen, da sich das Heim'sche Modell als weitaus umfassender und przi ser darstellt, als die aktuell angebotene String-Theorie. Heim entwikkelte in Jahrzehnten eine Physik, welche grundlegend auf 36 physikali schen Gleichungen basiert. Aus diesen Gleichungen lt sich eine Ma trix von 6 zu 6 Dimensionen entwickeln. Einstein hingegen baute sein Welt-Modell auf 4 zu 4 Dimensionen auf. Burkhard Heim geht also von einer sechsdimensionalen Raum-Zeit aus (spter werden wir sehen, da es sich tatschlich um 12 Dimensionen handelt). Burkhard Heim bentigt zur ganzheitlichen Darstellung einen sechsdimensionalen Raum und weist nach, das diese weder rumlich noch zeitlich sind. Sie sind quasi imaginrer Art, hnlich der vierten Dimension. Die fnfte Dimension ist der Ordnungsgrad- oder Entropie-Ebene zugeordnet. Komplexere Systeme liegen hher in der fnften Dimension. Die sechste Dimension hat eine steuernde und/oder aus whlende Funktion. Aus der fnften Dimension betrachtet, wre es hnlich wie mit den Seiten eines Buches, die gestapelt sind. In dieser Analogie wrde jede Seite eine vierdimensionale Welt ausmachen. Aus der sechsten knnte man nach dieser Darstellung alle fnf untergeord neten Dimensionen steuern. Im sechsdimensionalen Raum ist jeder Punkt ein dreidimensionales Gebilde, das sich auf der Zeitachse bewegt. Heim hat nachgewiesen, da es keine weiteren Hyperrume gibt. Der sechsdimensionale Hyperraum besitzt noch einen zwlfdimensionalen Hyperraum, auf den man alles erweitern kann. Dann kommt der Ok tavsprung. Dort geht es nicht mehr weiter. In den Ebenen der fnften und sechsten Dimension verbirgt sich das, was wir mit Persona, Geist, Seele und so weiter bezeichnen - eine Art bildliches Diagramm eines Lebewesens, welches ber Gravitations

94

wellen als Informationskanal mit den unteren (1.-4.) Dimensionen kommuniziert. Zwischen diesen Welten liegen nicht Lichtjahre - wie bei der Serie Raumschiff Enterprise -, sondern unter Umstnden kom men Besucher aus anderen Welten einfach aus diesem anderen Bereich der fnften und sechsten Dimension. Der Urknall ist ein gesteuertes Ereignis der hheren Dimensionen!

Feldtheorie nach Burkhard Heim und der Transzendente Raum G4


Beginnen wir mit den Qualitten: Qualitten, zum Beispiel Farben, haben im naturwissenschaftlichen Weltbild keinen Platz. In der Physik spricht man in diesem Fall von Frequenzen. Auch Klang oder Geruch sind Qualitten, die in der Na turwissenschaft nicht darstellbar sind. Alles, was existiert, mu in der Physik in das Kartesianische Koordinatensystem eingefgt werden knnen - alles andere existiert nicht. Klnge, Farben, Gerusche oder Geschmackswahrnehmungen knnen nicht organisch eingefgt wer den. Jede dieser Qualitten fllt einen eigenen Raum... Max Planck meint hierzu: Man bekommt die Qualitten genauso wenig in die Naturwissenschaften hinein, wie man eine Bleistiftzeichnung mit einem Bleistift kolorieren kann Man kann zwar blau, gelb, rot usw. darauf schreiben, doch mit dem Bleistift auf keinen Fall darstellen...). Gefordert wird etwas auerhalb des Systems (hier auerhalb des Bleistift-Modells). Es stellt sich zunchst einmal die Frage des Seins und nach der Umgebung des Seins... Die Prgung (Konditionierung) des Begriffes Sein ist im allgemei nen, gesellschaftlichen Bewutsein eher etwas Positives, wo hingegen das Nichts eher als negativ eingestuft wird. Das Dilemma der Natur wissenschaft ist, da sie auf der einen Seite versucht, objektiv zu sein, dabei aber die wesentlichen Aspekte unseres Lebens einbt.

95

Betrachten wir uns dieses Nichts einmal etwas genauer: Existenz kommt von (lat.) heraustreten. Es tritt aus dem Nichts heraus, dann ist es pltzlich da. Das Nichts ist uns verborgen,-doch es ist alles, was uns ausmacht! Nichts ist subjektiv. Burkhard Heim wagte sich mit der Physik immer weiter in diesen Raum hinein, der heutzutage an den Universitten zum Raum des Nichts gehren wrde, und der existiert bekanntlich nicht. So ist tatschlich durch die Mathematik zu belegen, was nach dem Tod eines Lebewesens tatschlich passiert, wobei die Schlufolgerung ist, da es eine quasi parallele Raum-Zeit gibt, in wel cher wir parallel existieren. Heim nennt dies Postmortale Zustnde. Heim ging es zunchst darum, einen Formalismus, eine Logik zu ent wickeln, mit welcher man die Aspekte beschreiben kann, die in unserer Gesellschaft - auch in der Naturwissenschaft - nicht beachtet werden. Die Physik, die sich dahinter verbarg, war im Grunde nur ein Neben produkt. Deshalb stellte er sich die Frage, was Realitt und Wirklichkeit ist. Wirklichkeit ist das, was wirkt; Realitt ist das, was dahinter verbor gen liegt. Was wir erfahren, ist die Wirklichkeit. Und was ist Realitt? Whlen wir die wissenschaftliche Herangehensweise. Hypothese A: Es gibt nur die Physis und sonst nichts, Alles, was in der Raum-Zeit Platz hat, ist die Realitt; alles andere sind die Effekte, die daraus abzu leiten sind. Aus diesem Grund braucht unsere Wissenschaft sich auch nur mit der vier-dimensionalen Raum-Zeit zu beschftigen. Von der Physik leitet sich die Chemie ab, daraus die Bio-Chemie, dann die Bio logie; und weiter knnen wir dann die Neuro-Physiologie ableiten. Hieraus entwickelt sich die Psychologie, die Soziologie und so weiter...

Die (fast) unbemerkte Revolution in der Naturwissenschaft


Das, was sich quasi hinter den Kulissen der groen Forschungszen tren zu einer exotisch erscheinenden Wissenschaft etabliert hat, ist von einer noch unvorstellbar bedeutungsvollen Tragweite auf nahezu alle Gebiete der Naturwissenschaft. In dem Fachjournal Spektrum der Wissenschaft (2, 2003) widmete der Verlag einige Sonderausgaben zum Thema der Quantenfeldtheorie. 96

So wurde im Editorial bereits unmiverstndlich zum Ausdruck ge bracht: Die Quantenphysik hat zu einer der bedeutendsten Revolutionen in unserem naturwissenschaftlichen Weltbild gefhrt, in ihrem Ausma hchstens vergleichbar mit der kopernikanischen Wende vor einem halben Jahrtausend. (U. Reichert). Das besondere an der Quantenphysik ist einmal, da sie die logisch erscheinende Naturwissenschaft (klassische Physik) auf den Kopf zu stellen scheint. So uerte sich der Nobelpreistrger und Mitbegrnder dieser Wissenschaft, Niels Bohr, hierzu: Wer ber Quantenmechanik nachdenken kann, ohne wirr im Kopf zu werden, hat sie nicht wirklich verstanden. Eine der Eigentmlichkeiten der Quantenphysik basiert auf dem Umstand, da die Grenzen zwischen Welle und Teilchen, also Materie und Nicht-Materie zu verschwimmen scheinen, oder sich gar ganz auflsen. Wer ist denn darber informiert, da unsere gesamte Elektro nik - von unseren Radios, Computern, bis zu den Kernkraftwerken ohne die bahnbrechenden Entdeckungen der Transistoren nicht mg lich gewesen wren, um hier nur eine, aus der Quantenphysik abgelei tete Innovation hervorzuheben. Obwohl Max Planck die Quantentheorie mit Niels Bohr begrnde te, konnte er selbst sich nie so recht mit ihr anfreunden. Das sonderba re Verhalten der Quanten narrt den gesunden Menschenverstand: Es ist schwer zu begreifen, da man Wellen (wie Licht) als Teilchen und Ma terieteilchen (wie Elektronen) betrachten kann, als zwei Ansichten ein und desselben Quantenfeldes; da ein Teilchen sich an zwei Orten oder in zwei Zustnden gleichzeitig befinden kann. Es ist tatschlich schwer, sich vom klassischen Determinismus zu verabschieden und in der Welt des allerkleinsten Wahrscheinlichkeiten zu akzeptieren. Und dennoch haben alle Experimente die Modelle besttigt. In Bose-EinsteinKondensaten sind sogar ber eintausend Atome bei extremer Klte zu einem einzigen sichtbaren Quantenzustand vereint. Verschrnkte Photonen ermglichen eine Teleportation von Teilchen ber makro

97

skopische Distanzen. Die Quantenwelt ist wirklich so seltsam, oh es uns nun pat oder nicht, resmieren Max Tegmark und /. Archibald Wheeler, die so etwas wie die gegenwrtige, geistige Elite darstellen (Princeton University). Stellen wir nun die Quantenphysik in den Betrach tungsrahmen der bio-physikalischen Aspekte, erhalten wir hierdurch erstmalig einen bedeutsamen Schlssel zum genaueren Verstndnis der biologischen Funktionen in ihren Grundlagen. Die hierdurch ermg lichte Perspektive der Betrachtung von elementaren bio-physikalischen Strukturen erscheint zunchst in einem Bild der Unglaubhaftigkeit und der Verwirrung. Trsten wir uns damit, da selbst herausragende Wis senschaftler von Weltruf anfnglich hnliche Beurteilungen hierzu ab geben. Vergessen wird den Fakt, da die tatschlichen, urschlichen Me chanismen und Strukturen eines jeden materiellen Systems auerhalb unserer Beurteilungsfhigkeit liegt. Biologische Systeme wurden bisher in der allgemein praktizierten Naturwissenschaft nahezu berwiegend physikalisch betrachtet, wobei gerade das Phnomen Leben sich deutlich durch nichtmaterielle, also geistige Prozesse, definiert. Eine willkrlich durchgefhrte Trennung zwischen Geist und Materie fhrte unter anderem dazu, da die elementaren Zusammenhnge und Wech selwirkungen der Biologie unverstanden blieben. Dabei ist doch gerade unser Geist, zum Beispiel unser Verstand, das eigentliche Element der Wahrnehmung, des Erkennens und Hinterfragens, wie beispielsweise das seiner eigentlichen Funktionalitt. Auf den elementarsten Ebenen der Materie vollzieht sich ein Szenarium, welches die Grenzen zwischen Geist und Materie (Welle/Teilchen) verwischt. Paradox und wider sprchlich erscheint hier die Bhne der Realitt. Nur zu gut ist an die ser Stelle der Ausspruch von Albert Einstein zu verstehen: Gott wr felt nicht. Heute, nahezu zwei Generationen spter, offenbart sich der Natur wissenschaft zwar noch ein hnliches Bild der Absonderlichkeiten, doch sind uns hierfr uerst scharfe Interpretations-Modelle in die

98

Hand gegeben. Was liegt nach hundert Jahren Quantentheorie nun vor uns? Welche Rtsel bleiben? Warum gibt es Quanten? Hierzu widmete das Spektrum der Wissenschaft (1, 2003) eine Sonderausgabe Vom Quant zum Kosmos. Unter anderem uerte sich hierzu der emeritierte Professor der Theoretischen Physik, Dieter Zeh (Universitt Heidelberg): Debatten um die richtige Interpretation der Quantenmechanik lassen sich grob in einem hierarchischen Schema anordnen, wobei sich jede -zumindest im Prinzip -von fundamentaleren Theorien herleiten, die in der Hierarchie ber ihr stehen. Ganz oben thro nen die Allgemeine Relativittstheorie und Quantenfeldtheorie. Die Schicht darunter umfat Spezielle Relativittstheorie und Quantenmecha nik, die ihrerseits Elektromagnetismus, klassische Mechanik, Atomphysik usw. unter sich haben. Fachgebiete wie Informatik, Psychologie und Medi zin erscheinen in diesem Schema tief unten. Ich mchte dem Leser mit der Darstellung dieser neu zu bewerten den Physik - der Quantenfeldtheorie - lediglich eine glaubhafte und schlssige Grundlage vermitteln. Nicht zuletzt deshalb, weil der Leser dieses Buches mit Beschreibungen der Wissenschaft konfrontiert wird, die er ohne diese Werbung nicht akzeptieren wrde. Auch so werden wir bei dem Betrachten der folgenden Kapitel sicherlich sehr schnell an die Grenze der Glaubhaftigkeit gefhrt. Natrlich obliegt es der Beur teilung eines jeden, ob und inwieweit sich an den entsprechenden Stel len der Glaube zu den Beschreibungsmodellen tatschlich einstellt. Si cherlich ist mit den hochgepriesenen Quantenfeldmodellen auch nicht die letzte Frage geklrt (wre auch schade...), jedoch liefert sie uns das zur Zeit schrfste Instrument zur Beschreibung und Erklrung des materiellen Seins. In den folgenden Kapiteln werden wenige, ausgewhlte Modelle hierzu vorgestellt. Diese Modelle zhlen bei der wissenschaftlichen Elite, in dem Kontext der entsprechenden Frage, zu den ernstgenommensten.

99

Quantenphysik und Gehirn


Fotos von Gott? Andrew Newberg (University of Pennsylvania) machte in einem La bor Fotos von dem, was Glubige die Gegenwart Gottes nennen. Er untersuchte Buddhisten und Franziskaner-Nonnen im Zustand von Gebet und Meditation. Newberg entdeckte, da an der Hinterseite des Gehirns ein kleiner Bereich existiert, der kontinuierlich die rumliche Orientierung eines Menschen berechnet, den Sinn also dafr, wo die Grenzen des eigenen Krpers liegen. Auch das in den Scheitellappen befindliche Orientierungs-Assoziations-Areal (OAA) war bei allen Versuchsteilnehmern besonders inaktiv. Die Aufgabe dieser Hirnregion ist es, uns die physischen Grenzen unseres Krpers zu vermitteln sowie Informationen ber Zeit und Raum weiterzugeben. Wird nun ein Teil dieser Funktionen inaktiv, wie es whrend einer Meditation der Fall ist, so schwindet der Bezug zu Zeit und Raum. Es entsteht dadurch eine Erfahrung, die als Gefhl der Ewigkeit und Endlosigkeit beschrieben wird. Offenbar findet hier eine bewute Ankopplung zum Hyperraum (>X4) statt. Das bewirkt ein Verschwimmen der Grenzen zwischen dem Selbst und der Welt, erklrte Newberg. Er fgte hinzu: Wenn man weit genug geht, lst sich das Selbst komplett auf, und man sprt ein Gefhl der Einheit, der unendlichen Grenzenlosigkeit. Der Neurologe Vilayanur Ramachandran (University of California in San Diego) identifizierte eine Region im Gehirn, die er als GottesModul bezeichnet. Dieses Gottes-Modul steht seiner Meinung nach in enger Verbindung mit spirituellen Gedanken. Ramachandran beobach tete bei Epilepsie-Patienten im Schlfenbereich unkontrollierte elektri sche Erregungen whrend ihrer Anflle. Die Betroffenen selbst berich teten von spirituellen Visionen und anderen intensiven religisen Erfahrungen. Ein Gefhlsreichtum, den sich alle Glaubensrichtungen in ihren Ri tualen zunutze machen, meint Andrew Newberg. Die Ablufe einer religisen Zeremonie unterschieden sich so sehr von Alltagssituationen,

100

da das Gehirn ihnen automatisch den Stempel besonders bedeutend aufdrckt. Um diese Ergebnisse und Interpretationen entsprechend deuten zu knnen, widmen wir uns nun den hierfr erforderlichen Grundlagen. Aus der Neurologie ist bekannt, da eine Korrelation zwi schen den erhhten Amplituden unserer Neuronen und dem Grad un serer Aufmerksamkeit besteht. Diese Aussage hat weitreichendere Konsequenzen, als uns der erste Eindruck vermitteln mag! Die Tatsache, da im ganzen Gehirn erhhte Amplituden gemessen werden knnen, bedeutet, da hier eine groe Anzahl von Neuronen in gleicher Frequenz schwingen. Dieses ent spricht einem hohen Ma an Kohrenz. Der Bio-Physiker Fritz Albert Popp bemerkte hierzu: Vernderte Bewutseinszustnde wie Entspan nung und Meditation knnen als eine Art Kohrenz im langwelligen Be reich unseres Biophotonenfeldes aufgefat werden. Nachweislich erhhten sie die Kohrenz der gemessenen Gehirn wellen und fhrten hchstwahrscheinlich zu einer Erweiterung des Be wutseins. Des weiteren ist zu bemerken, da die hohe Kohrenz den Photonen die Fhigkeit verleiht, Ordnung zu bilden und Informationen zu bermitteln (Kohrenz ist die Fhigkeit der Wellen zur berlage rung, zur Interferenz, wobei sich die Feldamplituden rumlich ver schiedener Photonenquellen gegenseitig verstrken oder abschwchen. Dadurch entsteht ein geordneter Zustand, bei dem die Wellen ein zu sammenhngendes und kommunikatives Feld bilden und in hohem Mae aufeinander ausgerichtet sind; bei nicht kohrenten - chaotischen oder thermischen - Photonen hingegen brechen die Interferenzen nach sehr kurzer Zeit zusammen; 10-3 bis 10-5 Sekunden). Die Eigenschaften der gemessenen Gehirnwellen deuten unter ande rem auf eine direkte Ankopplung an eine spezielle, nichtmaterielle Ebe ne hin. Das, was wir in der Physik als den Vakuumraum bezeichnen, ist offenbar die Quelle aller Information an sich (nicht zu verwechseln mit einem absolut leeren Raum).

101

Information, Struktur und Bewutsein sind eng verknpft mit der Struktur des Vakuum-Feldes.
Der oft zitierte Physiker Fritz Albert Popp weist darauf hin, da sich biologische Systeme dem Vakuum gegenber anders verhalten mssen als die isolierten freien Atome in den Modellvorstellungen der Physi ker. Die Atome befnden sich im Gewebe in einer Hohlraum-Situation, womit der berhmte Casimir-Effekt eine Rolle spiele. Dadurch wrden sie nicht mehr mit einem unendlichen Vakuum wechselwirken, sondern das Vakuum werde durch den Hohlraum eingeschrnkt. Durch die Wechselwirkung mit dem Vakuum erhalten Zellen und andere Hohlrume - in ihrer Funktion als Hohlraumresonatoren - eine ganz neue Bedeutungsebene. Die groe Bedeutung der DNS besteht darin, da sie ein idealer Hohlraumresonator ist. Unsere Erde als Kugel-Hohlraumresonator (7,8 Hz) bildet bei spielsweise durch eben diese Eigenschaft automatisch eine Stehende Welle, welche durch entsprechende em-Felder aufgebaut wird. Tatsch lich sieht es so aus, da Kontraktion und Expansion der DNS, ihr Pul sieren also, auf ein Zusammenwirken der attraktiven Casimir-Kraft (und der repulsiven Exciplexbildung) zurckzufhren ist. Die Wech selwirkung mit dem Vakuum kann tatschlich als mgliche Triebkraft der Evolution betrachtet werden. Fritz Albert Popp wagt die Prophezeiung, die DNS werde sich als Schnittstelle zwischen Nichts und Etwas, zwischen Vakuum und Biolo gie herausstellen. Die innere Ausrichtung der Chromosomen und Centriolen erfolgt wie unsichtbar gefhrt - wie die bekannten Feldlinienverlufe in Abbil dung 8 (Erde). Die hauptschlichsten Eigenschaften des Hohlraumre sonators sind im besonderen: 1. Aufbau einer Stehenden Welle (ortsfester Wirbel), und 2. seine Resonatorgte.

102

Abb.5: Ablaufproze einer Manifestation am Beispiel eines Gedankens bzw. einer Idee: senden.

Abb.6: Ablaufproze einer Eingebung aus dem Hyper-Raum zum menschli chen Gehirn: empfangen. Das Gehirn ist ein Instrument, das - wie offenbar auch die DNS - als Schnittstelle zwischen dem HyperRaum und dem vom Menschen wahrnehmbaren vierdimensionalen Raum betrachtet werden kann. Es ist mglich, willentlich auf diesen Proze einzuwirken. Der Auswahlproze vollzieht sich hierbei durch entsprechende Gehirnfrequenzen, wobei die Qualitt und die Zeit einer Umsetzung (Reakti onsproze) durch eine Synchronisa tion beider Gehirnhlften optimiert wird.

103

Abb.7: Mitose einer Zelle in Ruhestellung; whrend dieser Zeit wird die DNS verdoppelt. Die Chromosomen werden sicht bar. Die Zelle erfllt die gleichen physikalischen Bedingun gen wie zum Beispiel auch die Erde - sie ist quasi auch ein Hohlraumresonator.

Die Resonatorgte ist ein Mastab fr das Speichervermgen des Resonators und fr die Informationsfhigkeit der jeweiligen Struktur. Eine Stehende Welle wiederum kann die Positionen der Molekle be einflussen und stabilisieren. Stehende Wellen sind dem Gesetz der Ko hrenz zuzuordnen. Die Kohrenz wiederum sorgt dafr, da ein In formationstransfer und eine Signalverstrkung stattfindet. Zusammengefat lt sich sagen, da die biologische Zelle mit ihrer im Kern enthaltenen DNS eine ideale Antenne zum Senden und Emp fangen fr Informationen ist. Das herausragende hierbei ist jedoch die Eigenschaft der primren Kommunikation mittels Bio-Photonen und der Bio-Gravitationen (Dubrow). Hiermit ist das System in der Lage, untereinander (intra- und inter zellulr) sowie mit ihrer Quelldatenbank zu kommunizieren. Diese Quelldatenbank entspricht den imaginren Strukturebe nen, die den uns bekannten drei Raumdimensionen bergeordnet ist, also dem, was wir zusammengefat den Hyperraum nennen.

Abb.8: Die Erde als Hohlraumresonator (etwa 8 Hz als Resonanzfre quenz). Die Linien entsprechen dem typischen Feldlinienverlauf.

104

Die entscheidenden physikalischen Einflugren, die von hherdimensionalen Strukturen gesteuert werden, sind gravitative Systeme. Eine bekannte, sekundre Erscheinungsform hiervon ist zum Beispiel das uns bekannte Magnetfeld. Das Revolutionierende hierbei ist, da smtliche Strukturen und Programme, also Informationen, primr nichtmateriell abgelegt sind. Diese sind den hheren Dimensions-Ebenen (X5-X12) zugeordnet (Burkhard Heim et al.). Der eigentliche Grund, weshalb wir das Thema Geist - zum Beispiel als Information - nicht in unser primr materiell orientiertes, naturwissenschaftliches Weltbild integrieren konnten, liegt in seiner versteckten rtlichkeit, ergo in der hheren Dimension. Gerade an dieser Stelle ist der Leser sicherlich mit der Glaubhaftig keit konfrontiert. Dennoch bleibt die Seriositt und Zuverlssigkeit fr die Grundlage dieser Beschreibung aufrecht. Die Ableitung bzw. die Modellbeschreibung des Hyperraums im Kontext der Biologie zu stel len, basiert jedoch auf fundierten Berechnungen und abgesicherten Er gebnissen (zum Beispiel der Experimental-Physik). Sollte dieses phantasti sche physikalische Modell tatschlich die Interaktion zwischen Geist und Materie beschreiben, so findet sich hierin unter anderem eine Erklrungsgrundlage fr zahlreiche physikalisch und biologische Ungereimthei ten. So ist beispielsweise im mer noch nicht bekannt, wo sozusagen ein Gedanke sei nen Sitz hat. Niemand hat bisher auch nur einen Ge danken nachweisen knnen.

Abb.9: Bioinformation zwischen den Seinsschichten. Die Pfeile links (Klammem) bedeuten, da die Seinsschich ten untereinander wechselseitig wirken (und auerdem Unter-Schichten haben, die ihrerseits untereinander wechsel seitig wirken).

105

Das, was wir an dieser Stelle angeboten bekommen, sind bestenfalls sekundre Konstrukte, beispielsweise ein Nachweis, da ein Denkpro ze eingetreten ist (EEG, PET usw.). Das, was uns dabei unterschlagen wird, ist jedoch, da ein Gedanke nicht primr elektromagnetischen Ursprungs ist.

Naturwissenschaftliche Hintergrnde zum Casimir-Effekt


Zusammen mit Sinitiro Tomonaga, Julian Schwinger und Freeman Dyson entwickelte Richard Feynman eine neue Theorie der Quantene lektrodynamik (QED), wie es vor ihnen schon Paul Dirac jahrelang versucht hat. Mit einem Vorgehen, welches heute Renormierung heit, haben sie schwierige Passagen in ihren Gleichungen dadurch ge lst, da sie anstelle von Unendlichkeiten die effektiv gemessenen Werte (Masse und Ladung) eines Teilchens in die Gleichungen ein setzten. Dirac hat sich nie mit dieser Renormierung anfreunden kn nen, doch dieser Trick war sehr erfolgreich, konnte doch jetzt das metechnisch bestens bekannte Frequenzspektrum des Wasserstoffa toms (LAMB-Verschiebung) berechnet werden. Mit den Ergebnissen von Feynman wurde ersichtlich, da sich ein Photon in unglaublich kurzer Zeit in ein Elektron-Positron-Paar (Materie-Anti-Materie) tei len und sofort wieder vereinen kann. Diese virtuellen Teilchen entzie hen sich direkt jeder Messung, weil sie viel zu kurzlebig sind. Ander seits erzeugen diese Teilchen ein fluktuierendes Feld (eine Art elektro magnetisches Rauschen), welches auch Wirkungen auf reelle Ladungen hat. Das Vakuum ist nicht mehr leer, sondern aufgefllt wie ein See aus virtuellen Ladungen (Dirac-See). Hendrik Casimir leitete aus den Feynman-Gleichungen die sogenannte Nullpunktstrahlung ab und schlug dazu sein bekanntes Experiment vor.

106

Lebewesen steuern eigene Raumstruktur und Flu der Zeit: Dubrows Bio-Gravitations-Modell
Das Bio-Gravitations-Modell des sowjetischen Geophysikers und Biologen Alexander P. Dubrow erklrt einen Zusammenhang zwischen Gravitation und Bio-Photonen. Dubrow ist der Ansicht, das primre Bio-Feld in Organismen werde von einer gravitationshnlichen Kraft gebildet, die durch lebende Zellen erzeugt werde, sich in jede andere Energie umwandeln knne, jede Abschirmung durchdringe und deren Wirkungen man in allen Lebensprozessen beobachten knne. Sowohl die Bio-Photonen wie auch die Phononen (nicht zu verwechseln mit den Photonen), die im lebenden Organismus auftreten, sind nach Dubrows Ansicht Sekundrerscheinungen eines konstanten Biogravitationsfeldes, das die Lebensprozesse kontrolliere. Nach Burkhard Heim knnen elektromagnetische Felder, Ultraviolett- und Infrarotstrahlung, Radio aktivitt, Schallwellen und weitere physikalische Erscheinungen Sekun drerscheinungen von Gravitations-Feldern sein. Eine Verffentlichung der Fachzeitschrift Nature Neuroscience (2002) von Joe Mclntyre berichtet hierzu: Ein Weltraumexperiment legt nahe, da das menschliche Gehirn ber ein internes Modell der Gravitati on verfgt.

Gittermodell des Universums von William Tiller


Tiller hat den relativ jungen Begriff Subtile Energien umschrieben: Unter subtilen Feldern oder Energien verstehe ich nicht einfach schwache Felder oder Energien. Die Einstein sehe Aussage ,Gott ist subtil bedeutet nicht, da Gott schwach ist. Nach unseren bisherigen Erfahrun gen sind die subtilen Felder sehr schwach an unsere physikalischen Fel der angekoppelt, so da wir normalerweise nur kleine Wirkungen wahrnehmen. Sie knnen aber unter gnstigen Umstnden stark wech selwirken und massive Effekte ermglichen. Ich vermute, da unsere zuknftige Technologie in diesem Bereich den latenten Energiegehalt und die Nutzungsmglichkeiten solcher subtiler Felder entdecken wird, die um

107

viele Grenordnungen strker sind als die gegenwrtig bekannten physi kalischen Felder. ...Subtile Energien sind wirkliche Energien, die nicht unmittelbar beobachtet werden knnen, weil sie auf dem Niveau des Vakuums oder des negativ-energetischen DIRAC-Sees wirken. Sie kn nen in der gegenwrtigen Situation der Menschheit nur durch einen ver mittelnden Transducer in eine beobachtbare Gre umgewandelt werden. Derzeit sind diese Transducer vorwiegend lebende Systeme. Sie sind fr eine groe Anzahl beobachteter Erscheinungen verantwortlich, die auf der Grundlage des bisher allein akzeptierten wissenschaftlichen Paradigmas der vier bekannten universalen Grundkrfte unerklrlich bleiben. Das bekannte magnetische Vektorpotenzial scheint eine Rolle als ,Brcke' zwi schen den subtilen, nicht beobachtbaren Energien und den beobachtbaren EM-Energien zu spielen, die mit den elektrischen und magnetischen Fel dern verknpft sind. Die Physik stellt sich das Vakuum des Raumes modellhaft als eine Art Supraflssigkeit vor, die durch eine geometrische Gitterstruktur in dynamischer Stabilitt gehalten wird. So berichtet beispielsweise Erol Torum von experimentellen Beobachtungen an Quasikristallen, die darauf schlieen lassen, da das Vakuum in Wirklichkeit aus Ikosaedern bestehen knnte. In diesem Modell stellen dreidimensionale Raumfor men, wie das Ikosaeder und das Tetraeder Projektionen komplexerer ursprnglicher Formen im hheren Raum dar. Dies wrde bedeuten, da harmonische mathematische Beziehungen existieren, welche diese Geometrien des komplexen Raumes und des dreidimensionalen Raumes verbinden. Tillers Gitter stellt eine multidi mensionale Feldstruktur dar. Die Grundlage dieser Organisationsform sind Lichtmuster, welche die verschiedenen geometrischen Gitterlinien des Raumes bilden. Diese lichtkodierten Gitter legen die Muster fest, die fr die Entfaltung des Lebens, der Galaxien und der Sterne bentigt werden. Diese Gitter-Raster-Struktur existiert auerhalb der RaumZeit, ohne die normalen Einschrnkungen, die mit den Aspekten der Kausalitt (Ursache-Wirkung) einhergeht. Interdimensionale Knoten punkte bewirken, da Energien und Informationen zwischen den Di

108

mensionen zirkulieren knnen. Die Voraussetzungen, um auf diese Kommunikationskanle zugreifen zu knnen, sind Abstimmung und Kohrenz des Systems als Ganzes. Zwischen den Ebenen des Gitters existiert eine einzigartige und perfekte Geometrie. Die Wellen, die durch die Gitterstruktur fhren, sind Informationswellen, die in Ver bindung zum hchsten Aspekt unseres Bewutsein stehen. Im Grunde verbindet das Gitter die gesamte Wirklichkeit, die gesamte Seinsform.

Abb.10: Projektionen von Ereignismustern.

Aus Tillers Sicht bewirken Gedanken und Absicht, da an den Knotenpunkten der universellen Gitterstruktur Potenziale gespei chert werden. Diese Potenziale bilden sich als Muster, fr die es erfor derlich ist, da der Geist oder das gttliche Selbst mit den Fre quenzmustern in Interaktion tritt, damit aus ihnen Ereignisse in unse rem Leben werden. Der primre Strahl zur Projektion entspringt dem Geist. Tillers Ansicht nach funktioniert dieser Primrstrahl vom Geist so hnlich wie der Projektionsstrahl eines Hologramms: Er tritt in Wechselwirkung mit den von der Geistebene zwecks Projektion in die physische Ebene festgelegten Frequenzmustern. Eine Vernderung der Muster und Potenziale an den Knotenpunkten verndert die Ereig nisse, die in unserer Realitt projiziert werden. In der oberen Grafik

109

liefert der Geist den Energie-Referenzstrahl, hnlich wie bei einem ho lografischen Rekonstruktionsproze. Das Ereignis in unserem Leben ist eine Art holografische Projektion, die einer hyperrumlichen Wirk lichkeit entspringt. Der Proze ist doppelter Natur: Gedanken und Absicht bilden die Muster, wobei der Geist bei der Aktualisierung mit wirkt. Die Muster und Potenziale an den Knotenpunkten lassen sich durch Absicht programmieren und ndern. Das verndert die Ereignisse, die in unserem Alltag projiziert wer den. Offenbar erzeugen unsere Gedanken und Absichten Muster und Potenziale direkt innerhalb des universellen Kalibriergitters (UCL). Das UCL dient zur Verstrkung und Projektion dieser Muster und erzeugt eine Resonanz mit dem ueren Universum. Der gesamte Pro ze wird durch Bewutsein und Absicht gesteuert.

Abb.10: 10-dimensionale Gitterstruktur.

Tiller beschreibt eine 10-Dimensionale Gitterstruktur, durch die das Energiegitter des Geistes mit der physischen Wirklichkeit (Ebene 3) verbunden wird. Ebene 2 ist der Raum der thersubstanz (Vakuum). Bestimmte Knotenpunkte, welche die diversen Ebenen der viel schichtigen Gitterstruktur miteinander teilen, dienen als Anschlu punkte. Sie verbinden Energien und Informationen zwischen den Di mensionen und bertragen sie von einer zur anderen.

110

Abb. 12: Versuchsanordnung von Tiller: In dem (mit Aluminium/Kupfer verkleideten) Meditationsraum steht isoliert ein Stuhl, und der darauf sitzende Proband lt seine Daten an einen auerhalb stehenden Computer bertragen. Elektrische Strme durch die Al/Cu-Platten werden ebenfalls gemessen und simultan verglichen. Nachweis von Energiezirkulation durch thersubstanz.

Es handelt sich um interdimensionale Knotenpunkte, diese kann man als Kanle des geringsten Widerstandes betrachten, die einen di rekten Anschlu und eine direkte Energiezirkulation mit anderen Di mensionsrahmen hersteilen knnen. Dieses zusammengefat bedeutet: Das menschliche Gehirn ist in der Lage, ber die von ihm ausge strahlten Felder, mit dem, was man als Hyperraum bezeichnet, zu kommunizieren. Unter Hyperraum ist eine Dimensionsebene (X5-12) zu verstehen, die jenseits der uns allgemein bekannten, dreidimensio nalen Ebene (rumliche Mae X1-3) besteht. Im Hyperraum existiert keine Zeit (X4) und kein Raum (in unserem verstndlichem Sinne). Alle Handlungen und Aktivitten erfolgen quasi umgehend. Ein Krite rium fr die Verbindung zum Hyperraum sind die kohrent schwin genden Neuronen und damit der von denen ausgestrahlten Felder.

111

Abb.13: Die Grafik zeigt einen Vergleich der Medaten. Die Einteilung nach Professor Tiller in verschiedene Schichten. Jede Schicht hat eine einzigartige Substanz und Infrastruktur. Die beiden ueren Schichten stellen die physisch/zeitliche Wirklichkeit dar. Die mittlere Schicht ist ohne zeitliche Struktur belegt und wird in diesem Modell als Seele defi niert. Die anderen Infrastrukturen, die koppelnd den grten Teil zwischen den Schichten ausmachen, geben Aufschlu ber den Gesundheitszustand einer Person.

So betrachtet ist festzuhalten: Das Gehirn ist ein Instrument, das (wie offenbar auch die DNS) als Schnittstelle zwischen dem Hyperraum und dem von uns wahrnehmba ren 3 + 1. dimensionalen Raum betrachtet werden kann (1= Zeit/X4). Es ist uns mglich, willentlich auf diesen Proze einzuwirken. Der Auswahlproze vollzieht sich hierbei durch entsprechende Gehirnfre quenzen. Aus der Perspektive der Quantenfeldtheorie sind die realen Gegenstnde nur in besonderer Weise angeregte Formen von Quan tenfeldern und den daraus folgenden Elementarteilchen wie Elektronen, Photonen, Quarks und so weiter. Schlsse aus Heisenbergs UnschrfeRelation weisen sehr deutlich darauf hin, da derartige Bausteine aus dem Nichts entstehen knnen, um sich abhngig von ihrer aufge nommenen Energie wieder in Nichts aufzulsen. So mag es im Vaku

112

um brodeln, ohne da die Zeitspannen der Existenz solcher Teilchen gengend lang wren, da Menschen sie heute mit ihren Mittel wahr nehmen knnen. Theoretische Berechnungen sagen beispielsweise vor her, da in einem leeren Raum mit der Anwesenheit eines sehr starken elektrischen Feldes Elektronen und Positronen aus dem Nichts ent stehen mten. Ein Beispiel ist der Casimir-Effekt, der 1997 durch einen amerikani schen Forscher sogar mebar nachgewiesen werden konnte. Casimir berechnete 1948, da zwei Metallplatten, die im Vakuum dicht zusam mengebracht werden, ohne ueren Grund aneinandergepret werden mten. Der Grund wre, da sich in dem dnnen Spalt zwischen den Platten nicht mehr beliebige Quanten-Teilchen bilden knnten, son dern nur noch solche, deren Wellenlnge in den Abstand pat.

Abb.14: Der Casimir-Effekt als Schnittstelle zum Hyperraum.

So entstnde innerhalb des Spalts eine geringere Anzahl von Teil chen als im umgebenden Raum, worauf, wie bei dem bekannten Ph nomen des Luftdrucks, die Platte von auen zusammengedrckt wer den msse. Die theoretische Physik ist voller weiterer Beispiele. Im Moment sucht sie nach dem Higgs-Feld, das nach dem britischen Physiker Peter Higgs benannt wurde, der es berechnete. Dieses Feld ist der Schlssel fr die Eigenschaft, die wir als Masse bezeichnen. Die Wechselwirkung mit diesem Feld wrde erklren, warum ein Elektron Masse besitzt und warum diese so viel geringer ist, als bei einem Proton. Man hofft, dieses

113

Feld demnchst nachweisen zu knnen, wenn der neue CERNBeschleuniger Large Hadron Kollider fertiggestellt wurde. Sollten diese und andere Annahmen der theoretischen Physik besttigt werden - was sehr wahrscheinlich ist - so wre das Vakuum die Basis, aus der die materielle Welt hervorgekommen ist. So, wie dann in ihm ein Photon oder ein Elektron entstehen knnte, wren selbst komplexe Systeme wie ein menschlicher Organismus nur eine Vergrerung dieses Ph nomens. Physikern ist bekannt, da auch im perfektesten Vakuum stndig virtuelle Teilchenpaare aus Materie und Antimaterie entstehen, welche die Energie zu ihrer Erzeugung vom Vakuum ausleihen und sie nach sehr kurzer Zeit wieder zurckgeben, indem sie sich gegensei tig vernichten (annihilieren). Man kann virtuelle Teilchen nicht beob achten, jede Beobachtung wrde sie sofort zu reellen Teilchen werden lassen. Ein indirekter Beweis fr die Existenz dieser virtuellen Teilchen existiert bereits (zum Beispiel die Bewegung der Wasserstoffatome durch winzige Verschiebung ihres niedrigsten Energieniveaus). Allein im Moment ihrer Entstehung hat das Vakuum bereits eine negative Energiedichte, weil es einen kleinen Anteil seiner Energie an die Teil chen entliehen hat. Die virtuellen Teilchen kann man auch nach dem Welle-Teilchen-Dualismus als Welle auffassen. Der Casimir-Effekt reprsentiert, sozusagen beweisfhrend, da der materielle Schp fungsproze durch das Vakuum (Hyperraum) erfolgt. Um diesen Proze hervorzurufen, sind jedoch sehr eng definierte, physikalische Voraussetzungen erforderlich. So ist beispielsweise neben dem Material und der Geometrie auch der Abstand dieser Materialien von entschei dender Bedeutung. Es passen sozusagen nicht alle Wellenlngen zwi schen beiden Materialien (Platten), sondern nur stets ein ganzzahliges Vielfaches bestimmter Wellenlngen, whrend auen alle mglichen Fluktuationen bzw. Wellenlngen existieren drfen. Im Endeffekt drcken somit von auen mehr Wellen gegen die Platten, als im Zwischenraum ausgeglichen wird; es entsteht hier somit ein Feld mit negativer Energiedichte. So entsteht das, was man negative Energie nennt und dementsprechend ein negativer Druck im Spalt. Im

114

merhin wird das Anziehen der Platten auch als ein weiterer Beweis fr die Existenz der virtuellen Teilchen gesehen. Die Originalberechnung von Casimir ergab einen Abstand der Plat ten von etwa einem Mikrometer. Wenn man die Platten einander n hert, passen noch weniger Wellen in den Spalt - die negative Energie dichte steigt weiter. Zieht man sie auseinander, verschwindet der Ef fekt.

115

BEWUTSEIN UND REALITT


(aus neuer physikalischer Sicht). Holografie des Bewutseins: Zunchst wies der Neurologe Karl Pribram nach, da das technische Modell der holografischen Speicherung von visuellen Informationen auch fr die Menschen zutrifft. Das bedeutet, da unsere Erinnerung nicht lokal in irgendwelchen einzelnen Zellen gespeichert ist, sondern verteilt als Interferenzmuster = Hologramm ber ganze Areale. ber das materielle Substrat der Interferenzmuster sind sich die Wissenschaftler noch nicht ganz einig, ob nur in den Nervenzellen (Dendritenpotenziale) oder in allen Krperzellen diese Informations verarbeitung vonstatten geht. Spter weitete dann Pribram seine Theo rie dahin aus, da auch alle anderen Sinneseindrcke auf dem holografi schen Prinzip basieren. Zusammen mit David Bohm (ein Schler von Albert Einstein) erkannte er, da der ganze Kosmos ein holografisches Universum ist, wobei unser Gehirn wiederum ein Hologramm dar stellt! In dieser Wirklichkeit befinden wir uns in einem Ozean von Wellen und Frequenzen. Unser Gehirn hat nun die Fhigkeit, daraus kontinuierlich auf mathematischem Wege (Fourieranalyse/Fourier transformation) eine objektive Realitt durch die Interpretationen der Interferenzmuster zu konstruieren! Mehrere Autoren, wie zum Beispiel Bearden, York und so weiter fassen das menschliche Gehirn als Skalarwellendetektor auf. Die beiden Hirn-Hlften wrden demnach eine (auch aktivierbare) InterferometerAnordnung bilden. Nach Thompsen jr. wird eine Transkommunikation mittels Skalarwellen realisiert, die als holografische Muster unendli cher Dimensionen existieren, wobei proportional zur Komplexitt der Information viele derartige Muster berlagert sind. Pribram konzipiert ein umfassendes Paradigma, das die Hirnforschung eng an die Physik bindet. Normale Wahrnehmung, paranormale und transzendente Erfah rungen sind darin Teile der holistischen Natur. Der Funktionalismus sieht Bewutsein als reine Information und fundamentaler als die mate-

116

Abb.15: Materie als komplexes Feld STEHENDER WELLEN. Fel dionenmikroskopische Aufnah me einer Platinspitze mit 500.000facher Vergrerung. Die weien Punkte sind einzelne Atome. So etwa sollte man sich Materie als Feld stehender Wellen vorstellen.

Helle Welt. Eccles erkennt die Gehirnstruktur als Interface zu nicht materiellen geistigen Bereichen und den Geist als Programmierer des Gehirncomputers! Eccles erklrt in seinem neuen Buch Wie das Selbst sein Gehirn steuert (1999), da die Steuerung der Synapsen in Bereichen erfolgen kann, die dem Heisenbergschen Unschrfeprinzip unterliegt! Harris Walker aus Cambridge legt dar, da der Bewutseinsproze nicht chemischer Natur ist, sondern auf einen quantenmechanischen Tunneleffekt basiert. Er fhrt berzeugende Beweise dafr an, da in der Synapse irgendein quantenmechanisches Phnomen stattfindet. Auch David Bohm und Basil Hiley berichten von verblffenden hn lichkeiten zwischen dem Quantenpotenzial und den Verbindungen des Gehirns. Sie fanden heraus, da der Raum zwischen den Nervenenden sich niemals ganz still verhlt (Nullpunktenergie des Vakuums), son dern eine kontinuierliche Aktivitt langsamer Wellenpotenziale auf weist. In diesem Synaptischen Spalt herrscht nun eine unaufhrliche kom plexe Aktivitt von Wellenformen (bis zu 20 Impulsen pro Sekunde) mit Interferenzmustern - eine Grundvoraussetzung, um holografisch verschlsselte Informationen entstehen zu lassen. Dies wrde erklren, da Erinnerungen nicht allein auf bestimmte Gehirnzellen begrenzt bleiben, sondern sich (zeitgleich) im gesamten Gehirn ausbreiten.

117

Materie ist aus Schwingungen aufgebaut


Moderne Wissenschaftler stellen sich die Entstehung des Univer sums etwa so vor: Am Anfang war das Wort, waren Ton und Licht also Schwingungen, Felder. Materie stellt man sich aus Feldern entstan den vor, als Verdichtung dieser Felder, die nur scheinbar eine von den Feldern unabhngige Existenz haben. Sie sind als Knoten sich ber lagernden Wellenfronten (Stehende Wellen) aufzufassen und lsen sich genauso, wie sie aus den Feldern hervorgegangen sind, am Ende ihrer Lebensdauer auch wieder in diesen auf. Doch auch da, wo sich bereits bestehende Teilchen zu Atomen, Moleklen, Zellen und ganzen Or ganismen anordnen, stehen Felder als organisierende Krfte und Muster dahinter. Teilchen und Felder entstehen aus dem Nichts. Letztlich entstehen aber nicht nur Teilchen und smtliche Formen und Strukturen der materi ellen Welt, sondern auch die Felder selbst aus dem Vakuum, dem leeren Raum, der nach der modernen Physik berhaupt nicht leer, sondern von der unaufhrlichen Aktivitt der sogenannten Nullpunktfluktua tionen erfllt ist. Jack Sarfatti meint dazu: Materie bildet sich, wenn Information dem Substrat der chaotischen Nullpunktbewegung kohrente Ordnung aufprgt. Elementarteilchen sind, auf der grundlegendsten Ebene, ganz einfach kohrente Organisationen der ungeordneten NullpunktQuantenfluktuationen in der Geometrie der Raum-Zeit.

Die Elementarteilchen werden gebildet durch Information, die eine Form des Bewutseins ist.
Quantenphysik behandelt Realitt nach dem Vorbild der Akustik. Wie der Physiker Hamprecht gezeigt hat, behandelt die Schrdinger'sche Wellengleichung, Grundlage der modernen Quantenmechanik, alle Zustnde der Materie und des Lichts nach dem Vorbild der Aku stik, nmlich wie Grund und Obertne einer schwingenden Saite oder

118

Luftsule, die genauso diskrete (gequantelte) Zustnde (Tonfolgen) ohne Zwischenformen bilden wie Materie und Licht. Nur, da hier nicht die Saite oder Luft das schwingende Medium bilden, sondern der leere Raum, das Vakuum selbst! Elektronen und Photonen, genauso wie alle anderen Bausteine der Materie, sind als bestimmte Schwingungszustnde des Vakuums zu verstehen; Fermionen (wie die Elektronen und Neutronen) sind mate riehafte Bosonen (wie die Photonen), lichthafte Erregungszustnde des thers! Die Bewegung von Teilchen und die Emission von Photonen durch die Atome finden beim Wechsel des Elektrons von einem Eigen zustand (Schwingungszustand) in einen anderen statt. Somit beschreibt die Quantenmechanik Licht und Materie wie die Musik eines verborge nen nichtmateriellen Instrumentes - nmlich des Raumthers.

Mentale Unterdrckung des Radioempfangs


Die Arbeitsgruppe Instrumentelle Transkommunikation unter der Leitung von Professor Emst Senkowski beschftigt sich seit den sechzi ger Jahren mit dem Phnomen Kommunikation mit Jenseitswesen (Verstorbenen). ber Vakuum-Hyperraum stoen wir auf Wirkbrkken Mensch-Materie. Mittels elektronischer Mikrotechnik werden berraschend nchterne Ergebnisse erzielt. Die Instrumentelle Transkommunikation (IK) ist inzwischen ein Forschungsfeld mit streng naturwissenschaftlichen Methoden. Herausgehoben soll an dieser Stelle ein Versuch der mentalen Beeinflussung des Radioemp fangs. Tatschlich gelang es dem spirituellen Medium Homes am 20.3.1997 nach 30 Minuten Meditation, aus etwa 4 m Abstand den Fernsehempfang mehrere Male etwa 0,6 Sekunden lang, mental bewirkt, zu unterbrechen. Er bat die Jenseitsgruppe FDL um eine unter schiedliche Zahl von Unterbrechungen (von 3 bis 15), die sich jeweils nach einigen Sekunden korrekt verwirklichten. Whrend der Unterbre chungen trat ein starkes Rauschsignal auf, das eventuell den normalen Empfang unterdrckt hat. Mit starker Konzentration gelang es Homes

119

auch, aus etwa 1,5 m Entfernung die normale Funktion eines auf UKW eingestellten Empfngers vorbergehend mental zu blockieren. Ver mutlich befand er sich dabei in einem vernderten Bewutseinszustand. Das Oszillogramm des zeitlichen Ablaufs besttigt den subjektiven akustischen Eindruck des verzgerten Effektes.
Abb. 16: Unterdrckung (sieben mal in Folge) des TV-Empfangs durch ein Rausch signal.

Roger D. Nelson (Princeton, USA) stellt seine Bewutseinsfor schung (Feldbewutsein) in einen erweiterten Zusammenhang. Eine zufllig beobachtete, computerstatistisch erkennbare Abweichung vom Normalverhalten (reduzierte Amplitude des Rauschens - zustzliche Ordnung), synchron mit der Verffentlichung des Todes von Yitzhak Rabin, lste eine Entwicklung aus, die zur weltweiten Installation von etwa 75 Mestationen fhrte, in denen das computerisierte Verhalten von Rauschdioden fortlaufend beobachtet wird. Die Daten laufen in Princeton zusammen und werden im Hinblick auf eventuelle Korrela tionen mit weltbewegenden emotionalen Ereignissen ausgewertet. Ein besonders spektakulrer Effekt zeigte sich zur Zeit der Terroranschlge am 11. September 2001, bei dem die Abweichungen bereits einige Stun den vor den tatschlichen Ereignissen einsetzten, dann ein synchrones Maximum erreichten und nach mehreren Stunden abklangen. Smtliche Phnomene dieser Art kennzeichnet hochsynchronisierte, harmonische Zustnde im Gehirn, die ansonsten vorwiegend whrend der Meditation auftreten. Auerdem wurden enge Korrelationen der Gehirnwellen einander nahestehender Personen dokumentiert.

120

Dr. Nitamo Montecucco analysiert unter Benutzung einer greren Anzahl von Elektroden die Gehirnwellen im Beta- bis Theta-Bereich nach Amplitude und Frequenz und stellt die Spektren der rechten und linken Hirnhlfte in einem gemeinsamen Diagramm dar. Dabei gibt es deutliche Zusammenhnge der langsamen Theta-Wellen und speziellen Impulsen whrend der Fernheilung (mit Synchronisation zwischen Heiler und Patient) sowie mit meditativen Bewutseinszustnden und medialen Aktivitten. Eccles ordnet die Gehirnstruktur als Interface zu nicht-materiellen geistigen Bereichen ein und den Geist als Program mierer des Gehimcomputers. So schreibt Eccles in seinem Buch Wie das Selbst sein Gehirn steuert, da die Steuerung der Synapsen in Berei chen erfolgen kann, die der Heisenberg'schen Unschrferelation unter liegen. Nach Tom Bearden haben York und Jensen in den USA bereits vor Jahren die Gehirnwellenmuster einiger gesprochener bzw. nur ge dachter Worte entschlsselt. Die Autoren Henry Gris und William Dick zitieren in ihrem Buch PSI als Staatsgeheimnis die russische Neurologin Bechtereva: Eine meiner Ambitionen im Leben ist, nicht nur Worte zu verschlsseln und zu entschlsseln, die vom menschlichen Gehirn akustisch registriert werden, sondern das gesamte Spektrum der geistigen Aktivitten des Menschen elektronisch zu transkribieren. Sie resmierte, da es bereits mglich sei, den Code fr bestimmte Worte durch Elektroden in das Gehirn zu senden. Nobelpreistrger Eccles hlt bereinstimmend mit der Heimschen Theorie eine nichtenergetische Steuerung der elementaren Gehirnprozesse aus den quantentheoretischen Wahrscheinlichkeits feldern fr mglich. Nach berwiegend russischen Forschungsberichten treten bei Psychokinese-Experimenten relativ starke EM-Felder und eine merkliche Reduktion des umgebenden kosmisch-terrestrischen Strahlungsfeldes sowie Ultraschallfelder auf, die mit den Effekten selbst und physiologi schen Daten korreliert sind (Sergejev/Uphoff). Japanische Wissen schaftler haben im Nahfeld von Kiyota EM-Wellen bei 34,5 MHz nach 121

gewiesen, die vom linken vorderen Gehirnlappen abgestrahlt wurden. Die erste Beobachtung erfolgte zufllig whrend der Konzentrati onsphase der Versuchsperson, weil die 34,5 MHz Strahlung die Video aufzeichnung strte. Spter wurde eine Ausstrahlung erheblich hherer Amplitude von 26,5 MHz bei Yamashita gefunden (Uphoff 1980).

Para-wissenschaftliche Aspekte
Die Materie, oder auch die Realitt davon, wird aus der Anti-Materie heraus manifestiert. Der Magnetismus zieht es nach oben, um in Reali tt geschaffen zu werden (und wenn es stattfindet, machen wir dessen Erfahrung und unsere Realitt wchst). Die Seele ist das Buch in dem alle unsere Erfahrungen aufgezeichnet werden. Gott ist der Geist, der wir sind - Geist, die Superintelligenz von Be wutsein und Energie, die tote Materie lebendig macht. Und worauf immer wir unseren Geist richten, beginnt Realitt lebendig zu werden! Anti-Materie = Unterbewutsein, Materie = Bewutsein (beide sind gleichwertig). Durch das Unterbewute hlt sich das Bewute stabil. Anti-Materie ist es, durch die Materie geschaffen wird - weil Anti-Materie im Unter bewutsein existiert! Spirale ist Zeit. Sie mu durch jede Sequenz 7 Stufen hindurchgehen. Alles, worauf wir uns im Bewutsein ausdehnen, mu durch 7 Stufen von Gedankenwellen hindurch entworfen werden. Die Spirale mu um jene Realittsgrade herabfallen, um sich hier in dieser dreidimensionalen Ebene zu manifestieren. Dieses beansprucht Zeit, da in dem Moment, in dem wir Materie/Bewutsein haben, in dem Moment, in dem wir es innerlich fixieren und durch unsere Emotion mit Energie versehen, das Bewutsein seinen Fall nach unten antreten mu. Es fllt 7 Ebe

122

nen in der Schwingung, um zu seiner Polaritt am unteren Ende des Kreises/Spirale zu gelangen. Dann trifft es auf Anti-Materie (Unterbe wutsein). Und von daher wird sich das, was wir im Bewutsein ge schaffen haben, auf dem nchsten oberen Teil der Spirale manifestieren und Realitt sein! Ergo: Bewutsein erschafft Materie.

Gehirn als Transformator = Erschaffungs-Organ!


Whrend wir ber einen speziellen Gedanken nachdenken, setzen wir den Gedanken in seiner Frequenz herab. So entsteht bewute Mate rie (nun in der Spirale der Schpfung). Sie wird nun vollstndig in die sem Zeitflu herabgesetzt, so da sie in der Realitt erschaffen wird. Magnetismus ist eine gttliche Energie. (Ramtha) Magnetismus ist ein Phnomen der Schpfung. Magnetismus ist ein Phnomen der Zeit, denn Magnetismus ist die Energie, die geschaffen wird, wenn wir anfangen, unser Bewutsein zu dehnen und somit sein Abstieg in der Spirale beginnt. Durch das Unterbewutsein und AntiMaterie wird ihm Gltigkeit verliehen und es beginnt mit seinem Auf stieg! Das ist der Moment, in dem Magnetismus in dieser Manifestation geschaffen wird. Magnetismus kann einen Gedanken heraufziehen und ihn in unserer Realitt erschaffen. Das Unterbewutsein ist NICHT die angesammelte Erfahrung. Das Unterbewutsein ist das weite Nichts. Das Unterbewutsein wird als das IST bezeichnet. Es ist die Leere im Raum. Es ist alles Leben. BEWUTSEIN ist bewutes IST. BEWUTSEIN ist erwachte Intelligenz. Das ist das schlafende Potenzial.

123

Bekannt ist aus der Quantenphysik: Das Verhalten der Materie ndert sich, wenn sich Atome in einem hheren Energiezustand (e-Orbit) befinden. Sie reflektiert und absor biert dann andere Bereiche des Lichts. So ein Zustand kommt nur zu stande (quanten-physikalisch) durch starke Bewutseinskrfte! Ein Mensch mit einem solch hohen Energieniveau wre im Bewutsein sehr sensibel geworden. Er wrde sich und andere mit gleichem Energieni veau/Bewutsein sehen, wre aber fr andere unsichtbar! Unsere DNS sendet eine Art infrarotes Laserlicht, welches nach Ananda, einem spi rituellen Lehrer aus England, der den sogenannten LichtkrperProze lehrt, direkt aus dem Null-Punkt oder Vakuum entspringt. Roger Penrose, Fritz Albert Popp und andere haben nachgewiesen, da IR-Licht der Virtualitt, dem Null-Punkt entspringt und da von dort unser Bewutsein stammt. Unser Bewutsein wird nicht nur durch IRLicht erhalten, sondern stammt auch von unserer VORSTELLUNGS KRAFT ! Da nachgewiesen wurde, da unsere Vorstellungskraft aus dem Nichts in die supraleitfhigen Centrozyme eingeht, ist das Infrarot nur das Laser-Produkt, der Laserstrahl, der aus dem Bewutsein stammt. In der Visualisierung, der Meditation zur Erneuerung und Er haltung unseres Krpers, wird unser eigenes Bewutsein zu unserer Nahrung. Franz Bludorf und Grazyna Fosar erkannten: Menschliches Bewut sein ist eng verknpft mit der im 'Weltall allgegenwrtigen Schwerkraft. Es besteht eine Art Polaritt zwischen Bewutsein und Gravitation! Gravitation krmmt Raum und Zeit und verdichtet zu Materie. Be wutsein ist bestrebt, sich aus der Materie zu befreien. Schwarze und weie Lcher sind Eingnge zu Raum-Zeit-Tunneln. Schwarzes Licht: Es verdichtet sich Bewutsein zu Materie; es wird dadurch unbewuter; die Zeit verlangsamt sich (im schwarzen Loch ist Stillstand der Zeit). Weies Licht: Die Materie wird sich selbst bewuter; die Zeit be schleunigt sich. 124

Beide Krfte (weies/schwarzes Licht) wirken vor allem auf das menschliche Bewutsein = Tore zu hheren Dimensionen! Bewutsein und Gravitation sind zwei Seiten des Gleichen! (viel Materie = viel Bewutsein ?) Nobelpreistrger George Wald: Unser Bewutsein ist nicht nur die Voraussetzung der Wissenschaft, sondern der Wirklichkeit. Was existiert, ist das, was sich dem Bewutsein offenbart hat. Die Raum-Zeit als physisches Konstrukt ist mit dem Transbereich durch die Gravitation dynamisch verbunden. Der Informationsflu steigt und fllt, er ist aber in der physikalischen Raum-Zeit nicht erfa bar. Harmonische Gedankenmuster erschaffen Materie und Licht! Ele mentarteilchen und Atome sind spezielle Schwingungsmuster. Die Realitt ist als holistische Struktur relativ statisch erscheinender und dynamisch vernderlicher Systeme von stehenden Gravitationswellen aufzufassen, deren relative quantitative Werte von der Beobachtungs methode abhngen, oder als unendlich komplexes Feld von Wahr scheinlichkeiten des zeitlichen Ablaufs (der Zeitlinien). Gregory Dubrov von der University of Michigan beschreibt: Zeit und Raum besitzen metrische und topologische Strukturen, die sich als Ergebnis psychischer Prozesse verndern knnen. Schlielich kann die Welt als relativ stabile Massenhalluzination (Indische Maya-Schleier) interpretiert werden, deren Zusammenhang durch eine globale Synchroni sation der Gehirnttigkeit gewhrleistet ist. Es ist also zunchst festzuhalten, da gespeicherte Informationen nicht wie bisher angenommen, lokalisiert in bestimmten Gehirnarealen, sondern auf das ganze Gehirn verteilt gespeichert werden und da das Gehirn die in einem Photonenfeld gespeicherten Informationen abliest, indem es durch eine Foureir-Transformation die Frequenzen im Hologramm in Nervenimpulse umwandelt. Selbst die Erkenntnisse Hameroffs lieen sich in dieses Modell einordnen. Die von ihm ent deckten Erscheinungen im Bereich der Bewutseinsforschung wrden

125

elegant in dieses holografische System passen. Keith Floyd ist der An sicht, die hheren Gehirnfunktionen wie Wahrnehmung, Gedchtnis, Vorstellung usw. seien am besten auf der Grundlage eines optischen Systems zu verstehen. Er meinte, da der von Pribram vorgeschlagene holografische Mechanismus sich einer Art von dreidimensionalem or ganischem Bildschirm bedienen knnte, einer bestimmten Gehirnregi on, in der sich Bewutseinsprozesse abspielen wrden. Jener Bereich des Mittelhirns, der unmittelbar hinter der Sehnervkreuzung liegt, knnte eine solche neurale holografische Platte darstellen. Fr Floyd ist die Zirbeldrse (pineal gland) der Mittelpunkt des holografischen Nervenenergiefeldes, das hier als Bildschirm dient. So schreibt Floyd: Hier ereignet sich jener Lichtblitz, der als Be wutseins-Bildschirm erlebt wird, und auf dem sich stndig verndernde Figur-Hintergrund-Beziehungen die uere Realitt reprsentieren. Hier mte auch der Punkt sein, wo sich unser Zeitgefhl und unser Gefhl fr Bewegung und Vernderung manifestiert, so da die Entdeckung nicht berraschen sollte, da die Entfernung der Zirbeldrse unsere biologische Uhr durcheinander bringt. Wenn die Zirbeldrse entfernt ist, ist allerdings nur der Kontrollmechanismus fr die rhythmischen Lichtblitze eingebt; die Blitze selbst aber gehen weiter an derselben Stelle vor sich, obwohl das Organ, bei welchem sie abgelaufen waren, nicht mehr vorhanden ist. Zur Erinnerung sei darauf hingewiesen, da bis heute der Sitz des Bewutseins unentdeckt blieb. Vielmehr geht es um die Wechselwir kung von Energiefeldern im Gehirn im allgemeinen. Es wird unter den entsprechenden Spezialisten zur Zeit eine entsprechende Hypothese diskutiert. Hiernach wrden die Bewutseinsprozesse ein Vergleichen von auen kommender elektromagnetischen Wellen mit Photonen aus dem Nervensystem beinhalten, das in diesem zentralen Hirnbereich vor sich geht. Bei der Wahrnehmung, so meint Floyd, werden in den beiden gegenberliegenden Gehirnhlften Gehirnwellenmuster erzeugt, die auf dem wahrgenommenen holografischen Bild beruhen. Die Erinnerung spielt sich so ab, da die bei der ursprnglichen Wahrnehmung akti vierten Nervenstromkreise wieder auf die selbe Art erregt werden, wie bei dem Erlebnis selbst. Dadurch werden die gleichen Gehirnwellenmu 126

ster reaktiviert, die auch der ursprnglichen Erfahrung zugrunde lagen - und zwar in der Form einer berlagerung von Interferenzwellen von beiden Gehirnhlften, so da das ursprngliche Hologramm rekon struiert wird. Was wir Erinnerung nennen, wre somit eine bewut vor sich gehende Interpretation der grundstzlich vieldeutigen FigurHintergrund-Muster auf oder in der holografischen Platte, dem Feld im Gehirnbereich um die Zirbeldrse (drittes Ventrikel und Hypophy se), wo sich die Bewutwerdungsprozesse abspielen. Natrlich knnte das nur funktionieren, wenn tatschlich kohrente Energie im Gehirn vorhanden wre. Heute gibt es ernstzunehmende Forschungsergebnis se, die nachweisen, da elektromagnetische Vorgnge im Gehirn koor diniert und kohrent ablaufen. Schon einzelne Neuronen sind nach Erich Jantsch Spezialisten fr schnelle, nichtlineare Transformationen. Die Gehirnwellen, die wir im EEG aufzeichnen, zeigen, da sogar Tau sende bis Millionen von Gehirnzellen kohrent schwingen. Sie zeigen in ihrem Kommunikationsverhalten Phnomene der Selbstorganisation. Ihre Dynamik erinnert an dissipative Strukturen (Ilya Prigogine). Neueste Forschungen haben ergeben, da Gehirnzellen aus weit auseinanderliegenden Hirnbereichen auf Reize, die vom gleichen Wahr nehmungsobjekt stammen, koordiniert reagieren. Es ist durchaus anzu nehmen, da die zusammenhngenden Bilder von Objekten tatschlich durch kohrente Wellen elektrischer Aktivitt, die fr einen Moment das Gehirn durchlaufen, gebildet werden. Die lngsten EEG-Wellen mten also die kohrentesten sein. Tatschlich wird in Zustnden tie fer Entspannung (Meditation) die Dominanz der schnellen Betawellen des Alltags von einer Koexistenz mit langsameren und lngeren Alpha wellen abgelst. Bevorzugt treten diese Wellen bei Yogis oder Mystikern in hchster Versenkung sowie bei Heilem whrend ihrer Heilerttigkeit auf. Me ditation kann so als eine Art Kohrenztherapie im langwelligen Bereich unseres Photonenfeldes verstanden werden. Nachweislich erhht die Meditation die Kohrenz unserer Gehirnwellen und fhrt mglicher weise zu einer Erweiterung unseres Bewutseins.

127

In einem Zustand luzider Wachheit, wie er sich beispielsweise bei Heilem einstellt, treten alle drei Wellenbnder - Beta-, Thetaund Gamma-Wellen - symmetrisch in beiden Hirnhlften auf! Gleichzeitig synchronisieren sich beim Heilen auch die Gehirnwellen von Heiler und Patient! Im komplexen Netzwerk von miteinander auf vielfacher Weise ge koppelten Oszillatoren im Organismus spielt offenbar das Nervensy stem als Gewebe mit der hchsten Kohrenz eine besondere Rolle. Der Chaostheoretiker Ralph Abraham ist der Ansicht, da das Netzwerk der Neuronen in erster Linie als Lieferant von Stowechselenergie fr die Aufrechterhaltung von biochemischen Oszillationen und als Kopplung zu anderen Vibratoren im Organismus dienen knnte, wie beispielsweise zu den Muskeln und zu den Sinnesorganen. Ich schlage vor, da Wahrneh mung ein Phnomen der Resonanz zwischen dem Gehirn und externen Vibratoren ist. Der Biologe Roger Coghill meint, da das Gehirn ber die elektro magnetischen Signale einer morphogenetischen Gehirnstrahlung mit der DNS jeder einzelnen Zelle verbunden ist. Dieses Signal soll als indi vidualspezifisches Erkennungszeichen eine digitale Reprsentation des gesamten Bauplanes des Organismus enthalten, und der Zelle ber die Antenne DNS die ntigen Startbefehle fr die Teilung und die Synthese von Proteinen geben. Wegen der Abwesenheit von Sonnenlicht-Input und minimalem internem Rauschen knnte das Gehirn insbesondere nachts, und am intensivsten whrend des REM-Schlafs (Traumphase) - mit den Zellen kommunizieren und auf elektromagne tischem Wege ihre Reparatur, ihren Ersatz, aber auch die Ttigkeit des Immunsystems instruieren. Der Chemiker H. Primas verffentlichte hierzu bereits 1985 (Che mie in unserer Zeit 4/85): Die polarisierte Wirklichkeit ist nicht absolut, sondern eine spezifisch dem Ich-Bewutsein zugeordnete Wirklichkeit. Diese Polarisierung wird durch unser Bewutsein erzeugt.

128

Die durch diese Symmetriebrechung konstruierte Realitt ist inso fern objektiv, als sie immer dann eindeutig bestimmt ist, wenn wir uns fr eine bestimmte Optik entschieden haben. Aber die Wahl der Optik ist uns von der Quantenmechanik nicht vorgeschrieben. Ein konstruk tiver Geist kann diese Freiheit ntzen und eine neue Realitt erschaffen (!) und so im Sinne von Leonardo zum fabricator mundi werden! Jede Abstraktion schafft ihre eigene Realitt, und die erfahrene Wirklichkeit ist abhngig von der gewhlten Abstraktion.

Holografie des Bewutseins aus quantenmechanischer Sicht


David Bohm bewies schlielich durch seine Forschungen in der Quantenmechanik, da es nur entweder Realitt oder Lokalitt geben kann, nicht aber beides. Das bedeutet, wenn wir uns nicht von der Rea litt der ueren Wirklichkeit verabschieden wollen, wir akzeptieren mssen, da es eine begrenzte Lokalitt der Ereignisse unabhngig vom Rest des Universums nicht gibt. Alles ist mit allem verwoben und steht im stndigem (zeitgleichen!) Informationsaustausch. Jedes Teilchen im Universum ist jeden Augenblick ber alle ande ren Teilchen des Universums informiert! Eine andere Besonderheit der subatomaren Teilchen ist, da jedes Teilchen stndig von einer virtuellen Wolke von anderen Teilchen um geben ist, die unentwegt neu entstehen und wieder vernichtet werden. Dabei sind die Teilchen um so energiereicher, je nher sie ihrem Ur sprungsteilchen sind und je krzer ihre Lebensdauer ist. Dies geht so weit, da Teilchen, die sich in Nullentfernung vom Ursprungsteilchen bilden und in Nullzeit wieder vernichtet werden, eine unendliche Ener gieenge beinhalten und/oder eine unendliche Masse besitzen. Dies fhrte Hans Dehmelt (Nobelpreis fr Physik) zu der starken Vermu tung, da die gesamte Materie aus kleinsten Teilchen, den sogenannten Kosmonienen besteht, welche die gesamte Masse des Universums in sich vereinigen! Die Topologie des Kosmos wre so eine fraktale Mbi usschleife, bei der jedes Teilchen den gesamten Kosmos aus einer be

129

stimmten Perspektive heraus beinhaltet. Der Rand jedes Teilchens wre gleichzeitig der Rand des Kosmos aus der Perspektive des Teil chens (Ereignishorizont = Entfernung, bei der die Expansionsge schwindigkeit des Universums die Lichtgeschwindigkeit erreicht), was das Universum zu einer holografischen Projektion macht. Wie wir uns das vorzustellen haben kann uns das Bild des schwarzen Lochs zeigen. Im Ereignishorizont des schwar zen Lochs (wo die Fluchtgeschwin digkeit der Schwerkraft die Lichtge schwindigkeit erreicht) kippt die Raum-Zeit derart, da Zeit zu Raum wird und Raum zu Zeit. Dies zeigt uns, da Raum und Zeit austausch bare Komponenten sind, und beweist uns jene Behauptungen von Imma nuel Kant auf der philosophischen Seite und Albert Einstein auf der physikalischen Seite, da Raum und Zeit eher psychische Kategorien denn physikalische Realitten sind. Das Denken im Geist des Menschen Abb.17: scheint eine Sonderform des das ge Darstellung der NASA: Schwarzes Loch. samte Universum durchdringenden Prinzips zu sein. Rein physikalisch betrachtet gengt es, da ein Medium, welches Hologramme speichern kann, irgendwo Grenzflchen hat und eine wellenfrmige Energieform in sich trgt (Referenzlicht), um Objekte zu erzeugen, die sich selbst verstrken und stabilisieren. Diese Substanz sollte man sich wie eine Flssigkeit vorstellen, in der sich Schwingun gen fortpflanzen. Die speichernden Strukturen mssen ebenfalls aus dieser Flssigkeit bestehen. Mglicherweise kommen hierfr Wirbel in Frage. Ihre leichte Beweglichkeit befhigt sie zum Fokussieren ihrer Information, da sie ein gemeinsames Abbild ihres Hologramms erzeu gen knnen. Warum sollte tote Materie so etwas tun? Entweder, weil

130

sie von bewuten Energien gesteuert wird, oder weil sie selbst gar nicht tot ist! Es gengt, wenn sie sich so verhlt wie ein Funktions-Fraktal in der komplexen Zahlenebene. Durch die Rckkopplung von Abspeichern und Wiederabstrahlen kann ein stabiles Gebilde erzeugt werden, das gnzlich aus Lichtenergie besteht und das die Energie einer Hologrammspeicherstruktur bei weitem bersteigt. Diese Energieansammlung lebt nach wie vor vom Uberlagerungsprinzip und hngt im Fokus ihrer gemeinsamen Erzeu ger. Wenn sich die Erzeuger bewegen, wird sie unscharf (Heisenberg), weil aus Synchronmangel (bei Beschleunigungen) zeitweise Aus lschungen erfolgen knnen. Doch bei einigermaen synchroner Be wegung bewegt sich die gepumpte Lichtansammlung mit, ansonsten zerfllt sie unter Lichtabgabe (Bremsstrahlung). Das wrde konkret heien: Die holografische Energieansammlung ist Masse, ist materialisierte Lichtenergie, ist das Produkt einer kollekti ven Energiepumpe. Ein Beispiel fr diese Masse knnte ein Elektron, ein Proton, ein Neutron oder irgendein anderes massenbehaftetes Ele mentarteilchen sein. Die primren Hologrammspeicherstrukturen (HSS) aus dem Ur-Medium sind sehr viel kleiner, beinhalten aber in formatorisch das Elementarteilchen noch einmal. Sie knnten stabile kinetische Wirbelstrukturen im Urmedium sein. Die HSS haben ver mutlich etwas mit Bewutsein zu tun, weil sie mit Information zu tun haben. Ein Teil der eingefangenen Energie ist stndig unterwegs zwi schen HSS und Masse, um die Information in der HSS zu aktualisieren und auf dem Rckweg die Masse durch neues Licht zu stabilisieren. Zustzlich mssen im Urmedium gengend Referenzwellen vorhanden sein, weil sonst prinzipiell kein Hologramm entstehen kann! Da es auch Schall-Holografie gibt, gengt es auch, sich diese urmedialen Wellen wie longitudinale Schwingungen vorzustellen: Am An fang war das Wort. So ist es mglich, da zu jedem Materieteilchen mindestens zwei HSS-Teilchen gehren. Richtiger sogar umgekehrt, denn die sehr viel kleineren HSS htten primr zu sein. Gibt es nun pro Materieteilchen gengend berschssige HSS, knnten diese sich auch abkoppeln, ohne da sich die Materie in diffuses Licht auflst. Sie

131

knnten dann als viel dnneres Materie-Doppel bisweilen ein Eigenle ben fhren (zum Beispiel als wandelnde Astralkrper). Dazu mssen sie aber ihren Gesamtzusammenhang behalten. Dieses wre mglich, denn schon die Bindung zweier Elementarteilchen zum Atom erfordert ein gemeinsames Bindungs-HSS. Ebenso drfte die Moleklverbindung in einer Molekl-HSS-Zentrale die Informationen aller beteiligten Atome vereinen. Sobald etwas energetisch zusammengehrt, war es vorher in einem HSS-Hauptspeicher dieser Ebene aufgenommen wor den. Solche Hauptspeicher mu es auch fr jede Zellorganelle, fr jede Zelle, fr jedes Organ und auch fr den Gesamtorganismus geben. Ob es sich dabei um zusammengeballte Einzel-HSS handelt (HSSMolekle) oder um Kompaktinformationen am zentralen Ort, sei da hingestellt. Ein fest vorgegebener Energieflu verbindet dieses dichte Netz, das bis ins kleinste Elementarteilchen hinabreicht, mit der Hauptzentrale. Die Energie schwingt hin und her, vom hchsten Sy stem bis zum niedrigsten und zurck. Hologramme haben die Eigen schaft, alle Bildpunkte flchenhaft (Burkhard Heims Metronen sind Flchen!) abzulegen und gleichzeitig das gesamte Bild in einem Punkt zu speichern. Dadurch wird in der Hauptzentrale alles mit allem ver bunden.

Zusammenspiel der Schwingungsmuster


Untersucht man einen Organismus, erweist sich dieser als ein hier archisches Netz zahlreicher einzelner Schwingungskrper. So schwin gen das Herz und Gehirn auf der Organ-Ebene, im hheren Bereich, die Nervenimpulse hingegen auf der zellularen Ebene. Auf einer unteren hierarchischen Ebene sind es zum Beispiel die Proteine. Sie produzieren mit die hchsten Schwingungsfrequenzen. Die hchsten Frequenzen werden von den Wassermoleklen abge strahlt (2,4 GHz-Resonanz-Frequenz). Die Synthese organischer Stoffe ist zwar in der DNS kodiert, aber das dynamische Schwingungs

132

verhalten dieser Stoffe ist zustzliche Information, welches durch BioPhotonen im elektromagnetischem Spektrum ein optimales Ubertra gungsmedium darstellt (Fritz Albert Popp, G. Nagel, et. al.). Dies wre vergleichbar mit einem Computer, wobei als Analogie die Hardware die molekulare und die Software die elektromagnetische Ebene darstellt! So findet bereits auf molekularer Ebene kollektives Verhalten statt. Es sei bereits jetzt darauf hingewiesen, da die Rolle des Wassers als Kopplungssubstanz des dynamischen Netzes nicht hoch genug bewer tet werden kann (siehe auch extrazellulre Flssigkeit). Es besitzt offen sichtlich ideale Eigenschaften, die es zum Informationsspeicher macht. Zusammen mit den Wassereigenschaften bildet die Zelle ein dynami sches Netz, das chaotisch oder geordnet schwingen kann, je nach Mi schung der Frequenzen, Strke der Verkopplung oder Einflu eines dominanten Regelmechanismus. Dieser Punkt soll nachstehend aus Ausgangspunkt dienen. Wenn die Zellbestandteile bestimmte Positio nen eingenommen haben, um ihre Funktion zu erfllen, knnen sie auch in geordneter Weise ihre Schwingungen weiterleiten. Ein festes Schwingungsmuster (Stehende Welle) wiederum kann die Positionen der Molekle beeinflussen und stabilisieren, wie zum Beispiel bei Chladnischen Klangfiguren.

Zusammenfassung
Das menschliche Gehirn, mit seinen 1010 Neuronen (Nervenzellen), welche sich in zwei Hemisphren aufteilen, ist unter holografischen Aspekten zu betrachten. Um dem Prinzip des Hologramms zu entsprechen, sollten soge nannte Stehende Wellen aufgebaut sein. Stehende Wellen sind dem Ge setz der Kohrenz zuzuordnen. Kohrenz bedeutet, da Schwingungen - elektromagnetisch oder akustisch - sich im Gleichtakt beziehungs weise in Resonanz befinden. Dieses geschieht im Gehirn, besonders im Gehirn eines Menschen. Die Signale, die wir beispielsweise durch ein 133

EEG messen knnen, zeigen in unterschiedlichen Frequenzbereichen (0,5-40 Hz) grundstzlich nur die kohrenten, gleichschwingenden Neuronen. Die Hhe der Amplitude zeigt uns die Menge der kohrent schwingenden Neuronen. Man knnte es, elektrotechnisch gesehen (es gelten in biologischen Bereichen die physikalischen Gesetze als Basis), so ausdrcken: je hher die Amplitude, um so grer die Sendeleistung. Je mehr also einzelne Neuronen synchron miteinander schwingen (in Resonanz sind), um so besser ist die Voraussetzung fr die holografi schen Eigenschaften! Diese synchron schwingenden Neuronen bilden eine sogenannte Stehende Welle. Eine hhere Qualitt (Klarheit/Schrfe) und eine ab rufbare, verfgbare Kapazitt wird ber eine grere Anzahl beteiligter, kohrent schwingender Neuronen erreicht. Dieses geschieht in der Regel immer dann, wenn wir eine groe Aufmerksamkeit erreichen. Aufmerksam sein heit: Konzentration oder Meditation auf einen Punkt zentriert. So haben also unsere Wahrnehmung, unsere Gedanken etwas mit dem Synchronschwingen unserer Neuronen zu tun. Denken wir an oder ber etwas Bestimmtes nach, zum Beispiel einen Stein, so wre also dieser Gedanke die Frequenz dieses Steins, die also zumindest ein Neuron veranlat, eine bestimmte Spin-Vorzugsrichtung (Vernderung der Achsenlage) einzunehmen. Die Aufmerksamkeit, mit der wir ber diesen Stein nachdenken, wre - in Analogie zu unserem elektrotech nischen Modell (Nachrichtentechnik) - die Sendeleistung.

134

Abb.18: Dreidimensionales Bild.

Je aufmerksamer beziehungsweise emotionaler wir ber diesen Stein nachdenken, um so mehr Neuronen schwingen synchron miteinander - in gleicher Frequenz. Das bedeutet, es besteht eine Zwangslufigkeit zwischen der Emotion und der an diesem Gedanken beteiligten Neuro nen. Bei diesem Vorgang senden die Neuronen die mit der Information Stein versehenen elektromagnetischen Felder aus. Die entsprechende Emotion entscheidet ber die Vielzahl dieser elektromagnetischen Fel der. Diese em-Felder sind es, welche nun unter diesen kohrenten Be dingungen eine holografische Struktur bilden. Die Schrfe beziehungs weise Klarheit oder Gte des Hologramms entscheidet ber die Koh renz der Gedanken. Ein weiterer Aspekt, diese kohrenten em-Felder (Schwingungen) im Gehirn aufzubauen, sind Bereiche, die primr nichts mit den Emotionen zu tun haben. Hierzu gehren die Ebenen, die beide Gehirnhlften (Hemisphren) gleichschwingen lassen. Dieses zusammen Gleichschwingen der intuitiven (unbewuten) und rationa len (bewuten) Gehirnhlften entsteht unter anderem in der Meditati on. (Es gibt Techniken wie zum Beispiel das 3-D-Sehen, welche diese

135

Synchronisation der Hemisphren bewirken und damit offensichtlich auch Zugang zu den hheren Ebenen verschaffen.) ber dieses nun so aufgebaute Hologramm des Gehirns bestehen direkte Interaktionsmglichkeiten mit dem Umfeld, dem ganzen Uni versum! Von der Physik wissen wir, da unter Bedingungen einer Ste henden Welle eine Informationsbertragung quasi zeitgleich erfolgt, da innerhalb dieser Welle alles mit allem verbunden ist. Unsere Erde als Kugel-Hohlraumresonator (7,8 Hz) bildet durch eben diese Eigenschaft automatisch eine Stehende Welle, welche durch entsprechende em-Felder aufgebaut wird. Diese Stehenden Wellen regen pausenlos die Erde selbst zur Eigenschwingung (Resonanz) an. Bemer kenswerterweise stimmen bestimmte Frequenzen (SchnwetterSferics) - sowohl in ihrer Impulsform wie auch in ihrer Frequenz - in frappanter Weise mit dem Alpha-Gehirnwellen-Rhythmus (8-12 Hz) berein! Knig, Frhlich, Presman und andere Wissenschaftler gehen davon aus, da gerade diese em-Felder eine entscheidende Rolle in der Prgung der Evolution gespielt haben - sind es doch gerade die Fre quenzen, die fr die Ausbildung der elektrischen Steuerungs- und Re gelungsvorgnge bei Lebewesen von groer Bedeutung sind. Eingebet tet in ein quasi homogenes Meer von em-Feldern, die zumindest in ihrer natrlichen Form als eine kosmische Stehende Welle fungieren, knnen wir (wir sind das Ganze) auf diese Weise aktiv teilhaben am Spiel des Universums. Mit unseren Gedanken sind wir in der Lage, in Resonanz mit dem zu gehen, an das wir denken. In Analogie eines Computers wre es dann mglich, Modelle wie Akasha und mophogenetische Felder zu erklren. Unser Gehirn wre dann so etwas wie der Arbeitsspeicher, wobei die Festplatte in der ersten Ebene unsere Erde mit ihrem Magnet-Feld (0,5 Gau) in Verbindung mit den freien Elektronen (u.a. von der Sonne), darstellt. Von entscheidender Bedeutung drfte, diesem Beispiel fol gend, unser Bewutsein und unsere Wahrnehmung sein. Hieraus ergibt sich die Qualitt (als Intensitt und Prgung) unserer Gedanken. Kon

136

kret heit das, da aus der Vielzahl der Sinneseindrcke, die auf uns stndig einwirken, ein bewut selektives Auswhlen erfolgen sollte. Erst wenn entsprechende, kohrente Schwellenwerte (grere Anteile an synchron schwingenden Neuronen) erreicht werden, ergeben sich holografische Strukturen, die einen prgenden Einflu (Erkenntnisse, Erleuchtung...) bewirken. So besitzt also unser Gehirn die konkrete Mglichkeit, in den materiellen Schpfungsproze einzuwirken. Die Voraussetzungen hierzu sind aus physikalischer Sicht, da ein Gedanke mindestens drei Sekunden gehalten wird!

In der Physik heit es: berlagerungen (konstruktive Interferenz = Voraussetzung eines Hologramms) treten nur auf, wenn das Licht oder die em-Welle kohrent sind und wenn die Phasenbeziehungen whrend eines Verhltnis zur Schwingungsdauer lange Zeit konstant bleiben. Auf diese Weise bewirken die Strukturen der Schwingungsfelder, da auch die Materie sich in sie hineinordnet! Materielle Strukturen entstehen sowohl im Mikro- wie im Makrobe reich aus Schwingungsberlagerungen. Mikroteilchen sind selbst solche Knotenphnomene (Stehende Wellen), die sich nicht mehr fortpflan zen, sondern sich lokalisieren, weil sich an dem betreffenden Ort die Feldkrfte die Waage halten - und wachsen dann in dieses Feld hinein! Nach Dr. Injuschin bildet das Bioplasma (Bio-Photonen) ein Medi um, in dem vom Organismus selbst erzeugte oder von auen kommen de Infrarot- und Ultraviolett-Biophotonenstrahlung in der Form von angeregten Oszillationen langlebig gespeichert wird. Diese im Orga nismus wie in einem Hohlraumresonator gespeicherten Wellenzge besitzen unterschiedlichste Kohrenz - ein biologisches Feld, das eine komplexe holografische Wellenstruktur von groer Stabilitt bildet.

137

MATERIE UND BEWUTSEIN


Das Bewutsein entwickelt sich nach Charon frei innerhalb von zwei sich deterministisch entwickelnden Wohnsttten: den pronischen und onischen Mikrouniversa (Imaginres) und dem immen sen kosmologischen Universum (Realitt). Diese zwei, in ihren Dimensionen sehr verschiedenen Behausungen weisen dennoch viele hnlichkeiten auf, was ja auch nicht weiter ver wunderlich ist, da ihnen seit Anbeginn der Welt dieselben physikali schen Gesetze zugrundeliegen. Sie haben vor allem eines gemeinsam: Beide sind geschlossene, lichterfllte Rume, deren Radius in periodi scher Schwingung ist. Sehen wir uns diese Behausungen des Geistes etwas nher an.

Die pronischen und ionischen Mikro-Universa


Bekanntlich unterscheiden sich die Pronen von den onen da durch, da die elektrische Ladung der Pronen gleich Null ist, whrend die onen eine positive oder negative Ladung (Elementarladung e) aufweisen. Die Eigenmassen der onen bilden ein kontinuierliches Spektrum, das verschiedenen Quantelungszustnden entspricht. Die Eigenmassen der Pronen bilden dagegen ein kontinuierliches Spektrum. Auerdem gliedern sich die Pronen je nach ihrer Spin quantenzahl in zwei Gruppen: halbzahliger Spin (Neutrinos) oder ganzzahliger Spin (Photonen). Die Neutrinos sind also Pronen der Wirkungsstufe 1 (aufgeteilt in Spin und Impulse). Sie entstehen oder verschwinden je nachdem, wie die Erhaltung der Wirkung oder der Impuls-Energie es fordert. Sie sind Bestandteile der Struktur des ons und die Quelle der Psi-Welle, die von jeder Psychomaterie ausgeht! Sie besitzen nur die 16 Komponenten, welche die PsiWelle charakterisieren. Die Initialbedingungen dieser 16 Komponenten

138

informieren das Teilchen, von dem die Psi-Welle ausgeht, ber die Geometrie der umgebenden realen Raum-Zeit. Das Neutrino verfgt also noch ber kein Gedchtnis im eigentlichen Sinn. Es kumuliert nicht Informationen aus dem umgebenden Raum, sondern ersetzt die vorhandenen durch die gegenwrtigen (siehe auch die Verffentlichun gen von Lothar Gring). Es hat demnach auch keine eigene Freiheit, sondern versieht Auf klrerdienste und sammelt Informationen ber die Auenwelt, die von den Teilchengedchtnissen dann verwertet werden. Neutrino (Psi-Welle) = Informant Die Photonen sind Pronen der Wirkungsstufe 2 (aufgeteilt in Spin und Impulse). Sie werden durch die Fusion (im Sinne Louis de Broglies) von zwei Neutrinos gebildet, die ihre jeweiligen Dreh- und Schwingbewegungen vereinigen. 2 Neutrinos = 1 Photon Der wellenfrmige Aspekt der Photonen ist vollstndig darstellbar durch ein Feld mit 162 = 256 Komponenten. Diese Komponenten ent halten auch die 16 Komponenten, die das einzelne Neutrino charakteri sieren. Das Photon besitzt also ein eigenes Gedchtnis und ist frei. Wenn sie in ein onisches Mikro-Universum eingehen, knnen die Photonen einen 1 bersteigenden Gesamtspin annehmen und so die Grundstruktur des deutungsfhigen onischen Gedchtnisses (SigmaFeld) schaffen. Auerhalb des onischen Mikro-Universums kann das Photon sein eigenes Gedchtnis zum Transport von Informationen von einem Psychomaterieteilchen zum anderen benutzen: Photon (Sigma-Feld) = Bote

139

Die onen, jene punktfrmigen Strukturen, die sich im realen Raum als geladene Leptonen und Quarks manifestieren, interessieren uns ganz besonders. onen = Leptonen (Elektronen, Protonen und Neutronen). Sie sind nmlich jene Teilchen, die Milliarden von Symbolen (Informatio nen) unauslschlich kumulieren knnen. Am interessantesten sind in diesem Zusammenhang jene onen, die zu Bestandteilen stabiler Strukturen werden - namentlich der Nukleonen (Protonen und Neutronen), welche die Atomkerne bilden, und der Elektronen, die um diese Kerne kreisen. Das Lebensalter solch stabiler onen wird nach Jahrmilliarden gemessen. Ihre Lebensdauer bersteigt damit tatschlich die des Universums selbst. Die onen (Leptonen) entstehen paarweise (ein on und ein Antion) aus dem Licht, wenn zwei Photonen (Photon und Antiphoton), die ber die ntige Energie verfgen, Zusammensten. Elektronen, Neutronen und Protonen bestehen aus Photonen. Auch die umge kehrte Reaktion ist theoretisch mglich: Ein on und ein Antion knnen bei ihrem Zusammentreffen verschwinden und durch ein Paar Photon/Antiphoton ersetzt werden. Allerdings schrnkt die Komplexe Relativittstheorie diese Ver nichtungsreaktion ein: Die onen stellen eine Raum-Zeit dar, die eine negentropische Entwicklung durchluft, das heit, in der die gespei cherten Informationen nicht verloren gehen knnen. Das bedeutet wiederum, da ein on, in dessen Gedchtnis mehr als die maximal 256 Symbole gespeichert sind, die das Gedchtnis eines einzelnen Photons aufnehmen kann, nicht mehr der Vernichtung an heimfallen kann, durch die es sein Gedchtnis verlre und in Licht ver wandelt wrde. Nur onen mit wenig Gedchtnis (niedrigem Bewut seinsgrad) knnen verschwinden. Im Universum des Wortes bleiben die Formen/Symbole erhalten. Wir knnen also feststellen, da die onen, die unter ihrem kos mologischen Aspekt (also so, wie sie von der Physik im realen Raum dargestellt werden) Elektronen und Quarks genannt werden, die ei

140

gentlichen Bestandteile des Wortes sind: Sie verfgen ber eine Ein richtung zur Aufnahme von Informationen (Neutrino mit Psi-Welle), ber ein unzerstrbares Gedchtnis mit faktisch unerschpflicher Ka pazitt (Sigma-Feld) und ber ein Bewutsein (Geist), das sie frei macht. Dazu kommt, da (zumindest die bewuteren) onen praktisch ewig leben. Aus all dem lt sich schlieen, da wir es bei diesen Tr gern des Wortes mit wahren Persnlichkeiten zu tun haben: on (Psi-Sigma-Feld) = Persnlichkeit Das heit nun natrlich nicht, da komplexe Wesen wie wir (oder jeder andere Organismus im Tier- oder im Pflanzenreich), die aus einer riesigen Menge von onen bestehen, diese Bezeichnung deshalb nicht mehr in Anspruch nehmen drfen. Die einzelnen onen und unser Ich haben ein und denselben Geist. Doch haben wir auch dasselbe Ich? Wenn ich sterbe, lebt mein Geist weiter, denn er ist ja auch der transzendente Geist des Seienden. Was geschieht jedoch mit meinem Ich? Mit dieser Frage werden wir uns noch beschftigen mssen, nachdem wir den Begriff des Ichs genauer definiert haben.

Ergnzende Hintergrnde zur Informations-Physik aus aktueller Sicht der Quantenfeldphysik


Die physikalischen Eigenschaften der elektrischen Ladung von Elektronen und Positronen wird geradezu dadurch verursacht, da Elektronen und Positronen eine innere Raum-Zeit-Struktur mit Photonen/Anti-Photonen besitzen. Neben den rein physikalischen Aspekten hat die elektrostatische Wechselwirkung noch eine geistige Bedeu tung. Durch den Photonen-Impulsaustausch knnen die beiden Elektronen untereinander Informationen in Form von Lichtmustern austauschen. Das heit, sie knnen von einander lernen, es erfolgt ein Informationszuwachs!

141

Im inneren der Photongase der Elektronen sind nicht nur gewhnli che Photonenzustnde mit Spin = +/-1tn mglich, sondern auch sol che mit hherem Spin = +/-1 tn, +/-2 tn, +/- tn und so weiter (wie eine Arbeit von Louis de Broglie zeigt). Charon belegt, da durch sol che hheren Spin-Zustnde die Anzahl der mglichen Lichtmuster im inneren der Elektronen zunimmt. Somit knnen die Elektronen (wie alle geladenen Teilchen) sehr komplizierte Lichtmuster indirekt unter einander austauschen - durch den Photonen-Impulsaustausch. Und mit jedem Photon-Impuls-Austausch werden die Elektronen vertrauter miteinander, da die Zahl der gemeinsamen Lichtmuster zunimmt. Das Positron sammelt in gleicher Weise wie das Elektron Erfahrungen durch Speicherung von Antilichtmustern im inneren seines Antiphoto nengases. Auerdem werden die Lichtmuster/Anti-Lichtmuster zwi schen dem Elektron und dem Positron ausgetauscht. Der Photon-Antiphoton-Impulsaustausch hat jedoch zur Folge, da sich das Elektron und das Positron anziehen und gegenseitig festhalten. Die Elektron-Positron-Wechselwirkungen sind fr die Konden sation und Verdichtung materieller Strukturen (Quarks = Neutri nos) von Bedeutung. Diese elektrostatische Wechselwirkung zwi schen geladenen Teilchen ist nur ein Teilaspekt der allgemeinen emWechselwirkung. Neben diesem Photon-Impuls-Austausch, von Innenraum zu Innen raum knnen die Elektronen auch mit dem ueren Raum-ZeitKontinuum in Kontakt treten und zwar durch Abstrahlung bezie hungsweise Empfang von reellen Photonen, die sich in der ueren Raum-Zeit mit Lichtgeschwindigkeit ausbreiten. Die Gesamtheit dieser reellen Photonen im Auenraum bildet das Spektrum der em-Wellen. Aus den elementaren stabilen Teilchen Neutrino und Antineutrino las sen sich alle brigen Teilchen bilden. Neutrinos bilden Photonen, Photonen bilden Elektronen und Positronen, diese bilden die Quarks, die Quarks bilden die stabilen Kernteilchen Proton und Neutron. Aus Protonen, Neutronen und Elektronen wird die gesamte stabile im Uni versum vorkommende Materie aufgebaut. 142

Rckkopplungsschleifen des Gehirns


Ein weiteres Merkmal von Sarfattis Post-Quantentheorie ist sein Back-Action-Modell (Gegenwirkung). Das Back-Action-Modell be schreibt die Wechselwirkungen zwischen Geist und Materie. Dieser interaktive Proze ist in beiden Richtungen wirksam. Dieser Zweiwe geproze erzeugt eine aktive Rckkopplungsschleife, die Geist und Materie zu einem ungeteilten Ganzen verbindet. Back-Action bedeutet, da die oberste Steuerungsinstanz des Gehirns in jedem Moment mit ihrer Pilotinformation arbeitet. Im Verlauf des interaktiven Prozesses kommt es zu einem dauernden Umbauvorgang. Ursache dieser Interaktionen sind uere Botschaften aus der Ver gangenheit, der Zukunft und andernorts des momentanen Hier-JetztLichtkegels des Gehirns. Die Back-Action haucht den Gleichungen der Physik das Lehen ein, so Sarfatti selbst, sie ist der Heilige Geist. Die Absicht des Geistes, die auf der Quantenebene von Materie wirkt, kommt mit der Gegenwirkung (Back-Action) der Materie auf den Geist zusammen. Hieraus ergeben sich folgende Phnomene: sich spontan selbstorganisierende Systeme, Extraktion von Nullpunktenergie aus dem Vakuum, einem empfindungsfhigen absicht-bewuten Erleben, der Entstehung seltsamer Schleifen. Sarfatti ordnet Seltsame Schleifen einer zeitverbindenden Eigen schaft zu. Er erklrt, da sie in zweifacher Form auftreten, und zwar als Absicht aus den Zukunftsschleifen mit Erfahrungen aus der Vergangen heit, wie etwa bei Erinnerungen, zusammen mit der Vorausaktion oder rckwrts gerichteten Verursachung, und als Absicht aus den Vergangen heitsschleifen mit Erfahrung aus der Zukunft, wie etwa bei prkognitiven Fernwahrnehmungen oder Remote Viewing sowie bei jeder Art von schpferischem, geistigem Akt.

143

Einheitlichkeit von Geist und Materie


Geist und Materie agieren in Form eines Back-Action, eines Gegenwirkungs-Prinzips. Empfindsame Absicht steuert offenbar die Pilot-Q-Bit-Informationswellen, welche die Materie organisieren. Gedankliche Energie lt sich in die Energie des elektromagneti schen Feldes oder in Lichtenergie umwandeln. Nach Tom Bearden wirkt die Gedankenenergie dahingehend, da sie das Nachfolgende ermglicht oder in Gang setzt: Entweder die Ladung eines geladenen Teilchens auszulschen oder eine Ladung an einem Objekt aufzubauen, das zuvor keine elektrische Ladung hatte; ein elektrostatisches Feld im Umfeld eines Objektes zu erzeugen, damit eine Interaktion entsteht; und feinstoffliche Energien in den Hy perfeldflu von Magnetfeldern zu kondensieren. Zustzlich verdich tet sich Gedankenenergie fortlau fend zu elektrischen Mustern, wel che alle Vitalfunktionen des men schlichen Krpers beeinflussen, formen und modulieren.

Abb.19: Torus (Ringwirbel)

144

Wenn ein Elektron sich auf einer elliptischen Bahn im Atom dem Kern nhert, wird es beschleunigt und seine therteilchen bewegen sich immer schneller. Nehmen wir an, da dabei vom Torus therteilchen, welche die Lichtgeschwindigkeit erreicht haben, abgerissen werden (wie Elektronen vom Atom bei seiner Ionisierung). W.A. Azjukowski, ent wickelte 1974 und 1990 ein Modell fr Elementarteilchen, Atome und Molekle als Wirbel und Kreisstrmungen vom gasfrmigem ther. Hier ist ein Elementarteilchen ein Torus. Die therteilchen um die Achse des Torus erzeugen das Magnetfeld (Spin) des Teilchens. Gleichzeitig rotieren sie im Ring um den zentralen Kreis (die Seele) des Torus und erzeugen so die elektrische Ladung. Der ther bewegt sich also im Elementarteilchen gleichzeitig kreis- und schraubenfrmig. Roger Penrose geht davon aus, da sich in unserem Kopf ein komplettes Universum darstellt. Er wies nach, da sich in Pineal-Peturi, Hypotha lamus, Thalamus, Medula Oblongata und Hypocampus natrliche Re sonanzkrper bilden.

Mikromagnetische Felder, die gemessen wurden, zeigten im EEG die Form eines Torus (Wurmloch/Schwarzes Loch).
Der Ablauf der geometrischen Entfaltung einer Lebensform ist im mer gleich. Das Leben beginnt mit einer Eizelle oder Kugel, wandelt sich in ein Tetraeder, in ein Stern-Tetraeder, in einen Wrfel, in eine weitere Kugel und schlielich in eine rhrenfrmige Ring-Schnecke, in einen Torus. Ein solcher Torus - in diesem besonderen Fall knnte man ihn als Rhrentorus bezeichnen, da er an das Innere einer Rhre erinnert - ist von daher etwas Einzigartiges, als er sich einwrts falten und sich dabei nach innen oder nach auen drehen kann. Keine andere existierende Form kann dies oder etwas hnliches. Der Torus ist die erste Form, die sich ergibt, wenn das Genesismu ster vollendet ist, und er ist absolut einzigartig unter allen Formen. Ar thur Young entdeckte, da es bei dieser Form sieben Regionen gibt, die man zusammengenommen als seven-color map bezeichnet.

145

Abb.20: Feldlinienverlauf durch elektrotechnische Anregung

Der Torus, der Ringwulst, herrscht als Form bei vielen Aspekten unseres Lebens vor. So zum Beispiel hat das menschliche Herz sieben Muskeln, die einen Torus bilden, und es pumpt Blut in die sieben Regionen. Der Torus findet sich buchstblich in allen Formen von Leben, allen Atomen und allen Himmelskr pern wie etwa Planeten, Sternen, Galaxien und so weiter.

Das Herz und Gehirn im Zustand der Liebe Harmonie durch Kohrenz von Herz und Gehirn
Existieren objektivierbare Aspekte fr das, was wir mit Liebe ausdrcken? Ist nicht Liebe etwas, was sich der rationalen Hinterfragung entzieht - ein dualistischer Aspekt, dem Welle-Teilchen-Dualismus gleichkommend? Im Zustand der Hingabe lst sich das persnliche Selbst, um sich im Gefge des Seins als Ganzes zu integrieren. Absolute Hingabe erfahren wir im Zustand der Liebe und ist mit ihr gleichzuset zen. In diesen Momenten hren wir scheinbar auf zu existieren, sind offenbar auerhalb des Zeitgefges. Wir befinden uns im Flu des kosmischen Seins, ohne an persnliche Aspekte gebunden zu sein. Un ser Handeln verluft nach harmonischen, weichen Fliegesetzen der unpersnlichen Natrlichkeit. Gefhle der Ekstase tragen die inneren Bilder unserer Wahrnehmung. Unser Ego stellt sich diskret in den Dienst des erfahrenen Glcks, welches sich seiner Reichweite entzieht. Liebesenergie ist die eigentliche vereinheitlichende, anziehende Kraft (Kohsionskraft) des Universums. So ist sie beispielsweise die Kohsi onskraft zwischen den Elementarteilchen wie die Elektronen. Diese Liebe ist die Intelligenz, welche die Elektronen in eine bestimmte Form fhrt. 146

Abb.21: Das elektromagnetische Potenzial eines Kin derherzens. Deutlich erkennbar ist die Form eines Torus. Dieses Torus-Feld hat eine Reichweite von etwa zwlf bis fnfzehn Fu (vom Krper entfernt). Die Quelle dieses Torus ist das Herz.

Abb.22: Magnetfeldlinien eines menschlichen Herzens. Diese Aufnahme stammt von der University of Utah - Computer Department.

Abb.23: Wurmloch/Dimensions-Tor als Torus.

Abb.24: Der Mensch als Schnittstelle zum Hyperraum.

147

Willenskraft ist die Energie, welche die Elektronen um den Atom kern rotieren lt - und zusammenhlt. Dies bezieht sich auf alle Wir belkrfte im Universum. Selbst der atomare Kern wird durch einen sol chen Wirbel verursacht. Es sind die rotierenden Elektronen, welche aus therteilchen, den Neutrinos, bestehen. Das Prinzip Liebe beginnt bei der biologischen Evolution, also hier in den ueren Elektronen der Atome, die Lichtenergie (Photonengas) in den Innenrumen der Elektronen zu bndeln. Im Vergleich zu Pflanzen und Tieren ist beim Menschen der Bndelungsgrad der inne ren Lichtenergie der Elektronen wesentlich hher. In Atomen eines menschlichen Krpers wird schon viel Lichtenergie in tiefer liegenden Atomorbitalen gespeichert. Die Energieportionen solcher Elektronen bergnge liegen im Bereich der ultravioletten bis hinauf zur harten Gammastrahlung. Der Denkproze des Menschen (Gedanken) ent spricht mglicherweise solch hohen Lichtfrequenzen. Bei geistiger Transformation durch Meditationen werden die Lichtenergien im Inne ren der Elektronen noch strker gebndelt. Schlielich werden auch die Teilchen im Atomkern davon erfat. Auch die Antilichtenergie (Anti photonengas) im Inneren der Positronen beginnt nun, sich immer str ker zu bndeln. Die mglichen Energiebergnge im Atomkern ent sprechen bereits auerordentlich hohen Frequenzen (harte Rntgenbis Gammastrahlung). Bei weiterer Bndelung werden sogar die Kern-

Abb.25 und 26: Erde und Gehirn als Torus.

148

teilchen (Protonen und Neutronen) in ihre Bestandteile, die Quarks, zerlegt. Auch die Quarks, die aus stark miteinander gekoppelten Elek tronen und Positronen aufgebaut sind, werden bei weiterer Bndelung aufgelst. Die Materie befindet sich damit mehr und mehr in angereg ten Energiezustnden. Der Bndelungsproze der Lichtwolken in den inneren Raum-Zeiten der Elektronen kann beim Menschen durch gei stige Transformation schlielich soweit gehen, da die gesamte innere Lichtenergie des Elektrons (und die gesamte Antilichtenergie des Po sitrons) auf ein einziges Superphoton (bzw. Superantiphoton) zusam mengezogen wird. Wenn dies geschieht, schwingt das Licht im Inneren der elektronischen Raum-Zeit mit der hchstmglichen Frequenz. Wie kann man Herz und Gehirn nun zusammenbringen? ber eine Phasenwaage kann man beobachten, wenn man ein EEG (Megert fr Gehirnstrme) gleichzeitig mit einem EKG (Megert fr Herzfrequenzen) zusammenschliet. Auf diese Weise wird er kenntlich, in welchen bestimmten Situationen wir zum Beispiel Freude erfahren. Reine, ehrliche und unschuldige Freude ist im Grunde ge nommen ein Parameter der Liebe. Das wirft die Frage auf, warum unsere Gesellschaftsform die reine Freude des Menschen so extrem er schwert. Vielmehr werden Struk turen der Ablenkung, richtig ge hender Unter-Haltung (sie halten uns wahrhaft unten) untersttzt, um die Menschen immer weiter zu degenerieren. Wahre Freude ist die Unschuld, sich in Harmonie mit etwas wieder zu finden und darin auflsen zu knnen. In der Regel sind es natrliche Aspekte. Wir selbst sind im Grunde ein na trlicher Aspekt. Wenn wir uns in Abb.27: Kommunikation zweier Gehirne ber Hyperraum. dem Naturschauspiel des Sonnen

149

aufgangs wiederfinden und uns von Herzen daran erfreuen, dann stellt auch dies einen Liebesaspekt ganz direkter Art dar. Prozesse im Gehirn beeinflussen auch parapsychologische Gescheh nisse. Schlsselbereich ist die Zirbeldrse. Sie gibt eine besondere Fls sigkeit in den Blutstrom hinein, welche die Synapsen der Nerven be einflut. Das Potenzial ist allen Menschen gegeben, es ist jedoch bei spirituellen Medien (sogenannten Hellsehern) mit einer greren, strukturell verschiedenen Zirbeldrse strker ausgeprgt. Chemische und elektronische Mglichkeiten der PSI-Induktion existieren, jedoch sei die beste Methode die mentale Einstimmung auf Friede, Harmonie und Liebe.

Es ist unmglich, da sich ein hherer Bewutseinszustand einstellt ohne die endogene Erzeugung mindestens winziger Mengen gewisser Hormonmolekle durch die neurosekretorischen Zellen im Gehirn."
Dies meint Charles Muses.

150

GEHIRN UND HYPERRAUM


Als multidimensionale Wesen zeichnen wir uns in unserem Inner sten durch Elemente aus, die auf dieser Realittsbhne materiell an wesend sind. Diese Elemente bieten die Mechanismen, die uns helfen, unser Leben zu gestalten. In unserem physischen Krper sind wir Men schen mit elektromagnetischen Zugangswerkzeugen zum Hyperraum ausgestattet. Wenn wir diese Werkzeuge in Anspruch nehmen, treten wir bewuter als multidimensionale Wesen in Aktion, die an der Ge staltung ihrer Wirklichkeit arbeiten. Tatschlich verfgen wir Menschen ber angeborene, schpferische Fhigkeiten, dessen Funktionen ber wiegend in unserem Unterbewutsein ablaufen. Die Absicht bringt uns auf bewuter Ebene mit unseren hyperrumlichen Schpfungsfhig keiten in Verbindung. Absicht erzeugt eine Kruselwelle in Zeit und Raum, durch die dann Bewegung ausgelst wird. Unsere Absicht dient dazu, Energien durch interdimensionale Portale hindurchzufhren und zu lenken. Das Halten der Absicht erzeugt eine Flutwelle, welche die Raum-Zeit ndert und so neue Ereignisse in unsere Realitt plaziert. Die Fhrung durch die miteinander verknpften, geometrischen Strukturen innerhalb des Hyperraumes wird zu einem interdimensio nalen Proze. Der Schlssel zum Verbinden von Ebenen bestimmter Dimensionen liegt darin, die Verbindungswege zu finden oder herzu stellen, welche die Geometrien auf natrliche Weise miteinander ver binden. Unser Bewutsein steuert und durchdringt smtliche Dimensionen des Seins. Verbindungen dieser Art sind die naturgemen Frequenzen, interdimensionale Knotenpunkte, Einstein-Rosen-Brcken, Wurml cher oder geometrische Verbindungselemente. Das Nutzen dieser Mglichkeiten stellt einen interdimensionalen Proze dar, bei dem in nerhalb der geometrischen Muster ber die volle Bandbreite unserer multidimensionalen Natur eine Integration hergestellt wird. Ein interdimensionaler Proze erlaubt die bertragung oder den bergang energetischer Muster von einer Dimension in die andere.

151

Diese mit dem Geist verbundenen Energiemuster tragen das Element der Umwandelbarkeit in sich. Diese Muster erschaffen unsere Realitt. Elektromagnetische Phnomene und der Magnetismus haben ihren Ursprung in den hheren Dimensionen. Elektromagnetismus kann als ein Kruseln oder eine Schwingung aus der fnften Dimension verstan den werden, die wiederum mit der Geometrie der noch hheren Di mensionen in Verbindung stehen.

Das elektromagnetische Feld ist ein Hyper-Feld


Das elektromagnetische Feld ist in Relation zu unserem physischen Krper das erste Hyperfeld. Das elektromagnetische Feld kodiert in sich die Muster und Informationen der Hyperfelder aus noch hheren Dimensionen. Das Licht und die elektromagnetischen Felder sind Re flexionen und Schwingungen der fnften Dimension. Beide Phnomene - die hnliche Eigenschaften aufweisen - sind die Trger der Kodierung von Informationen aus hheren Dimensionen. Beide wirken sich auf den Ausdruck und die Organisation von Materie in der physischen Wirklichkeit aus und beeinflussen diese. Unsere multidimensionale Natur erlaubt uns, durch die bewute Einprgung von Mustern in den Hyperfeldern des hheren Raums unsere eigene Wirklichkeit zu kreie ren. Die Gitterabmessungen variieren je nach Gitter-Struktur, wobei sie vom Gitter des Geistes (Kleinstes) zur physischen Wirklichkeit reichen (Grtes). Nach Tiller gibt es durch das Netzwerk wandernde Wellen, die mit dem Bewutsein in Verbindung stehen. Wir werden jedoch spter noch genauer darauf eingehen.

Nichtlokale (nonlocal) Teilchen stehen in Wechselwirkung mit der gesamten Zeit


Nach Tom Bearden tritt das Elektron in Wechselwirkung mit ande ren Raum-Zeit-Systemen, whrend wir auf unserer dreidimensionalen Bhne lediglich einen Teilabschnitt von ihm erfahren. Wenn wir die Elektronen darber hinaus als Schleifen oder Verwlbungen im Raum152

Abb. 28 und 29: Energetisches Gitternetz im Gehirn.

Zeit-Gefge verstehen, erscheint das Ganze noch bizarrer. Mark Hadley zufolge ist die Verwlbung so ausgeprgt, da die Raum-Zeit sich rckwrts auf sich selbst faltet und dabei einen Knoten entstehen lt, bei dem die Zeit zu einer geschlossenen Kurve verschlungen ist, hnlich einer Achterschleife oder eines Mbiusbandes. Vergangenheit und Zu kunft werden zusammen durch diese Zeitschleife verbunden. Diese Schleife ermglicht es, da die Elektronen nicht nur mit anderen Elek tronen in ihrer eigenen Zeit in Wechselwirkung treten, sondern auch mit Elektronen, die in deren Vergangenheit oder auch in deren Zukunft existieren mgen. Nichtlokale Phnomene stellen in der Naturwissenschaft eine revo lutionre Entdeckung dar. Tatbestand ist, da die Nichtlokalitt ein naturgegebener Fakt ist, was zur Folge hat, da unsere physische Wirk lichkeit nichtlokal ist. Das Bewutsein, das Denk-Gehirn-System und die multidimensionalen Aspekte unseres Seins sind gnzlich nicht lokaler Natur. Sie alle verfgen ber die Fhigkeit, sich mit anderen Systemen zu interagieren, unabhngig von der Entfernung, die sie zu trennen scheint. Nach Tillers Modell durchdringt das 10-dimensionale universelle Kalibriergitter das Gehirn (Bild A).

153

In Bild B finden wir eine berlagerung zwischen dem Gitter und dem hyperrumlichen Antriebsmechanismus. Jack Sarfatti nach dient eine ganze Reihe von Nanoantennen, gebildet durch Elektronen in nerhalb des Gehirns, dazu, den Mikrotubuli des Gehirns Informationen zu bermitteln.

Die Denkmaschine Gehirn ist ein nichtlokales System


Amit Goswami beschreibt ein Experiment, das die Nichtlokalitt der Interaktion zwischen zwei menschlichen Denk-Gehirn-Systemen be sttigt. Diese Versuche, die von Jacobo Grinberg-Zylberbaum durchge fhrt wurden, gelten als das quivalent zu dem wegweisenden AspectExperiment, das bekanntlich mit Photonen durchgefhrt wurde. In die sem Experiment traten ber einen bestimmten Zeitraum zwei Ver suchspersonen in Interaktion, so da beide das Gefhl einer inneren Verbundenheit hatten. Anschlieend wurden beide Versuchspersonen in zwei separaten Faraday'schen Kfigen untergebracht. Der FaradayKfig schirmt bekanntlich alle herkmmlichen elektromagnetischen Signale ab. Versuchsperson Nummer 1 wurde nun einem Lichtblitz ausgesetzt, wovon die Versuchsperson 2 nichts wute. Der Lichtblitz bewirkte als Signal sofort ein mebares Potenzial im EEG. Gleichzeitig wurde die Hirnttigkeit von Versuchsperson 1 aufgezeichnet. Tatsch lich trat hierbei gleichzeitig im Gehirn der anderen Versuchsperson ein Signal hnlicher Form und Intensitt auf. Der Forschungsleiter Goswami meinte hierzu: Die beiden Gehirne, Denkapparate fungieren als nichtlokales korreliertes System. Die Korrela tion der Denk-Gehirn-Systeme wird durch nichtlokales Bewutsein und die Quantennatur unseres Gehirns erhalten. Eine derartige Resonanz zu erzielen, ist eine inhrente und natrliche Fhigkeit unseres nichtlokalen Bewutseins und unseres Quantengehirns. Dieses Experiment verdeutlicht, da die Kontaktaufnahme von Menschen untereinander immer unsichtbare, aber nichtsdestoweniger reale, nichtlokale Korrelationen mit sich bringt. Dieser Information stransfer stellt auch eine Resonanz mit dem Hyperraum dar. 154

Nichtlokalitt als Merkmal der Ganzheitlichkeit


Nichtlokalitt bezeichnet jene Eigenschaft, die mit der sofortigen Weitergabe von Information in Verbindung steht, gleich, wie weit aus einander und wie stark getrennt die Partikel (oder Systeme) sind. Wh rend die Photonen sich voneinander wegbewegten, kannten sie wei terhin den Polarisationszustand des anderen Photons. Dieses Wissen erfolgte sofort und beschrnkte sich nicht auf die Lichtgeschwindigkeit. Ein hnliches Experiment wurde 1997 wiederholt (Gisin, Universitt Genf), nur da dieses Mal die Photonen 11 Kilo meter weit entfernt waren, anstatt 13, wie beim Aspect-Experiment. An hand dieses Versuches von 1997 lie sich nachweisen, da man das Merkmal der Nichtlokalitt selbst dann noch besttigen knnte, wenn sich die Partikel an entgegengesetzten Enden des Universums befn-

Abb.30: Interaktion und Anbindung an den Hyperraum.

155

den. Nichtlokalitt verweist auf die Existenz einer unsichtbaren, einer verbogenen Wirklichkeit, die der physischen Wirklichkeit zugrunde liegt. Durch diese Wirklichkeit besteht eine ungeteilte Verbundenheit, die jenseits der Grenzen von Zeit und Raum kommuniziert. 1982 stellte das Aspect-Experiment erstmals eine nichtlokale Verbindung zwischen zwei Photonen her, die aus einem gemeinsamen Ereignis stammten. Dieses Experiment brachte die Physiker zwangslufig zu dem Schlu, da Nichtlokalitt eine universelle Lebensdynamik des Kosmos ist. Damit ergeben sich einerseits uerst eigenartige rumliche Beziehun gen, eben so genannte Nichtlokalitten im Sinne des EinsteinPodolsky-Rosen-Phnomens (Spin-Umkehr bei einem Teilchen fhrt zu augenblicklicher (instantaner) Spin-Umkehr eines beliebig weit entfernten, sogenannten verschrnkten Zwillingsteilchens, anderer seits ist es mglich, mit Hilfe einer Lorenztransformation im RaumZeitdiagramm die Reihenfolge der Ereignisse umzukehren (das heit somit auch den Zeitpfeil). Hier kommt ebenfalls das Raum-ZeitProblem zum tragen, das schon Pauli und Jung in ihrem Briefwechsel beschftigt hat. Als Erstes lt sich somit zusammenfassen: Das menschliche Bewutsein, das Denken, die Funktion des Her zens und die Emotionen des Menschen, sind smtlich nichtlokal.

156

IST UNSERE REALITTSBHNE GRAMM? (Diplomarbeit von Werner Held)

EIN

HOLO

Einer der bedeutungsvollsten Physiker des letzten Jahrhunderts war sicherlich David Bohm. Kaum ein anderer Physiker des 20. Jahrhun derts hat unseren Paradigmawechsel in der Naturwissenschaft mehr beeinflut. David Bohms bedeutendster naturwissenschaftlicher Beitrag ist seine Beschreibung von Wirklichkeit. Nach ihm ist die physikalische Wirklichkeit ein ungeteiltes Ganzes, das sich in einem stndigen Flu befindet. hnlich wie die Gezeiten der Meere ist dieses ungeteilte Gan ze in einer stndigen Bewegung. Aus dem ther tauchen smtliche Stofflichkeiten auf und kehren unmittelbar wieder zum Ursprung zu rck, wobei sich in einigen Fllen eine zeitlich befristete Materialisation entwickeln kann. Diesen Zyklus nie abreiender Vernderung in unse rer Wirklichkeit, bezeichnete Bohm als Holobewegung. Diese Holobewegung vereint Materie und Geist. Die Inspiration zu der Holobewe gung erfuhr David Bohm durch die groe hnlichkeit zu dem Aufbau eines Hologramms. Die sichtbare Wirklichkeit unserer Wahrnehmung ist eine holografische Projektion eines unsichtbaren, verborgenen, in der impliziten Ordnung des hheren Raums gebildeten Hologramms. Seine implizite Ordnung ist der Ursprungsort der verborgenen Ord nungsprinzipien fr alle Erscheinungen. Die implizite Ordnung verla gert das nach auen oder bringt das zur Entfaltung, was wir als Wirk lichkeit erfahren - und was David Bohm die explizite Ordnung nennt. Die implizite Ordnung ist als die primre Wirklichkeit zu verstehen. Das, was wir zuvor als die hheren Dimensionen bezeichnet haben, entspricht der Bohm'schen impliziten Ordnung. Das Bohmsche Modell ist mit denen von Jean-Emile Charon und Burkhard Heim kompatibel. Zu einer wertvollen Erweiterung dieser Modelle trgt si cherlich Jack Sarfatti bei. Er entwickelte die Post-Quanten-Theorie. Auch Sarfatti behandelt mit einem Schwerpunkt das Thema der Inter aktion zwischen Geist und Materie, wobei seine Post-Quanten-Theorie hierbei sehr dienlich erscheint. 157

Vor- und nachdenken Wer oder was denkt fr uns? Libet und Feinstein erhielten ein auf regendes Ergebnis ihrer Experimente: Das Gehirn beginnt bereits bis zu 1,5 Sekunden, bevor die Versuchsperson eine einfache willkrliche Handlung vornimmt, wie beispielsweise eine Hand zu heben, entsprechende Wellen auszusenden, und dies vllig unbewut. Das Bewutwerden der Entscheidung passiert erst 2/10 sec vor Beginn der Bewegung. Nur in dieser extrem kurzen Zeit des Bewutwerdens kann der Handlungsimpuls noch gestoppt werden. Die Interpretation dieses Ergebnisses wre: Die Absicht zu handeln entsteht aus einer Aktivitt, die nicht Teil unserer bewuten Wahrneh mung ist. Und: Das Bewutsein ist der Wchter ber die vom Gehirn erzeugten Absichten. Das pat zu der Theorie, wonach das Bewutsein lediglich dem Zugriff zur Steuerung der Vakuumenergien entspricht. Bewutseinsmodell nach Hameroff/Penrose

In den sogenannten Mikrotubuli und anderen Strukturen der Neu ronen im Hirn finden nach Hameroff/Penrose quantenphysikalische Vorgnge statt. Der Baustein der Mikrotubuli, das Protein Tubulin, kann in zwei verschiedenen Zustnden Vorkommen (bedingt durch unterschiedliche Elektronenlokalisationen, die mit unterschiedlichen Masseverteilungen einhergehen). Diese beiden Mglichkeiten befinden sich vor einer Entscheidung fr einen definitiven Zustand in einer quantenphysikalischen Superpo sition, einer Verschrnkung. Diese Quantenkohrenz (verschiedene Teile gehen in einen einheitlichen Zustand ber, der mit einer Schrdinger'schen Wellengleichung beschrieben werden kann - man nennt diesen Zustand auch Bose-Einstein-Kondensat) soll sich nun auf gre re Bereiche ausdehnen knnen, vermutlich angetrieben durch thermale und biochemische Energien (wie von Herbert Frhlich beschrieben).

158

Abb.31: Qubit-Modell von Roger Penrose.

Penroses Idee (basierend auf Karolyhazys) ist jetzt, da die beiden unterschiedlichen potentiellen Zustnde des Tubulins mit zunehmender Kohrenzzeit unterschiedliche Masseverteilungen annehmen und sich dadurch ein Auseinanderklaffen der Raum-Zeit-Geometrie der beiden Mglichkeiten ergibt, bis eine (bislang nicht definierte) Schwelle in der Quantengravitation berschritten wird und sich ein selbstorganisierter Kollaps der Wellenfunktion, also das Ende des verschrnkten Zustan des, zugunsten eines realen Zustands der Tubulinproteine, ergibt. Diese Reduktion des Wellenpakets nennt er in den Mikrotubuli jetzt Orche strated Objektive Reduction (Orch OR) im Unterschied zu seiner frhe ren (1994) Bezeichnung Objective Reduction (OR), weil bei dieser Art natrlichen Mevorgangs die MAPs - genetische und andere Vernde rungen der Tubulin-Proteine - diesen Proze auf eine nicht nher be schriebene, aber jedenfalls nicht kausale Weise bestimmen, sozusagen tunen. Die gngige Kopenhagener Interpretation der Quantenphysik, die natrlich keine Aussagen zu Quantenphnomenen in lebenden Sy stemen macht, geht hingegen von der zuflligen Reduktion R des Wel lenpakets aus, die Bewutseinsinterpretation (in der Folge Wigners) geht dagegen von einer durch das Bewutsein erwirkten subjektiven Reduktion aus SR. Penroses Idee der OR stellt eine Art natrlicher Mevorgang durch die Wirkung der hypothetischen Quantengravitati 159

on dar. Er meint, da ein objektives Kriterium fr einen Kollaps im Sinne einer Quantengravitationsschwelle vorlge. Mit Penroses zuneh mender Hinwendung zum lebendigen Organismus nimmt er mit der selbstorganisierten Orch OR eine notwendige Erweiterung vor. Wie man aber die ganz und gar nicht objektiven, sondern zustands- und erfahrungsabhngigen Prozesse in Organismen mit einer objektiven Reduktion zusammenbringen will, bleibt sein Geheimnis. Er sieht zwar die OR - aufgrund seiner frheren berlegungen zu Gdels Unvoll stndigkeitstheorien und seiner daraus folgenden Absage an die prinzi pielle Mglichkeit einer knstlichen Intelligenz - als nicht algorithmisierbar und damit nicht computerisierbar an, lst aber damit nicht den grundstzlichen Widerspruch zwischen seinem, als objektiv formulier tem Konzept und den Wahrscheinlichkeitsaussagen der Quantenphysik und der Selbstorganisation. Berechnung der Quantengravitationsschwelle

Penrose bernimmt nun die von dem Neurophysiologen Benjamin Libet in seiner Time-On-Tbeorie geuerte Vermutung, da lediglich die Dauer der Nervenaktivitt bestimmen knnte, was bewut wird. Libet kam zu etwa einem Drittel bis einer halben Sekunde notwendiger Vorlaufzeit der unbewuten Nervenaktivitt (in Form eines seit den sechziger Jahren durch Kornhuber und Deecke bekannten Bereitschafts potenzials, also einer langsam ansteigenden, negativen Spannungsver schiebung, die untrglich auf eine gleich einsetzende Ttigkeit hin weist). Penrose setzt dann die Dauer der Kohrenz der Mikrotubuli mit der halben Sekunde unbewuter Nerventtigkeit gleich und versucht somit, den bergang von unbewuten Vorgngen zu bewuten Vor gngen mit den Vorgngen in den Mikrotubuli gleich zu setzen. Die verschiedenen Formationen der Mikrotubulibausteine des Proteins Tubulin stellen fr Penrose die Schwelle fr den bergang der quan tenphysikalischen zur klassischen Beschreibung dar, da nach dem Selbstkollaps der Ansto fr die weiteren neurophysiologischen Vor gnge und Funktionen dann klassisch (also kausal und lokal) beschrie ben werden kann. 160

Die Formel fr die Quantifizierung der Quantengravitations schwelle lautet dabei T = h/E, wobei T die zeitliche Dauer der Super position zwischen den Tubulins ist, h Plancks Konstante darstellt und E die Gravitationsenergie der unterschiedlichen Massenverteilungen der zwei Tubulinzustnde (abhngig von der Zahl der kohrenten Tubulinproteine). Penrose nimmt dabei als durchschnittliche Superpositions zeit eine halbe Sekunde an. Penrose kommt nun zu folgenden Rech nungen: Ein typisches Neuron weist ungefhr 107 Tubulins auf. Wenn jetzt etwa 10% (also 106) davon einen Zustand der Quantenkohrenz bildeten, wrden 1.000 Neurone, die fr eine halbe Sekunde korreliert wren, die Schwelle der Quantengravitation berschreiten = Orchestrated Objective Reduction (Orch OR) der Wellenfunktion. Folgerung: Ein Organismus, der fhig ist, eine Quantenkohrenz von ber 109 Tu bulins fr 500 msec, aufrechtzuerhalten, ist in der Lage, bewute Erfah rungen zu haben. Mehr Tubulins fr eine krzere Zeit oder weniger fr eine lngere Zeit erreichen dasselbe. Da jetzt Quantenzustnde nichtlokal sind, kann jede Orch OR ver schiedene Superpositionen zusammenbinden, die entweder rumlich verteilt oder aber zu verschiedenen Zeiten entstanden sind. Die Erkl rung hierzu wre die berschreitung der Gravitationsschwelle zu einem Moment. Nach seiner Berechnung knnte auch das einzelne Elektron Bewutsein erlangen. Dazu mte es aber seine Superposition in unge strter Isolation lngere Zeit (und zwar lnger als das uns bekannte Alter des Universums) aufrechterhalten knnen. Kann es das nicht, erfolgt die jetzt dann zufllige Reduktion R mit seiner Umgebung. Pen rose unterscheidet also zwischen zuflliger R und nichtzufllige, nichtalgorithmisierbare Reduktion OR. Die Fragwrdigkeit dieser Unterscheidung zeigt sich darin, da also gewisse Teile des Organismus nur vllig zufllig funktionieren, die Mi krotubuli hingegen nichtzufllige Prozesse bewirken. Aber dies auch nicht ausschlielich, denn die Mikrotubuli beheimaten - nach Penrose - sowohl klassische als auch quantenmechanische Prozesse!

161

Die Polaritt der Tubulin-Endzustnde, die sich in Nanosekundenschritten (10-9 sec) ndern knnen, pflanzt sich lokal (klassisch) auf benachbarte Regionen fort, bildet damit Muster und kann als Signal vermittlung fungieren. Das kann mit einer Geschwindigkeit von 8 bis 800 Metern pro Sekunde geschehen und ist daher genau so schnell die Weiterleitung der Aktionspotentiale. Diesen klassischen Proze setzen Hameroff und Penrose mit autonomen, nicht bewutseinsfhigen Ak tivitten gleich, whrend die weitreichenden, langanhaltenden (quan tenphysikalischen) Kohrenzen in den Mikrotubuli mit unbewuten, aber zum Bewutsein fhrenden Prozessen gleichgesetzt werden. Es stellen sich nun die Fragen: Ist das Gehirn nichts anderes als Quantenphysik bzw. Quantengra vitation? Und wo ist der Schnitt zur Erzeugung der Wirklichkeit? Die vielleicht wichtigsten Erklrungslcken der Quantenphysik lauten: Warum kommt es zum Kollaps der Wellenfunktion? Und wann findet der Kollaps statt? Penrose bietet auf die erste Frage eine rein formale Antwort (und geht damit weiter als andere Theoretiker): Es kommt zum Kollaps, weil die Quantengravitationsschwelle berschritten wird.

Weitere Anstze, die auf die Mikrotubuli-Hypothese aufbauen


Der Physiker Del Giudice (1988) aus Mailand geht mit seiner Hy pothese noch ber die von Hameroff beschriebenen, optischen Lei tungsfhigkeiten der Mikrotubuli hinaus. Er behauptet, da Mikrotu buli nicht nur Lichtphotonen weiterleiten, sondern auch aus Licht photonen aufgebaut und strukturiert werden. Ursache dieses Phno mens ist die Fokussierung kohrenter Wellen, welche die Bedingungen dafr schafft, Materie entsprechend dem Strahlenkegel anzuordnen und zu verketten. Es handelt sich also um eine gegenseitige Stabilisierung von kohrenter Strahlung und Materie. Yasue, Jibu und Pribram (aufbauend auf Umezawa 1967) stellten in ihrer Theorie der quantum brain dynamics eine neurale Wellenglei 162

chung auf, die dieselbe Form wie die Schrdinger'sche Wellengleichung in der Quantenmechanik aufweist. Welleninterferenz spielt bei der neuralen Wellengleichung eine entscheidende Rolle, denn nach David Bohm geht jede raum-zeitliche Ordnung in eine nichtlokale implizite Ordnung ber, wenn sie in eine Interferenz eingeht. Betrachtet man das Gehirn also aus der Sichtweise der Quantenmechanik, so bedeutet dies, da, wenn ein Input die Interferenz der Gehirnwellen erreicht, er in eine nichtlokale, also berall verbreitete Ordnung bergeht, er also durch andere Muster interpenetriert wird und keine Spur von ihm zu rckbleibt. Diese implizite, nichtlokale, quantenphysikalische Ordnung mu unterschieden werden von der makrophysikalischen, lokalen Ord nung topologischer Zuordnungen, die der Hauptzweig der Hirnfor scher in seiner Beschreibung der gehirnarealgebunden Funktionen ver sucht. Gordon Globus, der besonders Yasues, Jibus und Pribrams (Y, J & P) Auffassungen zuneigt, beschreibt einen bergang von einem lo kalen zusammengesetzten Muster (Computation), das heit, einer be deutungslosen syntaktischen Form zu einer nichtlokalen Aktivitt (bei spielsweise, wenn Formaspekte zu einem Bild eines Dreiecks zusam mengesetzt werden). Der Gestaltsprung wird also als nichtlokales Ph nomen gedeutet. Globus erweitert die Mikrotubuli-Hypothese, ber die Membran hinaus, auch auf den extrazellulren Raum und damit in den synaptischen Spalt. Extrazellulr nennt man diese Eiweirhrchen Matrix. Diese Fden sind vielfach von innen nach auen ber Wasserstoffbindungen ver knpft (zwei Fden teilen sich ein Wasserstoffatom). Dieses Fadennetz mu nach seiner und Y, J & Ps Meinung als quantenphysikalisches Sy stem angesehen werden, denn mit seiner Ladung fngt sich das Netz nichtlokale Photonen. Auch Wassermolekle sind mit dem Fadennetz eng verbunden. Wassermolekle haben eine schwache elektrische La dung und fgen sich zu einem Riesenwassermolekl zusammen, das etwa 50 Mikrometer groe Regionen umspannt. Solch ein Riesenmole kl verlangt eine quantenphysikalische Beschreibung, das heit, die Nichtlokalitt bleibt erhalten. Also sind die vermittelnden Instanzen der Transferfunktion der Zellen Riesenwassermolekle und Licht.

163

Das quantenphysikalische Modell von Eccles/Beck

Der Ansatz von John C. Eccles konzentrierte sich auf die Synapsen. Denn seiner Meinung nach knnen Quantenvorgnge im gesamten elektro-physiologischen Proze des Neurons nur dort eine Rolle spie len (solch eine Aussage ist allerdings nur in diesen Grenordnungen plausibel). Zusammen mit dem Physiker Friedrich Beck entwickelte er daher in seinem Buch Wie das Selbst sein Gehirn steuert (1994) ein Modell fr die quantentheoretische Beschreibung der Synapsenttig keit. In den Boutons, den grundlegenden synaptischen Einheiten, voll zieht sich ein Proze, Exozytose genannt. Das heit nichts anderes, als die vorbergehende ffnung eines Kanals in der prsynaptischen Membran und die Freisetzung der Transmittersubstanz in den synapti schen Spalt. Exozytose vollzieht sich immer nach dem Alles-oderNichts-Prinzip. Wenn die Transmittersubstanz ausgeschttet wird, dann ganz. Eine Analyse ergab, da ein Impuls, der von einem Axon zum Bouton weitergeleitet wird, mit einer durchschnittlichen Wahr scheinlichkeit von sehr niedrigen 25% eine Freisetzung auslst. Fr diesen Wahrscheinlichkeitsproze entwickelten die beiden eine quan tenphysikalische Beschreibung. Dabei nahm man an, da eine Tunnel bewegung eines Quasi-Teilchens den Auslsemechanismus der Exo zytose darstellt. Eccles Hypothese lautete nun, da der mentale Vorsatz (das Wol len) durch eine momentane Zunahme der Wahrscheinlichkeit einer Exozytose in ausgewhlten Bereichen des Kortex ttig wird. In der Sprache der Quantenphysik bedeutet dies eine Selektion von Ereignis sen, die bereits mit einer gewissen Wahrscheinlichkeit vorbereitet wa ren. In der Benennung des zeitlichen Rahmens bezieht sich Eccles auf die Experimente Libets, die ein Intervall von 200 msec zwischen be wutem Wollen und der Ausfhrung einer willentlichen Handlung ergaben. Eine andere Betrachtungsweise wre folgende: Das menschliche Gehirn ist in der Lage, ber die von ihm ausges trahlten Felder, mit dem Hyperraum zu kommunizieren. Ein Kriterium 164

fr diese Verbindung sind die kohrent schwingenden Neuronen und damit der von denen ausgestrahlten Felder. Es bleibt festzuhalten: Das Gehirn ist ein Instrument, welches (wie offenbar auch die DNS) als Schnittstelle zwischen dem Hyperraum und dem von uns wahrnehmbaren vier-dimensionalen Raum betrachtet werden kann. Es ist uns mglich, willentlich auf diesen Proze einzu wirken. Der Auswahlproze vollzieht sich hierbei durch entsprechende Gehirnfrequenzen. Die vom Hirn abgestrahlten Frequenzen sind ent sprechenden Bewutseinszustnden zugeordnet. Erst wenn sehr lang same (langwellige) Schwingungen bewut ber einen bestimmten Zeit raum gehalten werden, sind diese Kriterien erfllt. Insofern knnen wir einen bewuten Einflu auf diesen Proze ausben. Unsere Bewut seinslage entscheidet somit ber die Ankopplung an den Hyperraum. Krpereigene (endogene) und uerlich zugefhrte (exogene) Drogen (psychoaktive Substanzen) tragen lediglich zu einer Verstrkung der neuronalen Aktivitt bei. Die uere Zufuhr einer psychoaktiven Sub stanz (zum Beispiel LSD) fhrt zu einer verstrkten Aktivitt der Neu ronen, was umgekehrt genauso geschieht. Das heit, die krpereigenen psychoaktiven Substanzen bewirken eine entsprechende NeuronenAktivitt. Dieses sind in beiden Fllen die Bedingungen, sich mit dem Hyperraum zu verbinden. Es sind auch die Voraussetzungen, welche zu einer der Intensitt entsprechenden Aufmerksamkeit fhren. Hhere Neuronen-Aktivitten bedeuten zum einen eine hhere Feld-Intensitt und eine hhere Aufmerksamkeit. Nun sagt die Aufmerksamkeit noch nichts ber den Grad der bewuten Wahrnehmung aus. Wir knnen, wie in Trumen zum Beispiel, durchaus sehr aufmerksam sein, und sind doch kaum bewut! Die Bewutheit entscheidet ber die Ebene der kontrollierten Wahrnehmung. Nehmen wir hierzu ein Beispiel: Wenn wir unsere Lieblingsspeise zu uns nehmen, entscheidet die Aufmerksamkeit ber den Grad des emp fundenen Genusses. Die gleiche Speise wird uns, wenn wir in einer weiteren Aufmerksamkeits-Aktion eingebunden sind, und zum Beispiel einen spannenden Film gleichzeitig auf uns einwirken lassen, kaum die Geschmacks-Intensitt vermitteln, als wenn wir uns nur mit unserer

165

Speise beschftigen wrden. Zwar verfgen wir ber eine LenkFunktion, einen Selektor, welcher eine Auswahl aus einer Vielzahl von mglichen Entscheidungen trifft, setzen diesen jedoch kaum bewut ein! Wir sind eher am Reagieren auf das, was auf uns einwirkt, als da wir von einer souvernen Position aus Agieren wrden. An folgender Stelle (1/2 Sekunden-Phnomen, Freier Wille) werden wir erkennen, da wir uns berwiegend marionettenhaft darstellen (welches sich in einer Funktionalitt begrndet). Unsere bewute Aufmerksamkeit entscheidet nun, ob und in welcher Intensitt das entsprechend Fixierte auf uns einwirkt (alles schmeckt besser/schlechter). Es existiert also noch eine andere Ebene, welche offensichtlich die Entscheidung der Bewutheit trifft, womit der sogenannte Freie Wille ins Spiel kommt. Da wir diesem Thema ein eigenes Kapitel zugeordnet haben, werden wir an dieser Stelle nicht nher darauf eingehen. Gehen wir jetzt der Frage nach:

Was entscheidet ber den Grad unserer Bewutheit?


Hierzu ist es erforderlich, den bio-chemischen Bereich etwas einge hender zu betrachten. Es bleibt festzustellen, da psychoaktive Sub stanzen krpereigene und uerlich zugefhrte Substanzen zu sehr hnlichen Wirkungen fhren. Betrachten wir nun die vom menschli chen Krper selbst produzierten Substanzen, die sogenannten NeuroTransmitter. Grundstzlich dominieren (was unser Bewutsein betrifft) in unserem Krper zwei von diesen Neuro-Transmittern - Serotonin und Melatonin. Vereinfacht kann man sagen, da Serotonin uns im Wach-, und Melatonin uns im Schlaf-Zustand hlt. Unser Krper pro duziert die jeweiligen Neuro-Transmitter zu der entsprechenden Tages beziehungsweise Nacht-Zeit. Viel Serotonin geht einher mit einer gr eren Aufmerksamkeit im Wach-Zustand, und viel Melatonin bewirkt die Intensitt unserer Trume (REM-Phase), was einer TraumAufmerksamkeit entsprechen knnte. Mit zunehmender Lebensdauer nimmt der absolute und relative Anteil des REM-Schlafs am Gesamt schlaf ab. Im REM-Schlaf wird die intensivste psychische Aktivitt

166

nachgewiesen, die sich in visuell und motorisch geprgten Erlebnispro zessen darstellt, zum Teil in bizarrer Ausformung, wobei Einsicht, Ur teilskraft und Kontrolle typischerweise dabei fehlen. In beiden Fllen sind unsere Neuronen in einem erhhten Aktiv-Zustand. Der Haup tunterschied hierbei ist der Grad der Bewutheit. Im Traum verliert sich unser ICH weitestgehend, wohingegen wir im Wachzustand uns unserer Identitt durchaus bewut sind. Nun existiert noch eine weite re Ebene, welche uns eine Antwort auf die Frage geben kann: Was ent scheidet ber den Grad unserer Bewutheit? Hinter dieser Ebene verbargen sich die Phnomene: Klartraum (Luzides-Trumen) und Nahtod-Erfahrung. In diesen Zustnden sind wir uns unserer Situation im vollem Umfang bewut, obwohl wir zum Bei spiel trumen. Hier verzerren sich die Zeit- und Raum-Dimensionen teilweise ganz erheblich. So kommt es in diesen Zustnden nicht selten vor, da wir in bereits vergangene oder zuknftige Prozesse bewut eingreifen knnen. Beobachtet man diese Prozesse metechnisch etwas eingehender, ist festzustellen, da die Frequenz der aktiven Neuronen (3-8 Hz) fr dieses Phnomen verantwortlich ist. Konkret bedeutet, da die Alpha- und Theta-Frequenzen dominieren, also der Frequenz bereich tiefster Entspannung (3-8 Hz). Vergleichen wir ein solches aufgezeichnetes Signal eines Menschen mit den Mediagrammen der Erd-Frequenzen (Schumann-Resonanz), so werden wir eine frappie rende hnlichkeit der Frequenzen und deren Kurvenform - zwischen Hirn und Erde - erkennen. Herausragende Naturwissenschaftler und Bewutsein sind beispielsweise: zum Thema

Quantenphysik

Roger Penrose Der Physiker und Mathematiker Roger Penrose geht ausdrcklich von einer realen Existenz platonischer Ideen - zumindest mathemati scher Art - aus. In seinem Buch Computerdenken widmet er dem Kontakt mit diesen Ideen ein eigenes Kapitel und beschreibt seine eige ne Wahrnehmung mathematischer Formeln explizit in der Form einer Wiedererinnerung an platonische Ideen. 167

Diesem Kapitel vorangestellt sind weitlufige berlegungen zur Funktion des menschlichen Gehirns und eine Beschreibung der Tatsa che, da einzelne nicht-determinierte Quantenereignisse den Gang der Gedanken in menschlichen Gehirnen beeinflussen knnten. Penrose bringt also explizit die nicht-Kausalitt von Quantenereignissen mit einer Wirkung platonischer Ideen in Zusammenhang. Bei seiner Unter suchung des Phnomens des Bewutseins charakterisiert er unbewute Denkvorgnge als automatisch, gedankenloses Befolgen von Regeln, pro grammiert, algorithmisch* und grenzt sie ab gegen bewute Denkvor gnge, die charakterisiert seien durch gesunden Menschenverstand, Wahrheitsurteil, Verstehen, knstlerische Wertung. Er schreibt: Ich meine daher, da unbewute Hirnttigkeiten gem algorithmischen Prozesses ablaufen, whrend die Ttigkeit des Bewutseins davon ganz verschieden ist und in einer Weise vor sich geht, die durch keinen Algorithmus beschrieben werden kann. Und: Das Bilden von Urteilen, das ich fr ein Wesensmerkmal von Bewutsein halte, ist an sich selbst etwas, von dessen Programmierung auf einem Computer die KIForscher keinen Begriff haben. Fr Penrose ist gerade der bewute Geist etwas klar gegen algorithmisierbare, das heit rationalisierbare Logik. Penrose lt also die von Platon vorgefhrten Schwierigkeiten einer Rationalisierung von Be griffen bestehen und postuliert vielmehr, da sich das menschliche Be wutsein gerade durch diese Fhigkeit einer Erkenntnis des Irrationalen auszeichne. Henry Stapp Der amerikanische Wissenschaftler Henry Stapp schlgt eine funk tionale Verknpfung von bewuten Gedanken und neuronalen Aktivi ttsmustern ber quantenphysikalische Phnomene vor. Die wesentli che verbindende Qualitt ist die Unteilbarkeit ihrer Komplexitt. Stapp sttzt sich auf das Werk von William James, in dem ein einzelner Ge danke wie folgt als holistische Einheit charakterisiert ist: ...each conscious thought is essentially a complex whole; each thought has components, which can be examined by subsequent analysis, but, as given, is a unified 168

whole that cannot be reduced to a collection of parts without destroying its essence. Man fhlt sich bei diesem Zitat an Platons Definition der Ideen als unteilbare Einheiten erinnert. Anders aber als Platon versucht Stapp nicht, die Vorstellung einer unteilbaren Komplexitt in logische Absur ditten zu fhren, sondern er akzeptiert diese Vorstellung als unge prfte Prmisse. Stapp sucht nun in der wahrnehmbaren physikalischen Realitt nach einem materiellen Korrelat als Trger von Gedanken. Und er glaubt es in koordinierten Quantenereignissen in den Synapsen und Neuronen menschlicher Gehirne vermuten zu drfen. Stapp bezieht sich dann auf C. G. Jungs Idee der Synchronizitt, die er wie folgt definiert: Synchronicity refers to the occurrence of representations of archetypes in meaningful coincidences that defy causal explanation. Hier ist es der Begriff Archetyp, der an die platonischen Ideen er innert. In Verbindung mit dem Vorhergesagten scheint Stapp unter diesen Archetypen etwas unteilbar Komplexes zu vermuten, das aber gedankliche Ablufe ber Quanteneffekte zu beeinflussen vermag und Ausdruck einer uns verborgenen Realitt zu sein scheint. Es sind aber gerade die quantenmechanischen Unbestimmtheiten, welche es un mglich machen, den Einflu dieser anderen Realitt empirisch zu fas sen. Die beeinfluten Ereignisse in der von uns wahrgenommenen Rea litt sind zwar akausal, sie werden aber von dem Zufallscharakter der Gesamtheit aller Quantenereignisse verwischt. Demnach ist es gerade die quantenmechanische Wahrscheinlichkeit, welche ein Wirken einer anderen Realitt in die unsrige hinein zult, aber gleichzeitig auch un kenntlich macht. Es verwundert, da Stapp in dem zitierten Buch Pla tons Ideen nicht explizit nennt. Fr die vorliegende Arbeit ausreichend ist aber die Erkenntnis, da der quantenphysikalische Wahrscheinlich keitsbegriff in einer Weise interpretiert wird, die unter Verletzung der Kausalitt die Wirkung einer fremden Realitt gleichzeitig zult und verschleiert. Nach Stapp lge es demnach in der Natur der Sache, da Platon bei dem Versuch einer rationalen Erfassung dieser jenseitigen Welt zwangslufig scheitern mute. 169

Karl Popper und John Eccles Der Philosoph Karl Popper und der Neurophysiologe John Eccles stellen in ihrem gemeinsamen Buch Das Ich und sein Gehirn die The se einer dreigeteilten Welt auf. Popper geht im ersten Teil des Buches im Zusammenhang mit dem Geist-Krper Problem ausfhrlich auf die philosophischen Grundlagen von Mehrweltentheorien im allgemeinen ein. Dabei setzt er sich unter anderem detailliert mit Platon auseinan der. Im zweiten Teil des Buches macht Eccles einen konkreten Vor schlag einer quantenphysikalisch plausiblen Beeinflussung menschlicher Gehirnaktivitt, ohne da dies gegen die Kausalabhngigkeiten der be obachtbaren physikalischen Realitt verstoen soll. Popper pldiert im Gegensatz zu Platon fr eine Dreiteilung der Welt. Poppers Welt 1 ent spricht Platons Welt der sinnlich wahrnehmbaren Erscheinungen. Pop pers Welt 2 hat als Welt psychischer Zustnde keine unmittelbare Ent sprechung in Platons Gedankengebude. Sie kommt Platons Vorstel lung von Seelen als vermittelnde Instanz allerdings recht nahe. Poppers Welt 3 deckt sich mit Platons Ideenwelt in vielen Aspekten. Popper charakterisiert sie als die Welt der Inhalte des Denkens". Doch anders als Platons Ideen sind die Gegenstnde Poppers Welt 3 Menschenwerk. Popper schreibt diesen Gegenstnden eine Eigenstndigkeit zu, die an die Autonomie der platonischen Ideen erinnert. Popper grenzt sich aber gegen Platons Ideenannahme unter anderem dadurch ab, da er beispielsweise falsche Theorien als Gegenstnde seiner Welt 3 akzep tiert, was Platon nach Meinung Poppers wohl nicht akzeptieren knne. Popper setzt sich ausfhrlich mit der Erkennbarkeit der Gegenstnde seiner Welt 3 auseinander, bleibt aber hnlich wie Platon vage in seinen Anleitungen dazu. Wie aber Poppers Gegenstnde der Welt 3 selbst etwas Falsches darzustellen vermgen, so kann auch der Proze der Erkennung durch den Menschen selbst fehlerhaft sein. Der Akt der Erkenntnis ist auch nicht wie bei Platon ein erleuchtungshnliches, pltzliches Ereignis, sondern ein aktiver, geistiger Proze. Die Ele mente von Poppers Welt 3 sind also Menschenwerk und sie knnen von Menschen auch grundstzlich erkannt werden. Popper grenzt sich zu dem klar gegen Platons Vermutung ab, da es Gegenstnde eines eige

170

nen Seinsbereiches gbe, die nur in einem Akt irrationaler Erkenntnis wahrgenommen werden knnten. Denkbaren Wechselwirkungen zwi schen den Gegenstnden seiner Welt 3 und der Welt 1 der physikali schen Dinge widmet Popper ein eigenes Kapitel. Die vermittelnde In stanz zwischen diesen Welten ist Welt 2, die Welt psychischer Zustnde im allgemeinen und des Bewutseins im speziellen. Aber obwohl die kausale Abgeschlossenheit der Welt 1 plausibel sei und von den meisten Physikern akzeptiert werde, postuliert Popper die kausale Offenheit von Welt 1 als Voraussetzung fr die menschliche Freiheit. Dies erin nert stark an Platons Wiedergabe von Sokrates1 Gedanken ber die Ur sachen seiner Handlungen in seiner Todeszelle. Poppers menschliche Freiheit kommt hier Sokrates1 wahrer Ursache nahe und Popper interpretiert diese Passage in Platons Werk als eine klare Benutzung des modernen Kausalittsbegriffes. Und so wie Sokrates eine rein materialistische Erklrung seiner Handlung als nicht hinreichend verwirft, so glaubt auch Popper, da ein radikaler Physikalismus (kausale Abgeschlossenheit von Welt 1) aufgrund der Tatsachenbefunde der Quantenphysik nicht aufrecht er halten werden kann. Popper gelangt also aufgrund philosophischer Be trachtungen und unter vielfacher Bezugnahme auf Platons Schriften zu dem Schlu, da die Welt der sichtbaren Dinge kausal nicht abgeschlos sen ist und Gegenstand einer Einflunahme einer immateriellen Welt 3 sein knnte. Als Vermittlungsinstanz sieht Popper seine Welt 2 psychi scher Zustnde, welche am ehesten mit Platons verschiedentlichen Be schreibungen der Seele verglichen werden knnte. Der Neurophysiologe Eccles stimmt dieser Analyse Poppers weitgehend zu und ber nimmt ausdrcklich dessen Begriffe zur Beschreibung einer dualisti schen Theorie. Eccles beschrnkt sich aber nicht auf philosophische Betrachtungen. Als Naturwissenschaftler unterbreitet er experimentell berprfbare Hypothesen zu zwei Kernproblemen menschlicher Er kenntnisfhigkeit und Handlungsfreiheit. Zum einen unterstellt er hnlich wie Henry Stapp -, da rumlich ber das gesamte Gehirn ver teilte Quantenzustnde beziehungsweise Aktivittsmuster von Neuro nen mit bestimmten Bewutseinsinhalten korrelieren, mit diesen aber

171

nicht identisch sind. Der selbstbewute Geist (die Seele in Platons Sprache) interpretiert neuronale Zustnde menschlicher Gehirne und integriert daraus Erfahrungen. Aus der Tatsache, da der selbstbewute Geist der Welt 2 angehrt, erklrt sich auch das Phnomen, da die integrierende Wirkung, welche bewute Wahrnehmung erzeugt, nicht mit rationaler Logik alleine erfat werden kann, sondern holistisch ge deutet werden mu. Zum zweiten macht Eccles in einem eigenen Buch einen konkreten Vorschlag, an welchen physiologischen Strukturen im menschlichen Gehirn die Wirkung von Quantenereignissen menschli che Gedanken und Empfindungen beeinflussen knnte, ohne dabei gegen die statistischen Gesetze der Quantenmechanik zu verstoen. An den Schnittstellen zwischen Nervenzellen, den sogenannten Synapsen, werden elektrische Reize mit Hilfe chemischer Botenstoffe bertragen. Die Wahrscheinlichkeit einer bertragung dieser chemischen Stoffe wird unter anderem durch den Zustand der synaptischen Strukturen beeinflut. Diese Strukturen sind nun klein genug, da die gezielte Be einflussung von Quantenereignissen die Wahrscheinlichkeit einer Reizbertragung zwischen Nervenzellen modifizieren knnte. Eccles bleibt also nicht blo dabei, eine willentliche Beeinflussung von Quan tenereignissen im Gehirn als Voraussetzung einer Steuerung menschli cher Handlung zu postulieren, sondern er schlgt auch konkrete, wis senschaftlich handhabbare Wirkmechanismen auf der Grundlage quan tenphysikalischer Unbestimmtheit vor. William A. Tiller 1997 verffentlichte William Tiller das umfangreiche Werk Science and Human Transformation - Subtle Energies, Intentionality and Consciousness (Wissenschaft und Transformation des Menschen - Subtile Energien, Absicht und Bewutsein). Hier sind die Abschnitte Bewutsein, psychophysikalische Wech selwirkungen, Psychosomatik/Geistige Heilung und Evolution ber nommen worden: Gott erscheint Tiller als durch und in der Schpfung pulsierendes Bewutsein, das reine, schnell pulsierende Gedankenener gie erzeugt, die ihrerseits Ton und Licht aussendet und in vollkommen

172

harmonischen Raumgittern eine Matrix erschafft, die das evolutive Wachstum und die Gestalt aller Lebensformen ebenso steuert wie die Bewegung der Sterne. Diese unsichtbare Matrix formt alles Sichtbare in einem kontinuierlichen, harmonischen Flu mittels eines momentanen Informationsaustausches in alle Richtungen (Transformation bei HO MES: Alles, was geschieht, geschieht im Zusammenhang mit allem, was geschieht.). Das Physische manifestiert sich als Schatten der hheren Dimensio nen, zu denen unser Krper spezielle Kontakt- oder Empfangsorgane besitzt: Gehirn, Herz, Akupunktur-Meridian-System, Chakren (Russi sche Wissenschaftler betonen die Bedeutung der DNS). Jedes Individu um als biophotonische Lichtmaschine strahlt und absorbiert Energie in allen Dimensionen ber aurische Antennensysteme. Die Auen welt ist eine Lern- und bungsmaschine zur inneren Entwicklung, und der Krper ist ein Lerngert fr den Geist. Alle Vernderungen beginnen innen. Tiller setzt das kommunikationstheoretische Modell in die hheren Dimensionen hinein fort und kennzeichnet die verschiede nen Bewutseinszustnde durch ihre Bandbreiten und Kanalkapazi tten (Burkhard Heim verwendet hierfr Begriffe wie: postmortale Zustnde, entelechiale Hhe und maximales Potenzial postmortaler Rheimirphismen). Unser Normalbewutsein erschafft, beispiels weise durch Angst, seine eigenen Hemmungen: Wir sind unsere ei gene Impedanz (Scheinwiderstand) und legen uns selbst Steine in den Weg. Als Korrelat des Geistes in der Materie ist Bewutsein eine systemi sche Eigenschaft. Es steht in einer hierarchischen Rangordnung ber Energie und Materie, schafft Energie und Substanz und ist zur Realisie rung aller (angeblich) paranormalen Effekte befhigt. Subtile Gedan kenenergie als Teil des Bewutseins vermag das kosmische Compu tersystem zu steuern, und die geisthnlichen Eigenschaften der Materie sind vom lokalen Bewutsein abhngig. Information mit praktisch un endlicher Ausbreitungsgeschwindigkeit kann instantan-gleichzeitig

173

an einer unendlichen Zahl von Orten vorhanden sein. Jedes Individuum beeinflut das multidimensionale dynamische Gleichgewicht, und der Flu geht nicht nur nach auen, sondern innerhalb des all-holografischen Musters, zur Quelle zurck: Der Mensch ist aktiver Teil eines rckgekoppelten Systems.

Psychophysikalische Wechselwirkungen
Die Manifestationen der Energie in den verschiedenen Dimensionen sind wesentlich ein fortlaufender Informations-TransformationsProze, und die psychophysikalischen Wechselwirkungen erfolgen unabhngig von unserer Elektromagnetik. Tiller definiert Intention Imprinted Electronic Devices (>yAbsicht-geprgte elektronische Systeme). In solchen zwitterhnlichen hybriden Anordnungen sind die unbe wuten Fhigkeiten des Operators mit den Eigenschaften eines Gertes korreliert oder integriert. Geeignete oder ausgebildete Individuen pr gen und imprgnieren mittels subtiler Energie spezielle (neuartige) elektronische Gerte, um unbewute geistige Strukturen bewut wahr nehmbar zu machen. Auf dem tiefsten (Subquanten-)Niveau gewinnen Elektronen im Vakuumfeld eine zustzliche therische Dimension und ermglichen dank ihrer vernderten Eigenschaften gem der vorge faten Absicht des Operators den informatorischen bergang in die subtilen Bereiche des multidimensionalen Universums. Die Verwirklichung dieser Prozesse als Kombination von Logik und nicht-linearer Intuition ist bei derzeit unvollstndigem Verstndnis eine Sache der Praxis und wird bereits labormig angestrebt (vergleiche auch die Arbeiten von Masaru Emoto ber die Kristallisationsformen von mental beeinfluten Wasserproben).

174

Psychosomatik und geistige Heilung


Entsprechend der engen Kopplung des Bewutseins an die biologi schen Strukturen sind bei hinreichendem Entwicklungsniveau alle Ar ten mentaler Beeinflussung der psychosomatischen Ablufe zur Ver besserung der Lebensdynamik des eigenen oder fremden Krpers mg lich (geistige Selbst- und Fremdheilung). Diese hhere Bioinformatik als Ausrichtung der jeweils neu entstehenden Zellen durch liebevolle In tention" umfat, eventuell gesttzt auf eine Klasse neuer Gerte, Ho mopathie, Radisthesie und Radionik. Die Gerte werden in einer zu knftigen Energie-Medizin zu Gebets- oder Trainingsinstrumenten und zu Hilfen, um die soziokulturell bedingten psychologischen Kon ditionierungen zu berwinden, die der erfolgreichen Simulatorpraxis entgegenstehen.

Evolution
Tillers berlegungen sind weitaus umfassender, als sich hier in Kr ze vermitteln lt. Sie beruhen auf einem transzendenten Menschenbild und versuchen, die existenzielle Frage nach dem Sinn des Daseins zu beantworten. Dieser liegt in der wahrscheinlich bereits im Gang be findlichen, kosmisch gesteuerten Hherentwicklung (vergleiche zum Beispiel Wilber), die sich als Wachsen in die Kohrenz zunehmend komplexer Systeme beschreiben lt. Die Bewutseinserweiterung verwirklicht sich als Annherung an die hchsten Werte des spirituellen Niveaus in zunehmender Erkenntnis und Verarbeitungskapazitt.

175

MATERIE IST VERFESTIGTER GEDANKE


Erkenntnisse und prgnante Fakten aus der Quantenfeld-Physik bis 2002: Menschen sind multidimensionale Wesen; Gennady Shipov und andere aus dem russischen Raumfahrtpro gramm fgen dem Einstein-Modell Torsions-Felder hinzu - zu den Einstein-Gleichungen mu hinzugefgt werden, da der Raum eine Spiralform und eine Krmmung besitzt; Einstein selbst wollte dies in seinen spteren Arbeiten (Vereinig te-Feld-Theorie) hinzufgen, wurde dabei aber von seinen Kolle gen nicht untersttzt; Die Bewegung von Materie und EM-Feldern von einem Punkt zu einem anderen Punkt krmmt den Raum. Eine Rotation von EMFeldern und Materie erzeugt eine Spirale im Raum-Zeit-Gefge. Die Verbindung aus Krmmung und Spirale ergibt den Antrieb fr neuartige Raumschiffe; Quantentheorie - Zusammenbruch des Raum-Zeit-Kontinuums (Einstein); Nicht-schneller als Licht - Lichtkonstante wird durch die Ver suche von Aspect 1982 widerlegt; Quanten-Effekte sind informational.

Information ist ein Quanteneffekt. Quanten-Wahrscheinlichkeit (randomness) Bohm bezeichnet die unkontrolliert auftretenden Quantenwahr scheinlichkeiten als eine Verletzung des Aktion-ReaktionPrinzips zwischen Welle und Teilchen. Bohr benutzt in seiner Theorie nur die quanteninformationale Welle. Er wirft das Partikel raus. Bohm benutzt weiterhin Teil chen und Welle. 176

Signal-rtlichkeit (rtlichkeit = Punkt in der Rumlichkeit) Die Quantenwelle wirkt auf das Teilchen in der Welle, jedoch wirkt das Teilchen nicht auf seine zugeordnete Welle. Quanten-Wahrscheinlichkeit verhindert, da nicht-lokale Signale schneller als Licht sind und in der Zeit rckwrts laufen.

Post-Quanten-Theorie Die Quanten-Informations-Welle ist eine mentale Welle. Bewutsein wird in dieser mentalen Welle generiert, wenn das mit ihm verbundene, materielle Gehirn auf die mentale Welle zu rckwirkt und die klassischen Informationen aus der materiellen Welt in Quanten-Information der mentalen Welt zurck ber trgt.

Biocomputer Information Shannon: materielle Bits C-bits Materie Bennett: AKA q-bits = Quantenbits Geist Postquanten-Theorie: Sarfatti: Q*-bits Bewutsein

Materie-Geist bertrger SETS (single electron transistor) konvertiert c-bits in q-bits (Mate rie in Quanten-Information) und umgekehrt. Es bentigt 1.000.000.000.000 SETS um ein bewutes q*-bit fr 1 Sekunde zu kreieren. Der Moment des Bewutseins Nur das Q*-bit ist Bewutsein. 1 Q*-bit ist aus 1.000.000.000.000 unbewuten mentalen q-bits erschaffen. Dies Zahl wurde aus der PostQuanten-Theorie hergeleitet und entspricht der experimentellen Zahl

177

im menschlichen Gehirn innerhalb der Mikrotubuli (Penrose/Puthoff). Der Wert dieser Zahl wird durch die Gre des Universums begrenzt. Das ist die Verbindung zum kosmischen Bewutsein.

Aktions-Reaktions-Hindernisse Es gibt zwei Hrden: Erstens die Aktions-Hrde fr den Geist und seine Einwirkung auf die Materie, und zweitens die Rckwirkung der Materie auf den Geist. Die Rckwirkung der Materie auf den Geist ist eine hhere Hrde als die Aktions-Hrde (Geist auf Materie). Deshalb funktioniert die unkontrollierte Quanten-Wahrscheinlichkeit in der Technik so gut. 40 Hz ist die Kenngre fr die Barriere im Gehirn. Diese Barriere ermglicht es, da ein bewutes Q*-bit entsteht. Ein Q*-bit hat eine Lebensdauer von 1 Sekunde. Unser BewutseinsKontinuum ist ein Q*-bit -Kontinuum. Der Crick-Gehirn-Rhythmus

Das Crick-Feld (elektromagnetisch) schwingt mit 40 Hz ber dem Schdel-Hohlraum. Dieses Feld besteht aus soft-virtual-photons (weiche imaginre Photonen) und diese Photonen unterscheiden sich von den klassischen Photonen, die mit Lichtgeschwindigkeit reisen. Die Geschwindigkeit dieser imaginren Photonen ist schneller als die klassi sche Lichtgeschwindigkeit (vgl. Supraleiter). Die soft-imaginren Photonen sind ein Bose-Einstein-Kondensat und in einem einzigen Photonen-Zustand kristallisiert eingefroren - bei 40 Hz. Ihre Energie betrgt 6.3 Kalorien. Paranormale Signal-Nicht-rtlichkeit

Die 2-Wege Aktion-Reaktionsmechanismen zwischen mentaler Quanteninformationswelle und dem materiellen Gehirn (ber die SETS unter zu Hilfenahme des Crick-elektrischen-Feldes in der Post-

178

Quanten-Theorie) verletzt die normale (Ergebnisse von Libet, Radin, Bierman). Normale/Paranormale Gehirne

Quantenwahrscheinlichkeit

Gewhnliches Bewutsein in einem Gehirn wird durch die nicht rtlichen (non-local = schneller-als-Licht) Signale verursacht, welche die verschiedenen SETS, die ber den gesamten Krper verteilt sind, miteinander verbinden. Paranormales Bewutsein ist derselbe Proze,' jedoch werden hierbei verschiedene Gehirne und Krper miteinander vernetzt und bilden dabei einen kollektiven Geist. Es besteht bereits die Mglichkeit, bewute Androiden zu konstruieren, indem wir SETS auf Chips auftragen und sie in Quanten-dots setzen.

Einige elementare Grundlagen


Die Erschaffungsbhne, die reale Welt, wird besetzt aus der eige nen Wahrnehmung und unserer Beobachtung. Als Beobachtungsvor gang reicht offenbar bereits ein inneres Bild, ein Gedanke aus, um die se Bhne zu gestalten. Sofern es sich hierbei um steuernde, beeinflus sende Aspekte der Beobachtung handelt, kann die Wirkebene hierfr mit den bestehenden, physikalischen Einflugren beschrieben wer den. Sobald jedoch eine Beobachtung aus einem inneren Bild besteht, welches eine vllige Neuerschaffung - etwas was es bisher nicht gab - erwirkt, stellt sich uns eine wichtige Frage: Woher nimmt die Erschaf fungsstruktur ihr Rohmaterial? Wodurch sind smtliche materiellen Strukturen, Atome, biologische Zellen, Sonnen, Galaxien Abb.32: entstanden? Tatschlich stehen uns hierfr Modelldarstellung eines Gehirns als Wurmloch. fundierte Antworten zur Verfgung.

179

FUNDAMENT DES MATERIELLEN SEINS


Nullpunktenergie des Vakuums

Der Quantenther, die sogenannte Nullpunktenergie des Vaku ums, wurde 1916 von Walter Nernst postuliert und 1925 von Werner Heisenberg als Konsequenz seines Unschrfeprinzips erkannt. Heute gilt sie als allgemein akzeptiert, nachdem der englische Nobelpreistr ger Paul Dirac sie 1927 in seine quantenelektrodynamische Theorie aufnahm. Der leere Raum ist das, was brig bleibt, wenn man aus einem Behlter Materie und Strahlung entfernt. Tatschlich ist dieses Vakuum alles andere als tot und leer. Nach Max Planck besitzt ein physikalisches System selbst am abso luten Temperaturnullpunkt noch eine Restenergie in Form von Schwingungsenergie. Wegen der Unschrferelation knnen seine Teil chen selbst dann (obwohl sie nach der klassischen Physik absolut be wegungslos sein sollten) nicht zur Ruhe kommen. Auch nach Nernst kann das Vakuum nicht wirklich einen energielosen Zustand erreichen, sondern nur einen Zustand relativ niedrigster Energie. Diese Null punktenergie stammt aus sogenannten Quantenfluktuationen. Wenn wir beispielsweise ein elektrisches Feld haben, das durch eine Ladungs verteilung im Raum entstanden ist, so verschwindet dieses Feld - ent gegen der Erwartung -, bei einer Reduktion der Ladungen auf Null nicht vllig. Wie aus dem Nichts entsteht und vergeht weiterhin ein Feld, und diese im Vakuum immer vorhandenen, fluktuierenden, virtu ellen (wegen ihrer kurzen Lebensdauer nicht mebaren) Quantenfelder enthalten immer noch Energie, obwohl die Intensitten der elektrischen und magnetischen Felder im Durchschnitt Null sind. Die Energie ge ngt, um fr kurze Zeit virtuelle Teilchen, wie beispielsweise Elektro nen oder Protonen, entstehen zu lassen, so da das scheinbar leere Va kuum in Wirklichkeit von aus dem Nichts auftauchenden und wieder verschwindenden Geisterfeldern und Geisterteilchen erfllt ist. Die im leeren Raum enthaltene Energie wurde verschiedentlich abgeschtzt: nach dem Physiker John Archibald Wheeler von der Universitt Texas

180

hat ein Kubikzentimeter Vakuum eine Energiedichte von 1027 erg/cm3 mehr Energie, als die gesamte Materie des Universums enthlt. Nach einer anderen Rechnung soll ein Kubikmeter leerer Raum etwa das quivalent von V* Kilowattstunde enthalten. Nach neuesten Schtzun gen des franzsischen Physikers Jacques P. Vallee betrgt die Energie dichte des Vakuums mindestens 57.000 Mega-Joules pro Kubikmeter. Die Existenz der Nullpunktenergie des Vakuums wurde 1948 durch Hendrik B. Casimir bewiesen. 1957 berichteten die Russen Deriagin und Abrikosawa ber eine direkte Messung dieser Energie. Auch die Entstehung von virtuellen Teilchen aus dem Vakuum ist durch Willis Lamb (Lamb-Shift im Wasserstoffatom) 1948 experimentell demon striert worden. Durch eine Vernderung der Raum-Zeit-Krmmung, wie sie durch gravitationelle oder elektromagnetische Einwirkungen zustande kommt, kann die Energiedichte des Vakuums verndert wer den. Auf diese Weise entstehen theoretisch Energie und auch Teilchen aus dem Nichts. In der unmittelbaren Umgebung jeder Materie ist das Vakuumfeld gegenber dem leeren Raum verndert. Diese Vernde rung um Objekte herum, besonders um Lebewesen, kann nach Maclay entweder direkt als Vernderung der Energiedichte, oder dann indirekt an der Streuung des Lichtes wahrgenommen werden. Es ist davon aus zugehen, da das Vakuumfeld mglicherweise auch durch die Aktivitt des Bewutseins beeinflut wird. Maclay vermutet, da dies durch eine Phasennderung geschieht, so da die mittlere Intensitt des Feldes nicht mehr Null ist. Mit anderen Worten: Aus Vakuumenergie wird Licht erzeugt und damit wird das, was wir als die Aura bezeichnen, sichtbar. Skalarfelder nach Tom Bearden

Eine andere Erklrung fr die Erzeugung von Energie und Materie aus dem Nichts liefert uns die Theorie des skalaren Elektromagne tismus des amerikanischen Physikers Thomas E. Bearden. Bearden versteht sie als Rekonstruktion und Weiterentwicklung von Nikola

181

Teslas therkonzept. Sein Skalarwellenfeld ist ein anderer Begriff fr Vakuumfeld. Beardens Theorie stellt sich wie folgt dar: Der stndige Flu der aufblitzenden und wieder verschwindenden virtuellen Teilchen uert sich im Vakuum als eine Art Druck, der in jedem Punkt des Raums ver schieden stark ist: das Skalarpotential des Vakuums, das Wellen von Verdichtungen und Verdnnungen verursacht, die Skalarwellen, die keine Masse besitzen. Die Skalarpotentiale sind fundamentaler als die daraus abgeleiteten Kraftfelder. Das elektrostatische und magnetosta tische Potenzial des Vakuums stellt eingefaltete, gefangene Energie dar - es ist so etwas wie ein Akkumulator - in dem eine groe Menge po tentieller Energie, potentieller Fhigkeit, Arbeit zu leisten, gespeichert ist. Jede normale, vektorielle, elektromagnetische Welle ist aus Skalar wellenkomponenten zusammengesetzt. Skalarwellen knnen deshalb jederzeit durch geeignete Kopplung in elektromagnetische Wellen, die Arbeit leisten, und in Materie umgewandelt werden. Skalare Potenziale werden in bereinstimmung zum Quantenther als lokale Raum-ZeitKrmmungen, also als Gravitationsfelder aufgefat. Damit ist die Ska larwelle, welche die Energiedichte des Vakuums variiert, per definitionem eine Gravitationswelle. Skalarwellen knnen nach Bearden sowohl Bewutsein und die Psyche steuern, als auch umgekehrt von ihnen beeinflut werden. Sie wirken auf den Flu der Zeit ein und berwin den den Raum. Tom Bearden ist berzeugt, da es sich bei der mitogenetischen Strahlung Gurwitschs und bei Popps Biophotonenfeld um solche Ska larfelder handelt. Quantenschaum von Wheeler

Ebenfalls mit der Struktur des Vakuums und ihrem Zusammenhang zur Gravitation befat sich die Quanten-Geometrodynamik des John Archibald Wheeler. Nach der modernen Quantenfeldtheorie entstehen alle Krfte aus der Krmmung der Raum-Zeit. Materie, elektrische La dung, Elektromagnetismus und andere Felder sind nur Manifestationen

182

der Krmmung des Raums. Dasselbe gilt, wie auch Bearden ausfhrt, fr das Vakuum und seine Struktur. Wheeler baut die aus lauter mikro skopischen Raumkrmmungen gebildete Raumstruktur als ein Meer von winzigen Blschen, dem sogenannten Quantenschaum. Die fr unvorstellbar kurze Zeit auftauchenden und wieder verschwindenden Blasen sind jene bereits erwhnten Quantenfluktuationen des Vaku ums. Felder und Teilchen sind die Schwingungsmuster in diesem Quantenschaum. Auf der Ebene des Quantenschaums existieren die drei Dimensionen des Raums nicht mehr. Die Oszillationen der Quantenfluktuationen sind so stark, da das Gewebe von Raum und Zeit zerrissen wird, was zu einer kontinuierlich aufgenommenen und wieder abreienden Verbindung zwischen weit voneinander entfernten Regionen des Raums fhrt. Wheelers Bild dafr ist die Existenz von dauernd auftauchenden und wieder verschwindenden Wurmlchern, die eine stndig wechselnde Verbindung zwischen Blasen des Quanten schaums schaffen. Die Wurmlcher spannen offenbar nicht den nor malen dreidimensionalen Raum auf, sondern einen Oberraum. Durch sie wird jeder Punkt des Raums, der in der gewhnlichen Raum-Zeit ganz bestimmte Distanzen von anderen Punkten besitzt, stndig mit jedem anderen Punkt des Raums verbunden, und zwar auf eine Art, in der rumliche Distanzen und die Zeit, die fr eine Verbindung bentigt wird, bedeutungslos werden. Durch stndig erscheinende und wieder verschwindende Wurmlochverbindungen gehen auch Signale, durch die eine unmittelbare, berlichtschnelle Kommunikation zwischen allen Raumregionen entsteht. Diese Signale wirken wie die Nervenimpulse in einem riesigen, kosmischen Gehirn, so da das Universum auf der Ebe ne des Oberraums, wie der englische Astrophysiker Sir James Jeans einmal sagte, wie ein einziger riesiger Gedanke erscheint. Implizite Ordnung nach Bohm

Eine weitere Variante des Quantenthers ist die implizite Ord nung des Einstein-Schlers und fhrenden Quantentheoretikers Da vid Bohm. Nach seiner holographischen Theorie existieren in unserer Wirklichkeit zwei Dimensionen, die sich grundlegend voneinander un 183

terscheiden: Die Welt, die wir in der normalen, alltglichen Wahrneh mung erfahren und mit den Instrumenten der Physik messen knnen, nennt er die explizite Ordnung. Sie ist die Dimension, in der alles in einem entfalteten manifesten, objekthaften Zustand vorhanden ist. Es ist die Welt der Objekte im leeren Raum, die sich voneinander und vom Hintergrund abheben. Es ist die mechanistische Ordnung, deren we sentlichstes Kennzeichen es ist, da die Welt aus Einheiten zusammenge setzt gedacht ist, die sich auerhalb voneinander befinden, in dem Sinne, da sie unabhngig voneinander in verschiedenen Bereichen des Raums und der Zeit existieren und durch Krfte miteinander interagieren, die ihr eigentliches Wesen unberhrt lassen . Die zweite Dimension von Bohms Weltbild ist die sogenannte im plizite Ordnung, die dem Quantenther, Beardens Skalarwellenfeld und Wheelers Quantenschaum und Oberraum entspricht. Sie be findet sich auerhalb von Raum und Zeit; in ihr gibt es keine in Raum und Zeit festgelegten Objekte, ja berhaupt keine Objekte. In dieser Dimension ist alles in allem anderen enthalten. Es existiert hier nicht in manifester, sondern in eingefalteter Form. Diese Dimension ist holo graphisch: Jeder Teil, ja jeder Punkt des Raumes enthlt die gesamte Information des Ganzen, so, wie in einem Hologramm die Form und die Struktur des ganzen Objektes in jeder Region der photographischen Aufnahme eingefaltet ist. Diese implizite Ordnung ist fundamentaler und umfassender als die explizite Ordnung, die, wie Bohm schreibt, als Spezialfall der impliziten Ordnung betrachtet werden mu. Die Ob jekte der expliziten Ordnung sind nicht nur eingebettet in sie und durchdrungen von ihr, wie man vom ther sagt. Auch die Formulie rung, da die implizite Ordnung der Ursprung und die Matrix aller materiellen Erscheinungen darstellt, ist zwar richtig, aber noch nicht ausreichend. Auf dem unendlichen Ozean des Holomovement, wie Bohm die implizite Ordnung auch nennt, um auf ihre Dynamik hinzu weisen, sind die manifesten, physikalischen Erscheinungen Krfte, Fel der und Teilchen nur kleine Wellen oder Strungen oder Projektionen der impliziten Ordnung einer hher-dimensionalen Realitt.

184

Die implizite Ordnung erscheint wie ein Fundament, in dem die Objekte der expliziten Ordnung vor ihrer (eventuellen) Manifesta tion in potentieller, virtueller oder informativer Form als Keinie oder modellhafte Urbilder ruhen. Diese Dimension stellt also auch eine Art morphogenetisches Feld dar, das als Matrize Materie und Felder in der typischen Gestalt von Virus, Strauch, Katze oder Mensch fokussiert und anordnet. Im Boden der impliziten Ordnung wurzeln die Objekte aber auch wh rend ihrer Manifestation. Das gilt nicht nur fr die ueren Ob jekte unserer Wahrnehmungswelt, sondern gleichermaen fr die inneren Erscheinungen unserer subjektiven Welt, fr die Gestalten unseres Denkens, Fhlens und Vorstellens, denn die implizite Ord nung ist nach Bohm jener Grund, aus dem beides entspringt und der beidem gemeinsam ist. Sowohl Materie wie Bewutsein ragen wie Eis berge mit ihrem expliziten Teil ber die Wasserflche hinaus und er scheinen uns dort als getrenntes Gegenber von Wahrnehmendem und Wahrgenommenem. Im Bereich des weitaus bedeutenderen, impliziten Anteils der Wirklichkeit sind die Dinge und wir selbst auf geheimnisvolle Weise ineinander verwoben. David Bohm: So, wie jeder Moment des Bewutseins einen gewissen expliziten Inhalt hat, der ein Vordergrund ist, und einen impliziten Inhalt, der ein dazugehriger Hintergrund ist, so hat auch ein Materieteilchen oder eine Welle als expliziter Teil einer Ganzheit ihre Ergnzung in der impliziten Ordnung. Sechs- beziehungsweise Burkhard Heim zwlf-dimensionales Weltmodell des

Noch deutlicher werden die Stufen der Manifestation im sechsdi mensionalen Weltmodell des deutschen Physikers Burkhard Heim. Auch Heim unterscheidet eine materiell-energetische, quantitativ be

185

schreibbare, objektive oder objektivierbare, manifeste Ebene der Auen welt, die durch drei Raumkoordinaten und eine Zeitkoordinate be schrieben wird und der expliziten Ordnung Bohms entspricht; und eine virtuelle Ebene, die nicht numerisch festgelegt werden und die als psychische Struktur teilweise intern erlebt werden kann. Sie entspricht Bohms impliziter Ordnung und umfat zwei imaginre Koordinaten: entelechiale Dimension und onische Dimension. Heim geht damit ber den herkmmlichen Einstein/Minkowski'schen Raumbegriff hin aus, der nur die ersten vier dieser Dimensionen umfat. Die beiden zustzlichen Dimensionen erweitern den Raum zu einem sechsdimen sionalen Tensorium, einem virtuellen, nicht mehr fabaren Raum, in den die gewhnliche Raum-Zeit eingebettet ist. Im Raum der EinsteinMinkowski-Raum-Zeit spielen sich alle manifesten Ereignisse des mate riellen Geschehens ab. Im umfassenderen, sechsdimensionalen Raum hingegen findet jenes Geschehen statt, das erst zu einer solchen Mani festation fhrt. Die beiden zeitartigen virtuellen Dimensionen stellen jenen fun damentalen Proze dar, den Heim Aktivitten nennt. Sie bilden kor relative Netzwerke und sind potentielle Strukturmuster komplement rer materieller Strukturorganisationen im Raum oder in der Raum-Zeit, deren Aktualisierung oder dem Zeitablauf unterworfene Projektion die Strukturen der physikalischen Welt sind. Mit anderen Worten: Im virtu ellen sechsdimensionalen Raum, insbesondere im entelechischen Feld, existieren potentielle Strukturmuster, die durch die sechste Ko ordinate im uns zugnglichen Raum realisiert, oder wie Heim es nennt, kondensiert werden. Sogenannte Selektoren sind fr die Auswahl derjenigen im entelechischen Feld vorhandenen Schpfungsmglich keiten verantwortlich, welche schlielich aktualisiert werden. Diese von Heim Transdynamik (der Transbereich umfat die fnfte und sechste Dimension) genannten virtuellen, fundamentalen Prozesse entsprechen dem Bohm'schen Holomovement der implizi ten Ordnung. Transdynamik wie Holomovement sind fundamentalere Prozesse und stellen eine umfassendere Wirklichkeit dar als die materi-

186

eilen Prozesse der manifesten Wirklichkeit, die nur deren Projektion sind. Gravitationswellen - nach Heim Strukturkondensationen der beiden Transkoordinaten - gehren vollstndig zur virtuellen, auer halb der gewhnlichen Raum-Zeit liegenden Ebene. Das Gravitations feld, das wird aus Heims Einordnung deutlich, mu im wesentlichen als ein Struktur (Informations)-Feld betrachtet werden; ein Grund dafr, da die Physik, die bisher den Strukturaspekt von Energie und Materie weitgehend vernachlssigt hat, sich schwer mit der Gravitation tut. Gravitationsfeldstrungen bewegen sich nach Heim schneller als Licht geschwindigkeit - Tachyonen/Gravitonen sind zwar gequantelt, aber keine Teilchen. Im Gegensatz zu den Photonen ohne Energieladung haben sie imaginren Charakter. Die Photonen hingegen bestehen nach Heim - der Biophotonen als Folgerung aus seiner Theorie vorausgesagt hat - aus den beiden Trans dimensionen plus der Zeitdimension, und sind damit fabarer. Sie exi stieren, wie alle elektromagnetischen Felder, zur Gnze in der uns zu gnglichen Raum-Zeit. Photonen knnen sich aber in Gravitonen um wandeln (und umgekehrt). Sie sind zwei verschiedene Strukturformen, die sich durch ihr zeitliches Verhalten unterscheiden. Wie in den modernen thertheorien besteht also auch bei Heim ein enger Zusammenhang zwischen Gravitation und Elektromagnetismus. Die Photonen stellen sozusagen die irdische Hand der rtselhaften Gravitation dar, die nach Heim mit der Steuerung der Umsetzung der im virtuellen Bereich enthaltenen Muster in die raum-zeitliche Manife station zu tun hat. Die Photonen bilden somit in der Heim'schen Theorie ein aktiv vermittelndes Glied, zwischen den auerhalb der gewhnlichen RaumZeit liegenden potentiellen Organisationsmustern des virtuellen Be reichs und dem mebaren raum-zeitlichen Bereich der Materie

187

VIRTUELLE PHOTONEN ALS BASIS


Zusammen mit Sinitiro Tomonaga, Julian Schwinger und Freeman Dyson entwickelte Richard Feynman eine neue Theorie der Quantene lektrodynamik (QED ), wie es vor ihnen schon Paul Dirac jahrelang versucht hat. Mit einem Vorgehen, welches heute Renormierung heit, haben sie schwierige Passagen in ihren Gleichungen dadurch ge lst, da anstelle von Unendlichkeiten die effektiv gemessenen Werte (Masse und Ladung) eines Teilchens in die Gleichungen eingesetzt wurden. Dirac hat sich nie mit dieser Renormierung anfreunden kn nen, doch dieser Trick war sehr erfolgreich, konnte doch jetzt das metechnisch bestens bekannte Frequenzspektrum des Wasserstoffa toms (LAMB-Verschiebung) berechnet werden. Mit den Ergebnissen von Feynman wurde ersichtlich, da sich ein Photon in unglaublich kurzer Zeit in ein Elektron-Positron-Paar (Materie-Anti-Materie) tei len und sofort wieder vereinen kann. Diese virtuellen Teilchen entzie hen sich direkt jeder Messung, weil sie viel zu kurzlebig sind. Ander seits erzeugen diese Teilchen ein fluktuierendes Feld (eine Art elektro magnetisches Rauschen), welches auch Wirkungen auf reelle Ladungen hat. Das Vakuum ist nicht mehr leer, sondern aufgefllt wie ein See aus virtuellen Ladungen (Dirac-See). Hendrik Casimir leitete aus den Feynman-Gleichungen die sogenannte Nullpunktstrahlung ab, und schlug dazu sein bekanntes Experiment vor. Der materiefreie Raum soll Minkowski-Struktur besitzen. Impulsund Spin-Drehimpulsdichten sind Quellen von metrischen und Tor sionsfeldern. Durch Einfhren der Wirkungsfunktion des DiracTeilchens, das mit einem Gravitationsfeld wechselwirkt, werden Feldgleichungen hergeleitet, die nach Eliminierung der Verzerrung in der Dirac-Gleichung auf die nichtlineare Spinor-Gleichung vom Heisenberg-Pauli-Typ fhren. Die Dirac-Gleichung beschreibt die Wahr scheinlichkeitsamplitude eines einzelnen Elektrons. Diese EinTeilchen-Theorie liefert eine ziemlich gute Vorhersage des Spins und magnetischen Moments des Elektrons und erlutert viel ber die Fein struktur, die in Atomspektren (Spektrallinien) zu beobachten ist. Sie

188

macht auerdem die Vorhersage, da es unendlich viele Quantenzu stnde gibt, in denen das Elektron eine negative Energie besitzt, was Dirac (ber die bemerkenswerte Hypothese der Loch-Theorie) dazu veranlate, die Existenz der Positronen vorherzusagen, welche sich exakt wie Elektronen mit positiver Ladung verhalten. Diese Vorhersage wurde mit der Entdeckung des Positrons besttigt.

Der Nobelpreistrger fr Physik Paul Dirac hat gezeigt, da im Universum die gesamte Zahl der Teilchen proportional dem Quadrat der Zeit ist. Und Karl G. Neumann hat die Absorption der Gravitati on vorgeschlagen, um die Stabilitt des Universum-Modells zu er halten. Eine Verwandlung des A zu B verluft normalerweise zuerst langsam, dann immer schneller. Wenn sich die Hlfte des A zu B ver wandelt hat, verluft der Proze am schnellsten. Dann reduziert sich allmhlich die Geschwindigkeit der Umwandlung, weil immer weniger A bleibt. So mu auch die Verwandlung des Quantenthers zu Sub stanz verlaufen. Je grer die Masse eines Krpers ist, desto mehr therteilchen absorbiert er und desto schneller wchst er auch. In der Nhe von Massen ist die therdichte grer als im Raum zwischen Galaxien (genau wie die Atmosphre!). Deshalb ndern sich auch alle physikalischen Konstanten in der Nhe von Krpern! (Otto sterle). In der vergangenen Zeit haben sich mehrere Forscher mit dem Expansionsmodell der Erde befat, darunter der bekannte Physiker Pasual Jordan (1966), der die Expansion durch die Hypothese von Paul Dirac ber die allmhliche Abnahme der Gra vitationskonstante zu erklren versuchte. Mehrere berzeugende geo logische Beweise der Expansion der Erde hat der Geologe S. W. Carey geliefert. Heute ist bekannt, da die Masse der Erde jhrlich um unge fhr zwei Millionen Tonnen pro Sekunde zunimmt. Man kann vermu ten, da das Expansionsmodell in der Zukunft das heutige Standard modell der Plattentektonik ersetzt.

189

Nun betrachten wir das Problem, welche Folgen die Abnahme des freien Quantenthers und die dadurch verursachte Vernderung des Raumes hat. Die Dichte des thers bestimmt alle Parameter der Ele mentarteilchen und deshalb auch der Atome und Molekle. Alle kon stanten Parameter dieser Teilchen mssen sich also mit der Zeit vern dern. Alte und neu entstandene Teilchen knnen sich unterschei den (die von der Quantentheorie postulierte absolute Identitt der Elementarteilchen ist falsch).

Eine dieser Konstanten ist die Rydberg'sche Konstante, welche die Wellenlngen des von Sternen und Galaxien - also von Atomen - aus gestrahlten Lichtes bestimmt. Diese Wellen wurden mit der Zeit immer krzer und somit das Licht immer blauer. Von weit entfernten Gala xien kommt zu uns heute rotes Licht, das vor Milliarden Jahren im Raum mit anderen Eigenschaften ausgestrahlt wurde und dessen Rot verschiebung also nicht durch den Doppler-Effekt verursacht wurde (Otto sterle, 1992). Das Standardmodell des Urknalls ist also falsch, was auch mehrere Fakten und Beobachtungen beweisen. Welches Universum-Modell statt Urknall? Wie schon erwhnt, wandelt sich der Quantenther mit der Zeit zu Substanz. Es wird im Universum immer weniger freien Quantenther und immer mehr Substanz geben. Bekanntlich konnte Paul Dirac darle gen, da im Universum die gesamte Zahl der Teilchen proportional dem Quadrat der Zeit ist. Und Karl G. Neumann hat die Absorption der Gravitation Vorgeschlagen, um die Stabilitt des UniversumModells zu erhalten. Es ist klar, da die Verwandlungsrate maximal sein wird, wenn die Hlfte des Quantenthers zu Substanz verwandelt ist. In welcher Entwicklungsphase befindet sich unser Universum? Man kann vermuten: irgendwo am Anfang der Umwandlung. Es ist bekannt,

190

da die Gravitationskrfte im Universum durch geheimnisvolle dunk le Materie (durch den Quantenther!) geprgt sind und da diese Ma terie zirka 90% der gesamten Materie des Universums betrgt. Also sind erst 10% des gesamten Quantenthers zu Substanz verwandelt. Es gibt auch Beweise, da diese Umwandlung nicht linear verluft. Die Beobachtung entfernter Galaxien zeigt, da das Verhltnis der Rotver schiebung zur Entfernung, das heit, die Hubblesche Konstante nicht bestndig ist, sondern von der Entfernung abhngt. Bei sehr entfernten Galaxien ist die Verschiebung fr gleiche Abstnde geringer als fr n here. Man sagt: Der Urknall verlangsamt sieb. In Wirklichkeit ist das eine Folge der nicht gleichmigen Abnahme der Dichte des Quan tenthers. Die maximale bekannte Rotverschiebung weist eine Ver lngerung der Wellen um nur zirka 2,17 mal auf, was auch fr das ge ringe Alter unseres Universums sprechen kann (diese Beobachtungen deuten brigens darauf hin, da manche Galaxien lter als das Univer sum selbst wren!). Die Dichte des Quantenthers bestimmt alle physikalischen Ereig nisse und Parameter, zum Beispiel die der Massen und Ladungen der Elementarteilchen in der Mikrowelt bis zu den Wechselwirkungen von Galaxien. Sie verndert sich aber nicht nur im Laufe der Zeit. Sie ist auch im Raum nicht bestndig (genauer gesagt: der Raum ist nicht ho mogen und nicht isotropisch - ther ist nmlich Raum), weil zum Bei spiel die Hubble'scbe Konstante in verschiedenen Richtungen des Him mels unterschiedlich ist. In der Nhe von Massen ist die therdichte grer als im Raum zwischen Galaxien (genau wie die Atmosphre!). Deshalb ndern sich auch alle physikalischen Konstanten in der Nhe von Krpern: die Lichtgeschwindigkeit, die Rydbergsche Konstante, welche die Rotver schiebung bestimmt. Und das ist die physikalische Ursache der Krm mung des Raumes und des Einstein-Effektes: Rotverschiebung und Beugung des Lichtes in der Nhe von Sternen (Die Relativittstheorie kann diese Krmmung nicht kausal erklren, weil das Licht sich mit

191

Lichtgeschwindigkeit ausbreitet und also mit nichts Zusammenwirken kann). Das ist auch die Ursache, warum genaue Uhren in Satelliten eine an dere Zeit zeigen als auf der Erdoberflche. Das mu aber nicht unbe dingt bedeuten, da auf dem Satelliten die Zeit anders verluft, sondern da die Uhr falsche Zeit zeigen kann (wie zum Beispiel eine Uhr mit einem eisernen Pendel im Magnetfeld).

192

WAS IST ZEIT?


Was ist aber Zeit? Fr Isaac Newton war die Zeit noch absolut. Alle Vernderungen in der Welt breiteten sich unendlich schnell im ganzen Universum aus. Albert Einstein hat das vierdimensionale Raum-ZeitKontinuum erfunden und gezeigt, da die Zeit und die Masse der Krper von der Geschwindigkeit des Systems abhngen. Bei der Licht geschwindigkeit bleibt die Zeit stehen und die Masse wird unendlich gro. Wie wir schon mehrmals wiederholt haben, folgt aus dem Kausa littsprinzip: Jede Null und Unendlichkeit ist Kennzeichen einer fal schen Theorie. Erstaunlicherweise hngen die Parameter des RaumZeit-Kontinuums von der Zeit nicht ab, weil die Lichtgeschwindigkeit als eine absolute Konstante angenommen wird. In Wirklichkeit schiebt jeder sich bewegende Krper Quantenther vor sich her und vergrert damit seine Masse, wie zum Beispiel ein Flugzeug die Luft vor sich herschiebt und verdichtet. Und wie das Flugzeug die Schallgeschwindigkeit berwinden kann, so kann im Prinzip auch die Lichtgeschwindigkeit berwunden werden. Die Abnahme der Dichte des Quantenthers mit der Zeit fhrt zur Abnahme der Lichtgeschwindigkeit und zur Vernderung des RaumZeit-Kontinuums. Die Zeit ist also nicht von der sekundren Lichtge schwindigkeit bestimmt, sondern von der Vernderungsrate der prim ren therdichte. Und diese Rate ist, wie schon erwhnt, im Mittelalter des Universums maximal. Kann man diese Vernderungsrate irgendwie durch unsere gewhn lichen Zeiteinheiten uern? Dazu haben wir einige Fakten. Einer da von wurde schon erwhnt: Junge Sterne mit gleichen Parametern wie unsere Sonne haben eine Leuchtkraft, die um 40% geringer ist als unse re junge Sonne vor 4,6 Milliarden Jahren (Ingersoll 1987). Es ist be kannt, da die Leuchtkraft durch eine siebente Wurzel von der Gravi tationskonstante (das heit der Dichte des Quantenthers) abhngt. Die siebente Wurzel von 1,4 ist gleich 1,04924144 oder rund 1,05. Also war die therdichte vor 4,6 Milliarden Jahren um 5% grer als heute. Wenn man als erste Nherung eine lineare Abnahme der therdichte

193

annimmt, kann man die Existenzzeit unseres Universums auf zirka 90 Milliarden Jahre schtzen. Das gehrt zu der allgemeinen pauschalen Zeit im Universum. Es gibt aber auch lokale, rtliche Zeiten. Die Dichte des thers in der Nhe der Erde nimmt nicht ab wie berall im Universum, sondern sie nimmt immer schneller zu, was durch das Wachstum der Erdkugel verursacht ist. Die absolute Vernderung ist natrlich relativ gering, aber fr das Leben auf der Erde ist sie entschei dend. Wir wissen, da jede nchste Entwicklungsstufe der Lebewesen, oder der menschlichen Gesellschaft, in immer krzeren Zeitabschnitten abluft. Wir sehen also, da die Definition der Zeit heute noch unvoll kommen ist. Um ein ganzheitliches Weltbild aufzubauen, mu man noch eine ab solute Vorstellung beseitigen, nmlich die des unendlichen Teilens der Materie. 1896 entdeckte Henri Bequerel die Radioaktivitt. Durch diese Entdeckung wurde klar, da das Atom in Wirklichkeit nicht das Un teilbare ist, sondern da es aus noch kleineren Teilchen besteht. Diese Teilchen sind bekanntlich die Elementarteilchen: Elektron, Proton, Neutron. Diese sind vermutlich auch teilbar und bestehen aus Quarks. Und die Quarks? Ist die Materie unendlich teilbar? Mit diesem Problem haben sich viele Wissenschaftler beschftigt. Fr Henri Poincare war es klar, da die Wechselwirkung zwischen Kor puskeln nicht im Leer-Raum vor sich gehen kann; sie kann nur durch Substanz, die aus kleineren Korpuskeln besteht, stattfinden. Und diese Korpuskeln knnen auch nur durch eine Substanz Zusammenwirken. Deshalb mu sich die Materie unendlich teilen. W. Lenin behauptete, das Elektron sei genauso unerschpflich wie das Atom. Olga C. Hil genberg meinte auch, da der Raum zwischen den therteilchen aus therteilchen der nchsten Ordnung besteht und so bis zur Unend lichkeit. W.A. Azujukowski (1990) hat ein hnliches Modell entwickelt. Erwin Chargaff hat dieses Problem anschaulich dargestellt: Kleine Luse haben immer noch kleinere Luse. Das Prinzip Nichts Absolu tes! zeigt, da die Unendlichkeit in der Natur nicht existieren kann, sie zerreit die Kausalketten und zerstrt die Ganzheitlichkeit der Welt. 194

Kausalketten knnen nicht unendlich lang sein, deshalb kann auch die Materie sich nicht unendlich teilen. Sie kann aber auch nicht aus absolut unteilbaren Korpuskeln bestehen. Welcher Ausweg existiert aus dieser Sackgasse? Ganz allgemein kann man sagen: Es gibt keinen absoluten Raum; ther ist Raum. Deshalb gibt es keine Klfte zwischen seinen Korpuskel-Wellen, die man mit Teilchen nchster Ordnung ausfllen mu. Man kann das auch ausfhrlicher darstellen. Wie schon erwhnt, knnen die therwellen und -Wirbel astronomische Dimensionen er reichen. Wenn wir immer weiter in die Mikrowelt eindringen - Mole kle, Atome, Elementarteilchen - tauchen wir in der Megawelt (im Weltall) auf. Die therfden verbinden buchstblich diese zwei Wel ten und bilden einen Kreis! Quantenther ist der Raum, die primre Materie. Die Elementar teilchen, wie das ganze Universum mit seinen Kraftfeldern, sind Wirbel, Zwirnsfden beziehungsweise therrhrchen und Stehende Wellen des Quantenthers. Und weil die therrhrchen keine ideal geraden Linien bilden und nicht unendlich, sondern kurzgeschlossen sind, ist der Raum krumm. Der bekannte Physiker M. A. Markov (1988) hat die Eigen schaften des krummen Raumes untersucht. Er hat gezeigt: Wenn man im Raum des Universums einen willkrlichen Punkt auswhlt und um ihn Sphren mit immer greren Radien bildet, dann werden die Ober flchen dieser Sphren zuerst immer grer, sie schlieen immer mehr Galaxien ein. Dann werden sie aber wieder kleiner und nhern sich Null. Wenn man unser Universum von auen sehen knnte, htte man ein... Elementarteilchen beobachtet! Und dieses Teilchenuniver sum rotiert, ist nicht absolut abgeschlossen und hat deshalb eine elek trische Ladung und ein Magnet-Spin. Der Kosmische Schaum und die Groen Mauern aus Galaxien sind gleichzeitig innere Strukturen der Elementarteilchen.

195

Der Aufbau des Universums entspricht also der Platon'schen Tria de: These (unendliches Teilen der Materie), Antithese (Existenz des unteilbaren Atoms), Synthese (Einschlieen der Mega- und der Mikro welt in einen Kreis). 1897 hat Professor U. G. Morrow sehr przisen geodtische Messungen durchgefhrt. Er hat aus mechanischen Teilen eine optisch sehr genau justierte, waagerecht gerade Linie mit einer Lnge von 6640m aufgebaut und damit festgestellt, da die Linie des Horizonts nicht unter der Haarlinie des Fernrohres beobachtet wird, sondern oben (Morrow 1899). Dieses wunderbare Ergebnis hielt er fr den Beweis, da die Erdoberflche nicht konvex, sondern konkav sei, das heit, die Erde htte nicht die Form einer Sphre, sondern einer von innen leeren Schale. Aufgrund dieser Messung wurde sogar ein neues Hohlweltbild aufgebaut, welches das gewhnliche Kopernikanische Modell ersetzen sollte. Die Messungen von Professor Morrow basieren auf dem Postulat, der Lichtstrahl sei eine absolut gerade Linie. Wenn man aber annimmt, da der Raum um die Erde sphrisch krumm ist und waagerechte Linien sich gegen die Erde biegen, bekommt dieses Ergebnis eine logische Erklrung - ohne Notwendigkeit, das heutige Weltbild auf den Kopf zu stellen. Satellitenaufnahmen des Meeresspie gels zeigen auerdem, da dieser Spiegel nicht ideal ist - es gibt nichts Ideales! -, er hat Hgel und Tler. Die Ursache ist die nicht gleichm ige Verteilung der Massen in der Erde, das heit Inhomogenitten des Gravitationsfeldes (deshalb werden Lote in Schchten nicht genau senkrecht hngen). Vielleicht ist der Lichtstrahl beim Experiment von Professor Morrow auf einen solchen Meereshgel gestoen? Im sphrisch gekrmmten Raum mssen senkrechte Lichtstrahlen nach oben divergieren (auseinandergehen) und deshalb mssen die Himmelskrper grer aussehen, als sie wirklich sind (es gibt Mittei lungen, die amerikanischen Astronauten htten den Mond bei ihrer Landung kleiner vorgefunden, als er von der Erde zu sein scheint). Wenn unser Universum ein Elementarteilchen ist, dann wandelt sich das Problem seines Entstehens zum Problem des Entstehens von Ele mentarteilchen. Es ist bekannt, da beim Zusammensto von Teilchen

196

neue Teilchen (neue Wirbel des thers) entstehen. Und diese neuen Teilchen verndern sich mit der Zeit durch die Umwandlung des in ihnen eingeschlossenen thers (Raumes) zu Substanz, bis zum Tode des Universums. Die Geschwindigkeit dieser Umwandlung ist die Zeit. Je tiefer wir in die Mikrowelt eindringen, desto grere Bewegungsge schwindigkeiten beobachten wir.

197

FUNKTION EINES HOLOGRAMMS IM GEHIRN


Holographie (griechisch holos: ganz; graphein: schreiben) ist eine Methode zur Erzeugung dreidimen sionaler Bilder von Gegenstnden. Die Basis fr dieses optische Verfah ren ist die Erzeugung von kohren tem (zusammenhngendem) Licht mit ausreichender Intensitt, was nur mit Hilfe eines Lasers mglich ist. Wenn man einen Gegenstand mit Abb.33: kohrentem Licht bestrahlt, dann Funktionsaufbau eines Hologramms durch Mikrotubuli. entsteht ein Wellenfeld, das sich von dem Feld des Laserlichtes unterschei det. Wenn die Lichtwellen auf den Gegenstand treffen, knnen ver schiedeneoptische Phnomene wie zum Beispiel Reflexion, Beugung oder Interferenz ablaufen. In dem auf diese Weise vernderten Wellen feld steckt dann sozusagen die optische Information, und zwar in Form von Amplituden- und Phasenverteilung. Gerade diese bentigt man, um einen dreidimensionalen Gegenstand vollstndig abzubilden. Einfacher dargestellt: Das Laser licht belichtet oder aktiviert den Film. In diesem Proze werden ko dierte Muster, die Frequenzinformati onen enthalten, in 3-D-Form umge setzt. Der wesentlichste Aspekt eines Hologramms ist der, da jedes Teil und jedes Fragment des Hologramms sich dafr verwenden lt, das Bild des kompletten Originalobjekts entstehen zu lassen. Jedes Fragment enthlt das Abb.34: Ganze. Das Hologramm steht fr die Funktionsaufbau eines Hologramms. ungeteilte Natur des Kosmos.

198

SUPRALEITFHIGKEIT DER MIKROTUBULI


Ergebnisse von Jack Tuszynski, Alex Nip, Mitchell Porter und Stuart Hameroff zeigen, da innerhalb der Proteine die aromatischen Ami nosuren (solche mit Elektron-resonanten Ringstrukturen, das heit Tryptophan, Tyrosin, Histid und Phenylalanin) durch Elektronen sprnge (Hopping) oder Elektronen-Tunneln zwischen den Aromatics, die durch einige Nanometer von einander getrennt sind, am Elektronen-Transport beteiligt sind. Die Mikrotubuli scheinen in die Erzeu gung von Information eingebunden zu sein und die ElektronenBewegungen knnten eine entscheidende Rolle dabei spielen. Whrend einer Simulation der dem Mikrotubuli untergeordneten Protein-Einheit Tubulin wurden die Stammpltze der aromatischen Aminosuren Tryptophan, Histidin und Tyrosin gefunden. Tryptophane wurden innerhalb ~2 nm mit einem anderen Tryptophan, und Histidine inner halb von ~2 nm mit einem anderen Histidin zusammengebracht, um mgliche Wege des Elektrons aufzuzeigen. Diese Intra-Protein-Wege wurden wiederum in ein zylindrisches Mikrotubuli-Gitter projeziert, das bestimmte helische Spiralenmuster innerhalb der zylindirschen Mi krotubuli-Gitter aufzeigte. Die Spiralenmuster entsprechen den Ver bindungsmustern der an die Mikrotubuli gebundenen Proteine, die wiederum mit der cytoskletalen und zellulren Struktur und Funktion bereinstimmen. Die Leitfhigkeit unter den aromatischen Ringen im Tubulin knnte Zellinformationserzeugung in den Mikrotubuli weiter leiten.

Mikrotubuli mit holografischer Funktion


Die Nervenzelle besitzt einen kernhaltigen Teil der neben Mitochondrien und Pigmenten Membranstapel des endoplasmatischen Reti kulums, die so genannten Nissl-Schollen, enthlt. Uber die vom Perika ryon ausgehenden, vielfach verzweigten Fortstze (Dendriten) werden den Nervenzellen Erregungen zugeleitet. Die Erregungsweiterleitung erfolgt ber das Axon, einen langen Fortsatz aus parallelen Mikrotubu 199

li. Jedes Axon ist von einer Membran, dem Axolemm, umgeben. Man unterscheidet marklose und markhaltige Fasern. Letztgenannte sind mit Schwann'schen Zellen umgeben, die an den Ranvier'schen Schnrringen unterbrochen sind. Nach der Anzahl der Fortstze unterscheidet man unipolare, bipolare und multipolare Nervenzellen. Globulre Proteine knnen sich auch zu winzigen, hohlen Rhrchen verbinden, die sowohl als Sttzelemente der Zelle dienen als auch als Transportmittel. Jedes dieser Mikrotubuli besteht aus zwei Typen nahezu kugelfrmiger Pro teine, die sich paarweise zusammenfinden und sich am Ende des Rhr chens anlagern und es so verlngern, wie es ntig ist. Mikrotubuli stellen auch das Gerst der Cilien dar. Cilien sind haa rhnliche Ausstlpungen von Zellen. Einige Mikroorganismen benut zen sie zur Fortbewegung im Wasser. Globulre Proteine knnen sich zu winzigen, hohlen Rhrchen verbinden, die sowohl als Sttzelemente der Zelle dienen als auch als Transportmittel. Ort des Primrgeschehens des Tagesbewutseins sind wahrscheinlich die Mikrotubulisysteme. Alle Zellen haben Mikrotubuli. Sie bilden kilometerlange Hohlrhren, die als Hohlraumresonatoren elektromagnetische Schwingungen leiten knnen. Durch Ansthetika, also durch Betubung, werden Mikrotubuli-Leitsysteme auer Gefecht gesetzt - wir verlieren unser Bewut sein, einschlielich bewuter Erinnerung. Der menschliche Krper erzeugt und sendet ununterbrochen energiereiche Strahlung mit der hchsten Intensitt (= hchste Quanten-/Photonenanzahl) im Mikro wellen- und Thermowellenbereich (1013 Hz). Gleichzeitig wird resonante Strahlung von auen eingestrahlt (2. Atmosphrenfenster). Alle Strahlung interferiert miteinander und bil det laufend im Muster sich ndernde Hologramme aus. Die gleichzeitig entstehenden Schwebungsfrequenzen haben neben den Frequenzen der Primrschwingungen ebenfalls physiologische Bedeutung. Die Strah lung entsteht bei Stoffwechselprozessen, Enzymttigkeiten, energeti schen Phosphorylierungen, aber vor allem bei Membrandepolarisation als Ursache von Nerven- und Muskelttigkeiten. Bei allen Strahlungs aktivitten sind die im Krper universal vorhandenen Mikrotubuli be teiligt (Hameroff, 1988).

200

MIKROTUBULI ALS HARDWARE


Die Teilung der ganzen Zelle geht in auffllig koordinierter Weise vor sich. Zunchst teilt sich der Kern, der die Erbsubstanz in Form der Chromosomen enthlt. Ein spindelfrmiges Fasergebilde, das Mikrotu buli und Mikrofilamente wie Eisenfeilspne zwischen zwei Magnetpo len formiert, zeigt die Bereitschaft zur Teilung an. Die Chromosomen ordnen sich in der quatorialebene in der Mitte der Kernspindel zu einer sternfrmigen Figur an, exakt in zwei gleiche Hlften aufgeteilt. Diese beiden Chromatiden wandern an schlieend zu den entgegengesetzten Polen der Spindel, vllig synchron und aufeinander abgestimmt. Wie von Geisterhand bewegt, verschwin det nun die Spindel.

VERBINDUNGEN LEITUNG?

ZUR

DNS

DURCH

SUPRA

Durch seinen hohen Gehalt an Zink und seine Eigenschaft, Zinkio nen zu binden und freizugeben, knnte Melanin wichtige Peptide und Proteine aktivieren und deaktivieren - unter ihnen Tubulin und Aktin, aus denen die Mikrotubuli und Mikrofilamente des Zellskelettes beste hen, aber auch verschiedene fr Aufbau und Funktion von DNS und RNS wichtige Enzyme. Wenn das Melanin tatschlich, wie Barr bei spielsweise vermutet, als organischer Supraleiter bei Raumtemperatur funktioniert, dann knnte es in direkter Supraleitungskommunikation mit der DNS stehen, von der man ja ebenfalls schon lange vermutet, ein solcher Supraleiter zu sein. Supraleitfhigkeit ist eine Eigenschaft, die falls sich die Kohrenztheorie der Biophotonen als richtig erweist - der DNS (und damit auch anderen angekoppelten Moleklsystemen) zuge schrieben werden mte. Obwohl eine Vielzahl anderer Biomolekle, wie hier am Beispiel des Melanins dokumentiert, hnliche Lichtspei 201

Abb.35: Die Ausprgung der Mikrotubuli in der DNS.

chereigenschaften hat wie die DNS, bleibt die DNS doch mit groer Wahrscheinlichkeit die zentrale Instanz fr die Steuerung der biologi schen Prozesse im Or ganismus ber das Bio photonenfeld. Die DNS vermag schon von ihrer Moleklstruktur her wesentlich mehr Infor mation zur Regulation beizutragen als alle an deren Biomolekle.

Alle Supraleiter sind, wie man seit kurzem wei, in der Lage, Licht und damit Informationen zu speichern. Nun gibt es noch ein weiteres mit der DNS und den Wurml chern zusammenhngendes Phnomen: Normalerweise sind diese minikleinen Wurmlcher hchst instabil und halten nur fr den aller kleinsten Bruchteil einer Sekunde lang. Unter bestimmten Umstnden (Fosar/Bludorf) knnen sich jedoch auch stabile Wurmlcher aufbauen und diese bilden ausgeprgte Vakuumdomnen, in denen sich unter anderem Gravitation in Elektrizitt verwandeln kann.

Abb.36: WurmlochBedingungen inner halb der DNS.

202

WURMLOCH INNERHALB NEURONEN


Eric Kandel uerte sich dahingehend, da die Neuronen, die durch Gap-Junctions (Verzweigungs-Spalten) miteinander verbunden sind, sich wie ein einziges gigantisches Neuron verhalten. Es sieht so aus, da Gap-Junctions fr die makroskopische Verteilung von QuantenZustnden unter den Neuronen (und Glia) von Wichtigkeit sind. Bio logisches Electron-Tunneling (Tunneln) kann bis zu einer Entfernung von 5 Nanometern stattfinden. Daher kann die Trennung von 4 Nano metern, die durch Gap-Junctions entsteht, die Tunnelung durch die Gaps (Spalten) ermglichen und dabei fr die Verbreitung des Quanten-Zustands sorgen. In den vergangenen Jahren sind bestimmte intra zellulre Organellen in Dendriten, die unmittelbar an die GapJunctions grenzen, entdeckt worden. Dies sind Membran-Schichten, die ein Mitochondrion abdecken. Sie werden als Dendritic Lamellar Bodies (Dendritische Lamellen-Krper) bezeichnet - DLBs (de Zeeuw, 1995). Diese DLBs wer den zu kleinen cytoskeletalen Protein-Ketten zusammengefgt, die an den Mikrotubuli verankert werden. Es sieht so aus, da den Mitochondrien freie Elektronen fr die Tunnelung zur Verfgung stehen und die DLBs eine Art Josephson-Junction (Verzweigung) zwischen den Zellen bilden und damit die Verteilung cytoplasmischer Quantenzu stnde auf weitreichende Gehirn-Bereiche.

Abb.37: Dentritic Lamellar Bodies (Dendritische Lamellen-Krper, DLBs) liegen an den gegenberliegenden Seiten der GapJunctions (Verzweigungs-Spalten) in neuronalen Gehirn-Dendriten. Sind sie die Trger der Quanten-Tunnelung, die einen einheitlichen Quanten Zustand unter den Neuronen verteilen?

203

DAS WUNDER IST BEWEISBAR


1961 untersuchten die ersten Mediziner indische Yogis und fanden so erstmals Alpha-Wellen der Gehirnrinde whrend Zustnden von Yoga-Ekstase. Die Alpha-Wellen sind typisch fr entspannte Ruhe whrend des Wach-Seins bei geschlossenen Augen. So lag es auch nahe, die Gehirnwellenmuster von Meditierenden nher zu analysieren. Die ersten Untersuchungen stammen von 1973 und sind seither von vielen Forscherteams mit immer neuen, differenzierten Fragestellungen durchgefhrt worden. Anders als zuvor entwickelten diese Bewut seinsforscher dafr jedoch viel aufwendigere Megerte, die mit einem komplexen Computer verbunden wurden. 1977 entwickelte Paul Le vine die Methode des Coherence Spectral Array, des COSPARs, um die fr die Meditations-typischen Gehirnwellen-Kohrenzen sichtbar zu machen. Dabei legen die Untersucher gleichzeitig immer zwei Elektro den an der Kopfhaut an und leiten dort diejenigen Gehirnwellen ab, die sie miteinander vergleichen wollen. blicherweise untersuchen sie die Ttigkeit des Gehirns an zwei verschiedenen, vorher definierten Ablei tungsstellen, beispielsweise ber derselben Gehirnhlfte jeweils vorne und hinten am Schdel, oder aber auf gleicher Hhe spiegelbildlich ber beiden Gehirnhlften. Das COSPAR-Gert wandelt die Signale dieser zwei elektrischen Ableitungen mathematisch um, vergleicht sie miteinander und zeichnet sie sodann als grafische Wellen auf. Als Kohrenz definieren Forscher dabei die mathematisch ermittelte bereinstimmung zwischen den Phasen des EEGs einer bestimmten Frequenz, die an den zwei ver schiedenen Stellen der Kopfhaut abgeleitet werden. So macht dieses Gert Ordnungsmuster von Gehirnwellen in verschiedenen Bereichen der Gehirnrinde sichtbar. Das Auftreten verschiedener Wellenbereiche kennzeichnet unter schiedliche Funktionen: Delta-Wellen (0,5-4 Hz): Regenerationsphase im Tiefschlaf; Theta-Wellen (5-7 Hz): traumloser, mitteltiefer Schlaf; 204

Alpha-Wellen (8-12 Hz): Beta-Wellen (13-30 Hz):

Entspannung, Meditation, inaktiver Wachzustand bei geschlossenen Augen; Denken, Aufgaben lsen, geistige Betti gung, Sinnesreize mit offenen Augen.

Zunahme der Gehirnwellen-Kohrenz whrend der Medi tation


Die Abbildungen auf der nachfolgenden Seite zeigen EEGAbleitungen von Personen mit unterschiedlich langer Meditationspra xis. Jeder Berg auf den Grafiken signalisiert eine bereinstimmung der Gehirnwellen zu 95% ber mindestens 10 Sekunden in verschiede nen Frequenzen von 0-25 Hz. In Ruhephasen von Nicht-Meditieren den treten beim Wach-Sein oder Schlafen keine Kohrenzen auf. Bei Meditations-Anfngern zeigen sich sofort Alpha-Wellen (10 Hz), mit zunehmender Praxis Theta-Wellen (6 Hz) und schlielich Kohrenzen in allen Wellenbereichen. Als Kohrenz definieren Forscher dabei die mathematisch ermittelte bereinstimmung zwischen den Phasen des EEGs einer bestimmten Frequenz, die an den zwei verschiedenen Stellen der Kopfhaut abgelei tet werden.

205

Abb.38 und 39: EEG-Messungen whrend der Meditation zum Zeitpunkt des Beginns und nach 4 Monaten.

Abb.40 und 41: Nach 5 Jahren und 15 Jahren.

206

Ergebnisse: Bedeutungsvoll war fr die Wissenschaftler nicht nur die Menge und Art der auftretenden Kohrenz, sondern vor allem deren nderung aufgrund unterschiedlicher geistiger Aktivitten der Versuchspersonen. Die ersten Kohrenzen bei Meditations-Anfngern treten in der Regel im Alpha-Frequenzbereich (10 Hz) auf und zwar bereits von der ersten Meditation an. Nach einiger Praxis treten dann oft zwei-gipflige AlphaKohrenzen auf, was die Wissenschaftler mit einer vertieften Erfahrung erklren. Wenn Personen die Medititation lngere Zeit ausben, treten ber einstimmungen zunehmend auch in anderen Frequenzen auf. Hufig sieht man dann schon beim Augenschlieen das Alpha-Band; mit Be ginn der Meditations-Technik treten zunehmend auch Kohrenzen im Theta- (6 Hz) und Beta-Bereich (20 Hz) auf. Bei einer jungen Frau, die mit Abstand die lngste Meditationspraxis hatte, weil sie vom 10. Lebensjahr an 15 Jahre regelmig meditierte, zeigte sich entsprechend die strkste Kohrenz in allen Frequenzberei chen von 0-25 Hz; selbst das Beta-Band war ber die gesamte Medita tions-Zeit kohrent ausgeprgt. Die parallel dazu durchgefhrte Mes sung des Atemmusters zeigte, da diese junge Frau in tiefer Ruhe kaum noch Sauerstoff brauchte - ihre Atmung war uerst ruhig und flach oder auf dem Monitor kaum noch sichtbar. Das Zusammentreffen die ser beiden Faktoren werteten die Untersucher als ein klares Zeichen einer Transzendenz-Erfahrung. Bei Versuchspersonen, die einschliefen, verschwanden die vorher vorhandenen Kohrenzen vollstndig, kehrten bei Wiederaufwachen bzw. Weitermeditieren aber sogleich wieder zu rck. Folgeuntersuchungen zeigten direkte Zusammenhnge zwischen dem sogenannten Yogischen Fliegen und der Kohrenz der Neuro nen.

207

Gehirnwellen beim Yogischen Fliegen:


Abb.42: Gehirnaktivitten in unterschiedlichen Intensitten - vor und whrend der Trans zendentalen Meditati on.

Orme-Johnson und andere Forscher untersuchten spter auch die Kohrenzen von Meditierenden, die bereits fortgeschrittende Techni ken anwandten. Besonders beeindruckend ist dabei die intensive Ent wicklung von Kohrenzen ber alle Hirnwellenbereiche whrend des Yogischen Fliegens. Als Vergleichspersonen dienten Menschen, die nicht meditierten und welche die Bewegungen, die bei der geistigen Technik des Fliegens spontan entstehen, willentlich imitierten. Dabei traten bei ihnen nicht einmal Alpha-Kohrenzen auf. 1994 untersuchte Nicolai Nicolaevich Lyubimov, Direktor der Forschungsabteilung fr Neurokybernetik des Moskauer Hirnforschungsinstituts, die Hirnakti vitt bei Meditierenden. Er fand heraus, da whrend der Meditation pltzlich weite Bereiche des Cortex (Hirnrinde), die normalerweise still liegen, auf kleinste akustische Reize (80-100msec) hellwach reagieren. Und was genauso bedeutsam war: Die Ausbreitung dieser feinen Akti vitt ging von einer Hirnhlfte aus und erfate auch die zweite, die vor her nicht aktiv war, fast gleichermaen. Die Meditation belebt und synchronisiert demnach beide Gehirnhlften und verbindet die analytischen Funktionen mit den synthetischen.

208

Gehirnfunktion bei kosmischem Bewutsein


In dieser Untersuchung entwickelten Forscher eine auf verschiede nen Funktionen der Hirnrinde beruhende Integrationsskala. In sie gin gen drei Faktoren als umgerechneter z-Wert ein: Erstens die Gehirnwellen-Kohrenz ber alle Wellenbereiche in den frontalen EEGAbleitungsstellen, zweitens die unterschiedlichen Werte von Hirnpo tenzialen bei verschiedenen Aufgaben whrend der Aktivitt und drit tens die Amplitude der Wellen an allen Ableitungsstellen des Gehirns. Die Regressionslinie durch die individuellen Punkte der einzelnen Testpersonen zeigt an, da mit wachsender Bewutseinsentwicklung das Gehirn deutlich mebare, geordnetere Funktionsweisen annimmt. Ein Maximum an Kohrenz fhrt beispielsweise zum Yogic Flying.

Abb.43 und 44: Whrend des Yogischen Fliegens tritt eine beeindruckende Gehirnwellenkohrenz ber alle Fre quenzbereiche auf. Dieses Gehirnwellenmuster ist einzigartig und deutet auf eine starke Integration aller Funktionen der Gehirnrinde hin.

209

Wissenschaftliche Grundlagen
Es gibt zunehmend mehr wissenschaftliche Forschungsarbeiten, die Personen untersuchen, welche die Abwesenheit von Raum, Zeit und krperlicher Wahrnehmung whrend der Meditation erfahren. So nimmt beispielsweise bei Praktizierenden des Tibetischen Buddhis mus der cerebrale Blutflu in den frontalen Bereichen des Gehirns linksseitig zu und rechtsseitig ab, wenn sie den Verlust der blichen Erfahrung von Raum und Zeit erfahren. Bei Ausbenden des Diamond Way Buddhisms (Ole Nydahl) erhht sich die 40-Hz-Amplitude der Gehirnwellen rechts frontotemporal (vorne-seitlich) gemessen, wenn sie sich selbst in eine grenzenlose Leere verlieren

Wissenswerte Hintergrundinformation
Durch lngere, regelmige Praxis der Meditation entwickelt sich kosmisches Bewutsein, das dadurch gekennzeichnet ist, da die Erfah rung von Transzendenz auch whrend der Tages-Aktivitt und des Schlafens bestehen bleibt. Inzwischen gibt es viele diese Meditation praktizierende Menschen, die seit einem Jahr oder lnger in diesem integrierten Zustand leben. EEG-Untersuchungen zeigten bei Perso nen, die Transzendenz erfahren, eine erhhte Alpha-Theta-Aktivitt der Gehirnwellen. Bei Menschen, die whrend des Schlafes Transzendenz aufrecht er halten, fanden Forscher einerseits eine hhere Alpha-EEG-Amplitude und -Kohrenz, die gemeinsam ein Anzeichen fr Transzendieren im Wachzustand sind. Parallel dazu zeigten sich whrend Stadium 3 und 4 des Tiefschlafs (oder Delta-Schlafs) dabei Delta-Wellen, die tiefen Schlaf anzeigen. Des weiteren fanden die Forscher Unterschiede in der sogenannten kontingenten, negativen Variation (CNV, wrtlich: abhngige negative Schwankung). Diese ist ein negatives Hirnwellenpotenzial, das zwi schen einem warnenden Reiz (Sl) und einem nachfolgenden Stimulus (S2), auf den der Getestete sofort reagieren soll, auftritt. 210

Ein Beispiel fr eine einfache CNV-Aufgabe hierzu: Die Ver suchspersonen sehen fr 150 msec ein Sternchen auf einem Computer bildschirm (Sl) und hren 1,5 sec spter einen Dauerton (S2), den sie so schnell wie mglich per Knopfdruck abstellen sollen. Die frhe kon tingente, negative Variation innerhalb der ersten 500-800 msec nach dem Sternchen-Warnreiz (S1) zeigt bei allen Personen automatische, orientierende Vorgnge an. Daher unterscheiden sich in der frhen CNV Personen mit hufigen oder seltenen Transzendenz-Erfahrungen nicht voneinander. Die spte CNV, die innerhalb der 200 msec vor dem dann folgenden Ton (S2) gefunden wird, mit nun die bereits auf die Handlung vorbe reitende Aktivitt des Gehirns, da die Personen wissen, da sie gleich reagieren sollen. Bei Personen mit hufigen Transzendenz-Erfahrungen nahm, bei einfachen Aufgaben, die spte CNV, das vorbereitende Hirnpotenzial vor dem Reiz (S2), zu. Umgekehrt verhielt es sich bei Wahl-Aufgaben. Bei diesen sieht der Getestete ebenfalls sehr kurz bei spielsweise eine ein- oder zweistellige Zahl auf dem ComputerBildschirm, auf die nach kurzem Intervall eine zweiten, jedoch anderer Gre, folgt. Die Personen sollen dann einen Knopf in der linken Hand drcken, wenn die erste Zahl die grere war oder aber einen Knopf in der rechten Hand drcken, wenn die zweite die grere war. Bei diesen Wahl-Aufgaben war interessanterweise die spte CNV bei Personen mit hufigen Transzendenz-Erfahrungen niedriger als bei den Kontrollpersonen. Dies interpretierten die Forscher als ein eher ausgewogenes Erwartungsverhalten, bei dem die Personen entspannt auf den Wahlreiz S2 warteten, bevor sie mit der Reaktion begannen. Das Ergebnis: Personen mit tglichen Transzendenz-Erfahrungen whrend der Meditation zeigten signifikant die hchste, kontingente negative Variation bei einfachen Reaktionszeit-Versuchen (Aufblitzen (Sl) Ton (S2)), Personen mit hufigen Transzendenz-Erfahrungen (1020 pro Jahr) die mittlere und Personen ohne TranszendenzErfahrungen (<1 pro Jahr) die geringste spte CNV. Ihre am Gehirn ablesbare, vorbereitende Aufmerksamkeit war demnach deutlich die

211

hchste. Bei Reaktionszeit-Versuchen, bei denen zwischen den eigentli chen Stimuli drei strende Zahlen eingeblendet wurden, die der Pro band sich merken sollte, war die erste Gruppe am wenigsten ablenkbar, die zweite Gruppe lag in der Mitte, whrend die Personen ohne Medi tations-Erfahrungen sich am strksten ablenken lieen.

Abgeleitete Ergebnisse und Konsequenzen


Diese Ergebnisse sind von weitreichender Bedeutung. Zum einen stellen sie einen praktischen Bezug zu unseren beschriebenen theoreti schen Modellen her. Zum anderen belegen diese Versuchsreihen den Verdacht, da unser Gehirn in der Lage ist, aktiv in einen physikali schen Schpfungsproze einzugreifen. Die, aus der Physik hinlnglich bekannten Phnomene der Kohrenz knnen demzufolge auf das menschliche Gehirn bertragen werden! Hierber hinaus ist zu erken nen, da wir unter definierten, entspannten Bedingungen, den einge schrnkten (oder gar kaum vorhandenen) Freiheitsgrad des freien Willens erhhen knnen. In diesen Zustnden sind wir tatschlich Schpfer und Herr unse rer eigenen Gedanken und Handlungen! Heben wir zum Schlu noch einmal die schpferischen Eigenschaf ten unseres Gehirns hervor. Der Schlssel hierzu liegt, ganz offenbar, in der Kohrenz. Die hohe Kohrenz verleiht den Photonen die Fhigkeit, Ordnung zu bilden und Informationen zu bermitteln. Die Kohrenz sorgt dafr, da ein Informationstransfer und eine Signalverstrkung stattfindet. Die kohrent schwingenden Neuronen sind ein Kriterium fr die Verbindung zum Hyperraum. Aus der Neurologie ist bekannt, da eine Korrelation zwischen den erhhten Amplituden unserer Neu ronen und dem Grad unserer Aufmerksamkeit besteht. Die Tatsache, da im Gehirn erhhte Amplituden gemessen werden knnen, bedeu tet, da hier eine groe Anzahl von Neuronen in gleicher Frequenz schwingen. Dieses entspricht einem hohen Ma an Kohrenz. Vern derte Bewutseinszustnde wie Entspannung und Meditation knnen 212

als eine Art Kohrenz im langwelligen Bereich unseres Biophotonenfel des aufgefat werden. Nachweislich erhhte sie die Kohrenz der ge messenen Gehirnwellen und fhrt offenbar zu einer Erweiterung des Bewutseins. Darber hinaus ist zu bemerken, da die hohe Kohrenz den Photonen die Fhigkeit verleiht, Ordnung zu bilden und Informa tionen zu bermitteln. Die Eigenschaften der gemessenen Gehirnwellen deuten unter anderem auf eine direkte Ankopplung an eine spezielle, nichtmaterielle Ebene hin. Das, was in der Physik als der Vakuumraum bezeichnen wird, ist offenbar die Quelle aller Information an sich. Information, Struktur und Bewutsein sind eng verknpft mit der Struktur des Vakuum-Feldes. Fritz Albert Popp weist darauf hin, da sich biologische Systeme dem Vakuum gegenber anders verhalten mssen als die isolierten, freien Atome in den Modellvorstellungen der Physiker - die Atome befnden sich im Gewebe in einer Hohlraum-Situation, womit der berhmte Casimir-Effekt eine Rolle spiele. Dadurch wrden sie nicht mehr mit ei nem unendlichen Vakuum wechselwirken, sondern das Vakuum werde durch den Hohlraum eingeschrnkt. Der Ablaufproze einer Manife station am Beispiel eines Gedankens beziehungsweise einer Idee knnte somit physiologisch erklrt werden. Aus virtuellen Energiephnomenen werden durch Energiezufuhr und Aufpfropfung auf virtuelle Photonen reale Zustnde. Die Beein flussung der Vakuumenergie durch Gedanken, Vorstellungen, Gefhle und Glauben funktioniert ber die Grenzen unseres Krpers hinaus. Ursache fr die Fernwirkung ist die Nichtlokalitt (nonlocal). Nichtlokalittseffekte lassen sich mit Feynmans Absorbertheorie erklren. Sie werden besonders effektiv durch Kohrenz (Doppel- oder Mehrphotonen mit jeweils entgegengesetzten Spin-Ausrichtungen, die in der Summe Null ergeben und eine Einheit darstellen). Es ist das Mo dell der Verfestigungs-Kaskade (Realittsbildung) unter Beteiligung des Bewutseins. Durch Kohrenz entstehen Zeitreisen ganz besonderer Art.

213

Elektromagnetische Wellen, die von den Neuronen gesendet wer den, verhalten sich wie folgt: Eine elektromagnetische Welle hat grund stzlich zwei Mglichkeiten. Entweder sie luft in die Vergangenheit, regt dort ein Elektron an und kommt dann als Echowelle in die Gegen wart, also als retardierte Welle; oder sie kommt aus der Zukunft als Echo der retardierten Welle. In beiden Fllen wird unser Elektron aktiv. Das wre dann sprbar, wenn viele Elektronen in gleicher Weise be troffen sind (was den Zustand der Kohrenz entspricht). Da bei der Aussendung der Welle - gleichgltig ob in die Zukunft oder in die Ver gangenheit - und bei Eintreffen der Besttigung exakt die gleiche Zeit gilt, spielen die zurckgelegten Entfernungen der Welle im Raum nicht die geringste Rolle. Aus diesem Modell erklren sich unter anderem die Nichtlokalitts-Experimente nach Aspect. Wenn wir also in der Lage sind, willentlich auf den Kohrenzgrad unserer Neuronen einzu wirken, so liegt uns, auer der beschriebenen Schpfungseigenschaft in unserer Realitt, ein weiterer Aspekt offen. Schon 1968 uerte der Physiker Herbert Frhlich, ein bekannter Vorreiter der Supraleiterfor schung: Kohrente Energieschwingungen sind das entscheidende Merk mal lebendiger Systeme. Zwar seien diese Schwingungen quantenmechanischen Ursprungs, knnten sich aber ber Regionen ausdehnen, die Millimeter oder gar Zentimeter lang sein knnten. Kohrente Energieschwingungen sind offenbar die Grundlage allen Lebens und das Element, welches Leben dige von toten Dingen unterscheidet. Leben unterscheidet sich vom Zustand des Todes nur durch Koh renz der Komponenten eines Systems. Im besonderen ist natrlich auch das Gehirn ein solches kohrentes Quantensystem. So tragen wir also aktiv zu unseren lebenserneuernden Prozessen bei, indem wir uns einen ruhigen und ausgeglichenen Zustand mit einer entsprechenden Vor stellung erschaffen. In der Ruhe liegt bekanntlich die Kraft. In einem Zustand der Ruhe und einem prgenden inneren Bild trgt diese Kraft zu einer bildentsprechenden Realittsausprgung bei.

214

Solange wir jedoch unsere Grenzen in den Bereich der Unmglich keit setzen, solange wird sich in unserem Leben nichts tatschlich Neu es vollziehen. Hier ntzt smtliche Meditationstechnik relativ wenig, wenn nicht die eigene Grenze sich in die unbegrenzten Hhen des All mglichen verschiebt. Nicht der Glaube, sondern das verinnerlichte Wissen, die voll kommene berzeugung, formatiert die inneren Visionen zu einer neuen Realittsbeschaffenheit. Grenzen werden nur durch unsere Vorstellungen festgelegt.

Es sind genau die gleichen Strukturen, die es uns ermglichen, un sere Wunder zu erschaffen...
Und so visualisiere ich mir eine Welt, in welcher die Menschen ihre grenzenlosen Mglichkeiten freudvoll nutzen und in ekstasischer Liebe in allen Variationen ausleben.

Morpheus

215

GLOSSARIUM (wissenschaftliche Erklrungen)


Antimaterie und Negative Energie Prinzipiell lassen sich Wurmlcher, die gengend gro und auch entsprechend stabil sind, auch ohne Schwarze Lcher konstruieren. Das Zauberwort hierzu heit negative Energie oder Masse, auch be kannt als exotische Materie. Die uns gelufige Materie weist durchweg positive Energie auf und verursacht deshalb eine positive Krmmung der Raum-Zeit. Auch Antimaterie weist positive Energie auf. Fr ein Wurmloch braucht man aber eine Region mit negativer Krmmung, also Materie mit negativer Energie, denn diese entspricht einer abstoenden Gravitation. Was aber ist nun diese negative Energie, und wie kann man sie ge winnen? Hier kommt uns die Unschrferelation der Quantenmechanik zu Hilfe: Im subatomaren Bereich brodelt es heftig! Es entstehen stn dig sogenannte virtuelle, entgegengesetzt geladene Teilchenpaare, die sich alsbald gegenseitig wieder vernichten, und das selbst im absoluten Va kuum! Die Energie zu ihrer Bildung leihen sie sich einfach aus dem Vakuum und geben sie bei ihrer Vernichtung wieder zurck. Die Ener giedichte eines jeden Feldes, egal, ob elektrisch, magnetisch oder gravitativ, ist nach der Heisenhergschen Unschrferelation selbst Schwankun gen unterworfen. Zu einem bestimmten Zeitpunkt kann sie in den ne gativen Bereich gelangen. Sie wird aber durch erhhte Werte der positi ven Dichte ausgeglichen. Und zwar wird der negative Puls berkom pensiert, und das um so mehr, je grer die Zeitintervalle zwischen den Pulsen sind. Diesen Effekt nennt man Quantenzins - die negative Ener gie ist quasi ein Darlehen, das mit Zinsen zurckgezahlt werden mu. Je lnger die Darlehensdauer (grere Zeitintervalle) und je grer die Darlehensmenge (die negative Energie), um so hher ist der Zins (der positive Puls). Zudem ist bei ansteigenden Darlehensbetrgen die Lauf zeit immer krzer.

216

Antiteilchen Zu jedem Teilchen der normalen Materie existiert ein Antiteil chen. Teilchen und Antiteilchen sind nahezu identisch. Sie besitzen gleiche Masse und Spin, tragen aber eine entgegengesetzte Ladung. Wenn ein Teilchen und sein entsprechendes Antiteilchen aufeinander treffen, so vernichten sie einander und es entsteht elektromagnetische Strahlung. Bisher wurde nur wenig Antimaterie im Kosmos beobachtet, und es ist unklar, warum die Natur eine von zwei mglichen Formen der Materie bevorzugt. Allerdings knnen die Antiteilchen heute von den Physikern mit Beschleunigern knstlich erzeugt werden. Das An titeilchen des Elektrons bezeichnet man als Positron. Es wurde 1932 durch Anderson bei der Durchsicht von Nebelkammeraufnahmen ent deckt, wobei seine Existenz durch die relativistische Quantentheorie bereits vorausgesagt worden war. Eine moderne Interpretation nach Feynman besagt, da das Positron auch als ein Elektron angesehen wer den kann, das in der Zeit rckwrts reist. Bose-Einstein-Kondensat Bose-Einstein-Kondensat ist ein neu (1995) entdeckter Zustand der Materie, bei nur einem Milliardstel Grad Kelvin ber dem absoluten Nullpunkt. Schon von Einstein und Bose vorhergesagt, verwandelt sich dabei Materie in eine Welle und entwickelt Eigenschaften, die bisher nur von Photonen (Lichtquanten) bekannt waren. Es wird in der mo dernen Physik beschrieben, wie superkalte Molekle mit dem Quan tenvakuum in Verbindung stehen und Informationen unserer Welt als Kruselungen im Hyper-Raum gespeichert werden. Die Evolution ist also das Resultat eines Informationsaustausches zwischen Quantenva kuum und Materie. Die Eigenschaften der Bose-Kondensation, wie dieses Phnomen auch genannt wird, stellen auch die Voraussetzungen fr die Anbindung an den Hyper-Raum dar. Casimir-Effekt Felder mit negativer Energiedichte lassen sich im Labor erzeugen. Benutzt wird hierzu der sogenannte Casimir-Effekt, benannt nach sei

217

nem Entdecker, dem niederlndischen Physiker Hendrik B. G. Casimir. Er zeigte bereits 1948, da sich zwei ungeladene Metallplatten in sehr engem Abstand in einem Vakuum anziehen. Ursache hierfr sind die Vakuumfluktuationen. Auch im perfektesten Vakuum entstehen stn dig virtuelle Teilchenpaare aus Materie und Antimaterie, welche die Energie zu ihrer Entstehung vom Vakuum ausleihen und sie nach sehr kurzer Zeit wieder zurckgeben, indem sie sich gegenseitig ver nichten (annihilieren). Man kann virtuelle Teilchen nicht beobachten, denn jede Beobachtung wrde sie sofort zu reellen Teilchen werden lassen. Einen indirekten Beweis fr ihre Existenz liefern sie aber, indem sie beispielsweise Wasserstoffatome etwas hin- und herstoen, was zu einer mebaren, winzigen Verschiebung ihres niedrigsten Energieni veaus fhrt. Allein im Moment ihrer Entstehung hat das Vakuum be reits eine negative Energiedichte, weil es einen kleinen Anteil seiner Energie an die Teilchen entliehen hat. Die virtuellen Teilchen kann man auch nach dem Welle-Teilchen-Dualismus als Welle auffassen. Nun passen aber nicht alle Wellenlngen zwischen beide Metallplatten, son dern nur stets ein ganzzahliges Vielfaches bestimmter Wellenlngen, whrend auen alle mglichen Fluktuationen beziehungsweise Wellen lngen existieren drfen. Im Endeffekt drcken somit von auen mehr Wellen gegen die Platten als im Zwischenraum ausgeglichen wird. Es entsteht hier somit ein Feld mit negativer Energiedichte. Das Anziehen der Platten ist damit auch ein weiterer Beweis fr die Existenz der vir tuellen Teilchen. Der Casimir-Effekt ist winzig: Zum Beispiel betrgt der Quantendruck bei einem Abstand der Platten von einem Millionstel Millimeter nur rund ein Zehntausendstel des Luftdrucks. Wenn man die Platten einander nhert, passen noch weniger Wellen in den Spalt, und die negative Energiedichte steigt weiter - zieht man sie auseinander, verschwindet der Effekt.

DNS im Sinne der Quantendynamik Heute wei kaum jemand, da das Verstndnis der lebenden Mole kle (DNS), zum Beispiel in der Gentechnologie, erst durch die Quantenmechanik erklrt werden kann. Um zu verstehen, wie wir Ge

218

ne aufbauen oder umbauen knnen, mssen wir verstanden haben, war um Atome sich nur in ganz bestimmten Abstnden und mit chemi schen Bindungen von bestimmter Strke zusammenschlieen. Dieses Verstndnis ist das Geschenk der Quantenphysik an die Chemie und die Molekularbiologie.

Einstein-Rosen-Brcke In den dreiiger Jahren wurden spezifische Lsungen der Einstcin'schen Feldgleichungen entdeckt, die eine Art von Durchtunne lung der Raum-Zeit beschreiben. Diese Tunnel wurden zuerst von Al bert Einstein und seinem Mitarbeiter Nathan Rosen bei der sogenannten Schwarzschildlsung der Gleichungen der Allgemeinen Relativittstheorie gefunden. Die Schwarzschildlsung beschreibt die Verhltnisse in der Umgebung eines Schwarzen Lochs und zeigt, da im Inneren des Schwarzen Lochs eine Verbindung zu einem anderen Raum-Zeit-Gebiet existiert. Man bezeichnet solch eine Verbindung als Wurmloch oder auch als Einstein-Rosen-Brcke. Die Schwarzschildlsung zeigt jedoch, da eine Kommunikation ber eine solche Brcke nicht mglich ist, da das Wurmloch nicht lange genug geffnet ist, um mit weniger als Lichtgeschwindigkeit durchquert zu werden. Wenn ein Schwarzes Loch jedoch Ladung besitzt oder rotiert, sind die Verhltnisse komplizierter - es lassen sich relativistische Modelle aufstellen, die Transport von Masse und Information ber eine Einstein-Rosen-Brcke im Prinzip zulassen. In diesem Zusammenhang gibt es aktuelle berlegungen der Physiker, ob Wurmlcher Zeitreisen in die Vergangenheit ermglichen. Elektromagnetische Wellen Diese sind als potentielle Kraftfelder oder Strahler zu verstehen und entstehen primr aus einer Wirbelbildung (Vortex/Spin). Diese elek tromagnetischen Wellen sind zuerst Wahrscheinlichkeitswellen, also noch keine Realitt. Keine dieser Wahrscheinlichkeitswellen berlagert eine andere, sondern jede Welle fhrt ihr WahrscheinlichkeitsEigenleben. Dahingegen berlagern sich die potentiellen Kraftfelder aller Wellen zu Interferenz-Feldern mit neuer elektromagnetischer In

219

dividualitt. Alle elektromagnetischen Wellen mit ihrer Energie und potentiellen Kraftwirkung sind letztlich Informationstrger fr die be reits existierende Materie. Informationsaufnahme entsteht, wenn die Bauteile der Materie abgestimmte Antennen (also resonanzfhige Strukturen) besitzen. In dem Augenblick, in dem die e-mWahrscheinlichkeitswelle auf Resonanzstrukturen trifft, geschieht et was Entscheidendes: Auf Kosten der Welle werden jetzt Photonen (Quanten) gebildet. Sobald diese Photonen bertragen werden, kolla biert die Welle. Sie kollabiert im ganzen Raum, im ganzen Kosmos, falls sie sich nicht weit genug ausbreiten kann.

Elementarstruktur des materiellen Seins Die Austauschteilchen der schwachen Wechselwirkung, die virtuel len Vektorbosonen (Spin 1) sind elektrisch geladen, es handelt sich also um Ladungsaustauschreaktionen. Zudem sind sie sehr schwer (experi mentell nachgewiesen am CERN 1983, Nobelpreis 1984). Die Bosonen koppeln an die Differenz aus Vektor- und Axialvektor strom, weshalb man auch von der V-A-Theorie der schwachen Wechsel wirkung spricht. Fr dieses Verhalten existiert bislang keine wirklich tiefe Begrndung, es ist vielmehr im Einklang mit dem Experiment so gefunden worden. Neben Vektorstrmen tauchen hier zum ersten Mal auch sogenannte Axialvektorstrme auf. Ereignis Einen Punkt im Kontinuum der Raum-Zeit nennt man Ereignis oder Weltpunkt. Ein Ereignis ist mit einem bestimmten Ort und einer be stimmten Zeit verknpft. In der mathematischen Beschreibung der Raum-Zeit werden einem Ereignis vier reelle Parameter zugeordnet: drei rumliche Koordinaten x, y, z und eine Zeitkoordinate t. Der Ab stand zwischen zwei Ereignissen der Raum-Zeit bleibt in der Relativi ttstheorie eine absolute Gre.

220

Ereignishorizont Ein Objekt, das sich verdichtet, erhht seine Oberflchenschwer kraft und damit die Fluchtgeschwindigkeit. Es existiert eine kritische Distanz, bei der die Fluchtgeschwindigkeit grer wird als die Lichtge schwindigkeit. Diese spezielle Grenze der Komprimierung eines Mas seobjektes wird auch als Schwarzschildradius bezeichnet. Wenn ein Krper auf die Gre seines Schwarzschildradius schrumpft (oder dar ber hinaus), so kann er keine Strahlung, Materie oder Information mehr verlieren. Die Grenze, die den Schwarzschildradius markiert, wird als Ereignishorizont bezeichnet. Der Ereignishorizont schliet das Ob jekt vom Rest des Universums unumkehrbar ab, und es wird zum Schwarzen Loch. Das Schwarze Loch hat eine einbahnstraenartige Oberflche. Die physikalischen Bedingungen jenseits des Ereignishori zontes sind nur noch ber Modellrechnungen ableitbar. Der Schwarz schildradius fr einen Krper mit Sonnenmasse betrgt ungefhr 3 km. Es wird vermutet, da Schwarze Lcher in unserem Universum als Endstadien im Proze der Sternentwicklung auftreten. Exotische Materie Die ffnung eines Wurmlochs sollte sich glatt mit der umgeben den Raum-Zeit verbinden, damit der Durchgang stabil bleibt. Wie von den Physikern Morris, Thome und Yurtsever gezeigt werden konnte, besitzt das Material, das bentigt wird, um das Wurmloch offenzuhal ten, in bestimmten Bezugsrahmen eine negative Energiedichte. Eine Materie dieser Art (oder auch Feld) wird exotisch genannt. Die kali fornischen Physiker nahmen dabei Bezug auf ein Experiment des hol lndischen Physikers Casimir, der schon 1948 negative Energiedichten zwischen zwei geladenen Kondensatorplatten untersucht hatte. Sie be rechneten, da ein Feld dieser Art das Wurmloch offenhalten kann, so da ein drohender Zusammenbruch verhindert wird. Gehirn und Neuronen als Sender und Empfnger Bei der Verarbeitung von Sinneseindrcken nutzt das Gehirn Schwingungsvernderungen der elektrischen Nervenimpulse offenbar hnlich wie ein Radioempfnger oder -sender. Israelische Forscher am
221

Weizman-Institut (Professor Ehud Ahissar) stellten fest, da auch das Nervensystem (Neuronen) die Frequenz elektrischer Impulse zur In formationsbermittlung nutzt. Fangen Sinneszellen (bestimmte Neu ronen) Reize auf, werden diese zuerst zum Thalamus geleitet. Der ver teilt sie wiederum an die entsprechenden Verarbeitungszentren in der Grohirnrinde. Dort werden die einzelnen Reize dann zu einem umfas senden Sinneseindruck zusammengefgt. Doch die Leitungen zwischen den Gehirnregionen funktionieren nicht nur in eine Richtung. Auch andere Gehirnareale senden ihrerseits Impulse an den Thalamus, die von dort aus in die Umwelt abgestrahlt werden. Von entscheidender Bedeutung sind hierbei Frequenzen, die im 10-Hz-Bereich (Alpha) liegen, also der Grundresonanz-Frequenz der Erde hnlich sind.

Geschlossene Zeitschleife (CTC) Die Relativittstheorie verlangt, da die Weltlinien, auf denen sich die Masseteilchen bewegen, zeitartig sind. Moderne Forschungen erga ben, da massive Objekte (in bereinstimmung mit der Theorie) Weltlinien, also Raum und Zeit, verbiegen knnen. Theoretisch wre es denkbar, da diese Raum-Zeit-Verdrehungen so stark sind, da eine Weltlinie in sich zurckgebogen wird und eine geschlossene Schleife bildet. Lokal wrden auf der Weltlinie die Eigenschaften von Raum und Zeit erhalten bleiben, aber es wrden sich merkwrdige Korridore in die Vergangenheit ffnen. Wenn sich ein Masseteilchen auf dieser Schleife immer vorwrts in der Zeit bewegt, dann wird es nach einer endlichen Eigenzeit in seiner eigenen Vergangenheit auftauchen. Solch ein theoretisches Konstrukt nennt man eine geschlossene Zeitkurve oder Zeitschleife oder auch eine CTC (Closed Timelike Curve). Heisenbergsche Unschrferelation Eine Folgerung aus den Grundgesetzen der Quantenmechanik ist, da bestimmte Produkte physikalischer Gren grundstzlich eine Unbestimmtheit aufweisen. Dieses Unbestimmtheitsprinzip wurde erstmals 1927 von Werner Heisenberg formuliert und gilt im Bereich der atomaren Grenordnungen. Diese Unschrfe in der Mikrowelt kann

222

nicht als Folge einer Meungenauigkeit aufgefat werden, sondern ist eine prinzipielle Eigenschaft. Alle Elementarteilchen unterliegen diesem Unbestimmtheitsprinzip. So ist es zum Beispiel nicht mglich, gleich zeitig die genauen Werte fr Ort und Geschwindigkeit eines Elemen tarteilchens zu bestimmen. Es lt sich zeigen, da die Impulsunbe stimmtheit dp eines Elementarteilchens und seine Ortsunbestimmtheit dx der Beziehung dp * dx ~ h gehorchen mssen. Die konstante Gre h wird als Plancksches Wirkungsquantum bezeichnet und hat den Wert h = 6.6.261 * 10-34 Js.

Kausalitt Kausalitt ist das Verhltnis, in dem Wirkung und Ursache zueinan der stehen. Die Physik versucht bei Ereignissen den Zusammenhang zwischen Wirkungen und Ursachen systematisch darzustellen. Durch physikalische Gesetze werden zuknftige Ereignisse auf zeitlich frher liegende zurckgefhrt, und aus vorhandenen Daten werden zuknftige Zustnde vorausberechnet. Das heit, die Ursache liegt zeitlich immer frher als die Wirkung. Die kausale Struktur der relativistischen RaumZeit unterscheidet sich grundlegend von der klassischen, Newton'schen Raum-Zeit. In der Newtonschen Physik nahm man an, da alle zeitlich frher liegenden Ereignisse im Prinzip alle zuknftigen Ereignisse be einflussen konnten. Dazu mute man aber eine unendlich schnelle Ausbreitung der Wirkungen postulieren (Fernwirkungstheorie). Mit der Relativittstheorie, die fr jede Form der Signalausbreitung eine obere Grenze setzte (die Lichtgeschwindigkeit), erkannte man, da es keinen unbeschrnkten Kausalzusammenhang geben kann. Fr jedes Ereignis E der Gegenwart teilt der zu E gehrige Lichtkegel den Raum in drei Bereiche ein: 1. Im Zukunftskegel liegen alle die Ereignisse, die von E durch elek tromagnetische Wechselwirkungen beeinflut werden knnen. 2. Im Vergangenheitskegel liegen alle Ereignisse, die E htten beein flussen knnen. 3. Alle anderen Ereignisse bilden den dritten Bereich auerhalb, das Anderswo.

223

Die relativistische Bedingung, da reale Weltlinien niemals den Lichtkegel verlassen knnen, sichert die Kausalstruktur unserer vierdi mensionalen Raum-Zeit.

Molekle und Gefhle Wir haben nur die Chance, Krper, Psyche und Geist zu verstehen, wenn wir den Mechanismus des Zusammenspiels von Atomkernen, Elektronen und den dahinterstehenden Energien und Krften entdekken. Das setzt voraus, da wir den Fachbereich der Quantenelektrody namik (QED) fr diese Beschreibung zugrunde legen. QED gilt als die exakteste und erfolgreichste wissenschaftliche Theorie, fr die Feynman, Schwinger und Tomo Nago 1965 den Nobelpreis erhielten. Hier aus geht hervor, da das gesamte Universum, die ganze Erdenwelt, die gesamte Natur und unser ganzes Leben unter anderem auf der unent wegt ablaufenden Wiederholung von nur drei elementaren Vorgngen beruhen: 1. der elektromagnetischen Welle, welche die Bewegungen des Elek trons kennzeichnet; 2. der elektromagnetischen Welle, welche die Bewegung des Photons kennzeichnet, und 3. der Wechselwirkung dieser beiden Wellen.
Alle sich ungleichfrmig bewegenden Elektronen und alle elektrisch nicht neutralen, also alle geladenen Teilstrukturen oder Krper sind Sender elektromagnetischer Felder mit Kraftwirkung. Ein vlliges Still stehen gibt es nicht. Das bedeutet: Alle Molekle und Krper haben eine Quantenenergie. Jedes Atom und jedes Molekl kennzeichnet sich durch charakteristische Quantenenergie aus, hnlich eines Fingerab drucks. Alle Bio-Regulatoren wie Hormone, Anti-Gene oder Substrate der Enzyme haben elektrische Eigenladungen (fingerprints), die sich meistens als Di-Pole darstellen. Gleichzeitig haben alle diese Molekle eine mechanische Eigenschwingung. Beide zusammen genommen (DiPol-Moment und Vibration) fungieren als Sender von elektromagneti schen Wellen. Ihre Partner - wie Rezeptoren, Antikrper und Enzyme - fungieren wiederum als spezifische Empfnger dieser Wellen. Das 224

heit, da der Empfang von Informationen als codierte Energie dabei ber Resonanz geschieht. So entsteht Realitt!

Paralleluniversum In einer modernen Interpretation der Quantentheorie (Viele-WeltenTheorie) wird eine hypothetische Erweiterung unseres Universums angenommen. Unser aktueller Kosmos ist Teil eines umfassenden Multiversums, das aus einer ungeheuren Anzahl von separaten, unter schiedlichen oder auch parallelen Universen besteht. Direkte Wechsel wirkungen (zum Beispiel der Austausch von Materie) zwischen diesen Universen sind nicht zulssig. Photon Es ist das kleinste Paket des elektromagnetischen Feldes. Es ist das Austauschteilchen der elektromagnetischen Wechselwirkung (von den Radiowellen ber das sichtbare Licht bis hin zur Gammastrahlung). Als Elementarteilchen besitzt das Photon keine Ruhemasse, da es sich kon stant mit Lichtgeschwindigkeit fortbewegt. Licht kann als ein Strom von Photonen aufgefat werden, von denen jedes die Energie E = h v besitzt. Jedem Photon kann in bereinstimmung mit dem WelleTeilchen-Dualismus eine Wellenlnge und eine Frequenz zugeordnet werden. Dabei gilt: Je hher die Frequenz, desto krzer ist die Wellen lnge und desto energiereicher ist die Strahlung. Planck'sche Lnge Sie ist eine Lngeneinheit, die mit den Gesetzen der Quantengravi tation verknpft ist. Sie errechnet sich aus den Grundkonstanten der Physik und hat den Wert 1p = 1,62 * 10-33 cm. In dieser Grenord nung hrt der Raum auf, wie wir ihn kennen. Unterhalb der Planck'schen Lnge wird der Raum zum sogenannten Quantenschaum und unterliegt gewaltigen Quantenfluktuationen.

225

Planck'sehe Zeit Das ist die Zeit, die das Licht braucht, um die Planck'sche Lnge zu rckzulegen. Wenn man die Planck'sche Lnge durch die Lichtge schwindigkeit teilt, so erhlt man ungefhr tp = 6,3 * 10-43 s. Die Planckzeit ist mit den Gesetzen der Quantengravitation verknpft. Wenn zwei Ereignisse durch ein Zeitintervall getrennt sind, das krzer als die Planck'sche Zeit ist, dann lt sich nicht mehr feststellen, wel ches Ereignis frher oder spter stattgefunden hat. Die Kausalordnung geht in der Welt der Planck'schen Dimensionen verloren. Quantengravitation Die beiden anerkannten Grundpfeiler und fundamentalen Theorien der Physik sind die Allgemeine Relativittstheorie und die Quantenme chanik. Bei der Quantengravitation handelt es sich um ein Programm, das diese beiden Theorienzweige vereinheitlichen will. Angestrebt wird eine umfassende Theorie bezglich der Gravitation, die auch Quan teneffekte einbezieht. Quantenschaum Schaumartige Struktur des Raumes, die sich nach den Gesetzen der Quantengravitation unterhalb der Planck'schen Lnge ausbildet. Er erscheint topologisch betrachtet als dynamisch vielfach zusammenhn gend. Winzige Henkel, ffnungen und Wurmlcher durchbrechen die glatte Struktur des Normalraumes und verbinden sich zu einem kom plexen Gebilde, in dem Quantenfluktuationen dominieren. Raum-Zeit Alle Ereignisse, ebenso wie alle Massen, existieren in Raum und Zeit. Einem Ereignis kann man vier Koordinaten zuordnen, drei Raumkoor dinaten x, y, z und eine Zeitkoordinate t. Diese Koordinaten bilden ei nen Ereignispunkt in einem vierdimensionalen Kontinuum. Die RaumZeit ist die Gesamtheit aller Ereignispunkte. Weltlinien, die sich aus Ereignispunkten zusammensetzen, beschreiben Ereignisse und Bewe gungen von Krpern. Da die Lichtgeschwindigkeit die grtmgliche

226

Kommunikationsgeschwindigkeit ist, liegen die Weltlinien innerhalb der relativistischen Lichtkegel, die der Raum-Zeit eine besondere Struktur verleihen.

Raum-Zeit-Krmmung Die Existenz von Gravitationsfeldern bedingt in unserem Univer sum eine von Ort zu Ort wechselnde geometrische Struktur des Rau mes, die Raumkrmmung. In der Nachbarschaft von massereichen Krpern wird der Raum so verndert, da elektromagnetische Strah lung und Materieteilchen gekrmmten Bahnen folgen (Geodten). Untersucht man die Struktur des Universums als Ganzes, dann er geben sich drei theoretisch mgliche Flle: 1. Raumkrmmung Null: Die Struktur des Raumes entspricht dem unendlichen, euklidi schen, flachen Raum, in dem die krzeste Verbindung zwischen zwei Punkten eine gerade Linie ist. 2. Raumkrmmung negativ: Es handelt sich um einen gekrmmten, unendlich offenen, hyper bolischen Raum (Lobatschewskische Geometrie). 3. Raumkrmmung positiv: In diesem Fall erhalten wir einen Raum, der ohne Rand in sich ge schlossen ist, wie die Oberflche einer Kugel (Riemann'sche Geo metrie). Zur Zeit ist nicht hinreichend geklrt, welcher Fall fr un ser aktuelles Universum zutrifft. Resonanz Resonanz ist Schwingung, und zwar eine zeitlich sich wiederholende nderung einer oder mehrerer physikalischer Gren um einen Mit telwert. Hufig haben Schwingungen periodische Zustandsnderungen der jeweiligen physikalischen Systeme zur Folge. Bekannte Beispiele hierfr sind neben vielen anderen Schwingungen Saiten, Pendel, Luft und Flssigkeiten. Auerdem zhlen beispielsweise auch Schwingungen im Schwingkreis und die Schwingungen im elektrischen und magneti schen Feld dazu (siehe Elektrizitt, Elektronik und Magnetismus). Bei

227

der Pendelschwingung handelt es sich um eine wiederholte Hin- und Herbewegung mit Durchgang durch die Gleichgewichtslage (auch neu trale Position genannt). Eine einzelne Bewegung von einer Extremposi tion zur anderen (eine Amplitude) und zurck - mit zweimaligem Durchgang durch die neutrale Position - bezeichnet man als Zyklus, wobei die Anzahl der Zyklen pro Sekunde oder Hertz (Hz) die Fre quenz der Schwingung wiedergibt. Ein schwingfhiges System schwingt dann mit der sogenannten Eigenfrequenz, wenn man dieses System zu Schwingungen anregt und anschlieend sich selbst berlt. Zur Veranschaulichung dieses Phnomens betrachten wir uns einen Versuch von Professor Meyl: Erst bei Resonanz zwischen Sender und Empfnger geht beim Empfnger eine Kontroll-Lampe an als Zeichen dafr, da die gesendete Energie auch ankommt. Geht man im Experi ment aus der perfekten Resonanz beziehungsweise Eigenresonanz her aus, indem man die Frequenz ndert, geht beim Empfnger die Kontroll-Lampe aus. Nur bei perfekter Resonanz (Nikola Tesla) - wobei Resonanz als Synchronismus von Sender, Empfnger und den vermit telten Teilchen zu verstehen ist kommt hundert Prozent Sendelei stung beim Empfnger an, whrend andere, die nicht in Resonanz ge hen, selbst wenn sie dem Sender nher sind, berhaupt nichts abbe kommen (Meyl); erst im Resonanzfall findet ein Datenaustausch (Kommunikation) statt. Die Feldlinien, die dabei vom Sender, also ei nem Pol, abgegeben werden, knnen vom Empfnger (dem anderen Pol) ohne Energieverlust nur bei umgekehrter Phase eingesammelt werden. Bei gleichphasigem Schwingen kann der Empfnger die Signale nicht empfangen. Erst bei perfekter Resonanz zeigt nach Meyl die Tes lastrahlung eine schwingende elektromagnetische Wechselwirkung, das heit: Die Tesla-Strahlung ist ebenfalls eine elektromagnetische Welle, wenn auch eine longitudinale, und bei resonant schwingenden Polen erfolgt die gegenseitige Anzie hung genauso wie bei ungleichnamigen statischen Polen.

228

Schumann-Resonanz-Frequenz (Erdfrequenz) Diese Frequenz entspricht nach ihrem Entdecker Prof Dr. W. O. Schumann (TU Mnchen, 1938) der Erdresonanz-Frequenz. Diese Er dresonanz-Frequenz ergibt sich aus dem Verhltnis der Lichtgeschwin digkeit zum Umfang der Erde und entspricht 7,83 Hz. Diese 7,83 Hz entsprechen in aufflliger Weise dem Frequenzmuster des menschli chen Gehirns im Alpha-Bereich (bergangszustand zwischen Schlafund Wachzustand bzw. in Meditation). Die seit einigen Jahren zuneh mende Erhhung dieser Schumann-Resonanz-Frequenz erklrt sich durch zwei Einflugren, die einerseits knstlichen Ursprungs sind (HAARP) und andererseits einen naturgemen Proze erklren las sen. Diese naturgeme Einfluebene stellt unsere Sonne dar. Schwarzes Loch Ein stellares Schwarzes Loch ist ein Raumgebiet, in dem ein Stern kollabiert ist. Ein Sternzusammenbruch findet in der Regel dann statt, wenn sich sein nuklearer Ofen erschpft hat. Die Gravitationskraft zieht die Masse des Sterns in sich zusammen. Wenn sich die Masse in diesem Proze auf ein Gebiet reduziert, das kleiner als der sogenannte Schwarzschildradius ist, dann beherrscht die Gravitation alle anderen Krfte und schnrt dieses Raumgebiet vom ueren Universum ab. Die Gravitationskraft wchst im Inneren des Schwarzen Lochs auf unendli che Werte. Nicht einmal die Photonen des Lichts knnen den Anzie hungsbereich eines Schwarzen Lochs verlassen. Das Zentrum eines Schwarzen Lochs, das sich jeder physikalischen Interpretation entzieht, wird als singulr bezeichnet. Durch die Singularitt verliert jede physi kalische Theorie ihre Bedeutung. Zur Zeit sind Schwarze Lcher noch hypothetisch, doch besitzen die Astronomen einige Indizien. Es wer den einige kosmische Objekte analysiert, deren Beobachtungsdaten auf Schwarze Lcher hinweisen. Singularitt Es ist ein Punkt im Kontinuum der Raum-Zeit, in dem die physikali schen Gesetze keine Gltigkeit mehr besitzen. Wenn anerkannte Stan

229

dardtheorien in diesem Punkt unendliche Werte fr Dichte, Masse und Gravitationskrfte Voraussagen, geben sie indirekt zu, da keine sinn vollen und empirisch berprfbaren Aussagen mglich sind. Zum Bei spiel wird der Big Bang auch als Anfangssingularitt unseres Univer sums bezeichnet. Die Frage, was vor dem Big Bang geschehen ist, kn nen die Physiker nicht sinnvoll beantworten. Das singulre Geschehen im Ursprung setzt fr jede Theorie eine unberwindbare Schranke.

Stehende Welle Eine Stehende Welle setzt sich immer aus zwei interferierenden Wel len gleicher Frequenz und Amplitude zusammen. Meist erhlt man Stehende Wellen bei einer Reflektion an einer Wand, wobei sich die Welle mit der reflektierten Welle berlagert. Eine Stehende Welle zeich net sich besonders dadurch aus, da bei ihr keine Energiebertragung mehr stattfindet, wie es bei einer fortschreitenden Welle der Fall wre. Die Energie wird vielmehr gespeichert. Das menschliche Gehirn, mit seinen 1010 Neuronen (Nervenzellen), welche sich in zwei Hemisph ren aufteilen, ist unter holografischen Aspekten zu betrachten. Um dem Prinzip des Hologramms zu entsprechen, sollten sogenannte Ste hende Wellen aufgebaut sein. Stehende Wellen sind dem Gesetz der Ko hrenz zuzuordnen. Die synchron schwingenden Neuronen bilden eine sogenannte Stehende Welle. ber ein aufgebautes Hologramm des Ge hirns bestehen direkte Interaktionsmglichkeiten mit dem Umfeld, dem ganzen Universum! Von der Physik wissen wir, da unter Bedin gungen einer Stehenden Welle eine Informationsbertragung quasi zeit gleich erfolgt, da innerhalb dieser Welle alles mit allem verbunden ist. Strings Strings sind fadenfrmige, kosmische Relikte aus der Anfangsphase des Universums. Ihr Durchmesser (zirka IO'30 cm) ist kleiner als der eines Atomkerns, und sie erstrecken sich ber riesige kosmische Di stanzen. Strings entstehen nicht aus Materie, sondern sind Strungen des Vakuums. Sie sind mit Energie aufgeladener leerer Raum, entstan den in den turbulenten Phasenbergngen des frhen Universums. Es

230

wird angenommen, da sie als gravitative Samen bei der Ausbildung von Galaxien eine wichtige Rolle spielen.

Superposition Unter Superpositon versteht man generell eine berlagerung. In der Quantenphysik bedeutet Superposition (Quantensuperpo sition) die berlagerung von zwei oder mehreren Zustnden ei nes Objekts. Aufgrund der Heisenberg'schen Unschrferelation knnen die Zustnde einer aktuellen Superposition nicht gleich zeitig beobachtet werden. Die Quantensuperposition wird fr die theoretische Konzeption von Quantencomputern herangezogen. In der Informationstheorie bedeutet Superposition die berlage rung von Informationen auf einem physischen Informationstr ger. Dadurch wird eine maximale Informationsdichte erreicht. In der Genetik versteht man unter Superposition die Codierung mehrerer Eiweie durch denselben DNS-Abschnitt bei Eukaryoten. Diese Superposition genetischer Information in Form von Introns und Exons wird durch das alternative Splicing der mRNS im Rahmen der Proteinbiosynthese aufgelst. Supraleiter Unter Supraleitung versteht man kurz zusammengefat einen ma kroskopischen Quantenzustand von Elektronenpaaren, die ber Pho tonen miteinander gekoppelt sind. Charakteristisch fr einen Supralei ter sind folgende Eigenschaften: Ideale Leitfhigkeit und idealer Diamagnet.
Die Phnomene der Supraleitfhigkeit sind bei weitem noch nicht vollstndig aufgedeckt. So wurde zum Beispiel die Fhigkeit von Su praleitern, Licht speichern zu knnen, erst in jngster Zeit entdeckt. Das klingt vielleicht berraschend, doch man sollte sich deutlich vor Augen halten, da Licht, obwohl uns allen vertraut, nichts eigentlich Greifbares ist. Licht ist reine elektromagnetische Energie, unterteilt in

231

kleine Quanten, sogenannte Photonen, die - wie der Name schon sagt stndig mit Lichtgeschwindigkeit unterwegs sind. Man kann Photonen zwar durch bestimmte Teilchenreaktionen vernichten, das heit, ihre Energie vollstndig auf andere Materie bertragen, ein Photon einzu sperren, gelang jedoch bislang nicht. Am Rowland-Forschungsinstitut in Cambridge, USA, stellte nun die Harvard-Physikerin Lene Vestergaard Hau fest, da sich Laserlicht beim Durchqueren von NatriumAtomen bei fast -270 Grad auf eine Geschwindigkeit von etwa 60 Ki lometer pro Stunde abbremsen lt. Grundvoraussetzung fr diesen Bremseffekt ist, da das Medium in einen sehr exotischen Aggregatzu stand bergehen mu, ein sogenanntes Bose-Einstein-Kondensat, was ebenfalls die Fhigkeit zur Supraleitung mit einschliet. Wie wir ferner aus den Forschungen von Fritz Albert Popp wissen, ist die DNS zu gleich Antenne, Supraleiter und Licht-Informationsspeicher. Die Ge schwindigkeit dieser imaginren Photonen ist schneller als die klassi sche Lichtgeschwindigkeit.

Vakuumsfluktuation Unter einem Vakuum versteht man einen Bereich der Raum-Zeit, in dem weder Teilchen noch Felder vorhanden sind. Im Vakuum entste hen (bedingt durch die Heisenbergsche Unschrferelation) zufllige und spontane Energieschwankungen, indem sich benachbarte Raumge biete gegenseitig Energie ausleihen und wieder zurckgeben. Dadurch entstehen zwangslufig Oszillationen eines physikalischen Feldes. Zum Beispiel bilden sich spontan virtuelle Photonen, die Trger der elektro magnetischen Vakuumsfluktuationen. In entsprechender Weise verkr pern virtuelle Gravitonen den Teilchenaspekt der Gravitationswellen. Viele- Welten-Theorie Dies ist eine 1957 von dem Physiker Hugh Everett vorgeschlagene Deutung der Quantenmechanik. Diese Deutung zielt darauf ab, das viel diskutierte Meproblem der Quantenmechanik zu lsen. Es handelt sich dabei um den sogenannten Zusammenbruch der Wellenfunktion. Wenn man eine Messung durchfhren will, um eine physikalische Gr e zu bestimmen, befindet sich das System vor der Messung in einem
232

Zustand, in dem alle Lsungen fr das zeitliche Verhalten des physikali schen Systems enthalten sind. Das System wird durch die SchrdingerWellenfunktion vollstndig beschrieben. Dabei ist die Quantisierung der physikalischen Gren automatisch Bestandteil der Lsungen. Die Wellenfunktion bricht bei der Messung zusammen, da nur eines der vielen wahrscheinlichen Resultate gemessen und realisiert wird. Die vorherrschende Kopenhagener Deutung der Quantenmechanik besagt, da die Wellenfunktion, in der alle Mglichkeiten enthalten sind, keine Realitt an sich darstellt. Das Quadrat des Absolutbetrags der Wellen funktion lt sich aber anschaulich beschreiben: Es gibt die Wahr scheinlichkeit des Teilchens oder des Teilchensystems an, da es sich in einem bestimmten Raumgebiet aufhlt. Uber die Eigenschaften von Teilchen werden in der Kopenhagener Deutung nur Wahrscheinlich keitsaussagen gemacht. In der Deutung der Viele-Welten-Theorie ver sucht man nun, alle anderen Me-Ereignisse, die beim Zusammenbruch der Wellenfunktion als Ballast ausscheiden, in die Realitt zu holen. Jedes mgliche Me-Ereignis existiert tatschlich, nur jeweils in einem eigenen Universum. Jede Wahlmglichkeit des Systems spaltet das Universum in voneinander unabhngige Zweige auf. Der Me-Proze stellt daher keine Wahl zwischen Me-Ereignissen dar, sondern eine Wahl zwischen Universen. Alle Mglichkeiten der Wellenfunktion werden in einem Superuniversum paralleler Welten realisiert. Zur Zeit wird die Viele-Welten-Theorie von der Mehrzahl der aktiven Physiker abgelehnt. Die Idee einer unermelichen Vielfalt von parallelen Univer sen, die fr uns physikalisch unerreichbar sind, wird von vielen Physi kern als unntiger Begriffsballast verworfen.

Virtuelle Teilchen Das sind Elementarteilchen, die spontan und extrem kurzfristig im Vakuum entstehen. Sie verdanken ihre Existenz der Heisenberg'sehen Unschrferelation. Die Teilchen entstehen paarweise und borgen sich Energie aus den benachbarten Raumgebieten. Die Unschrferelation verlangt, da sie ihre Energie schnell wieder zurckgeben, so da sie nicht eingefangen werden knnen. Die geborgte Energie wird zu

233

rckbezahlt, und die Teilchen vernichten sich. Virtuelle Teilchen lassen sich daher als Resultat von Vakuumsfluktuationen auffassen.

Weies Loch Ein Weies Loch ist das hypothetische Gegenstck eines Schwarzen Lochs. Whrend in einem Schwarzen Loch die Materie unaufhaltsam in die Singularitt kollabiert, strmt aus der Singularitt des Weien Lochs unablssig Materie in den umgebenden Raum. Welle- Teilchen-Dualismus Es ist die Beschreibung subatomarer Phnomene als Wellen und als Teilchen. Seit dem 17. Jahrhundert herrschte unter den Physikern Streit darber, ob das Licht als Welle oder als transportable Masse (Teilchen) anzusehen ist. Auf der einen Seite stand Newton, der die Teilchenhy pothese vertrat, auf der anderen Seite Huygbens, der das Licht als Wel lenbewegung deutete. Im 18. und 19. Jahrhundert schien sich mit den erfolgreichen Interferenz- und Beugungsversuchen des Lichts zunchst die Auffassung Huyghens durchzusetzen, bis Einstein 1905 in seiner Erklrung des photoelektrischen Effekts nachwies, da sich Licht auch als diskreter Strom von Photonen uern kann. Photonen bezeichnen die partikelhaften Trger der elektromagnetischen Wechselwirkung. Als um 1920 gezeigt wurde (de Broglie u.a.), da man umgekehrt auch Elektronen eine Wellenlnge zuordnen kann, wurde der WelleTeilchen-Dualismus als Beschreibung subatomarer Phnomene endgl tig anerkannt. Niels Bohr formulierte die Idee der Komplementaritt. Ein bestimmtes Geschehen, zum Beispiel Licht, kann nicht nur auf der Basis einer einzigen Vorstellung allein beschrieben werden, sondern es existiert eine dazu komplementre Beschreibung. Welle und Teilchen sind im Bereich der atomaren Grenordnungen gleichberechtigte Be schreibungsweisen. Die beiden komplementren Beschreibungen schlieen sich allerdings bei der Interpretation eines Experiments ge genseitig aus.

234

Wurmloch Ein Wurmloch ist eine tunnelfrmige Verbindung zwischen zwei weit entfernt voneinander liegenden Raumpunkten. Es stellt eine Art Abkrzung in der gekrmmten Raum-Zeit dar, indem es die Krm mung einfach umgeht. Nach der Relativittstheorie kann man Licht zwar nicht berholen, aber mit einem Wurmloch lt es sich austrick sen. Zeitdehnung Die Relativittstheorie behauptet, da bewegte Uhren langsamer ge hen als ruhende, wenn man sie vom ruhenden System aus betrachtet, das heit, fr den bewegten Beobachter verlangsamt sich der Zeitver lauf. Ist im System S die Dauer der Ereignisse gleich dt, so betrgt sie im bewegten System S* - entsprechend der Lorentztransformation dt''= dt SQRT(1- v2/c2). Zum Beispiel blieb 1971 ein Flugzeug mit einer extrem genauen CsAtomuhr 15 Stunden lang in der Luft. Die durchschnittliche Ge schwindigkeit des Flugzeugs betrug zirka 1.200 km/h, das sind etwa 0.001% von c. Nach 15 Stunden wurde eine Zeitverschiebung von 0.00000047 Sekunden gegenber einer identischen, am Boden befindli chen Uhr gemessen. Das ist genau die Gre der zu erwartenden Zeit dehnung.

235

LITERATUR- UND QUELLENVERZEICHNIS


(1) Aharonov, Y und Vaidman, Eigenschaften eines Quantensystems whrend des Zeitabstands zwischen zwei Maen, 1990 (2) Akhiezer, A. I. und Berestetskii, V. B., Elements of Quantum Electrody namics, London, Oldbourne Press. 1962 (3) Albert David Z., David Bohms Quantentheorie, Spektrum der Wissen schaft, Juli 1994 (4) Alvager, T. und Kreisler, M. N., Quest for faster-than-light particles, Phys. Rev. 171, 1968 (5) Kluwer Assis, A. K. T. und Graneau, P., Nonlocal Forces of Inertia in Cosmology, Found, of Physics, 26, 271. 1996 (6) Arendes, Lothar, Anstze zur physikalischen Untersuchung des Leib-SeeleProblems, 1996; http://home.t-online.de/home/Lothar.Arendes/index.htm (7) Aspect, A. und Gragier P., Experiments on Einstein-Podolsky-Rosen type correlations with pairs of visible photons, in: Quantum theory of measure ment. Eds. Wheeler J.A., Zurek WH. Princeton University Press, 1983 (8) Attolini, M. R.; Galli, M. und Castagnoli, G. C., On the Rz-sunspot relati ve number variations, Solar Physics, 95, 1985 (9) Bai, T. und Sturrock, P. A., The 154-day and related periodicities of solar activity as subharmonics of a fundamental period, Nature 350, 141-143. 1991 (10) Bauer, E., Theoretical Biology, Moscow-Leningrad, IEM, in Russian (1967, in Hungarian). (11) Bauer, E. und Borsdyko, S., Mutations and the Structure of Living Matter, Biodynamica, No. 14, 1-8. 1936 (12) Bayles, Jerry, Electrogravitational Mechanics, wwvv.electrogravity.com (13) Bearden, T.E., Gravitobilogy -The New Biophysics, Tesla-BookCompany, Box 121873, Chula Vista, CA 91912, 1991. (14) Beck, F. und Eccles, J.C., Quantum aspects of brain activity and the role of consciousness, Proc. Natl. Acad. Sei. USA 89(23):11357-11361. 1992 (15) Becker, Robert O., The Effect of Magnetic Fields upon the Central Nervous System, Biological Effects of Magnetic Fields, Vol. 2, pp. 207-214. (16) Bloc Immanuel, Hnsch Theodor W., Esslinger Tilman, Wenn Materie Quantenwellen schlgt, Spektrum der Wissenschaft, Juli 2000 (17) Bogen, Joseph E., The Other Side of the Brain: An Appositional Mind, in

236

(18) (19) (20)

(21) (22) (23)

(24)

(25) (26) (27) (28) (29) (30) (31) (32) (33) (34)

Robert Ornstein (ed.), The Nature of Human Consciousness, San Francis co, W H. Freeman, 1973 Bohm, D., Physics and the Ultimate Significance of Time, ed. by D. R. Griffin, State Univ. of New York Press, 1986 Boyer, T. H., Classical Statistical Thermodynamics and Electromagnetic Zero Point Radiation, Phys. Rev. Vol. 186, 1304-1318. 1969 Breithaupt, H., Biological Rhythms and Communications, in Electroma gnetic Bio-Information, eds. 1989 Burr, H. S. und Northrop, E. S. C., The Electrodynamic Theory of Life, Quart. Rev. Biol. 10, 322. 1935 Calvet, Carlos, Hyperraum - Die Beherrschung von Raum und Zeit, Argo-Verlag, 2002 Cassidy, David C., Werner Heisenberg und die Quantenrevolution, Spektrum der Wissenschaft, Juli 1992 Chiao Raymond Y.; Kwiat Paul G. und Steinberg Aephraim M., Quan tenphnomene schneller als Licht?, Spektrum der Wissenschaft, Oktober 1993 Chalmers, D., Facing up to the problem of consiousness. In: Toward a Science of Consciousness - The First Tucson Discussions and Debates, S.R. Hameroff, A. Kaszniak und A.C. Scott (eds.), MIT Press, Cambridge, MA. 1996 Chalmers, D., Toward a Theory of Consciousness, Springer-Verlag, Ber lin 1996 Charon, Jean E., Der Geist der Materie, Ullstein, 1988 Charon, Jean E., Theorie de la Relativite complexe, Albin Michel, 1977 Conley, Charles C., Effects of Near-Zero Magnetic Fields on Biological Systems, Biological Effects of Magnetic Fields, Vol.2. Cramer J. G., Transactional Deutung der Quantenmechanikerberichte moderner Physik, 1986 Crick, F. & Koch, C., Towards a neurobiological theory of consciousness, Seminars Neurosci., 2, 263-275, 1990 Cramer J. G., The transactional interpretation of quantum mechanics. Rev. Morden Physics, 58, 647-688, 1986 Davies, Paul, Mehrfachwelten, Diederichs 1981 Dicke R.H., Coherence in spontaneous radiation processes, Phys.Rev. 93, 99, 1954 Dirac P, The principles of quantum mechanics, Claredon press, Oxford, 1958 237

(35) Deutsch, David und Lockwood, Michael, Quantenphysik der Zeitreise, r Spektrum der Wissenschaft, November 1994 (36) Dubrov, Alexander P., Biogravitation et Psychotronique, Impact, Science et Societe, UNESCO XXIV, Nr. 4.1974 (37) Dull, T. und Dull, B., ber die Abhngigkeit des Gesundheitszustandes von pltzlichen Eruptionen auf der Sonne und die Existenz einer 27 tgigen Pe riode in den Sterbefllen, Virchows Archiv, No. 293, 1934. This study is summarized in Michel Gauquelin, The Scientific Basis of Astrology, New York, Stein and Day, 1969 (38) Dulnev G.N., Registration of phenomena of psychokinesis by means of ma gnetic devices (39) Physicist in parapsychology, Essays, Hatrol, Moscow, 2002 (40) Dzang Kangeng Yu.V., Bioelectromagnetic fields as a material carrier of biogenetic information, Aura-Z, 1993 (41) Eberlein C., Sonoluminescence as quantum vacuum radiation, Phys. Rev. Lett. 3842, 1996 (42) Eckhorn, R.; Bauer, R.; Jordan, W; Brosch, M.; Kruse, W; Munk, M. und Reitboeck, H. J., Coherent oscillations: a mechanism of feature linking in the visual cortex?, Biol. Cybern., 60, 121-130, 1988 (43) Einstein A., Collection of works, Nauka, Moscow (in Russian), 1965 (44) Einstein A.; Podolsky B. und Rosen N. Phys., Rev. 47, 777-787, 1935 (45) Eccles, John C., How the Self Controls its Brain, Springer-Verlag, Ber lin, 1994 (46) Eccles, John C., Persnliche Mitteilung, Internationale Tagung der Temple-Universitt, Bermudas 1992 (47) Eccles, John C., Facing Reality, New York, Springer-Verlag, 1970 (48) Elitzur, Time and consciousness: The uneasy bearing of relativity theory on the mind-body problem, in: Toward a Science of Consciousness - The First Tucson Discussions and Debates, S.R. Hameroff; A. Kaszniak und A.C. Scott (eds.), MIT Press, Cambridge, MA. 1996 (49) DeAquino, Fran., Gravitational Spacecraft, www.elo.com.br/~deaquino/ (50) Delgado, Jose, Die experimentelle Gehimforschung und die Verhaltens weise, Endeavour Jg. 69, 1967 (51) Derbyshire, Stuart, Mind over matter, examines the latest debate about what shapes human consciousness, October 1994 www.junius.co.uk/LM/LM72/LM72__ Books.html (52) Esfeld, Michael, Der Holismus der Quantenphysik, Philosophia Naturalis 36,1999 238

(53) Everett, H., Relative state formulation of quantum mechanics, in Quan tum Theory and Measurement, J.A. Wheeler und W.H. Zurek (eds.), Princeton University Press (54) Englert, Berthold; Georg, O.; Scully, Marian und Walther, Herbert, Komplementaritt und Welle-Teilchen-Dualismus, Spektrum der Wissen schaft, Februar 1995 (55) Everett, Hugh, The Many-Worlds Interpretation of Quantum-Mechanics, Princeton, N.J., University Press 1973 (56) Feinberg, G., Possibility of faster-than-light particles, Phys. Rev. 159, 1089, 1967 (57) Feynmann, Richard P., Sechs physikalische Fingerbungen, Piper 1995 (58) Feynmann, Richard P, QED -Die seltsame Theorie des Lichts und der Materie, Piper, 1997 (59) Feynman, R. P, Space-time approach to quantum electrodynamics, Phys. Rev. 76, 769, 1949, (60) Feynman, R. P, Theory of Fundamental Processes, 1961 (61) Feynman, R. P, Leighton, R. B., Sands, M., The Feynman Lectures on Physics, 1963 (62) Feynman, R. P, QED - the strange theory of light and matter, Penguin Books, 1985 (63) Fleming, G. und Butterfield, J., Is there superluminal causation in quantum theory?, International Conference on Bells Theory and the Foundation of Modern Physics, World Scientific, 203-207, 1992 (64) Fredericks K., The photographic detection of tachyons in human body ra diation, Journal of Nonlocality und Remote Mental Interaction, 2002 (65) Freedman, D. Z.; Schramm, D. N. und Tubbs, D. L., The weak neutral current and its effect in stellar collapse, Ann. Rev. Nucl. Sei. 27,167-207, 1977 (66) Friedman, Howard; Becker, Robert O. und Bachman, Charles, Geoma gnetic Parameters and Psychiatric Hospital Admissions, Nature, 200, No vember 16, 1963 (67) Friedman, Howard; Becker, Robert O. und Bachman, Charles H., Psych iatric Ward Behavior and Geophysical Parameters, Nature, 205, March 13, 1965 (68) Friedman, Howard; Becker, Robert O. und Bachman, Charles H., Effect of Magnetic Fields on Reaction Time Performance, Nature, 213, March 4, 1967

239

(69) Frhlich, Fi., Long-range coherence and energy storage in biological sy stems, Int. J. Quantum Chem. 2:641-9, 1968 (70) Frhlich, H., Long range coherence and the actions of enzymes, Nature ' 228:1093,1970 (71) Frhlich, H., The extraordinary dielectric properties of biological materials and the action of enzymes, Proc. Natl. Acad. Sei. 72:4211-4215, 1975 (72) Frolov, Alexabder V., Resonance Effects, www.patrak.com/ine/NEN4-86.html (73) Gariaev P, Birstein B., Iaroshenko A., Marcer E, Tertishny G., Leonova K., Kaempf U., The DNA-wave biocomputer, International J. Computing Anticipatory Systems. Ed. by D. Dubois, 2001 (74) Gariaev PP, Tertishny G.G., Iarochenko A.M., Maximenko V.V, Leonova E.A., The spectroscopy of biophotons in non-local genetic regulation, Jour nal of Nonlocality and Remote Mental Interaction, 2002; www.emergentmind.org/ gariaevI3.htm (75) Goswami, A., The Self-Aware Universe: How Consciousness Creates the Material World, Tarcher/Putnam, New York, 1993 (76) Gutzwiller, Martin C., Quantenchaos, Spektrum der Wissenschaft, Mrz 1992 (77) Gurvich, A.G., Selected works, 1977 (78) Grandpierre, Attila, in Theoretical problems in Stellar Stability and Oscil lations, eds. A. Noels und M. Gabriel, 48, 1984 (79) Grandpierre, Attila, The Universe as a Living System, in Forras 1988, No. 2 (in Hungarian) 1988 (80) Grandpierre, Attila, How is working the Sun?, Solar Physics, Vol. 128, p. 3, 1990 (81) Grandpierre, Attila, A pulsating.-ejecting solar core model and the solar neutrino problem, Astronomy and Astrophysics, Vol. 308, 199, 1996 (82) Grandpierre, Attila, The Physics of Collective Consciousness, World Futu res, Vol. 1997 (83) Greiner, W, Theoretische Physik, Bd. 6: Relativistische Quantenmechanik: Wellengleichungen, Frankfurt a. M, 1987 (84) Grof, Stanislav, Topographie des Unbewuten, Klett-Cotta 1978 (85) Gurwitsch Conference, Moscow, Sept. 28.-Oct. 4. Non Equilibrium and Coherent Systems in Biophysics, Biology and Biotechnology (86) Haken, H., Synopsis and Introduction, in: E. Basar, H. Flohr, H. Haken Sc A.J. Mandell (Hg.), Synergetics of the Brain, 3-25, Berlin, 1983 (87) Haken, H., Synergetik -Eine Einfhrung, Berlin, 1990 240

(88) Haken, H. und Haken-Krell, M., Erfolgsgeheimnisse der Wahrnehmung, Stuttgart, 1992 (89) Hameroff, Stuart und Penrose, Roger, Conscious Events as Orchestrated Space-Time Selections, www.u.arizona.edu/~hameroff/conscov.html (90) Hameroff, S.R.; Dayhoff, J.E.; Lahoz-Beltra, R.; Samsonovich, A. und Rasmuen, S., Conformational automata in the cytoskeleton: models for molecular computation, IEEE Computer (October Special Issue on Mo lecular Computing) 30-39, 1992 (91) Hameroff, S.R. und Penrose, R., Orchestrated reduction of quantum co herence in brain microtubules: A model for consciousness, Neural Net work World 5 (5) 793-804, 1995 (92) Hameroff, S.R. und Penrose, R., Orchestrated reduction of quantum co herence in brain microtubules: A model for consciousness, in: Toward a Science of Consciousness - The First Tucson Discussions and Debates, S.R. Hameroff; A. Kaszniak und A.C. Scott (eds.), MIT Press, Cambridge, MA, 1996 (93) Haroche, Serge und Raimond, Jean-Michel, HohlraumQuantenelektrodynamik, Spektrum der Wissenschaft, Juni 1993 (94) Heim, Burkhard, Postmortale Zustnde, Resch-Verlag, 1980 (95) Held, Werner, Quantentheorie der Information, 2001, http://people.freenet.de/soleil7 nicht mehr online - Artikel auf neuer Seite:

http://www.werner-held.de/images/stories/pdf/qm-info.pdf (96) Held, Werner, Die 1 und die 2. Beobachtung als bergang vom EinsSein in die Dualitt in informationstheoretischen und systemtheoretischen Anstzen, http://www.werner-held.de/images/stories/pdf/12.pdf (97) Herrmann, Dieter B., Antimaterie - Auf der Suche nach der Gegenwelt, C.H.Beck, 1999 (98) Hey, Tony und Walters, Patrick, Quantenuniversum - Die Welt der Wellen und Teilchen, Spektrum der Wissenschaft, 1990 (99) Holler, Johannes, Das neue Gehirn, Bruno Martin, 1985 (100) Horgan, John, Quantenphilosophie, Spektrum der Wissenschaft, Sep tember 1992 (101) Hovis, R. Corby und Kragh, Helge, Paul Dirac und das Schne in der Physik, Spektrum der Wissenschaft, Juli 1993 (102) Hoyle, Fred, Astronomy and Cosmology -A modern course, W H. Free man and Company, San Francisco, 1975 (103) Hoyle, Fred, The Intelligent Universe Kortvelyessy, 1983 241 (104) Huxley, Aldous, Die Pforten der Wahrnehmung, Piper 1956

(105) Jibu, M.; Hagan, S.; Hameroff, S.R.; Pribram, K.H. und Yasue, K., Quantum optical coherence in cytoskeletal microtuhules: implications for brain function, BioSystems 32:195-209, 1994 (106) Jibu, M.; Yasue, K. und Hagan, S., Water laser as cellular vision, sub mitted, 1995 (107) Karolhazy, F.; Frenkel, A. und Lukacs, B.; On the possible role of gra vity on the reduction of the wave function, In Quantum Concepts in Space and Time, R. Penrose und C.J. Isham (eds.), Oxford University Press, 1986 (108) Korotaev, S.M.; Serdyuk V.O. und Sorokin M.O., Experimental verifica tion of Kozyrev's interaction of natural processes, Galilean Electrodyna mics, 2000 (109) Korotkov, K.G., Registration of biofield influence on a gas-discharge de tector, in dem Buch Physicist in parapsychology, Essays, Hatrol, Moscow, 2002 (110) Kaivarainen, A., Hierarchic theoiy of matter, general for liquids and solids: ice, water and phase transitions, American Institute of Physics Confe rence Proceedings, 2001 (111) Kaivarainen, A., Bivacuum, sub-elementary particles and dynamic model of corpuscle-wave Duality, CASYS: International Journal of Computing Anticipatory Systems, 2001 (112) Kaivarainen, A., New Hierarchic theory of water and its role in biosystems. The quantum Psi Problem, Proceedings of the International conference: Energy and informational transfer in biological systems: How physics could enrich biological understanding, F. Musumeci, L.S. Brishik, M.W Ho (editors), World Scientific, 2003 (113) Kaivarainen, A., New Hierarchic theory of water and its role in biosystems. Bivacuum mediated time effects, electromagnetic, gravitational & mental interactions, http://www.karelia.ru/~alexk/new_articles/index.html, und in Electronic library of Temporology Institute (Moscow University), http://www.chronos.msu.ru/relectropublications.html, 2003 (114) Kaivarainen, A., Unified Theory of Bivacuum, Particles Duality, Fields & Time, New Bivacuum-Mediated Nonlocal Interaction. In the archives of Los-Alamos, Quantum Physics Research. NOVA Science, ed F. Co lumbus and V. Krasnoholvets, 2004 (115) Kaku, Michio, Hyperraum - Eine Reise durch Zeittunnel und Paralleluniversen, Rowohlt-Science, 2002

242

(116) Kaznatcheev, V. und Trofimov, A., Die Wirkungen morphogenetiscber Felder in einem Modellraum, International Institut of Cosmic Anthropoecology, Moscau, 1999 (117) Kholodov, Yurij A., Electromagnetic Fields and the Brain, Impact: of Science on Society, 24(4), October 1974, 291-297. Kholodov is one of the Soviet researchers in the area of biomagnetic interactions. This issue of Impact, published by UNESCO, was devoted to the international developments in the parasciences. (118) Kholodov, Yuri, The Brain and the Magnetic Field, Journal of Paraphy sics, 6(4), 1972 (119) Kim, H.; Jensen, C.G. und Rebhund, L.I., The binding of MAP2 and tau on brain microtubules in vitro. In pp 218-239. Dynamic Aspects of Microtubule Biology, D. Soifer (ed.), Ann. NY Acad. Sei. 466, 1986 (120) Kirshivink, Joseph L.; Kobayashi-Kirshivink, Atsuko und Woodford, Barbera J., Magnetite Biomineralization in the Fluman Brain, Procee dings of the National Academy of Science, 89 7683-7687, 1992 (121) Kivelson, Steven; Lee Dung-Hai und Zhang Shou-Cheng, QuantenHall-Effekt und Supraleitung, Spektrum der Wissenschaft, Mai 1996 (122) Koegler, R. R.; Hicks, S. M.; Rogers L. und Barger, J. H., A Preliminary Study in the Use of Electrosleep Therapy in Clinical Psychiatry, in Nor man L. Wulfson (ed.), The Nervous System and Electric Currents, New York, Plenum Press, 1970 (123) Korotaev, S.M.; Serdyuk, V.O.; Sorokin, M.O. und Abramov, J.M., Geo physical manifestation of interaction of the processes through the active pro perties of time, Physics and Chemistry of the Earth, 1999 (124) Kotov, V A., The 160 minutes oscillations, Solar Physics, 100, 1985 (125) Kotov, V A., From solar oscillations to restrictions on standard cosmology, 4th SOHO Workshop, Helioseismology, 1995 (126) Kozyrev, N.A., Selected Works, Leningrad (auf Russisch) 1991 (127) Krolhzy, F.; Frenkel, A. und Lukacs, B., On the possible role of gravity on the reduction of the wave function, In Quantum Concepts in Space and Time, R. Penrose und C.J. Isham (eds.), Oxford University Press, 1986 (128) Krueger, A. P und Kotaka, S., The Effects of Air Ions on Brain Levels of Serotonin in Mice, International Journal of Biometeorology, 13(1), 1969 (129) Kudo, T.; Tada, K.; Takeda, M. und Nishimura, T., Learning impair ment and microtubule-associated protein 2, (MAP2) decrease in gerbils under chronic cerebral hypoperfusion, Stroke 21:1205-1209, 1990 243

(130) Kgler, Peter, Quantentheorie, Bewutsein und, Willensfreiheit, WTVw.aurora-magazin.at/wissenschaft/phil_kuegler_druck.htm (131) Kppers, Bernd-Olaf, Der Ursprung biologischer Information, 2. Aufla ge, Mnchen 1990 (132) Kwiat, Paul; Weinfurter, Harald und Zeilinger, Anton, Wechselwir kungsfreie Quantenmessung, Spektrum der Wissenschaft, Januar 1997 (133) Lambeck, K., The Variable Rotation of the Earth, Cambridge University Press, 1980 Lausch, Erwin, Manipulation - Der Griff nach dem Gehirn - Methoden, Resultate, Konsequenzen der Gehirnforschung, Rowohlt 1974 (134) Libet, Benjamin, Sekundenphnomen, www.hia.com/hia/pcr/wolf/libet.html (135) Libet, B.; Wright, E.W. Jr.; Feinstein, B. und Pearl, D.K., Subjective referral of the timing for a conscious sensory experience, Brain 102:193224,1979 (136) Lilly, John, The Scientist and The Deep Self und Im Zentrum des Zyklons und The Scientist, auf Deutsch: Der Scientist, Basel, Sphinx 1984 (137) Lipkind, M., Definition of Consciousness, Integrative Biophysics (F. A. Popp und L. Beloussov, eds.), Kluwer Academic Publishers, Dordrecht-Boston-London, 2002 (138) Lloyd, Seth, Quantencomputer, Spektrum der Wissenschaft, Dezember 1995 (139) Lbsack, Theo, Die manipulierte Seele, DTV 1981 (140) v. Holst, E., Vom Wirkungsgefge der Triebe, Die Naturwissenschaften
Jg. 47, 1960

(141) Longo, Angela, To Sleep; Perchance to Dream? -A Neurochemical Study of the States of Sleep, unpublished paper, 1971 (142) Lyre, Holger, Homepage mit verschiedenen Texten und Erluterungen zur Ur-Theorie ist zu finden unter: www.ruhr-uni-bochum.de/philosophy/staff/lyre.htm (143) Lyre, Holger, Die Quantentheorie der Information, Springer Akademi scher Verlag, Berlin 1998 (144) Mach, E., Analyse der Empfindungen, ]ena, 1903 (145) von der Malsburg, C., The Correlation Theory of Brain Function, Inter nal Report of Max-Planck-Institute for Biophysical Chemistry, Gt tingen, Dept. Neurobiology, 81-2, Gottingen, 1981 (146) Marshall, I.N., Consciousness and Bose-Einstein condensates, New Ideas in Psychology 7:73 83, 1989 244

(147) Mender, D., The Myth of Neuropsychiatry: A Look at Paradoxes, Physics, and the Human Brain, New York, 1994 (148) Metzinger, Thomas, Conscious Experience, www.zynet.co.uk/imprint/ce.html (149) Mller, Hartmut, Global Scaling, raum&zeit (150) Murch, G. M. und Woodworth, G. L., Wahrnehmung, Stuttgart, 1977 (151) von Neumann, J., Mathematische Grundlagen der Quantenmechanik, Berlin, 1986 (152) Murphy, Todd, The Production of Consciousness out of States of Con sciousness, www.jps.net/brainsci (153) Naranjo, Claudio, Die Reise zum Ich, Fischer 1979 (154) Niedermeyer, E. und Lopes da Silva, F., Electroencephalography: Basic Principles, Clinical Applications and Related Fields, BaltimoreMnchen, 1987 (155) Norden, Bengt. und Ramel, Claes., Interaction Mechanisms of LowLewel Electromagnetic Fields in Living Systems, Oxford Science Publi cations, 1992 (156) Norretranders, Tor, Spre die Welt - Die Wissenschaft des Bewutseins, Science Sachbuch, Rowohlt 2000 (157) Ornstein, Robert, Die Psychologie des Bewutseins, Fischer 1976 (158) Penfield, W. und Roberts, L., Speech and Brain-Mechanisms, Princeton, 1959 (159) Pearce, Joseph Chilton, The Biology of Transcendence, Park Street Press, 2002 (160) Pearle, P., Combining stochastic dynamical state vector reduction with spontaneous localization, Phys. Rev. D. 13:857-868, 1989 (161) Pearle, P. und Squires, E., Bound-state excitation, nucleon decay experi ments and models of wave-function collapse, Phys. Rev. Letts. 73(1): 15, 1994 (162) Peggy Phoenix Dubro und David P. Lapierre, Potenziale der inneren Kraft, Koha Verlag, 2002 (163) Penfield, Wilder, Mystery of the Mind, Princeton, Princeton University Press, 1975 (164) Penrose, Roger, Schatten des Verstandes, Oxfordpress, 1994 (165) Penrose, R., Quantum theory and reality. In 300 Years of Gravity S.W. Hawking und W. Israel (eds.), Cambridge University Press, 1987 (166) Penrose, R., The Emperor's New Mind, Oxford Press, U.K. 1989

245

(167) Penrose, R., Gravity and quantum mechanics - in General Relativity and Gravitation. Proceedings of the Thirteenth International Confe rence on General Relativity and Gravitation held at Cordoba, Argentina 28 June-4 July 1992. Part 1: Plenary Lectures (eds. R.J. Gleiser, C.N. Kozameh und O.M. Moreschi) Institute of Physics Publications, Bristol, 1993 (168) Penrose, R., Shadows of the Mind, Oxford Press, Oxford, U.K. 1994 (169) Penrose, R., On gravity's role in quantum state reduction, 1995 (170) Penrose, R. und Hameroff, S.R., What gaps?, Journal of Consciousness Studies 2 (2) :99-112 (171) Persinger, Michael A., The Paranormal: Part I - The Patterns, New York, MSS Information, 1974. (172) Persinger, Michael A., Psi Phenomena and Temporal Lobe Activity: The Geomagnetic Factor, in L. A. Henkel & R. E. Berger (eds.), Research in Parapsychology 1988, Metuchen, NJ, Scarecrow Press, 1989 (173) Persinger, Michael und Schaut, G. B., Geomagnetic Factors in Subjective Telepathie, Precognitive and Post-Mortem Experiences, Journal of the American Society for Psychical Research, 82,1988 (174) Persinger, Michael, ELF Waves and ESP, New Horizons, 1 (5), January 1975 (175) Peters, J., Einfhrung in die Allgemeine Informationstheorie, Springer, Berlin-Heidelberg 1967 (176) Poponin, V., The DNA phantom effect: direct measurement of a new field in thevaeuum substructure,]. Nanobiology, accepted, 1998 (177) Popp, F. A., Summer School about Consciousness, Academy of Con sciousness Studies, Princeton University, June 26-July 9,1994 (178) Popp, F. A., Evolution as the Expansion of Coherent States, The Interrela tionship Between Mind and Matter (B.Rubik ed.), Center of Frontier Sciences, Temple University, Philadelphia, Marketing Graphics, Sout hampton, PA,1992 (179) Popp, F. A. und Zhang, J.J., Mechanism of interaction between electromagnetic fields and living organisms, Science in China (Series C), 43, 2000 (180) Popp, F.A., Leben als Sinnsuche, Elemente des Lebens (H.-P Drr, F.A. Popp und W. Schommers (Hrsg.)), Die graue Edition, Kusterdingen
2000

(181) Popp, F.A. und Yan,Y., Delayed luminescence of biological systems in terms of coherent states, Phys. Lett. A 293, 2002 (182) Popper, Karl R., und Eccles, John C., The Seif and Its Brain, London, 246

Routledge und Kegan Paul, 1983 (183) Posdzech, Olaf, Protosimplex, Burkhard Heim, http://people.blinx.de/behemoth/protosimplex/protosimplex_d.htm (184) Presman, A. S., Electromagnetic Fields and Life, trans. by F. L. Sinclair, ed. by F. A. Brown. New York, Plenum Press, 1970 (185) Puschkin, Veniamin, Bestehen Zusammenhnge zwischen Biogravitation und Psychokinese? Vorabdruck aus Ideen des exakten Wissens in: Zeit schrift fr Parapsychologie und Grenzgebiete der Psychologie, 1974 (186) Rafelski, J. und Mller, B., Die Struktur des Vakuums: Ein Dialog ber das Nichts, Frankfurt a. M, 1985 (187) Rakovic, Dejan, Prospects for Conscious Brain-Like Computers: Biophysikal Faculty of Electrical Engineering, Belgrade University P.O.Box 816, 11001 Belgrade, Yugoslavia, mailto:rakovic@buef31.etf.bg.ac.yu (188) Rasmuen, S.; Karampurwala, H.; Vaidyanath, R.; Jensen, K.S. und Hameroff, S., Computational connectionism within neurons: A model of cytoskeletal automata subserving neural networks, Physica D 42:428-449, 1990 (189) Rein, G., The topology of consciousness, in TUCSON III conference on consciousness, 1998 (190) Roth, Gerhald, Fhlen, Denken, Fiandeln, Suhrkamp, 2001 (191) Russell, Bertrand, Mind and Matter, in Portraits From Memory, New York, Simon and Schuster, 1956 (192) Ruth, B., in Electromagnetic Bio-Information, eds. F.-A. Popp et al., 2nd Edition, Urban and Schwarzenberg, 128-143, 1989 (193) Sarfatti, Jack, Theory of Brain Quantum Mechanics an Superstrings by D.V. Nanopoulos of the Center for Theoretical Physics, Department of Physics Texas A&M University, www.hia.com/pcr/nanopoul.html (194) Sarfatti, Jacob (Jack), Ph.D., Progress in Post-Quanten Theory, www.qedcorp.com/pcr/index.html, 7.08.1999. (195) Sassaroli, E.S., Srivatava,Y, Swain, J. und Widom, E., Macroscopic Quan tum Coherence, World Scientific, Singapore-New Jersey, 1998 (196) Schneider, J., Time, the mind/body problem and the semiotic state vector collapse in quantum mechanics, Abstract No. 749,2001 (197) Schrdinger, E., Mind and Matter, Cambridge, at the University Press, p. 37, 1958 (198) Schtter, Erik, Modelling the cerebellar Purkinje Cell, De Division of Biology, California Institute of Technology, Pasadena, CA 91125, USA. Published in Progress in Brain Research 102: 417-431.1994 247

http://kuifje.bbf.uia.ac.be/TNB/TNB_pub9.html (199) Senkowski, Ernst, Mentale Unterdrckung des Radioempfangs, Transkommunikation: www.rodiehr.de/a_24_itk_g_43.htm (200) Senkowski, Ernst, Instrumentelle Transkommunikation, ISBN 3-89501254-8 (201) Sheldrake, Rupert, Morphogenetische Felder, www.sheldrake.org (202) Shimony, A., The reality of the quantum world. Scientific American, 258(1), 1988 (203) Shnoll, S.E., The form of the macroscopic fluctuation spectra depends on the Earth rotation, Biophysics, 1995 (204) Shnoll, S.E.; Zenchenko, T.A.; Zenchenko, K.I.; Pozharskii, V.A.; Kolombet V.A. und Kondradov A.A., Regular variation of the fine structure of statistical distributions as a consequence of cosmophysical agents, Uspekhi Fizicheskikh Nauk, Russische Akademie der Wissenschaften
2000

(205) Sidorov, L., The Imprinting and Transmission of Mentally-Directed Bioinformation,]N\JlMl 1(1) January 2002, www.emergentmind.org/sidorov_II.htm (206) Sinha, K.E; E.C.G. Sudarshan und J.P Vigier, Superfluid Vacuum Car rying Real Einstein-deBroglie Waves, Phys. Lett. Vol. 114A, 298-300, 1986 (207) Smith, T., Compton Radius Vortex, www.innerx.net/personal/tsmith/TShome.html (208) Sperry, R.W., The Great Cerebral Commissure, Scientific American, 210, p. 42, 1964 (209) Sperry, R.W., Das Holistische des Mentalen, 1976 (210) Sperry, R.W., Mental Phenomena as Causal Determinants in Brain Func tion, in G. G. Globus, G. Maxwell & I. Savodnik (eds.), Consciousness and the Brain. New York, Plenum, 1976 (211) Stapp, H.P, Mind, matter and quantum mechanics, New York, SpringerVerlag, 1982 (212) Stapp, H.P, Quantum propensities and the brain-mind connection, Foun dations of Physics, Vol. 21, 12, p. 1451, 1991 (213) Stapp H.P, Why classical mechanics cannot naturally accommodate conciousness but quantum mechanics can?, Psyche, May 1995, 2(5), 1995 (214) Strzempa-Depre, Michael, Die Physik der Erleuchtung, Goldmann, 1988 (215) Susskind, Leonard, Vernichten Schwarze Lcher Information?, Spektrum der Wissenschaft, Juni 1997 248

(216) Szent-Gyrgyi, A., Introduction to a Submolecular Biology, Acad. Press, New York/London, 1960 (217) Tart, Charles T., On Being Stoned: A Psychological Study of Marijuana Intoxication, Science and Behavior Books, 1971 (218) Tegmark, Max, Spektrum der Wissenschaft, August 2003 (219) Tegmark, Max und Wheeler, John Archibald, 100 fahre Quantentheorie, Spektrum der Wissenschaft, April 2001 (220) THE MONROE INSTITUTE OF APPLIED SCIENCES: The HemiSync Process, Bulletin, Faber/Virginia 22938 USA, Box 175 (221) Tiller, WA.; Dibble WE.,Jr. und Kohane, M.J., Conscious Acts of Creati on: The emergence of a new physics, Pavior Publishing, Walnut Creek, CA, USA, 2001 (222) Tiller, William A., Science and Human Transformation -Subtle Ener gies, Intentionality and Consciousness, Pavior Publishing, Walnut Creek, CA, 1997 (223) Vigil, Estrada Juan und Masperi, Luis, Dynamic Cosmological Constant and Relations among Pseudo Goldstone Bosons, hep-ph/9710522, 29 Oct 1997 (224) Von Campenhausen, C., Die Sinne des Menschen, Bd I: Einfhrung in die Psychophysik der Wahrnehmung, Stuttgart, 1981 (225) Von Ludwiger, Illobrand, Heim'sche einheitliche Quantenfeldtheorie, Resch-Verlag 1981 (226) Vos, M.H.; Rappaport, J.; Lambry J. Ch.; Breton, J. und Martin, J.L., Visualization of coherent nuclear motion in a membrane protein by fem tosecond laser spectroscopy, Nature 363:320-325 (227) Vujiein, P, States of consciousness in esoteric practice, in D. Rakovic and D. Koruga, eds., Consciousness: Scientific Challenge of the 21st Centu ry, 1995 (228) Wagner, Waltraud, Geist, Energie und Form, Tattva Viveka, Ausgabe Nr. 14 (229) Walleczek, J., Magnetokinetic effects on radical pairs: a possible paradigm for understanding sub-kT magnetic field interactions with biological sy stems, in Biological Effects of Environmental Electromagnetic Fields. M. Blank (ed) Advances in Chemistry No 250 American Chemical so ciety Books Washington D.C., 1995 (230) Warnke, Ulrich, Die geheime Macht der Psyche, Popular Academic Verlags-Gesellschaft, 1998

249

(231) Warnke, Ulrich, Gehim-Magie, Popular Academic VerlagsGesellschaft, 1997 (232) Waser, Andre, Der ther in der Naturwissenschaft www.safeswiss.org/infobereich/Publikationen/ waser/ aetherindernatur =wissenschaft.htm (233) Wasserburg, G. J.; Busso, M. und Gallino, R., Abundances of actinides and shortlived nonactinides in the interstellar medium -diverse superno va sources for the r-process, Astrophys. J. 466, L109, 1996 (234) Wassiliew, L. L., Experimentelle Untersuchungen zur Mentalsuggestion, 1965 (235) Wheeler, John Archibald, Einsteins Vision, Springer 1968 (236) Wheeler, J. A. und Feynman, R. P, Interaction with the absorber as the mechanism of radiation, Rev. Mod. Phys. 17, 157, 1945 (237) Whitehead A. N., Process and Reality, corrected edition, edited by D.R. Griffin and D. W Sherburne, the Free Press, New York, 1978 (238) Wigner E. P, Remarks on the mind-body question, in: The Scientist Spe culates, I. J. Good, ed., W Heinemann, London, pp. 284-302, 1961 (239) Wigner E. P, Symmetries and Reflections, Indiana University Press, Bloomington, 1967 (240) Wilber, Ken, The Atman Project, Quest, Wheaton, IL, 1980 (241) Yam, Philip, Das zhe Leben von Schrdingers Katze, Spektrum der Wis senschaft, November 1997 (242) Wheeler, J.A., Assessment of Everett's relative state formulation of quantum theory, Revs. Mod. Phys., 29:463-465, 1957 (243) Wheeler, J.A.; Information, physics, quantum: The search for links, in (W. Zurek, ed.) Complexity, Entropy, and the Physics of Information. Addison-Wesley, 1990 (244) Wilson, Robert Anton, Cosmic Trigger, 1986 (245) Wolf, Johannes E., Quantum Metaphysics http://home.sprynet.com/sprynet/jowolf (246) Zazerskiy, Alexander, From the Field Model of the Electron to the Unifield Theory, www.ltn.lv/~elefzaze (247) Zioutas, K., On the living matter sensitivity to dark matter, CERN-PPE, 1991 (248) Zioutas, K., Bioluminescence as a Signature for Dark Matter Reactions, in Current Development in Biophysics, eds., 1992 (249) Zioutas, K., Evidence of dark matter from biological observations, Phys. Lett. B 242, 257, 1990 250

Um sich im Internet weiter ber Burkhard Heim zu informie ren, so bieten sich folgende Webseiten an:
Protosimplex - Die Ideen von Burkhard Heim http://people.blinx.de/behemoth/protosimplex/protosimplex_d.htm IGW - Institut fr Grenzgebiete der Wissenschaft Burkhard Heim, Einheitliche Beschreibung der Welt und weiteres http://news.uibk.ac.at/c/ cb/cb26/081 .html DATADIWAN - Werner Held Burkhard Heim, Elementarstrukturen der Materie, www.datadiwan.de/heim

Zustzliche Literatur zur Quantentheorie:


von Heisenberg, Werner, Quantentheorie und Philosophie, Vorlesungen und Aufstze; Herausgeber Jrgen Busche, Reclam, Universal-Bibliothek Nr.9948 72g, ISBN 3-15-009948-X Bearden, Tom E., Giant Negentropy in the Common Dipole, Proc. IC-2000, St. Petersburg, Russia, 2000 Penrose, Roger und Hameroff, Stuart, What,Gaps'? Journal of Consciousness Studies 2, 99-112, 1995 Eccles, John C., Wie das Selbst sein Gehirn steuert, Mnchen, Piper 1994 Libet, Benjamin; Gleason, Curtis A.; Wright, Elwood W. und Pearl, Dennis K., Time of Conscious Intention to Act in Relation to Onset of Cerebral Acti vity (Readiness-Potenzial), 1983 Brain 106, 623-642 Tiller, William A., Science and Human Transformation, Subtle Energies, Intentionality and Consciousness; Pavior-Publishing, Walnut Creek, Ca lifornia, 1997.

251

Casimir, Hendrik, Introductory results in quantum electrodynamics, Physics (19), 1953, P. 846- 849 Heim, Burkhard, Einheitliche Beschreibung der Materiellen Welt Informatorische Zusammenfassung von Elementarstrukturen der Materie, Band 1 und Band 2, Resch Innsbruck, ISBN 3-85382-048-4 Stapp, Henry, Mind, Matter and Quantum Mechanics Series, The Frontiers Collection, P. 2nd ed., 2004, XII, 297 p., ISBN 3-540-40761-8 Drscher, W. und Heim, B., Strukturen der physikalischen Welt und ihrer nichtmateriellen Seite, 1996, Resch Verlag, Innsbruck Schindewolf, Otto H., Basic Questions in Paleontology: Geologie Time, Organic Evolution, and Biological Systematics, 1993, ISBN 0-226-73 835-3, 1. Auflage in deutscher Sprache 1950 Travis F.; Teece, J.J. und Guttman, J., Cortical plasticity, contingent negative variation, and transcendent experiences during practice of the Transcendental Meditation technique

252

BILDQUELLEN
(1) Privatarchiv (2) T. E. Bearden, Mechanism for Long-Term Cumulative Biological Effects of EM Fields and Radiation (3) www.consciousness.arizona.edu/hameroff/PenHam/anesthesia/General%20Pharmacology.htm (4) KOHA-Verlag, Potenziale der Kraft, David P.Lapierre (5) Privatarchiv (6) Privatarchiv (7) www.biophotonen-online.de/News/2002061 l.htm (8) The Art of MboC, 1995 Garland Publishing, Inc. (9) Postmortale Zustnde, Burkhard Heim und Die erweiterte einheitliche Quantenfeldtheorie von Burkhard Heim, Wolfgang Ludwig, Resch 2000, ISBN 3-85382-063-8 (10) KOHA-Verlag, Potenziale der Kraft, David P.Lapierre (11) W. A. Tiller, A Lattice Model of Space, Phoenix (1978) W. A. Tiller, Conscious Acts of Creation: The Emergence of a New Physics, The On-line, International Journal of Healing and Caring, 3 (2003) No.l. (12) W.A. Tiller, Science and Fluman Transformation: Subtle Energies, Intentionality and Consciousness (Pavior-Publishing, Walnut Creek, CA, 1997). (13) NEUROSCIENCE, Cellular and sub-neural processes (14) E. Mller, Pennsylvania State-University (15) Instrumentelle Transkommunikation von Ernst Senkowski (16) NASA-Archiv, NASA-News, Hubble-Teleskop (SOHO), 2002 (17) www.angelseven.de (18) www.torkado.de/torkadoBeispiele.htm (19) J.L.Naudin, http://naudin.free.fr/html/vtxsph.htm (20) Heart Math Institute, Boulder Creek, California, www.tiller.org (21) University of Utah Computer Department, www.tiller.org (22) University of Utah Computer Department, www.tiller.org (23) KOHA-Verlag, Potenziale der Kraft, David P. Lapierre (24) Privatarchiv (25) Privatarchiv (26) KOHA-Verlag

253

(27) (28) (29) (30) (31) (32) (33) (34) (35) (36) (37) (38) (39) (40) (41) (42) (43)

Privatarchiv Privatarchiv www.quantumconsciousniss.org/pres www.quantumconsciousniss.org/ pres KOHA-Verlag The Art of MboC, 1995 Garland Publishing, Inc. Daniel Winter und Stuart Hameroff www.soulinvitation.com/compressin Mati Pitknen www.physics.helsinki.fi/~matpitka/index.html Mati Pitknen www.physics.helsinki.fi/~matpitka/index.html wvw.quantumconsciousness.org/penrose-hameroff/moreneutral.html www.meditation.de www.meditation.de www.meditation.de www.meditation.de www.meditation.de www.meditation.de www.meditation.de

MATRIX-CODE
Morpheus
Weit du, was eine Wirklichkeit ist? Weit du, was deine Wirklichkeit ist? Ist das, was du gerade erlebst, denkst und fhlst, die Wirklichkeit, oder ist alles nur Teil eines Programms, das sich Matrix nennt und das uns diese Wirklichkeit nur vor gaukelt? Wenn du die Chance httest, mit Morpheus persnlich zu sprechen, welche Fragen wrdest du ihm dann stellen? Ich bin bereit, mein Wissen mit dir zu teilen, nur spreche ich diesmal die Sprache der Wissenschaft, um dir ein tieferes Verstndnis von den Geheim nissen der Matrix zu vermitteln. Vielleicht bin ich dir sogar einmal auf dieser Erde begegnet, du httest mich allerdings kaum erkannt. Denn ich kann viele Formen annehmen. Was ist, wenn ich dir beweisen wrde, da deine Realitt und deine Entschei dungen von etwas bestimmt werden, was sich deiner Wahrnehmung bisher entzieht? Da es zwischen Film und Realitt grere Zusammenhnge gibt, als du dir er trumt beziehungsweise befurchtet hast? Ich empfehle dir, den Inhalt dieses Buches kritisch zu lesen, und sei dir bewut, da dieWirklichkeit das ist, was wirkt - ganz gleich, auf welcher Ebene deines Bewutseins, obintellektuell, physisch in deinem Krper, emotional in deinen Ge fhlen oder auf den tiefsten Ebenen deiner Seele. La dir einen guten Rat geben: Achte auf deinen Instinkt... Nur durch die Befreiung deines Geistes kann dir - wie Neo - tatschlich der Ausstieg aus der Matrix gelingen. Den Geist zu befreien, bedeutet, sich klar zu machen - also zu wissen und nicht zu glauben -, da der Geist alles kann. Lies dieses Buch, und sei dir bewut, da deine Gedanken, die du whrend des Lesens denkst, und deine Gefhle, die du whrend des Lesens fhlst, deine persn liche Matrix aufbauen, deine Realitt, deine Wirklichkeit. La dir durch dieses Buch zeigen, woraus die Matrix besteht und wie du aus den Begrenzungen der Ma trix aussteigen kannst. So stehst jetzt auch du vor der Entscheidung zwischen der roten und der blauen Pille. Ich bin gespannt, welche Wahl du nun getroffen hast. Wenn du es willst, hltst du die Bedienungsanleitung zum Ausstieg aus der Matrix in Hnden. Aber sei dir auch bewut, da sie nur ein Weg ist. Prfe, ob dies dein Weg ist, und wenn ja: bist du fr mich ein Eingeweihter... und eine wirklich phantastische Reise wartet auf dich.

ISBN 3-9501801-5-X 21.00 Euro

DIE KINDER DES NEUEN JAHRTAUSENDS


Jan Udo Holey
Mediale Kinder verndern die Welt!
Der dreizehnjhrige Lorenz sieht seinen ver storbenen Grovater, spricht mit ihm und gibt dessen Hinweise aus dem Jenseits an andere weiter. Kevin kommt ins Bett der Eltern ge krochen und erzhlt, da der groe Engel wie der am Bett stand. Peter ist neun und kann nicht nur die Aura um Lebewesen sehen, son dern auch die Gedanken anderer Menschen le sen. Vladimir liest aus verschlossenen Bchern und sein Bruder Sergej verbiegt Lffel durch Gedankenkraft. Ausnahmen, meinen Sie, ein Kind unter tausend, das solche Begabungen hat? Nein, keinesfalls! Wie der Autor in diesem, durch viele Fallbeispiele belebten Buch aufzeigt, schlummern in allen Kindern solche und viele an dere Talente, die jedoch berwiegend durch falsche Religions- und Erzie hungssysteme, aber auch durch Unachtsamkeit oder fehlende Kenntnis der Eltern bersehen oder gar verdrngt werden. Und das spannendste an dieser Tatsache ist, da nicht nur die Anzahl der medial geborenen Kinder enorm steigt, sondern sich auch ihre Fhigkeiten verstrken. Was hat es damit auf sich? Lauschen wir den spannenden und faszinierenden Berichten medialer Kinder aus aller Welt, darunter die hellsichtig-medialen Kinder, die in Kontakt mit der geistigen Welt - mit dem Jenseits - stehen, die Kinder, die sich an ihr letztes Leben erinnern knnen, die Indigo-Kinder, die durch ihr hyperaktives Verhalten, ihre extreme Art, sich nicht anzupassen, und ihren hohen IQ auffallen, die supermedialen chinesischen Kinder, die nicht nur in der Lage sind, mit den Ohren oder den Hnden zu lesen, sondern auch Gegenstnde aus dem Nichts zu materialisieren, und die Kinder, die eine neue - bisher als mutiert bezeichnete - DNS aufweisen und daher nicht nur gegen infiziertes Blut resisitent, son dern selbst gegen Krebszellen immun sind.

ISBN 3-9807106-4-5 23.30 Euro

DEN GTTERN AUF DER SPUR


Stefan Erdmann
Gentechnik vor 400.000 Jahren
Waren wir bisher der Meinung, da die Fra ge nach der Entstehung des Menschen lngst geklrt sei? Wenn ja, werden wir durch dieses Werk eines besseren belehrt. Stefan Erdmann hat auf seinen Expeditionen durch sechs Konti nente, schwerpunktmig jedoch durch den afrikanischen, Entdeckungen gemacht, die sehr berzeugend darlegen, da die ersten Kultur bringer der Menschheit einst von den Sternen kamen und genetisch in die Entwicklung auf der Erde eingegriffen hatten. Auf seiner Suche nach Anhaltspunkten, die diese These untersttzen wrden, hatte er Gebiete Afrikas besucht, die nie zuvor ein Weier betreten hatte, traf dabei auf Menschen, von denen bisher kein Mensch wute, da sie berhaupt existierten, besuchte verborgene Tler, von denen bisher nur Mythen berichte ten und stie dabei immer wieder auf Hinweise, die einen Eingriff von auen besttigten. Auch wenn wir solch einer Annahme bisher noch skeptisch gegenber ein gestellt gewesen sein sollten, wird sich das nach der Lektre dieses Buches gerndert haben. Wie ein roter Faden ziehen sich Berichte ber diese Besu cher durch die Geschichte der Menschheit und wir werden dabei unweigerlich mit der Frage konfrontiert, ob der Mensch wirklich die Krone der Schpfung ist, wie es das Alte Testament lehrt, oder nur ein evolutionrer Fremdling, der sein Auftauchen der Laune einer Gruppe von Gttern zu verdanken hat? Begeben wir uns mit dem Autor auf eine faszinierende und teilweise fanta stisch anmutende Spurensuche durch die verschiedenen Kulturen dieses Plane ten und erfahren dabei von Ereignissen, die der klassischen Archologie nicht nur unangenehm werden, sondern diese teilweise gnzlich ber den Haufen werfen. Seien wir auf die berraschungen gespannt, die wir mit Stefan Erd mann auf seiner Zeireise durch die Menschheitsgeschichte erleben werden und folgen wir ihm auf den Spuren der Gtter.

ISBN 3-9807106-6-1 20,30 Euro

In seinem zweiten Buch fhrt Morpheus den Leser erneut in die faszinierende Welt des Geistes und erklrt, wie die Matrix - also das Webmuster des Lebens - funktioniert, und wie der Mensch sich darin erkennen und - sollte dies sein Wunsch sein - auch daraus befreien kann. Morpheus: "Das denkende und fhlende neuro-chemische Netzwerk eines Menschen erzeugt eine Realitt, wel che dem jeweils Gedachten entspricht. Dieser realittsgenerierende Schpfungsproze - "Den ken" genannt - erschafft sowohl die geistige als auch die materielle Ebene des Seins. Die Wahrnehmung dessen, was wir als "unsere Realitt" bezeichnen, ist das Summen produkt aller bisherigen Denkprozesse (unserer eigenen und der aller anderen)... Was wir gewohnt sind, als "uere physikalische Erschei nungen" zu bezeichnen, ist in Form materieller Objekte konditioniert und mu definitionsgem intersubjektiv in jeder Psyche existieren. Um die Unbegrenztheit unserer Mglichkeiten in all ihrem Potenzial zu erfassen, bedarf es einer glaubhaften Darstellung gegenber der rationalen und der intuitiven Ebene. Tatschlich existieren solche berzeugenden und glaub haften Belege aus der Naturwissenschaft, die eine willkr lich gesetzte Grenze zwischen Geist und Materie aufheben und hierdurch sehr wirkungsvoll zu einer Verinnerlichung der eigenen Fhigkeiten beitragen... Denken ist eine Art Reflexion unserer Wahrnehmung, je doch ist das, was wir wahrnehmen, nur ein individuell kon ditioniertes Muster einer knstlichen Wirklichkeit. Die tat schliche Wirklichkeit hingegen ist anders ...

Die Realittenmacher beschreibt dieses "anders"!"


2 1 00 ISBN 3-95D1SD1-3-3