You are on page 1of 32

Kurskompendium

Introduktion till energisystem 10 hp, 2013 TN0287

Kursansvarig:JohanVinterbck

20130904

KONTAKTINFORMATION OCH VIKTIGA WEBBADRESSER


Kursledning: Introduktion till energisystem TN0287 Kursansvarig: JohanVinterbck johan.vinterback@slu.se vrigalrare: TorunHammar Programansvariga ES SLU: GertrudNordlander UU: MatthiasWeiszflog torun.hammar@slu.se 018673803 018671830

gertrud.nordlander@slu.se matthias@physics.uu.se

018671986 0184713051

Studievgledare ES UU: SonjaDroschke Frgor om datasystem SLU: FrgoromFronter SLU: UU:

studievagledarees@uadm.uu.se

0184713105

utbildningssystem@slu.se

https://student.slu.se/sv/studieservice/itstod/ itstod@slu.se http://uadm.uu.se/iti/student helpdesk@uu.se

018676600 0184717890

UUdataintro: KarlMarklund

karl.marklund@it.uu.se 0184711046

Energisystem http://www.energisystem.nuEnergisystemprogrammetshemsidasomblandannatsamlatlnkar tillESsektionen,schema,tentaschema,kursanmlanochexamensarbete.Hrfinnsveninformation omutlandsstudier,aktuellahndelsersomkanvaraavintressefrenergisystemstudentersamtvar ESstudenterfttjobb. SLU http://student.slu.se/SLU:sstudentwebbmedmejl,infoomvilkakurserdurregistreradpvid SLU,samtlnktillFronter.(Braattvetarattdirektadressenhttp://student.slu.se/fronterfungerar venomstudentportaleninteskullegradet.)Fronterhemsidanrlsenordsskyddadochendast studenterpkursenhartillgngtilldessadokument.Allviktiginformationomintroduktionskursen kommerattgrastillgngligpFronter. http://slunik.slu.se/HrkanduskautallaSLUkursersslunikkurshemsidor.Dessahemsidorr offentligaochinnehllerexempelvisschema,kursplan,betygskriterierochlnktill kursutvrderingen.Allinformationomkursenkommerinteattgrastillgngligpdennahemsida justeftersomdeninteharbegrnsadtkomst. UU www.studentportalen.uu.seUU:sstudentportalmedmejlsamtinfoomvilkakurserdulserpUU. DuhittarocksenlnktillPingPong(dukanvengviahttps://pingpong.uu.se).Omduanvnder studentportalensinbyggdaschemafunktionkanduendastsedekurserdurregistreradpvidUU. Frattskautheladittschema,sewebbadressennedan.

http://www.teknat.uu.se/Student/Teknisknaturvetenskapligafakultetensstudentwebbmed schemafringenjrsstudenter.DettaschemaskauppdaterasefterSLU:segnaschemanmenfelkan frekomma.DetralltidSLU:sschemasomgllerfrSLUkurser.

INNEHLL
1 KURSINFORMATION........................................................................................................................ 2 1.1 1.2 1.3 1.4 2 Schema....................................................................................................................................2 Obligatoriskamomentochkompletteringar........................................................................... 2 Fronter.....................................................................................................................................3 Kursbetyg.................................................................................................................................3

SEGMENTI:Studiefrberedandemoment..................................................................................... 4 2.1 Obligatoriskamoment............................................................................................................. 4

SEGMENTII:Seminarierochreferat............................................................................................... 5 3.1 Obligatoriskamoment............................................................................................................. 5

SEGMENTIII:Studiebeskochgrupparbete................................................................................... 6 4.1 Obligatoriskamoment............................................................................................................. 6

SEGMENTIV:Slutuppgiften............................................................................................................. 7 5.1 Obligatoriskamoment............................................................................................................. 7

BILAGOR..........................................................................................................................................8 6.1 6.2 6.3 6.4 6.5 6.6 Kursplan...................................................................................................................................8 Betygskriterierochviktningstabell........................................................................................ 10 Omseminarierna................................................................................................................... 13 Referatguide.......................................................................................................................... 22 Instruktiontillslutuppgiften.................................................................................................. 25 Obligatoriskamoment........................................................................................................... 27

1 KURSINFORMATION
Enligtkursplanenrkursenssyfteattgeenvergripandekunskapomenergisystemsomkommer attberrasiprogrammetsamtattintroducerastudententillstudierviduniversitetetsamtdet framtidayrketsomcivilingenjr.Dettagenomfrsgenomstudieresor,attviharseminariermed framstendeexperterinomolikaomrdensamtattstudentendeltariettgrupparbete.Vifrbereder ocksstudentenallmntfruniversitetsstudiergenomdatorochbiblioteksintroduktioner,vning pattarbetasvlindividuelltsomigrupp,skriftligochmuntligredovisningetc.Kursensmoment kandelasinifyrasegment(somdukanlsameromisenareavsnitt): I. II. III. IV. Studiefrberedandemoment Seminarierochreferat/uppgifter Studiebeskochgrupparbete Slutuppgiften

Dethrkompendietharsammanstlltsfrattgrakursenmerlttverskdlig.Allinformationom kursenfinnsinteinkluderadikompendietmenkommerattgrastillgngligallteftersom.Omdetr ngotduundrarveromkursensrduvlkommenattkontaktakursledningen! Kurslitteratur: Dessabckerrkurslitteratur.Detvfrstnmndakommervenattanvndaspkursen Energisystem(5hp)somlsesunderrskurs2.Skrivbokenrenguidetillskrivandesommedfrdel kananvndasunderhelautbildningen.KursbckernafinnstillgngligaibegrnsatantaliUltuna biblioteket(somliggerisammabyggnadsomUndervisningshuset). Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationand Implementation.2012.2nded.McGrawHill. alternativt Vanek,Francis&AlbrightLouis:EnergisystemteknikUtvrderingoch genomfrande.2013.Frstaupplagan.Liber. Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.2:auppl. Studentlitteratur. Strmquist,Siv:Skrivbokenskrivprocess,skrivrdochskrivstrategier.2010.6:euppl. Gleerups.

1.1 Schema
Teknisknaturvetenskapligafakulteten(Teknat)pUppsalauniversitetharettschemafringenjrs studentersomskauppdaterasefterSLU:segnaschemanmenfelkanfrekomma.DetralltidSLU:s schemasomgllerfrSLUkurser.SchematfrintroduktionskursenfinnspSLUNIKhemsidanoch drifrnvenlnkattillFronter.

1.2 Obligatoriska moment och kompletteringar


Iprincipallaschemalagdatillfllenpkursenharobligatorisknrvaro.Undantagrfrmsttidsom avsesfrgrupparbetenellerindividuelltarbetemedslutuppgiften.Ideavsnittnedansombehandlar kursensfyrasegmentkandusevilkamomentsomrobligatoriska.Ensammanstllningavdessa liggerockssombilaga(sebilaga6.8Obligatoriskamoment).

Vadsomhnderomdumissarettobligatorisktmomentkandulsameromiavsnittenom respektivesegment.Idefalldrdetrmjligterbjudsduattgraenkompletteringsuppgiftfrattbli godkndpdetaktuellamomentetunderdettakurstillflle.Noteraattdetintermjligtattgra kompletteringsuppgifterpallamoment!

1.3 Fronter
Dennakurs,liksommngaandraSLUkurser,anvndersigavFronterfrkommunikationmellan kursledningochstudenterochhrhittardukursdokumentochlmnarinuppgiftermedmera. FronterhittardupSLU:sstudentportalellerdirektviahttp://student.slu.se/fronter.Detrviktigt attdutidigtsertillatthadinainloggningsuppgiftertillFronterklarafrdig. 1.3.1 Inlmning och feedback AllinlmningunderkursenskerviainlmningsmapparpFronter.Inlmningkangrasantingen individuelltellerigrupp.Detsenaregrattsamtligastudentersomdeltagitiettgrupparbetekanse denfeedbacksomkommerfrnkursledningen. Tnkpattalltidvaratydligochskrivnamnialladokumentdulmnarin.Namngeocksdokumentet enligt:EfternamnFrnamn/Grupp#NamnPSeminarium/Moment.Samtligainlmnadedokument kontrollerasviaUrkund,somjmfrinnehlletmotwebbplatser,publiceratmaterialochtidigare inskickadedokument.SyftetmedUrkundrattmotverkafuskochplagiering. Inlmningeftertidsgrnsinnebrattdumaximaltkanfbetyg3preferat/uppgifteroch slutuppgiften,ochdenordinarieinlmningsmappenkommerstngaseftertidsgrnsen.Sena dokumentochkompletteringsuppgifterlmnasiniensrskildinlmningsmappfrdetta. Shrgrdufrattlmnain: Gtillanvisadinlmningsmapp. Klickapverfrfilochblddraframtilldittdokument,vljppna. Omduvillgraengruppinlmning;klickapAnpassagareochvljGruppinlmning.Hr kandusedanvljagruppensdeltagare. KlickapSpara.

Shrgrdufrattsekommentarerfrnkursledningen: Gtillanvisadinlmningsmapp. KlickairutanVisadetaljerskandusekommentarersomlmnatspdittdokument. ObserveraattdukanffeedbackantingengenomkommentarerpFronterellergenom kommentarerdirektidittdokument.

1.4 Kursbetyg
Kursbetygsttsnrsamtligaobligatoriskamomentpkursenruppfyllda,ochrensammanvgning avbetygenpreferaten(U/3/4)ochslutuppgiften(U/3/4/5).Hurbetygenpreferatrespektive betygetpslutuppgiftenviktassammanfinnsredovisatienviktningstabell(sebilaga 6.2Betygskriterierochviktningstabell).

2 SEGMENT I: Studiefrberedande moment


Kursenska,frutomattintroducerabegreppetenergisystem,venfrberedastudenternainfr framtidastudiervidSLUochUU.Drfrinnehllerkursenettantalmomentmeddettasyfte.Extra viktigrintroduktionentillSLU:sdatasystemeftersomstudenternadrfrinformationom inloggningsuppgifterochengenomgngavdedatasystemsomkommeranvndasflitigtunder kursen.Merinformationomdettafinnsvia http://www.slu.se/sv/utbildning/nystudent/studentkonto/datorkonto/.Observeraattsamtligadessa momentharobligatorisknrvaro.

2.1 Obligatoriska moment


IntroduktiontillSLU:sdatasystem IntroduktiontillUU:sdatasystem IntroduktiontillkemipSLU(tvlektionstillfllen) IntroduktiontillUltunabiblioteketochinformationsskningpSLU Introduktiontillreferatskrivning(tvlektionstillfllen) Datorbaseradsimuleringsvning

Omduavngonanledningintekannrvarapngotavdeobligatoriskatillfllenaerbjudsduattf graenkompletteringsuppgiftidefallddettarmjligt.Nrvaroellergodkndkompletterings uppgiftkrvspettstortflertalavdessatillfllenfrattbligodkndpkursen. OmduexempelvisinteblirgodkndpintroduktionentillUU:sdatasystemmstedusjlvgenom kontaktmedansvarigpUUtaredapvaddumissatochvadsomkrvsfrattbligodknd.Ett annatexempelromduintekanvaramedpdendatorbaseradesimuleringsvningensomutfrs gruppvis.Duhardmjlighetattensamutfrauppgifternafrnvningstillflletpegentidoch skickain,menhardrmedintetillgngtilldenlrarassistanssombrukarbehvas.Detrgenerellt mycketenklareattdeltaideobligatoriskamomentennattgrakompletteringsuppgifter.

3 SEGMENT II: Seminarier och referat


Kurseninnehllertrettonseminarier,drettseminariumbestravfrelsningochskrivandeav referatalternativtenannananvisaduppgift.Flerafrelsningarkommerattingiettochsamma referat.Omfattningenpdessaaggregeradereferatskavara500600ord,inklusiveenreflektionsdel (somlmpligenmotsvararcirka20%avtextmassan)pettanvisattema.Referatenbetygstts (U/3/4)efterkvalitetpsprkochformaliaochhurutvecklatresonemangstudentenkanfrakring deolikatemana.Frattbligodkndpkursenkrvsnrvarovidsamtligaseminariefrelsningar,och godkntbetygp3aggregeradereferat.ReferatenlmnasinianvisadinlmningsmapppFronter. Tidsgrnsfrinlmningriallmnhetenveckaefterdensistafrelsningenidengruppsomska lggassammanireferatet,omingetannatmeddelats.Noteraattinlmningeftertidsgrnseninnebr atthgstbetyg3kanfs. Informationomhurduskriverettreferatgesunderdetvfrelsningaromskriftligpresentation somingrsomstudiefrberedandemoment.Mertipsomhurduskriverreferatetochreflektions delenhittarduibilaga6.4Referatguide.

3.1 Obligatoriska moment


Nrvarovidsamtligatrettonseminariefrelsningar Inlmningavtregodkndaaggregeradereferat Godkndavrigainlmningsuppgifter

Omduintekannrvaravidenseminariefrelsninghardumjlighetattkompletteragenomatt skrivaensammanfattningaventextomdetaktuellamnet.Vilkatexterdetrrsigommeddelas eftervarjeseminarium.Kompletteringsuppgiftensomfattningskavara10001500ord,inklusiveen reflektionsdelmotsvarandeca20%avtextmassan.Dukanmaximaltfbetyg3pkompletterings uppgifter.

4 SEGMENT III: Studiebesk och grupparbete


Underhstenkommerettantalstudiebeskattgenomfras.Flertaletavdessaliggerunderen tredagarsstudieresatillDalarna,menettantalbeskkommervenattgraspanlggningarioch omkringUppsala. Enstudentgruppbestendeavfyratillfemstudenterkommerattutfraettgrupparbeteomvarje studiebesk,ochhardrfrettextraansvarfrattinhmtainformationochstllafrgortillstudie besksvrden.Fokusfrgrupparbetetskaliggapstudiebesksvrdensrollienergisystemetoch dessanvndning/produktionavenergi,mendetrndvndigtattsttainbesketiettstrre perspektivpverksamhetsomrdetsomberrs.Ettexempel,omstudiebesketgenomfrspett sgverk,rattsomenbakgrundochfrslutsatsersepsgverksindustrinmergenerellt.Respektive gruppfrberedersiginfrstudiebesketochtankenrattdetmestaavfaktaochkontaktermed respektivefretagtasunderbesket.Iblandblirdetgivetvisndvndigtattbeattfterkommavia telefonellerepostfrkompletteringar. Resultatetavgrupparbetetskapresenterasskriftligt,antingensomenrapportellerPM,ochmuntligt infrvrigakursdeltagarevidtrepresentationstillfllenunderkursen.Omfattningenskavara2000 3000ordochinnehllaenreflektionsdelmotsvarandeungefr2030%avtextmassan.Ordantalet avseralltsbrdtextenochinkluderarinteframsida,sidhuvud/sidfot,innehllsfrteckning,kllfr teckningocheventuellabilderochdiagram.Frdenmuntligapresentationenhargruppentio minutertillfrfogandeochdrefterfinnsutrymmefrfrgor.Observeraattallaigruppenskavara aktivaunderpresentationenochattdetrviktigtatthllatiden.

4.1 Obligatoriska moment


Deltagandeisamtligastudiebesk Aktivmedverkanigrupparbete Inlmningavgodkndgrupparbetsrapport Aktivtdeltagandeimuntligpresentationavgrupparbetet Nrvaropsamtligatrepresentationstillfllenfrgrupparbetena

Dalaresanromfattandeochviktigfratttillgodograsigkursensinnehllochdrfrfinnsingen mjlighetattkompletteraomduskullemissaden.Istlletkrvsattdufljermedpresanvidnsta kurstillflle.Omduavngonanledningskullemissangotavdeandrastudiebeskensfinns mjlighetattgraenkompletteringsuppgift(dessardockgenerelltmertidskrvandensjlva studiebesket).Vilkadessauppgifterrmeddelasomdetbliraktuellt.Omduintekannrvarapdet studiebesksomdingruppskagragrupparbeteomskandubliflyttadtillenannangrupparbets grupp. Omdumissarettpresentationstillfllesrkompletteringsuppgiftenattp10001500ord sammanfattagrupparbetsrapporternafrndegruppersompresenteratviddetaktuellatillfllet.

5 SEGMENT IV: Slutuppgiften


Slutuppgiftenrendelavexaminationenpkursen,ochkopplardelvistilllrandeml1:Skriftligt ochmuntligtkunnasammanfattanaturvetenskapligaochsamhllsvetenskapligaaspekterp samhlletsenergibehovochtillgngligakllorochframfrallttilllrandeml2:Kunnaexemplifiera framtidaenergisystemochderassamverkanmedmiljochsamhlle. SlutuppgifteninnebrattskrivaettPMbaseratpreferatochannandokumentationfrn frelsningarnapkursensamtandrappnakllorsomhemsidor,rapporter,vetenskapligaeller populrvetenskapligaartiklarmedmera.Merinformationomslutuppgiftenhittarduibilaga 6.5Instruktiontillslutuppgiften. Noteraattinlmningefterdeadlineinnebratthgstbetyg3kanfs.

5.1 Obligatoriska moment


Inlmningavgodkndslutuppgift

6 BILAGOR
6.1 Kursplan
KursengesiCivilingenjrsprogrammetienergisystem Kursplanfaststlld:20120524(Gllerfr.o.m.vt2013) Versionshistorik: 1.ht2010ht2012 2.vt2013 mnen:Teknologi/Teknik Utbildningensniv:Grundniv Frdjupning:Grundnivmedendastgymnasialafrkunskapskrav(G1N) Betygsskala:5/4/3/U Kravenfrkursensolikabetygsgraderframgravbetygskriterier,somredovisasibilagatill kursplanen.Aktuellinformationombetygskriterierskafinnastillgngligsenastvidkursstart. Frkunskapskrav: Enligtfordringarfrantagningtillcivilingenjrsprogrammetienergisystemellermotsvarande Ml: Kursenssyfterattgeenvergripandekunskapomenergisystemsomkommerattberrasi programmetsamtattintroducerastudententillstudierviduniversitetetsamtdetframtidayrketsom civilingenjr. Eftergenomgngenkursskastudentenkunna: skriftligtochmuntligtsammanfattanaturvetenskapligaochsamhllsvetenskapligaaspekterp samhlletsenergibehovochtillgngligaenergikllor exemplifieraframtidaenergisystemochdesssamverkanmedmiljochsamhlle beskrivagrunddragidenallmnnaidhistorienmedtonviktpvetenskapernasutveckling visafrmgaattanvndadatorer,datorsystemochbiblioteksdatabasersomanvndsunder utbildningensamtfrklaradereglersomgllerfrdatoranvndningvidsvlUppsalauniversitet somSLU. Innehll Vidseminariernabehandlasbegreppetenergisystem,olikaenergikllor,energislagsamtindustrins ochsamhlletsenergibehov.Seminariuminnebrbdefrelsningsamtskrivningavreferat Studiebeskpenergiindustrierochfretag Grupparbeten(omenergisystem)genomfrsisambandmedexkursionerochredovisasskriftligt ochmuntligt Helaenergisystemetanalyserasienslutrapportsombyggerpseminariernasomgesunderkursen 8

Dataintroduktiongesunderkursensfrstadelliksomenintroduktiontillbiblioteksoch informationsskning Envninggesiprojektformdrstudentenfrsimuleraochanalyseraenergiochmiljaspekter. Genomfrande Schemalagdaaktiviteter Studiebesk Seminariearbete Timmar ca30 ca65 ca15 ca10 ca5 ca10 ca15 ca70 ca50 ca270 Obligatorisk Ja Ja Ja Ja Ja Ja

Projektarbete(planeringochpresentationer) Dataintroduktion

Biblioteksochinformationsskning Introduktiontillallmnkemi

Gruppaktiviteterutanfrschemalagdtid Projektarbeteigrupp

Sjlvstudierutanfrschemalagdtid Rapportskrivning Slutuppgift Totalt Litteratur:

Gemensamkurslitteraturfaststllsseparatochredovisasibilagatillkursplanen.Aktuellinformation omgemensamkurslitteraturskafinnastillgngligsenasttta(8)veckorfrekursstart. Examinationsformerochfordringarfrgodkndkurs: Muntligaochskriftligaredovisningaravvningarochuppgifter. Godkndavningarochuppgifter,samtdeltagandeiobligatoriskamoment. Generellareglerochriktlinjerfrexaminationochbetygssttningfinnsiregelsamlingfrutbildning pgrundnivochavanceradnivvidSLU. Ansvariginstitution/motsvarande:Institutionenfrenergiochteknik Ort:Uppsala Kompletterandeuppgifter Faststlldav:Utbildningsutskottetfrekonomi,miljochteknik Erstter:TN0264

6.2 Betygskriterier och viktningstabell

Betygskriterierutifrnlrandemlpkursen:TN0287Introduktiontillenergisystem10hp Lrandeml1:Skriftligtoch muntligtkunnasammanfatta naturvetenskapligaoch samhllvetenskapliga aspekterpsamhllets energibehovochtillgngliga kllor(gstfrelsningar, referat,studieresaoch studiebesk) Lrandeml2:Kunna exemplifieraframtida energisystemochdess samverkanmedmiljoch samhlle(slutuppgiften) Lrandeml3:Beskriva grunddragidenallmnna idhistorienmedtonviktp vetenskapernasutveckling Lrandeml4:Visafrmga attanvndadatorer, datorsystemoch biblioteksdatabasersom anvndsunderutbildningen samtfrklaradereglersom gllerfrdatoranvndningvid svlUppsalauniversitetsom SLU

Betyg 5 4 3 U

Frgestllningarnadelvisnya ochutmanande.Somkllor anvndsbl.a.vetenskapliga artiklar.Tidigareforskning redovisasutfrligt.Mycket bradispositionmedmycket braformaliaochsprk. Genomfregnaanalyserav energisystemsomr omfattandeoch teorianknutna. Referatetharbraformalia,ett Vlvaldaochrelevanta gottsprkochallavsentliga frgestllningar.Somkllor anvndsbl.a.hemsidor, aspekterbehandlas. Avanceradegenreflektionoch rapporteretc.Tydlig analysavenergisystemen. dispositionmedgodformalia Svararpfrgorsom"varfr?" ochsprk.Godegenanalysav energisystemen.Inlmnas eller"hur?".Inlmnasinom inomtidsgrnsen(terminens tidsgrnsen.Mycketvl slut). genomfrdmuntlig presentationavgrupparbete. Studentendeltar(aktivt)i Avgrnsadeochtydliga studieresantillDalarna. frgestllningar.Studenten Studentendeltarisamtliga fullfljeruppgiftenmedhjlp vrigastudiebesk.Studenten avreferatskrivnaunder deltarvidsamtliga kursen.Acceptabelformalia gstfrelsningar.Studenten (enligtanvisningar)ochsprk genomfrgrupparbeteoch samtbegrnsadegenanalys. visardrprovpfrstelsefr Omfattning15002000ord. Kontrollutananmrkningi energisystemetochdess Urkund. samverkanmedmiljoch samhlle.Innehllet frmedlasskriftligtoch presenterasvenvlmuntligt (detskriftligagrupparbetet examinerasigrupp). Studentenrefererarskriftligen vadsomkommerframvid seminarierochstudiebesk. Begrnsadegenreflektionoch analysavenergisystemen, omfng500600ord. Kontrollutananmrkningi Urkund. Uppnrejnivnfrbetyg3 Uppnrejnivnfrbetyg3

Referatetharbraformalia,ett gottsprkochallavsentliga aspekterbehandlas. Avanceradegenreflektionoch analys.Svararpfrgorsom "varfr?"eller"hur?". Inlmnasinomtidsgrnsen.

Studentenrefererarskriftligen vadsomkommerframvid seminariet.Begrnsadegen reflektionochanalys,omfng 500600ord.Kontrollutan anmrkningiUrkund.

Godkndadatoroch biblioteksintroduktionervid UppsalauniversitetochSLU. Deltaraktivtiden datorbaserade simuleringsvningen.

Uppnrejnivnfrbetyg3

Uppnrejnivnfrbetyg3

10


Betygskriterierutifrnhelkurs:TN0287Introduktiontillenergisystem10hp betyg helkurs/heltmoment 3pdendelsomhar3sombetyg.4pdendelsomhar4sombetyg.3godkndareferat. Betyg5enligtviktningstabellen.

3pdendelsomhar3sombetyg.4pdendelsomhar4sombetyg.3godkndareferat. Betyg4enligtviktningstabellen.

3pdendelsomhar3sombetyg.3godkndareferat.Betyg3enligtviktningstabellen.

Upngondelavkurseninomtrer(tidenfrattblifrdigkandidat).Omintekursenrklar inomtrerfrmangomden.

11

Viktningstabell:TN0287Introduktiontillenergisystem10hp Referat(antal) Slutuppgift Betyg 3 3 3 3 2 2 2 1 1 1 0 0 0 4 0 0 0 1 1 1 2 2 2 3 3 3 3 X X X X 4 X X X X 5 X X X X

Viktatbetyg 3 3 4 3 3 4 3 4 5 4 4 5

12

6.3 Om seminarierna

SEMINARIUM: Bioenergi ISverigevxerbioenergisektornsnabbtochutgrenungefrlikastordelavenergianvndningen somvattenkraftenochkrnkraftentillsammans.r2010tillfrdestotalt140TWhbiobrnslentilldet svenskaenergisystemet,ochtrotsdetredanhgauttagetfinnsstorpotentialattkabioenergi produktionen.Globaltutgrbioenergiungefrentiondelavenergianvndningen,ochtraditionell anvndning(smskaligeldningavlgbearbetadebrnslenfrmatlagningochliknande,utanrening avrkgaser)dominerar. Brnslenbaseradepbiomassakallasbiobrnslen,ochdetfinnsbdefasta,flytandeochgasformiga biobrnslen.Dessakananvndasfrproduktionavelochvrme,ellersomdrivmedel.Biobrnslen kankommafrnjordbruket,skogenellerfrnavfall,ochroftaintehomogenautanharvarierande materialstorlekochfukthalt.Frattkunnajmfraocheffektivtanvndabiobrnslenkrvsdrfratt deklassificerasenligtstandarder.Generelltgllerfrfastabiobrnslenattdemesthomogena brnslena(sompellets)ifrstahandnrvillamarknaden,medanmindrehomogenabrnsleneldas storskaligtifjrrvrmeverk.Ungefr70%avfjrrvrmeniSverigeproducerasfrnbiobrnslen. Gemensamtfrbiobrnslenrattderiprincipkoldioxidneutralaochdrfrintebidrartillvxthus effekten.Detrdockviktigtattproduktionenskerpetthllbartstt,vilketfrskogsbrukkaninne braexempelvisterplantering,askterfringochattmanltergrenarochtopparliggakvarunder vinternfrattbladskafallaavochlmnaskvar. Nyckelord:Traditionell/modernbioenergi,fasta(ved,energiskog,torv)biobrnslen,flytande biobrnslen(metanol,FTD,DME),fjrrvrme,avfall,askterfring,terplantering,grenarochtoppar (GROT) BioenergipSLU: BranschorganisationenSvenskaBioenergifreningen: BioenergifrgorinomjordbruketpBioenergiportalen: http://www.slu.se/energiochteknik http://www.svebio.se/ http://www.bioenergiportalen.se/

Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.273283 Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.s. 449451,454460.

SEMINARIUM: Artificiell fotosyntes Varjerstrlarstoramngdersolljusenergiinvenhosossinorr.Sammanlagtrenergimngdeni solinstrlningenverSverigeca400000TWh/r,ochsomjmfrelseliggerSverigesenergianvnd ningpca400TWh/r.Frganrhursolenerginpettenkeltochkostnadseffektivtsttkanomvand lastillanvndbarenergiiformavel,vrmeochdrivmedel. Elochvrmekanproducerasisolcellsochsolvrmeanlggningar,mendessvrrersolinstrlningen somlgstpvinternnrdetrmrktochkalltochenergibehovetrsomstrst.Drfrbehversol 13

energinkunnalagrasiformavngonlmpligenergibrare.Vtgas,somkananvndasibrnsleceller ochifrbrnning,rensdanmjligenergibrareochenavvtgasensfrdelarrattdenvid anvndninginteslpperutngonkoldioxid. Denuvarandemetodernafrattproduceravtgasrbaseradepfossilabrnslen,menommankan utvecklaenenergieffektivochutslppsfriproduktionblirdenenavfleraintressantaenergibrarefr ettuthlligtenergisystem.Artificiellfotosyntesinnebrattimiteravaldadelaravvxternasnaturliga fotosyntesfrattproduceravtgas.Ettannatsttrattmodifieradegenetiskaarvsanlagenhos algersomredanharennaturligfrmgaattproduceravtgas.Dettarfremlfrforskninghos Konsortietfrartificiellfotosyntes,somharsitthuvudstepngstrmlaboratoriet. Nyckelord:Energiklla,energibrare,vtgas,brnsleceller,fotosyntes,fotosystemII,fotobiologisk vtgasproduktion,cyanobakterier(blgrnaalger). Forskningpngstrm: http://www.fotomol.uu.se/Forskning/Biomimetics/consortium/index.shtm

SEMINARIUM: Fossila brnslen Denglobalaenergianvndningenharlngekatochdrmedocksanvndningenavfossilabrnslen, somutgrungefr80%avdentotalatillfrselnavprimrenergi.Primrenergirenergimngden somtillfrsenergisystemet,ochinkluderarinteomvandlingsfrluster(pungefr30%).Envanlig enhetfrenergirtonoljeekvivalenter[toe],dr1toemotsvararenergiinnehlletietttonolja. Tillskillnadfrnkol,sommesthandlasmedpnationellniv,rmarknadernafroljaochgasinter nationella.Detfinnsengeografiskobalansitillgngochefterfrganbdepoljeochgasmark naderna,vilketinnebrattdenstrstaproduktionenochdenstrstakonsumtionenskeriolika regioner.MngaavvrldensoljeproducerandelnderrmedlemmarioljekartellenOrganizationof PetroleumExportingCountries(OPEC)somefterstrvarettstabiltoljepris.OPEClndernaharidag ungefr80%avvrldenskndaoljereserver.Europardenstrstaimportrenavnaturgas,och beroendetkar.FlerastorarrledningarfrnaturgasplanerasochdennyaNordStreamledningen genomstersjn,frnRysslandtillTyskland,rettexempel. Resurserrdentotalamngdavexempelvisoljasomfinnsienreservoariutgngslget,medan reserverrdenoljemngdsomrekonomisktlnsamochmjligattutvinnamedaktuellteknik.Om innovationergrproduktionenbilligare,elleromoljeprisetstiger,karalltsreserverna.Idagkan ungefr40%avoljanivrldensoljefltutvinnas.Detfinnsolikauppfattningaromnrdenmaximala globalaoljeproduktionenkommerintrffa,meneftersomfossilabrnslenrenndligresurskaninte produktionenkaiondlighet.VissamenarattPeakOilredanpasserats,medanPeakGasochPeak Coalliggerlngreframitiden. Nyckelord:Primrenergiochenergianvndning,OPECochIEA,resurserochreserver,NordStream, PeakOil/PeakGas/PeakCoal,Liquefiednaturalgas(LNG). AssociationfortheStudyofPeakOilandGas(ASPO): NtverketOljaochgas(NOG): http://www.peakoil.net/ http://www.nog.se/

14

Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.101102,144145,194,197 209. Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.s.133 156,157204.

SEMINARIUM: Solenergi Solstrlningensomnrjordensatmosfrharenintensitetpdrygt1300W/m2.Nrstrlningenpass erargenomatmosfrenabsorberasendelavden,ochintensitetenvidjordytanrdrfrlgre(maxi maltca1000W/m2).DensolenergisomrligenstrlariniSverigerungefr1000kWh/m2,medan exempelvisnorraAfrikafrnstandubbeltsmycket. Solenergikananvndasfrattproduceravrme(isolfngare)ellerel(iexempelvissolceller).Sol cellerbestravhalvledarmaterial,drelektronerfrigrsnrinfallandefotonerabsorberas.Genom attlggapkontakterpframochbaksidankansolcellenanslutastillenelektriskkrets.Vanligen anvndskiselskivorsomhalvledaremenikandeutstrckningventunnfilm,drettbrandemat erial(oftaglas)belggsmedettmyckettuntlagerhalvledarmaterial. Denmaximalateoretiskaverkningsgradenfrensolcellsombestravetthalvledarmaterialrunge fr30%,menipraktikenliggerverkningsgradenprunt15%.Varjekiselsolcellgerenspnningp 0,5V,ochfrattstadkommamerhanterbaraenheterseriekopplasvanligenfleracelleriensolcells modul.Ensolcellsanlggningkanbestavfleraserieoch/ellerparallellkoppladesolcellsmoduler,och kanantingenvarafristendeellerelntansluten.Eftersomensolcellsanlggningintebehverinne hllangrarrligadelarrunderhllskostnadernalgaochlivslngdenlng. Undersenarerharinvesteringskostnadenfrsolcellsanlggningarsjunkitsnabbt,menfortfarande krvsekonomiskastdsystemfrattuppnlnsamhet.Exempelpsdanastdrnettodebitering, inmatningstariffer,investeringsstdochelcertifikat.ISverigeanvndsdetvsistnmnda,mensol cellerstrnnufrenfrsumbarandelavelproduktionen. Nyckelord:Halvledare,n/pdopning,mono/multikristallintkisel,tunnfilm(CIGS,CdTe,amorftkisel), solcell,solcellsmodul,vxelriktare,standalone/gridconnected,nettodebitering,inmatningstariffer, elcertifikat Solenergipngstrmlaboratoriet: BranschfreningenSvenskSolenergi: Solelprogrammetsdatabasversvenskasolcellsanlggningar: Dygns,mnadsochrsproduktionfr enskildasvenskasolcellsanlggningar: http://www.asc.angstrom.uu.se/ http://www.svensksolenergi.se/ http://www.solcell.nu/ http://www.soldata.se/

Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.192193,211242. Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.s.269 292,293335,337370,371398. 15

SEMINARIUM: Vindkraft r2010produceradesvenskvindkraft3,5TWhel,vilketmotsvarade2,4%avdentotalasvenskael produktionen.Andelenkarfrvarjerochriksdagenharsattuppettplaneringsmlp30TWhr 2020.Vindkraftrberttigattillelcertifikat.Internationellthardenstrstamarknadenfrvindkraft verklngevaritEuropa,menrsedan2009istlletKina.Detlanddrvindkraftutgrstrstandelav elproduktionenrDanmark(>20%),fljtavSpanienochTyskland. Vindkraftverkkanplacerasippnalandskap,tillhavselleriskogen.Detfrstnmndarvanligast, menvendetsomvckerstrstmotstndfrnnrboende.Tillhavsrdergenerelltbttrevindfr hllandenmendeekonomiskafrutsttningarnarsmre.Attplaceravindkraftverkiskogrnnu ovanligt,menstorpotentialfinns.Vindkraftverkenblirintelikasynligamenvindenrmerturbulent ochtornenmstevarahgre. Vanligastidagrtrebladigaochhorisontalaxladevindkraftverk,menforskningskervenpvertikal axladeverk(exempelvispngstrmlaboratoriet).Frattundvikahgreproduktionnvindkraft verketdimensioneratsfrkrvsmjlighettilleffektbegrnsning,genomstallellerbladvinkelregle ring.Andrakonstruktionsfrgorhandlaromhuruvidavindkraftverketskakrasmedkonstanteller variabeltvarvtal,samtomgeneratornskavaravxladellerdirektdriven.Itaktmedattvindkraftens andelavelfrsrjningenvxer,karocksreglerbehovetochkravenptlighetmotstrningarp elntet. Nyckelord:Horisontal/vertikalaxladevindkraftverk,land/havs/skogsbaseradvindkraft, stall/bladvinkelreglering,vxlad/direktdrivengenerator,elcertifikat. Vindkraftforskningpngstrm: Svenskvindkraftfreningshemsida: http://www.el.angstrom.uu.se/forskningsprojekt/vind.html http://www.svenskvindkraft.org/

Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.255,264271. Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.s.399 447.

SEMINARIUM: Jordbrukets energisystem Jordbruksysselstternra1/3avjordensbefolkning,ochtckercirka37%avjordensyta.Jordbruket frserossblandannatmedmat,fibrer,ekosystemtjnsterochenergi.Idennafrelsningtarvien tittphurmarkenglobaltsettinomjordbruketanvnds.Viserhurmycketenergisomjordbruket levererartillrestenavsamhlletochvilkapotentialerdetfinnsfrattkabioenergiproduktionen, bdeglobaltochiSverige.Vitittarockspenskildaodlingar,grdarochbioenergisystemochhur energibalanserkanberknasfrdessa.Vilkainsatserkrvsochhurmycketenergifrviut?Vitittar ocksversiktligtpvilkamiljproblemsomrkoppladetilljordbruketsenergisystem. Nyckelord:Markanvndning,bioenergi,potential,energibalans,flytande(etanol,FAME)/gasformiga (biogas)biobrnslen. 16

Lnkar:Odlingibalans(set.ex.Excelarkfrberkningavenergibalanspengrd): http://www.odlingibalans.com/ Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.4256. Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.2012. s.451454,460472.

SEMINARIUM: Vg, strm och vertikalaxlad vindkraft Enrelativtoutforskadteknikfrhllbarelproduktionrvgkraft.Manrknarmedattdentekniska potentialeniSveriger10TWh/r,ochfrmstfinnspvstkusten.Pngstrmlaboratorietharman utvecklatentekniksominnebrattenskalladlinjrgeneratorplacerasphavsbotten,meden krnaavpermanentmagnetersomlyftsochsnksavenbojsomflyterpvgorna.Strmmensom alstraslikriktas,innandentervxelriktasplandmedelntetsfrekvens.Enfrsksanlggningmed dennateknikfinnspplatsutanfrLysekil,ochFortumbyggerjustnuvadmankallarvrldensstrsta vgkraftanlggningmedteknikfrnngstrmfretagetSeabased. Vertikalaxladevindkraftverkfrekommerpraktiskttagetintepmarknaden.Dehardockflera designmssigafrdelarjmfrtmedhorisontalaxladevindkraftverk,ochmekanikenrbetydligt enklare.Eftersomdetintefinnsngotbehovavattriktavindkraftverketmotvindenbehvsexempel visingengirfrmga,ochvindkraftverketkankonstruerassattdetendastharenrrligdel.Gene ratornkangrasdirektdriven,vilketavlgsnarbehovetavenvxellda,ochkandessutomplaceras pmarken,vilketinnebrattpfrestningarnaptornetblirmindreochkonstruktionenkangras lttare.Pngstrmlaboratorietutfrmanfrskmedegenkonstrueradevindkraftverk. Strmmandevattenilvar,sundochhavrytterligareenoutnyttjadfrnybarenergiklla.Energini havsstrmmarkanutvinnasochomvandlastillelpettsttsompminneromvindkraft.Turbinerna somplacerasutistrmmenkanvaraantingenvertikalellerhoristontalaxladeochseutpmnga olikastt.Enviktigskillnadmotvindkraftenratthastighetenidetstrmmandevattengenerelltr mycketlgre.Dettakompenserasavattenergitthetenivattnetrhgrenivinden,pgrundav denhgredensiteten.Denforskningsombedrivspngstrmlaboratorietrinriktadmotvertikal axladekraftverkmeddirektdrivengenerator.Dentekniskaochekonomiskapotentialenfrntid vattenstrmmariEuropauppskattastill3958TWh/r. Nyckelord:Vg/strm/vertikalaxladvindkraft,teknisk/ekonomiskpotential,intermittenta energikllor,utnyttjandegrad,generator/linjrgenerator,Lysekilsprojektet Forskningsprojektpngstrm: VgkraftsfretagetSeabased: VindkraftsfretagetVerticalWind: http://www.el.angstrom.uu.se/Meny/mforskproj.html http://seabased.com/ http://www.verticalwind.se/SV/

17

SEMINARIUM: Teknikutveckling och energihistoria Mnniskanhariprincipalltidanvntsigavbioenergi,iformavvedochdjurspillningfreldningoch gdsling.Lngevarmanberoendeavmuskelkraftfrattutfraarbetemenvenvindochstrm mandevattenutnyttjades,blandannattillattdrivasegelbtarochkvarnar.Under1700och1800 taleninnebardenindustriellarevolutionenattflerochflerprocessermekaniserades,vilketleddetill enstorskaliganvndningavfossilabrnslen.Idagtillgodosessamhlletsenergibehovavettkomplext frsrjningssystemsombaseraspenkombinationavenmngdolikaenergikllorochenergibrare. Underseminarietdiskuterasvadsommenasmedteknikochteknikutveckling.Vadrdetsomgratt vissatekniskalsningarspridsmedanandraaldrigslrigenom?Vilkadrivkrafterfinnsochvilka intressenrdetsomstyr?Teknikutvecklingkaninteskeoberoendeavsamhllet,somistorutstrck ningfrmjarellerhindrarolikalsningar.Exempelvishartekniskutvecklingiblandhllitstillbakaav mktigainstitutionersomkyrkanochstaten.andrasidankanvissteknikiblandanseshautvecklats frsnabbt,ochetableratsmedankunskapnnusaknatsomdesseffekter.Blandannatutnyttjades rntgenstrlningunderenperiodtillhrborttagning,ochradioaktivamnenansgshaenhlsosam effektochanvndessomtillsatsikosten. Tekniskamuseetomenergiochmilj: Frelsarenshemsida: http://www.tekniskamuseet.se/1/181.html http://www.innovationshistoria.se/

SEMINARIUM: Krnkraft ISverigefinnstiokrnkraftsreaktorerfrdeladeptrekrnkraftverk,iForsmark,Oskarshamnoch Ringhals.Dentotalainstalleradeeffektenrdrygt9000MW,vilketgerenrsproduktionavelp ungefr5560TWh/r(motsvarandeknappthlftenavdenelsomanvndsiSverige).Entredjedelav energinsomgenererasrel.Resterandeenergirvrmesomkylsbort,vilketinnebrattkrnkraften harbetydandefrluster(istorleksordningen100130TWh/r).Denstoramngdkylvattensomkrvs renanledningtillattallasvenskakrnkraftverkrplaceradevidhavet. Processeniettkrnkraftverkkallasfission,ochinnebrattatomkrnorklyvsvarvidenergifrigrs. Processenrsjlvgendeeftersomvarjeklyvninggerupphovtillfrianeutronersomisinturkanklyva nyaatomkrnor.Sombrnsleikrnkraftverkanvndsvanligenisotoperavuranochplutonium.Styr ningskermedstyrstavarsomabsorberarverskottetavfrianeutroner,menfrattbromsaneutron ernatilllmplighastighetkrvsocksenmoderator.Ikokochtryckvattenreaktoreranvndsvatten sombdemoderatorochkylmedel. Uranmalmsomerhllsvidgruvdriftmsteanrikasfrattanvndasikrnkraft.Anrikninginnebratt koncentrationenav235Ukas.Krnkraftgerupphovtillradioaktivtavfall,ochdensvenskamodellen rattmellanlagraavfalletiOskarshamn,frattsedanslutfrvaradetiberggrundenienplanerad anlggningiForsmark,norromUppsala.Ivissutstrckningrdetmjligtattupparbetauttjntkrn brnslefrteranvndningiandrareaktorer,ochforskningpdettapgr. KrnkraftrkontroversielltimngalndermycketpgrundavolyckornaiThreeMileIsland, TjernobylochFukushimamenkrnkraftsesavvissasomenrelativtrenenergikllamedlga utslppavvxthusgaser. 18

Nyckelord:Forsmarks/Oskarshamns/Ringhalskrnkraftverk,anrikning,fission/fusion,235U/238U, kokvatten/tryckvatten/bridreaktor,moderator,halveringstid,Centraltmellanlagerfranvnt krnbrnsle(CLAB),hrdsmlta,promptkriticitet,ThreeMileIsland/Tjernobyl/Fukushima Tillmpadkrnfysikpngstrm: Svensktkrnteknisktcentrum(SKC): Svenskkrnbrnslehantering(SKB): InternationalAtomicEnergyAgency(IAEA): http://www.physics.uu.se/tk/ http://www.sci.kth.se/centra/skc http://www.skb.se/ http://www.iaea.org/

Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.167185,285307. Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.s.231 268.

SEMINARIUM: Metoder fr analys av energisystem Energisystemetrjustettsystem,drenhndelsepenplatsvidentidpunktpverkarandradelar avsystemetunderentidframver.Energisystemetstyrsavekonomiochjuridik,avfysikochteknik, ochavolikamnniskorsagerande.Vadsomskahndaienergisystemetkansimulerasmedhjlpav datormodeller.Nrmanbyggermodellerutnyttjasbdekunskapomdetspecifikasystemetoch generellsystemkunskap,somrlikafrallaslagssystem.Enmodellralltidenfrenklingav verkligheten,ochdrfrkanvarjemodellbarabesvaraenvisstypavfrgor. Energisystemetmodellerasochsimuleraspmngaolikastt.Mansimulerarenergibehoveti framtiden,bdelokalt,nationelltochglobalt.Modelleranvndsfrattfrsthurett fjrrvrmesystemruppbyggtochhurdetbehverfrndrasnrfleranvndareansluts.Med modellerkanmanrknautomdetrlnsamtattbyggaettnyttkraftverk.Medmodellergrs prognoserfrframtidensklimatbaseratpfrvntadenergianvndning. Nyckelord:system,modell,simulering,energiplanering Modellerfrstorskaligenergiplanering:http://www.energycommunity.org/default.asp?action=71 Sidhnvisningar:Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationand Implementation.2012.s.2972,110119.

SEMINARIUM: Vattenkraft Densvenskainstalleradevattenkraftseffektenrdrygt16000MW,vilketgrattunderettnormalr producerarsvenskvattenkraft68TWhel,motsvarandeungefr45%avelproduktionen.Denrliga produktionenvarierardocksjlvklartmednederbrdsmngden.ISverigestrkrnkraftenfrbas produktionenaveleftersomdenhareninbyggdtrghet,ochvattenkraftsproduktionenreglerasfr attfljavariationenielkonsumtion. Vattenkraftspotentialenivstvrldenriprincipheltutbyggdmeniandradelaravvrlden,som exempelvisKina,pgrenintensivutbyggnadmedkraftverketiThreeGorges(installeradeffekt 19

22500MW)somettexempel.ISverigeharfyrastrresvenskalvar(Kalixlv,Pitelv,Tornelvoch Vindellven)skyddatsmotreglering,ochvattenkraftenrdrmednragrnsenfrmjligutbyggnad. Vattenkraftensnegativamiljeffekterrihuvudsaklokalaochregionalamedpverkanpekosystem bdeuppstrmochnedstrmsilven.Ettminskatnringsfldepgrundavsedimenteringidammar rettexempelpdetta.Nedbrytningavbiologisktmaterialidammarkandockocksgeupphovtill utslppavdenkraftigavxthusgasenmetan. Vattenkraftanvnderidagtekniksomrvlutvecklad,medverkningsgraderrunt95%.Pngstrm laboratorietrforskningenfrmstinriktadpattunderskaochfrbttradriftegenskaperhosgene ratorn.Dettabliralltviktigaredvattenkrafteniframtidenfrvntasreglerasmerochsnabbarei taktmedproduktionenfrnintermittentaenergikllorkar. Nyckelord:Teknisk/ekonomiskpotential,ThreeGorges,Harsprnget,nationallvar,damm, sedimentering,turbin,generator Vattenkraftforskningpngstrm:http://www.el.angstrom.uu.se/forskningsprojekt/vattenkraft.html Svensktvattenkraftcentrum: http://www.elforsk.se/svc/ Sidhnvisningar:Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.255264,270 271.

SEMINARIUM: Vgtransporter Vgtransporterstrfrenstorandelavdesvenskakoldioxidutslppen,ochdetrndvndigtatt minskautslppenfrntransportsektornfrattuppnriksdagensnationellamiljmlombegrnsad klimatpverkan.Vgtransporternaskoldioxidutslppharkatngotdesenastedecenniernaochlig gerprunt20miljonertonperr.Destrocksfrdrygthlftenavtransportsektornstotalaenergi anvndning.Inomvgtransporterfrdelarsigbdeenergianvndningochkoldioxidutslpptilltv tredjedelarppersontransporterochentredjedelpgodstransportermedlastbil. RegeringenharenambitionatttransportsektorniSverigeskavarafossiloberoender2030.Svensk energiochElforskhartolkatdettasomattdetskavarateknisktmjligtattr2030drivafordons flottanmedfossilbrnslefriaenergibrare.Manharocksgttettsteglngreochsattsommlatt transportsektornr2050skavaraheltklimatneutral. Detfinnsidagenmngdalternativabrnslensomivarierandeutstrckningrtillgngligapmark naden.Exempelpsdanabrnslenrbiogas,vtgas,etanol,metanol,syntetiskdieselochRME (rapsmetylester),ochvissakananvndasfrinblandning.Dessutomrdetmjligtattdrivafordon medel.Attbytabrnslerdockbaraettsttattminskakoldioxidutslppenfrnvgtransporter. Dettakanocksstadkommasgenomattflyttavertransportertilltg,effektiviseramotorersamt minskatransportbehovetgenomexempelvisbttreruttplaneringochsamdistribution. Nyckelord:Fossiloberoende/klimatneutraltransportsektor,samdistribution,miljbil,inblandning, biogas,vtgas,etanol,metanol,syntetiskdiesel,RME,DME,el/laddhybrid. Trafikverket: http://www.trafikverket.se/ 20

Sidhnvisningar: Areskoug,Mats&Eliasson,Per:Energifrhllbarutveckling.2012.s.94106. Vanek,Francis&AlbrightLouis:EnergySystemsEngineeringEvaluationandImplementation.s.477 522,523572.

21

6.4 Referatguide
Underkursenkommertvfrelsningarhllasomskriftligpresentationochreferatskrivning.Denhr guidenrtnktsomettkomplementtilldefrelsningarnasomettstdfrminnetochsomett frtydligandeavvadsomfrvntaspjustdenhrkursen. Referatetsomfattningskavara500600ord(varnogamedatthlladessagrnser),inklusiveen reflektionsdelpanvisattema(somlmpligenmotsvararcirka20%avtextmassan).Ytterligare anvisningaromhurduskriverettreferathittarduiSkrivboken,somocksinnehllermnga skrivtekniskatips(somnrmanskrivertalmedbokstverochnrmedsiffror,hurmanskriver frkortningarochhurmananvnderskiljeteckenetc.).venMyndigheternasskrivreglerkanvara tillhjlphttp://www.regeringen.se/content/1/c6/13/15/83/7be35768.pdf.LsocksURKUNDs plagiathandbokfrattfrebyggariskenattdintextbedmssomfuskellerplagiat. http://www.urkund.se/SE/documents/Urkunds_plagiathandbok.pdf Referatdelen Attskrivaettreferatinnebrattduterberttarinnehlletifrelsningenilpandetextochmed egnaord,sundvikalltsistrstamjligamnpunktlistorochfigurerfrnfrelsningen.Referatet skavaraskrivetpettakademisktochobjektivtsprk,ochfljakorrektformaliafrettreferat(med exempelvisreferatannonseringochreferatmarkrer).Idittreferatskadustrvaefterbdebredd ochdjup,vilketinnebrattdubrtauppdeviktigastemnensomfrelsarentagitupp,pen tillrckligtdetaljeradniv.Vaddetinnebrrsvrtattpreciseramenomdittreferatexempelvisbara tckerendelavfrelsningen,elleromduanvnder500ordfrattingendebeskrivahurensolcell fungerar,sbrdunogseverdindisposition.Dubrtnkap: attreferatetskavaraobjektivt,vilketinnebrattdetinteskainnehllangraavdinaegna sikterellervrderingar.Omfrelsarenuttryckerensiktsomduvillfrmedlaanvnderdu lmpligreferatmarkrfrattvisaattdetrensiktochattdetrfrelsarenssiktoch intedin.(Visstutrymmefrattuttryckaegnatankarochreflektionerkringmneochtema frduireflektionsdelen.) attfokuserapattfrmedlainnehlletifrelsningen,ochintepattberttahurfrelsa renframfrdedet.Detrintesrskiltrelevantfrlsarenattvetaattfrelsarenvisadede lndersomharstrstinstalleradsolcellseffektientabell,utandetrintressantfrlsaren attvetavilkalndersomharstrstinstalleradsolcellseffekt. attseverdinstyckeindelningochdisposition.Enhuvudregelrattettstyckeskafokusera pettmneelleromrde,ochnrdubytermnebyterdustycke.Detrdockinteatt rekommenderaattduanvnderstyckenpendastenmeningellerpenhelsida.Attdu byterstyckemarkerarduantingengenomattlmnaettlitetmellanrummellanstyckena (rekommenderas)ellergenomattgraettlitetindragpfrstaradenidittnyastycke.Tnk ockspattintebytaradinomettstycke. attundvikaattskrivaomoss,viochdeeftersomdetoftagertextenenngotpersonlig prgel.Detriskerarocksattblioklartvemduverkligensyftarpmeddittvi(rdetvii Sverige,ellervihrare,ellerviidenrikadelenavvrlden,ellervimnniskorellervibil gare?)

22

Referatannonsering och referatmarkrer Frattlsarenskavetaattdintextrettreferatrdetviktigtattdumeddelardetiinledningen genomattanvndaenreferatannonsering.Detinnebrattdugerlsarenvissinformationomdin kllagenomattsvarapfrgornavad,vem,nr,varochvarfr.Dinreferatannonseringbrallts innehlla: Vad?Frelsning,mne,viktigahuvudpunkter Vem?Namn,fretag/organisation,titel,ev.ngotomvadNNjobbarmed Nr?Datum Var?SLU(ochUltuna?)iUppsala Varfr?Kurs

Dinreferatannonseringskriverduhelstilpandetextochutanattvaraalltfrdetaljerad(utelmna klockslagochsalsnamn).Referatannonseringenkommeralltidfrstidintextochutgrsavcirkatv tillfyrameningar. Drefterrdetviktigtattmedjmnamellanrumpminnalsarenomatttextenrettreferat,vilket grsgenomanvndandetavreferatmarkrer.Dessabrterkommamedlmpligamellanrumochett rimligtantalkankanskevaraenperstycke,ellertretillfempersida.Dethrrbaraentumregel menreferatmarkrernaskaintevarasmngaattdestrochminskarlsbarheten,menhellerinte frf.Referatmarkrerkanseutpmngaolikasttochngraexempelr: Inledningsvisredovisarfrelsaren Frelsarenexemplifierargenomatt vilketfrelsarenmenarr Meddettaexempelvillfrelsarenbelysa somenligtfrelsarenkan

Ordetfrelsarenkaniovanstendeexempelsjlvklartbytasuttillensynonym,ellertillfrelsarens namn(dockinteendastfrnamn).Varocksmedvetenomattordsommenar,hvdar,troroch pstrantyderattfrelsarenuttrycktensikt,ochalltsintebranvndasvidrenfrmedlingav fakta. Vem skriver du fr? Detralltidviktigtatttnkapvemsomrmottagarenavdetmanskriverochanpassasintext drefter.Skrivgrnareferatetsomomduvillterberttafrelsningenfrstudentersomnyligen pbrjatencivilingenjrsutbildningmedenergiinriktning,mensomintegrdenhrkursen.Dukan alltsfrvntadigattlsarenharvissnaturvetenskapligbildningochrngorlundabekantmed mnet,meninteatthan/honharkunskapomkompliceradeprocesser/begreppochovanligafrkort ningar(utandessabrdufrklaraireferatet).Undvikocksattskrivaomandrastudiebeskoch frelsningarunderkursen(ireferatdelen). Reflektionsdelen Sistidintextskaduskrivaenreflektionsdelpanvisattema(somdugerenegenrubrikfrattvara tydligmedattreferatdelenrslut).venreflektionsdelenskavaraakademisktochformelltskriven ochvenomdufruttryckaegnasikterochreflektionersbrduundvikaattltaalltfrpersonlig (skrivalltsinteexempelvisjagtyckerochliknande). 23

Fokuserapfrelsningensinnehllochintephurfrelsarenfrmedlatinformationen.Tnkpatt reflektionsdeleninterenutvrderingavfrelsarensinsatsutandinareflektionerkringdetaktuella mnet.(Virsklartintresseradevenavsynpunkterpfrelsningensomhelhetmenframfr hellredessaikursutvrderingen.) Ibetygskriteriernastrattdinreflektionochanalysskavaraavanceradfrbetyg4,vilketkanvara litesvrtatttolka.Blandannatrdetpositivtomdudiskuterarurettsystemperspektiv,kopplartill andrafrelsningar,studiebeskellerkurslitteraturen,omdufrhllerdigkritisktillvadfrelsaren sger,ochomdudiskuterarmneturetthllbarhetsperspektiv.Resoneragrnakringdetaktuella mnetspverkanpmiljochekosystem(lokalt,regionalt,globalt)ochpdetekonomiskasystemet ochpsamhlletivrigt.Exempelpfrgordukantauppr: Vilkastyrmedelkananvndasfrattstyrautvecklingenochtvilkethllskadenstyras? Finnsdetutrymmefrstorateknikfrbttringar? Kanmaneffektiviseraoch/ellertatillvaraspillvrme? Finnsaspektersomfrelsarenmissat? Harfrelsarenrtt? Kanmansefrganfrnettannatperspektiv? Finnsdetetiskaaspekter? Vilkagruppergynnasellermissgynnas? Skavissagrupperprioriteras? Vilkenrollspelarenergislagetienergisystemet? Storskaligtellersmskaligtochvilketrbst? Passarenergislagetinietthllbartsamhlle? Pvilketsttrdetintehllbart? Finnsdetolikahllbarhetsaspekter?

Ochglmintemotiveradetduskriver!

24

6.5 Instruktion till slutuppgiften


Slutuppgifteninlmnasnrvrigamomentpkursenrklaraochgodknda.Uppstrfrgors kontaktardukursledningen. Slutuppgiften SlutuppgiftenbestriattskrivaettvldisponeratPMenligtkurslitteraturen(Skrivboken)samtp godsvenskaunderrubrikenSverigesenergisystem2030.Tankenrattduskagedinegenbildav hurdutrorattdetsvenskaenergisystemetserutinomenintealltfravlgsenframtid. Syftetmeddennaslutvningrattstudentenskavisafrstelsefrenergisystemetskomplexitetoch hurdetpverkarandraaktivitetergenomattgeenanalysochetthelhetsperspektivplandets energisystemiennraframtid.Uppsatsenskrivsindividuelltochskickassenastden12/12014till anvisadinlmningsmapppFronter.Detrviktigtattklaraavatthllaendeadlineochdrfrstngs inlmningenpangivendag(12/1)ochdrefterfrdukontaktakursledningenindividuellt. OBS!Sebetygsmatrisennedanfrvadsomkrvsmedavseendepkvalitetochkvantitetfrdeolika betygsstegen! Kllor Somkllorkanduanvndareferatochannandokumentationfrnfrelsningarnapkursensamt ppnakllorsomhemsidor,rapporter,vetenskapligaellerpopulrvetenskapligaartiklarm.m. Observeradockattdetintertilltetattraktavkopieratextfrnegnareferat! Format etc. FormatetrPMmedlitteraturfrteckningpslutet.Brdtextenskaliggaiintervallet15002000 ord.Ibrdtexteningrvarkentitelsida,innehllsfrteckning,ev.fotnoter,litteraturfrteckningeller ev.bilagor.Dettotalaordantaletkandrfrivissafallkommaattverstiga2000.Omfattningen motsvararungefr36sidortextmendetrordantaletsomrstyrande. Sprketskavaraneutraltochformellt.Reflektionsavsnittetmeddeegnaslutsatsernaskavendet skrivasiakademiskstil.Frskattundvikaalltfrpersonligaformuleringarireflektionsavsnittet(t.ex. jagtycker).Reflektionsavsnittetskavaralagomstortochutgraca25%avtextmassan.Enmall frlitteraturfrteckningfinnsiSkrivboken.Ivrigtfljsanvisningarnafruppsatsskrivningi Skrivboken. Indelning FljandedelarskafinnasmedidettaPM: 25 Titelsida(hrskavendittnamnfinnasmed) Innehllsfrteckning Sammandrag Inledandedel(hrskasyfteochfrgestllningfinnasmed) Huvuddel(vljegenrubrikfrdettaavsnitt) Avslutandedelmeddiskussion(vljegenrubrikfrdettaavsnitt) Litteraturfrteckning Ev.bilagor

Matris fr bedmning av slutuppgiften (baserad p betygskriterierna) Aspekt 3 4 5 Redovisningav Slutuppgiftenbaseras Slutuppgiften Slutuppgiftenutfrs kunskapslgeoch preferatskrivnavid genomfrsdessutom dessutommedstdav frgestllningar seminariernaunder medhjlpavbl.a. vetenskapligaartiklar. kursen. hemsidor,rapporter Tidigareforskningr Frgestllningarnar etc. utfrligtredovisad. avgrnsadeochtydliga. Frgestllningarnar Frgestllningarnar vlvaldaochrelevanta. delvisnyaoch utmanande. Analys Begrnsadegenanalys. Godegenanalysav Omfattandeoch energisystemen. teorianknutnaegna analyserav energisystemen. Formaliaoch Uppsatsenrutformad Uppsatsenrtydligt Uppsatsenrmycket sprkligutformning enligtgngsemnster, disponeradochmed vldisponeradoch godformaliaochsprk. medmycketbra acceptabelformalia Omfattningbrdtext ochsprk. formaliaochsprk. 15002000ordab. Omfattningbrdtext Omfattningbrdtext a 15002000ord . 15002000ordab. Kontrolleratutan b anmrkningiUrkund . Kontrolleratutan Kontrolleratutan anmrkningiUrkund. anmrkningiUrkundb. Tidsgrns Inom3r. Inomtidsgrnsenb. Inomtidsgrnsenb. a Innehllsfrteckning,ev.fotnoter,litteraturfrteckningochev.bilagoringrejibrdtexten. b Mstealltidvarauppfyllt Frbetyget3krvsallafyraaspekternauppfyllda(lodrtt).Frbetygen4resp.5krvstreavfyra aspekteruppfylldainomrespektivebetygsniv.Frdenaspektsominteruppfylldgllerkravenp nivnnrmastunder. Lyckatill!

26

6.6 Obligatoriska moment


Dethrrensammanstllningavdeobligatoriskamomentenpkursen.Fyllgrnaitabellen vartefterduklararavmomentenfratthllakollpdinaframsteg! SEGMENTI:Studiefrberedandemoment IntroduktiontillSLU:sdatasystem IntroduktiontillUU:sdatasystem IntroduktiontillkemipSLU1 IntroduktiontillkemipSLU2 IntroduktiontillUltunabiblioteketpSLU Frelsningomreferatskrivning1 Frelsningomreferatskrivning2 Datorbaseradsimuleringsvning SEGMENTII:Seminarierochreferat Bioenergi Solenergi Fossilabrnslen Jordbruketsenergisystem Vindkraft Metoderfranalysavenergisystem Artificiellfotosyntes Krnkraft Teknikutvecklingochenergihistoria Vattenkraft Vg,strmochvertikalaxladvindkraft Vgtransporter Metoderfrvrderingavenergisystem SEGMENTIII:Studiebeskochgrupparbete Dalaresan Studiebesk:ENAEnergi Studiebesk:Kungsngsverket Studiebesk:Grnbyvattenverk Grupparbete Presentationstillflle1,nrvaro Presentationstillflle2,nrvaro Presentationstillflle3,nrvaro SEGMENTIV:Slutuppgiften Slutuppgiften MOMENTGODKNT BETYG Rapport+presentation+ opponering KOMMENTAR

27