Sie sind auf Seite 1von 47

British Columbia

Canada

ay Lake
Kooten

Castlegar/Slocan Valley Trail/Beaver Va


Nelson/Salmo
lley/Ross
land
Intern
et

Priceless

Castlegar/Slocan Valley

1-800-663-4619

flyer

www.pennywiseads.com

INSIDE

November 18, 2014

See pages 24 & 25

Published Weekly

Your Success Is Our Success

Email: nelson@vpo.ca
www.vpo.ca

Great Gift Ideas


for the Holiday Season

OUTDOOR CLOTHING AND GEAR SINCE 1996!


624 BAKER STREET DOWNTOWN NELSON 250-3541006

Toll Free

1-877-554-1006

Ditch the shovel


and the trouble
by visiting Main
Jet Motorsports.

FOR
FO
R A LI
LIMI
MITE
MI
TED
TE
D TI
TIME
ME
ME

Honda HSS 622


Series Snowblowers

computers-tablets-displays
networking-gamer gear
iphone/mac accessories

$1,869 (MSRP $2,049)


Only $35 bi-weekly OAC

Honda HSS 724


Series Snowblowers

LARGE Print

$2,899 (MSRP $3,099)


Only $52 bi-weekly OAC

Tri-Color

Illuminated

Plus $50 freight & PDI


and $99 document fee

3 YE
YEAR
AR MAN
ANUF
UFAC
UF
ACTU
AC
TURE
TU
RER
RE
RS
R
WARR
WA
RRAN
RR
ANTY
AN
TY INC
NCLU
LUDE
LU
DED!
DE
D!

Keyboard
REG $47
ONLY

$3495

Other models available for as low as $749


708 Hwy 3A, Nelson
Ph: 250-352-3191 Fax: 250-352-3194

www.mainjet.ca
Open: Tues-Sat 8 am-5:30 pm Closed Sun & Mon
Hondas Its About Time offers apply to eligible retail purchase agreements of select models for a limited time, while supplies
last. For a limited time prices shown are only available to eligible retail customers on cash purchases, and include a discount
that is deducted from the manufacturers suggested retail price before taxes. All prices shown do not include freight and PDI or
applicable sales taxes and are not applicable in Quebec. Actual savings may vary by dealer. Promotional prices in effect until
November 30, 2014. All offers/prices/specifications are subject to change, extension or cancellation without notice. Dealer
order or trade may be necessary. Dealers may sell for less. Models and colours may not be exactly as shown. Errors and omissions excepted. See your Honda Power Equipment dealer or honda.ca/snowblowerevent for full details and eligible models.

Honda Motorcycles & ATVs Canada

@HondaPowerCA

For: Sam J. Glotz esq

Thank You For Helping Keep Our Area Prosperous!


468 Baker Street Nelson 250.354.4300
www.phoenixnelson.com

Co-op Deals

t: 250-354-4077
e: info@kootenay.coop

Prices in eect Nov 18, 2014

www.kootenay.coop

Liberte

40 off
%

Yogurt
Mediterranean

2.95

Stahlbush Island Farms

Probar

Whole Food Bar


All Varieties

2.95

500g

85g

While quantities last. For active Members only.

26 off
%

Frozen Fruits
All Varieties

3.95

225-300g

25 off
%

Exceptionally creamy probiotic yogurt. A delicious, satisfying and nutritious bar. Sustainably farmed in
made with fruits, nuts & seeds.
Free of gelatin & sugar substitutes.
Oregons lush Willamette Valley.

Teas

Edamame Beans

All Varieties

Shelled
Pods

3.35

So Delicious

Yogi Teas

McKellar Farms

4.7516bags

400g

20 off

25 off

Non-GMO &
grown in Ontario!

The highest quality ingredients


in every delicious cup.

Flora

Flax Oil

d
f i e
r t i
C e

$7.75250ml

Naka

Vital Greens

27.95

13 off

$12.95500ml

450ml

$19.95 941ml

24 off

Organic and 100% Canadian,


this Flax Oil is a good source
of plant-based Omega 3!

A liquid boost of essential green


nutrients. Energizes & detoxies
with just 1 tablespoon a day!

Guayaki

20off

d
f i e
r t i
C e

Yerba Mate

All Tea Bags Varieties

$6.9516-25bags
Traditional Loose

$7.95227g

13%off

Find a lovely
selection of gifty
items in store now!

Uplifting tea with vitamins & minerals,


15 amino acids & abundant antioxidants.

Open every day 7:30am - 9pm


295 Baker St, Nelson, BC
PAGE 2

Nov. 18, 2014

Pennywise

20 off

Coconut Milk
Coee Creamer
All Varieties

2.35

473ml

A perfect, soy-free addition


to your morning beverage.
Made with organic, NonGMO Project Veried
coconuts.

E3 Live

Frozen Liquid E3

33.95

15%off

473ml

Power On

Formerly known as Brain On!

38.95

473ml

Wild-harvested, nutrientdense aquabotanical considered to be one


of natures most benecial superfoods.

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Bulletin Board

Bulletin Board

*HARDWOOD FLOORS AT WHOLESALE: 100% made


in Canada. Hard Maple and Red Oak, Tavern grade,
solid 314x3/4 at $4.39/sq.ft. pallet. Fantastic mill run,
314x3/4 up to 6 long, $5.39/sq.ft. pallet. Prefinished
engineered exotics: Brazilian Cherry, Black Cherry,
Bloodwood, Santos Mahogany, Tigerwood, African
Walnut & Teak, from $3.99/sq.ft. pallet. Cork, 50 plus
choices from $2.49/sq.ft. pallet. Bamboo, strand or
regular. Slate, 36 choices. At Juans, 1503 Hwy 3A,
Thrums. Monday-Saturday, 9am-5pm. 250-399-6377.

10 YEAR ANNIVERSARY AT S.H.A.R.E NELSON on Dec.


13. Special deals and bake sale as well other fun stuff happening. Come join in the fun. Shop S.H.A.R.E Nelson, NEW
LOW PRICES, free pickups, 612 Lakeside Dr. 250-3521222, Support Our Daily Bread.
10% OFF INTERIOR & EXTERIOR AUTO DETAILING!
Steam clean/shampoo/hot water extraction/scratch removal/polish/wax. Dont wait, book today! On The Spot
Detailing, 1055 Columbia Ave, Castlegar. 250-608-3243.
3 YOUNG LADS collecting refundable bottles & cans. 5%
donated to BEAKS. 250-365-7371 for pick-up.
A STORAGE CO. Outside, any size from $20/mo. Covered spots,
20x12x12; dry, secure containers, 20x8x8. 250-367-9413.

2015 SALMO GOLF CLUB EARLY BIRDS now available


at Western Financial in Salmo or online at www.golfsalmo.
com. Great Christmas gift idea!

Thanks to Essilors
Perfect Pair offer,
buy one pair of Crizal
Transitions lenses and get
a second pair of Crizal
Xperio polarized lenses
for free. Details in store.

A PERFECT PAIR
deserves a second!

BUY 1 PAIR
of Criza
l Transiti
lenses and.. ons
.

Daily
activities
Outdoor
activities

FROM SEPTEMBER 1
TO DECEMBER 31, 2014

Get a
R of
2nd PAIerio

Trail Vision Care Clinic

p
Crizal X nses for
le
d
polarize

FREE

1370 McQuarrie St
Trail BC 250-364-2020

More details in store

www.trailvisioncare.ca

Ask
about our
package
Pricing

Bed

Bath Kitchen

DOWNHILL
X-Country
Back country

K2
Salomon
Fischer
Full tilt
Ski
armada
Boot
ALPINA
Fitting
Marker
Experts
Dynafit
Line
702
La
Sportiva
Baker Street,
Scott
Nelson

SALE ON ALL BATHWARE!

Shower curtains, bamboo towels,bathmats, accessories...

I t s wor t h t he d r i ve t o K a s lo
F R O N T S T R E E T, K A S L O B C 2 5 0 . 3 5 3 . 2 2 5 7
W I L L O W H O M E G A L L E RY. C O M

www.gericks.com 250-354-4622 info@gericks.com

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 3

DISPLAY ADVERTISERS INDEX


ACCOMMODATIONS

EVENTS

Days Inn Kelowna...................................20 Banff Mountain Film Festival ....................8


Quality Inn Oakwood, Spokane .............30 Selkirk College Gala .................................9
Printed in Canada. All Rights Reserved. 2014 by PFW Publications Ltd., Patty
Axenroth, Publisher We reserve the right to edit or reject submissions or advertising that
are not within our guidelines, see at www.pennywiseads.com/ed_submit.php

Castlegar Sales Rep

Silverton, New Denver Nakusp Rep

Adam Prisciak

Tara Lynne Clapp

Ph 250-505-2921
Fax 825-2206
adam@pennywiseads.com

Ph 250-353-2602
Fax 250-353-7444
tara@pennywiseads.com

Slocan Valley Sales Rep

Slocan Valley Sales Rep

Donna Nett

Peter Williams

Ph 250-352-6314
Fax 250-352-9607
donnapennywise@netidea.com

Ph 250-352-7679
Fax 250-352-7674
peterpennywise@shaw.ca

Kootenay Lake
Dental Clinic
Providing all aspects of general family dentistry in a comfortable,
caring environment. We welcome all patients and referrals.

Dr. DOUG KELLY

ANIMALS

GROCERIES

AUTOMOTIVE

HOUSEHOLD GOODS

KAAP ......................................................28 Ellisons Market ......................................12


Nelson Animal Hospital ..........................28 Evergreen Natural Foods..........................5
Kootenay Co-op ......................................2
Alfab Manufacturing ...............................38
AM Ford ................................................41
Castlegar Kia .........................................40
Champion Chev ....................................43
Colville Tire .............................................35
Glacier Honda ........................................45
Kootenay Chrysler ............................36, 37
Marios South Country Towing ...............15
McLachlan Auto ....................................44
Midas ......................................................13
Nelson Chrysler ......................................39
Nelson Ford ......................................46, 47
Nelson Toyota.........................................34
Rock Island RV .......................................42
Scrap King Auto Wrecking .....................40
Summit Subaru ................................38, 44

Home Goods Furniture...........................11

HEALTH/PERSONAL CARE
Kootenay Lake Dental ..............................4
Trail Vision Care ........................................3

NOTICES
Columbia Power .....................................13

REAL ESTATE
Castlegar Realty .....................................48
Centum Mortgage/KFS .........................32
Eagle Homes ..........................................32
Property Guys .......................................31

RECREATION

Bs Public House ....................................21


Champion Lakes Golf .............................6
Dulux Paint .............................................16 Chances Castlegar ...............................30
Gold Island Forest Products ..................20 Main Jet Motorsports .............................17
Selkirk Truss ...........................................16

BUILDING SUPPLIES

SERVICES

CONTRACTORS

HG Insurance/Heritage Credit Union .....23


Bell Lumber & Pole.................................18 Main Jet Motorsports .............................16
McLains Roofing ...................................22 Paulson Mechanical Systems ................22
Nelson Insulation ....................................26 Philip Kanigan, Notary Public...................6
Tyleen Underwood Law Office ...............19

DINING

Also, offering hospital based treatment in Nelson


(minimal wait times)

DR. KELLY KOSHEIFF


Extensive training in all aspects of dentistry including
implants and surgery
556 Josephine St, Nelson, BC 250-352-5522
info@kootenaylakedental.ca

Canadian 2 for 1 Pizza .............................6

SHOPPING

Gerick Cycle & Sport, Nelson ..................3


Secret Garden Toys ..........................24, 25
ProCare Institute ....................................26 Ted Allen Jewellery .................................14
School District 8 .....................................27 Valhalla Pure Outfitters .............................1
Selkirk College ...................................4, 26 Vince DeVitos Shoes & Orthotics ......4,10,30
Willow Home Boutique.............................3

EDUCATION

ELECTRONICS

Andres Electronic Experts ......................7 TOOLS & EQUIPMENT


Phoenix Computers..................................1 Bart T 5 .................................................33
Impact Equipment Ltd............................18
ENERGY
Kootenay Industrial Supply ....................21
Backwoods Solar ..................................18 Main Jet Motorsports ...............................1

SAFETY IN RESOURCE INDUSTRY:

Forestry Training
Get ready for entry level forestry work now!
Make your resume stand out!

FREE!

INFORMATION SESSIONS -

for qualified
applicants

CRAWFORD BAY

NELSON

Oct 15, 6:30 pm


Learning hub

Nov 6, 6:30 pm
Silverking Campus

NAKUSP

SALMO

Oct 27, 12:00 pm


311 Broadway St

Oct 28, 6:30 pm


Salmo Secondary School

SLOCAN

YMIR

Nov 20, 6:30 pm


W. E. Graham School

Oct 28, 4:30 pm


Location: TBA

For more information, email pbt@selkirk.ca.

now in...
Mens viberg
wool sweater
rs
super
gifts

only

$109

80% wool / 20% nylon, sizes small to


XXL, two styles, button or collar, black or
grey...a heavy duty version of a Stanelds!

411 HALL STREET, NELSON


selkirk.ca/ce/pbt
PAGE 4

Nov. 18, 2014 C

250-352-6261
TOLL FREE 1-800-337-1622
www.vincedevito.com

1-800-663-4619

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Bulletin Board

Bulletin Board

AFFORDABLE & SECURE HOUSEHOLD STORAGE:


10, 20, & 40 units available. Kootenay Containers Sales &
Rentals, Castlegar, 250-365-3014..
ALLIGATOR PIE CATERING: From weddings to business
meetings & everything in between. Award winning service.
Like us on Facebook to see whats cooking! 250-3526115, www.apcatering.ca, alligatorpie@telus.net
ALTERATIONS & CUSTOM BLINDS: Helenas in Stitches,
250-368-5493.
APPLEWOOD MASSAGE THERAPY & HAIR STUDIO:
Paul Chernoff, Registered Massage Therapist, injury related treatments, deep tissue therapy, ICBC, RCMP, VA, MSP.
Karen Simpson, Stylist, specializing in consultation, style &
colour suitability. For appointments, please call 250-3657752 or 250-608-7752(cell). 785 Silverbirch Lane, in the
Oglow Subdivision, Castlegar..
ARE YOU FEELING STUCK IN SOME AREAS OF
YOUR LIFE? Do you tend to focus on what you cant instead of what you can do? Do you feel the desire to do
more fulfilling work? Are you trying to be a successful entrepreneur, a good wife and a super mom at the same time
and feeling constantly overwhelmed? Are you looking for
more joy and happiness? Call life coach Birgit Treipl. I offer
a free one hour exploratory session to see if were a good
match. Cell: 250-353-1597 and visit: www.birgittreipl.com
Life is short! Live it!
AUTOMOTIVE & SATELLITE SPECIALS/SALES; Ford/
GM alternators/starters from $55. Also, brake relining. Direct TV available. 250-365-3313.
BRIDAL REGISTRIES AT BEAR COUNTRY KITCHEN,
Rossland. Open 7 days. 250-362-3355. Like on Facebook.
BRILLIANT MINI HOUSEHOLD STORAGE: First class,
economical, 5 min to Castlegar, long-term discounts. 250365-2774.
CAMPBELLS DECOR: Painting & Decorating Services.
30yrs experience, reliable, quality work, colour consultations, interior repaints. Certified journeyman w/Red Seal.
250-687-4671..
CANADIAN 2 for 1 PIZZA: 1474 Bay Ave, Trail 250-3683684; 1004 Columbia Ave, Castlegar 250-365-3244. $5
discount coupon in display ad in this issue. Pizza, pasta,
ribs, chicken.
CASTLEGAR CUSTOM PICTURE FRAMING and GIFT
IDEAS: At Dragonflies and Fairy Dust, 15-1502 Columbia
Ave,(next to Dollarama). See Nadia 9:30-5:30pm, Thursday-Sunday, 250-304-6999.
CASTLEGAR HOSPITAL AUXILIARY TREASURE SHOP
210-11 Ave. 1st floor: furniture, mens clothing, family
footwear, housewares, sporting goods, books, craft supplies, fabric & much more. 2nd floor: amazing womens
& childrens clothing. Monday-Thursday, 10am-4pm, Friday, 10am-2pm, Saturday, 10am-4pm. 250-365-7317.
CONCRETE GRAVEL, sand, drain, road and landscaping
rocks. Recommended by customers! Yvon Couture, 250355-2518.
DAVES U-CUT CHRISTMAS TREES: $45, any shape or
size. CASH ONLY. 2826 Highway 6, Slocan Park. Contact
dkanderson58@gmail.com or call 250-445-6112. Follow
us on facebook @ Legendary Christmas Tree Farm.
DR. McKENZIE, CHIROPRACTOR at SLOCAN PARK
MEDICAL CLINIC: Hours: 2:30-7pm, Thursdays. 250226-7989.

ELLISONS CHRISTMAS TABLE is coming November


20th! Christmas Cakes - Gingerbread - Pfeffernusse Cookies and more! 523 Front St, Nelson, 250-352-3181.
FREE BUSINESS COUNSELLING FOR NEW & EXISTING BUSINESSES. A Community Futures representative
will be at Castlegar City Hall, Wednesday, Nov. 5, 12, 19
& 26. Call 352-1933 x100 for an appointment. Community
Futures offers business loans, business workshops, resource library, Self-Employment Program, 1 on 1 business
counseling and Basin Business Advisors Program! www.
futures.bc.ca
HERITAGE CREDIT UNION: Castlegar 250-365-7232,
Slocan Park 250-226-7212. Thinking loans? Well make
it simple. HG Insurance, Castlegar 250-365-3368, Slocan
Park 250-226-7216; home and auto - better service, great
coverage, competitive price.
MICHAEL SMITH, Dr. TCM, FMC has moved his practice
to 385 Baker St. Offering services in Acupuncture, Chinese
medicine, Nutritional & Functional medicine. Over 17yrs
experience with a focus on digestive problems & autoimmune diseases. 250-352-0459.
NELSON HEALING ROOMS: Wednesdays 7-8:30pm,
711-10th St, Eleos Centre, no appointment necessary.
250-352-0300.
OVERBURDENED WITH DEBT? G.Moroso & Associates, Trustee in bankruptcy, situated locally, offers friendly,
confidential services to help with financial problems. Call
Anna, 250-365-1035 for a free consultation.
Are you looking to INVEST. LIVE. VISIT. SHARE. WORK.
PLAY. www.pennywiseads.com Where the locals do it.

16th annual

FRESH
CROP
Dried Fruit & Nut SALE
Nov 21- Dec 1

Supreme Quality
& Freshness
Exciting &
Unique Products
Perfect for Holiday Baking
& Gift Giving
For the first 3 days of our sale
(Friday, Saturday & Sunday)
we are offering an Extra HOT

 ] 
 
pre-order deal for full cases of
5
ORGANIC
  << Almonds, Raisins & Sunflower Seeds
call store for details

1290 Hwy 6, Crescent Valley


OPEN DAILY

Like us on Facebook

250-359-7323

A scenic 20 minute drive from Nelson or Castlegar

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 5

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Bulletin Board

Bulletin Board

PHILIP KANIGAN, NOTARY PUBLIC: 2009 Columbia


Ave, Castlegar. 250-365-2289, www.castlegarnotary.com.
Affidavits, mortgages, health directives, wills, real estate
transfers, business purchases and sales.
PINETREE MARKET NOV. SPECIAL: 20% off 15lb bag,
Grain Free Dog Food. 1884 Pass Creek..
SAVE THE SALMO GOLF COURSE FUNDRAISER
DANCE at the Salmo Hotel. Saturday, Nov. 29. Doors Open
at 7pm. Minimum $5 donation. Fun games, prizes, DJ and
Karaoke. The course will receive a portion of all drink sales.
$500 elimination draw at 9pm. Draw tickets available now
at the Salmo Hotel or call 250-505-4663.
SHARPENING SERVICE: Saws, tools, scissors, knives,
clipper blades. C&D Sharpening Service, 250-365-3658.
SLOCAN CURLING CLUB IS LOOKING FOR NEW
MEMBERS for the coming season. Teams and individuals
welcome. Fee is $100 per membership. Call Randy at 250226-6959 or Lorne at 250-355-2688 to join today!
SMALL ENGINE REPAIR: Pick up & delivery available, lawnmowers, rototillers, garden tractors, etc.
250-368-5219.
SNOW REMOVAL, 24-HR TOWING, OLD CAR REMOVAL...Used auto parts, certified welding. Smokey Creek Salvage, South Slocan. 250-359-7815/1-877-376-6539.

SNOWBLOWER AND CHAINSAW SERVICE available at


Westside Small Engines & Rentals, Hwy 6, Passmore. 250226-7145.
SPECIALTY FILTER MEDIA: Bulk carbon, silica gel, potassium permanganate. Columbia Filter Ltd. Phone 250364-2510, fax 250-364-2722.
STILL EAGLE IS 23! Win a $230 gift basket, AND visit our
Anniversary Weekend Sale Friday-Saturday, Nov. 22-23:
23% OFF EVERYTHING! 476 Baker.
TIME FOR MERINO: Get awesome merino wool scarves
at Still Eagle, all I/O Merino permanently discounted at
25% off! 476 Baker.
TRAIL VISION CENTRE: 1370 McQuarrie St, Trail. 250365-2020, www.trailvisioncare.ca. Buy one pair, get one
free, Sept 1 to Dec 31.
VITAMIX BLENDERS NOW IN STOCK at Bear Country
Kitchen, Rossland. Open 7 days. 250-362-3355.
WESTSIDE SMALL ENGINES & RENTALS: For rent... tillers, post hole augers, wood splitters, scaffolding, pumps,
generators, cement mixers, plate tampers, etc. Hwy 6,
Passmore. 250-226-7145.
WHOLE SCHOOLS 16th ANNUAL COFFEE HOUSE: Call
out for musicians! Saturday, Nov. 29, 5-10pm at the Winlaw
Hall. Would you like a chance to get up on stage in support
of our amazing school? We would love to have you! Please
call Tamara at 250-355-2855.
WHY SUFFER FROM PAIN, SWELLING AND DISCOMFORT IF THERE IS A SOLUTION? Consider the latest in
cold pulsed laser technology today. It has 10x the strength
of the other machines, penetrates to 4 inches, breaks
down calcifications or scar tissue and stimulates healing
and repair of the area. For plantar faciitis, sports injuries or
any other discomfort, consider a free laser consultation to
see if this treatment is for you! Call Dr. Brenda Gill at 250362-5035 in Rossland today!
WRIPS.COM Productions Promotional Services for any
size Business, Event, Cause, Purpose. Broadcast Quality
Audio, Video, Photography. Contact WRIPS.COM
WANT TO SEE MORE BULLETIN BOARD ADS?
Visit: www.pennywiseads.com

Member

$IGDYLWV0RUWJDJHV
+HDOWK&DUH'LUHFWLYHV
3RZHURI$WWRUQH\:LOOV
5HDO(VWDWH7UDQVIHUV
%XVLQHVV3XUFKDVHV 6DOHV

3KLOLS.DQLJDQ

BSc, DMD

1RWDU\3XEOLF,QF
A name you can trust

Subdivisions Mediation Representation Agreements

2009 Columbia Ave, Castlegar, BC Tel. 250-365-2289


Fax 250-365-2275 www.castlegarnotary.com

SPECIAL COUPON FOR YOU!!


Bring in this
Coupon for a

DISCOUNT
One coupon per customer

PIZZA
PASTA
RIBS
CHICKEN

Pick Up
Eat in,
Delivery
Your Choice!

Special valid at Trail & Castlegar locations with coupon only until November 30, 2014.
Not to be combined with any other offer.
Full menu is in the Better Book phone book and at www.canadian2for1pizza.com

Traila

Castlegar

250-368-3684

250-365-3244

1474 Bay Ave

1004 Columbia Ave

Delivery is Available in Castlegar and Trail Areasa

PAGE 6

Nov. 18, 2014

WARNING!
Reading this willl make you
want to start swinging
Professional GOLF SHOP
COMING SOON
to Waneta Plaza for your
Christmas needs!
2015 merchandise will be available as
well as many other golng products
including Taylor Made, Adidas,
Callaway, Adams, Titleist, Foot-Joy,
and many more.
We also carry Asham curling products.

Now Open at the Waneta Plaza


7 days a week

Champion Lakes Golf


www.golfchampionlakes.com 250-367-7001 877-900-7030

= view picture of this item on our website: www.pennywiseads.com

129888

EX
PE
RT
IS
E

ER
W
PO

P
R
IC
E

NG
YI
BU

CO
M
M
U
N
IT
Y

WE WILL NOT BE BEAT!


TELUS KIOSK

CASTLEGAR

CRANBROOK

200-1965 Columbia Ave. 101 Kootenay St. North


(250) 365-6455
(250) 426-8927

NELSON

KELOWNA

WEST KELOWNA

Chahko Mika Mall


(250) 352-7258

2153 Springfield Road


(250) 860-2600

#200 - 2180 Elk Rd.


(250) 707-2600

Pennywise

Nov. 18, 2014

PAGE 7

All classified ads may be viewed at www.pennywiseads.com

Bulletin Board

Bulletin Board

VITAMIX BLENDERS NOW IN STOCK at Bear Country


Kitchen, Rossland. Open 7 days. 250-362-3355.
#1 STORAGE FACILITY....WEST KOOTENAY SELF STORAGE:
Household, RV, commercial. 2820 Osachoff Rd, South Slocan.
250-359-5085/1-877-359-5085, www.wkselfstorage.com
2015 GEAR FOR SNOWMOBILERS!! Come and see the
latest sled gear from Klim, MotorFist, 509, SnowPulse and
BCA. Main Jet Motorsports, 250-352-3191. www.mainjet.ca
40% OFF all PERSIAN & TRIBAL RUGS. 402 Baker St,
Nelson, Tuesday-Saturday, 10am-4pm.
A SALE ON BATHWARE AT WILLOW!! Shower curtains,
bamboo towels, bath mats, accessories. Its worth the drive
to Kaslo. 250-353-2257, www.willowhomegallery.com
ALL THINGS VACUUM: New, reconditioned, Canavac
built-in, repairs, supplies, The Vacuum Shop, 953 Spokane-Trail. 250-231-6041.
ARE YOU READY FOR WINTER? We are, here at Arrow
Building Supplies. We have PREMIUM OKANAGAN WOOD
PELLETS and 70lb SAND BAGS in stock! 250-365-2175.
BALFOUR EQUIPMENT & RENTAL CO. is closing for
retirement. Sale of equipment and tools will be available
Monday-Friday from 10am-3pm! For inquiries please call
ahead, 250-229-5771.
BEEKEEPING GEAR! Boxes, clothing, etc. Kootenay
Beekeeping Supplies, 250-365-5454. kootbees@shaw.ca,
www.kootenaybeekeeping.com
BIG EVENT TENT RENTAL: Weddings, reunions, special
events. Great service and rates. bigeventtent@gmail.com
www.bigeventtentrental.com 250-551-5645.

BLACK FRIDAY SALE: On all Pfaff, Brother & Bernina


sewing machines & Sergers at Heritage Sew, 1-800-7395151, 250-229-4030.
BLUE SKY CLOTHING, NELSON: Weekly feature 30%
off. Come and see. New wool coats have arrived. www.
blueskyclothingco.com
BLUNDSTONE CSA WORK BOOT: All day comfort, pullon kick-off convenience. Vince DeVito Shoes & Orthotics,
411 Hall St, Nelson. 250-352-6261, 1-800-337-1622.
CASH FOR GOLD & SILVER: Out-of-town buyers often
give 20% of value. Max the Jeweller gives 66%! 507 Baker
St, Nelson. 250-354-0242.
CHRISTMAS LIGHTS; GARLAND; SANTA SUITS &
HATS; ice melter; shovels. Gadgets & More, downtown
Trail. 250-364-0404.
COLLEEN NAHNYCHUK TAX PREPARATION AND
BOOKKEEPING: By Appointment. 250-551-7054, fax
1-888-370-4938 or email: cntaxprep@gmail.com
CRAZY SELECTION: NEW/USED BOOKS, new vinyl records, stereo equipment, comics, GIFTS. Eclectic Circus,
250-352-6569.
CUSTOMER APPRECIATION DAY: Saturday, Nov. 29,
from 12-5:30. Come in for great pre-Christmas savings on
everything! In-store only, no rain cheques. Isis Essentials,
582 Ward St, Nelson.
DAYS IN KELOWNA: www.daysinnkelowna.com,
salesdesk@daysinnkelowna.com. Shop n Stay special
$72 until Jan 31, 2015.
DUCT CLEANING: Best method available, brush & power
whip. Local K.F. Kootenay Furnace, Slocan, 250-355-0088.
DULUX PAINT: 410 Stanley St, Nelson. 250-352-9411.
Save $10 on Dulux Lifemaster, Nov. 3-Nov. 30.
ELECTROLUX SALES & SERVICE: Central vacs, canisters, uprights, carpet shampooers. Call Terry Hanson, 250-825-9371.
FULL SERVICE AUTOMOTIVE: Repairs/diagnostics all
makes and models, free customer drop off/pick up within
Nelson. Herbs Alignment & Mechanical, 250-352-3626
www.herbsalign.ca
GETTING MARRIED? Ceremonies, Reception & Four Star
Accommodation Packages in 1 spectacular setting! www.
kootenaylakeviewlodge.com 1-877-229-4141.
GOGH VAN CUSTOM FRAMING CHRISTMAS IDEAS!
Fabric art, shadow boxes & photo framing. 550 Baker, Nelson. 250-352-6001.
HUNTER DOUGLAS BLINDS SALE: Save up to 40% on
cellular, horizontal, vertical and more. DULUX PAINTS,
250-352-9411.
ITS NOT ALWAYS EASY TO SPOT PHONE SCAMS, and
new ones are invented every day. If you suspect that you
may be a target of fraud, or if you have already sent funds,
dont be embarrassed...youre not alone. If you would like
to report a fraud or if you need more information, contact
the Canadian Anti-Fraud Centre at 1-888-495-8501 or
www.antifraudcentre.ca
KODIAK SHARPENING: Specializing in carpentry/garden
tools. Pick-up/drop-off: Home Hardware Nelson/Castlegar/Trail; Mitchells Castlegar, Maglios Trail. 250-352-9703.
KOOTENAY CURRENCY EXCHANGE for all your foreign
currency needs. Currency for over 40 countries in stock.
We buy pre 1966 Canadian coins. Canadian gold & silver
Maple Leaf coins available. Visit 715 Vernon St, Nelson.
9am-5pm. Call 250-354-1441.

Capitol Theatre
Nelson
Thurs, Fri, Sat Nov 27, 28, 29
7:00 pm Nightly
Presented by

SNOWPACK

Tickets available online at www.capitoltheatre.bc.ca


or at Snowpack (3-night passes only)
Tickets $20 ~ Three night pass $45

Your Adventure...
Our Gear
333 Baker St. Nelson 250-352-6411
1-87-SNOWPACK www.snowpack.ca

PAGE 8

Nov. 18, 2014

= view picture of this item on our website: www.pennywiseads.com

All classified ads may be viewed at www.pennywiseads.com

Bulletin Board

Bulletin Board

KOOTENAY INDUSTRIAL SUPPLY: 323 Vernon St, Nelson.


SNOWPACK PRESENTS the Banff Mountain Film Festival. Nov 27, 28, 29 Capitol Theatre, 7pm nightly. See dis250-352-5301; 2181 Columbia Ave, Castlegar 250-304-2900,
play ad for details.
www.kootenayindustrialsupply.com. Closed for inventory Saturday, November 23. Sorry for any inconvenience.
TANGO PLEASURE MATE COLLECTION: The ultimate
all-in-one pleasure set, for all kinds of fun! New from WeKOOTENAY WOODSTOVES HAS YOUR HEATING
vibe. $189. Available at Isis Exotica, 582 Ward St, Nelson.
NEEDS COVERED: New or existing W.E.T.T. inspection or
www.isis.ca
installation. Call now to arrange an inspection or an estimate. kootenaywoodstoves@gmail.com 250-352-2001 or
TRY E-CIGS NICOTINE OR NON: See what vaping is all
KootenayWoodstoves.com
about. Now 4 locations to serve you: Sound West, 1696
2nd Ave, Trail, 250-364-1817; Phoenix Computers, NelLUNCH AND SWIM SPECIAL... #CHEWSDAY: Tuesdays
son; Castlegar Computers and Source, Grand Forks.
from Sept. 30-Dec. 16 at The Springs Restaurant. Order
Lunch (over $10) and receive one half price single entry to
TYLEEN UNDERWOOD LAW OFFICE, Family Law/Crimithe Hot Springs Cave and Pools. Lunch is served 11amnal Law. 507 Baker St, Nelson 250-352-6638. Valuable le4pm Ainsworth Hot Springs Resort, 1-800-668-1171 www.
gal advice.
facebook.com/AinsworthHotSprings or tweet us @ahsr11
VIDEO, FILM, AUDIO, PHOTO, DIGITAL SERVICES:
ME INC. WORKSHOPS. Have you ever wondered about
Transfers, Conversions, Duplications of movie film, slides,
becoming an entrepreneur? Taking your training or skills
photos, audio & video tapes, DVD/CD/BLU RAY. www.
to a new level and running your own show? Launching a
tmtv.net email: videolab@tmtv.net Call Toll free 1-800-824start-up? Maybe buying a business and running it? The
8688 Nelson, 8am-5pm Monday-Friday.
free Me Inc. Workshop is designed to answer your quesWHETHER BUILDING NEW OR RENOVATING: A
tions. In just 1.5 hours we will review critical decision
mini split heat pump handles your heating/cooling
points for making the transition, provide industry insights,
needs to -17C. No ducting, professional installation.
support resources and other details like: what it is to be an
www.mini-splits.ca 250-687-1892, 250-442-5574.
entrepreneur (pros/cons/lifestyle considerations); types of
business entities (for profit, non-profit, co-ops); business
WOOD, ELECTRIC, OIL HEATING: Blaze King, Valley
models (brick and mortar versus online); product types
Comfort. WETT certifications, consultation. K.F. Koo(pros, cons); common pitfalls and motivations and how to
tenay Furnace, Slocan City, 250-355-0088.
get started (support services, best practices). Please join
YOU DREAM IT-WE CAN BUILD IT! You break it-we can
us for this free, informative workshop. Workshops are at:
fix it! The best in custom metal fabrication for 25 yrs and
6:30-8pm local time. Castlegar: Nov. 18; Cranbrook: Dec.
counting. Zap Welding, 250-352-6978.
2; Nelson: Dec. 9; Trail: Dec. 16. Register online at www.
bbaprogram.ca/basin-business-advisors/workshops/ or
call us toll free to register by phone at 1-855-510-2227.
Pre-register 2 days prior to ensure you get a seat and to
avoid cancellation.
MIDWAY STORAGE: Covered units available in Genelle.
Please call 250-231-2346.
MOBILE NAIL SERVICE for the West Kootenay area. Sets
start at $45. Call/text 250-784-8710.
NEW! HUNTER DOUGLAS WINDOW COVERINGS at
Nelson Home Building Centre. Free installations and inhome consultations, ask for details. 101 McDonald Dr,
250-352-1919.
ORTHOTICS: Effective solutions for heel pain, arch pain,
heel spurs, bunions, Extended Health/ICBC/WCB/DVA eligible. Call DR. LIH, PODIATRIST, 250-304-4792.
PACKRAT ANNIES: New releases by Frazey Ford and
Robert Plant. We special order CDs & Vinyl for you. 411
Kootenay St, Nelson. 250-354-4722.
PET BREATH KNOCKING YOU OVER? Canine/Feline
Oral Hygienist (no anesthetic) Friday, Nov. 28, Tails Pets,
Rossland, 1-888-764-5959; Barks & Recreation, Trail,
1-888-764-5959; Sindys Dog Grooming, Salmo, 250-3579956; Saturday, Nov. 29 Two Greyt Grams Pet, Castlegar.
250-365-5605.
QUALITY INN OAKWOOD, SPOKANE: 919 N Division
St, 1-888-353-4900, www.QualiytInnOakwood.com.
$84.00 US per night Sunday to Thursday. See display
ad for details.
SECRET GARDEN TOYS has great gift ideas for this holiday season. Playmobil, Schleich, Klutz, Ravensburger
and much more! See display ad for details.
SNOWBLOWER FRICTION DISC; SHEAR PINS;
belts; ice melter. Gadgets & More, downtown Trail.
250-364-0404.
Nov. 18, 2014
PAGE 9
 = view picture of this item on our website: www.pennywiseads.com

All classified ads may be viewed at www.pennywiseads.com

Merchandise For Sale

Merchandise For Sale

BAMBOO: Bamboo sheets, blankets, duvet covers, towels,


socks, etc. Mother Natures, downtown Castlegar, 250-365-7750.
COAST SPAS HOT TUB SALE ON NOW! Huge savings
at Kootenay Outdoor Living, 2910 Highway Dr, Trail. 250368-5552.
DELUXE AQUARIUM: 60 gallons, Fluval 405 filter system,
lighted canopy, water features, fish and much more. Retail
$800, asking $150. Come and look. 250-353-2675.
ELECTRIC SCOTTY DOWNRIGGER: 24 fixed boom, w/rod
holder; mobile booster pack, 700 cranking amp. 250-364-1094.
GLUTEN FREE BREADS, MUFFINS, BROWNIES, pizza
shells, baking mixes, etc. Mother Natures, downtown Castlegar. 250-365-7750.
GO GREEN IN 2014: Air source heating and cooling, energy efficient, no ducts needed. 250-505-8209, 250-3572770, www.canadianaerothermal.ca

GRANITE & QUARTZ COUNTERTOPS by The Kitchen


Connection. Free estimates. 250-505-3806.
HYDROPONIC STORE, TRAIL: Newly expanded product
lines. 2910 Highway Dr. 250-368-5552.
KITCHEN CONNECTION... custom designs to fit your
home. Showroom appointments. www.kitchencraft.com
250-505-3806.
KOOTENAY SPRINGS SOFTUB: Offering all the West
Kootenay Canadian made new & used softubs, spa chemicals (including low Cl Nature2) and service! Call 250-3548557 in Riondel, www.softubcanada.com
LIKE NEW BRIGGS & STRATTON GENSET: Starts at
8500W, runs at 5500W, $700obo. 250-226-7517.
NINE 18 LOAD RANGE-E TIRES: 5 - 275/70, 4 - 275/65,
$450/all; 1 jumping saddle; Wintec Western Saddle; misc
horse blanket; Kenmore dishwasher, like new; kitchen table, w/chairs; car roof carrier. 250367-9150.
PERRY RIDGE PANELING: Manufactured cedar, pine, clear larch
building products. Siding, decking,
T&G, V-joint, moulding and other
products. Call 250-226-7530.
PROPANE: Water heaters, heating
appliances, fridges, 3-way coolers,
stoves, cylinders new & used. 250359-5922 or jim@jemsgas.com
SOOTHING
&
LUXURIOUS
BATH ACCESSORIES at Willow
Home Boutique in Kaslo. Treat
yourself - all bathware is on sale!
STEEL SHIPPING CONTAINERS
FOR SALE/RENT: 20 & 40 sizes.
Kootenay Containers, Castlegar,
BC. 250-365-3014.

Antiques
....ANTIQUE AFFAIR ..... Rugs,
lamps, mirrors, chests, tables,
chairs, paintings, prints, jewellery,
pottery, glass, china, tins, sheet
music, postcards, etc. 412 Davies
Ave, Salmo. Open 10am-6pm,
Wednesday-Saturday..
ANTIQUE SLEIGH BED: Double (92x55), $250. 250-226-7350,
please leave msg.
OLD KOOTENAY MAPS WANTED by local collector. Town plans,
early maps of the Kootenays etc.
1880s-1940s. 250-551-3000.

Arts & Crafts


2 BEAUTIFUL PAINTINGS
by renowned artist, Alf Crossley.
Wonderful Christmas Gifts! Contact: mvbadjads1@gmail.com

Building Supplies
*PETERS WINDOWS & DOORS:
The biggest, littlest door & window shop in the Kootenays. 1435
Hwy 3A, Thrums. 250-399-0079.
PAGE 10

Nov. 18, 2014

= view picture of this item on our website: www.pennywiseads.com

SALE ON

BLACK FRIDAY

NOW
Ends Nov. 30!

blowout

SAVE UP TO 60 %
storewide!

*ALL SOFAS & LOVE SEATS

25% - 60%

OFF

30%

OFF

*ALL DINING ROOM FURNITURE

25% - 60%

OFF

*ALL MATTRESSES

45% - 60%

OFF

*ALL ACCENT FURNITURE

25% - 60%

OFF

*ALL BEDROOM FURNITURE

25% - 60%

OFF

*ALL LA-Z-BOY RECLINERS

25% - 60%

OFF

*ALL HOME DECOR ACCESSORIES

SAVE 30% & MORE WHEN BUYING CHAIRS BY THE PAIR


*ALL COFFEE & END TABLES

25% - 60%

OFF

*ALL MAJOR APPLIANCES

10% - 35%

OFF

EVERY ITEM IN OUR GIGANTIC


SHOWROOM IS SALE PRICED!
* This sale cannot be combined with any other offer.
* Product is limited to stock on hand.
* Product is subject to prior sale.
Located at China Creek halfway between Trail and Castlegar
Phone 250-693-2227 Toll Free 1-877-693-2227
FURNITURE WAREHOUSE
Fax 250-693-2388 See us on Facebook!
& APPLIANCE CENTRE Check out our new website: www.homegoodsfurniture.com

HOME GOODS

Pennywise

Nov. 18, 2014

PAGE 11

Pet Foods
Garden Supplies
Natural Foods Caf

Organic Produce
Groceries
Bulk Foods

HEALTHY CHOICES
fied
Certi anic
Org

FOR OUR COMMUNITY

PRODUCE SPECIALS

NEW! Kienna Coffee

Single Brew Compostable Pods

Mixed Winter Squash Broccoli


Red/Romaine Lettuce Lemons
BC Jonagold Apples Grapefruit

Use with Kienna Cup


Reusable Pod Adapter
in your Keurig Brewer.

SPECIAL

10% OFF!
ELLISON'S
IHI
Bulk Xylitol IHI
Christmas TableTH
is back!
Perfect for your
holiday baking.

SAVE
$4/kg

BAKING SALE Ends Nov. 18


...But the specials continue!
Save On:

IS COMING NOVEMBER 20

Frontier Organic
CINNAMON
$4 OFF, 454g

Christmas Cakes Gingerbread Stollen


Pfeffernusse Cookies Turkish Delight
Chocolates and more!

SUGARS: Coconut, Cane,


Sucanat Organic & Demerara
Up to $3.00 OFF per kg

IHIHIHI
FROZEN
NEWPET
FOOD
Complete
Meals

HORIZON
Complete Dog Food

CANADIAN NATURALS
Senior Dog Food

Puppy, Adult & Senior

For Senior Dog Month!

$5 OFF 11.4kg

$5 OFF

PET FOOD SPECIALS


Natural Balance Dog Food
20% OFF small bags
Natural Balance Cat Food
20% OFF small bags

Natural Balance
Venison & Sweet Potato 6.81kg

$5.00 OFF

Duck & Potato 5.8kg

$5.00 OFF

Natural Balance Cat Food


15% OFF pouches

Natural Balance
Dog Food cans 6oz & 13oz

NEW Natural Balance

While quantities last

BUY 2 GET 1 FREE

KANGAROO DOG FOOD Lean Protein, Grain Free. For Pets on a Limited Diet
Join us for our workshops at 10am every Saturday: Nov. 22: Intro to Bio-Feedback - Understand your body & discover balance with Brian McArthur
Ellisons Acoustic Music 1-3pm
Your Local Indoor Market Mon - Sat 9am 6pm 523 Front St, Nelson 250-352-3181
PAGE 12

Nov. 18, 2014

Pennywise

To Place Your Ad Call 1-800-663-4619

Merchandise For Sale


Building Supplies
*GOLD ISLAND FOREST PRODUCTS LTD: 2896 Sentinel
Rd, South Slocan. 250-359-7000. Specializing in Douglas fir
and cider. Kiln dried and planed timbers, cedar decking, fascia and siding. Douglas fir panelling, flooring and clear trim.
HARROP-PROCTER FOREST PRODUCTS: Your local
source for sustainably harvested building materials. Timbers, decking, siding, paneling, fencing, flooring and a
wide variety of cedar lumber. We also custom cut to order.
Make the green consumer choice by supporting BCs only
Eco-Certified Community Forest. Check out our products
& story at www.hpcommunityforest.org. Free local delivery on minimum orders. Call 250-551-5452 for a quote.
Monday-Friday 8am-4:30pm & Saturday 9am-3pm.
www.SelkirkTruss.com. Call us now to order your metal
roofing. 250-359-7000.

Tread With Condence


This Winter.

Good

Westlake Tires
Your affordable winter tire alternative.

Tools

84

ALL MACHINED CAST IRON TABLE SAW: 26x18,


10amp, 115-230v, 3/4hp motor, c/w accessories, $170.
250-365-7382.
HURRY! Great buys till the end of November on new Honda snowblowers at Main Jet. See ad on front page of this
paper.
DELTA BAND SAW: 2spd, 14 throat, 16x16 cast iron
table, $800. 250-367-9890.
SELL YOUR STUFF! Got too many things lying around
the house? Sell it! turn your trash into cash - fast! Dont
delay, do it today! 1-800-663-4619.

Better

.95
Per tire. Plus tax.
For Westlake SW606
tire size P195/65R15.

Winterforce Tires
.61
$

102

Best

Per tire. Plus tax.


For Winterforce
tire size P195/65R15.

Blizzak Tires
Get a $70 Bridgestone
Prepaid Visa Gift Card.*

Apply Now for Local Environmental


Conservation and Restoration Project Support

By mail with the purchase of four eligible Bridgestone Blizzak tires.


Offer valid Oct. 15 - Nov. 30

126

.64

The Waneta Terrestrial Compensation Program


provides up to $50,000 annually to projects in the
Waneta area that have a terrestrial ecosystem focus
and benefit the natural environment.

Per tire. Plus tax.


For Blizzak WS70
tire size P195/65R15.

Eligible projects include: research, species


inventories, educational programs, development of
management plans, habitat creation (restoration,
rehabilitation), weed control, habitat protection
and land acquisition.
The deadline for submissions is January 31, 2015.
Visit columbiapower.org/WTCP for an application
package and more information.

columbiapower.org/wanetaexpansion

618 Lake Street 250-354-4866

Installation extra. Tire balancing and disposal extra. Plus shop fee of up to 10% based on non-discounted retail
price, not to exceed $35.00, where permitted. Void where prohibited. Not valid with other offers. See participating
stores for details. *Offer valid in Canada at participating Midas stores. Issued in the form of a $70 Visa Prepaid
Card. Prepaid cards are issued by Peoples Trust Company pursuant to a license by Visa Int. The card is given to
you as a reward and no consideration, value, or money has been paid by you in exchange for the reward card. Card
is not transferable and cannot be issued to minors. Country restrictions apply and are subject to change. Card
terms, conditions, and limitations apply. Rebate prepaid card does not have cash access and can be used at any
merchants that accept visa cards. Sweepstakes card valid for up to 6 months, unused funds forfeit at midnight est
the last day of the month of the valid thru date, subject to applicable law; see myprepaidcenter.com/site/visa-atmcan for details. Eligible tires must be purchased from a participating Midas between October 15 and November 30,
claim/entry forms must be postmarked or submitted online at BridgestoneRewards.com by December 10, 2014.
If submitted via mail, claim/entry form must be received by December 19, 2014. Not valid with other offers. See
manager or ConquerTheCold.ca for complete details. Visa is not a sponsor of this promotion. Blizzak DM-V1,
Blizzak DM-Z3, Blizzak LM-25 RFT, Blizzak LM-25 4x4, Blizzak LM-32, Blizzak LM-32 RFT, Blizzak LM-50 RFT,
Blizzak LM-60, Blizzak LM-60 RFT, Blizzak LM-80 RFT, Blizzak MZ-03 RFT, Blizzak W965, Blizzak WS60, Blizzak
WS70, Blizzak WS80. 2014 Midas Canada Inc.

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 13

All classified ads may be viewed at www.pennywiseads.com

Merchandise For Sale

Merchandise For Sale

Furniture & Appliances

Sporting Goods

ARMANA INFRARED SAUNA: Sits 3, w/2 backrests, stereo inside, mint condition, paid $6000+, asking $3000. Perfect for business/home. 250-304-9497.
BLACK FRIDAY BLOWOUT! Save up to 60% Storewide!
Home Goods Furniture, Located at China Creek (halfway
between Trail & Castlegar) www.homegoodsfurniture.com
DALE FROM TRAIL GOOD USED FURNITURE, Buy Sell,
help recycle, the boutique 2nd hand store. 792 Rossland
Ave, Trail. Thursday/Friday noon-6pm, Saturday 10am3pm, also warehouse. 250-367-9939 for appt.
MOVING, MUST SELL: Beautiful large formal dining room
set; 6 chairs, table, hutch & glass cabinet, $1000obo. 250362-5955 after 6 or email CAD_estate@outlook.com

SKIERS EDGE WORLD CUP PLYOMETRIC POWER SKI


TRAINER: Like new condition, $800; La Sportiva Hi5 touring
skis, 178cm, with Dynafit Radical binding and La Sportiva
skins, (only have 15 days use), $750. 250-225-3234.
GERICK CYCLE & SKI: 702 Baker St, Nelson. 250-3544622. info@gericks.com www.gericks.com. Ask about our
package pricing - downhill, X-country, back country. Ski
boot fitting experts.

Music Equipment/Service
LARGE PA SYSTEM FOR SALE. Too much to list. Call
for details. 250-365-6158 after 7pm or 250-354-3631(cell).
PIANO TUNER AVAILABLE: Professional service, quality
workmanship, repairs, appraisals. Work guaranteed. Call
Anything Piano, 250-354-8872.
SPICE UP YOUR BAND! Hire an experienced, professional,
multi-instrumentalist, vocalist. I offer hot saxophones, flute,
harmonicas, guitar, and searing vocals in all styles. Paying
gigs only, please. Call Ronald Halliday, 778-457-0011.
THOMPSON GUITARS: Custom work and repairs since
1972. 250-352-7729.

Sporting Goods
P&R ARCHERY is hosting a demo day with the PSE rep on Monday, Dec. 1, 9am-4pm. Come out and try all the new 2015 bows!
REMINGTON 870: 3, 26 barrel, screw & choke wood
stock, $300 includes some ammo; Savage 243, model#11,
w/VSA 3x9x40, 4 rounds fired, 16 rounds of ammo, extremely accurate, $500. 250-352-2322.
SELL YOUR STUFF! Got too many things lying around
the house? Sell it! turn your trash into cash - fast! Dont
delay, do it today!
1-800-663-4619.

Great Christmas Idea

Family Rings

Shop early to have it in time


for Christmas!

We do
lay away!

beautiful, new inventory now in

Ted Allens
Jewellery

431 Baker St., Nelson 250.352.5033

PAGE 14

Nov. 18, 2014

Merchandise Wanted
DONATE FURNITURE, WORKING APPLIANCES, household goods to S.H.A.R.E. Help feed the hungry, volunteers
welcome. Shop at S.H.A.R.E. NEW LOW PRICES, free
pickups. 612 Lakeside Dr. 250-352-1222.
FIREARMS: Call John Urquhart in confidence anytime. I
will come to your home. 250-367-7540.
LOOKING FOR 15 OF KITCHEN CABINETS in good
condition. 250-354-3591.
PRIVATE COIN COLLECTOR Buying Collections, Accumulations, Olympic Gold & Silver Coins, Bills etc. Local, 250499-0251.
WANTED CHINA BY WALLACE, DIANE PATTERN. Dish
set or individual pieces. 250-365-3158..
WANTED-RANGE BOILER HOT WATER TANK for woodstove,
non-electric, new or used, in good condition. 250-366-4222.
WANTED: COPPER, BRASS, RADIATORS & BATTERIES. Dont trash it...cash it. 250-354-9894.

Free For Free


9YR OLD 20 SAMSUNG Samsung TV in very good condition with a great picture. Ready to give it away so please
come and pick it up. Call 250-229-5309.
FREE - PIANO WITH STOOL. 250-693-8886.
FREE MUSCOVY DUCKLINGS: 3 weeks old. 250-365-5130.
FREE OFFICE PRINTERS: Lexmark W840 black &
white multi function printer; Pennywise, Kaslo 250-3532602/800-663-4619.
FREE: 2 orchid cactus. Phone 250-357-2647 or call at
8907 Hwy 6, Salmo.

Whats On Your Plate?


Filmmaker and concerned father Jeremy Seifert is in search of answers about
genetically modified organisms (GMOs) and how they affect our children, the
health of our planet, and our freedom of choice. His journey takes him to Haiti,
Paris, Norway, and even the front door of agri-giant Monsanto, the largest provider of GMOs in the United States, as he poses perhaps the ultimate question about
what we eat: is it still possible to reject our current food system, or have we already
lost something we cant get back? GMO OMG is a timely, informative, entertaining, and ultimately insightful documentary about the question thats a growing
concern to citizens around the world: who controls the future of our food?
In 2010, Jeremy completed his debut film, DIVE!: Living Off Americas Waste.
Initially made with a $200 budget, a borrowed camera, and a lot of heart, DIVE!
went on to win 22 film festivals worldwide. Due to the concern and questiones
that DIVE! raised Jeremys second film project developed into GMO OMG. The
personal nature of his films finds instant connection with viewers and inspires
real change both personally and socially. Jeremy uses his films and experiences
to speak on issues surrounding the environment, food, and social change at
universities and conferences around the world.
contd on pg 32

= view picture of this item on our website: www.pennywiseads.com

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Merchandise For Sale

Merchandise For Sale

2X100 GAL TIDY TANKS: With 12V Gas Boy pumps, good
condition, $975/ea. 250-365-3014.
BABY ITEMS: Wicker bassinet, Bumbo chair, Medella
pump, Moby wrap, Angelcare Movement Monitor and
more. 250-231-4620.
COMPUTER REPAIR: House calls, free quotes, honest,
affordable, over 10yrs experience. Call Jordan any time/
day, Castlegar, 250-608-3548.
CONVERT YOUR HOME VIDEOS to DVD, $10/tape,
DVD/case included. Call Jordan any time/day, Castlegar,
250-608-3548.
FREESTANDING NATURAL GAS FIREPLACE: Looks like
a wood stove, $400. 250-399-4786.
GE PROFILE CONVECTION SLIDE-IN STOVE: White,
self-cleaning, glass cooktop, excellent condition, $500;
Frigidaire Gallery microwave/hood fan, $40; oak office
desk, $50; outdoor island lounger, adjustable, w/cushions,
glass table & umbrella, $25. 250-365-3150.
GREAT USED FURNITURE, HOUSEHOLD ITEMS, ANTIQUES, Shop S.H.A.R.E. NEW LOW PRICES, free pickups. 612 Lakeside Dr. 250-352-1222. Volunteers welcome,
Support Our Daily Bread.
HAPPY BIRTHDAY STILL EAGLE! Get 23% off everything storewide Friday-Sunday, Nov. 22-23. AND enter to
win a $230 gift basket! 476 Baker.
PAIR OF LADIES CHRISTIAN DIOR SUNGLASSES:
$120obo. 250-365-6816.
TAUPE FABRIC CHAISE: Has working heater/vibrator in
lumbar section, $300obo. Also, DOG AGILITY TUNNEL
FOR SALE, $100obo. 250-399-4191.

Furniture & Appliances

Building Supplies
9 MATCHING OAK DOORS: New, unused, excellent
quality, solid core fire doors from Oregon, big, beautiful,
36 wide & heavy, $175/ea. 250-226-7647.

Computer Sales/Service
COMPUTER REPAIR: House calls, free quotes, honest,
affordable, over 10yrs experience. Call Jordan any time/
day, Castlegar, 250-608-3548.
WINLAW FINE COMPUTING: 15yrs & counting in the Valley, systems, networks, cabling. Patrick, 250-226-7215.

Firewood
16 DOUGLAS FIR: Measured cords, split & delivered,
$250. Call 250-354-8205.
FIREWOOD FOR SALE. Also 22T brand new log splitter
for sale. Call 250-608-1563.
FIREWOOD: Full cords, split and delivered. Pine $200, Fir
$225, Larch $250. 250-505-2028.

WHIRLPOOL APPLIANCES: 27cu.ft. fridge with icemaker; convection ceramic top stove, $250/ea; dishwasher,
stainless steel tub, $300; front load washer & dryer, $450/
pr. Castlegar, 250-365-3828.

Music Equipment/Service
DRUMSET LESSONS! Experienced teacher. Robin, 250226-0046, robinsittig@gmail.com
LOCAL BAND SEEKS LEAD GUITARIST/SINGER. Mike,
250-365-6158, 250-354-3631.

Sporting Goods
BOWFLEX HOME GYM: $1200 (paid $4000), like new, lots
of attachments. Email: huberne@hotmail.com
FIREARMS: Marlin 30/30, $500; Chiappa M1-22, $500;
SKS, $200. 250-357-2000.
GERICK CYCLE & SKI: 702 Baker St, Nelson. 250-3544622. info@gericks.com www.gericks.com. Ask about our
package pricing - downhill, X-country, back country. Ski
boot fitting experts.
PROFESSIONAL GOLF SHOP coming soon at Waneta Plaza,
Trail, for your Christmas needs. 7 days a week. Also curling
products. Champion Lakes Golf www.golfchampionlakes.com
250-367-7001 1-877-900-7030.

Merchandise Wanted
CLEANING YOUR FREEZER? Need to get rid of unwanted meat? I will take it for dog food. 250-226-6796.
DONATE FURNITURE, WORKING APPLIANCES, household goods to S.H.A.R.E. Help feed the hungry, volunteers
welcome. Shop at S.H.A.R.E. NEW LOW PRICES, free
pickups. 612 Lakeside Dr. 250-352-1222.
OLD BEER/POP SIGNS, wooden/metal crates, old gas/
service station items, old bikes, old Coke/pop machines.
250-231-9397.
OLDER HOCKEY & BASEBALL CARDS WANTED: From
1950s-1980s; +sports memorabilia, in good condition.
John, 250-368-8986/250-368-1158.
WANTED-COLLECTOR BUYING COMINCO 40YR MEDAL, clock, watch, etc. Smoke Eater programs & memorabilia, early Trail calendars & advertising, tokens, Medalta
Ogilvie Flour advertising. 250-368-5730.
WANTED: Used lumber/plywood to build outdoor rink.
Reasonable price, will pick up. 250-352-0769.

Furniture & Appliances


LARGE ENTERTAINMENT UNIT: 50X50X18 Medium oak
finish, good condition, 27x18 opening for TV, pull-out DVD
player space, 2 small drawers + DVD/CD storage, 3 shelves
behind glass door, +small cupboard, $100obo. 250-359-6600.
POWER LIFT AND RECLINE CHAIR: Brown, dual motors, excellent condition, used one week, paid $2700, asking $1000. 250-365-3842.
PRIDE RECLINER CHAIR W/AUTO LIFT: Suitable for senior, burgundy colour, excellent condition, $200. 250-3655625.

BCAA contractors serving the West Kootenay 24/7


Light & medium duty wreckers & deck trucks for local and long distance towing
Recoveries Boosts Unlocks Tire changes Fuel deliveries
Tandem wrecker available for heavy truck needs
Equipment and container moving Towing available to and from the US

MARIO'S SOUTH COUNTRY TOWING


is now located at 1010 Commercial Way, Genelle, BC
and available for all your towing needs 24/7
Call TOLL FREE-1-888-292-1581 or 250-693-8850
Fax: 250-693-8857 www.marios-towing.com

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 15

All classified ads may be viewed at www.pennywiseads.com

Contractors/Tradespeople
Classified Header

Classified Header
Contractors/Tradespeople

5 SEAMLESS GUTTERS, SOFFIT, FASCIA INSTALLATION & REPAIRS: Leaf Guard Systems. Free estimates!
Call UNDER COVER GUTTER, 250-359-6975.
A&A PAINTING: Longest serving & best reputation.
Now booking interior specials, for best prices call now!
www.aapainting.ca Rick, 250-354-9015/1-888-270-1188.
ADAMS WINDOWS & DOORS: All types of window and
door installations. Free estimates! Call 250-608-1419.

GRANITE COUNTER TOPS: Professional and reliable


service. Custom template to final install. Contact Ken, Iron
Ridge Contracting, 250-551-3867.
IMPACT EQUIPMENT: Across form Birchbank Golf Course,
250-364-9964, impactgroup@shaw.ca. Sand, gravel, topsoil sales and delivery. Custom crushing and screening.
KOKANEE PEAKS INTERIORS: Check out our showroom
for specials on Cabinetry and Flooring. Inventory Reduction Sale 30% off. Drywall & Flooring installation. With any
$10,000 purchase you receive 7 day Hawaiian trip! Unit 3,
3513 Hwy 6, Nelson, 250-352-5150.
LEADING EDGE OVERHEAD & GARAGE DOORS: Installation, Sales & Service. Nathan Robertson, 250-505-9686.
MONEY FROM YOUR FORESTLANDS. Bell Lumber &
Pole wants your cedar poles. Call Jim at 250-308-6477.
OFFERING GRATITUDE, A&A PAINTING LTD PLATINUM BEST IN BUSINESS 2014. Thanks customers and
business associates for voting us the #1 Painting contractor. www.aapainting.ca..
PERFECT LINE PAINTING LTD: Voted the best Painting
Company for 2014. Commercial, Residential, Industrial. New
construction, interior-exterior. 19 ys experience. Fully insured,
bonded, WCB coverage. We have the best prices and reputation in the Kootenays. Dont wait, book now! 250-505-6810.

ANDREW, HERITAGE GUTTERS, GUTTER HELMET


KOOTENAYS. Call for your complimentary estimate on
5x5 gutters or Gutter Helmet. heritageguttersnelson.com
or 250-551-0189.

HOOVER MASONRY, CERTIFIED EXPERIENCED MASON: Stonework, Bricklaying, Tile Setting. Custom Masonry Fireplaces, Restoration, Chimney Re-pointing, Stone
Patios & Stairs, Retaining Walls, Manufactured Stone.
Communication...Service...Satisfaction!
250-551-3245,
hoovermasonry@gmail.com

Custom Designed
Engineered Floors and Roof Systems

Save $10*
On Dulux Lifemaster
November 3 30

Call us now to order


your metal roofing for the fall

Learn more at Dulux.ca

Rewards

*Offer applies off the regular retail price of 3.0L-3.78L Dulux Lifemaster Interior products (5911X, 5931X, 59425, 5921X, 59113, 59170 series). Cannot be
combined with any other offer of promotion. See store associate for more details. At participating locations only.

250-359-7000

Dulux Paints

250-352-9411 410 Stanley St. Nelson Mon to Fri 8:30am5pm, Sat 9am4pm

SNOWBLOWER SERVICE SPECIALG G

Have Grant tune up your blower so youre ready when the snow ies and blow that snow right into your
neighbours yard! With over 20 years experience, Grant will get your unit running like a dream.
Check starter
Check carburetor as required
Check ignition system
Check compression
Check controls, choke, throttle, etc.
Check transmission for proper
operation (if applicable)
Check tires for proper inflation
(if applicable)
Change spark plug
Check belts and pulleys
Check and clutch/brake

Check and lubricate steering


and linkage
Lubricate and grease fittings
as applicable
Check all safety features
(switch, brakes, guards)
Test run for proper operation
Adjust skid plates as required
Lubricate chute/augers
Lubricate tracks as applicable
Clean air filter
Change oil

$5995

Now Only

$4995

Plus
parts

Hurry, for a limited time only.


If extra work is required,
price may vary.

OPEN:
Tues-Sat
8 am-5:30 pm
Closed Sun & Mon

708 Hwy 3A, Nelson


Ph: 250-352-3191
Fax: 250-352-3194

DL 30577

We service all makes and models

www.mainjet.ca

PAGE
Nov. 18,of2014
view picture of this item on our website:
this item on our website:
Nov. www.pennywiseads.com
18, 2014
PAGE 16
 =www.pennywiseads.com
 =16view picture

All classified ads may be viewed at www.pennywiseads.com

Get all your

Classified Header

Classified Header

do
ne
at

CHRISTMAS
SHOPPING
Gifts for SLEDDERS

RUGGED BY DESIGN

With event waterproof fabric


ALWAYS DRY IT JUST WORKS!

with GORTEX! Durable,


Waterproof & Breathable.

Come in and check-out our prices


on non-current gear.

Be at the top of your game with KLIM! Come in


and check out our prices on non-current gear.

KEEP THEM SAFE IN THE


BACK COUNTRY!

We have all sorts of HELMETS!


Look great with our NEW
509 Helmet and Goggle Combo!

Airbag Systems, Avalanche


Transceivers, Probes and Shovels
With purchase of an Avalanche Airbag
get 10% OFF in-stock Transceivers

Non-current Helmets up to 40% OFF

sled tether switches sled bags & accessories

Gifts for MX and STREET RIDERS


DIRT RIDERS: STREET RIDERS:

Helmets, Goggles, Hydro Packs...

ALL KINDS OF APPAREL:

Klim, Fox, KTM, Thor, MSR & Alpinestar


NEW 2015 Fox and Thor Gear Available
NON-CURRENT MX GEAR, UP TO 50% OFF
ATV Storage Boxes, Thumb Warmers,
Hot Grips & Loading Ramps
IN-STOCK ATV & MX TIRES 25% OFF

APPAREL AND MORE!

Bell, HJC, Icon and ZOX Helmets


Klim, Joe Rocket & Alpinestar
Keep them warm with Lithium Battery
Operated Heated Vests, Gloves & Socks
Tail Bags, Tank Bags and Saddle Bags,
Wheel Locks and Lots More for your Street Rider

IN-STOCK STREET TIRES 25% OFF

We have STOCKING STUFFERS and other GIFT IDEAS!


Drift Camera
inReach Satellite
Communicators
Gear Bags
Muff Pots

Maintenance Chargers for all your Batteries

KTM ACCESSORIES

Movies for the MX or Snow Rider


Goggles Replacement Lenses
Quick Straps for Goggles
No Fog Cloths Goggle Fans
Hoodies and T-Shirts
Mid layers, Base layers & Socks

DL 5310

GIFT CERTIFICATES AVAILABLE

708 Hwy 3A, Nelson


Closed: Sun & Mon
rst right hand turn on the north side of the orange bridge Open: Tues - Sat
www.mainjet.ca Ph: 250-352-3191 Fax: 250-352-3194 8am - 5:30pm

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 17

All classified ads may be viewed at www.pennywiseads.com

Contractors/Tradespeople

Services

WEST KOOTENAY MACHINE SHOP: Machine parts


manufactured and repaired, 915 Front St (rear), Nelson.
250-352-2123.
WOLFGANGS PLUMBING SERVICES: Residential
plumbing, Goulds pumps, hot water tanks, renovations,
etc. 250-226-7320.
www.shasheenmachine.com: Canadian Welding Bureau
Certified Shop. Structural steel & fine architectural metal
work. Portable welding. 250-359-2289.

BEAVERS SEPTIC TANK CLEANING SERVICE: Serving


the Kootenays. Goes the distance! 250-354-3508 (cell) or
250-357-9724.
KOOTENAY CHIMNEY: WETT certified technician.
Sweeps, insurance inspections, installations. Service all
regions. Brad 250-551-0321, 250-352-7157.
MAIN JET MOTORSPORTS: 708 Hwy 3A, Nelson. 250352-3191 www.mainjet.ca. Snowblower Service Special.
Have Grant tune up your blower so youre ready when the
son skies. Now only $49.95 plus parts, for a limited time.
MANUFACTURED HOME TRANSPORTING: Fully experienced, providing quality service. Call Shorty Phillips 250921-7574, NDB Trucking LTD.
TREE SERVICE: Certified, Licensed, Insured. Pruning to
removal of hazardous trees. Free estimates. 250-505-6114
www.fallguy.ca

Health/Personal Care
HOSPITAL BED, ELECTRIC PACKAGE: Full rails, like
new, $1200; bath bench, $80. 250-364-1690.

Sand Gravel Topsoil

Sales & Delivery


Custom Crushing & Screening

Located across from


Birchbank Golf Course

Gardening/Landscaping
GRAVEL, SOIL, ROCK, ETC. Reasonable rates, delivered.
Inquiries, call Lars 1-250-862-1190 cell, Nelson & area.
LANDSCAPE RENOVATIONS: Retaining wall systems,
Certified Allan Block installers, fencing for deer/elk/bear
barriers, residential privacy panel, animal containment.
Lawn/property/farm services. Full line of commercial
equipment. Licensed, insured. SlocanValley 250-3597976, haymaintenance@gmail.com
STRAW AND MULCHING HAY BALES: Many sizes and
prices. Free delivery. Any amount, any location. Wayne
Savinkoff, 250-226-7054.

WANTED:

CEDAR POLES

Bell Pole & Lumber Canada, ulc


Rossland, BC
CONTACT:
Pole Buyer Jim Johnson
250-308-6477
jim.johnson@blpole.com
or
Yard Supervisor Tyler Bryden
250-521-3031
tyler.bryden@blpole.com

ALL SPEC MATERIAL


Phone: 250-364-9964
Fax: 250-364-9956
Email: impactgroup@shaw.ca

Huge Sale on Solar Panels!


Backwoods Solar and ET Solar are working together to bring you a better deal!
We are pleased to bring you top quality and low cost solar options with B-Grade
modules. Cosmetic imperfections do not affect the power production!

Over 50 systems sold


in the Kootenays
Headquarters:
1589 Rapid Lightning Road,
Sandpoint, ID

PAGE 18

Nov. 18, 2014

We have both 60 cell and 72 cell modules


available in 250W, 280W, 290W and 300W.

25 YEAR
WARRANTY
ON POWER
OUTPUT!

Starting at
$0.80 USD
per watt

Call ahead for pick-up in Cooper Creek, BC


Cheryl Sinclair 250-366-4459 cl.sinclair11@gmail.com

= view picture of this item on our website: www.pennywiseads.com

1-800-663-4619

Farmers Market
LAMB IS READY: Naturally raised, government
inspected, cut & wrapped,
$6.99/lb. Also goat, mutton,
sausage.
250-357-2263,
Salmo.
NOW TAKING ORDERS
for naturally raised Heritage
breed pork. Will be ready
spring of 2015, Rainbow
Recovery Farm, 250-3685376.
SLOCAN VALLEY BLACK
ANGUS BEEF: Homegrown, sides/quarters, $100
freezer packs, 5 pound
bags
soup/marrow
or
knuckle bones, dog bones
50 pounds $49.99. Government inspected, no GMOs,
antibiotics, or tranqulizers.
Home of the happy cows.
Always delivered. Wayne
Savinkoff, 250-226-7054.
Extra lean ground beef and
sausage special.
TARZWELL FARMS: Locally grown & naturally raised
beef available year round.
Government inspected and
government graded AA
or better, $4.30/lb hanging weight. This is custom
cut & wrapped. Delivery to
Nelson, Castlegar, and Trail
available. 250-428-4316.

Lost & Found


FOUND ADS ARE FREE! If
you have found an item and
wish to connect with the
owner, give us a call and we
will advertise it for you at no
charge.
FOUND LADIES/ CHILDRENS PRESCRIPTION
GLASSES: On 2nd St.
Castlegar, next to Kinsman
Park. Call 250-365-7573 to
identify and claim.
FOUND, SET OF GLASSES IN CASE: On 800 block
of Baker St. Nelson. Call
Kootenay Chrysler, Nelson
to claim, 250-352-3542.
FOUND:
Prescription
glasses on walkway park in
Nelson, close to Save On.
250-352-7914.
NORCO
KATMANDU
MOUNTAIN BIKE with
Springer dog attachment.
Lost at land bridge to Zuckerburg Island. If located
please return no questions
asked. 250-365-0770.

78

LAW OFFICE

Presents

YOU AND THE LAW

YOU MUST TRY TO BE FINANCIALLY


SELF-SUFFICIENT AFTER DIVORCE
Anne and Steve (names changed) were
married for 34 years before separating.
Steve was the main family bread-winner
during the marriage. Anne had worked in
a bank for 20 years during the marriage.
But, for the last 12 years of the marriage she
had not worked at the bank, instead she did
child care out of the family home.
Anne was now 58 years old and did not
have a high school diploma. Steve had
never been supportive of Annes child care
work and at the time they were breaking
up she stopped running the childcare program. After their marriage ended, Anne did
not try to get work outside the home, since
shed only qualify for minimum wage-type
work that she wouldnt like.
Steve was at one time making $125,000 a
year. But his income had recently dropped
to $90,000, and his job was now less secure
too.
What were Steves post-divorce obligations for supporting Anne financially? And
what were Anne's responsibilities to earn
money of her own?
The BC Court of Appeal considered this
case recently.
It highlighted that an important goal of
our divorce laws is to encourage each former spouse to become economically selfsufficient after their marriage breaks up.
You have to take reasonable steps to contribute to your own financial support.
But, the court also acknowledged that becoming fully financially self-sufficient may
not always be possible due to age, health,
limited education or other reasons. Nevertheless, the court emphasized you have to

make an effort its not fair to put the whole


financial burden for your future financial
support on your ex (and this wouldnt promote the laws important goal of striving for
self-sufficiency after a marriage ends).
The court went on to say that, yes, in our
free society, you can choose not to take a
job which you wouldnt like and feel doesnt
pay enough (like minimum wage). But even
if your earning ability may not be great, if
you dont try to contribute to your own selfsufficiency, you have to bear the financial
consequences of your own personal choice.
The court observed here that Anne received the family home when the marital
property was divided up, in part because
she said she wanted to run a daycare in it.
But she hadnt started on that.
In these circumstances, the appeal court
said that the spousal support Steve had to
pay, based on his income and the guidelines
commonly applied, should be adjusted
downward.
The court made an assessment of what
Anne could be expected to earn, either as
a part-time employee earning minimum
wage or by running a daycare. These earnings were estimated at $1,000 per month
($12,000 per year). The spousal support
order was therefore adjusted to arrive at a
new, lower amount of spousal support he
had to pay her under the guidelines.
The court also said that either Anne or
Steve could apply for a review of the courts
decision in six months time, based on relevant factors.
If you and your spouse are separating,
consult your lawyer.

Please contact TYLEEN UNDERWOOD for legal advice concerning your particular case.
Written by Janice Mucalov, LL.B. with contribution by TYLEEN UNDERWOOD LAW OFFICE.
This column provides information only and must not be relied on for legal advice.
Lawyer Janice Mucalov is an award-winning legal writer. You and the Law is a registered trade-mark. Janice Mucalov

Tyleen Underwood Law Office


Family Law I Criminal Law

Phone: 250-352-6638 Fax 250-352-6634


Suite 200 - 507 Baker Street, Nelson, BC V1L 4J2

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 19

All classified ads may be viewed at www.pennywiseads.com

Christmas Craft Fairs

Christmas Craft Fairs

BALFOUR HALL CHRISTMAS CRAFT FAIRE: Saturday,


Nov. 22, 9am-3pm. Door prizes, free admission or food donations for Aimee Beaulieu Transition House. Information
250-229-5265.
FRIENDS OF THE BEAVER VALLEY LIBRARY thank all
the vendors and customers for their support of our recent
annual fundraiser, the Fruitvale Christmas Craft Fair. Also
thanks to our many muffin bakers!
CASTLEGAR CHRISTMAS CRAFT FAIRE! Sunday, Dec.
7, 10am-4pm, $2/person, 12 & under, free.
KASLO CHRISTMAS CRAFT FAIRE: Saturday, Dec. 6,
10am-4pm, Kaslo Legion Hall. Enquiries, singindontworry@
hotmail.com
PROCTER CHRISTMAS CRAFT FAIR: Saturday, Nov. 22,
9:30am-3pm. Vendors email taline@shaw.ca or call Caroline at 250-505-3560.
THE ARGENTA WINTER FESTIVE SEASON CRAFT,
FOOD AND MUSIC EVENT is Wednesday, Dec. 10, at our
hall, lunch till later. Vendor info 250-366-4422.
EDGEWOOD COMMUNITY CHRISTMAS CRAFT MARKET Christmas Market News: Dec. 7, 2014 at the Legion
Hall. 11am-3pm. Calling all crafty, artsy and home based
business people, quilters, sewing gurus, painters, sculptures and uniquely talented people! We need vendors!
Please contact Laurie McDonald 250-269-7560, or Ryan
Larue, 250-269-7558 for details.
LOOKING FOR VENDORS for our ANNUAL HOLIDAY
PARTY: Castlegar Recreation Centre, Saturday, Dec. 13.
Table fee $50. If you are interested, please contact Amanda
at gibbmom@gmail.com

CHRISTMAS IN THE VALLEY CRAFT FAIRE: Sunday,


Nov. 23 at Slocan Legion Hall, 502 Harold St, 10am-3pm.
Santa visit between 11 & 12noon. Everyone Welcome!
WARFIELD CRAFT & HOME-BASED BUSINESS FAIR:
Saturday, Nov. 22, 2014. Warfield Community Hall, 9am3pm. Cost, $2.

Ask about ou

Shoppers Delig

ht

Packages!

EDGEWOOD COMMUNITY CHRISTMAS CRAFT MARKET Christmas Market News: Dec. 7, 2014 at the Legion
Hall. 11am-3pm. Calling all crafty, artsy and home based
business people, quilters, sewing gurus, painters, sculptures and uniquely talented people! We need vendors!
Please contact Laurie McDonald 250-269-7560, or Ryan
Larue, 250-269-7558 for details.
KOOTENAY ARTISAN FAIR: Nov. 21-23, Friday, 12-7pm;
Saturday, 10am-6pm; Sunday, 11am-4pm at the Prestige
Lakeside Resort in Nelson. $3 entrance fee, 12 and under free. Come support your local artisans and enter for
a chance to win a diamond ring/bracelet, Wii U or home
theater system. For contest details and sneak peek album
of vendors, find us on Facebook.
MOUNTAIN SKY SOAP SECONDS SALE: Get some
local off-cut soaps and lip balms for gift giving, Saturday
Dec. 6, 9am-4pm, 2276 Hwy #6, Crescent Valley.
ROSSLAND HOMESPUN CHRISTMAS CRAFT FAIR:
Saturday, Nov. 29, 2014. Prestige Mountain Resort, 10am4pm. Admission $3.
SILVERTON CHRISTMAS FAIRE! Saturday, Dec. 6, 10am4pm, Silverton Memorial Hall! Music, Food and a whole lot
of Fun! Booth draws, tea/coffee & desserts, home-style food
nearby! Richard Burton on piano; Community Band in afternoon. Crafts/Gifts: hand-dyed socks, furniture, luscious
scarves/shawls, toys, jewelry, pottery, photography, leather,
body products, truffles, herbs, baskets, photography, hats,
sauerkraut, totes & much more... Come make a day of it!
WINLAW HALLS CHRISTMAS CRAFT FAIR: Saturday,
Dec. 13, at Winlaw Hall, 9am-4pm. Admission still free. Donations to the Food Bank greatly appreciated. Come join us!

Legal Notices
IS IT TIME TO GET YOUR AFFAIRS IN ORDER? I can
help you write your will - your way. Thomas R Humphries
Law Office in Kaslo. 250-353-2292 www.kaslolaw.com

Shop n Stay
SPECIAL

72

Park n Fly
available

Outdoor hot tub


FREE Wi-Fi
Pets ALWAYS
welcome.
Offer valid until Jan 31, 2015.
Based on double occupancy.

www.daysinnkelowna.com
salesdesk@daysinnkelowna.com
PAGE 20

Nov. 18, 2014

Specializing in Douglas Fir and Cedar


:WLJPHSPaPUNPU+V\NSHZ-PYHUK*LKHY
Kiln Dried and Planed Timbers
2PSU+YPLKHUK7SHULK;PTILYZ
Cedar
Decking, Fascia, and Siding
*LKHY+LJRPUN-HsJPHHUK:PKPUN
Douglas
Fir Panelling, Flooring
+V\NSHZ-PY7HULSPUN-SVVYPUN
and Clear Trim
HUK*SLHY;YPT

 :LU[PULS9K:V\[O:SVJHU


FINgGIMgKNNN

= view picture of this item on our website: www.pennywiseads.com

All classified ads may be viewed at www.pennywiseads.com

Education/Classes

Animals/Animal Care

SELKIRK COLLEGE FORESTRY TRAINING. Get ready


for entry level forestry work now. selkirk.ca/ce/pbt

COMMUNITY FUTURES OFFERS SMALL BUSINESS


WORKSHOPS: Build your own fully functioning business
website in 2 days: Building Your Website with WordPress.com on Dec. 3 & 4 (9am-4pm both days) with Nikta
Boroumand $300+GST. Register at 250-352-1933 x100.
Full schedule: www.futures.bc.ca

RETIRED REGISTERED PUREBRED PERSIAN:


Spayed 2yr old black smoke female. Great Companion!
250-365-3403, maloff@telus.net http://www3.telus.net/
Sugar/arrow1.htm
SIMPLY PAWS-ITIVE DOG TRAINING: Obedience/agility classes. Private consultations for obedience/behaviour
problems. www.simplypawsitive.ca Linda Murray, 250367-7211.
4 ROTTIE CROSS PUPPIES: 2 males, 2 females, $100/ea.
250-608-4423.

Events

Livestock

CUSTOMER APPRECIATION DAY: Saturday, Nov. 29,


from 12-5:30. Come in for great pre-Christmas savings on
everything! In-store only, no rain cheques. Isis Essentials,
582 Ward St, Nelson.
Hey Hockey fans! WIN tickets to the Trail Smoke Eaters!
Like our Pennywise - Shopping and Services Facebook
page, and then Like & Share corresponding post to WIN!
Draw date is Nov. 20. Tickets are open dated, so you can
choose the game you want to attend!

GRASS MIX HAY: Small square bales, $180/ton. Creston


250-428-4316.
HAY AND STRAW: Straw, $5/bale or $4.50 for 30 and over. Oat
hay, $160/T; 2nd cut Timothy, $180/T 250-428-3374 Creston.
HIGHLAND CATTLE for sale. 250-366-4440.

Lessons/Workshops

LOL. WIN tickets for Yuk Yuks at the Spirit Bar on Thursday, Nov. 27! Like our Pennywise - Shopping and Services
Facebook page, and then Like & Share corresponding post
to WIN! Draw on Nov. 25!
NEW RIDERS OF THE PURPLE SAGE: Capitol Theatre,
Nelson, Friday, Nov. 21 and Saturday, Nov. 22, 8pm presented by On the Road Productions.
You can WIN tickets for the New Riders of the Purple Sage
concert at the Capitol Theatre on Saturday, Nov. 22! Like our
Pennywise - Shopping and Services Facebook page, and then
Like & Share corresponding post to WIN! Draw on Nov. 19.

Employment Opportunities
BECOME A HEALTH CARE ASSISTANT in only 8 months.
Nelson class starts Nov. 24, Castlegar class in January.
ProCare Institute 1-800-282-0030, www.procare.ca
EI CLAIM DENIED? NEED HELP? 22yrs experience as EI
Officer. Will prepare/present reconsiderations & appeals.
Call me first! Bernie Hughes, 1-877-581-1122(toll-free).
PART TIME DENTAL HYGIENIST NEEDED at Kaslo Dental Clinic. Call 250-777-4802.
FREE CALLBACK SERVICE: When placing your Pennywise
ad, you can request a reminder notice. Call 1-800-663-4619.

Animals/Animal Care

AKC STANDARD POODLE PUPPIES: Ready now! Parents onsite. Black, brown & red. Females & males. All puppies have a 2 year health guarantee. For more information,
go to www.OurPoeticPoodles.com or call 509-582-6027.
ALL PLAY PET CARE: Is Your Dog Alone Today? We offer DOGGY DAYCARE in a bright, clean setting. Drop-ins
welcome. Nelson 250-352-2021, Castlegar 250-365-2886.
www.allplay.ca
BEAUTIFUL LOVEBIRDS: Various colours, $25/ea; w/
cage, $40/ea. 250-367-7751.
GOLDEN RETRIEVER PUPPIES: Vet checked, dewormed,
1st shots, $600/ea. 250-265-3320.
K-9 TRAINING RANCH. Call Roxann, 250-352-3357.
NOTICE: The Kootenay Industrial Supply
Nelson & Castlegar stores will be

CLOSED
for inventory

on ta

FABULOUS CHICKEN WINGS


and other select appies - every day from 3 to 6pm
(except Wednesday) $6.50 with the purchase
of an alcoholic beverage. and Im appy!
FRIDAYS: PRIME RIB
SPECIAL $23.95

Sorry for any inconvenience

HOU Y
IS H
R
ER !
E
!

Saturday, November 22nd

KOOTENAY INDUSTRIAL SUPPLY LTD.

6 beerp!

APP

323 Vernon St.,


2181 Columbia Ave,
Nelson 250-352-5301
Castlegar
TOLL FREE
Ph 250-304-2900
1-888-663-4KIS (4547)
www.kootenayindustrialsupply.com

= view picture of this item on our website: www.pennywiseads.com

BEST WINGS IN THE KOOTENAYS!


1LB ONLY $6.50 ON WEDNESDAYS!
For meeting room and
banquet bookings
please call 250-304-6306
For restaurant reservations
please call 250-304-6311

Set a time limit


before you play
Nov. 18, 2014

PAGE 21

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Employment Opportunities

Contractors/Tradespeople

CASUAL BOBCAT OPERATOR WANTED for snow removal in South Slocan area. Please email past experience:
info@wkselfstorage.com
HAIRSTYLIST REQUIRED with minimum 1yr experience.
Drop off resume at 2327-6th Ave, Castlegar. Call 250-3046933.
KITCHEN POSITIONS AVAILABLE at established backcountry cat skiing lodge. Contact Rick at 250-509-0693.
PART TIME POSITION FOR CARE AIDE REQUIRED in
Nelson, for handicapped adult male. Email resume to Val at
piewil@netidea.com or Barb bab_360_white@hotmail.com

*DJM CONTRACTING LTD: Custom homes, new construction, renovations, garages, carports, foundations, framing
+more. Licensed Residential Builder/WCB/Insured. Free estimates. www.djmcontracting.com Justin, 250-362-2151.
*Jamieson Contracting: RENOVATION AND RESTORATION. 250-505-5010.

Business Opportunities
FREE BUSINESS COUNSELLING FOR NEW & EXISTING BUSINESSES. A Community Futures representative
will be at Castlegar City Hall, Wednesday, Dec. 3, 10 &
17. Call 352-1933 x100 for an appointment. Community
Futures offers business loans, business workshops, resource library, Self-Employment Program, 1 on 1 business
counseling and Basin Business Advisors Program! www.
futures.bc.ca
PRIVATE RURAL RESIDENTIAL GARBAGE DISPOSAL
& RECYCLING BUSINESS: Hundreds of happy long term
customers, plenty of potential. Phone Tim, 250-365-7104,
250-304-8919.

Help Wanted
HELP NEEDED IN NELSON: With shopping, driving to appointments, occasional other stuff, $13/hr. 250-352-6699.
HORSE TO LEASE TO EXPERIENCED RIDER in exchange for stable duties. 250-365-8264.
PERMANENT PART TIME: 2-3 days/week. Bookkeeper/
secretary. Handwritten cover letter to: Help Wanted, PO
Box 64, Nelson V1L 5P7.

Employment Wanted
ON HAND SERVICES: General labourer; available for yard,
home & garden work. 250-365-2490.

Farmers Market
RABBIT MEAT FOR SALE: 12 wks old, 2 -2 lbs, $20/
ea. 250-362-5216.

5 CONTINUOUS GUTTERS: Call for your free quote.


TRS Gutters, Your Kootenay Eavestrough Specialists.
Visit us at www.trsgutters.com or call 250-365-1061.
5 SEAMLESS GUTTER: Lowest price guaranteed! Certified installer for roofing, torch on roofing, soffits, fascia,
siding, HardiePlank. All your exterior needs. Quality
workmanship at affordable prices. 250-365-0049, 250304-8883, email: ricker1968@hotmail.com
ALL YOU NEED HANDY HOME HELPER: Tile, painting,
drywall, install doors/windows, all reno needs, free estimates. 250-304-7490.
ALL-SEASON CARPENTRY: Interior, exterior. Over a decade
of happy clients. Affordable, high quality. Eric, 250-226-7333.
AMC, FORMERLY ANDY & MAXINES Plumbing & Heating, Gas
& Drain Cleaning Services. 250-365-6692 or 250-608-3240 cell.
B MOLLER RENOVATIONS: Quality Workmanship, Reasonable, Reliable, References. No job too small. Call Mike,
250-365-1825.
BOB ESSAUNCE, B.P. ESS. HOLDINGS LTD: Quality
Work on Interior Finishing, Small Renovations & Repairs.
250-365-9344.
BURN SAFE WOOD HEATING: Offering inspections, installations, sweeps and maintenance. Wett Certified 250357-2928, burnsafe@live.com
CASCADIA ROOFING: Re-roofing/new installations. Laminate
Asphalt shingles, cedar shakes & metal roofing. Quality guaranteed. Theres still time to reroof before winter! 250-354-2999.
CONCRETE, TILE, WOOD: Custom showers, counter
tops, Nuheat in-floor heating, Allan Block, precast concrete, cultured stone, epoxy stone. Quality work! S1 Contracting, Ian Voboril, 250-354-8954. www.s1contracting.ca
CRESTVIEW PAINTING: 25yrs+ experience, reliable/quality work that lasts, new construction, residential, repaints,
certified journeyman. Fully insured. 250-304-5197.

4J3HPUZ9VVUNLtd.

Come home to an
Heating System

Residential & Commercial


Serving the West Kootenay

and leave the


winter outside

For comfort and reliability


that lasts and lasts and lasts.

PHWDOURRQJ
VKLQJOHV
cedar shakes
QHZURRQJ
UHURRQJ
VRIW IDVFLD

Call today for a free estimate!

Paulson Mechanical Systems Ltd


3170 Highway Drive, Trail 250-368-9404

Fax: 250-368-9966 Cell: 250-364-3820

PAGE 22

Nov. 18, 2014

Workmanship guaranteed
17 years experience
5 year warranty on labour
Fully insured
Free estimate

Clint McLain
7UDLO%&PFODLQVURRQJ#KRWPDLOFRP

= view picture of this item on our website: www.pennywiseads.com

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Contractors/Tradespeople

Contractors/Tradespeople

CURRYS EXCAVATING: Site prep, road building, basements, wells and all your excavating needs. If experience
and knowledge is what you are looking for CALL WAYNE
CURRY, 250-226-7661.
DALES PAINTING: Interior/exterior, let my references
explain!! Fast, professional, reliable, free reasonable estimates. 250-365-2725.

KNOTTY ROOTS custom site finished hardwood flooring specialist, natural products, dust containment system.
250-355-2773.
KOOTENAY CREATIONS: Specialists in custom woodwork cabinets and countertops, now offering Murphy Wall
Beds. 250-231-0172.

DEDICATED CONTRACTOR SEEKING CLIENT for


meaningful home remodel. Contact Ken at Iron Ridge Contracting, 250-551-3867.
GAS APPLIANCE INSTALLATIONS & MAINTENANCE.
Licensed & bonded gas fitting. Specializing in Propane.
www.Jemsgas.com 250-359-5922.
GENERAL CONTRACTING: New construction, renovations, additions, siding, roofing, decking. Experienced, energetic, reliable. Guy, 250-354-1760, 250-505-0709.
GW CONTRACTING: Rock/Allen block, retaining walls,
concrete sidewalks/driveways, demolition, leaky basements, plumbing, water, sewer, decks, patios, panel fencing, Land clearing. 250-231-4532.
HUSCROFT HVAC specializing in heat pumps, licensed
Refrigeration Technician. Save with rebates. Doug, 250365-9673, www.livesmartbc.ca
JAMES STRUICK CONTRACTING: Renovations, home &
shop framing, foundations, decks, metal roofing, siding or
any of your construction needs. Quality Work! 250-3990085. www.s1contracting.ca
JM ROOFING: Very knowledgeable, experienced, licensed
& insured. Free estimates, great rates. 250-231-5327.

THINKING LOANS...
WELL MAKE IT SIMPLE.

LEAF CABINETRY: Custom cabinetwork, residential &


commercial. Your local cabinetmaker serving the West Kootenay since 1991. www.leafcabinetry.com, 250-226-7441.
MCLAINS ROOFING, TRAIL. 250-231-5543. Metal roofing, shingles, cedar shakes, new roofing, re-roofing, soffit
and fascia.
NELSON INSULATION: Sprayfoam, exterior walls, new construction, attics, crawl spaces, parkades. Free estimates in
the West Kootenay. 250-226-6765. www.nelsoninsulation.ca
ROCK SOLID MASONRY: Specializing in custom
natural stone, cultured stone, tile, block, brick, pavers. Insured, work guaranteed. Ask about winter pricing. Tristan Ray, 250-354-8125. stanrayca@yahoo.ca
www.rocksolidmason.ca
THE SLOCAN ELECTRICAL MAN...Serving the Valley
and Beyond! Licensed, Bonded, Insured-Residential
and Commercial. slocanelectricalman@gmail.com,
250-226-7744.
TOM COTTON PAINTING & DRYWALL: Booking for winter. 250-357-0063 or 250-354-7300 cell.
WITH AN ACCENT FINE CARPENTRY: Complete renovation services. Interior finishing, railing specialist, manufacturers prices. 250-551-1842.

BETTER SERVICE
GREAT COVERAGE
COMPETITIVE PRICE

HOME

A new purchase or
unexpected expenses.
We have a loan product for all your needs.

HERITAGE
CREDIT UNION

AUTO

Our professional insurance brokers


are not paid by commission
they have your interests at heart!
Call today, whether your existing insurance is
due for renewal or not. Join the thousands of
people who have obtained better service and
great coverage at a competitive price.

Traditional service in person and online

Castlegar
Slocan Park
www.heritagecu.ca
#100 - 630 - 17th Street
3014 Hwy 6
Tel: 250-365-7232
Tel: 250-226-7212
Fax: 250-365-2913
Fax: 250-226-7351

HG INSURANCE
AGENCIES LTD.
www.hgins.ca

= view picture of this item on our website: www.pennywiseads.com

Castlegar 100-630-17th St
Open MonSat 250-365-3368
Slocan Park 3014 Hwy 6
Open TuesSat 250-226-7216

Nov. 18, 2014

PAGE 23

Great Gift Ideas for the Holiday Season!


BIL
O
M
Y
A
L
P
f
o
Tons
back in stock!

and
so much.
more..

Introducing:

SANDS
ALIVE!

Klutz
Activity Books
Creative, Educational & Fun
C

Catapults &
Trebuchets
GREAT GAMES!
Schleich Figurines
From Farm to Fantasy

Open 9:30 am until 5:30 pm Sundays 11 am to 4 pm


455 Ward Street, Historic Downtown Nelson
250-352-9114 sgtoys@telus.net
PAGE 24

Nov 18, 2014

Pennywise

Pennywise

Nov 18, 2014

PAGE 25

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Services

Services

1T CUBE VAN & DRIVER FOR HIRE: Moving, garage,


yard clean-up, pick up, delivery. 250-359-5967.
3/4T TRUCK AVAILABLE, will do hauling/clean-up jobs.
Also siding & roofing. Call Ross, 250-608-1563.
A MAN AND HIS DOLLY, MOVING COMPANY. 1T cube
van. Moving to and from most places in BC and Alberta.
Accepting VISA, MasterCard and Debit at your door. www.
AManAndHisDolly.com 250-304-8400.
AREA SNOWPLOWING: Crescent Valley, South Slocan to Castlegar, including Pass Creek & Krestova. (cell) 250-354-8957.
BLEWETT BOBCAT SERVICES: SNOW PLOWING,
Driveways, Cleanup, Site prep/clearing & much more. Experienced & efficient. Free estimates. 250-354-1020..
GOOSE CREEK WOODWORKING: Journeyman carpenter, 30+ yrs experience, small renovations, repairs, finishing. Phil Richmond, 250-365-5037.
GT ELECTRICAL SERVICES: Reasonable rates, 30 years
experience. Call Greg 1-250-304-8328.
HANDYMAN FOR HIRE: Carpentry, concrete work, drywall, fencing, repairs & other projects. Reasonable rates.
250-304-9960.
DIDJA KNOW?...
Coming up in NELSON
THE TRAIL/BV/
ROSSLAND EDIPrenatal: Nelson Hospital Visit ... Nov 27
TION OF THE
Commercial Vehicle Inspection .. Nov 28
PENNYWISE
Massage for Couples................... Nov 29
gives
excellent
coverage to your
Foot Massage & Reflexology ...... Nov 29
ad! We distribBasic Full Body Massage (including
ute to over 8600
prenatal) ................................... Nov 30
homes in this
area every week!
Post Partum Class .......................Dec 5
Be sure to take
Pre & Post Natal Baby Massage for
advantage of this
Professionals ............................. Dec 6 & 7 readership when
Firearms Safety Non-Restricted.. Dec 13
you place your
personal or busiSalmo: Prenatal in a Weekend ... Dec 13
ness ads. Call
Food Safe Level 1 ....................... Dec 16
1-800-663-4619
Prenatal: Early Pregnancy .......... Dec 18
between 9 am &
5pm weekdays.
COMMUNITY EDUCATION
Please remember,
& WORKPLACE TRAINING
our deadline is always 3pm Thursday to have your
Visit selkirk.ca/ce
ad appear in the
or call 866.301.6601 for more information
following
Tueswww.facebook.com/SelkirkCommunityEducation
days edition.

HAVE IT MAID! Weekly, bi-weekly, monthly, or one time


cleans available now! Great references. Thorough, consistent, confidential, reliable. Call Laurie at 250-608-3143.
Clean Guaranteed, or your dirt back for free. Christmas gift
certificates now available!
LOGAN RENOVATIONS: Bathrooms and Residential Alterations or Repairs. Free Estimates. 1-800-747-7730.
MARIOS SOUTH COUNTRY TOWING: Genelle. 1-888292-1581 or 250-693-8850, www.marios-towing.com.
Available for all your towing needs 24/7.
MR. FIX IT HANDYMAN: Repairs, Renos, Interior Painting,
Laminate Floors. Estimates: 250-399-6606, mrtroyfixit@
outlook.com
PAULSON MECHANICAL SYSTEMS, TRAIL. 250-3689404, 250-364-3820. Come home to an Amana Heating
system for comfort and reliability that lasts.
REPAIR, REPLACE, RENOVATE HANDYMAN: 30yrs
construction trades experience. Hardware to complete interiors, exteriors, decks, etc. Get that project finished! 250226-7800.
SNOW REMOVAL, JUST CALL SMOKEY CREEK SALVAGE! 250-359-7815, toll-free 1-877-376-6539. 3453
Yateman Rd, South Slocan.
SNOWPLOWING & SANDING IN WINLAW AREA:
Driveways and commercial, 250-226-7891, Cedar Creek
Farm & Landscaping.
SNOWPLOWING in Playmor Junction and surrounding
communities. Call Craig for free on-site estimate. 250354-8402.
THE SEASON IS CHANGING, YOUR TIRES SHOULD
TOO: All name brands available. Tire changeovers and winter servicing. Kootenay Motors, traditional values, modern
technology. 213 Baker St., Nelson. Shop while your car is
serviced. 250-352-5383. www.kootenaymotors.com
WE DELIVER LARGE OR SMALL ITEMS, 3 ton truck
available! Tuesday to Saturday, household moves within
West Kootenays. NEW LOW DELIVERY RATES. Help feed
the hungry, shop at S.H.A.R.E. Volunteers welcome. NEW
LOW PRICES, 612 Lakeside Dr. 250-352-1222.
~GARBAGE CAN DAN... JUNK HAULING & SNOW
PLOWING~ Residential, commercial, full estate clean-ups,
appliances, household junk, construction waste, scrap
metal, anything you need hauled! Mid-size dump truck for
pick-ups and deliveries. Snow plowing in Slocan Valley.
Call 250-226-PLOW(7569) for free estimate.

Become a health care assistant

in only 8 months
A rewarding career

Nelson class starts Nov. 24! Castlegar class in January


Includes: Dementia Assisted Living
CPR and 1st Aid FoodSafe
Basic Medications

Call us for more details

ACCREDITED

PROCARE INSTITUTE

Education in Health Care


1-800-282-0030 www.procare.ca
Ask us about funding options!

PAGE 26

Nov. 18, 2014

250-226-6765

FREE ESTIMATES in the West Kootenay


Sprayfoam Exterior Walls New Construction Attics Crawl Spaces Parkades

WWW.NELSONINSULATION.CA
= view picture of this item on our website: www.pennywiseads.com

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Recycling

Events

FREE USED ANTIFREEZE. No charge drop-off for scrap


steel, cars/trucks, etc, all white goods and non-ferrous
goods, tires, (w/o rims), batteries. Certified yard. Smokey
Creek Salvage Ltd, 3453 Yateman Rd, South Slocan. 250359-7815.

NELSON OVERTURE CONCERTS SOCIETY presents Canadas legendary piano duo Anagnoson & Kinton at the Capitol Theatre, Sunday Nov. 23, 2 pm. Tickets $24/adults, $14/
students. (Students from schools participating in the NOCS
School Outreach Program can access tickets for free).
NETWORKS FOR NEW PARENTS: Thursday, Nov. 20.
Special guest Lauren Steeg Grace will have info on rec
programs and subsidies, and wants to hear your ideas
for future programming. Connect with other families, exchange childrens goods, and enjoy a healthy lunch. Babies, preschoolers and pregnant parents are always welcome at these free events! Passmore Hall, 10am-1pm.
SLOCAN FITNESS CENTRE OPEN HOUSE. Sunday November 23rd from 10 am to 3 pm. Come check us out!
Were located in the Red School House on Harold Street.
Gym passes are $20/ month!
TEXAS HOLDEM TOURNAMENT Saturday, Nov. 29,
6:30pm sharp at the Slocan Legion Hall. $30 Buy-in. Tickets at Mountain Valley Station in Slocan or phone 250-3552672 to reserve. The Legion welcomes members & guests.

Health/Personal Care
CATHERINES HAPPY FEET: Mobile nursing foot care
services. Catherine, LPN 250-304-8283.
KOOTENAY LAKE DENTAL CLINIC: 556 Josephine St,
Nelson, 250-352-5522, info@kootenaylakedental.ca. Providing all aspects of general family dentistry in a comfortable, caring environment.

Gardening/Landscaping
# 1 IN SERVICE-DC TREE SERVICE: Dangerous tree
removal, fully-insured, prompt, quality service. Free estimates. Wes, 250-304-8541.
15 YRS AS YOUR LOCAL FULL TIME PROFESSIONAL
TREE EXPERT: Limbwalker Tree Services. Hazardous removals, finest custom pruning, stump grinding. Fully insured. 250-354-1627.
FAMILYTREE LAWN+GARDEN MAINTENANCE: Leaf
season is here! Leaf removal/hedgetrimming/fall cleanup.
Call Kyle for a FREE estimate, 250-608-LAWN(5296).
GLACIER VALLEY TREE CARE LTD: Local Danger
Tree Professionals. Bucket trucks, brush chipped, wood
hauled, stumps ground. Free, same-day assessment &
advice. Certified, insured, references. Owner/Operator Jim
Sipkes 250-304-3774.
KODIAK TREE SERVICE: Fully Insured, Certified Arborists providing professional, reliable tree care. Removals,
Wind Firming, Pruning, Chipping, Stump Grinding. Castlegar, 250-365-6664 or Winlaw, 250-226-6946.

Notices
KOOTENAY ANIMAL ASSISTANCE PROGRAM SOCIETY (KAAP) Annual General Meeting is Saturday, Nov. 29,
2014, 2pm at 521 Vernon St, Nelson BC.
SCHOOL DISTRICT NO 8 (Kootenay Lake): District
Schools and Facilities Planning Town Hall Meetings. For
details see display ad in this edition, or www.sd8.bc.ca
Facilities Planning.

Education/Classes
Lessons/Workshops
A COURSE IN MIRACLES STUDY GROUPS. Free your
mind. Mondays-7pm, Fridays-10.30am, Pass Creek. 778460-2222 bodymindspiritearth@hotmail.com
VAR GUITAR INSTRUCTION: Fun, effective weekly lessons, electric, acoustic, experienced, formally-trained.
250-365-6547.
VOICE LESSONS W/ELAINE: Develop vocal skill, breath
support, microphone technique, overcome stage fright.
Music-your choice! 250-365-1199..

Events
CHRISTMAS BOOK SALE! Slocan Community Library,
510 Harold St, Slocan City, Sunday, Nov. 23, 10am-3pm.
Jenny Ash, formerly of Jennys Garden, has generously
donated her leftover stock of new books. Come and buy
your Christmas gifts!

School District No 8
(Kootenay Lake)

District Schools And Facilities Planning


TOWN HALL MEETINGS
November 17
Mount Sentinel School
November 19
Winlaw Elementary School
November 24
PCSS Auditorium
November 26
Salmo Secondary School
December 1
Trafalgar Middle School
December 2
JV Humphries School
December 8
Crawford Bay School
Meetings will be held from 6:30 to 9 pm (local time)
The Board of Education is developing a long-range
facilities plan.
Goals:
Best Learning Environments
Sustainability & Stability
Renewal
Competitive & Effective Organization
Key objectives:
consult regarding the current state of all
district schools and facilities;
inform the public; and
request ideas for potential changes to schools
and facilities.
For more information contact:
Kim Morris, Secretary Treasurer
250-505-7039 or facilities@sd8.bc.ca

= view picture of this item on our website: www.pennywiseads.com

www.sd8.bc.ca
C

Nov. 18, 2014

PAGE 27

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Events

Animals/Animal Care

WHOLE SCHOOLS 16th ANNUAL COFFEE HOUSE: Saturday, Nov. 29, The Whole School Presents our 16th Annual Blue
Moon Coffee House. Join us from 5-10 at the Winlaw Community Hall for a sumptuous Indian feast, great live entertainment
and our huge holiday inspired silent auction. As always, this is
a family friendly event with a kids area and craft table. Admission is $3 at the door ( kids 12 and under free). Doors open at
5pm. No alcohol please. Call the school at 250-226-7737 if you
need more information. See you there!!

DOGSITTER AVAILABLE: Free meet & greet, home environment, lots of walks & attention. Call Linda, 250-687-0109.
DONT HAVE TIME TO WALK YOUR DOG? I DO! Anita in
Robson, 250-880-1819 (cell).
FROG PEAK PET RESORT: 2 acre fenced Adventure Park,
on-leash neighbourhood excursions. We only take 5 dogs
at a time. Lots of individual attention! For bookings call Monique, 250-226-0028.
NOVEMBER IS SENIOR PET MONTH. There is a lot you
can do to keep senior pets healthy, comfortable and mobile. Contact us at Nelson Animal Hospital, 2124 Ymir Rd,
Nelson. 250-352-7861, www.nelsonvet.com
PET SITTER SERVICES in the comfort of your home or
mine. Also providing dog walking, housesitting, daily dropins & boarding, Castlegar, references. Susan 250-365-0778.
YOUR ANIMAL FRIENDS HEALTH NATURALLY WORKSHOP: Nov. 23, 11am-3pm, Animal Reiki, Homemade Pet
Food, Natural Pet Remedies www.wayoflifematters.com/
natural-pet-remedies.html $50. Call Carola, 250-825-0105.
SAVE YOUR TIME AND YOUR MONEY... Pennywise sells
it faster. Thursday 3 pm is the deadline for advertising in
the next weeks paper. 1-800-663-4619
FIND YOUR NEXT PET IN PENNYWISE!

Animals/Animal Care
AGILITY COMPETITION TUNNEL: 20 long, excellent
condition, $100obo. 250-399-4191.
AKC GOLDEN RETRIEVER PUPS: OFA hips, vet checked,
1st shots, wormed, dewclaws removed, 12 years breeding
experience, health guarantee, $800, ready mid-November.
509-429-8005, www.DenzilsGoldens.com
BARK N ROLL INN, WINLAW: Luxury home-style dog
boarding, riverside, fenced acreage, no kennels, affordable, www.barknrollinn.com 1-250-448-6553.
CANINE PSYCHOLOGY CENTER: Dog boarding, consulting, personal & group training, daycare, workshops.
250-367-0124.
DOES YOUR DOG NEED AN OBEDIENCE BRUSH UP?
Book now for January classes. Group classes/private lessons. Jeanne Shaw, CPDT, Love 2 Play Dog Training. www.
love2play.ca 250-359-6650.
DOG BOARDING: Dogs love it at Spirit of the North Kennels, Salmo. www.spiritofthenorthkennels.com 250-3579390, almagaw@telus.net

Livestock
HAY FOR SALE: Good quality. 250-226-7427.
WANT TO SEE MORE
ANIMAL/LIVESTOCK CLASSIFIED ADS?
Visit: www.pennywiseads.com

november is

senior pet month!


Do you have a senior pet at home
who is slowing down? There is a
lot that you can do to keep them
healthy, comfortable and mobile.
Please contact us for
more information!

Dr. Celeste BignellDVM, BSc


Dr. Veronika PakDVM, BSc
Dr. Leanne SackneyDVM, BSc

250-352-7861

www.nelsonvet.com

2124 Ymir Rd., Nelson just down from Nelson Toyota


Hours: Monday to Friday 7:30am - 5:30pm; Saturday 9am - 1pm
PAGE 28

Nov. 18, 2014

MAMA CATS

These four beauties all came into KAAP care while pregnant,
or with very young kittens. Lexie, Kordy, Gemma, & Cleopatra
have all been great moms, and their kittens have been adopted
into loving families. Now its their turn they deserve the very
best too! Please check our website for more information on
these lovely kitties www.kaap.ca/adopt and come and meet
them! They are all young, under 2 years, and have now been
spayed and vaccinated. Or call KAAP at 250-551-1053.

Kootenay Animal
Assistance Program
Society (KAAP)

sponsored by

= view picture of this item on our website: www.pennywiseads.com

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Real Estate

Rentals

CHECK OUT THE CLASSIFIED AD INDEX ON PAGE 4.


Real Estate classifications appear on 2 separate pages.
2.7 ACRE HOBBY FARM: Beautiful property near
Fruitvale. Home, barn, garage, chicken coup, hottub.
Very clean, seller motivated, $248,900. Visit: realtor.ca
ID#2394166. Contact Nancy Kaiser, 250-368-1817.
HOUSE FOR SALE IN BONNINGTON: Clean & bright
3bdr, 2bath modular home on a full-hectare, sunny, big
garden/very private, $225,000.00. Lisa Cutler, 250-3527252. Remax Listing ID: 2399935.
SOLID, CLEAN, WELL-MAINTAINED WEST TRAIL HOUSE:
3bdr, 2bath, with many upgrades including electrical, central
air, hot water tank, exterior paint and garage roof etc. Basement
is a total reno with rental potential. Amazing view! $162,500.
For more info, photos or to view, call 250-551-0261.

3BDR HOUSE WOODLAND PARK, CASTLEGAR: 1acre


lot, backing on river, very private, $1200/mo. +utilities.
403-418-5762.
3BDR HOUSE, NEAR SLOCAN CITY: F/s, wood/electric,
young family preferred, $750/mo. +utilities. 250-355-2468.
3BDR, 1BATH HOME, WINLAW: 14 acres, wood heat, ns,
references required, pets on approval, $1200/mo. +utilities. 250-353-9682/250-353-1400.
BONNINGTON: Available Dec. 1, sunny, private, 3bdr,
2bath, references required, $1100. 250-358-2317.
5BDR HOUSE DOWNTOWN CASTLEGAR, $1200/mo. +
utilities. 250-505-4703.
AFFORDABLE RENTAL OPPORTUNITY, CASTLEGAR:
CMHA Kootenays, has 3bdr units available for rent to low
income families. Sites well-maintained, large green space
and playground, fridge/stove, fresh paint and newer flooring. More info, call 250-365-2667. **BC Housing application form and proof of income required.**
AVAILABLE IMMEDIATELY: 2bdr lower suite in walkout basement, central Castlegar, f/s, dw, w/d, very wellmaintained quiet home. Looking for a quiet non-smoking
tenant, $850/mo. +power. Willing to negotiate for the right
tenant. References required. 250-365-9513.
BEAUTIFUL LAKEFRONT 2BDR, 1BATH SUITE, SYRINGA: 12 minutes west of Castlegar, 5 appliances, ns/np,
reference required, $1200/mo. inclusive. 250-365-5333.
CASTLEGAR 2BDR APARTMENT: Bright, spacious, f/s,
laundry, close to amenities, ns/np, $725/mo. +utilities.
250-359-7819.
CASTLEGAR: Clean, quiet 3bdr, large deck, air, full
kitchen, w/d, ns, cats OK, $1200/mo. +utilities (WiFi included). 250-608-2762.
COOL, COZY YURT, THRUMS: Available Dec.-Apr. wood/
electric heat, wfi, np, strong references, proof of income.
250-399-4116.
LARGE 2BDR HOME IN SHUTTY BENCH just north of
Kaslo, wood heat, stunning views, fabulous property, quiet neighbourhood, $800/mo. +utilities. Quiet, ns working
couple or family. References required. 250-354-3591.
LAST RENTAL AVAILABLE IN THE CHUCKLEBERRY
COMMUNITY! Cute, cozy and clean 2bdr suite on a quiet,
spacious acreage. Organic gardens, great views. Amongst
a fun community in Beasley. W/D, NS, ND, $735/mo. +utilities. Call Jon at 250-359-6669.
MODERN COTTAGE, NEAR WINLAW: 2bdr, loft, quiet,
valley views, suitable 2 people, $875/mo. 250-226-0034,
www.merryproperties.com
RENTALS AVAILABLE IN NELSON & CASTLEGAR!
www.westkootenayrentals.com West Kootenay Rentals,
250-359-5021.
WINLAW: Furnished cottages from $625/mo. including
utilities, plowing, etc, til May 31. Respectful people with
references. 250-226-7306, www.karibupark.com

Land
1/2 ACRE, OOTISCHENIA, VIEW LOT: Extremely private road,
water included, all services available, $100,000. 250-304-7865.

Mobile Homes For Sale


MOBILE HOME, SENIORS PARK(55+): Fruitvale. 12x68
w/finished 20x10 addition, small garden & lawn, metal
storage shed, new rubberized roof coating, poly ground
sheet, plumbing updates, new electric furnace, laminate
floor/carpet, w/range, fridge, dw, microwave, TV, couch,
chairs, bed, $35,000obo. 250-367-9694.

Rentals
1000SQ.FT. HALF DUPLEX IN MONTROSE: Close to
bus stop & post office, heat pump, double pane windows
& storage, $850/mo. Please call 604-374-0121 or email
carlyhebner@gmail.com
1BDR BASEMENT SUITE, S.CASTLEGAR: Partly furnished, separate entrance, suitable for single, ns/np,
clean, bright, roomy, $650/mo. utilities included, (no laundry). 250-304-5066.
1BDR BASEMENT SUITE, TRAIL: Separate ground entry,
w/d, np/ns, references, $575/mo. +utilities. 250-231-0920.
1BDR BASEMENT SUITE: Available Dec. 1, ns/np, shared
laundry, quiet downtown Castlegar neighbourhood, $700/
mo. includes utilities. 250-687-4606.
2BDR APARTMENT, FAIRVIEW, NELSON: Clean, quiet,
adult-oriented building $650/mo. +utilities, ns/np, references required. 250-352-3965.
2BDR CASTLEGAR DUPLEX: Oglow Subdivision, w/d,
ns/np, December, $925/mo. + utilities. 250-608-1583.
2BDR HOUSE IN VALLICAN: Quiet surroundings, f/s,
w/d, ns/np, carport, 30-35 min to Nelson/Castlegar. Available immediately. 1-250-365-2484.
2BDR LEGAL BASEMENT SUITE, NORTH CASTLEGAR:
Recent upgrades, f/s, w/d, $595/mo. +utilities. 250-608-1583.
2BDR QUEENS BAY HOUSE: 1700sq.ft., acreage, 1.5
bath, appliances, wood/electric heat, ns, $1050/mo. +utilities. 250-229-2226.
2BDR SPACIOUS ADULT-ORIENTED 6-PLEX APARTMENT: North Castlegar, 4 appliances, n/p, smoking outside, $585/mo. +utilities. 250-365-6147.
2BDR SUITE: Bright, quiet house, on bus route, large
yard and patio, single person or couple best suited, ns/np,
$700/mo., includes utilities & laundry. 250-513-0535.
3BDR HOME, RELKOFF ROAD: Private country setting, 1km
to downtown Castlegar, $1200/mo. +utilities. 250-365-3733.

Commercial Rentals
CASTLEGAR 1600SQ.FT. OFFICE/ WAREHOUSE:
Light industrial zoned. Rent negotiable. 250-365-3059
kats4348@shaw.ca
CASTLEGAR SMALL COMMERCIAL BUILDING: Highway frontage, great for restaurant or business venture.
Lease or rent, for info call 250-365-5003.

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 29

To Place Your Ad Call 1-800-663-4619

Real Estate
CHECK OUT THE CLASSIFIED AD INDEX ON PAGE 4.
Real Estate classifications appear on 2 separate pages.
CASTLEGAR, MERRY CREEK RD, 11 ACRES: With 3bdr
home, panoramic view, near shopping, ready for development, utilities to property line. 250-365-4823.
EAGLE HOMES: 4430 Minto Rd, Castlegar. 250-3652121, 1-877-632-4536, www.EagleHomes.ca. Inquire
about rental lots in the West Kootenay area with your new
Eagle Homes purchase.
WE HAVE SAVED OVER $6,200,000 in real estate commissions for our Kootenay clients. Property Guys 250-3042269 www.propertyguys.com

Commercial Real Estate


1750 SQ.FT. COMMERCIAL BUILDING in prime location,
Kaslo. Potential for upper storey development, $159,000.
Phone 250-353-7500.

Land

411 HALL STREET


NELSON

250-352-6261
TOLL FREE 1-800-337-1622
www.vincedevito.com

2.7 ACRES IN GENELLE, ZONED LIGHT INDUSTRIAL:


With well, $135,000. 250-365-3155.
YOU WRITE IT...WELL PRINT YOUR COMMUNITY INFORMATION ARTICLES. Leave at our Kaslo Pennywise
office (401A Ave), e-mail: editorial@pennywiseads.com, fax
to 250-353-7444, or mail to Pennywise, Box 430, Kaslo, BC
V0G 1M0. Please note: Deadline for community article submissions is noon on Wednesday. The best length for your
articles is approximately 100 words. No Thank You lists,
please. (We reserve the right to edit or refuse articles.)

TRY YOUR

LU C K

U.S.

ON OUR NEW SLOT MACHINES

B IG
BINGO

0
$100,00 T
JACKYPTIOME

AFTERNO
ON
BIN
SUNDAY G O
C

ON SA ARDS GO
GAME STA LE @ 1PM
RTS @ 1:45
PM

E VENI
N
BINGO G

FRI. &
ON S SAT. CAR
GAME ALE @ 5:30DS GO
STARTS
P
@ 6:15 M
PM

7919 N Division Street


Spokane, WA 99208
Toll free direct: 1.888.535.4900

PA
and PSLTA
MOND AY
AYS
EVERY MO
NDAY IN

EVER
Y!
YO U P L A

ARCH
$14.95 G
PASTA DIN ETS YOU A
N
$5.00 FRE ER AND A
E PLAY
VOU
FOR OUR CHER
Ask your se SLOT FLOOR
rver for de
tails

SPECIALS
FRIDAYS - PRIME RIB SPECIAL $23.95
WING WEDNESDAY 1LB ONLY $6.50
100 Hall Road, Castlegar | 250.304.6300
Restaurant 250-304-6311

PAGE 30

Nov. 18, 2014

x
x
x
x
x
x
x
x

NorthTown Mall
Costco, Hobby Lobby
Pier 1 & Target
Azteca & Olive Garden
Bed, Bath & Beyond
Sports Authority 
Ulta & DSW Shoes
TJ Maxx & More!

= view picture of this item on our website: www.pennywiseads.com

TRAIL 197552

www.PropertyGuys.com
250-304-2269

$180,000

Move-in ready 3 bed 1 bath home,


garage parking for 3 cars.

1-855-742-4539

List on
realtor.ca*
for
$449
Ask us how!
GRAND FORKS 197568

NELSON 197560

Like Us On
Facebook

REDUCED

NELSON 197589

$327,000

to keep up to date on all the


latest homes on the market:

www.facebook.com/
PropertyGuys.comWestKootenays

CASTLEGAR 197613

$469,900

CASTLEGAR 197817

$575,000

Sunlit 3 bed 4 bath home on 5.65 acres.


Private, yet minutes to all amenities.

3 bed 2.5 bath home on 5.37 acres. Short


walk to riverfront.

4 bed 2 bath split level family home and


acreage. Equipped for horses.

1-855-742-4539

1-855-742-4539

1-855-742-4539

TRAIL 197810

CRESTON 197524

CASTLEGAR 197563

CRESTON 197807
REDUCED

$447,900

$182,999

$295,000

$179,900

$548,000

$179,900

Stunning 3 bed home with lots of large


windows, on 0.5 acre fully fenced yard.

2 bed 1 bath end unit in lower Fairview.


Screened front balcony, replace.

Great 4 bed 2.5 bath home with potential


in-law suite in walk-out basement.

Cozy 2 bed 1 bath home in Sunningdale.


Private fenced spacious back yard, 2 sheds.

Stunning 4 bedroom 3 bath home is surrounded


by 10 acres of amazing land including orchards,
vineyards, gardens, and mature trees.

3 bed 1 bath bungalow, low


maintenance and affordable

1-250-442-0906

1-855-742-4539

1-855-742-4539

1-250-364-1940

1-855-742-4539

1-855-742-4539

BALFOUR 196708

$315,000

Lakeview home just steps to a sandy


beach. 4 beds, 2 baths, separate suite..

ROBSON 197546

Agent Like Service


Get Started for $99* Special

REDUCED

$389,900

Includes a listing on Realtor.ca*


Customers who List Now, Pay Later* can now pay the remainder of their package once their property is sold (call for details!)

1-250-505-9933

GRAND FORKS 197580

Beautiful 5 bed 2 bath heritage home


overlooking the Columbia River.

1-855-742-4539

GRAND FORKS 197575

GREENWOOD 196255

GRAND FORKS 197578

CASTLEGAR 197500

KASLO 197561

REDUCED

$339,500

$219,000

$312,000

$329,000

$399,900

Vaulted ceilings, argon lled low energy


windows. High end moldings, doors and
nishes. Radiant in-oor heating.

$215,000

Lovely 3+ bed 2.5 bath home with open deck


and patio. Fully fenced yard.
In ground sprinklers.

3+ acres of level, fertile land, ideal


neighbourhood, highly desirable location.
Serviced property.

7 plus acres with 3240 sq ft 4 bed 2


bath family home. Private and peaceful.

Lovely 5 bed 2.5 bath home. Large windows


throughout create sunlit interior. Both levels
above ground. Amazing views from any room.

This 4 bed 4 bath single family home is


currently a legal triplex - great home or
investment property.

1-855-742-4539

1-855-742-4539

1-250-445-2251

1-855-742-4539

1-250-687-4782

1-250-353-2649

CASTLEGAR 197590

NELSON 197577

TRAIL 197565

TRAIL 197591

GRAND FORKS 197583

CHRISTINA LAKE197582

NEW PRICE

$499,900

$109,000

$215,000

$499,000

$369,900

$650,000

Extensively upgraded 3 bed 2 bath home on


6.5 acres. Plenty of covered storage space.

Cozy 2 bed 1 bath home.


Open concept, low maintenance yard.

Perfect for a young family. 3 bed 2 bath


home is located across from school and
park, steps to river.

5 bed 4 bath 3680 sq ft home on 1/2 acre of


beautifully landscaped property.

53 bed 2.5 bath bungalow with 75 feet of


waterfront and a stunning view.

3 bed 1.5 bath home 85% complete,


1.7 acres overlooking Christina Lake.

1-250-365-0949

1-250-509-0145

1-855-742-4539

1-855-742-4539

1-250-442-5073

1-855-742-4539

GENELLE 197587$419,900

$375,000

$419,900GENELLE 197905

CASTLEGAR 197815
$419,900

$435,000

Beautiful 4 bed 2 bath family


home with fully contained
suite. Great yard, covered
deck and shop. Paved drive,
double attached garage.

2760 sq ft, 6 bed 3 bath


home on elevated, level
half acre lot with spectacular
Columbia River views.
2 decks, irrigation system.

1-855-742-4539

1-250-693-2262

$249,900

4 bed 2 bath split level home.


New laminate ooring
throughout. Level lawn,
mature trees, paved drive,
single attached garage,
front deck.

1-855-742-4539

*The brokerage programs described are available only through our partnership with friendly, progressive real estate brokerages that are members
of the Canadian Real Estate Association. *List Now. Pay Later. is a deferred payment program offered through a third party provider.

For More Info & Free Advice Call Simon 250-304-2269 1402 Columbia Ave, Castlegar (opposite Mohawk)
Email: sajones@propertyguys.com Website: www.propertyguys.com

60 Million
Visits to our
Website per
Month

We Have Saved Over $6,200,000 in Real Estate Commissions for our Kootenay Clients
Pennywise

Nov. 18, 2014

0588

SELF SERVE PACKAGES FROM $599 FULL SERVE PACKAGES FROM $999
We market your home You show it The lawyer does the paperwork

PAGE 31

All classified ads may be viewed at www.pennywiseads.com

Rentals

Rentals

1BDR KITCHENETTE SUITES, 6-MILE: Available immediately, fully furnished, includes utilities, WiFi, cable, onsite laundry. 250-825-9420.
2BDR HOUSE, WATERFRONT, THRUMS: F/s, w/d, on
acreage, snow removal/lawn cutting, quiet area, nd, available immediately, $800/mo. 250-399-4547.
3BDR, CASTLEGAR: Close to schools, shopping, $1100/
mo. +utilities. 250-365-4857.
4BDR NEWLY RENOVATED MODULAR HOME: Located
on lakeshore property, Scott Rd next to Kootenay Bay ferry
landing on East Shore. Parking, references required, $650/
mo. +utilities. Ricki, 250-768-7471.

MOUNTAIN COTTAGE above Slocan Lake available for


Winter Rentals. Nov. 1-May, weekly/monthly or long-term,
Beautiful 4bdr/2bath on acreage with VIEWS! www.slocan
lakemountaincottage.com 250-231-2174.
REX HOTEL NEWLY RENOVATED CLEAN ROOMS: New
fridges/TVs, WiFi, ns, shared washrooms. Nightly/weekly/
monthly rates. 250-368-6611.

Shared Accommodation

Whats on Your Plate? contd

Inquire about
rental lots
in the West
Kootenay area,
with your new
Eagle Homes
purchase.

Proudly built in BC

250-365-2121 1-877-632-4536
4430 Minto Rd, Castlegar

MATURE RELIABLE COUPLE seeks quiet rental in rural


Nelson. Excellent credit history. 250-276-4226.

FURNISHED ROOM IN WEST TRAIL HOUSE: Includes


utilities, internet, laundry, $450/mo., ns/np, references.
250-608-4425.

Home & Land Package


at under
in Montrose starting$300,000

Ask us about the


Canadian made
Difference

Rentals Wanted

Next to the The Brick

from pg 14
Come and see this movie, it is films like this that give viewers
the power to make educated choices and to come to a fuller
understanding of our food systems. At the end of the day what
is more close to home and personal then the food we eat?
GMO OMG screens at 7:30 on Wednesday, November
19 at the Nelson Civic Theatre. Tickets are $10 for the
general public or $8 for students, seniors, and EcoSociety members. The proceeds will go to the West Kootenay
EcoSociety for its educational efforts to bring awareness
to environmental issues and conservation projects. More
information can be found online at www.ecosociety.ca

Local ... Knowledgeable ... Professional

We work for you insuring your best interest!


, KDG PHW ZLWK RWKHU PRUWJDJH EURNHUV EHIRUH 1DQF\ EXW WKH UHDVRQ WKDW , FKRVH WR
ZRUNZLWKKHURQJHWWLQJDPRUWJDJHZDVEHFDXVHVKHWRRNWKHWLPHWRUHDOO\ORRNDWRXU
SHUVRQDOVLWXDWLRQDQGJLYHXVDGYLFHRQWKHEHVWZD\WRPRYHIRUZDUG7KHDGYLFHZDVQW
DERXWZKDWZRXOGEHWKHHDVLHVWZD\WRJHWDPRUWJDJHLWZDVDERXWZKDWZDVEHVWIRUXV
SHUVRQDOO\ZKLFK,UHDOO\DSSUHFLDWHG7DONLQJDERXWDQGVKDULQJLQIRUPDWLRQRQQDQFHV
LVDYHU\SHUVRQDOWKLQJDQGFDQVRPHWLPHVEHXQFRPIRUWDEOHEXW,IHOWYHU\FRPIRUWDEOH
ZLWK KHU SURIHVVLRQDOLVP WKURXJKRXW WKH SURFHVV :H KDG D VRPHZKDW FRPSOLFDWHG
VLWXDWLRQWKDWWRRNDORWRISDWLHQFHDQGQXPEHUFUXQFKLQJRQKHUSDUWWRPDNHWKLQJV
ZRUN&RPPXQLFDWLRQZDVRSHQWKURXJKRXWWKHSURFHVVDQGZHZHUHDEOHWRDVNTXHVWLRQV
DORQJWKHZD\VRWKDWZHXQGHUVWRRGHDFKVWHS
,ZRXOGKLJKO\UHFRPPHQG1DQF\WRDQ\RQHORRNLQJIRUDQRSHQDQG
KRQHVWPRUWJDJHEURNHUZKRORRNVRXWIRU\RXUEHVWLQWHUHVWV
7KDQNV1DQF\
Let Jason help you today!
Kristen Brennan
Saving to buy a house?
Active Balance Chiropractic
Retirement?
Childrens Education?
1-888-998-9513
Emergency fund?

Nancy Trotman
Looking for a mortgage?

Let Nancy help you today!


Buying a house? Renovating?
Time to consolidate?

Access your equity for renovations,


RRSPs, pay off high interest
loans and much more!
Why shop at one bank when we
can shop at over 30?

There are NO COSTS to use a mortgage broker!


Call Nancy 1-888-998-9513 today
Centum Mortgage Store Ltd 0RUHVHUYLFHVPRUHOHQGHUVDWQRFRVWWR\RX

Its never too early and its not too late.

Call Jason Cesa at Krueckl Financial


Services 1-855-365-RRSP(7777) today

Investments, Insurance, Advice


KFS INC 1-855-365-RRSP(7777)

/LNHXVRQIDFHERRNDWIDFHERRNFRPNIVLQFIRUDFKDQFHWRZLQDJLIWFHUWLFDWHIRUWKH(OHPHQW
PAGE 32

Nov. 18, 2014

= view picture of this item on our website: www.pennywiseads.com

BAR T5 TRAILERS
& EQUIPMENT SALMO

6160 Hwy 3 W, Salmo BC 250-357-2604 bart5salmo@gmail.com

www.bart5.ca

FINAL 2014 TRAILERS CLEARANCE SALE!


Once theyre gone Theyre gone!

Last trailers
left! Already
discounted from
original price!

5x8 cargo $2,300


NOW $1,895

5x8 black, side door $2,495


NOW $2,295

5x8 rear ramp $2,595


NOW $2,395

5x8 silver $2,395


NOW $2,195

6x10, side door $3,350


NOW $3,196

6x10, dome roof $3,695


NOW $3,495

6x12, RV door, lined ceiling


$3,950 NOW $3,750

7x12, silver, dome roof


$5,265 NOW $4,995

7x12 silver, X wide ramp, D rings


$5,665 NOW $5,395

7x12 black, X wide ramp,


Cambar side door
$5,665 NOW $5,395

7x14, X tall, rear ramp,


D rings installed
$5,195 NOW $4,950

7x14 silver $4,696


NOW $4,495

7x14 black, dome roof


$5,495 NOW $5,250

7x16 silver dome roof


SOLD

4 place 14 sled deck


aluminum
$3,800 NOW $3,195

7x12 aluminum raft trailer


$2,695 NOW $2,495

6.5x12 tandem utility


7000lb GVWR
$2,895 NOW $2,795
5x8, 3500lb axle, 15 tire
$1,650 NOW $1,500

7x10 utility, 36 sides


$2,695 NOW $2,595

Pennywise

18 equipment 14,000lb GVWR


$5,995 NOW $5,580

Nov. 18, 2014

PAGE 33

All classified ads may be viewed at www.pennywiseads.com

Automotive

Automotive

CHECK OUT THE CLASSIFIED AD INDEX ON PAGE 4.


Automotive classifications appear on 2 separate pages.
BLACK FRIDAY SALE at Champion Chevrolet in Trail.
Huge rebates and 0% available on most new models! Free
winter tires!
FOUR WHEEL AND ALL WHEEL DRIVE SALE ON NOW
at Nelson Toyota! www.nelsontoyota.com See display ad
for details.

Cars

FREE CAR REMOVAL: All areas, some restrictions or


bring your old vehicle to us and well pay you. Scrap
King Auto-wrecking, 1-888-357-2091.
MCLACHLAN AUTOMOTIVE: 8153 Old Waneta Road,
Trail DL#24802, www.mclauto.com, 250-364-2881, 1-888364-2881. This weeks feature: 2012 Arctic Cat M1100
Turbo Snowmobile.
MIDAS: 618 Lake St, Nelson. 250-354-4866. Tread with
confidence this winter with winter tires from Midas.
NOVEMBER ONLY: Get a 10 year warranty at no charge
on a new Kia at Castlegar Kia.
SCRAP KING AUTO WRECKING & TOWING: 1660 Airport Rd, Salmo, 1-888-357-2091. Free car and truck removal - Nelson, Salmo, Trail, Castlegar, Slocan Valley,
Kaslo and everywhere in between.

Vans
2005 WINDSTAR MINIVAN: Excellent condition,
58,000kms, 2 sets of tires and rims, $6500. 250-693-5434.
WORKING AROUND THE CLOCK... thats classified advertising: 1-800-663-4619.

1991 TOYOTA COROLLA WAGON AWD: Automatic, only


78,000kms, $3995obo. 250-354-7254.
1998 TOYOTA CAMRY XLE: Power everything, leather,
runs excellent, new winters, 255,000kms, $2700obo. 250359-7867 after 5pm.
2003 HONDA ACCORD EX: Manual, leather, no rust, engine tight, winters on rims, $3500. 250-365-2020.
2005 TOYOTA COROLLA CE SPECIAL EDITION: Sunroof, mag wheels, air, 170,000kms, great shape, well-maintained, winters on rims, $7500. Call 250-354-3604.
2006 CHEVROLET IMPALA LTZ: 50,000kms, pw/pdl/
ps, cruise control, remote keyless start, $8500obo. Call
250-365-3597.
SUBARU OUTBACKS: 2001, 273,000kms, 5spd, $3500;
2000, 259,000kms, auto, $4000. Both run well, regular
maintenance with records available. 250-362-9680.

Utility Trailers
CUSTOM BUILT SLED DECK: By Alfab, 8x10 aluminum,
plus Beavertail, w/10 ramp & 3 extension, snow guides &
superclamps, fits longbox, LED lights, like new, $2100 (no
tax). 250-359-7923.
TRUCK DECKS & SNOW TRAILERS: Taking orders
NOW!! Nelco Marine & Build-A-Dock www.atvsleddeck
trailersbc.com 250-354-9011, next door to Main Jet.
WHAT DOES PENNYWISE HAVE THAT NO ONE ELSE
DOES? Your attention! If you want to buy OR sell, call us.
You know it works! 1-800-663-4619.

4 Wheel/All Wheel Drive Sale on NOW!


$14,480

2006 Subaru Legacy


Outback Wagon 3.0 R
L.L. Bean AWD BU1644

$24,995

2009 Toyota Tacoma TRD


Sport 4x4
BU1645

3.0L 6 cyl, 5 speed auto, leather, sunroof,


with 79,685 km. Winter tires, rims included.

4.0L 6 cyl, 5 spd automatic with 125,620 km


plus a tonneau cover.

$8,650

$8,995

2005 Mitsubishi Outlander


LS AWD CO1458A

2.2L 4 cyl, 4 spd automatic, 188,381 km.


Winter tires and rims included.

2005 Chrysler 300 Touring


AWD PR1969A

3.5L 6 cylinder 5 speed automatic with


150,373 km, sunroof and new rims.

250-352-2235
1-888-352-2235
PAGE 34

Nov. 18, 2014

$9,988

2004 Honda Pilot EX 4WD


BU1638A

3.5L 6 cyl, 5 speed auto, DVD, leather,


with 187,254 km.
Winter tires and rims included.

$13,288

2009 Ford Ranger Ext Cab


4x4 BU1632A
5 speed with 114,000 km.

$12,488

2008 Toyota Highlander


Limited FWD
BU1643

3.3L 6 cyl 5 spd auto with 173,374 km.


Winter tires included.

$25,995

2008 Chevrolet 1500 Z71


Silverado LTZ 4x4 BU1628

Crew cab, 5.3L 8 cylinder automatic


with 50,850 km.

WE PAY CASH FOR CARS AND TRUCKS


DL#5970

www.nelsontoyota.com

Like Us On
Your West Kootenay Toyota Dealer Since 1969 2324 Ymir Road, Nelson

= view picture of this item on our website: www.pennywiseads.com

Castlegar/Slocan Valley

Castlegar/Slocan Valley

Automotive

Automotive

CHECK OUT THE CLASSIFIED AD INDEX ON PAGE 4.


Automotive classifications appear on 2 separate pages.

Parts, Accessories & Service

Cars
1996 NISSAN MAXIMA: 4dr, loaded, leather, sunroof, 3L-V6,
172,000kms, 34mpg, reliable luxury auto, $3195. 250-365-3658.
1997 DODGE STRATUS: 142,500kms, new rear brakes &
drums, front disc brakes, rotors & battery, 4 winters on rims,
4 summers on rims, air/tilt/cruise CD player, well cared for
& maintained, $2200. Laurie, 250-608-3143(Castlegar).
2000 ACURA: 4dr, sedan, loaded, tan exterior/interior,
195,000kms, one owner, summer/winter tires, $3800. 250226-6886.
2000 SUBARU OUTBACK: Loaded, body in great shape,
250,000kms, needs engine, $750obo. 250-355-2608.
2004 BUICK LE SABRE: Fully loaded, non-smoker,
120,000kms, $4850. Great winter car! 250-368-6103.
2008 NISSAN VERSA: 4dr sedan, auto, blue tooth, sunroof, fog lights, good summer & new winter tires, all on
rims, near new brakes, 112,000kms, $7000obo. Nakusp,
250-265-3127.
2008 TOYOTA COROLLA: Red, 130,000kms, great condition, roof racks, winter/summer tires, $9000obo. Call
Shawn, 250-513-1717.

Trucks
1991 CHEV SILVERADO HD 4X4: Good condition, asking
$2200obo. 250-357-2900 or 250-367-0070.
1996 GMC SONOMA PICKUP: 4cyl, manual, w/canopy,
good running order, no rust, $1800obo. 250-365-6639.
2003 NISSAN FRONTIER 4X4: Crew-cab, auto, shortbox,
$8500. 250-265-0062 leave msg.
2005 CHEVY SILVERADO 4X4 SE: 192,000kms, nice
truck, good tires, must sell, $8000. 250-369-6868.
2005 DAKOTA 4X4: Quad-cab, auto, air, 147,800kms,
$9000. 250-608-2111.
2007 CHEV COLORADO 4X4: Extra-cab, 4cyl, std,
162,000kms, air, aluminum rack, spray boxliner, stereo
Bluetooth, good tires, $10,600. 250-304-7401.

FREE! FREE SCRAP CAR REMOVAL: Smokey Creek Salvage, 3453 Yateman Rd, South Slocan. Drive your vehicle
in for minimum $80. Call 250-359-7815..
SPECIAL: Paint jobs, $885, flat satin, single stage, base
clear, 38yrs experience, restorations, rust repair, smash repairs, sandblasting, pick up & delivery available, workmanship guaranteed. Call 250-265-4419.
THULE RACK: 50 bars, gutter/gutterless foot packs,
Thule ski box, functional, $125obo. 250-226-7827.
TORK LIFT CAMPER TIE DOWNS, $250; Air Shocks System, $500. Both fitted for 2006 Toyota Tundra 6.5 box,
used 3 months. 250-364-3022 or leave SMS Text. Email:
njgmckinnon@gmail.com

Motorcycles/ATVs
5 SNOW BLADE & MOUNT for ATV, $650. 250-357-2026.

RVs/Campers
2011 24 SPORTSMAN TRAVEL TRAILER: Weighs 2900lb,
sleeps 7, 6 slide, great condition. Call 250-365-0805.

Heavy/Farm Equipment
HYDRAULIC SYSTEM: 5x2 and two 4x4, and one 2.5x2
cylinders; Denison vane pump 40 & 20 GPM output; three
flow controls, two double valve banks; 12 hoses w/fittings;
30gal hydraulic tank, $750. 250-446-2543.
TIRE CHAINS: 11:00x24.5 size, 4 sets triples, 2 sets singles, very good condition, $650/all . 250-365-3014.

WINTER TIRE
PRE-ORDER

SALE

BIG SAVINGS! See Store for Details

SUVs
SELLING SILVER 2005 CRV due to leaving province.
Good shape, new brakes, alloy summers, winters on rims,
no issues,170,000kms, $9500 firm. 250-226-7271.

10% - 20% OFF

Vans

4 New Tire Purchase


Limit 4 tires per coupon.
See store for details.
Coupon Required.

1993 CHEV LUMINA MINIVAN: 6cyl, auto, 300,000kms,


good running order, no rust, $1700obo. 250-365-6639.

Expires 11/30/14.
Not valid with other promotions or offers.
Valid only at Colville Tire

Parts, Accessories & Service


205/70R15 NOKIAN SNOW TIRES: With rims, used one
season, $100. 250-359-2924.
4 LOW PROFILE SUMMERS mounted on 16 Mazda sport
rims, (good one more season), $200. 250-354-4858.
4 TIRES 16 FIVE HOLE RIM: New condition, $100. 250365-6816.
4 WINTERS ON RIMS: For Subaru Loyale, 175/70R13,
Firestones, almost brand new, $200. 250-365-0778.
COLVILLE TIRE: 163 East Second St, Colville WA, 509684-4551, www.colvilletire.com. Winter Tire Pre-Order
Sale; 10-20% Off 4 new tire purchase. See display ad for
details.

FREE
Shuttle
FREE
Shuttle
Service

Service

163 East Second Street


Colville, WA

509-684-4551

We have
Nitrogen
We Have
Nitrogen
Service
Service

Your On & Off Road Specialist!


Monday - Friday 7:30 - 5:00 Saturday 8:00 - 12:00

www.colvilletire.com

= view picture of this item on our website: www.pennywiseads.com

Nov. 18, 2014

PAGE 35

DONT WAIT
PRE-OWNED INVENTORY
REDUCTION SALE
NEW ARRIVALS ~ TRUCKS
2013 Ram 3500 Laramie Crew longbox #14215A..............$55,995
2013 Ram 1500 Outdoorsman Crew #14188A.........................$33,995
2013 Ram 1500 SXT Crew #14145A..............................................................$28,995
2012 Ram 1500 Outdoorsman Crew #14123A..........................$31,495
2012 Ram 1500 SLT Plus Crew #13167A..............................................$34,995
2012 Ram 1500 SXT Quadcab #13183A................................................$26,995
2012 Ram 2500 Laramie Crew Diesel #14207A.....................$49,995
2011 Dodge 1500 Outdoorsman Quadcab #14183A.$24,495
2009 Dodge 1500 Laramie Crew #13019A......................................$26,995
2009 Dodge 1500 SLT Plus Quadcab #14212A ......................$20,495
2008 Dodge 1500 Laramie Quadcab #14198B.......................... $18,995
2008 Ford Ranger Supercab Sport # 14125A......................................$8,995

NEW ARRIVALS ~ CARS, VANS & SUVS


2014 Dodge Journey Rallye AWD #14192A ......................................$31,995
2012 Nissan Rogue SL AWD #14031A.......................................................$23,995
2011 Chevy Impala LT 4dr SDN #14143A ................................................ $11,995
2010 Buick Lacrosse CX #14001A ........................................................................ $15,995
2010 Hyundai Santa Fe #14006A............................................................................ $11,995
2007 Toyota RAV4 V6 LTD #14172A ............................................................... $16,995
2007 Ford Fusion SE #13141B ........................................................................................... $7,995

2009 Jeep
Wrangler Sahara
Unlimited
All tricked up
$8000 in extras!
$

ALL OTHER USED INVENTORY


CLEARANCE PRICED!

26,995

Phone ahead for fast


credit pre-approval

Taxes, $425 doc fee extra

Trail Waneta Junction 250-368-8295


Chris Wenger
Sales

Sarah Youngson
Business Manager

Al Wenger
Owner

www.kootenaychrysler.com

DL#5888

1-888-812-6506

email: sales@kootenaychrysler.com

At Kootenay Chrysler, we dont sell you a car, we help you buy one.
PAGE 36

#14164A

When youre in the Kootenays


Youre in Kootenay Chrysler
Country

Trades Welcome

Gary Ashley
Sales Manager

Only 71,000 kms


Black

Nov. 18, 2014

Pennywise

Our Parts
Department
Now Open
Saturdays 9-4

Dont Wait! When they are gone,

theyre gone!!
2013 Ram 2500 Crew 4X4 SXT

2014 Ram 1500 Reg Cab Short Box

Engine brakes
6 speed auto
6.7L Cummins
engine

1 at this price!

$
STK#13113

5.7L Hemi-MDS
6 speed auto
Tow package

19,998

47,995

2014 Dodge Durango R/T

STK#14141

2014 Jeep Patriot Sport

5.7 Hemi MDS


8 speed auto
Sunroof
Heated leather

4 cylinder
Automatic
Air conditioning
Power group

53,995

1 left at this price!

STK#14221

2014 Jeep Grand Cherokee Overland


3.6L V6 PentaStar
4 speed auto
Panorama sunroof
Heated leather

1 left at this price!

$
STK#14191

53,995

1 left at this price!

STK#14100

2014 Jeep Wrangler Unlimited Sahara


3.6L V6 PentaStar
6 speed
Heated seats
Trailer package

33,495

1 left at this price!

STK#14052

2014 Dodge Grand Caravan SXT

2014 Dodge Dart SXT

3.6L V6 PentaStar
6 speed auto
DVD player
Tri-zone climate

2.4L Tigershark
6 speed manual
Rallye Package

26,495

22,245

STK#14139

6 to choose from

1 at this price!

$
STK#14080

20,995
Taxes, $425 doc fee extra.

Gary Ashley

Al Wenger

SALES MANAGER

OWNER

Our Parts
Department
Now Open
Saturdays 9-4

Trail Waneta Junction

www.kootenaychrysler.com
email: sales@kootenaychrysler.com
Chris Wenger

Sarah Youngson

SALES

BUSINESS MANAGER

250-368-8295

DT. NO. 5888

1-888-303-6343
1-888-30DODGE

At Kootenay Chrysler We Dont Sell you a Car, we help you buy one!
Pennywise

Trades Welcome
Phone ahead
for fast credit pre-approval.

Nov. 18, 2014

PAGE 37

All classified ads may be viewed at www.pennywiseads.com

Automotive

There are Better Buys in Pennywise!!

Trucks

LTD.
Nelsons Only Manufacturer of

ALUMINUM
Single Snowmobile Decks
Dry Boxes Truck Racks
2612 Robison Rd, Nelson www.alfabmfg.ca 250-352-0575
Like us on Facebook: www.facebook.com/alfabmfg

1990 DODGE DIESEL 3/4T 2WD: Good shape, runs well,


$2500. 250-355-2454.
1996 CHEV: Extended-cab, very clean, no rust, new winters, well-maintained, asking $9200. 250-365-3014.
1996 GMC 3500SLE SIERRA: Excellent condition, new
6 lift with 35 tires, $17,500obo. 250-354-3390.
1997 F350 XLT: Crew-cab, 7.3L diesel, power stroke,
270,000kms, 4 exhausted, 4 lift, cold air intake, ladder
bars, new 37 Hankook MTs on 17 rims, rebuild or for
parts(have cab), $3000. 250-304-5066.
1997 FORD F-250 4X4 LARIAT: Extra-cab, 3rd door, 5.4L
220,000kms, good condition, $3000. 250-354-4429.
1997 FORD F150 4X4: Runs great, $1795. 250-354-8462.

2015 OUTBACK 2.5i


LIMITED PACKAGE SHOWN

* Pricing applies to a 2015 Outback 2.5i (FD1 BP) with MSRP of $30,815 including freight & PDI ($1,650), documentation fees ($395)and battery tax ($30). License, taxes, insurance and registration extra. Dealers may sell for less. Dealer order/trade may be necessary. Model shown is a 2015 Outback 2.5i Limited Package (FD2LP) with MSRP of $38,715 including freight & PDI ($1,650),
documentation fees ($395), and battery tax ($30). License, taxes, insurance and registration extra. Vehicle shown solely for purpose of illustration, and may not be equipped exactly as shown.
**1.9% lease/nance rates available on all new 2015 Outback models for a 24-month term. Financing and leasing programs available through Toyota Credit Canada Inc. on approved credit. ***
$500 Holiday Bonus Accessories offer applies to lease, nance and cash agreements for all new 2014 and 2015 Subaru models (excluding the 2015 Impreza and 2015 WRX STI models) and can
be combined with Stackable Cash and Alternate Cash offers. **/ Offers valid until December 1st, 2014. See dealer or www.western.subarudealer.ca for full details. Ratings are awarded for ve
crashworthiness tests by the Insurance Institute for Highway Safety (IIHS) (www.iihs.org) moderate frontal, side impact, rear impact, roof strength, and the new small overlap frontal crash test.
To earn a 2014 TOP SAFETY PICK+, vehicles must earn good ratings in the moderate overlap front, side, roof strength and head restraint tests; a good or acceptable rating in the small overlap
front test; and a basic, advanced or superior rating for front crash prevention.

SUMMIT
SUBARU

Take It
ToThe
Top!

www.summit.subarudealer.ca
We Specialize in New & Used 4 Wheel Drives! Your AUTHORIZED Subaru Dealership in the West Kootenay
Phone 250-364-9988 or Toll Free 1-888-737-9988
Across from Waneta Plaza Trail DL#10441 TAXES AND $399.00 DOC FEE EXTRA

PAGE 38

Nov. 18, 2014

1998 HINO 3T CUBE TRUCK.


Asking $9000. Regular maintenance, set of winter tires used
one season. Call for more details
250-352-1222..
2000
CHEVY
SILVERADO
3/4T 4X4: Complete w/Western snowplow for personal use,
140,000kms, pewter colour, kept
in heated garage, excellent condition, asking $11,000. 250-3656857, 250-365-9498(c)
2000 TOYOTA TUNDRA 4X4:
Matching canopy(green), new
brakes & exhausted, engine has
180,000kms, $6000obo. 250365-1632.
2002 CHEV 4X4: Regular-cab,
shortbox, box cover, bed mat, 4
mounted winters, good condition,
$6000. 250-362-5882.
2006 DODGE RAM 3500: 5.9L
diesel, 6spd, std, crew-cab, longbox, 187,000kms, $16,800. 250365-3614, 250-551-0555.
2006 FORD F150 4X4: Crew-cab,
chocolate brown, detailed, wheel
alignment, new battery, 90,000kms,
$14,000. 250-357-0110.
2010 F150 XTR 4X4: Crew-cab, 5.4L,
76,000kms, canopy, 4 winter tires on
rims, $22,000. 250-365-6480.
2012 DODGE RAM 1500: Outdoorsman, mega-cab, hemi, Loaded, 65,000kms, $29,700. Call 250551-0555 or 250-364-8081.
2013 GMC SIERRA SLE 4X4:
Extended-cab, 6spd auto, 5.3L V8,
blue metallic with matching canopy, extended warranty, 26,000kms,
$31,000. 250-364-6004.
A PICTURE TELLS A THOUSAND WORDS It is SO TRUE!
For only a $1.49 picture charge,
you can save a LOT OF WORDS!
Call us today for more information on how to promote your item
most effectively, 1-800-663-4619.

= view picture of this item on our website: www.pennywiseads.com

1-800-663-4619

Automotive

THE GREAT 2014

SUVs
1994 SUNRUNNER/SUZUKI SIDEKICK: 180,000kms,
in perfect running, rust-free
condition, $4750obo. This
week only. 250-265-4419.
1999 JEEP GRAND CHEROKEE LIMITED 4X4: Runs
great, has winters on, new
stereo,
leather
interior,
208,000kms, $2500. 250777-2598.
2006 BUICK RENDEZVOUS: FWD, well-maintained,
good
winters,
extra summers on rims,
153,000kms, $7500. 250368-9685.
2008 CHEV TRAILBLAZER
4WD: 117,400kms, no rust,
loaded, auto, tow package,
winters on, 4 extra rims/
tires, excellent condition,
$12,000obo. 250-226-7577.
WANTED 1997-99 4RUNNER FOR PARTS: Body
must be good, (blown engine/transmission is OK).
For sale: 1994 CHEV 3/4T,
extra-cab, diesel, 5spd,
$3250; and 1991 Tracker,
$3500obo. 250-365-0020..

2014 JEEP COMPASS


SPORT 4X4
STK#14141

$20,998
ONLY 1 AT THIS PRICE!

2014 JEEP PATRIOT


NORTH EDITION 4X4
STK#1408

$21,998
2014 RAM 1500 SLT 4X4
QUAD CAB BUYERS STK#14129

$46,300 REG

$33,498

ASK FOR
DETAILS

INCLUDES ALL REBATES FOR QUALIFIED BUYERS

2014 DODGE JOURNEY


R/T ALL WHEEL DRIVE
STK#1492

$37,210 REG

$31,998
ONLY 1 AT THIS PRICE!

2014 DODGE
GRAND CARAVAN SXT
STK#14124

$39,990 REG

$28,998
3 LEFT TO CHOOSE FROM

D5413

$27,880 REG

ONLY 1 AT THIS PRICE!

Parts, Accessories &


Service
2000 HONDA CRV: Great for
parts, body in great shape,
needs motor, $1500obo.
250-369-6868.
4 TOYO GO-2+ WINTER
TIRES: With rims, 5-bolt,
P195/65R15, from VW Jetta,
$140. 250-365-6057.
ALFAB ALUMINUM MANUFACTURING: Single Snowmobile decks, dry boxes,
truck racks. Nelson: 250352-0575 www.alfabmfg.ca
COME TO NELSON FORD
for November winter tire and
reno sale. Amazing deals on
brand name tires. Nelson
Ford, 623 Railway St, Nelson. 1-888-955-5528, 250352-7202, www.nelsonford
sales.com
FULL SET OF TOYO OBSERVE
GSI-5
TIRES:
P255/70R18 112T, brand
new, have been used for
100km, paid $1200, asking
$800. Located in Nelson.
Please call 250-353-1905.

$24,690 REG

803 Baker Street


* Plus $295 doc fee
sales@nelsonchrysler.com
on all prices
250-352-3542 1-800-663-7794

= view picture of this item on our website: www.pennywiseads.com

www.nelsonchrysler.com
Nov. 18, 2014

PAGE 39

All classified ads may be viewed at www.pennywiseads.com

RVs/Campers

Automotive
Parts, Accessories & Service
TIRE CHAINS: New/unused quantity of light truck chains,
all sizes 15-22 tires, asking $650/all. 250-365-3014.
WEATHER TECH FLOOR LINERS; stainless steel exhaust
tip; both for Dodge 3/4-1T, 2010-2014, $125/both. 250368-1640.

Motorcycles/ATVs
2010 GIO QUAD: 125cc, 3spd, std, hardly used, $650. Call
250-359-8118.
2013 HONDA CBR 500R: Leaving country, must sell!
$4000 firm. No crashes, valves done, fluids & filters
changed regularly. Michelin Pilot tires at 90%. 250-5052366. philjwhiz@yahoo.ca

SNOWBIRD SPECIAL 1993 SAFARI SERENGETTI 33


CLASS A MOTORHOME: 5.9 Cummins diesel, new radiator,
new rebuilt transmission, custom skirting, 6.6kw generator,
72,000miles, $18,500; 2002 Jeep Wrangler, inline 6cyl/auto,
K&N system, power brakes, soft top w/roofrack, satellite radio, air, blue, Ox towbar, $4900. Russell Auction, 2067 Hwy
3A, 250-399-4793. Photos on Kijiji, Nelson BC/RVs.
2007 36 FOREST RIVER CARDINAL L.E. 5TH WHEEL:
2bdr, 2bath, 3 slides. Fall special, $43,900. See it online at
www.jonesboysboats.com 250-353-2550.
2010 25 WILDCAT TRAILER: Like new, we have absorbed the first owner price beating! Power everything;
tongue jack/stabilizer jacks/18 awning(so cool), 7 sofa
slide-out, 80W solar panel, queen walkaround bed, 2 new
6V batteries, 3yrs left on transferable extended warranty.
$19,000, 250-365-6593.

Boats/Watercraft
18X32 BOATHOUSE FOR SALE: With water lot (24x40),
in Kaslo Bay Marine Club. 250-355-2949.
1977 176 CAL-GLASS BOAT: IB/OB, Mercruiser sterndrive 120hp, trailer, w/hardware for water sports, good
condition, $2000. 250-368-9074.

Snowmobiles
2002 POLARIS RMK 800: 151 track, Simmons skis,
heated grips, strong running & reliable, great for ski touring,
(engine rebuild in 2007), $2995. 250-825-3488.
2008 SKI-DOO XP800: 154, one owner, cover, fuel caddy,
rack, left throttle, $5000. 250-551-5505.

Heavy/Farm Equipment

Nelson Salmo Trail Castlegar Slocan Valley


Kaslo & everywhere in between

1660 Airport Rd, Salmo

1-888-357-2091

1965 MASSEY FERGUSON 135 TRACTOR: 3cyl diesel,


runs great, never had a problem, lots of power, used for
snow plowing in winter, with/snowblade, bucket & chains,
$4500obo. 250-357-2158.
1974 401A JOHN DEERE TRACTOR BACKHOE: Spare
tire on rim, $8000obo. 250-359-2998.
1989 INTERNATIONAL TANDEM TRUCK w/9T CRANE:
Inspected, $12,000 recent repairs, very good shape,
$15,000. 250-355-2454..
2000 GMC 8500 TANDEM CRANE TRUCK: With high ab
crane, model#140-RW, $21,000obo. Arrow Building Supplies, 250-365-2175.
BOBCAT V-BLADE, $4000obo. Arrow Building Supplies,
250-365-2175.
THE TRACTOR GUY TRACTOR
& MACHINERY REPAIR: All diesel, engine, transmission, differential, hydraulic, electrical repairs.
Now offering welding. 250-5057632.
TIRE CHAINS: 1 set to fit 23.5x25,
heavy diamond studded, good
condition, $1000. 250-365-3014.

Were behind you


for 10 years

NOVEMBER ONLY
Get a 10 Year Warranty at No Charge with the Purchase of a New Kia.*
Were so confident in the quality and workmanship of our cars and crossovers that were willing to
warrant your new Kia for a full decade. Isnt it time you explored something new? This Castlegar
Kia exclusive offer ends November 30, 2014 and is not available elsewhere.

WEVE GOT
YOU COVERED
*5-year/100,000 km worry-free
comprehensive warranty.

CASTLEGAR KIA

The Power to Surprise

www.castlegarkia.com | 1665 Columbia Avenue | (855) 539-5873

*Customer may choose 10-year warranty or available manufacturer rebate. In-stock vehicles only. Program does not apply to the Kia Soul. See dealer for full details. Models may not be not exactly as shown. Program ends November 30, 2014.

PAGE 40

Nov. 18, 2014

DIDJA KNOW?... THE TRAIL/


BV/ROSSLAND EDITION OF
THE PENNYWISE gives excellent
coverage to your ad! We distribute
to over 8600 homes in this area
every week! Be sure to take advantage of this readership when
you place your personal or business ads. Call 1-800-663-4619
between 9am & 5pm weekdays
(9am-4pm Fridays). Please remember, our deadline is always
3pm Thursday to have your ad
appear in the following Tuesdays
edition.
PENNYWISE WORKS!

= view picture of this item on our website: www.pennywiseads.com

SWAP
RIDE

22,164

99

197 1.99%

BUY FOR

40 MPG
7.1L/100KM

30,949

INCLUDES
WINTER SAFETY
PACKAGE

DJ Ashman
Sales Manager

ECOBOOST ENGINE
6SPD AUTO TRANS
SEAT & KNEE AIRBAGS
AIR CONDITIONING
POWER WINDOWS
POWER LOCKS

Herb Amaral
Sales Manager
250-231-2520

AMFord

2795 Highway Drive, Trail


DLN#7336

STK# EMI75820

AIR CONDITIONING
6SPD AUTO TRANS
SYNC VOICE SYSTEM
SIDE CURTAIN AIR BAGS

INCLUDES
WINTER TIRES
& RIMS

2,750

299

BUY FOR

Dennis Bedin
Financial Services
Manager

INCLUDES
WINTER TIRES
& RIMS

Air Conditioning
Power Windows
Power Locks
Heated Front Seats
Dual Stage Front and Knee Airbags
Eight Air Bags
6spd Auto Transmission
SE Package

2015 Explorer XLT 4WD STK# FGA79263

Focus - 133@0.99% biweekly for 84 months. $2500 downpayment. Taxes and $689 doc fee included OAC.
Escape - 197@1.99% biweekly for 84 months. $2500 downpayment. Taxes and $689 doc fee included OAC.

Dan Ashman
Dealer Principal
250-364-0202

16,264

DISCOUNTED

STK# EUE43691

APR

BIWEEKLY

BUY FOR

WINTER TIRES
& RIMS

2014 Ford Escape 4dr SE AWD


@

OR OWN FOR

26,464

Offers include $500 in manufacturer


rebates and exclude taxes.

AIR CONDITIONING
6SPD AUTO TRANS
HEATED SEATS
INCLUDES HEATED MIRRORS

2014 Fiesta 5dr

STK# EL401482

FEATURES:
APR

Financed Bi-weekly for 84 months


with $2,500 down. Includes Freight. Payment
includes taxes and $689 documentation fee

TITANIUM MODEL
SHOWN

APR

$26,464

133 0.99%

BUY FOR

161 0.99%

IN

2014 Focus SE 4 door


@

0 STOCKAT
1
STARTING
STK#E5373729

PURCHASE FINANCE FOR

2014
FUSION

Shawn Brandt
Financial Services
Manager

Paul Caron
Financial Services
Manager

BIWEEKLY

44,894

AIR CONDITIONING
POWER LIFT GATE
LEATHER SEATS
NAVIGATION SYSTEM
XLT APPEARANCE
PACAKGE
20 ALUMINUM WHEEL

INCLUDES
WINTER TIRES
& RIMS

Fiesta - 99@5.89% biweekly for 96 months. $2500 downpayment. Taxes and $689 doc fee included OAC.
Explorer - 299@5.89% biweekly for 84 months. $2500 downpayment. Taxes and $689 doc fee included OAC.

Sean Mackinlay
Sales & Leasing
250-231-8437

Milo Papanek
Sales & Leasing
250-367-0059

Darrin Kissock
Sales & Leasing
250-364-0202

1.800.961.0202

Kelly MaurielloZaytsoff
Sales & Leasing
250 364 8101

Ross McDonnell
Sales & Leasing
250-231-2114

Darcy Howard
Sales & Leasing
250-364-0202

AMFordplus
Waneta Plaza, Trail

on demand

24/7

AMFord.

DLN#307770
com

Pennywise

Nov. 18, 2014

PAGE 41

ON ALL
INVENTORY!
ALL PRICES SLASHED!

Las Vegas Getaway


offer is now even better!
Get 3 days
and 2 nights free with the purchase of any unit
REGARDLESS OF PRICE. Prices starting at only $3,995

EXTENDED AND

EXPANDED

MOTOR HOME SALE

2000 Conquest 30ft

2011 Lexington 26ft

U7111
$36,995

2 slides U8908 - $54,995

NOW $29,995

2003 Flair 30ft

YEAR END
BLOWOUT $49,995

2013 Cardinal 3800


Top of the line!
Fully loaded, 5 slides, front living
room, 40" TV, luxury at its finest.
#13580 $89,995 NOW $71,995

1994 Lextra Odessa 25ft 2010 Wildcat Fifth Wheel

2 slides U8347
$46,995
NOW $38,995

diesel, auto, class A motor home


U6745 - 52,000 km

2012 Sunseeker 28ft

2010 Pleasureway 20ft

2 slides, generator U1335

king size bed U0211 -

YEAR END BLOWOUT


NOW $49,995

YEAR END BLOWOUT


$59,995 $49,995

$59,995

SNOWBIRD SPECIALS

ASKING PRICE

Rock Island RV

$9,000

Full Winter Package


Pop up TV, fireplace - U0403
SALE $29,995

TRUCK

2013 Cardinal 3030


Top of the line!
Fully loaded, 3 slides, luxury
at its finest. #99273
$72,995 NOW $56,995

2006 Prowler Regal


Front kitchen, four
slides, generator U4752

(Winter Package)

$38,995 $28,995

2010 Ford F150 Lariat 2009 Copper Canyon


Crew Cab
Fifth Wheel
Full load, 1 owner, low kms U1268
U0202 $21,995
NOW $28,995

Dealers for Arctic Fox Desert Fox Cougar Hideout Trail Lite
Ultra Light Passports R. Pod Mountaineer Montana Nash

8023 Old Waneta Road, Trail 250-364-2323 Parts 250-364-1267 Toll Free 1-888-817-2323 www.rockislandrv.com DL#9096

PAGE 42

Nov. 18, 2014

Pennywise

Black Friday Sale!


es and
Huge Rebat ilable
ava
on
most new
models!

Every Test Drive

Black Friday
Pricing

in the month of
November is entered into
on all used
a draw to win a quality
vehicles for
pre-owned vehicle!
the month o
f
(draw date Nov. 28 @ 5:00pm.
N
o
v
e
m
b
er!
Must be present to win)

150+ point inspection


Manufacturers Warranty

THE ADVANTAGES:

Trail BC DLN #30251

Tony
Vercillo,

Shane
Anderson,

Sales

Sales

*OAC - see dealer for details

2880 Highway
Drive, Trail
250-368-9134
1-877-872-4522

Ken
Smitheram,

Marc
Cabana,

Sales
Manager

General
Manager

Jake
Kazakoff,
Financial
Service
Manager

Pennywise

24hr Roadside Assistance


30-Day Exchange Privilege

*all prices before documentation of399 and applicable taxes

150+ point inspection


Manufacturers Warranty

2013 Mazda Mazda3 GX 14-61A ......................................................$15,995


2013 Chevrolet Silverado 1500 LTZ 15-22A ...................................$38,995
2013 GMC Sierra 1500 SLE 15-32A ..................................................$31,995
2013 Chevrolet Equinox LT A13-178 ................................................$26,995
2012 Chevrolet Cruze LT ECO P14-10 .............................................$16,995
2012 Chevrolet Silverado 1500 LTZ 14-129A..................................$35,995
2011 Chevrolet Malibu LT w/2LT 14-102A ........................................$17,988
2011 Buick Enclave CXL-1 14-134A ..................................................$28,995
2011 Chevrolet Impala LT A13-176A $14,995
2011 GMC Sierra 1500 LS Reg Cab P14-144 ....................................$19,995
2009 Pontiac G5 Coupe P14-11 ........................................................ $7,995
2009 Chevrolet Colorado LT P14-12 ................................................$16,995
2009 Chevrolet HHR LT w/1LT 14-64A ................................................ $9,995
2009 Chevrolet Cobalt LT P14-143A.................................................... $7,995
2008 Subaru Outback LTD. 14-101A ................................................$13,995
2008 Chevrolet Silverado 2500HD Duramax LT 15-13A ................$32,995
2007 Chevrolet Impala LTZ 14-58A ..................................................$10,995
2007 Chevrolet Impala LS P13-156A .................................................$11,995
2006 Hummer H3 Leather 14-89B ....................................................$15,995
2005 Nissan Maxima 3.5 14-132B .....................................................$10,995
2005 GMC Sierra 1500 SLE P13-102C ................................................$13,995
2003 Chevrolet Silverado SS AWD P14-152 .............................$14,995

THE ADVANTAGES:

24hr Roadside Assistance


30-Day Exchange Privilege

"MMWFIJDMFTTPMEJO/PWFNCFS come with free winter tires! (new & used!)

in the Kootenays!
Visit us online at
www.championgm.com
Nov. 18, 2014

PAGE 43

Giving Tuesday Is A
National Giving Day
You may have heard of Black Friday that marks the un
official beginning of the Christmas shopping season, or
Cyber Monday that promotes online shopping the Monday after US Thanksgiving. Both days are marketing ploys
to boost sales for commerce and corporate profits.
Well, consider Giving Tuesday, December 2. It is a new
movement for giving and volunteering, taking place each
year after Cyber Monday. The opening day of the giving
season, it is a day when charities, companies and individuals join together to share commitments, rally for favourite
causes and think about others. We already have two days
that are good for consumerism, and now we have a day that
is good for communities and charitable organizations.
The Osprey Community Foundation, based in Nelson, has
three affiliate funds that support good works in other West
Kootenay Communities the Community Fund of North
Kootenay Lake, the Salmo Valley Fund, and the Slocan Val-

ley Legacy Fund. Gifts to Osprey for any of these funds support registered charities in the various communities.
Giving Tuesday is a way of bringing philanthropy to the
attention of everyone with the hope that you will consider
investing in the betterment of the communities in which
you live, work and play. On Giving Tuesday, we invite you
to support your local foundation or fund, or any of the
other charities in your area.
Osprey Community Foundation www.ospreycommunityfoundation.ca 250-352-3643. (Serving Nelson and area)
Community Fund of North Kootenay Lake www.nklcommunityfund.org 250-353-7600. (Serving Kaslo and
Area D of the RDCK)
Slocan Valley Legacy Fund www.slocanvalleylegacy.
com Toll Free: 1-877-649-5643. (Serving all of RDCK
Area H and the Villages therein)
Salmo Community Resource Society www.scrs.ca 250357-2277. (Serving the communities of Salmo, Ymir Ross
Spur, Hall Siding, Airport Road, Erie, Nelway & Porto Rico)

2008 Nissan Rogue SL AWD


#11934-1

2012 Arctic Cat M1100


Turbo Snowmobile

l52562-1

$10,500
1,048 km,
tons of power

YOU MUST SEE IT!

11,995

SUBARU

Ask us about pre-owned vehicle financing plans.

VERY COMPETITIVE RATES!


2009 Toyota Rav4 Ltd 4WD #1841-1 fully loaded.......................... NOW $17,900
2009 Forester 2.5i AWD #W2272 one owner............................... JUST IN $18,995
2009 Pontiac G5 GT #1234-1 2 door, 5 spd..................... WAS $10,995 NOW $9,995
2007 Nissan Murano AWD #1942-1 ......................................................... JUST IN $5,995
2006 Subaru Tribeca Ltd AWD #1781-3 7 passenger ................. NOW $11,900
2006 Ford Fusion SE #1692-1 sedan, nice car......................................... NOW $4,900
2003 Subaru Impreza Outback Sport AWD #1887-1 5 spd ............... $4,995
2003 Subaru Forester AWD #1857-2 fully reconditioned ............................ $8,995
2002 GMC Sierra Crew 4WD #W-2441-2 low km,

..................................

$13,995

2000 Subaru Forester X AWD #1668-3 5 spd, fully reconditioned............. $7,995

WE NEED YOUR TRADES!


Paying top dollar for used Subaru vehicles
Taxes and $399 Doc Fees Extra

SUMMIT
SUBARU
Ph. 250-364-9988
or 1-888-737-9988
PAGE 44

TAKE IT
TO THE TOP

Across from Waneta Plaza, Trail


www.summit.subarudealer.ca DL 10441
WE SPECIALIZE IN NEW & USED 4 WHEEL DRIVES

Nov. 18, 2014

Pennywise

2007 Subaru Legacy Outback 2.5i


L35467 146,631 km
$13,897
2006 Subaru Outback AWD
L21469 Super clean, fantastic condition
$10,697
2004 Subaru Forester X 4WD
L46204 170,111km all new head gaskets
$10,973
2004 Subaru Outback
L04537 170,405 km all new head gaskets
$9,652
2003 Subaru Forester XS Premium
L01384 129,256 km, new head gaskets
$10,458
2003 Subaru Impreza Outback Sport
L08401 152,715k m, new head gaskets
$9,583
4X4

OTHER GREAT INVENTORY

2012 Ford Fiesta SEL


L85625 Loaded, Bluetooth

$13,613

L28788 128,000

km, great price!

$11,887

2009 Ford Fusion SE


L33289 87,447km, moon roof, Bluetooth & sat

$13,498

2008 Pontiac G6 SE
L17411-1

remote start, loaded 60,722 km

$10,987

2007 Honda Fit LX


L12979 161,137

km, fantastic on gas!

$7,996

2007 Dodge Caliber SXT


L28654 107,934

2011 Chevy Silverado Lt 4X4


L23081 5.3L, 107,894 km
$21,928
2009 Toyota Rav4 Sport 4WD
L02818, 120937 km, a fantastic Rav4!
$19,922
2007 Ford Escape XLT 4WD
L37016 fantastic shape!
$8,925
2006 Ford Explorer
L07964 144,589 km seats 7, all fold at
$10,976
2005 Dodge Dakota St Quad V8 4X4
L87339 auto,158,516km
$12,978
2005 Nissan Pathnder
L69581, 7 Seater or cargo SUV
$10,899
2004 Jeep Grand Cherokee Laredo 4x4
L05291 179,800 km, fantastic shape
$7,989
2004 Gmc Envoy XUV 4WD SLT
L75863 . $8,991

67,135km

2010 Honda Civic DX-G

km, sporty and versatile

$8,755

2006 Chevrolet HHR


L77810-1 126,742

km, tons of room

$6,948

2005 Chevrolet Impala


L88560-1 96,316

km

$6,851

2005 Smart Fortwo


L10795 107,344

km, save every day

$6,869

2004 Chevy SSR L10758-3


CONVERTIBLE truck, 97,896 km
$17,995
2003 Chrysler PT Cruiser GT Turbo
L21917 148,670 km, leather, power sunroof
$5,989
2001 Chrysler Sebring LX
L02896 92,660 km, LOW km
$4,964
1975 Dodge Charger
L28263 23,414 miles
CALL

McLACHLAN
AUTOMOTIVE

All prices subject to $299 doc fee

8153 Old Waneta Rd, Trail DL#24802


For more info go to mclauto.com

250-364-2881 1-888-364-2881
Service & Sales: Monday 94:30, Tuesday Friday 84:30, Sat 94

2008 Honda
CR-V EX AWD
9-0188-1

2013 Honda
Civic Coupe SI

17,997

11,000 km
C-0283A

2014 Honda
Fit Sport AT

2006 Honda
CR-V EX
V-0216-A

F-1740-B

C-7477-A

18,997

A-1292-A

V-8389-B

9,997

2001 Honda
CR-V

12,997

L-3663-A

7,997

7,997
2006 Honda
Civic DX-G
C-7189-B

6,997

2011 Honda
Odyssey
$

2006 Honda
Civic EX FWD

2006 Honda
Accord EX

2001 Honda
Accord SE

9-3120-A

22,997

14,997

2003 Honda
Civic LX

F-6055-A

2010 Honda
Accord Cross Tour

9,997

9-1359-0

2006 Honda
CR-V EX-L

31,997

9-8918-0

21,997

2011 Honda
CR-Z Hybrid

14,997

9-0900-0

17,997

NOVEMBER DEALS!
SUVs

CARS

2014 Volkswagen Tiguan AWD very low km..............9-7768-0


2012 Jeep Wrangler Unlimited Sahara ............9-5357-0
2010 Honda CR-V EX-L ....................................................V-7329-A
2007 Suzuki XL7 7 passenger, all wheel drive ..........................R-1724-E
2006 Ford Escape XLS AWD low km ............................V-6465-A
2006 Pontiac Montana SV6 all wheel drive ..................9-2802-A
2002 Honda CR-V LX rare manual transmission ...................V-1937-B

26,997
$
30,997
$
22,997
$
10,997
$
9,997
$
12,997
$
7,997

TRUCKS
2013 Dodge Ram 1500 SLT Big Horn edition ............... C-1140-A
2013 Honda Ridgeline Touring ................................9-2502-0
2012 Chevrolet Silverado 1500 LT .......................9-6046-0
2012 Ford Super Duty F-250 SRW ........................9-3954-0
2010 Toyota Tacoma DblCab TRD supercharged :-) 9-8229-0
2010 Ford F-350 Lariat 4x4 ........................................9-1602-0
2008 Honda Ridgeline RTS leather ...............................9-3652-0
2007 Dodge Ram 1500 .................................................V-9821-A1
2005 Dodge Ram 1500 Quad Cab 4x4 .............9-3289-A
Visit

30,997
35,997
$
27,997
$
31,997
$
28,997
$
37,997
$
18,997
$
15,997
$
14,997
$

2012 Honda Civic Coupe SI ........................................9-0603-0


2011 Chevy Camaro 2SS Convertible ..............................9-6197-0
2009 Toyota Corolla CE manual ...................................... C-2184-A
2008 Honda Accord EX low kms...................................... A-2930-A
2008 Pontiac Wave ............................................................ A-9271-A
2007 Dodge Caliber ...........................................................9-1982-A
2007 Toyota Corolla CE/LE/S CE ............................. C-3212-A
2006 Toyota Corolla ..........................................................9-5398-0
2005 Nissan Altima SE-R ...............................................V-4800-A
2004 Acura RSX 75,000 km.................................................... A-0898-A
2004 Pontiac Grand AM GT ........................................C-1499-B
2003 Toyota Matrix ............................................................V-6568-B
2001 Subaru Legacy Wagon low km........................... C-3378-A

19,997
35,997
$
10,997
$
12,997
$
7,997
$
7,500
$
9,997
$
6,500
$
10,997
$
12,997
$
5,997
$
5,997
$
6,997
$

BIKES
2006 Honda Goldwing (Only 7,000 Km) ...........................9-8467-0

17,997

TION FULL TANK


ICBC
INSPEC RT
RPROOF PORT
A
C
S
A
O
G
P
RE
RE
OF
HISTORY

www.glacierhonda.ca for full information on each vehicle and multiple photos.

Plus tax. All prices subject to $299 documentation fee. See dealer for details.

GLACIER HONDA
1-866-365-4845
SERVICE
& SALES

www.glacierhonda.ca

On all pre-owned vehicles


we will provide:
Inspection report
Carproof ICBC history report
Full disclosure by our sales consultants
Full tank of gas

Open 8:30-5:30 Mon -Sat 1602 Columbia Ave, Castlegar


Pennywise

Nov. 18, 2014

DL 23033

PAGE 45

Come to Nelson Ford for


November Winter Tire & Reno SALE
THANKS!

CHECK OUT THESE AMAZING DEALS

for your patience during our building


renovations currently underway...
to better serve our customers!

ON BRAND NAME TIRES


ALL TIRES

Come in
& SAVE

WITH DISCOUNTS UP TO

$$$$$$

until November 30, 2014

ARE ON SALE

40% OFF
Winter Slalom

+PLUS

MANUFACTURERS
REBATES UP TO $

Grandtrek SJ6

100

Altimax Arctic

185/60 R15

195/65 R15

265/70 R17

235/55 R17

On Sale Now
only $8995*

On Sale Now
only $10995*

On Sale Now
only $18995*

On Sale Now
only $15995*

s at competitive prices,
WE OFFER: All brand name tire and balancing, full
ing
tire storage, tire repair, mount
allation, full stock of tires,
vehicle inspection with tire inst
year unlimited parts warranty.
wheels and sensors and two
your appointment today!
k
boo
Call for a quote and

ALL steel
& aluminum
wheels

at prices
Quality products at gre
ff
Friendly courteous sta
icians including Toyota
Factory trained techn
Repairs for all makes

20% OFF
Free inspection with all tire sales!
We also offer tire storage.

5% with our
a
tr
ex
an
ve
sa
n
ca
u
yo
Ask how
ards Program
Owner Advantage Rew
3ULFHVGRQRWLQFOXGHVDOHVWD[WLUHWD[OHY\RULQVWDOODWLRQ6DOHSULFHVIRUDOLPLWHGWLPHRQO\

623 Railway Street, Nelson

1.888.955.5528
250-352-7202
nelsonfordsales.com

DLN# 28082

PAGE 46

Nov. 18, 2014

Pennywise

NELSON

RENOVATION
SALE!!!
PRICES ARE FALLING! PRICES ARE FALLING!
2011 FORD FUSION SE
#4EC3725A

RENO PRICE

14,680*

#LTOO90A

9,995*

RENO PRICE $

116**

BI-WEEKLY

2013 FORD ESCAPE


SEL AWD

#4EC2747A

#13LT2835A

RENO PRICE

24,996*

BI-WEEKLY

192**

2014 NISSAN
ROGUE AWD

RENO PRICE

RENO PRICE

26,946*

BI-WEEKLY

206**

#PE0500

RENO PRICE

13,660*

BI-WEEKLY

109**

213**

28,880*
218**

2013 HYUNDAI
ELANTRA GT
#PE0499

RENO PRICE

#LT2604A 5SPD .................................................................................

2007 FORD FUSION SE

5dr Hatchback

BI-WEEKLY
$14,837*
$8,680*

#4FN4117A RENO PRICE .........................................................................


#LT4994A RENO PRICE ....................................................................

16,987*

$21,770*

133**

Auto, sunroof

15,990*

BI-WEEKLY

126**

2013 HYUNDAI
ACCENT GL
#PE0498

RENO PRICE

Hatchback

14,888*

BI-WEEKLY

118**

2014 CEHVROLET
MALIBU 1LT

Supercab 5.0

BI-WEEKLY

2008 FORD RANGER FX4

2009 TOYOTA VENZA AWD

27,840*

RENO PRICE

Sunroof, Leather 5spd

RENO PRICE

2014 NISSAN
FRONTIER SV 4X4

2011 FORD FOCUS SES


#PW0495

BI-WEEKLY

#PE0501

#4FE5395A

11,760

2013 FORD ESCAPE


SE AWD
$

2013 TOYOTA
COROLLA CE

2003 NISSAN 350Z

#PE0496

RENO PRICE

21,469*

BI-WEEKLY

172**

2014 FIAT 500 SPORT


#PE0497

RENO PRICE

17,983*

BI-WEEKLY

2003 PONTIAC GRAND AM

Auto

140**

$3,995*

4 DR SEDAN, V6, 174,145 KM .............................................................

2006 TOYOTA COROLLA LE FWD

$10,600 $9,995*
2002 FORD Supercab XLT F150 4X4
#4LT0905A ..............................................................................................$5,995*
ACO491A RENO PRICE.............................................

1 year maintenance & roadside assistance on most used vehicles. *Plus tax & $699 admin fee. **Bi-weekly payment OAC, 5.24% interest rate for 84 month therm, bi-weekly payments include fees & taxes

623 Railway Street, Nelson

1.888.955.5528
DLN# 28082

250-352-7202
nelsonfordsales.com
Pennywise

NELSON
Nov. 18, 2014

PAGE 47

Carmen Harris

Charissa Hackett

Tammy Peitzsche

Pat Klohn

Val Koochin

PJ Poznekoff

365-1520

304-4373

365-9640

365-1731

365-1846

365-4679

Matt McCarthy

Chad Williams

Larry Peitzsche

Marnie Pettit

Connor McCarthy

Simon Laurie

304-4831

304-5241

608-3017

304-3564

304-4781

365-1585

1761 Columbia Ave.


250-365-2166 1-877-365-2169

www.castlegarrealty.ca
FABULOUS
CONDITION!

GREAT PRICE!

Gorgeous family home between Nelson


and Castlegar. Custom home sits on .75
acre with lots of garden space and room
for your toys. 4 bed, 3 bath, 10 foot ceilings throughout, features incl walk-out
basement and main floor with spectacular vaulted ceilings.

2001 mobile in Columbia River Estates waiting for its new owner. 2
bedroom, 1-bath, open concept living/dining/kitchen. One of the quietest areas in the park.

$75,000

$369,000

A SUITE DEAL!

A DREAM PROPERTY!

JUST LIKE NEW!

This Kinnaird Bench home offers


three bedrooms on the main and a
self contained one bedroom suite
down. Entire main floor has been
renovated and property includes
large yard, lots of parking and attached garage!

Located just steps from the shores of the


Columbia River with a breathtaking panoramic view of the river, mountains and
skyline is this well maintained three bedroom home!

Fantastic four bedroom three bath home


in ultra-desirable Twin River Estates.
Heat-pump, double garage, vaulted ceilings, hardwood and tile flooring, awesome yard with auto irrigation and so
much more!

$279,900

$199,900

LOTS OF POTENTIAL

SEARCHING FOR
FAMILY

SPECTACULAR VIEWS

BEAUTIFULLY
RENOVATED

This is a real fixer upper, a cute


starter home. At this price tear
down the existing building, and
build a large home on this oversized lot.

Spacious, family home, open


plan, custom house built in
1982 on 1.12 acres. Needs a face
lift and some updating. 4 bedrooms, 2 bathrooms.

This flat treed 5 acres, overlooking


Christina Lake is the perfect
setting for your dream house.
Ideal retirement spot, now you
can vacation all year round!

Recent renovations made to the


kitchen and bathrooms. Adjoining
family room has cozy gas fireplace
with slate surround, large master
bedroom has 3piece ensuite and
walk out deck overlooking the private backyard.

$69,000

$349,000

$259,000

$409,900

REDUCED!

Located on the south end in one of


Castlegars most family oriented
and desirable neighbourhoods this
sprawling family home is backed
onto the rivers edge allowing the potential for a breath taking view of the
Columbia River.

HOUSE AND SHOP!

AMAZING VIEW!

Freshly updated 1 bedroom Fabulous acreage minutes to


home located in Robson with town! Perfect for your shop or
detached 16x30 shop.
home!

$162,000

$309,000

$89,900

$389,000
HOUSE & ACREAGE

and a large shop in desirable


Pass Creek! If youre looking for a
house with character, shop, open
space and privacy this fantastic
property is a must see!

$349,500

ADORABLE HOME

PRIVATE SETTING

With full basement, this perfect


bungalow offers a large bath,
enclosed deck, large side yard,
2 baths.

A well maintained rancher in


beautiful Pass Creek valley. Large
spacious rooms. The 2.06 acre
property is half landscaped and half
forest. 2 door garage with attached
suite and many extras make for great
outdoor living.

$239,900

$415,000

WATERFRONT
PROPERTY

SOLID HOME

PRIVATE SETTING

NEW LISTING!

NEW LISTING!

A few minutes from Castlegar. Enjoy


the serenity of being on the water
and boating whenever you wish. Unfinished basement provides lots of
opportunity for development.

Located in the ultra desirable Blueberry area this spacious home has
two bedrooms on the main with
a partially finished basement and
room for endless possibilities in the
remainder.

Beautifully renovated, offering 4 bedrooms, and an open concept kitchen/


dinning/living area. Upgrades include
roof, windows, doors, floors, paint,
fixtures, garage door with an extra
quiet door opener.

Nine acres of land with a solid home


needing some finishing touches. Rural living close to town !

Solid three bedroom home with


the big upgrades done. Ideal location close to schools, parks
and shopping.

$349,000

$299,900

$299,000

$219,900

$189,900

PAGE 48

Nov. 18, 2014

Pennywise