You are on page 1of 1610

Flexi Network Gateway, Rel.

2.1 4.0, Operating


Documentation, v2
General Glossary
Issue 28

GeneralGlossary

Theinformationinthisdocumentissubjecttochangewithoutnoticeanddescribesonlytheproduct
defined in the introduction of this documentation. This documentation is intended for the use of
NokiaSolutionsandNetworkscustomersonlyforthepurposesoftheagreementunderwhichthe
documentissubmitted,andnopartofitmaybeused,reproduced,modifiedortransmittedinany
formormeanswithoutthepriorwrittenpermissionofNokiaSolutionsandNetworks.Thedocumentationhasbeenpreparedtobeusedbyprofessionalandproperlytrainedpersonnel,andthecustomerassumesfullresponsibilitywhenusingit.NokiaSolutionsandNetworkswelcomescustomer
commentsaspartoftheprocessofcontinuousdevelopmentandimprovementofthedocumentation.
The information or statements given in this documentation concerning the suitability, capacity, or
performanceofthementionedhardwareorsoftwareproductsaregiven"asis"andallliabilityarisinginconnectionwithsuchhardwareorsoftwareproductsshallbedefinedconclusivelyandfinally
in a separate agreement between Nokia Solutions and Networks and the customer. However,
NokiaSolutionsandNetworkshasmadeallreasonableeffortstoensurethattheinstructionscontained in the document are adequate and free of material errors and omissions. Nokia Solutions
and Networks will, if deemed necessary by Nokia Solutions and Networks, explain issues which
maynotbecoveredbythedocument.
NokiaSolutionsandNetworkswillcorrecterrorsinthisdocumentationassoonaspossible.INNO
EVENT WILL Nokia Solutions and Networks BE LIABLE FOR ERRORS IN THIS DOCUMENTATION OR FOR ANY DAMAGES, INCLUDING BUT NOT LIMITED TO SPECIAL, DIRECT, INDIRECT,INCIDENTALORCONSEQUENTIALORANYLOSSES,SUCHASBUTNOTLIMITEDTO
LOSSOFPROFIT,REVENUE,BUSINESSINTERRUPTION,BUSINESSOPPORTUNITYORDATA,THATMAYARISEFROMTHEUSEOFTHISDOCUMENTORTHEINFORMATIONINIT.
Thisdocumentationandtheproductitdescribesareconsideredprotectedbycopyrightsandother
intellectualpropertyrightsaccordingtotheapplicablelaws.
NSN is a trademark of Nokia Solutions and Networks. Nokia is a registered trademark of Nokia
Corporation.Otherproductnamesmentionedinthisdocumentmaybetrademarksoftheirrespectiveowners,andtheyarementionedforidentificationpurposesonly.
CopyrightNokiaSolutionsandNetworks2014.Allrightsreserved

Important Notice on Product Safety


Thisproductmaypresentsafetyrisksduetolaser,electricity,heat,andothersourcesof
danger.
Only trained and qualified personnel may install, operate, maintain or otherwise handle
this product and only after having carefully read the safety information applicable to this
product.
ThesafetyinformationisprovidedintheSafetyInformationsectionintheLegal,Safety
andEnvironmentalInformationpartofthisdocumentordocumentationset.

NokiaSolutionsandNetworksiscontinuallystrivingtoreducetheadverseenvironmentaleffectsof
itsproductsandservices.Wewouldliketoencourageyouasourcustomersanduserstojoinusin
working towards a cleaner, safer environment. Please recycle product packaging and follow the
recommendationsforpoweruseandproperdisposalofourproductsandtheircomponents.
IfyoushouldhavequestionsregardingourEnvironmentalPolicyoranyoftheenvironmentalservicesweoffer,pleasecontactusatNokiaSolutionsandNetworksforanyadditionalinformation.

Issue:28

GeneralGlossary

Table of Contents
Thisdocumenthas1610pages

Issue:28

Introduction.................................................................................... 5

Numbers.........................................................................................6

A................................................................................................... 11

B.................................................................................................123

C.................................................................................................178

D.................................................................................................340

E.................................................................................................433

F................................................................................................. 495

G................................................................................................ 550

10

H.................................................................................................586

11

I.................................................................................................. 621

12

J................................................................................................. 715

13

K.................................................................................................722

14

L................................................................................................. 727

15

M................................................................................................ 784

16

N.................................................................................................885

17

O................................................................................................ 943

18

P.................................................................................................992

19

Q............................................................................................... 1113

20

R............................................................................................... 1122

21

S...............................................................................................1214

22

T............................................................................................... 1427

23

U...............................................................................................1514

24

V...............................................................................................1551

25

W.............................................................................................. 1581

26

X...............................................................................................1603

GeneralGlossary

27

Y...............................................................................................1608

28

Z............................................................................................... 1609

Issue:28

GeneralGlossary

Introduction

1 Introduction
ThisGlossaryismeanttohelpthoseacquaintingthemselveswiththeNSN
documentation.
TheGlossarycoversthecentralconceptsoftelecommunicationsaswellastheconcepts
relatedtotheproductsofNSN.
TheGlossaryhasbeencompiledatNSNincollaborationwithexpertsonboth
technologyandterminologywork.Itisbasedontheconceptofterminologyadoptedin
theNordiccountriesandonseveralnationalandinternationalsources,aswellason
internationaltechnicalandterminologicalstandardsandrecommendations.
Theentriesarearrangedinalphabeticalorder.Synonymsarealsoentered
independentlywitha"see"referencetothemainentry.
Sinceterminologybyitsnatureisaconstantlydevelopingfield,theGlossaryis
continuouslyexpandedanddeveloped.Therefore,anyfeedbackonthisGlossarywillbe
highlyappreciated.
Thetermsusedonlyinalimitedgeographicalareaaremarkedwithcodesaccordingto
standardISO3166NamesofCountries.
Thecodesusedinthisdictionary:
/GB/GreatBritain
/US/TheUnitedStatesofAmerica

Issue:28

Numbers

GeneralGlossary

2 Numbers
1000Base-LX/LH
GigabitEthernetstandard,basedonIEEE802.3,whichusestwostrandsofmultimode
orsingle-modeopticalcableperlink

1000Base-Sx
standard(IEEE802.3)forGigabitEthernetusingtwostrandsofmultimodeopticalcable
perlink

1000Base-T
standard(IEEE802.3ab)forGigabitEthernetoveranunshieldedtwisted-pairwire

1000Base-TX
GigabitEthernetstandard,basedonIEEE802.3,fordatatransferovercopperwire

100BaseTX
100-MbpsbasebandFastEthernetspecificationusingtwopairsofeitherunshielded
twistedpair(UTP)orshieldedtwistedpair(STP)wiring

10Base-T; 10 BASET
IEEE802.3mediastandardabbreviationfora10MbpsbasebandEthernetusingtwisted
paircabling

10-gigabit Ethernet; 10GbE


IEEEstandardthatdefinesaversionofEthernetwithanominaldatarateof10Gbit/s

1+1 redundancy; 1+1 protection


redundancyschemeinwhichaunittypeconsistsofoneactiveunitandonespareunit,
andtheidlespareunitcanreplacetheactiveunit

1-phase codec modification


codecmodificationinwhichtheMcinterfacecontainsonemodifyrequestcommandthat
onlycontainsnewcodecinformation

1st+ interval report; 1st+ interval log report


reportthatrecordsfaultsinthesignallingnetworkandthenetworksresponseto
abnormalconditions,andthatisprintedoutinfiveminutesifanerroreventoccurs

Issue:28

GeneralGlossary

Numbers

1XTREME
globalopenstandardsproposalandtechnology,whichprovidesintegratedvoiceand
dataspeedsupto5.2Mbpsonasingle1.25MHzinCDMA

23B+D
primaryrateaccessthatprovidesa1.544Mbit/sISDNuser-networkinterfacewith23
datachannelsandasignallingchannel

2.5G
furtherdevelopmentsofthe2ndgenerationdigitalcellulartechnologybeforethe3rd
generation

2G SGSN; 2G-SGSN
DX200-basedservingGPRSsupportnode(SGSN)forGPRSnetworks

2G subscriber
mobilesubscriberwhosubscribesto2Gservices

2G technology; 2G; 2nd generation mobile communications


secondgenerationmobilecommunicationstechnologywhichisprimarilymeantfor
transferringvoice

2K protocol
proprietarynetworkmanagementprotocolinwhichIPdatalinksareusedtoconnectthe
NSNHopperManageroramanagementsystemtoanode

2M
external2048kbit/ssynchronisationsourceconformingtoITU-TG.703

2 Mbit/s submultiplexer; SM2M


submultiplexerthatcombines9016kbit/ssubratechannelsintoone2Mbit/s
transmissionbus

2N redundancy; 2N; duplication


redundancyschemeinwhichtwounitsareusedtocompleteataskforwhichoneis
enoughatanygiventime

Issue:28

Numbers

GeneralGlossary

2-phase codec modification


codecmodificationinwhichtheMcinterfacecontainstwomodifyrequestcommands,the
firstofwhichcontainsoldandnewcodecinformationandthesecondofwhichcontains
onlynewcodecinformation

30 B + D / DSS1
primaryrateaccessbetweenthebasestationcontroller(BSC)andanothernetwork
element,whichispartoftheISDNAbisfeature

3DES; triple DES


encryptionthatisbasedonaDESalgorithm,inwhichthreedifferentkeysareutilised

3G CS video telephony
videocall(service)thatisbasedonacircuit-switchedconnectioninathird-generation
mobilenetwork

3G HLR
homelocationregister(HLR)forthirdgenerationnetworks,whichstorespacket-switched
andcircuit-switchedaccess-relateddataandperformsHLRfunctionsthataredefinedin
3GPPRelease4

3G modem
modemthatisusedtocreateadataconnectionviathe3Gnetwork

3G MSC; third generation mobile services switching centre


mobileservicesswitchingcentre(MSC)forathirdgenerationnetwork

3G network; 3GN; third generation network


networkofthirdgenerationmobilecommunicationsystem

3GPP; 3rd Generation Partnership Project


projectinwhichstandardsorganisationsandotherrelatedbodieshaveagreedtocooperatefortheproductionofgloballyapplicabletechnicalspecificationsforathird
generationmobilesystem

3G SGSN; 3G-SGSN
servingGPRSsupportnode(SGSN)for3rdgenerationmobilenetworks

Issue:28

GeneralGlossary

Numbers

3G subscriber
mobilesubscriberwhosubscribesto3Gservices

3G technology; 3G; 3rd generation mobile communications


thirdgenerationmobilecommunicationstechnologythatenablesbothvoicetransferand
fastdatatransfer

3G UP
collectionoftheuserplane(UP)parametersspecifiedbythe3rdGenerationPartnership
Project(3GPP)

3G user equipment; UE; user equipment (3G)


terminalthatsupportsaUMTSsubscriberidentitymodule(USIM)andtheUuinterface,
withtheUSIMinserted

3G-VMSC
visitedMSCforthirdgenerationmobilenetworks

3L description language
languagedescribingtheoperationofmultiprocessorsystemsandhowdifferentsystem
functionsproceedindifferentunitsandprocesses

3N redundancy; 3N
redundancyschemeinwhichthreeunitsareusedtocompleteataskforwhichoneor
twoisenoughatanygiventime

4B3T; four binary, three ternary


lineencodingthatisusedfortheISDNbasicrateinterfaceandinwhichfourbitsare
mappedtothreepulses

4G technology; 4G; 4th generation mobile communications


fourthgenerationmobilecommunicationstechnologythatenablesveryfastvoiceand
datatransferinlargevolumes

6over4
mechanismwhichusesanIPv4domainthatsupportsIPv4multicasttoallowisolated
IPv6hoststoactlikefullyfunctionalIPv6hostswithoutdirectcontactwithanIPv6router

Issue:28

Numbers

GeneralGlossary

6to4
transitionmechanismwhichprovidesawaytoconnectIPv6end-sitenetworksby
creatingatunnelovertheinterveningIPv4network

802.11I
specificationforenhancedsecurityfortheIEEE802.11basedwirelessnetworks

802.1X; port-based network access control


IEEEstandardforlocalandmetropolitanareanetworkswhichmakesuseofthephysical
accesscharacteristicsofIEEE802localareanetwork(LAN)infrastructuresinorderto
provideameansofauthenticatingandauthorisingdevicesattachedtoaLANportthat
haspoint-to-pointcharacteristics,andofpreventingaccesstothatportincasethe
authenticationandauthorisationprocessfails

8-PSK modulation; 8-PSK; 8 phase shift keying


modulationtechniqueinwhichthecarriercanexistinoneofeightdifferentstates

10

Issue:28

GeneralGlossary

3 A
A3 algorithm; A3
cryptographicalgorithmusedforsubscriberauthenticationinaGSMpubliclandmobile
network(PLMN)

A5/3 algorithm; A5/3


cryptographicalgorithmforGSM/EDGE,whichproducesciphertextoutofcleartextusing
thecipheringkey(Kc)

A8 algorithm; A8
cryptographicalgorithmusedforgeneratingcipherkeystoprotectthedatatransferon
theradiopathinaGSMpubliclandmobilenetwork(PLMN)

AAA; authentication, authorisation, and accounting /GB/; authentication,


authorization, and accounting /US/
facilitythatprovidesaninterfacebetweenthedevicesandsecurityserversthrough
whichaccesscontrolcanbesetup

AAA client
clientthatinitiatesAAAproceduresforamobileterminal

AAA configuration
meansofsharingauthentication,authorisation,andaccountingservicesamong
applicationsthatrunonIPSO,usingdynamically-loadedmodules

AAA profile; authentication, authorisation, and accounting profile /GB/;


authentication, authorization, and accounting profile /US/
userprofilewhichcontainsinformationontheuser'srole,accessrights,name,and
passwords,andontheaccountexpirationdate

AAA server; authentication, authorisation, and accounting server /GB/;


authentication, authorization, and accounting server /US/
serverthathandlesuserrequestsforaccesstocomputerresourcesandprovides
authentication,authorisation,andaccountingservices

AAL1 connection
ATMadaptationlayertype1(AAL1)basedconnectionwhichhasaconstantbitrateand
issuitableforcarryingvideoandspeechtraffic

Issue:28

11

GeneralGlossary

AAL2 connection admission control; AAL2 CAC


ATMconnectionadmissioncontrolthatoperatesonlywithinanexistingvirtualchannel
connection(VCC)andthatdecideswhetherthesystemcanaccommodateanewAAL2
connectionwithinthegivenVCC

AAL2 connection control; AAL2 CC


featurethathandlestheoperations(create,delete,interrogate)relatedtoAAL2crossconnectionsandtheallocationofconnectionidentifier(CID)valuesfortheAAL2crossconnections

AAL2 connection control function


functionwhichroutestheAAL2signallingaccordingtothereceivedserviceendpoint
addresssothattheAAL2transitconnectionscanbeformedbetweentwoservice
endpointsviathemultimediagateway(MGW)

AAL2 connection management


AAL2connectioncontrolfunctionwhichprovidesservicestomanagethecreation,
modification,interrogation,andreleaseoftheAAL2cross-connections

AAL2 CPS packet; CPS packet


packetthatconsistsofathree-octetheaderfollowedbyapayloadthatcontainsthe
commonpartsublayer(CPS)protocoldataunit

AAL2 cross-connection; AAL2 CC


cross-connectionbywhichATMadaptationlayertype2(AAL2)packetsareswitched
betweentheinternalN_CIDandtheinternal1_CIDterminationpoints

AAL2 endpoint address; A2EA


addressthatidentifiesawidebandapplicationmanagerthatcontainsanATMtermination
point

AAL2 flow control


featurethatisusedtoavoidanIuboverloadbycontrollingtheAAL2sourcesbasedon
theATMadaptationlayertype2(AAL2)queuelength

AAL2 leg
AALtype2(AAL2)connectionbetweenaconnectionpointandanaddressableentity

12

Issue:28

GeneralGlossary

AAL2 link characteristics; ALC


parameterthatisusedinarequestmessageoftheAALtype2signallingprotocolifthere
isanAAL2switchingfunctioninthetransportnetworklayeroftheinterface

AAL2 microcode
featurethatisusedtoconfigurequeuethresholdsfortheinternalflowcontrol
implementationwithdynamicthresholdcalculation

AAL2 nodal function; NF; nodal function


functioninthemultimediagateway(MGW)whichenablesanyATMadaptationlayertype
2(AAL2)basedconnectionstoberoutedviaMGWwithoutcontrolfromtheMSCserver

AAL2 packet switching; AAL2 switching


switchingperformedatATMadaptationlayertype2(AAL2),inwhichpacketsthatare
encapsulatedwithinanATMcellareswitchedaccordingtotheirvirtualpathidentifier
(VPI),virtualchannelidentifier(VCI),andchannelidentifier(CID)values

AAL2 path CAC resource measurement


measurementthatprovidesinformationontheuseofAALtype2path(AAL2)resources

AAL2 prioritisation /GB/; AAL2 prioritization /US/


featurethatenablestheuseofdifferentprioritiesforAALtype2(AAL2)connections
carryingsignallingandreal-timetrafficandAALtype2connectionswithnon-real-time
dedicatedmediumaccesscontrolflows

AAL2 protocol entity; AAL2 PE


softwarewhichisresponsibleforperformingAALtype2(AAL2)signallingprotocol
towardsothernetworkelements

AAL2 resource management


AAL2connectioncontrolfunctionwhichprovidesservicestomanagetheresources
neededforAAL2cross-connections

AAL2 resource reservation measurement


measurementwhichenablestofollowtheuserplaneATMadaptationlayertype2
(AAL2)resourcereservationfailurereasonsandsuccessratesforthewholeradio
networkcontroller(RNC)andindividualAAL2paths

Issue:28

13

GeneralGlossary

AAL2 scheduling performance measurement


measurementthatprovidesinformationontheabilityoftheIubinterfacetoserve
downlinktraffictowardsthebasetransceiverstation

AAL2 served user; AAL type 2 served user


userofanAAL2signallingprotocol

AAL2 signalling /GB/; AAL2 signaling /US/; AAL type 2 signalling /GB/; AAL
type 2 signaling /US/
signallingthatisusedtosetupandreleaseAAL2connectionsinsidevirtualchannel
connections

AAL2 signalling at NNI measurement /BR/; AAL2 signaling at NNI


measurement /US/
measurementthatprovidesinformationontheprotocolerrorsandinternalnon-protocol
errorsintheNbandIu-CSinterfacesinthemultimediagatewayandintheIu-CSandIur
interfacesintheradionetworkcontroller

AAL2 signalling at UNI measurement /GB/; AAL2 signaling at UNI


measurement /US/
measurementthatprovidesinformationoncontrolplanefunctionsthatestablishand
releaseAALtype2(AAL2)connectionsattheusernetworkinterface(UNI)forUNI
signallinglinks

AAL2 termination and switching; AAL2 switching and termination


featurewhichimplementstheterminationandswitchingfunctionfortheswitching
platformtosupportAAL2packetbasedtransmission

AAL2UP connectivity
amountofdatathatcanbeprocessedpersecondonAALtype2(AAL2)connections
overIub,Iur,andIu-CSinterfaces

AAL2 virtual channel connection; AAL2 VCC


ATMvirtualchannelconnectionwhichisbasedontheuseoftheATMadaptationlayer
type2(AAL2)

14

Issue:28

GeneralGlossary

AAL2 VPC endpoint management


AAL2connectioncontrolfunctionwhichprovidesservicestocreateanddeletevirtual
pathconnection(VPC)endpointsrelatedtoagivenAAL2SwitchingProcessor(A2SP)
andalsoservicestoselecttheproperVPCendpointfortherequestedAAL2crossconnection

AAL5 common part; AAL5 CP


partofATMadaptationlayertype5(AAL5)whichconsistsofsegmentationand
reassembly(SAR)sublayerandcommonpartconvergencesublayer(CPCS)

AAL5 frame
framethatcontainstheATMadaptationlayertype5(AAL5)protocoldataunits
encapsulatedinitspayloadfield

AAL5 profile
profilewhichcontainstheparametersforconfiguringanATMadaptationlayertype5
(AAL5)connection

AAL5 protocol measurement


measurementthatprovidesinformationontheamountoftrafficbetweentheATMlayer
andtheATMadaptationlayertype5(AAL5)incomputerunits,andthatindicates
protocolabnormalitiesdetectedinreassemblingATMcellstocommonpartconvergence
sublayerdataunits

A-alarm
criticalalarmgeneratedbyafaultwhichinhibitsthenormaloperationoftheequipment

AAL performance measurements


featureforcollectingandmonitoringtheAAL5,AAL2signallingprotocolatUNI,AAL2
signallingprotocolatNNI,andsignallingAAL(SAAL)protocolperformanceparameters

AAL type 2 channel; AAL2 channel


channelusedforthetransportofcommonpartsublayer(CPS)packetsassociatedwitha
AALtype2channelidentifier(CID)valueonavirtualchannelconnection(VCC)

AAL type 2 channel identifier; CID; AAL2 channel identifier; channel


identifier
commonuniqueidentifierofanAALtype2channel

Issue:28

15

GeneralGlossary

AAL type 2 connecting point


pointinaconnectionwherethetwoadjacentAALtype2linkscometogether,providing
theconnectingfunctions

AAL type 2 connection; AAL2 connection


logicalconcatenationofoneormoreAALtype2linksbetweentwoAALtype2service
endpoints

AAL type 2 intermediate switch; AAL2 intermediate switch


AALtype2switchservingasanAALtype2signallingendpointatanAALtype2
connectingpoint

AAL type 2 link; AAL2 link


logicaluserplanecommunicationfacilitybetweentwoadjacentAALtype2switching
pointsorserviceendpoints

AAL type 2 link characteristics; AAL2 link characteristics


informationusedtodescribeattributesoftheAALtype2link

AAL type 2 path; AAL2 path


logicalconcatenationofoneormoreATMvirtualchannelconnections(VCC)between
twoAALtype2switches

AAL type 2 path identifier; AAL2 path identifier


inanATMadaptationlayertype2(AAL2)signallingprotocolmessage,afieldwitha
fixedsizeof4octetswhichidentifiestheAALtype2path

AAL type 2 route; AAL2 route


routethatconsistsofoneormorehuntedAALtype2pathsorAALtype2channelsthat
connectATM-basednetworkelementsandthatusethesamesignallingprotocolorare
associatedwiththesamesubscribernumber

AAL type 2 routing; AAL2 routing


routinginwhichtheAALtype2pathisselectedaccordingtothequalityofservice
associatedwithavirtualchannelconnection

AAL type 2 service endpoint; AAL2 service endpoint


terminationpointofanAALtype2connection,providingtheconnectiontermination
functions

16

Issue:28

GeneralGlossary

AAL type 2 signalling protocol /GB/; AAL type 2 signaling protocol /US/;
AAL2 signalling protocol /GB/; AAL2 signaling protocol /US/
setofcontrolplanefunctionswhichestablishesandreleasesAAL2connectionsandthe
maintenancefunctionsassociatedwiththeAAL2signalling

AAL type 2 switch; AAL2 switch


systemwhichiscapableofswitchingAALtype2connections

abandoned call
callregisteredintheautomaticcalldistributionwherethecallingsubscriberhashungup
orqueuingtimehasexpiredbeforethesubscriberhasgotthroughtoanattendant

abbreviated dialling /GB/; abbreviated dialling, subscriber registration


/GB/; abbreviated dialing /US/; abbreviated dialing, subscriber registration
/US/
facilitywhichenablesasubscribertomakeacallbydiallinganabbreviatednumber
insteadofthefulltelephonenumber

abbreviated number; ADN; abbreviated dialling number /GB/; abbreviated


dialing number /US/
privatenumber(shortcode)dialledinsteadofthecalledsubscriber'stelephonenumber,
programmedintheexchangeorthetelephone

Abis interface; Abis


basestationcontroller(BSC)tobasetransceiverstation(BTS)interface

Abis interface common control channel; ABICCCH


commoncontrolchannel(CCCH)handoftheAbisinterfaceprogramblock(ABIPRB),
whichhandlesCCCHprocedures

Abis interface extended common control channel; ABIECCCH


commoncontrolchannel(CCCH)handoftheAbisinterfaceprogramblock(ABIPRB),
whichhandlesextendedCCCHprocedures

Abis interface stand-alone dedicated control channel; ABISDCCH


stand-alonededicatedcontrolchannel(SDCCH)handoftheAbisinterfaceprogram
block(ABIPRB),whichhandlesSDCCHprocedures

Issue:28

17

GeneralGlossary

Abis interface traffic channel; ABITCH


trafficchannel(TCH)handoftheAbisinterfaceprogramblock(ABIPRB),whichhandles
TCHprocedures

Abis LAPD link; Abis LAPD


linkontheAbisinterfacethatisbasedonthelinkaccessprocedureontheD-channel
(LAPD)protocol

Abis loop test


testthatisusedtoverifytheAbisinterfacetransmissionsetupandquality

Abis signalling link /GB/; Abis signaling link /US/


signallinglinkintheAbisinterfaceconnectingabasetransceiverstation(BTS)anda
basestationcontroller(BSC)

abort
terminate,inacontrolledmanner,aprocessingactivityinacomputersystembecauseit
isimpossibleorundesirablefortheactivitytoproceed

abort message
transactioncapabilitiesmessagethatisusedtoterminateatransactionfollowingan
abnormalsituationdetectedbythetransactionsublayer,ortoabortatransactionbythe
transactionuser

Abort-Session-Answer message; ASA; Abort-Session-Answer


messagethatissentasaresponsetoapreviouslyreceivedAbort-Session-Request
message(ASR)

Abort-Session-Request message; ASR; Abort-Session-Request


messagethataserversendstotheaccessdevicewhichprovidesasessionserviceto
requestthatasessionidentifiedbyasessionidentifierisstopped

about box
windowinwhichcanbeshownthecompanylogo,applicationname,productcode,
versionnumber,copyrightnotice,contactpointforqueriesabouttheapplication,trademarkinformation,licensinginformation,andcommandbuttontoclosethewindow

18

Issue:28

GeneralGlossary

absent subscriber service; absent subscriber service - immediate


diversion; absent subscriber service - immediate diversion to an
answering service; manual answering service
callforwardingwhichenablesasubscribertohaveincomingcallsautomaticallydiverted
toamanualansweringservice

absent subscriber service - immediate diversion to a fixed announcement


without message accepting capability
callforwardingwhichenablesasubscribertohaveincomingcallsautomaticallydiverted
toanannouncementintheterminatingexchange

absolute address; machine address


addressinacomputerlanguagethatidentifiesastorageoradevicewithouttheuseof
anyintermediatereference

absolute grant; AG
schedulinggrantthatprovidesanabsolutelimitforthemaximumamountofuplink
resourcesapieceofuserequipmentmayusefordatatransmission

absolute radio frequency number; ARFN; ARFCN; absolute radio


frequency channel number
radiofrequencyusedinconnectionwith,forexample,mobileoriginatingandterminating
testcalls

absolute time difference; ATD


timedifferencethatiscalculatedbasedontimestampsfromaknownsystemtimeinthe
acquiredglobalpositioningsystem(GPS)data

abstract class
classthatincludessimilarparameterssharedbetweendifferentclasses

abstract data type


datatypethatisdefinedsolelyintermsoftheoperationsthatcanbeperformedon
objectsofthattype,andtherangeofvaluesthatitcantake,regardlessofthemethodof
representationofthevalue

abstraction layer
softwaretranslationlayerthatprovidesacommoninterfacebetweenapplicationsand
otherprogramsandhidestheimplementationdetailsofapplications

Issue:28

19

GeneralGlossary

abstract syntax notation; ASN


notationwhichenablescomplicatedtypestobedefinedandenablesvaluesofthese
typestobespecifiedwithoutdeterminingthewayaninstanceofthistypeistobe
represented

abstract syntax notation one; ASN.1


transmissionnotationstandardisedbytheInternationalOrganizationforStandardization
andusedtodescribenotationsgenerallyusedbytheadaptationlayerprotocols

acceptable cell
suitablecellfromwhichthemobilestationcanmakeemergencycalls

acceptable channel codings; ACC


partofabearercapabilityinformationelement(BCIE)inamobile-originatingcallset-up
thatindicatesthechannelcodingmethodsthemobilestationcanuse

accept-contact header
SIPheaderthatcontainsfeaturesetsthatdescribetheuseragentsthatthecallerwould
liketoreach

accept list
accesscontrollistwhichallowsuserstospecifyexactlywhichusersmaycallthem
directly

access
rightorabilitytoenter,approach,orusesomething

access accept
authenticationphasemessagefromtheremoteauthenticationdial-inuserservice
(RADIUS)serverconveyingapositiveauthenticationreply

access administration
administrationofuseraccesstoresourcessuchassystems,applications,and
information

access administrator
userwhomanagestheloginaccountsandaccessrightsoftheserviceandsubscription
administratorsandthesubscriber'sloginaccountsandaccessrightsforself-service
managementpurposes

20

Issue:28

GeneralGlossary

access API; access interface


applicationprogramminginterface(API)thattheapplicationsusetoreadorwritedatain
asystembasedonOpenEMSSuite

access attempt
processbywhichoneormoreusersinteractwithatelecommunicationssystemto
enableinitiationofuserinformationtransfer

access authentication; AA
authenticationofauser'slog-innameandpasswordbeforetheyareallowedtoconnect
tothenetworkortoadevice

access burst; AB
signalsentbythemobilestationtothebasetransceiverstationsothatthebase
transceiverstationcanderivethetimingadvancefromthedelayofitsarrival

access channel; AC
channelmarkedwithaspecialidentificationsignalandusedtogainaccesstoatraffic
channelwhen,forexample,themobilestationinitiatesacall

access channel
designatedpartoftheinformationtransfercapabilityhavingspecifiedcharacteristics,
providedattheuser-networkinterface

access channel band; AC band


thefrequencybandinuseforaccesschannels

access chronology
informationthattheUCSbusinesslogicenginemaintainstoassociatetheuseofa
specificservicewiththecorrectsubscriptionandtoapplythecorrectchargebasedon
thetimeatwhichtheservicewasused

access concentrator
networkdevicewhichisusedtocombinemultiplecommunicationslinesontoasingle,
high-speedoutputlink

access conditions; AC
setofsecurityattributesassociatedwithafile

Issue:28

21

GeneralGlossary

access contention
conflictbetweenthedemandsmadeonanetworkterminationinmultipointaccess

access control
techniqueforthepreventionofunauthoriseduseofaresource,includingitsuseinan
unauthorisedmanner,toensuretheconfidentialityandintegrityofinformation

access controller; AC
gatewaybetweentheinternetandwirelessstationsthatareattachedtoawirelessLAN

access control list; ACL


listofentitiesandtheiraccessrightsthatisusedfortheaccesscontrolservice

access control list application programming interface; ACL API; access


control list management interface
applicationprogramminginterfacethatthePoCcallprocessorprovidesforupdatingthe
accesscontrollistsviathenetworkoperator'scustomercaresystem

access control list entry; ACE


entryinanaccesscontrollistthatusuallyconsistsofatypeofentry(grouporindividual
user),nameoridentityandaccessrights

access control service


informationsecurityserviceforprovidingaccesscontrolfunctions

access delay
timeelapsedbetweenanaccessrequestandsuccessfulaccess

access denial
accessfailurecausedbytheissuingofasystemblockingsignalbyacommunications
systemthatdoesnothaveacall-originatorcamp-onfeatureoraccessfailurecausedby
exceedingthemaximumaccesstimeandnominalsystemaccesstimefractionduringan
accessattempt

access failure
inacommunicationssystem,anunsuccessfulaccessthatresultsinterminationofan
accessattemptinanymannerotherthaninitiationofuserinformationtransferbetween
theintendedsourceanddestinationwithinthespecifiedmaximumaccesstime

22

Issue:28

GeneralGlossary

access gateway; aGW


gatewaythathasthemobilitymanagemententityandservinggatewayfunctions
combined

access grant channel; AGCH


downlinkandpoint-to-pointcommoncontrolchannel(CCH)reservedforassignment
messages

access group
inlocationservices,agroupofoneormoreaccesspointswiththesameservice
characteristicinthesamelocation

accessibility data
datawhichdefinesconnectivitybetweenLANswitchesandbetweenLANswitchesand
hosts,andwhichdefineswhichlinksareinblockedstateandwhichinforwardingstate

access information
signallingparameterthatindicatesthenetworkinwhichthecalloriginatedorterminated,
thatis,a3GorGSMnetwork

access line loopback


loopbackinwhichtheOAMcellsareinsertedbythecustomerorthenetwork,and
switchedbackbythefirstATMnodeinthenetworkorcustomerequipmentrespectively

Access Link Control Application Protocol; ALCAP


transportsignallingprotocolthatisusedtosetupandteardowntransportbearers

access list; AL; access control list


listofstatementsthatpermitsordeniespacketflowacrossaninterfacebasedon
informationcontainedinthepacketandtheparametersinthelistthatareappliedagainst
thepacketcontents

access list management


featurewhichallowsuserstocontrolwhichincominginvitationstoPoCsessionsare
rejectedandwhichareaccepted

access mode
techniquetoobtainaspecificrecordformortoplaceaspecificrecordinginafile
containedinastoragedevice

Issue:28

23

GeneralGlossary

access network; AN
telecommunicationsnetworkbetweenalocalexchangeandthesubscriberstation

access node
nodeimplementedbetweenthelocalexchange(LE)andtheuser,replacingpartorthe
wholeofthelocallinedistributionnetwork

access path
pathtoafile,whichcanbeusedforfetchingafilebutdoesnotexplicitlystatethe
storagelocationofthefile

access plan view


packetcoreconfiguratorviewthatisusedtodefinethedefaultparametersoftheaccess
pointsforanewpacketnetworkaccessplan,andmodifyorviewtheparametersofan
existingaccessplan

access point; AP
physicaldevicethatconnectswiredandwirelessnetworkstogether

access point name; APN


logicalnamethatdescribestheactualconnectedaccesspointtotheexternalpacket
datanetworkaccordingtodomainnamesystemnamingconventions

access point plan view


packetcoreconfiguratorviewthatisusedtomodifyandviewtheparametersofa
selectedaccesspoint

access point provisioning


provisioningoftheaccesspointsinasystemsothattheaccesspointspecific
configurationdataisconsistentindifferentnetworkelements

access point re-hosting


re-hostingthatincludesremovinganaccesspointfromonegatewayGPRSsupport
node(GGSN)andcreatinganaccesspointinanotherGGSNforthetrafficofaspecific
end-user

access profile; ATM access profile


groupofattributesassociatedwithanATMinterfaceorwithavirtualpathtermination
point

24

Issue:28

GeneralGlossary

access profile
descriptionthatcontainstheaccessrightsfortheassociatedcredentialsandisusedfor
authorisation,whichoccursafterauthentication

access protocol
protocolthatisadoptedataninterfaceataspecifiedreferencepointbetweenauserand
anetworktoenabletheusertoinvoketheservicesorfacilitiesofthatnetwork

access reject
authenticationphasemessagefromtheremoteauthenticationdial-inuserservice
(RADIUS)serverconveyinganegativeauthenticationreply

access revenue sharing


revenuesharinginwhichtherevenuemadefromtheaccessportionofaneventissplit

access right; permission


definedrightwhichcontrolstheuseofasystemoritsparts

access router; AR
accessserverthatprovidesmobileconnectionstodatanetworksandcorporatelocal
areanetworksfromtheswitchingcentre

access security; network access security


securityfeaturethatprovidesuserswithsecureaccesstothenetworkservicesand
protectsagainstattacksontheradiolink

access security management entity; ASME


accessnetworknodethatreceivesthetop-levelcryptographickeysfromthehome
subscriberserverorhomelocationregister

access server; AS
serverthatconnectstheusertothenetwork

access service
partoftransactionprocessingwhichstartsatthereceptionofanaccesstokenandends
atthereleaseofthetoken

Issue:28

25

GeneralGlossary

access service network; ASN


accessnetworkthatprovidesradioaccessforaWiMAXsubscriber

access service provider; ASP


serviceproviderthatprovidesandcontrolstheaccessnetworkbetweentheenduser
andthebackbonenetwork

access stratum; AS
functionalgroupingconsistingofthepartsintheinfrastructureandinthemobilestation
andtheprotocolsbetweenthesepartsbeingspecifictotheaccesstechnique

access stratum service data unit; access stratum SDU


servicedataunitthatistransferredovertheaccessstratumserviceaccesspoint(SAP)
inthecorenetworkorinthemobilestation

access tandem /US/; AT


switchingsystemthatprovidesaconcentrationanddistributionfunctionfororiginating
andterminatingtrafficbetweenendofficesandacustomer'slocation

access tier
logicallayerofadistributedsystemthatisresponsibleforuserauthenticationand
serviceauthorisationofthesystem

access time
timeintervalbetweentheinstantwhendataisrequestedfromamemorydevicetothe
instantwhenitisdeliveredtothecentralprocessingunit,andviceversa

access transport; ATP


signallingparametergeneratedontheaccesssideofacallandtransferredtransparently
ineitherdirectionbetweenoriginatingandterminatinglocalexchanges

access validity emulator; AVE


emulatorthatreadstheaccesslogsoftheICDservicedirectory,picksoutrecords
concerningthetrafficanalyser,emulatesthetrafficanalyser,andwritesvaliditydata
regardingthereadoperation

access zone; AZ; public access zone; hotspot


publiclocation,forexampleanoffice,campus,hotelorairport,wherewirelessLAN
connectionsareprovidedtousers

26

Issue:28

GeneralGlossary

accountability
propertyofasystem,includingallofitssystemresources,thatensuresthattheactions
ofasystementitymaybetraced

account balance; wallet


amountofresources(forexamplemonetary)inasubscriber'saccount

account balance enquiry; balance enquiry


enquirythatasubscribercanusetogettheirownaccountbalanceorthatanaccount
ownercanusetogetthebalanceofamulti-useraccount

account balance management


processofmanagingtheaccountbalanceinthebalanceholder

account card calling; ACC


INservicefeaturewhichallowsthecallertobeautomaticallychargedonatelephone
accountsubscribedwiththenetworkoperator,foranytypeofoutgoingcall

accounting
collectionandanalysisofdatarelatedtotheuseofthenetworkandservicestomonitor
theamountandmonetaryvalueoftraffic

Accounting-Answer message; AWA; accounting answer


DiametermessagethatisusedtoacknowledgeanAccounting-Requestmessage

accounting counter
counterwhichstoresdatarelatedtoconversationtimeinseconds,numberofcalls,and
numberofgeneratedchargingpulses

accounting counter file


filethatcontainsdifferentkindsofaccountingcounterdata

accounting cycle
timeperiodduringwhichallthechargeableeventsarerecordedandthechargesare
calculated,butnotbilled

Issue:28

27

GeneralGlossary

accounting improvement
featurewhichenablestheoperatortodefinefourseparatedayclassgroupsfornormal
weekdays,aswellasspecialdays

accounting information record; AIR


recordthatanetworkelementgenerateswiththepurposeofpassingrelevantdataor
informationtoacentralisedaccountingfunction

accounting management; charging management


setoffunctionswhichenablestheuseoftelecommunicationsnetworkservicestobe
measuredandthecostsforsuchusetobedeterminedandrendered

accounting meter record


recordthatcontainsinformationononeormorecountersthatregistertheuseof
resourcesasawhole

accounting OFF
remoteauthenticationdial-inuserservice(RADIUS)accountingmessagethatthe
gatewayGPRSsupportnode(GGSN)sendstotheRADIUSaccountingserverwhenthe
accesspointbecomesinactivesothattheIPaddressescanbereleased

accounting ON
remoteauthenticationdial-inuserservice(RADIUS)accountingmessagethatthe
gatewayGPRSsupportnode(GGSN)sendstotheRADIUSaccountingserverwhenthe
accesspointbecomesactivesothattheIPaddressespossiblyhangingcanbereleased

Accounting-Request message; ACR; accounting request; ACR message


DiametermessagethatisusedtorequestaccountinginformationfromaDiameterpeer

accounting session
sessionthatthenetworkelementconnectedtotheonlineservicecontroller(OSC)
initiateswheneverthesubscriberretrievescontentviathatnode

accounting start
remoteauthenticationdial-inuserservice(RADIUS)accountingmessagethatthe
gatewayGPRSsupportnode(GGSN)sendstotheRADIUSaccountingserverwhena
PDPcontextiscreated

28

Issue:28

GeneralGlossary

accounting stop
remoteauthenticationdial-inuserservice(RADIUS)accountingmessagethatthe
gatewayGPRSsupportnode(GGSN)sendstotheRADIUSaccountingserverwhena
PDPcontextisdeleted

account management
processthatprovidesthecustomerservicerepresentativeacomprehensivecapabilityto
accesscustomeraccountinformation

account owner
personororganisationlegallyresponsibleforpayingthebillsoracceptinganypenalties

account query
queryforthebalanceofaprepaidsubscription

accumulated call meter; ACM


informationstoredontheSIMcard,holdingtheinformationaboutthetotalchargesforall
callsmade

accuracy
performancecriterionthatdescribesthedegreeofcorrectnesswithwhichafunctionis
performed

accuracy; accuracy of a clock


abilityofaclocktomaintainfrequencyandtimeincomparisonwiththenational
standards

ACID properties; ACID


propertiesthatadatabasetransactionshouldsatisfy

acknowledged mode; AM
radiolinkcontrolmodeinwhichaservicedataunit(SDU)istransmittedtoapeerwhich
thenacknowledgesit

acknowledged mode data; AMD; AM data


datathatthetransmittingsideofaradiolinkcontrolprotocolentitysendsinthe
acknowledgedmode

Issue:28

29

GeneralGlossary

acknowledgement
serviceofthesignallingconnectioncontrolpart(SCCP)bywhichthereceiverofthe
messageinformsthesenderofthecorrectreceipt

acknowledgement request bit; A bit


controlfieldbitforthelogicallinkcontrol(LLC)containedinconfirmedinformation
transferframes(IformatorIframe)andsupervisoryfunctionsframes(SformatorS
frame)toindicatewhetheracknowledgementisrequested

acoustic coupling
acousticphenomenonbetweentheearpieceandmouthpieceofthehandsetthatcan
causeanecho

acoustic echo
echoformedinthetelephonesetwhenthesoundiscarriedfromtheloudspeakertothe
microphoneviathehandsetorfromtheenvironment

acoustic echo cancellation; AEC


processofremovingtheechothatisproducedbycouplingbetweentheearpieceand
microphoneinhandsetsandhandsfreedevices

acoustic echo cancellation measurement


network-element-specificmeasurementthatcollectsacousticechocancellation
informationfromtheinterfacesignallingunits

acoustic echo canceller /GB/; acoustic echo canceler /US/; AEC


basetransceiverstationsystemfeatureusedforremovingtheechocausedbycoupling
betweenthehandsetearpieceandmouthpiece

acoustic echo controller


voice-operateddeviceinstalledinaudioterminalsonthecustomerpremises,usedfor
thepurposeofeliminatingacousticechoesandprotectingthecommunicationfrom
howlingduetoacousticfeedbackfromloudspeakertomicrophone

acoustic noise
unwantedaudibledisturbanceintheaudiofrequencyrange

acoustic noise emission; noise emission


noiseemittedbyasoundornoisesource

30

Issue:28

GeneralGlossary

acquisition indication channel; AICH; acquisition indicator channel


physicalchannelusedtocarryacquisitionindicators(AI)

AC statistics
featurewhichprovidesstatisticaldatathroughauthentication

action
typeofmanagementoperationwhichappliestomanagedobjectsasawhole.Itsimpact
isgenerallynotconfinedtomodificationsofattributevalues

action indication
indicationmessagewhichthesenderusestoreportaboutaspecificevent,fromarange
ofdiscretepossibilities

activate
tobringaserviceintoanactivestateinwhichitwillbeinvokedbytheoccurrenceofa
stateoreventdeterminedbythenatureoftheserviceoratregistration

ActivateServiceFiltering procedure; ActivateServiceFiltering


procedurewhichmakestheserviceswitchingfunctionhandlecallstodestinationsina
specifiedmannerwithoutrequestinginstructionsfromtheservicecontrolfunction

activateSS
operationinwhichasupplementaryserviceisbroughtintoanactivestate

activation; service activation; activation of service


processwhichbringsaserviceintoanactivestateinwhichitwillbeinvokedbythe
occurrenceofastateoreventdeterminedbythenatureoftheserviceoratregistration

activation allowed
commandthatisusedtoallowtheactivationofasignallinglink

activation command pull interface


interfacethatisusedtotransferactivationcommandstothebusinesssupportsystem
andtothecustomercareandbillingsystem(CCB)

Issue:28

31

GeneralGlossary

activation denied
commandthatisusedtodenytheactivationofasignallingroute

activation file transfer interface


interfacethatisusedtoreceiveactivationcommandsfromthebusinesssupportsystem
andtosendbackresultfilescontainingtheresultsoftheactivationcommands

activation of barring based on roaming


featurewhichtheoperatorusestopreventsubscribersfromroamingoutsidetheirhome
networkandmakingexpensiveinternationalphonecalls,andthenrefrainingfrompaying
them

activation status; feature activation status


parameterthatdescribestheactivityoftheoptionalfeature

activation test
testinwhichtheexchangeattemptsacalltoasubscriberandreleasesitbeforeringing
phaseiftheterminalrespondstothecallattempt

active
broughtintoanactivestateforinvocationattheoccurrenceofastateorevent
determinedbythenatureoftheserviceoratregistration

active alarm
alarmthatindicatesafailureandthatthealarmmanagementhasnotyetcleared

active alarm polarity


externalalarminputcharacteristicwhichdefinesthelogicalstateoftheexternalalarm
inputwhenthecorrespondingalarmissetbythealarmsystem

active alarms database; AADB


databaseinwhichallactivealarmsarestoredandwhichthusindicatesthesituationin
thenetwork

active alarms list


listoftheactivealarmsrelatedtoaspecificpartofthemanagednetwork,suchasa
managedobject,andsortedbyalarmcategoryandtimeofalarm

32

Issue:28

GeneralGlossary

active and operative


statusofthesupplementaryservicewhenitisactivatedandthesubscribercanoperate
withit

active and quiescent


statusofthesupplementaryservicewhenitisactivatedbutthesubscribercannot
operatewithit

active CG
charginggatewaytowhichchargingrecordsaresent

active codec set; ACS


setofdifferentactivecodecmodesthatareselectedfromthesupportedcodecset

active communication
communicationmodeinwhichacircuitswitchedconnectionisestablished

active condition; active


condition,suchasanalarm,thatisstillopenandhasnotbeencleared

active data connection; active connection


dataconnectionthattheclientinitiates

active IMSI
internationalmobilesubscriberidentity(IMSI)withwhichthesubscriberisregisteredin
thenetwork

active incoming call barring category


validincomingcallbarringcategoryactivatedbyauser

active key
cryptographickeythatiscurrentlyusedtoprotectdatathatisstoredinadatabase

active licence file /GB/ ; active license file /US/


licencefilewhosestarttimehasbeenreached

Issue:28

33

GeneralGlossary

active location retrieval; ALR


featurewherebytheGSMservicecontrolfunction(gsmSCF)explicitlyrequeststhe
currentlocationofthemobileterminalinanytimeinterrogation

active measurement
measurementwherethemeasurementsystemisinanactiverolegeneratingtesttraffic
andmeasuringitsproperties

active mobile station; active MS


mobilestationthatisswitchedonandthathasaSIMcardattached

active mode auto-tuning; active mode tuning


fastauto-tuningofthehandoverandthenetwork-controlledcellreselection(NCCRS)
triggersandthresholdsaccordingtothecellstatus

active modular process


activeprocessinaprocesspair

active PDP context


PDPcontextwhichisstoredintheservingGPRSsupportnode(SGSN)wheretheuser
hasperformedsuccessfulPDPcontextactivationandwhichcontainsallthenegotiated
parameters(qualityofserviceandaccesspointname)

active pending state; active pending


stateoflocallyactivatedtracingandmonitoringwhentheirsettingsarestoredinthe
visitorlocationregister(VLR)whichisactivelywaitingforthesubscriberorequipmentto
register

active PoC session


PoCsessioninwhichpacketsbasedonboththeReal-TimeTransportProtocolandfloor
controlprotocolarecarriedtotheuser

active queue management


processofmanagingaqueuebyusingrandomearlydetection(RED),weightedrandom
earlydetection,orREDwithinandoutasarandomdropalgorithm

active redundancy
redundancywhereinallmeansforperformingarequiredfunctionareintendedtooperate
simultaneously

34

Issue:28

GeneralGlossary

active router
routerselectedfromtheroutergroup,whichisresponsibleforforwardingthepackets
thathostssendtothevirtualrouteratanygiventime

active service
serviceforwhichtimeorconditiontriggershavebeensetbyauser

active set
setofradiolinkssimultaneouslyinvolvedinaspecificcommunicationservicebetween
themobilestationandradioaccessnetwork(RAN)accesspoint

active software build; active SW build


softwarebuildwhoseloadmodulesaredefaultversions

active-standby recovery group


recoverygroupthatisusedtoimplementactive-standbyredundancy

active-standby redundancy
standbyredundancyinwhichtheactiveprocessesformaloadsharinggroupand
replicatetheirstatetotheirowndedicatedstandbyprocess

Active state
stateintowhichthesubscriberisplaceduponmakingthefirstoutgoingcallenablingthe
subscribertomakeandreceivecalls

active supervision
supervisionwheretheobjectofthesupervisionactivelytakespartinsupervisionby
communicatingwithsupervisorinsomeway

active synchronisation unit


synchronisationunitthatisfeedingclocksignalstotheexchangeandissynchronisedto
onesynchronisationsignal

active system maintenance computer; A-SYM


unitinwhichthecentralpartofthealarmsystem,therecoverysystemandthe
diagnosticsarelocated

Issue:28

35

GeneralGlossary

active threat
threatofanunauthorisedchangetothestateofthesystemoralternationofinformation
containedinthesystem

active UE; active user equipment


userequipmentforwhichatleastonenon-GBRdataradiobearerhasbeenconfigured
successfully

active unit
unitthatisinaworkingexecutingorworkingrestartstate

active user monitor


applicationwhichdisplaysthecurrentnumberofactiveusersandgroupsinthetraffic
andcontrolservers,makingitpossibletomonitortheloadoftheservers

activity factor
foracommunicationschannelduringaspecifiedtimeinterval,thepercentageoftime
thatasignalispresentinthechannelineitherdirection

ActivityTest procedure; AT; ActivityTest


procedurethatisusedtocheckforthecontinuedexistenceofarelationshipbetweenthe
servicecontrolfunction(SCF)andtheserviceswitchingfunction(SSF),betweenthe
SCFandthecallunrelatedservicefunction(CUSF),orbetweenSCFs

actor
processinChorusoperatingsystem(ChorusOS)

actor identifier; actor ID


integerthatidentifiesanactorintheChorusOSoperatingsystem

actor supervision
partoffaultmanagementinaChorusunitwiththepurposeofmonitoringtheoperationof
actors,detectingerroneousbehaviourandexceptions,reportingthemtothelocal
recoverysystem,andrestartingfailedactorsaccordingtotheinstructionsgivenbythe
recoverysystem

actual group member


virtualprivatenetworkgroupmemberincludedinthevirtualprivatenetwork(VPN)group
andprovidedwiththeservice

36

Issue:28

GeneralGlossary

actual parameter
expressiongiventoaprocessorprocedureforthecorrespondingformalparameter
whentheprocessorprocedureiscreatedorcalled

adaptation
functionwhichchangestheclient-layerinformationintoaformsuitablefortransferonthe
serverlayer,orrecoverstheoriginalformofinformation

adaptation database tailoring


featurethatenablesthemanualdefinitionofthedatabaseschemaforadaptation
fragments

adaptation deployment
processofusingtheadaptationmanagertodeployadaptationmetadatainasystem
basedonOpenEMSSuite

adaptation deployment interface


southmediationinterfacethatisusedtodeployadaptationmetadataduringsystem
installationandatruntime

adaptation description
tablethatcontainsthemeasurementtypesandmeasuredindicatorsthatareusedas
countersinanadaptationproject

adaptation file
filethatcontainsadaptationmetadatainXMLformat

adaptation fragment; adaptation model fragment


partofcommonO&Mmetamodelthatrelatestoaspecificinstanceoftheadaptation
metamodel

adaptation identifier; adaptation ID


identifierthatuniquelyidentifiesanadaptation

adaptation information browser; AIB


toolthatisspecificallydesignedforbrowsingadaptationinformationonobjectclasses
andonperformance,configuration,andfaultmanagement

Issue:28

37

GeneralGlossary

adaptation interface
interfacethatcanbeusedatruntimetoconfigureperformance,fault,andconfiguration
managementdatainasystembasedonOpenEMSSuitetomanageanykindsof
networkresourcesorservices

adaptation logic
applicationlogicthatallowsadaptationmetadatatobesupportedandimplemented
properlyinapplicationclients

adaptation management
commonOSScomponentthatprovidestoolsformappingeachnetworkelementrelease
andadaptation-fragment-specificdatatotheexistingdatamodelsandsemantics

adaptation manager
managerthatconfigurestheOpenEMSSuiterun-timeenvironmentbywritingthenew
metadataintothesystemsdatabaseanddeletingtheoldmetadatafromthere,changing
thedatabaseschema,andnotifyingtheapplicationsaboutthechangedmetadata

adaptation metadata; adaptation


metadatathatisusedtoconfigurethesoftwaretohandlenewnetworkelementsor
servicetypes

adaptation module
moduleconsistingofasetofprotocolsthatconvertservicetriggersandhandlestothe
propersyntaxtosupporttheservicesexpectedbyaparticularprotocol

adaptation patch level; patch level; adaptation version


versionofadaptationmetadatathatallowsdifferentadaptationfragmentstobedefined
separatelyfromthemainadaptationrelease

adaptation project
projectthatcombinesthecreationofalladaptationfilesthatbelongtonetwork-elementrelatedadaptationmetadata

adaptation release
versionofadaptationmetadatathatneedstobecreatedforeachnewnetworkelement
release

38

Issue:28

GeneralGlossary

adaptation root class


rootclassofthemanagedsystemsobjectmodel

Adaptation SDK
partoftheSoftwareDevelopmentKit(SDK)thatsupportscreationanddeploymentof
adaptationstoOpenEMSSuite

adaptation sink
transportprocessingfunctionwhichpresentstheclientlayernetworkcharacteristic
informationatitsoutputbyprocessingtheinformationpresentedatitsinputbytheserver
layernetworktrail

adaptation source
transportprocessingfunctionwhichacceptsclientlayernetworkcharacteristic
informationatitsinputandprocessesittoallowtransferoveratrailintheserverlayer
network

adapter
fittingusedbetweentwosetsofequipmenttoprovideatransitionfromonetotheother
whentheycannotbedirectlyconnected

adaptive antenna system; AAS


antennasystemthatadaptivelyexploitsmorethanoneantennatoincreasecoverage
andsystemcapacity

adaptive differential pulse code modulation; ADPCM


formofdifferentialpulsecodemodulationthatusesadaptivequantising

adaptive equalizer
devicethatautomaticallycompensatesforthedistortionexperiencedbyadigitalsignal
oradigitallymodulatedsignalinitspassagethroughatransmissionsystem

adaptive frame alignment


processwherethemobilestationtimesitstransmissionstothebasetransceiverstation
inlinewiththosereceivedfromthebasetransceiverstation

adaptive gain control


methodofmodifyingthesendingandreceivingsensitivitiesbasedonthesurrounding
noiselevel

Issue:28

39

GeneralGlossary

adaptive predictor
predictorwhoseestimatingfunctionismadevariableaccordingtotheshorttermspectral
characteristicsofthesampledsignal

adaptive quantising /GB/; adaptive quantizing /US/


quantisinginwhichsomeparametersaremadevariableaccordingtotheshortterm
statisticalcharacteristicsofthequantisedsignal

adaptive reporting rate


rateofcreatingmeasurementreportswhichvariesaccordingtotheallowedchanges
withreferencetothelastreportedvalue

adaptive transmission bandwidth; ATB


transmissionbandwidththatcanbemodifiedbasedonthetransmissiontimeinterval

adaptor; RPC Solution Suite adaptor; adapter


inatelecommunicationsmanagementnetwork(TMN),partofadistributedmanagement
applicationwhichusuallyresidesinanexternalsystemandimplementstheintegration
interface

add-drop capacity; add/drop capacity


multiplexingfunctioninconnectionwithsynchronousdigitalhierarchythatallowslower
levelsignalstobeaddedtoordroppedfromahigh-speedopticalcarrierchannel

add-drop multiplexer; ADM; add-drop node


multiplexerforinsertingsignalsinand/orextractingthemfromanSTM-Nframe

add-in card; add-on card; expansion card


printedboardthatcanbepluggedintoafreeslotofacomputertoprovidespecificextra
functions

additional call information message; ACI; ACI message


messagewhichisusedtorequestandsendsupplementarycallinformation

additional calling line identity; ACLI; additional calling party number


addressinformationwhichidentifiestheadditionallineofacallingsubscriberforcalling
lineidentificationpresentation(CLIP)

40

Issue:28

GeneralGlossary

additional charging
chargingdeterminedbytheoriginofthecallortheclassofthecallingpartyand
generatedbypulsetraincharging,timecharging,orbyacombinationofthese

additional charging point


chargingpointintheascendingdirectionbelowthemainchargingpoint

additional charging zone


chargingzone,otherthanthemainchargingzone,accordingtowhichmeteringpulses
canbegeneratedtothecall

additional connected line identity; aCOL; additional COL


numberwhichidentifiestheadditionallineofthesubscriberforconnectedline
identificationpresentation(COLP)

additional dialling /GB/; additional dialing /US/


diallingusedinactivationanddeactivationoffacilitiesincaseswhentheuseofafacility
inthenetworkrequiresfurtherinformation

additional digit time supervision; time supervision for the additional digit;
additional number supervision; main number time supervision
periodintimewithinwhichtheusermustsupplytheadditionaldigitinpost-dialling

additional GPRS and EGPRS capacity; additional (E)GPRS capacity


partoftheGPRSandEGPRSterritorythatisallocatedforpacket-switchedtrafficwhen
theloadissohighthatthedefaultGPRSandEGPRScapacityisnotenough

additional information
informationwhichdescribescurrentfunctionalcharacteristicsofaunit

additional intra-frequency adjacency; ADJD


logicaladjacencyobjectthatisusedtocontrolintra-frequencyhandoverswhenthe
numberofadjacenciesisgreaterthan31

additional network functions


functionswhichincreasecallcontrolpossibilitiesinthenetwork

Issue:28

41

GeneralGlossary

additional number
numberthatisdefinedtothesameaccessasthemainnumber

additional object information


additionalinformationattachedtoamanagedobject

additional operation
functionaldefinitionelementthatgivesadditionalfunctionstothebasicoperationsand
thatcanbeexecutedonlyifthebasicoperationisexecuted

additional out-line number


out-linenumberusedtoaccessadifferentnumberingplanthantheoneaccessedby
usingthemainout-linenumber

additional output control block


guidancemessagethatindicateshowtoexecuteorcancelanMMLcommand

additional routing info


informationinthedatabaseoftheserviceroutingregister(SRRiDB)thatisusedto
derivetheroutingaddressforthemapapplicationterminatingfunction(MATF)

additional signalling point code /GB/; additional signaling point code /US/
signallingpointcodethatisusedtoincreasethesignallingcapacitybetweentwoormore
networkelements

additive white Gaussian noise; AWGN


statisticallyrandomradionoisethatischaracterisedbyawidefrequencyrangewith
regardstoasignalinacommunicationschannel

add-on
softwareoradaptationmetadatathatisdevelopedbycustomersontopofanalready
installedOpenEMSSuiteatruntime

add-on charge
singleadditionalchargewhichdoesnotchangethecurrenttariff

42

Issue:28

GeneralGlossary

add-on conference; CONF; conference calling add-on


conferencecallingthatallowstheusertoreserveaconferenceresourceformakinga
multipartycall,indicatingthedate,time,andconferenceduration.Oncetheconference
isactive,theusercontrolstheconference,andmayadd,drop,isolate,reattach,orsplit
parties

add-on feature
featurethatsupplementsanexistingfeature

add-on manager
managerthatprovidesforpowerusersawebuserinterfaceforinstalling,updating,and
removingadaptationmetadataandadd-onsoftwareinOpenEMSSuite

add party
functionthatextendstheswitchedvirtualcircuit(SVC)toreachanewleaftoanexisting
point-to-multipointconnectionwhentherootstartssendingdatatoanewuser

address
characterorgroupofcharactersthatidentifiesaregister,aparticularpartofmemoryor
someotherdatasourceordestination

address
datastructureorlogicalconventionusedtoidentifyauniqueentity,suchasaparticular
process,networkdeviceoruser

addressable entity
customerpremisesequipmentorotherterminationpointthathasanaddress

addressable unit
unitthatcontainsalogical,relative,orphysicalcomputeraddressandsocanbereached
byaDMXmessage

address analysis
functionthatfindsoutthepossiblesubdestinationsforthecallaccordingtothecalled
partyaddress

address autoconfiguration
mechanismbywhichanodeinanetworkcanconfigureanIPaddresswhichisunique
throughouttheconnectedportionofthenetwork

Issue:28

43

GeneralGlossary

address complete message; ACM


signallingmessagesentinthebackwarddirectionindicatingthatalltheaddresssignals
requiredforroutingthecalltothecalledpartyhavebeenreceived

address conversion
functionwhichperformsconversionbetweenE.164andNSAP(networkserviceaccess
point)addressformats

address digits
digitsequencewhichdefinesinthenetworkthepointwhichthecalliscomingfrom,or
wherethecallisgoingto

address family
setofIPaddresseswithcommoncharacteristics

address file
inthemobileclient,alinearelementaryfilethatstorestheaddressofthelanguagefiles
andsomeadditionaldata

address handling; AH
functionwhichprovidesanalysis,translation,modification,addressportabilityoperations,
andmappingofaliasaddresses

address hiding
functionwhichallowsthesendingofanonymousmessageswherethesender'saddress
ormobilesubscriberinternationalISDNnumber(MSISDN)isnotshowntotherecipient

address information
informationdefiningthatpointinthenetworktowhichacallisdestinated

addressing
processbywhichacallinguserindicatestheidentityofthecalleduseronaparticular
call.Itincludesanetworkaddressing(numbering)componenttoidentifythecalledusernetworkinterface,andmayalsoincludefurtherinformation(sub-address)toidentifya
particularterminalbeyondthepublicnetwork(ISDN)

addressing
assignmentofaddressestotheinstructionsofaprogram

44

Issue:28

GeneralGlossary

address management
functionthatmanagesauser'sdirectorynumbers

address-of-record; AOR
SIPuniformresourceidentifier(URI)thatpointstoadomainwithalocationservicethat
canmaptheURItoanotherURIwheretheusermightbeavailable

address register
registerinwhichanaddressisstored

address resolution
conversionofaninternetaddressintothecorrespondingphysicaladdress

Address Resolution Protocol; ARP


protocolwhichoperatesonthenetworklayerandisusedformappingIPaddressesto
linklayeraddresses

address server
serverforaddressconversions,forexamplebetweenasymbolicandatechnicaladdress

address server; AdS


inapushtotalkcallprocessor,aserverinthemanagementplanewhichprovides
mappinginformationneededtolocatethecorrectauthorisationserverduringsignalling
transactions

address signal
elementofinformationinanetworknumber,sentintheforwarddirectionincallset-up
signalling

address space
numberofdistinctlocationsthatmaybereferredto

address table; page table


tablethatavirtualmemoryinanoperatingsystemusestostorethemappingbetween
virtualaddressesandphysicaladdresses

Issue:28

45

GeneralGlossary

address translation
functionofaGPRSsupportnodethatprovidesthemeanstotranslateanaddressused
inaGPRSbackbonenetworktoidentifyaPDPcontextintoaninternaladdressformat
usedinaservingGPRSsupportnode(SGSN)andviceversa

address type analysis


analysisforextractingdifferentelementsfromtheaddress

ad hoc group
talkgroupwhichuserscanestablishthemselvesfortheirownusewithouttheneedto
contacttheoperatorortouseagroupmanagementsystem

ad hoc network
networkthatdoesnothaveabasetransceiverstation,centralcontrol,orwired
infrastructure,thecommunicationsofwhicharesupportedviamobile-to-mobile
transmission

ad hoc pro group; ad hoc group pro


adhocgroupwhichprofessionaluserscanestablishthemselvesfortheirownuse
withouttheneedtocontacttheoperatorortouseagroupmanagementsystem

ad-hoc query; ad hoc query; self-service reporting


querythatuserscanmaketoasktheirownquestionsonthedatawithoutrelyingtothe
ITsupporttocreateareport

adjacency
relationshipbetweentwocommunicatingneighboringpeernodesformedforthepurpose
ofexchangingroutinginformation

adjacency
relationshipthatisdefinedbetweenawidebandcodedivisionmultipleaccess(WCDMA)
cellandaneighbouringcell

adjacency list; adjacent cell list


listofcellsandtheiradjacentcellsusedforthedefinitionoftheinterferenceby
calculatingthebiterrorratio(BER)betweeneverycellforeverybasetransceiverstation

46

Issue:28

GeneralGlossary

adjacent AAL2 node identifier; ANI


parameterthatidentifiestheadjacentATMadaptationlayertype2(AAL2)nodebya
uniquestringinthenetwork

adjacent channel interference; ACI


interferencecausedbyatransmitteroperatingonanadjacentradiochannel

adjacent channel leakage power ratio; ACLR; adjacent channel leakage


ratio
ratioofthetransmittedpowertothepowerthatismeasuredafterareceiverfilterinthe
adjacentradiofrequencychannel

adjacent channel power; ACP


thatpartofthetotaloutputpowerofatransmitter,modulatedunderdefinedconditions,
whichfallswithinaspecifiedbandwidthcentredonthenominalfrequencyofeitherofthe
adjacentchannels

adjacent channel selectivity; ACS


selectivityoftheequipmentwithrespecttoitsadjacentchannel

adjacent point code; APC


pointcodetowhichthelocalnodeisdirectlyconnected

adjacent signalling points /GB/; adjacent signaling points /US/


twosignallingpointsthataredirectlyinterconnectedbyasignallinglinkorsignallinglinks

adjunct; AD
entityintheintelligentnetworkthatisfunctionallyequivalenttoaservicecontrolpointbut
isdirectlyconnectedtoaserviceswitchingpoint

adjunct platform
platformforoperationandmaintenanceapplicationservicesanddifferentnetwork
elementmanagementapplicationsandtools

Adler-32 checksum; ADLER32


32-bitchecksumusedforthedetectionofdatacorruption

Issue:28

47

GeneralGlossary

administration
actionsrelatedtoconfigurationmanagement,security,backups,andtimemanagement
ofanetworkornetworkelement

administration centre; ADC


nodeoftheTMNwhichprovidesforPLMNoperator-specificrequirementsinthe
administrationandcommercialareas

administration entity
publictelecommunicationadministrationorrecognisedprivateoperatingagency

administration interface
interfacefromthenetworkservertowardstheoperator'sadministrativesystem

administration management domain; ADMD


managementdomainmanagedbyanadministrationwhichcanbeatelecommunication
administrationorarecognisedprivateoperatingagency

administration node
dedicatedhostinaclusteredmessagingcentrethroughwhichthewholeclustercanbe
managed

administration of measurements; AoM


NetActfunctionformanagingtheperformancemeasurements

administration task
taskwhichcoversabroadgroupoffunctionsthatsustaintelecommunicationservices
oncetheyhavebeenestablished

administration user interface; AUI


userinterfaceforoperatorstodooperationalandadministrativetasks

administrative centre interface; AdC interface


interfacebetweenahomelocationregister(HLR)andanadministrativecentre

48

Issue:28

GeneralGlossary

administrative computer; AdC; administrative centre


networkelementwhichperformsdatacollectiontosupportbillingandothercentraltasks
relatedtoserviceadministration

administrative domain
collectionofsystemsandsubnetworksoperatedbyasingleorganisationor
administrativeauthority

administrative log
loginwhichinformationabouttheoperationsperformedwiththeadministrationinterface
issaved

administrative protocol module; APM


connectionserverprocessthatverifiesthefunctionsofthephysicalconnectiontothe
host

administrative state
attributewhichdescribesthefunctionalstateofmanagedobjects

administrative state of the radio network object; administrative state


functionalstateofaradionetworkobjectfromtheoperator'sviewpoint

administrative unit; AU
structuralpartofanSTM-1framethatconsistsofahigherordervirtualcontainerandan
AUpointer

administrative unit group; AUG


administrativeunitorgroupofadministrativeunitswithafixedpositioninanSTM-1
frame

administrative unit pointer; AU pointer


pointerthatisaddedtoahigherordervirtualcontainerforthelocationofinformationbits

administrator
operatorofalocalareanetworkorsomeotherpassword-restrictedcommunication
systemwhotakescareofissuingotheruserswithaccessrightsanduseridentifiers,and
whoisresponsibleforvariouskindsofmaintenancetaskssuchasbackupcopyingand
deletingunnecessaryfiles

Issue:28

49

GeneralGlossary

administrator account
built-inuseraccountincomputersthatusetheWindowsoperatingsystem,whichhasfull
andcompleterightstoeverythingonthecomputer

administrator log
logthatconsistsofentriesabouttheactionsthatadministratorsandcontentproviders
perform

admission control; AC
processthatdealswiththemanagementofavailableresourcesinacell,sothat
wheneverarequestismadeforresourcesatbearerset-up,bearerre-negotiation,or
handover,adecisionprocesswilldeterminetheactualresourceallocation

ADSL Lite
versionoftheADSLservice,whereonlyalimitedbandwidthisavailable,asspecifiedin
ITU-TG.992.2

advanced device management; ADM; TARM; terminal administration rights


model
setofadvancedsecuritypoliciesandcontrolsformobiledevices

Advanced Encryption Standard; AES


USgovernmentstandardforasymmetriccryptographicalgorithm,beingdraftedbythe
NationalInstituteofStandardsandTechnology(NIST)

advanced HLR splitting; advanced HLR split


HLRsplittinginwhichthecombinedcapacityoftwoexistinghomelocationregisters
(HLR)isshared

advanced indoor radio; AIR


signaldistributionsystemthatprovidesseamlessindoorcoverageinWCDMAnetworks

advanced management module; AMM


hot-swappablemodulethatisusedtoconfigureandmanagealltheinstalledblade
servers

AdvancedMC; AMC; AMC module


mezzaninethatisoptimisedtoenhancethemodularityofAdvancedTCAandtoextend
performancescalability

50

Issue:28

GeneralGlossary

advanced media server package


H.248packagethatdefinesaparametersyntaxtoprovideameansofreferringto
provisionedannouncementsandvariablecontenttobeplayedwithinthem

advanced multilayer handling; AMH


inthebasestationcontroller,afunctionthatprovidesefficienttoolsforoptimisingthe
performanceandincreasingthecapacityofbothsingle-layerandmultilayernetworks

AdvancedTCA; ATCA
standardisedplatformarchitectureforcarrier-gradetelecommunicationapplicationsand
equipment,withsupportforcarrier-gradefeatures

advanced technology attachment; ATA


standardinterfaceforconnectingstoragedevicessuchasharddisksandCD-ROM
drivesintopersonalcomputers

advanced visualisation
functionthatisusedtoprovideabettervisualviewofthenetworksituationandalsoto
completemeasurementdata

advantage framework; ADVFRW; advantage FRW


applicationserverfortelecommunicationplatformsthatisusedbycharging,billing,and
carenetworkelementsandbycorenetworkelements

advice of charge; AOC


ISDNsupplementaryserviceallowingtheuserpayingforacalltobeinformedofusagebasedcharginginformation

advice of charge; AoC


indicationtotheuserofthechargeofacall

advice of charge at call set-up time; AOC-S; advice of charge, charging


information at call set-up time; advice of charge with charging information
at call setup
servicewhichprovidesauserwiththecharginginformationratesinthecallset-upphase
andadditionalinformationduringacall,ifthechargingrateischanged

Issue:28

51

GeneralGlossary

advice of charge during the call; AOC-D; advice of charge, charging


information during the call; in-call advice of charge
servicewhichprovidesauserwithcumulativecharginginformationduringacall

advice of charge information; AOC-I; AoCI


adviceofchargewhenthecallingsubscriberhasaGSMconnection

advice of duration and charge; AD&C; ADC


servicewhichprovidesauserwithanannouncementofthedurationofandchargeforan
outgoingcallafterthecall

aerial optical cable; fibre-optic aerial cable; aerial fibre-optic cable


opticalcablethatisdesignedforuseinoverheadsuspensiondevices,suchastowersor
poles

AGC tracking
abilityoftheautomaticgaincontrol(AGC)circuittofollowfastchangesinthelevelofthe
receivedsignal

age indicator
partofthesubscriberdatainasuper-chargednetworkthatisusedtocheckthedata
consistencybetweenthehomelocationregisterandvisitorlocationregister

agent
managementinformationserviceuserwhich,foraparticularexchangeofsystem
managementinformation,hastakentheroleofanagent

agent
web-basedsoftwareapplicationthatcollectsalarmandperformancedatafromnetwork
elements

agent
intheclient-servermodel,thepartofthesystemthatperformsinformationpreparation
andexchangeonbehalfofaclientorserverapplication

agent advertisement message; agent advertisement


routeradvertisementmessagethatadvertisesanagentusinganattachedspecial
extension

52

Issue:28

GeneralGlossary

agent object
managedobjectthatrepresentstheO&Magent

agent role
managementinformationsystemusercapableofperformingoperationsonmanaged
objectsandofemittingnotificationsonbehalfofmanagedobjects

aggregate
sideofthenodethatprovidestheinterfacestowardsthecentreofthenetwork

aggregate bit rate


bitratethatisequaltothesumoftheinputchanneldatasignallingratesavailabletothe
userandtherateoftheoverheadbitsrequired

aggregate data
datacontainedbytheinputoroutputsignalatthe2Mbit/sinterface

aggregated link
logicaltransmissionlinkthatconsistsofmultiplecombinedlinks

aggregate interface
interfacefortheoutputofmultiplexedsignalsfrommultiplexequipment

aggregate maximum bit rate; AMBR


maximumbitratethatisbasedonthetotalradioresourcesavailableforallnon-GBR
bearersthatasubscriberhasactive

aggregate signal
signaltransmittedoverthecommonmultiplexchannel

aggregating switch; aggregate switch


switchthatbindsalltheotherswitchestogetherandthatthemanagementusesto
accesstheswitches

aggregation
gatheringofcharginginformationfromallchargingrecords(CDR)thatarerelatedtoa
session

Issue:28

53

GeneralGlossary

aggregation class; AGC


classthatisusedtodeterminewhetheratrafficstreammeetscertainthroughputgoals

Aggregation Engine
partofthePerformanceManagementPlatformthatcompressestherawperformance
managementdataondifferentdimensions,andcalculatesandstoresmeasurementdata
aggregationsassystem-managedaggregates

aggregation proxy; AP
proxythatprovidestheauthenticationofmanagementrequestsfromtheterminal,and
theroutingofmanagementrequeststowardsaPoCcallprocessor,presenceserver,and
listmanagementserver

aggregator
routerfunctionthatisusedtocreateasinglemessagefrommultipleindividualmessages

aggressive mode
modeofthefirstphaseofInternetKeyExchange(IKE)inwhichthenegotiatingparties
usethefirstmessagetoproposethesecuritypolicy,passdataforthekeyexchange,and
passthenonceforidentification

AGPS data interface; ADIF


logicalinterfacebetweentheradionetworkcontroller(RNC)andtheAGPSserver

AIF-MTC-manager
partofAinterfaceimplementationwhichhandlesthemobile-terminatingcallset-up

A interface
interfacebetweenabasestationcontrollerandanexchangethroughwhichallthe
servicesandotherfacilitiesareofferedtoaGSMPLMNuserinordertoenabletheuse
ofthesystem

A' interface
interfacebetweenthemobileservicesswitchingcentre(MSC)andmultimediagateway
(MGW)

A+ interface
AinterfacefortheUMAnetworkcontrollerthatisoptimisedfor3GPPRelease4
networks

54

Issue:28

GeneralGlossary

A-interface attribute analysis; AIF attribute analysis


attributeanalysisthattheoperatorcanusetodefinedifferentprioritylevelsformobileoriginatingandmobile-terminatingcalls

A interface circuit allocation


terrestrialcircuitreservationpartoftheGSM08.08assignmentprocedure

A-interface gateway; AGW


gatewaybetweenanintranetandaGSMnetworkwhichprovidestheAinterfaceforthe
mobileservicesswitchingcentre(MSC)

air cell; air-to-ground cell


cellwhichoffersservicemainlyforairborneterminals

air interface user rate; AIUR


userratebetweenthemobileterminationandthemobileservicesswitchingcentre
(MSC)orinterworkingfunction(IWF)

AK identifier; AKID
identifieroftheauthorisationkey(AK)thatabasetransceiverstationhasgenerated

alarm
announcementthatisgiventothemanagementsystemaboutabnormalfunctioningof
thesystemoraboutafailure,oranindicationofthedegradationoftheservicelevelor
reliability

alarm acknowledgement upload


functionthatisusedtotransferacknowledgementinformationbetweentheglobalsystem
andregionalsystemsinbothdirections

alarm adapter; ALA; alarm system adapter


partofthealarmsystemwhichconvertsalarmnotificationstorequestsforraisingand
clearingalarms,andpassestherequeststothecentralisedpart(CP)

alarm and cancel correlation


featureinwhichthecancellationsarecomparedtotheactivealarmsandifthe
cancellationsmatchthealarms,thealarmsareremovedfromtheactivealarmslist

Issue:28

55

GeneralGlossary

alarm bit
bitthatconveysalarminformation

alarm blocking
situationwherethehandlingofanalarmisblockedbyusingacommand

alarm buffering
storingalarmsinbufferswhentheycannotbedirectlyforwardedtothedestination

alarm bus
businacablethatconveysalarmsfromacartridgeorsubracktotheequipmentrack
top,whichfunctionsasanalarmcollectionpoint

alarm-cancel alarm; AC alarm; alarm-cancel pair


alarmthatiscancelledimmediatelyafterithasbeenactivated

alarm cancellation; cancellation; cancelling an alarm


removaloftheeffectofanalarminthesystemwhentheprogramwhichsetthealarm
doesnotrecognisetheremovalofthefault

alarm category; alarm class


classificationofalarmsthatconsistsofanalarmurgencylevelandalarmtype

alarm client
partofthealarmdispatcherthatisusedtoviewandcancelactivealarms

alarm collector
servicethathandlestheNE3Sprotocolandthecollectionofdataforfaultand
performancemanagementpurposes

alarm condition; condition


situationthatmaycauseanalarm

alarm correlation
partofalarmflowreductioninwhichalarmsthatareknowntobeassociatedwitheach
otherarecombined

56

Issue:28

GeneralGlossary

alarm correlation rule editor


applicationthatisusedforcreatingrulesforalarmcorrelation

alarm counter
partoffaultmanagementapplicationoftheNMSdatabasewhichgathersdataabout
alarms

alarm daemon
daemontowhichtheprocessessendalarms,andwhichhasadefinitionofhowto
handleeachalarm

alarm database cleanup


functionthatisusedtodeleteacknowledgedandcancelledalarmsfromthedatabase

alarm database upload


applicationthatisusedtoverifythatthenetworkmanagementsystem(NMS)database
isconsistentwiththedatabasesofthenetworkelements

alarm data flow


routeandprocessthatanalarmgoesthroughfrombeingraisedtobeingcleared

alarm description
descriptionoftheseverity,reason,instructions,cancellation,andotherinformationwhich
isrelatedtoanalarm

alarm description file


adaptationfilethatiscreatedforeachspecificproblemtoprovideadditionaltextual
informationthatcanbeusedtoresolveproblems

alarm event; error notification


internaldataobjectwhichisusedbythecharginggatewaymodulestorepresentan
abnormalsituationandwhichispassedfromthemodulestothealarmdispatcher

alarm event interface; RPC Solution Suite alarm event interface


real-timealarmeventtransferinterfacethatsendseventstothemanagerastheyare
generatedintheexternaladaptor

Issue:28

57

GeneralGlossary

alarm extension module; external alarm module


modulethatisusedtoimplementtheexternalalarmconnection

alarm filtering
partofalarmflowreductionthatallowstheblockingofcertainalarmsfromthenetwork
managementsystem(NMS)

alarm filtering and reclassification


featurethatisusedinnetworkmanagementsystemsforcontrollingtheparametersof
thenetworkelementalarmsandthatiscomposedofalarmfilteringandalarm
reclassification

alarm flow reduction


processofmakingnetworkmonitoringmoreefficientthroughalarmfiltering,correlation,
andreclassification

alarm flow supervision


supervisionthatmonitorsthetransferofalarmsfromregionalsystemstotheglobal
clusterandgeneratesaninternalalarmifthealarmflowisdelayedorinterrupted

alarm forwarder
applicationthatforwardscertainalarmsfromthemanagedsystemtothepersonnel
responsibleforfaultstudyandcorrection

alarm forwarding to e-mail


featurewherebyallthealarmmessagescomingtothenetworkmanagementsystemare
testedagainstasetofforwardingcriteriaandthosematchingitareforwardedviaanemailsystemfromtheNMSworkstationtoadefinede-mailaddressoraddresses

alarm forwarding to paging system


featurewherebyallthealarmmessagescomingtothenetworkmanagementsystemare
testedagainstasetofforwardingcriteriaandthosematchingitareforwardedfromthe
NMSworkstationtoadefinedpagerorpagers

alarm gravity level


classificationofanalarmwhichmakesuseofanumericalvaluewhendescribingthe
criticalityofthealarmfromtheviewpointoftherecoverysystem

58

Issue:28

GeneralGlossary

alarm group
setofhardwarealarmsinonesinglecartridge

alarm history; alarm event history


finitelistofpreviousalarmevents(notices,disturbances,alarms,andalarm
cancellations)ofanetworkelement

alarm history handling


featurewhichisapartoffaultmanagementprovidingmethodsforcontrollingand
organisingalarmsreceivedbythenetworkmanagementsystem

alarm indication
indicationofafaulteventfortheoperatingpersonnel

alarm indication instance


objecttowhichthealarmsystemsendstheinformationofthealarmifnecessary

alarm indication signal; AIS


signalthatreplacesthenormaltrafficsignalwhenamaintenancealarmindicationhas
beenactivated

alarm information category


classificationofbasetransceiverstationalarmsindicatingtheeffectofafaultor
disturbanceonthechannelstateonthebasisoftheirexistenceornature

alarm information dialogue


dialogueofthegraphicaluserinterfacewhichshowsallinformationonalarmeventsin
theactivealarmstabandalarmhistorytab

alarm-information parameter
alarmparameterusedinalarmreportsforcategorisingthealarmsfortheoperating
personnel

alarm information transfer


featurewhichenablesthealarminformationtobetransferredfromthemobileservices
switchingcentre(MSC)andhomelocationregister(HLR)totheoperationand
maintenancecentre(OMC)byusingtheQ3interfacebasedonthecommon
managementinterfaceprotocol(CMIP)

Issue:28

59

GeneralGlossary

alarm input
inputstartedbyanincident

alarm interface
partoftheRPCinterfacewhichisusedtotransferalarmdata

alarm lifting
functionthatre-targetsthealarmsofonemanagedobjectclasstoanotheraccordingtoa
liftingrule

alarm live time; live time


timefromthesettingofanalarmtoitsautomaticcancellation

alarm management
setoffunctionsusedtodetectandrecoverallactivealarmsinrun-timeandsearchall
alarmsbasedonspecificcriteria

alarm manager
programwhichprovidesinformationaboutthecurrentstatusofthenodestothe
monitoringsoftware

alarm manual
applicationwithagraphicaluserinterfacethatprovidesdetailedinformationabouteach
alarm

alarm mediation function; alarm-mediating function


mediationfunctionthattransmitsalarmsbetweenanetworkelementandthenetwork
managementsystem

alarm monitor
toolformonitoringanetworkfaultsituation,whichpresentstheactivealarmsituationof
thenetworkintheformoftheactivealarmlist

alarm monitoring
functionofalarmsurveillanceinthemonitormodethatchecksthevaluesofdetermined
parametersatregularintervals

60

Issue:28

GeneralGlossary

alarm notification; alarm notification message


notificationsentorreceivedbythealarmsystem

alarm notification event


CORBA-structuredeventthatcontainsinformationaboutsystemfaultsinapredefined
format

alarm number
numberidentifyingthepossiblereasonforanalarm

alarm object hierarchy


listofobjectsshowingthepathtotheobjectofthealarm

alarm output control


softwareinthealarmsystemthatcontrolsthealarmoutputsinco-operationwiththe
hardwaremanagementsystem

alarm pipe
setofprocessesandbuffersdefinedinaconfigurationfile,usedforcollecting,
processing,anddistributingalarmstorecipients

alarm polarity
particularstateofthealarminputwhichthealarmsysteminterpretsasanalarm

alarm processing parameter


alarmparameterusedbythealarmsystemintheprocessingofanalarmevent,suchas
informingaboutandcancellingdelays

alarm reclassification
partofalarmflowreductionthatallowstheusertochangethestatusofalarmsand
performsearchesofexistingreclassificationsettings

alarm report; alarm printout


printoutonafaulteventfortheoperatingpersonnel

alarm reset limit


percentageofreservationinthebuffer,towhichthealarmcancellationisset

Issue:28

61

GeneralGlossary

alarm set limit


percentageofreservationinthebuffer,towhichthealarmisset

alarm-setting delay; setting delay


timethatthealarmsystemwaitsbeforeitinformstherestofthesystemabouta
hypothesis

alarm signal
signalthatindicatesanalarmsituation

alarm status
attributethatdescribesthecurrentstatusofamanagedobjectasaresultofoneormore
alarmevents

alarm surveillance
setoftelecommunicationsmanagementnetwork(TMN)applicationfunctionswhich
provides,nearrealtime,detectionandindicationoffailures

alarm system; AS; alarm handling system


systemwhichmakesdecisionsonthebasisofalarmindicationsandactivatesthe
recoverysystemwhenneededsothattheautomaticrecoveryactionsarestarted

alarm system administration


DX200commandclass

alarm system application programming interface; AS API


applicationprogramminginterfacethatclients,applications,andmanagedobjectsuseto
raiseanalarminafaultsituation

alarm system rulebase; alarm rulebase; rulebase


rulebasewhichconsistsoffilescontainingsupportrules,preventionrules,andinforming
rules

alarm text
brieftextualdescriptionofthealarm

62

Issue:28

GeneralGlossary

alarm threshold
predeterminedvalueofaparameterbeyondwhichanalarmistriggered

alarm trigger
toolusedforstartingupexternalandinternalprocessesthatsupportthedailyroutinesof
alarmhandling

alarm type
classificationthatindicatesthetypeofanalarm

alarm upload
operationwhereeitherthealarmhistoryorthecurrentalarmsituationistransferredfrom
thenetworkelementtotheoperationssystem(OS)

alarm upload interface


interfaceformakinganalarmuploadforallactivealarmsfromanadaptortothe
manager

alarm urgency level


classificationofalarmswhichdescribestheircriticalityfromtheviewpointoftheuser

alarm viewer
toolformonitoringalarms,warnings,cancellations,andacknowledgementsinthe
network

A-law; compression law


standardcompression/decompressionalgorithmforpulsecodemodulation(PCM)from
theITUTelecommunicationStandardizationSector

alert
opticaloracousticwarningsignalthatdrawstheattentionofthenetworkadministratorto
aspecificserviceevent

alert box
secondarywindowofanapplicationusedtoconveyamessageorwarningortogathera
smallamountofinformationfromtheuser

Issue:28

63

GeneralGlossary

alert SC
messagesentfromthenetworktotheshortmessageservicecentre(SMSC)indicating
thatapreviouslynon-reachablemobilesubscriberisnowavailabletoreceiveamessage

Alert Standard Format specification; ASF; Alert Standard Format


specificationthatdefinesremotecontrolandalertinginterfacesforaclient'senvironment
outsidethecontextofanoperatingsystem

alert type
classificationofnotificationstoenableoperatorsandsubscriberstomanagedelivery
accordingtocontent

algorithm A5; A5
cryptographicalgorithmthatproducesciphertextoutofcleartextusingthecipheringkey
(Kc)

algorithm f1; f1
messageauthenticationfunctionusedtocomputethemessageauthenticationcode
(MAC)

algorithm f1*; f1*


messageauthenticationfunctionusedtocomputethemessageauthenticationcodefor
resynchronisation(MAC-S)

algorithm f2; f2
messageauthenticationfunctionthatisusedtocomputetheresponse(RES)andthe
expectedresponse(XRES)

algorithm f3; f3
keygeneratingfunctionusedtocomputethecipherkey(CK)

algorithm f4; f4
keygeneratingfunctionusedtocomputetheintegritykey(IK)

algorithm f5; f5
keygeneratingfunctionusedtocomputetheanonymitykey(AK)innormalprocedures

64

Issue:28

GeneralGlossary

algorithm f5*; f5*


keygeneratingfunctionusedtocomputetheanonymitykey(AK)inresynchronisation
procedures

alias
alternativeoradditionalname

alias IMSI
internationalmobilesubscriberidentity(IMSI)thatistiedtoaregularinternationalmobile
subscriberidentitysothatthesamesubscriberisfoundwithbothinternationalmobile
subscriberidentities

alignment error rate monitoring; AERM


procedurebywhichtheerrorrateofasignallinglinkismeasuredduringtheinitial
alignment

alive supervision
supervisionthatisusedtocheckthatthecomputerunitsarealiveandthatthemessage
connectionfromtheactivesystemmaintenancecomputertothesupervisedunitis
working

all-call-query; AcQ
numberportabilitysolutioninwhichtheoriginatingnetworkmakesanumberportability
checkforallcallsandroutescallsdirectlytowardstherecipientnetwork

All-IP
technologyandarchitectureinwhichdifferentnetworkaccessoptionsareintegratedin
anInternetProtocol(IP)basednetworkinglayer

All-IP network
integratedtelecommunicationsnetworkthatusestheInternetProtocol(IP)fortheendto
endtransportofalluserdataandsignallingdata,thatis,includingcallcontrol

All-IP radio access network; All-IP RAN; IP RAN


radioaccessnetwork(RAN)whichisfullybasedontheInternetProtocol(IP)and
optimisedtocarryIPpackettraffic

all-nodes multicast address


link-localscopemulticastaddresstoreachallnodes

Issue:28

65

GeneralGlossary

allocate (verb); reserve


assignaresourcetoaspecifictask

allocation and retention priority; ARP; allocation/retention priority


valuethatisusedtodifferentiatebetweenbearerswhenperformingallocationand
retentionofabearer

allocation class
classthatindicatestherelativepriorityofmaintainingagivenservice

allocation domain; AD
associationbetweenaroutingdomainandtheIPaddressspace

allocation type
parameterthatdetermineswhetherafixedchannelisreservedfortheannouncementor
whetheranewchannelisreservedfortheannouncementateverynewannouncement
request

allomorphism
abilityofamanagedobjectofagivenclasstoresembleobjectsofoneormoreother
objectclasses

allowable PLMN; allowable public land mobile network


publiclandmobilenetwork(PLMN)whichisnotusedinthelistofforbiddenPLMNsin
themobilestation

allowed cell rate; ACR


currentcellrateincells/secatwhichasourceisallowedtosend,usedasanavailablebit
rate(ABR)serviceparameter

all-routers multicast address


link-localscopemulticastaddresstoreachallrouters

alphanumeric paging service; alphanumeric radio paging service;


alphanumeric call
pagingwherethepagingmessageoutputonthescreenofthepagercancontainashort
text

66

Issue:28

GeneralGlossary

alternate line
secondarysubscriptionofasubscriberattachedbyusinganalternatelineservice(ALS)

alternate line service; ALS; dual numbering


capabilityofthenetworktoattachtwologicallyseparatesubscriptionstoasinglenumber

alternate line service MSISDN; ALS MSISDN


mobilesubscriberinternationalISDNnumber(MSISDN)ofanalternateline

alternately routed call; ART


calltypethatconsistsofcallsthatarerejectedbytheirprimarysubdestinationandare
routedtoanalternativesubdestination

alternate mark inversion code; AMI code; bipolar code


linecodethatemploysaternarysignaltoconveybinarydigits,inwhichsuccessive
binaryonesarerepresentedbysignalelementsthatarenormallyofalternating,positive
andnegativepolaritybutequalinamplitude,andinwhichbinaryzerosarerepresented
bysignalelementsthathavezeroamplitude

alternate mark inversion signal; AMI


encodedsignalproducedbyalternatemarkinversioncode

alternate mark inversion violation; AMI violation


non-zerosignalelementinanalternatemarkinversionsignalthathasthesamepolarity
asthepreviousnon-zerosignalelement

alternate MSISDN
mobilesubscriberinternationalISDNnumber(MSISDN)assignedtotheteleservicefor
thealternatelineservice(ALS)subscriber'salternateline

alternating current signalling /GB/; alternating current signaling /US/; AC


signalling /GB/; AC signaling /US/
signallingmethodinwhichthesignallinginformationisrepresentedbymeansofpulsed
alternatingcurrenthavingafrequencybelowthetelephonespeechband

alternative charging index


chargingindexincludedinalternativeroutingalternative,whichtogetherwiththe
chargingoriginspecifiesthechargingofacall

Issue:28

67

GeneralGlossary

alternative network address types; ANAT


semanticsfortheSessionDescriptionProtocolwhichallowstheexpressionofalternative
networkaddressesforaparticularmediastream

alternative routing
routinginwhichadestination'strafficisdirectedtoacertainsubdestinationamong
primaryandalternativesubdestinations

alternative routing of signalling /GB/; alternative routing of signaling /US/


routingofagivensignallingtrafficflowincaseoffailuresaffectingthesignallinglinksor
routesthatareinvolvedinthenormalroutingofthatsignallingtrafficflow

alternative service source


locationfromwhichanINsupportedservicecanbestartedincaseserviceinitiation
towardstheprimarylocationfails

alternative subdestination; alternative route; secondary route; overflow


route
subdestinationthatisusedifnormalroutingisnotpossible

Always On
methodaccordingtowhichtheconnectionispermanentlysetupandnever
disconnected,regardlessofwhetherdataistransmittedornot

Amazon machine image; AMI


pre-configuredoperatingsystemandvirtualapplicationsoftwarethatcanbeusedto
createavirtualmachinewithintheAmazonElasticComputeCloud

AMC bay; AMC slot


structurethatprovidesforanAdvancedMCmechanicalsupportandshieldingfrom
electromagneticinterference

AMC filler
fillermodulethatispluggedintoanAMCbaywhichisnotpopulatedwithanyfunctional
AdvancedMCtoensureelectromagneticcompatibility(EMC)shieldingandtoactasan
airseal

American National Standards Institute; ANSI


nationalstandardizationorganizationoftheUnitedStates

68

Issue:28

GeneralGlossary

amplification
proceduretoincreasethepowerofasignal,frequentlydonetoovercomelossofpower
arisingfromelectricalresistanceinthematerialsusedinconstructingatransmission
channel

amplitude distortion
distortionoccurringinanamplifierorotherdevicewhentheoutputamplitudeisnota
linearfunctionoftheinputamplitudeunderspecifiedconditions

amplitude fading; flat fading


fadingthataffectsallfrequenciesmoreorlessequally,sothesignalisreducedin
amplitude,butnototherwisedistorted

amplitude quantised control /GB/; amplitude quantized control /US/


synchronisationcontrolinwhichtheclockcontrolsignalisaquantisedfunctionofthe
phasedifferencebetweenclocks

amplitude response
maximumoutputamplitudethatcanbeobtainedatvariouspointsoverthefrequency
rangeofaninstrumentoperatedunderratedconditions

AMR frame type; FT; frame type


4-bitfieldinanAMRspeechcodecpayloadframe,whichindicatesthemodeofthe
correspondingframe

AMR speech codec; AMR codec; adaptive multi-rate speech codec


speechcodecwhichadaptsitsoperationoptimallyaccordingtotheprevailingchannel
conditions

AMR TFO
tandem-freeoperationfortheAMRspeechcodecsthatiscontrolledeitherbytheMSC
serverormediagateway

A/Mu-law converter; AMC; A-law/Mu-law converter


devicethatconvertsaPCMsignalsamplefromA-lawtoMu-lawinonedirection,and
fromMu-lawtoA-lawintheotherdirection

Issue:28

69

GeneralGlossary

AMX/AET channel
transmissionchannelwhichisusedtoimplementtheinternaldatatransmission
connectioninthesystembetweena386computerandanATMMultiplexer(AMX)and
betweena386computerandanATMexchangeterminal(AET)

analogue /GB/; analog /US/


describingaphenomenoncontinuouslywithanotherphenomenon,forexamplea
continuouslyvariablesignal

analogue access /GB/; analog access /US/


pointinananaloguetelecommunicationnetworkwhichhasaninterfaceforterminal
equipment

analogue control /GB/; analog control /US/


synchronisationcontrolinwhichtheclockcontrolsignalisacontinuous(monotonic)
functionofthephasedifferencebetweenclocks,atleastoveralimitedrange

analogue repeater /GB/; analog repeater /US/


repeaterforamplifyinganaloguesignalsordigitalsignals,butnotcapableof
regeneratingdigitalsignals

analogue signal /GB/; analog signal /US/


signaloneofwhosecharacteristicquantitiesfollowscontinuouslythevariationsof
anotherphysicalquantityrepresentinginformation

analogue signalling data link /GB/; analog signaling data link /US/
datalinkthatprovidesaninterfacetosignallingterminalsandismadeupofvoicefrequencyanaloguetransmissionchannelsandmodems

analogue subscriber /GB/; analog subscriber /US/


subscribertoananaloguetelecommunicationservice

analogue switch matrix /GB/; analog switch matrix /US/


groupofrelaysthatcarryoutsubscriberswitchfromoneinterfacetoanother,activated
byoperationandmaintenancecommands,dueto,forexample,achangeintheservice
typeorfaultintheinterface

70

Issue:28

GeneralGlossary

analogue telephone adapter /GB/; analog telephone adapter /US/; ATA


adapterthatisusedtoconnectastandardtelephonetoahigh-speedmodemtofacilitate
voiceoverIP(VoIP)andfaxcallsovertheinternet

analogue terminal equipment /GB/; analog terminal equipment /US/


terminalequipmentwhichconnectsacomputerunittoanaloguedatanetwork

analogue-to-digital conversion /GB/; analog-to-digital conversion /US/; A/D;


A/D conversion
processdesignedtoconvertananaloguesignalintoadigitalsignalwithessentiallythe
sameinformation

analogue-to-digital converter /GB/; analog-to-digital converter /US/; ADC;


A/D converter
devicewhichconvertsananalogueinputsignaltoadigitaloutputsignalcarrying
equivalentinformation

analysis
partofadiagnosticprogramwhichistodeterminethelocationofafault

analysis class model


staticclassmodelthatidentifiescentralconceptsandclassesofthetargetsystemand
theirrelationships

analysis factor
informationonthebasisofwhichtheanalysisservicedeterminesanoutput

analysis path
chainofanalysisfilerecords

analysis port; mirror port; sniffer port


portthatcopiesthetrafficofanotherportwiththepurposeofanalysingandmonitoring
thetrafficinthenetwork

analysis service
servicethatselectstheoptimalrecoveryactionforagivenfaultsituationandperformsa
concurrentrecoveryactionanalysistodeterminewhetherornotitispossibletostartthe
recoveryaction

Issue:28

71

GeneralGlossary

analysis starting point; analysis start point


entrytothedatastructuresoftheaddressanalysisrecordchain

analysis starting point selection


functionthatoffersmorethanoneaddressanalysisstartingpointbyenablingdifferent
analysisresultsforthesameaddressinformation

analysis tree
chainofrecordsintheanalysisfileusedforanalysingandidentifiedbythenumberofits
initialrecord

analysis tree of attribute values


analysistreewhichindicatesthestartingrecordforanattributeanalysis

analysis tree selection


triggerdatawhichexpresseswhetherthecallednumberwillbeanalysedintheoriginally
selectedtreeorwhetheritshouldbechangedtoaspecialINtree

anchor ASN gateway


ASNgatewayviawhichamobileterminalisconnectedtotheconnectivityservice
network

anchor data path function; ADPF; anchor DPF; anchor DP function


datapathfunctionthatislocatedatoneendofthedatapathandthatanchorsthedata
pathassociatedwiththemobileterminalacrosshandovers

anchoring
casewherethefunctionsofthebasestationgateway(BSGW)andUEcontrolfunction
(UCF)areprovidedbyabasetransceiverstation(BTS)thatdoesnotprovideradio
resourcestotheuserequipment(UE)

anchor MGW; anchor media gateway


mediagatewaythatterminatestheIu-CSinterfacefromthesourceRNCintheinter-MSS
relocation

anchor mobile services switching centre; MSC-A; MSCA; anchor MSC


controllingmobileservicesswitchingcentre(MSC)whichfirstestablishedradio
connectiontoorfromamobilestation

72

Issue:28

GeneralGlossary

anchor RNC; anchoring RNC


radionetworkcontroller(RNC)whichisconnectedtotheIuinterfaceforaparticular
mobileterminalandremainsasaservingRNCforthemobileterminalifrelocation
procedureisnotsupported

angle of arrival; AoA; AOA


positioningmethodinwhichthelocationofamobileterminaliscalculatedbasedonan
analysisoftheangleatwhichthesignalarrivesattheantennafromthemobileterminal

anisochronous
essentialcharacteristicofasignalsuchthatthetimeintervalsbetweenconsecutive
significantinstantsdonotnecessarilyhavethesamedurationordurationsthatare
integralmultiplesoftheshortestduration

annotation
extensiontoadaptationmetadatathatiscreatedbyanOpenEMSSuitecustomerand
thatcontainscustomer-specificinformationconcerningmanagedobjectclasses,
measurementtypes,orotherelementsoftheadaptationfiles

announcement
messagethatistransmittedtoinformtherecipientaboutanevent

announcement case
categorywhichincludescertaintypesofannouncements

announcement channel
onePCMtime-slotfromtheannouncementhardwaretotheswitchingnetwork

announcement channel measurement report


measurementreportwhichshowsthenumberandchannelofannouncementsgiven
duringtheresultsaccumulationperiod

announcement identifier
digitsequencewhichwithintheannouncementanalysesprovidestheinformation
neededforstartingtheannouncement

announcement index
obligatoryparameterusedwhencreatingannouncementsforaninternalannouncement
device

Issue:28

73

GeneralGlossary

announcement measurement
intheVoiceAnnouncementUnit,ameasurementthatprovidesinformationabout
successfulandunsuccessfulannouncementrequests

announcement of chargeable service


recordedannouncementwhichtellsthataserviceischargedfor

announcement of estimated queuing time


recordedannouncementwhichtellstheaveragelengthofaqueue

announcement specifier
specifier(anumber)whichisusedtodistinguishannouncementsbelongingtothesame
announcementcase

announcement terminating call


callthatdoesnotreachthecalledsubscriberduetocalledsubscriberIMSIdetach,thus
creatinganannouncementforthecallingsubscriber

anonymity key; AK
keywhichisusedtoconcealthesequencenumber(SQN)

anonymity server; anonym server


serverwhichallowstheusertobeconnectedtodifferentsitesandserversonthe
networkwithoutbeingrecognisedonthebasisoftheuserdata

anonymous access; AA
functionwhichallowsausertoaccessthenetworkwithoutasubscriberidentity

anonymous access indicator


informationinaSGSNchargingrecord(S-CDR)thatindicatesifanonymousaccesshas
beendeployed

anonymous call barring; ACB


incomingcallbarringwhichenablesthepreventionofcallsfromuserswhohavecalling
lineidentificationrestrictionactive

74

Issue:28

GeneralGlossary

anonymous communication
communicationinwhichtheuseridentityissuppressedorreplacedbyananonymous
identity

anonymous message
messageinwhichthesender'sMSISDNnumberishiddenfromtherecipientby
replacingitwithapseudo-address

answer message; ANM


signallingmessagesentinthebackwarddirectionindicatingthatthecallhasbeen
answered

answer mode override


PoCfeaturethattheinvitingPoCclientusestooverridetheinvitedPoCclientsanswer
modesetting

answer seizure ratio; ASR; answer-to-seizure ratio


eitheronarouteoradestinationcodebasis,andduringaspecifiedtimeinterval,the
ratioofthenumberofseizuresthatresultinananswersignaltothetotalnumberof
seizures

answer-signal delay
timeintervalbetweentheestablishmentofaconnectionbetweencallingandcalled
users,andthedetectionofananswersignalattheoriginatingexchange

antenna branching
couplingofoneormoretransmittersandreceiversintothesameantennagate

antenna branching equipment


deviceforcouplingoneormoretransmittersandreceiversintothesameantennagate

antenna cable; antenna feeder


cablebetweenanantennaandradiorelayequipment,transmittingtheRFsignalineither
direction

antenna filter; AF
waveguideassemblythatonlyallowsaspecifiedfrequencyrangetopassfromthe
transmittertotheantennaandfromtheantennatothereceiver

Issue:28

75

GeneralGlossary

antenna gain
ratioofthemaximumradiationintensityinagivendirectiontothemaximumradiation
intensityproducedinthesamedirectionfromareferenceantennawiththesamepower
input

antenna hopping
frequencyhoppinginwhichthetransceiversinabasetransceiverstation(BTS)can
transmitwithalltheradiotransmitterantennasintheBTS

antenna sharing
usinganantennafortransmissionandreceptionwithatleasttwodifferenttechnologies
suchasWCDMAandGSM

antenna tilting
adjustingthetiltangleofanantenna

anti-replay
protectionmethodthatisusedtopreventsendingofaninterceptedpacketmessageto
therecipientmultipletimeswithouttheoriginalsenderknowing

anti-replay window; IPsec anti-replay window; anti-replay service window


transmitwindowthatprotectsthereceiveragainstreplayattacksbyrejectingoldor
duplicatepackets

anti-replay window size; replay window size


configurablesizeoftheanti-replaywindowthatprotectsthereceiveragainstreplay
attacks

antivirus software; antivirus program; virus protection software


securitysoftwarethatisusedtopreventmalicioussoftwarefromenteringthesystem,to
identifythefilesinfected,andtoremove,clean,orquarantinethem

anycast address
IPaddressidentifyingasetofnodesofwhichthepacketreachesonlyone

anycasting; anycast
unidirectionaltransmissionofdatabetweenasinglesenderandthenearestofseveral
receiversinagroup

76

Issue:28

GeneralGlossary

any time interrogation; ATI


interrogationinwhichtheservicecontrolpoint(SCP)enquiresthesubscriber'sstatus
andlocationinformationfromthehomelocationregister(HLR)

any time modification; ATM


controlprocedurethattheGSMservicecontrolfunctioncanuseatanytimetomodify
thesubscriberinformationinthehomelocationregister

any time subscription interrogation; ATSI


interrogationwhichtheservicecontrolpoint(SCP)canperformatanytimetofindthe
subscriptioninformationfromthehomelocationregister(HLR)

any-to-any networking
featurethatprovidesapossibilitytocombineallnetworktechnologies

APN-AMBR
aggregatemaximumbitrate(AMBR)thatisassociatedwithanaccesspointname(APN)
andthatlimitsthebitratethatcanbeexpectedtobeprovidedfornon-GBRbearersand
packetdatanetworkconnectionsacrossanaccesspoint

APN network identifier; APN-NI; NID; network identifier


identifierthatisthefirstpartoftheDNSaccesspointname(APN)andthatdefinestheIP
networktheuserwantstoconnectto

APN operator identifier; APN-OI; operator identifier


identifierthatisthesecondpartoftheDNSaccesspointname(APN)andthatdefines
theoperator'sbackbonenetwork

applet
applicationwhichoperatesonlyasassociatedwithanotherapplication

application; application program; application software


softwarethatformsalogicalcollectionoffeatures

application
softwarewhich,togetherwiththerelatedhardware,performsaspecificfunctionforthe
useror,insomecases,foranotherapplication

Issue:28

77

GeneralGlossary

application archive
filethatcontainsallthecomponentsofaservlet

application association
co-operativerelationshipbetweentwoapplicationentitiesformedbytheirexchangeof
applicationprotocolcontrolinformationthroughtheiruseofpresentationservices

application awareness
databaseapplicationthatcanbedesignedtoenableanddisableselectiveroles
automaticallywhenauserattemptstousetheapplication

application binary interface; ABI


interfacebetweenanapplicationandtheoperatingsystem,betweenanapplicationand
itslibraries,orbetweenthecomponentsoftheapplication

application binary interface for C++; C++ ABI


applicationbinaryinterfacebetweentheuserC++codeandthesystemandlibrariesthat
theimplementationprovides

application class; application QoS class


qualityofservice(QoS)classinwhichthequalityofserviceisdefinedasasetof
parametersthatdescribesthebehaviourofatrafficflowthroughthenetwork

application client
applicationthatprovidesagraphicaluserinterfacetorunaclientmachineanddirectly
accessserverapplicationsthatrunontheapplicationserver

Application Configuration Access Protocol; ACAP


internetprotocolforstoringandaccessingclientprogramoptions,configurations,and
preferenceinformationremotely

application context; AC
explicitlyidentifiedsetofapplicationserviceelements,relatedoptions,andanyother
necessaryinformationfortheinterworkingofapplicationentitiesonanapplication
association

application convention
application-specificinformationgoverningthetextofadocumentinareasthatstandard
generalisedmarkuplanguage(SGML)leavestouserchoice

78

Issue:28

GeneralGlossary

application-defined RTCP packet; APP


RTCPpacketthatisintendedfortestusewhennewapplicationsandfeaturesare
developedandwhosepackettypevalueisnotregistered

application development environment; ADE


combinationofhardwareandsoftwarethatisusedtodevelopanapplication

application domain
unitofprocessingthatthecommonlanguageruntime(CLR)canusetoprovideisolation
betweenapplications

application domain security


securityfeaturethatenablesapplicationsintheuserandproviderdomainstosecurely
exchangemessages

application entity; AE
setofapplicationserviceelementswhichtogetherperformallorpartofthe
communicationsaspectsofanapplicationprocess

application entity name; AEN; AE name


unambiguousidentifierofanOSIapplication

application entity title; AET


unequivocalidentifierconnectedwitheachOSIapplicationentityintheDXsystem

application field
groupofprocessfamiliesperformingthetaskofacertaingroupofapplications

application framework; AF; application development framework


setofcommonsoftwareroutinesthatprovidesastructureforapplicationdevelopmentin
aspecificdevelopmentenvironment

application function; AF
functionthathoststheservicelogicandcommunicatestheapplication-levelsession
informationtothepolicyandchargingfunctions

Issue:28

79

GeneralGlossary

application functions
oneofthetwomajorfunctionalareasofmPlatform,enablingseamless,user-friendly
servicestobeprovidedoverdiversechannels,handsets,andnetworks

application gateway; AGW


gatewaywhichprovidesmultimediastorage,legacysupport,e-mailsmartpush,and
multimediavoicemessagingservices

application group
groupthatcontainsapplicationitems

application icon
iconrepresentinganapplicationthathasalreadystarted,andhasbeenminimised,while
stillrunning

application identifier; AID; APPID; application ID


uniqueidentifierthatreferstoanapplication

application information
application-specificinformationtobepassedtoanapplicationorprocessornot
appearinginthedocumentoritsdocumenttypedefinition(DTD)

application instance
singleoccurrenceofanapplicationthatrunsononeofthenodesinacluster

application interface
interfaceviawhichthecommunicationbetweenthesystemandexternalapplicationsis
handled

application item
applicationiconrepresentinganapplicationwithspecificparameters

application launcher; AL; AppLauncher


partofanelementmanager(EM)thatoffersaninterfaceforinstalling,launching,and
managingseparateelementmanagerapplications

80

Issue:28

GeneralGlossary

application launch extension point


clientAPIthatmakesitpossibletoextendtheapplicationlaunchtypessupportedinCM
userinterfaceadaptationfragmentswithcustomapplicationlaunchtypes

application layer
layer7withintheOSImodelprovidingthemeansbywhichtheuserprogramsaccess
theOSIenvironment

application layer gateway; ALG


application-specificgatewaythatallowsanInternetProtocolversion6(IPv6)nodeand
anInternetProtocolversion4(IPv4)nodetocommunicatewitheachother

application-level addressing
addressingofpushcontentbetweenaparticularuseragentonaWAPclientandapush
initiatoronaserver

application location register; ALR


registerprovidedwiththefunctionwhichassociatesamobilesubscriberinternational
ISDNnumber(MSISDN)withthehomelocationregister(HLR)wherethesubscriptionis
locatedresultingintheabilitytomovetoanotherHLRwithoutchangingtheMSISDN

application log
logwhichcontainsspecificeventsthattheapplicationshavemonitoredandlogged

application logic
computationalpartofanapplicationwhichincludesalistofinstructionsthatindicateto
thesoftwareapplicationhowtooperate

application management
functionsintheapplicationlayerthatarerelatedtothemanagementofOSIapplication
processes

application management
setoffunctionsforcontrollingtheinternalapplicationsofasystemandtheexternal
applicationsinteractingwiththesystem

application manager
toolthatprovidesaccesstospecificapplicationsandobjects

Issue:28

81

GeneralGlossary

application message queue; AMQ


databasetablethattheexternalapplicationinterface(EAIF)processesuseforinterprocesscommunicationtopassmessagesfromoneprocesstoanother

application node; AN
nodethatusestheservicesprovidedbylowerlayerprotocols

application number
numberwithwhichthesubscribersendstherequesttotheshortmessageservicecentre
(SMSC)ormultimediamessageservicecentre(MMSC)andontotheMessaging
Gateway

application-originated; AO
characteristicofaniteminitiatedbyanapplication

application-originated short message; AO-SM


shortmessageinitiatedbyanapplication

application prefix
uniqueprefixdefinedforeachapplication,whichtheshortmessageservicecentre
(SMSC)recognises

application process; AP
elementwithinarealopensystemwhichperformstheinformationprocessingfora
particularapplication

application processor
inamultiprocessorcomputer,anyprocessorotherthanthebootstrapprocessor

application program
programthatiswrittenforauserandappliestotheuser'swork

application programming interface; API


programminginterfacethatsupportstheprocessofdevelopingapplicationprograms
usedtoaccessvariousnetworkservices

82

Issue:28

GeneralGlossary

application program system; APS


entiresoftwareofacompletesystemthatisabletoinstall,start,andmaintainthewhole
systemwithallitsfunctions

application protocol
protocolwhichdeterminesthecommunicationbehaviourofapplicationentitiesinthe
performanceofapplicationfunctions

application protocol control information


informationexchangedbetweenapplicationentitiesusingpresentationservicestocoordinatetheirjointoperation

application protocol data unit; APDU


sequenceofdataelementsexchangedbetweenpeerentitiesofapplicationlayer

application protocol version


triggerdatawhichdefinestheapplicationprotocolversionforapplicationsusingthe
communicationservicesoftheapplicationprotocol

application response measurement interface; ARM; application response


measurement; ARM interface
standardapplicationprogramminginterface(API)formeasuringservicelevelsofsinglesystemanddistributedapplications

application security
securitymeasuresrequiredfortheprotectionagainstattacksdirectedattheapplication
level

application server; AS
serveroraprograminacomputerinadistributednetworkthatprovidesthebusiness
logicforanapplication

application server; AS
logicalentitythatservesaspecificroutingkey

application server identity; AS identity


informationelementthatidentifiestheapplicationserverwhichhasoriginatedarequest
andthatisusedincheckingtheASpermissionslist

Issue:28

83

GeneralGlossary

application server node; ASN


nodethatservesasanapplicationserver

application server process; ASP


processinstanceofanapplicationserver,servingasanactiveorstandbyprocess

application server process maintenance message; ASPM


messagethatisusedinthemanagement,support,andmaintenanceofapplication
serverprocesses

application service element; ASE


setoffunctionsthatprovideacapabilityfortheinterworkingofapplicationentity
invocationsforaspecificpurposeonasingleapplicationassociation

application service function; ASF


functionprovidingservicecapabilitieswhichofferaccesstonetworkresourcesfor
externalandinternalservicesandapplications

application service provider; ASP


serviceproviderthatmanagesanddistributessoftware-basedservicesandsolutionsto
customersacrossawideareanetworkfromacentraldatastorage

application services
serviceareaspecificallygearedtowardsapplicationdevelopers'community,forexample
scenariomanager

application service subscription information; ASSI


inadefaultsequencelist,afieldthatcontainsanorderedlistofinternalservicesandISC
subsystemapplicationlogicstowhichtheeventsmustbereported

applications of charging
partofchargingwhichenablestheobservationoflongcalls,chargingofoperatorcalls,
freephoneservicecharging,andSSPcharging

application-specific integrity rules


databasepropertiesthatconcerntheintegrityofthedatabaseandaremaintainedbythe
application

84

Issue:28

GeneralGlossary

application supervision service; supervision service


partofthecomputingplatformthefunctionofwhichistomonitorthehealthofthe
applicationsrunningintheswitchingsystem

application-terminated; AT
characteristicofanitemterminatedbyanapplication

application-terminated short message; AT-SM


shortmessageterminatedtoanapplication

application timer
timerthatdefinesthewaitingtimeinhuntingforananswerwhenthecallisconnectedto
ahuntingnumber

application traffic
trafficthatconsistsofcommunicationbetweentheapplicationsofanetworkelement

application transport instruction indicator; ATII


mechanismwhichallowsanapplicationtransportmechanismuserapplication(APM
user)toinstructareceivingnodehowtorespondtoerrorcases

application transport mechanism; APM


transportmechanismusedbyapplicationsrequiringabearerinconjunctionwiththe
supportoftheapplication'ssignallinginformationflow

application transport parameter; APP


applicationtransportmechanism(APM)parameterwhichisusedfortransportingcalland
bearer-relatedcorrelationandbindinginformationinnarrowbandISDN

application workstation
workstationthatispartoftheoperatorseatofanetworkmanagementsystemand
connectedtoalocalareanetwork

applied service
logicalservicethatisrequestedforanexistinglogicalleg

Issue:28

85

GeneralGlossary

ApplyCharging; AC
messagethattheservicecontrolpoint(SCP)usestoinformserviceswitchingpoint
(SSP)ofthelimitthatthechargingforthecallmustnotexceed

ApplyChargingReport procedure; ACR; ApplyChargingReport


procedureusedbytheGSMserviceswitchingfunction(gsmSSF)toreporttotheGSM
servicecontrolfunction(gsmSCF)theinformationrequestedintheApplyCharging

APS 1+1
automaticprotectionswitching(APS)inwhichapermanentelectricalbridgeisused
betweentheservingandprotectingconnection,andthesamepayloadsignalissentover
bothconnections

arbiter
mechanismforsolvingconflictswhentwoormoredeviceswanttousethesame
resourceatthesametime

arbitrated loop
looptopologyinwhichtwoormoreportscanbeinterconnected,butonlytwoportsata
timecancommunicate

arbitrated loop physical address; AL_PA


infibre-channeltransmission,aneight-bitvaluethatisusedtoidentifyadevice
participatinginanarbitratedloop

arbitration
surveyoncompetitionsituation

architecture; system architecture


conceptualdesignfortherulesandguidelinesthatdefinethestructureandbehaviourof
asystem

archive attribute
attributethatindicateswhetherthefilehasbeenupdatedsincethelastbackupcreation

archive file
filethathasbeensavedinadifferentlocationfromtheoriginalforbackuppurposes

86

Issue:28

GeneralGlossary

archive log file; archive log


logthatissavedinanarchiveandkeptforaspecifiedperiodoftime

area address
partoftheNSAPaddress,whichidentifiestheareawheretheequipmentislocated

area code; AC
numberthatisdialledbeforethecalledsubscribernumberandthatconsistsofthe
nationalprefix0togetherwiththenumberofthecallednumberingarea,anationwide
servicenumber,oranumberofanothernetwork,suchasthatofamobilenetwork

area code
codeaddedtoanauthoritysystemsothattheauthoritiesofacertainusercanbelimited
toexchangeslocatedinacertainarea,andtodatarelatedtothem

area code analysis


analysisofadialledareacodethatisusedforroutingacall

area information
informationthatindicatesthebasetransceiverstationinitiatingthesignallingand
preventsmalfunctionduetoco-channelinterference

area service number


actualcallnumberfortheareaserviceaccesspointwhichthesubscriberdoesnotneed
toknow

arithmetic expression
combinationofarithmeticdelimiters,numeralsandidentifiersenclosedinparentheses(in
MML)

armed (adj)
stateofadetectionpointinwhichtriggeringoccurswhenthatdetectionpointis
encountered

ARQ channel identifier; ACID


identifierofachannelinwhichautomaticrepeatrequest(ARQ)packetsaretransferred

Issue:28

87

GeneralGlossary

ARQ protocol; automatic repeat request protocol


protocolthatoperatesontheradiolinklayerandprovidesanerrorrecoveryschemeby
retransmittingapacketoraframethathasnotbeenacknowledged

array
predefinedtypegeneratorwhichcontainsseveralvaluesofthesametypewhichcanall
befoundbymeansofanindex

array file
one-dimensionalortwo-dimensionalfilewhichcancontainrecordswhich,fortheirpart,
cancontainsubrecords

arrow button
buttonthatdisplaysatriangle

ascending direction
directionofcallsfromalowernetworkhierarchyleveltoahigherone

ASCII alarm forwarding


applicationforsendingalarminformationfromthenetworkmanagementsystem(NMS)
toathird-partynetworkmanagementcentre(NMC)inASCIIformatusingTCP/IPand
UNIXorLinuxservices

ASCII disk file editor


featurewhichprovidesascreeneditorforcreatingandeditingASCIIfilesviaanMML
sessioninthemobileservicesswitchingcentre(MSC)andhomelocationregister(HLR)

ASCII interface; ASCII file interface


openinterfacethatenablesthetransferofASCIIfilestoexternalsystems

ASCII print-out
insubscribermanagement,afeaturethatmakesitpossibletoexportsubscriptiondatain
ASCIIformat

ASCII report
measurementreportthatisstoredinAmericanStandardCodeforInformation
Interchange(ASCII)format

88

Issue:28

GeneralGlossary

ASN-anchored mobility
inaWiMAXsystem,micro-mobilitythatallowshandoverswheretheanchorpointforthe
mobileterminalintheaccessservicenetwork(ASN)doesnotchange

ASN gateway; ASN-GW


subscriberaccessgatewayforamobileWiMAXnetworkthatprovidesacompletesetof
networkfunctionsthatareneededtoprovideradioaccesstoasubscriber

ASP active; ASPAC


signallingmessagethatanapplicationserverprocess(ASP)sendstoasignalling
gatewaytoindicatethatitisactiveandreadytobeused

ASP active acknowledgement; ASPAC ACK; ASPAC ACK message


signallingmessagethatthesignallinggatewayusestoacknowledgetotheapplication
serverprocess(ASP)thatithasreceivedanASPactivemessage(ASPAC)

ASP down acknowledgement; ASP down ACK


signallingmessagethatthesignallinggatewayusestoacknowledgetotheapplication
serverprocess(ASP)thatithasreceivedanASPdownmessage(DOWN)

ASP down message; DOWN; ASP down


signallingmessagethatanapplicationserverprocess(ASP)sendstoasignalling
gatewaytoindicatethatitisnotreadytoreceivetrafficormaintenancemessages

AS permissions list
list,whichthehomesubscriberservermaintains,oftheoperationsthatanapplication
server(AS)isallowedtoperformintheShinterface

ASP inactive; ASPIA


signallingmessagethatanapplicationserverprocess(ASP)sendstoasignalling
gatewaytoindicatethatitisnolongeractiveandcannotbeused

ASP inactive acknowledgement; ASPIA ACK; ASP inactive ACK


signallingmessagethatthesignallinggatewayusestoacknowledgetotheapplication
serverprocess(ASP)thatithasreceivedanASPinactive(ASPIA)message

ASP up acknowledgement; ASPUP ACK


signallingmessagethatthesignallinggatewayusestoacknowledgetotheapplication
serverprocess(ASP)thatithasreceivedanASPupmessage(ASPUP)

Issue:28

89

GeneralGlossary

ASP up message; ASPUP; ASP up


signallingmessagethatanapplicationserverprocess(ASP)sendstoasignalling
gatewaytoindicatethatitisreadytoreceivetrafficormaintenancemessages

assembler
translatorusedtotranslateaprogramexpressedinanassemblylanguage

assembly language
low-levellanguagewhoseinstructionsareusuallyinone-to-onecorrespondencewith
computerinstructionsandwhichmayprovidefacilitiessuchastheuseof
macroinstructions

assertion consumer service URL; ACSU


URLaddressattheserviceproviderthatanidentityprovidershouldusewhensending
singlesign-onresponses

asset manager; AM
centralisedinventoryformanagingandtrackingvariousassets,suchashardwareunits
orcomponents,softwarelicenses,orotherentitieswhichhavetobetrackedthrough
theirlifecycle

assigned Ethernet interface


EthernetinterfaceofahostunitthathasanassignedlogicalIPaddress

assignment
operationwhichgivesavariableavalue,replacingthepreviousvaluegiventothe
variable

assignment operator
partofassignmentstatementinacommandlanguage

assignment statement
statementwhichassignsavaluetoavariable

assistance data delivery procedure; assistance data delivery


procedurewhichenablestheservingmobilelocationcentre(SMLC)orradionetwork
controller(RNC)tosendpositioning-relatedassistancedatatotheuserequipment

90

Issue:28

GeneralGlossary

assisted GPS; AGPS; A-GPS; network-assisted GPS


globalpositioningsystem(GPS)inwhichthemobilecommunicationsnetworktransmits
theGPSsatellites'track,correctionandtimingdatatotheGPSphoneinordertomake
positioningfasterandtoimprovethepositionaccuracy

assisting GSM service switching function; assisting gsmSSF


GSMserviceswitchingfunction(gsmSSF)whichsendstheAssistRequestInstructions
procedure(ARI)totheGSMservicecontrolfunction(gsmSCF)whenitreceivesan
indicationfromaninitiatinggsmSSFindicatinganassistprocedure

assisting SSF for CAMEL


serviceswitchingfunction(SSF)thatenablestheuseofthemobileservicesswitching
centre'sinternalsignallingrelayfunctiontoprovideCAMELuserinteractionfunctionsfor
roamingsubscribers

AssistRequestInstructions procedure; ARI; Assist Request Instructions


proceduresenttotheservicecontrolfunction(SCF)byaserviceswitchingfunction
(SSF)orbyaspecialisedresourcesfunction(SRF)whentheassistingSSForSRF
receivesanindicationfromaninitiatingSSFcontaininginformationindicatinganassist
orhand-offprocedure

associated alarms
alarmsdirectlyrelatedtoagivenidentifiedtrouble

associated control channel; ACCH; DCCH; dedicated control channel


point-to-point,bidirectionalcontrolchannelthatisassociatedwiththetrafficchannel
(TCH)andthatsupportsbothsignallingandpacketdata

associated LMU
stand-alonelocationmanagementunit(LMU)whichgiveslocationservicesataBTSsite

associated mode of signalling /GB/; associated mode of signaling /US/


modewheremessagesforasignallingrelationinvolvingtwoadjacentsignallingpoints
areconveyedoveradirectlyinterconnectingsignallinglink

associated object
managedobjectthatisassociatedwithaspecificserviceortask

Issue:28

91

GeneralGlossary

associated URI
uniformresourceidentifier(URI)thattheserviceproviderhasallocatedforauser'sown
use

association control service element; ACSE


applicationserviceelementwhichprovidesbasicfacilitiesforthecontrolofan
associationamongcommunicatingapplication-service-objects(ASO)

association identifier
identifierwhichunambiguouslyidentifiesanSCTPassociationwithinthecomputerunit

association set
groupofassociations,usuallyconfiguredtoonenetworkelement

associative memory; CAM; associative storage; content addressed


storage; contents addressable memory; content addressable memory
storagewherehardwarelocatesinformationonthebasisofitscontentratherthanits
location

associative search
searchmadeonthebasisofinformationcontent

assured forwarding PHB group; assured forwarding


differentiatedservicesper-hop-behaviour(PHB)thatprovidesmeansfortheassured
transferofIPpacketsovertheinternet

asymmetric algorithm; asymmetric cryptographic algorithm


cryptographicalgorithmwhichisusedincombinationwithtwodifferentkeystoencrypt
anddecryptdata

asymmetrical through connection


throughconnectionofonlyonedirectionoftransmissiononapotentialboth-ways
throughconnection

asymmetric configuration
configurationinwhichtheIMAgroupisnotrequiredtoconfigurealllinksinboththe
transmitandreceivedirections

92

Issue:28

GeneralGlossary

asymmetric digital subscriber line; ADSL; asymmetric digital subscriber


loop
technologywhichenableshigh-speeddatacommunicationoverexistingtwistedpair
telephonelinesandsupportsadownstreamdatarateof1.5-8Mbit/sandanupstream
datarateof16kbit/s-1Mbit/s

asymmetric encryption
encryptionthatusestwomathematicallyrelatedcryptographickeys:apublickeyanda
privatekey

asymmetric multiprocessing
multiprocessinginwhichprocessorsinthesameordifferentsystemsarededicatedto
specifictasks

asymmetric operation
operationmodeinwhichtheIMAgroupisallowedtocarryATMtrafficoverlinksthatare
notactiveineitherthetransmitorreceivedirection

asynchronous; async
occurrenceoftwoormorephenomenawithoutacommontimingreference

asynchronous announcement
announcementinwhichthespeechpathconnectionisnotalignedwiththebeginningof
aphrase

asynchronous application
applicationwhichcanhandleseveralmessagesatthesametime

asynchronous basic PAD access


accesstoanX.28dial-inportinapacketswitchedpublicdatanetwork(PSPDN)without
orviaoneormoretransitISDNorPSTNnetworks

asynchronous bearer service


bearerservicewherethetransmittingandreceivingdataterminalsmaintaintheir
synchronismonlyovereachsinglecharacter

asynchronous event; push type network event


eventthatisinitiatedbythenetworkwithoutanyactiontakenbytheuserorclient

Issue:28

93

GeneralGlossary

asynchronous interface
entityofalowerlevelthananasynchronousservicedefinitionusedforhandling
exceptionalandcomplicatedasynchronousinterfacecases

asynchronous mapping
SDHmappinginwhichjustificationbitsareused

asynchronous provisioning
provisioningthatisimplementedintheasynchronousmode

asynchronous query; asynchronous querying; asynchronous request


querythatissenttoorfromanetworkelementintheasynchronousmode

asynchronous service; ASYNC


servicewhereareplyisnotexpectedbeforeproceeding

asynchronous service invocation


serviceinvocationinwhichtheclientofthecallimmediatelyreturnsfromtherequest
invocationandwillbenotifiedatalatertimeoftheactualresponse.

asynchronous tandem encoding


transcodingoftheformADPCM-PCM-analoguesignal-PCM-ADPCM

asynchronous time-division multiplexing


multiplexingtechniqueinwhichatransmissioncapabilityisorganisedinundedicated
slotsfilledwithcellswithrespecttoeachapplication'sinstantaneousrealneed.Inthis
case,theterminalequipment(thatis,thecustomerapplication)definestheactual
transmittedbitrate,whateverthisrateis,possiblyvariableduringthecommunication.
Thistechniquecarriesalabelledinterfacestructureoveraframeoraself-delineating
labelledinterface

asynchronous transfer mode; ATM


transfermodeinwhichtheinformationisorganisedintocells:itisasynchronousinthe
sensethattherecurrenceofcellscontaininginformationfromanindividualuserisnot
necessarilyperiodic

Ater codec
codecthatcanbeusedontheAterinterface

94

Issue:28

GeneralGlossary

Ater interface
interfacebetweenthebasestationcontroller(BSC)andtheremotetranscoder

Ater PCM
PCMcircuitthatconnectsthebasestationcontrollerandtranscoderintheGSMsystem
radioaccessnetwork

ATM adaptation layer; AAL


layerwhichenhancestheserviceprovidedbytheATMlayertosupportfunctions
requiredbythenexthigherlayer

ATM adaptation layer service data unit; AAL-SDU


servicedataunitthatispresentedtotheATMadaptationlayeratitsserviceinterfaceor
serviceaccesspoint,andthatisprocessedontheATMadaptationlayer

ATM adaptation layer type 0; AAL0


ATMadaptationlayerthatreferstorawATMcellswithapayloadof48byteswithouta
specialfield

ATM adaptation layer type 1; AAL1


ATMadaptationlayerthatsupportsconstantbitrate(CBR),connection-oriented,timedependentdatatraffic

ATM adaptation layer type 2; AAL2; AAL type 2


ATMadaptationlayerthatsupportsvariablebitrate(VBR),connection-oriented,timedependentdatatraffic

ATM adaptation layer type 3/4; AAL3/4


ATMadaptationlayerthatsuppliessequencinganderrordetectionsupporttovariablebit
rate(VBR),time-independentdatatraffic.Trafficcanbebothconnection-orientedand
connectionless

ATM adaptation layer type 5; AAL5; SEAL; simple and efficient adaptation
layer
ATMadaptationlayerthatenhancestheserviceprovidedbytheATMlayerbysupporting
variablebitrate(VBR),connection-oriented,time-independentdatatraffic

ATMARP
addressresolutionprotocol(ARP)formappingIPaddressestoATMaddresses

Issue:28

95

GeneralGlossary

ATM backbone; ATM BB


backbonethatusestechnologybasedontransferringdatainpacketsofafixedsize

ATM bearer service


partoftelecommunicationsserviceinwhichtheswitchingandstatisticalmultiplexingis
doneattheasynchronoustransfermode(ATM)levelandthatprovidesthecapabilityfor
thetransmissionofsignalsbetweenuser-networkinterfaces

ATM cell; cell


blockoffixedlengthwhichisidentifiedbyalabelattheATMlayeroftheB-ISDNprotocol
referencemodel

ATM cell counter; cell counter


counterwhichcanbeusedtomeasureanytypeofATMcellevents

ATM cell flow; cell flow


dataflowthatconsistsofATMcells

ATM cell header; header


protocolcontrolinformationlocatedatthebeginningofanATMcell

ATM cell stream; cell stream


alldatatransmittedthroughacommunicationslineinasinglereadorwriteoperationin
theformofcellswhicharriveatknownintervals

ATM cell trailer; trailer


protocolcontrolinformationlocatedattheendofanATMcellpayload

ATM circuit
telecommunicationcircuitthatprovidesanend-to-endATMconnection

ATM connection
connectionconsistingofATMlayerlinkswhichareinterconnectedinordertoprovidean
end-to-endtransfercapabilitytoaccesspoints

96

Issue:28

GeneralGlossary

ATM connection admission control; ATM CAC


connectionadmissioncontrolwhichprovidesasetofactionsduringthecall
establishmentphaseorcallre-negotiationphaseinordertoestablishwhetheravirtual
channelconnection(VCC)oravirtualpathconnection(VPC)canbeacceptedor
rejectedorwhetherarequestforre-allocationcanbeaccommodated

ATM connection control; CC; connection control


functionthatkeepstrackofconnectionresourcesandbasedonthosehandlesthe
operationsrelatedtodifferentkindsofcross-connections

ATM cross-connect; AXC; ATM cross connect; AXC node


transmissionnodethatprovidessemi-permanentvirtualpathconnections(VPC)and
semi-permanentvirtualchannelconnections(VCC)accordingtoanalterablememory
map

ATM cross-connection; ATM CC; AXC


ATMconnectionwhichforpoint-to-pointconnectionsrepresentsthecross-connect
relationshipbetweentwovirtualpathlink(VPL)orvirtualchannellink(VCL)termination
points,andformultipointconnectionsthecross-connectrelationshipbetweenan
instanceoftheVPLorVCLterminationpointandaninstanceofthemultipointbridge

ATM cross-connect unit; AXU


masterunitoftheATMcross-connect(AXC)thatperformsthemainATMfunctionof
communicatingwiththebasetransceiverstation(BTS),connectstootherBTSsandto
theradionetworkcontroller(RNC),andcontrolstheNSNAXCnode

ATM edge switch


ATMswitchthatislocatedattheedgeofthecarriernetworktoaggregateATMtraffic
frommultiplecustomers

ATM end system address; AESA; ATM address


numberthatisusedtouniquelyidentifyanATMendpointfromanyotherendpointina
globalnetwork

ATM exchange terminal; AET


exchangeterminationusedintheATMsystem

ATM frame
datagramofvariablelengththatcanbetransportedoverATMinfrastructureutilising
high-speedSONETorSDHtransmissionfacilities

Issue:28

97

GeneralGlossary

ATM hub
hubthatprovidesATMoverSONET,SDH,orPDHinterfacesforcommunicationswith
thenetwork

ATM interface
interfaceinanATMnetworkthatcanbeeitherauser-networkinterface(UNI)ora
networknodeinterface(NNI)andthathasauniqueidentificationcode

ATM interface identifier


identifierthatidentifiestheexternalATMinterfacethatisusedfortheVPLorVCL
terminationpoint

ATM interface measurement


trafficmeasurementinwhichtrafficintensityandpacketlossinanATMinterfaceare
measured

ATM layer
layerintheATMreferencemodelthatprovidesaninterfacebetweentheATMadaptation
layerandthephysicallayer

ATM layer connection


associationestablishedbytheATMlayertosupportcommunicationbetweentwoor
moreATMserviceusers

ATM layer OAM handling; ATM layer OAM


Operations,AdministrationsandMaintenance(OAM)whichcoversfaultmanagement
andperformancemonitoringrelatedfunctionsinvirtualpathandvirtualchannellevels

ATM layer performance measurement


featureforcollectinginformationaboutpossibleoverloadinthenetworkelementandthe
amountoftrafficthroughtheswitchingfabric,andforprovidinginformationaboutbuffer
managementintheATMlayer

ATM layer traffic control; ATM traffic control


setofactionsthataimstomeetthenetworkperformanceobjectivesandnegotiated
qualityofservicecommitmentsandtoavoidcongestedconditionsinanATMnetwork

98

Issue:28

GeneralGlossary

ATM link
linkthatprovidesforthecapabilityoftransferringinformationtransparently,and
representstheassociationbetweentwocontiguousconnectingpointsorbetweenan
endpointanditscontiguousconnectingpoint

ATM management; ATMM


processthatrunsonanATMswitchthatcontrolsvirtualchannelidentifier(VCI)
translationandrateenforcement

ATM messaging
messaginginwhichthepostofficesendsmessagestoothercomputersviaoneormore
centreDMXcomputersthatareabletoroutemessagesonbehalfofothercomputers

ATM multicasting
multicastinginwhichasingleATMswitchoranATMnetworkcopiesaninputATMcell
streamanddeliversittomultipleoutputATMlinkswhichmayormaynotbeonseparate
physicalinterfaces

ATM multiplexing
multiplexingthatenablestheefficientuseofATMswitchingresourcesfornetwork
interfaceunits,signalprocessingunits,andcomputerunitswithabandwidthrequirement
oflessthan155megabitspersecond

ATM network
networkinwhichhigh-load,high-speed,fixed-sizepacketswitchingwithdynamic
bandwidthallocationisusedaccordingtotheasynchronoustransfermode(ATM)
standard

ATM node
ATMswitchorcross-connectwhichrealisesthedatatransmissioninanATMnetwork

ATM OAM
Operations,AdministrationsandMaintenance(OAM)forperformancemonitoring,defect
andfailuredetection,systemprotection,defectinformationandfaultlocalisationinan
ATMnetwork

ATM over Ethernet


featurethatenablestheuseofEthernetasaphysicaltransmissionlayerforthetransfer
ofATMcells

Issue:28

99

GeneralGlossary

ATM over fractional E1/JT1


featurethatsupportstheinsertionofATMcellsintofullorpartialE1/JT1channels

ATM plan
planfilewhichcontainstheATMlayerparameterswhichanetworkelementrequires

ATM recharge; ATM recharge service


rechargewheretheprepaidsubscribercanrechargetheprepaidaccountviaan
automatedtellermachine(ATM)usingadebitorcreditcard

ATM reference model; ATM protocol reference model


logicalmodelthatdescribesthefunctionsthatATMsupportsandiscomposedoffour
layersandthreeplanes

ATM resource handling


resourcehandlingthatconsistsofthereservation,modification,andreleaseofATM
resources

ATM resource management


groupofresourcemanagementoperationsforcreatingandhandlingIMA(inverse
multiplexingforATM)groups,endpoints,endpointgroups,permanentvirtual
connections,ATMinterfaces,accessprofilesassociatedwiththeinterfaces,and
terminationpointsonvirtualpathandvirtualchannellevel

ATM route
routethatconsistsofoneormorehuntedvirtualpathsorvirtualchannelsthatconnect
twoATMexchangesandthatusethesamesignallingprotocolorareassociatedwiththe
sameB-ISDNuser(subscribernumber)

ATM route load measurement


measurementthatprovidesinformationontheATMadaptationlayertype2capacity
allocationsatATMroutelevel

ATM routing
routinginwhichfreeresourcesofanATMnetworkarelocatedinordertodirecttheuser
planetraffictothedesireddestination

100

Issue:28

GeneralGlossary

ATM services
setofservicesthatprovidesamechanismtoensurethatthequalityofserviceremains
ashighaspossiblewhiletheATMnetworkisused,andtoallocatethebandwidthofATM
connectionsaccordingtotheapplicationneeds

ATM statistical
modeoftheasynchronoustransfermodeinwhichtheinformationtransfercapability
specifiedforagivenservicethatisprovidedtotheuserthroughoutacallisexpressedin
termsofvaluesofparameterssuchasmean,peak,andstandarddeviation

ATM switch; asynchronous transfer mode switch; ATM switching unit


ATMfunctionalunitthatoperateswithcell-basedsignalsandoverstandardlineratesfor
bothinputandoutput,andpassesthecellsreceivedontheinputtotheoutput

ATM switching; cell switching; ATM cell switching


switchingofATMcellsbetweenanyinputandoutputportsoftheATMswitchingfabric

ATM switching fabric supervision


featurewhichisusedtosupervisetheequipmentfunctionsintheATMswitchingfabric

ATM switching platform; ASP


switchingplatformthatprovidesswitchingofATMcellswithflexiblebandwidthallocation
fordifferenttypesofusertraffic

ATM termination
ephemeralterminationthatlogicallyrepresentsanATMnetworkconnection

ATM test cell; test cell


ATMcellthatisusedfortestingconnectionsbetweenthefunctionalunitsofanATMbasednetworkelement

ATM test loop; ATM loop


testloopwhichverifiesthesignalpathintheATMconnections

ATM traffic descriptor


genericlistoftrafficparametersthatcanbeusedtocapturetheintrinsictraffic
characteristicsofanATMconnection

Issue:28

101

GeneralGlossary

ATM traffic management


trafficmanagementthatconsistsoftrafficshaping,policing,andbuffermanagementand
schedulingfunctionsinanATMnetwork

ATM transfer capability; ATC


setofATMlayerparametersandproceduresthatisintendedtosupportanATMlayer
servicemodelandarangeofassociatedqualityofservice(QoS)classes

ATM transport layer


layer4withintheATMreferencemodelmodellingthevirtualpath(VP)andvirtual
channel(VC)connections

ATM user-network interface protocol; ATM UNI signalling protocol /BR/;


ATM UNI signaling protocol /US/; ATM UNI protocol
protocolthatisusedtoestablishandcontrolswitchedvirtualconnections(SVC)through
anATMnetwork

ATM VCC bundle; VCC bundle


groupofvirtualchannelconnections(VCC)thatareconnectedtothesameendpoints
buthavedifferentqualityofservicecharacteristics

ATM virtual channel connection measurement


measurementthatprovidesinformationontheamountofATMcelltrafficiningressand
egressdirectionsattheATMvirtualchannellevel

ATM virtual channel separation


virtualchannelseparationthatisusedforATMtrafficmanagement

ATM virtual path connection measurement


measurementthatprovidesinformationontheamountofATMcelltrafficiningressand
egressdirectionsattheATMvirtualpathlevel

atomic database transaction; atomic transaction


databasetransactionwhichisguaranteedtobecompletedsuccessfullyornotatall

atomicity
statewhereaneventiseitherfinishedornotexecutedatall

102

Issue:28

GeneralGlossary

atomicity, consistency, isolation, and durability; ACID


setofpropertiesforrelatedoperationssuchthattheoperationsareeitherallperformed,
ornoneofthemareperformed(atomicity);thattheeffectsoftheoperationsare
performedaccurately,correctly,andwithvalidity,withrespecttoapplicationsemantics
(consistency);thatpartialresultsofthesetofoperationsarenotaccessible,exceptby
operationsoftheset(isolation);andthatnoneoftheeffectsoftheoperationsarealtered
byanysortoffailure(durability)

atomic plan
configurationplanwhichdetailschangestotheunderlyingconfigurationsothatallthe
plannedchangesshouldpassdynamicvalidationbeforetheycanbeimplemented

atomic request
servicerequestwhichincludesasharedfilesystemcommandorprogramfunctionto
completetheexecutionimmediately,andwhichdoesnotaffectworkinotherresources
oftheworkingunit

A-TRAU
protocolwhichtogetherwiththeV.110protocolprovidessupportforrateadapted
transparentandnon-transparentdatarates(14.4kbit/sand9.6kbit/srespectively)inthe
basestationcontroller(BSC)andinthemobileservicesswitchingcentre's(MSC)
interworkingfunction(IWF)interface

A-TRAU'
protocolthatprovidessupportforrate-adaptedtransparentandnon-transparentdata
rates(28.8kbit/s,33.6kbit/s)intheATMmoduleandinthemobileservicesswitching
centre's(MSC)interworkingfunction(IWF)interface

attached group; joined group; active group


talkgroupinpushtotalkcorenetworkthatauserisamemberofandinwhichtheuser
iscurrentlyattached

attached IMSI; attached international mobile subscriber identity


entryinthehomelocationregister'ssubscriberdatabasecontainingtheinternational
mobilesubscriberidentity(IMSI)ofthenewSIMcard

attachment unit interface; AUI


interfacebetweenamediaattachmentunit(MAU)andanetworkinterfacecard(NIC)

Issue:28

103

GeneralGlossary

attendant; operator
personwhooffersansweringandswitchingservices

attendant group; operator group


groupofattendantswhichcanbefreelydefined

attendant incall identifier; operator incall identifier


operatornumber,consistingofoneortwodigits,thatmembersofcentrexgroupcanuse
whencallingtothecentrexgroupattendant

attendant incall number; operator incall number


servicenumbercorrespondingtotheattendantincallidentifier

attendant position subscriber number; operator position subscriber


number
subscribernumberofthesubscriberlinetowhichtheattendantisattached

attendant services platform; ASP; operator system


systemwhereattendantsofferansweringandswitchingservicestosubscribers

attenuation
ratiooftheoutputtotheinputvaluesofquantitiesofthesamekindinadeviceorsystem
whenlessthanunity

attenuation distortion
departurefromuniformamplificationorattenuationoverthefrequencyrangerequiredfor
transmission

attribute
metadatathatdescribesanobjectorobjectclass

attribute analysis
analysisofoneormoreattributes,eachofwhichcomprisesonecondition

attribute directed routing; ADR


routingthatallowstheusertosetlogicalconditionstoadestinationortosubdestinations
includedinadestination

104

Issue:28

GeneralGlossary

attribute group
setofattributesthatiscreatedtoenablemanagedobjectstoinheritattributes

attribute identifier
identifierusedtodistinguishanattributeofamanagedobjectclassfromallother
attributesdefinedforthatobjectclass

attribute of managed object


informationconcerningamanagedobjectusedtodescribe(eitherinpartorinwhole)
thatmanagedobject

attribute specification
specificationwhichdescribesthename,value,andotherpropertiesofanattribute

attribute type
collectionofvalueswhichaninstanceofthattypemayhave,andacollectionof
operationswhichmaybeperformedonthosevalues

attribute validation
procedureforcheckingthattheattributesandattributevaluesthatareusedareallowed

attribute value
particularinstanceoftheclassofinformationindicatedbyanattributetype

attribute value assertion; AVA


assertionthataparticularattributeofamanagedobjecthasaparticularvalue,thatisa
positionthatmaybetrue,false,orundefined,concerningthevalues(orperhapsonlythe
distinguishedvalues)ofanentry

attribute-value pair; AVP; AV pair


genericpairofvaluesthatconsistsofanattributeheaderandthecorrespondingvalue

AU-4 alarm indication signal; AU-4 AIS


STM-Nsignalatthenetworknodeinterface(NNI)inwhichtheentirecapacityofan
administrativeunit4AU-4issettologic"1"

Issue:28

105

GeneralGlossary

AUC data file


fileusedasatemporarystoragefortheauthenticationcentre(AUC)subscriberstobe
transferredfromthesourcehomelocationregister(HLR)tothetargetHLR

AUC encryption
optionalfeaturethatprotectstheconfidentialityandintegrityofthesubscriber
authenticationkeys(Ki)usingdataencryptiontechniqueswhenthekeysaretransferred
fromthenetworkelementtotheauthenticationcentre(AUC)andstoredintheAUC

audible tone
informationtonesentbacktothecallingtelephonesubscriber

audio codec; AC
codecthatisusedintheprovisioningofbidirectionalaudioservicesovernetworks

audio conference
teleconferenceinwhichonlyanaudioconnectionisusedbetweentheparticipants

audio performance
characteristicsindicatingaudioquality,suchasdistortionandnoise

audio response; AR
informationgiventoacallerinvocalform

audio segment
referencetooneormoreaudiorecordings

audio stream
mediastreamthatconsistsofaudibleinformation

audio unit; ARU; audio response unit


devicethatproducesvocalresponses

audit descriptor
descriptorthatspecifiestheinformationthatneedstobeauditedandthelistof
descriptorsandindividualpropertiesthatneedtobereturned

106

Issue:28

GeneralGlossary

augmented Backus-Naur form; ABNF; augmented BNF


modifiedversionofBackus-Naurform,usedamonginternetspecifications

authenticated originator's PoC address


PoCaddressoftheoriginatingPoCclientthathasbeenauthenticatedbytheSIP/IPcore
network

authentication
corroborationthatthepeerentityordatasourceistheoneitclaimstobe

authentication
confirmationoftheclaimedidentityofauser,orofamessagenothavingchangedafterit
hasbeensent

authentication adapter
softwarecomponentofthedeliveryserverwhichintegratesthedeliveryserverto
authentication,authorisation,andsubscribersystems

authentication and key agreement; AKA


procedurewhichauthenticatestheuserandestablishesanewpairofcipherand
integritykeysbetweentheservingnetworkvisitorlocationregister(SN/VLR)andthe
userequipment

authentication centre /GB/; authentication center /US/; AUC; AuC; AR; AC;
authentication register
networkelementofthepubliclandmobilenetwork(PLMN)whichcontainssubscriber
relatedinformationforauthenticationpurposes

authentication data; authentication information


setofdatathatisusedintheauthenticationtoestablishthevalidityofanentity'sclaimed
identity

authentication form
templatewhichisusedtoasktheend-user'susernameandpassword

authentication header; AH; IP authentication header


headerinanIPpacketthatprovidesconnectionless,strongintegrityanddataorigin
authenticationforIPdatagrams,andanoptionalantireplyservice

Issue:28

107

GeneralGlossary

authentication in the HSS


featurewhichprovidestheauthenticationfunctionsthatthehomesubscriberserver
(HSS)requires

authentication management field; AMF


16-bitfieldthatisusedinauthenticationandkeyagreementtoindicatethecryptographic
algorithmandkeyusedbythecurrentauthenticationsystem

authentication mode
parameterthatindicatesthetypeofauthenticationthatasubscriberuses

authentication proxy; AP; HTTP authentication proxy


HTTPproxythattakestheroleofanetworkapplicationfunctionfortheuserequipment
byhandlingthetransportlayersecurityrelationwiththeuserequipmentandrelievingthe
applicationserverofthistask

authentication quintuplet; quintuplet; authentication quintet; quintet


authenticationvectorwhichconsistsofarandomchallenge(RAND),anexpecteduser
response(XRES),acipherkey(CK),anintegritykey(IK),andanauthenticationtoken
(AUTN)

authentication repetition rate


parameterwhichtellshowmanytimestheeventinquestionhappensbeforean
authenticationneedstobeperformed

authentication server; AS
serverwhichprovidesauthenticationservicestoothersystemsinanetwork

authentication server manager; AS manager


applicationusedtoconfigureandmanageanauthenticationserver(AS)remotely

authentication service
informationsecurityserviceforprovidingauthentication

authentication synchronisation information; AUTS


informationsentbythemobilestation(MS)tothenetworkwhenavectorusedforthe
authenticationisfoundtobetooold

108

Issue:28

GeneralGlossary

authentication token; AUTN


informationthatisusedtoauthenticateitssendercontainingtheclaimantidentityand
ticket,aswellassignedandencryptedsecretkeyexchangemessagesconveyinga
secretkeytobeusedinfuturecryptographicoperations

authentication trap
trapmessagethatthesystemgeneratesuponahostauthorisationfailure

authentication triplet; triplet


authenticationvectorwhichconsistsofarandomnumber(RAND)whichissenttothe
mobilestation,asignedresponse(SRES)asananswertoit,andacipheringkey(Kc)
fortheencryptionofthesignalling

authentication vector; AV
setofparametersusedforauthenticationandkeyagreement

authenticator
authenticationserver,storingtheuser'sauthentication,authorisationandaccount
information

authenticator ASN gateway; AuthGW


ASNgatewaythatperformsauthenticationtransactions

authorisation /GB/; authorization /US/


grantingofrightstotheuserfortheuseofaresource,forexampleasystemor
information

authorisation decision message /GB/; authorization decision message


/US/; authorisation decision /GB/; authorization decision /US/
decisionmessagewhichthepolicydecisionfunctionusestosendtothegatewayGPRS
supportnode(GGSN)theIPqualityofservice(QoS)parametersforeachclienthandle

authorisation handler /GB/; authorization handler /US/


logicalcomponentofthedeliveryserverthatisresponsibleforauthenticationand
authorisation,andprovidesanapplicationprogramminginterface(API)foruserdatabase
integration

authorisation header /GB/; authorization header /US/


headerthatcontainstheauthenticationcredentialsofauseragent

Issue:28

109

GeneralGlossary

authorisation interface /GB/; authorization interface /US/


interfacethatisusedtotransferauthorisationinformationwhenauthorisationis
implementedorperformedoutsidethecurrentsystem

authorisation key /GB/; authorization key /US/; AK


cryptographickeythattheauthenticatorandmobilesubscriberstationderivefromthe
pairwisemasterkeyandthatthemobilesubscriberstationandbasetransceiverstation
usetogenerateencryptionandauthenticationkeys

authorisation proxy /GB/; authorization proxy /US/; authorisation proxy


server; authorization proxy server /US/
proxythatauthenticatesandauthorisessubscribersthatareloggingintoaservice,
sendslogoutinformationtothebackend,andhandlesforcedlogoutrequeststhatthe
backendinitiates

authorisation report message /GB/; authorization report message /US/;


authorisation report; authorization report /US/
reportmessagewhichthegatewayGPRSsupportnode(GGSN)usestoinformthe
policydecisionfunctionabouttheresultofapplyingtheauthorisationdecisions

authorisation request message /GB/; authorization request message /US/;


authorisation request; authorization request /US/
requestmessagewhichthegatewayGPRSsupportnode(GGSN)usestorequestfrom
thepolicydecisionfunctionthepolicyinformationnecessaryfortheauthorisationofthe
IPflows

authorisation requirement /GB/; authorization requirement /US/


minimumauthoritytheusermusthavetogetthecommandintoexecutionphase

authorisation service /GB/; authorisation service /US/


partoftheusermanagementinNMSwhichallowsthesystemadministratortodefineon
thelevelofnetworkmanagementspecificobjectswhatoperationsausercanperform
withinanapplication

authorisation type /GB/; authorization type /US


authorisationinformationwhichindicateswhethertheoperationtobeauthorisedisthe
registrationorderegistrationofauser

110

Issue:28

GeneralGlossary

authorised networks list /GB/; authorized networks list /US/; ANE list
listthatcontainsasetofpubliclandmobilenetwork(PLMN)identifiersthatareusedto
selectthepermittedcellsfromalltheadjacentcellsofaservingcell

authorised subscriber /GB/; authorized subscriber /US/


subscriberwhohasanexclusivesubscriptiontoservices,theuseofwhichisregulated
bylaws

authority
righttoperformorrejectcertainactionsorfunctions

authority and format identifier; AFI


partoftheinitialdomainpart(IDP)oftheNSAPaddressindicatingtheauthority
responsibleforthenumberfollowingit,suchasX.121orE.164,andtheformatofthe
domain-specificpart(DSP)

authority combination
authorityvalueformedfromaterminalprofileandauserprofile

authority domain
setofmanagedobjectsmanagedbyamanagingapplicationinthecontextofaparticular
authorityrelationshipset

authority group
commandgroupthatisformedbasedontheeffectsthecommandshaveonthesystem

authority management
intheMMIsystem,managementofthecommandauthorityrequirementsandthe
authorityvaluesoftheuseridentitiesandterminalprofiles

authority relationship
relationshipbetweenamanagingapplicationandamanagedobject,inwhichthe
managingapplicationhastheauthoritytomanagethemanagedobject

authority relationship set


setofauthorityrelationships,eachauthorityrelationshipofthesetbeingdefinedfrom
somecommonstandpointofallocatedmanagementresponsibility

Issue:28

111

GeneralGlossary

authority requirement
minimumrequirementofasessionauthorityinthespecificcommandclasssothatan
MMLcommandcanenterexecutionphase

authority revocation list; ARL


certificaterevocationlistofaparticularcertificationauthoritythatcontainscertificates
thathavebeenrevokedorsuspended

authority system
systemforinformationsecurity,adoptedtopreventunauthorisedaccesstoasystem

authorization server; AuS


inapushtotalkcallprocessor,aserverinthemanagementplanewhichhandlesand
maintainsthestaticend-userdata

auto
inconnectionmanagement,aconnectionwhichcanbemodifiedfromapoint-to-pointto
apoint-to-multipointconnectionbyaddingabranch

auto-address configuration
processinwhichahostautomaticallyconfiguresitselfwithanIPv6addressthatis
derivedfromprefixesthatlocalroutersadvertise

autoconfiguration
networklevelfeaturethatprovidesautomatedcommissioningandconfigurationofbase
transceiverstationsandautomatesthecreationofatransmissioncircuitbetweenabase
stationcontrollerandbasetransceiverstation

autoconfiguration pool; AC pool


blockoftimeslotsusedforautoconfiguration,whicharedefinedinthebasestation
controllerandroutedthroughthetransmissionnetworkasoneblock

autoconfiguration report
reportthattheusercanaccessusingNetActafterautoconfigurationandthatallowsthe
usertoviewthecurrentstatusesofthebasetransceiverstationsinthenetworkandin
theplannedconfiguration

112

Issue:28

GeneralGlossary

autoconfiguration server; ACS; configuration server


serverthatprovidesconnectivitybetweenthecustomerpremisesequipment(CPE)and
operationalsupportsystemtoenableautoconfigurationandadministrationofthe
customer-premisesequipment

autoconfiguration wizard
NetActapplicationthatcontrolstheworkflowofautoconfigurationandautomated
commissioning

autoconnectivity; autoconnection
functionthatisusedfortheautomaticsetupofIPconnectionsandunambiguousnetwork
elementidentificationinaremotecommissioning

autodetect
autonegotiationprocessinwhichaFastEthernetinterfacenegotiatesitsspeedand
duplexmodebeforeitestablishesalinkwiththefarend

autodialler; auto-dial device


devicethatautomaticallydialsoneofasetofpreviouslyrecordedsubscribernumbers
whentheappropriatebuttonispushed

automated adjacency management


adjacencymanagementthatincludesfunctionstocreateanddeleteadjacenciesbased
onmobilemeasurementreportscollectedtothenetworkmanagementsystem

automated planning enhancement; APE


featurethatisusedtomeasurethefulloperatorfrequencyband

automated radio network tuning; ARNT


radionetworktuninginwhichtheGSMnetworkadjacencyandfrequencyplansare
optimisedbasedpurelyonmeasuredinformation

automated RNS split


featurethatisusedtotriggerthenetworkelementconfigurationupload,download,and
activationoperationsbyusingtheradioaccessconfiguratortoolofNetAct

automatic acknowledgement; auto-ack


functionofalarmfilteringwhichallowscertainalarmstobedefinedsothattheyare
automaticallyacknowledgedastheycomeintotheNMS

Issue:28

113

GeneralGlossary

automatic alarm call service; alarm call service


servicewhichallowsausertoreceiveanalarmcallatatimeortimesspecifiedbythe
userinadvance

automatic announcement equipment; announcement device


equipmentwhichsendsshortannouncementstosubscribers

automatic answer override


answermodeoverridesettingthatenablesthecallingpartytomakeapolitecall,in
whichtheterminalofthecalledpartyisforcedtoringbutthesessionstartsonlyifthe
calledpartymanuallyacceptstheinvitation

automatic call distribution; ACD


servicewhichprovidesautomaticdistributionofincomingcallstoacentralisedgroupof
users

automatic congestion control; ACC


partofloadsupervisionwhichisusedtolimitthetraffictoanexchangeincaseof
congestion

automatic definition of neighbouring cells


featurethatautomaticallyupdateshandoveradjacencyliststhatareoptimisedbasedon
measurements,withouttheneedforaradionetworkplanningprocess

automatic device detection support


featurethatenablestheterminalmanagementservertoobtaininformationaboutthe
subscriber'sfirstlocationupdatingandaboutchangesintheinternationalmobile
equipmentidentity(IMEI)andinternationalmobilestationequipmentidentityand
softwareversionnumber(IMEISV)

automatic exchange; automatic switching exchange


exchangeinwhichtheswitchingoperationsareperformedbyautomaticequipment

automatic facsimile group 3 service


automaticfaxservicewherethereceiverhasaseparatemobilesubscriberinternational
ISDNnumber(MSISDN)forthefaxserviceandallcallstothisnumberarepurely
facsimilecalls

114

Issue:28

GeneralGlossary

automatic fading margin measurement; AFMM


fadingmarginmeasurementwhichisexecutedduringradiorelaycommissioningtoverify
thequalityofradiolinknetworkplanning,andwhichiscarriedoutwithouttheaidofany
additionaltoolsormeasurementequipment

automatic identification of outward dialing /US/; AIOD; automatic identified


outward dialing /US/
featurewhichprovidesidentificationofthecallinglineforautomaticmessageaccounting
(AMA)recordingpurposesforallcallsdirectedtothepublicnetwork

automatic IMSI-Ki replacement


enhancedautomaticIMSIreplacementwhichremovestheoldsubscriberentryalsofrom
theauthenticationcentre(AUC)

automatic IMSI replacement


operationinwhichtheoldIMSIandSIMareautomaticallydisabledwhenasubscriber
receivesanewSIMcard

automatic laser shutdown; ALS


functionofanopticallinesystem,whichautomaticallyswitchesoffthetransmitterofa
regeneratorsectionincaseofacablebreakinthissection

automatic level control; ALC; automatic speech level control


controlsystemthatadjuststheincomingsignaltoapredeterminedlevel

automatic level controller; ALC


signalprocessingfunctionthatislocatedinthedigitaltransmissionpathandthat
automaticallyadjuststhelevelofasignaltowardsapredeterminedvalue

automatic licence assignment /GB/ ; automatic license assignment /US/


processinwhichafeaturetriggersalicencerequestthatresultsinanautonomous
licencefilecreationanddownload

automatic location identification; ALI


featurethatprovidesemergencyservicespersonnelwiththelocationofamobile
terminaluserduringanemergencycall

automatic message
messagethatasystemsendsautomaticallyincertainconditions

Issue:28

115

GeneralGlossary

automatic neighbour relation /GB/ ; automatic neighbor relation /US/; ANR


evolvednodeBfunctionforidentifyingtheneighbouringevolvednodeBs,inwhichan
evolvednodeBaskstheuserequipmenttoreadtheglobalcellidentitiesfromthe
broadcastinformationofotherevolvednodeBs

automatic number identification; ANI


signallingsystemNo.7featureinwhichaseriesofdigits,eitheranalogueordigital,are
includedinthecalltoidentifythecallingpartynumber

automatic OMS resiliency; OMS resiliency


featurethatsupportsconstantnetworkoperabilityincaseswheretheoperationand
managementserver(OMS)failsorwhentheconnectionbetweenanOMSandanetwork
elementisinterruptedduetoproblemsinthetransmissionnetwork

automatic overload control of statistics


featurewhichenablestheoperatortoswitchoffsomemeasurementsunderhighload
conditions

automatic picocell planning; APP


servicethatisusedincommissioningNSNInSitebasetransceiverstations

automatic protection switching; APS


switchingwhichperformstheprotectionofaconnectionorapartofitautomatically

automatic repeat request; ARQ; automatic request for repetition; automatic


retransmission request; automatic request for retransmission
procedurethatallowsthereceivingdevicetodetecterrorsandrequestretransmissions

automatic reply; auto-reply; automatic response; auto-answer


automaticmessagethataserviceorsystemsendsasanacknowledgementtoa
messageithasreceived

automatic rerouting; ARR


routingfacilitywhichenablestheconnectionofcallattemptsthatencountercongestion
duringtheinitialcallset-upphase

automatic ringback when free


servicewhichenablesauserwhohascalledabusysubscribertowaitonhookforthe
connectiontobeestablishedwithouthavingtoredialthenumber

116

Issue:28

GeneralGlossary

automatic switching equipment


equipmentinwhichswitchingoperationsareperformedbyelectricallycontrolled
apparatus

automatic switching system


systeminwhichtheswitchingoperationsareperformedbyelectricallycontrolleddevices

automatic terminal detection and configuration


featureusedintheterminalmanagementservertodetectautomaticallytheterminaltype
associatedwitheachMSISDNintheoperator'snetwork,andtoprovideautomatic
configurationbasedonthereceivedinformationsothattheappropriatedefaultsettings
aresenttoterminalsintheformtheyareinthenetwork

automatic TMSI reallocation


TMSIreallocationinwhichtheuseofthetemporarymobilesubscriberidentity(TMSI)is
activatedinthenetworkandthenetworkautomaticallyallocatesthetemporarymobile
subscriberidentitytothemobileterminal

automatic transfer mode; automatic mode


filetransfermodeinwhichdownloadedfileswithknowntextfileextensionsaretreated
asASCIIfilesandallothersasbinaryfiles

automatic transmit power control; ATPC; ALCQ; adaptive level control with
quality measurement
featurethatenablestheradiotransmittertoincreaseordecreasethetransmitpower
automaticallysothattheradiotransmitsattheminimumpowerneededtomaintaingood
transmissionquality

automatic view upload


functionthatisusedtotransferviewsfromregionalsystems,suchasaregionalcluster,
totheglobalcluster

automaton lifetime
timefromtheinitialisationofachargingautomatontothemomentwhenthebilling
informationissent

autonegotiation
protocolthroughwhichtwoconnecteddevicescancommunicatecommoncapabilities,
forexamplespeedandduplexmode,toeachother

Issue:28

117

GeneralGlossary

autonomous system; AS; RD; routing domain


setofroutersandnetworksunderasingleadministrativeauthorityusingacommon
interiorgatewayprotocolforroutingpackets

autonomous system border router; ASBR


routerinanopenshortestpathfirstareawhichdistributesroutesoriginatingfromsome
otherroutingprotocolthanopenshortestpathfirst

autoprovisioning
processofmakingtheresourceautomaticallyavailablefortheuser

autoprovisioning interface
interfacethatmakesautoprovisioningpossiblefortheusers

autoprovisioning licence /GB/; autoprovisioning license /US/


licencethatdefinesthemaximumnumberofsubscriptionsforaspecificserviceinthe
profilemanagerdatabase

autoprovisioning module; APR; autoprovisioning node


modulethatprovidestheadaptationlayertowardstheoperator'sexistingsubscriber
databases

autoprovisioning proxy; autoprovisioning proxy server


proxythatprovidesautoprovisioningforPoCsubscribers

autostarter
nativeexecutablethatlaunchesandmonitorssystemcomponents

auxiliary keyword; auxiliary password


keywordusedinDX220withoutgoingcallbarringservicewhentheprocedurefor
changingthekeywordserviceisnotprovidedforauser

auxiliary object; grouping object


viewobjectusedtogroupmanagedobjectsaccordingtotheobjecttypeornetworkarea
toenablemoreefficientnetworkmanagement

118

Issue:28

GeneralGlossary

auxiliary radio network; auxiliary network


partoftheneighbouringmobileservicesswitchingcentre'sradionetworkthatassistsin
locatingamobileterminalaccurately

auxiliary signalling index /GB/; auxiliary signaling index /US/; ASI


partofthecallset-upmessagewhichisusedforhandlingclearcodes

auxiliary speech
bearercapabilityusedforauxiliarytelephony

auxiliary telephony
solebasicserviceforthealternatelinewhichisotherwiseequivalenttonormaltelephony
service

auxiliary TLLI; auxiliary temporary logical link identity


temporarylogicallinkidentityselectedbytheservingGPRSsupportnode(SGSN)and
usedbytheSGSNandmobilestation(MS)tounambiguouslyidentifyananonymous
accessmobilitymanagement(MM)andPDPcontext

AUXP signal
unframedandcontinuousbitstreamofalternatingonesandzeros(...101010...)

availability
probabilitythatanitemcanperformitsrequiredfunctionunderstatedconditionsfor
stateddurationoftime

availability
ratioofthenumberofcircuitsthatareabletoswitchtraffictothetotalnumberofcircuits

availability
propertyofboththeinformationandthesystem(softwareandhardware)being
accessibleandusableupondemandbyanauthorisedentity

availability information
presenceinformationaboutuseravailabilityandavailabilitystatus

Issue:28

119

GeneralGlossary

availability of circuit group; circuit group availability


ratioofthenumberofcircuitsthatareabletoswitchtraffictothetotalnumberofcircuits
inacircuitgroup

availability performance
abilityofanitemtobeinastatetoperformarequiredfunctionatagiveninstantoftime
oratanyinstantoftimewithinagiventimeinterval,assumingthattheexternal
resources,ifrequired,areprovided

availability performance measurement


inanetworkelement,ameasurementwhichcollectsinformationabouttherestartsof
computerunitsandprocessfamilies,andaboutthestatechangesofcomputerunits,and
basedonthereceivedinformationcalculatesthetimetheunithasbeenoutofservice

availability performance of network element


featureusedforcollectinginformationaboutrestartsofcomputerunitsandprocess
families,andofstatechangesofcomputerunits,andforcalculatingfromthereceived
informationthetimewhichtheunitshavebeenoutofservice

availability status; availability value


presenceattributeindicatingthepresenceservicepublisher'swillingnesstothedifferent
communicationsessions,forexamplevoicecallsormessages

available (adj)
abletobeinteractedwith

available bit rate; ABR


bitrateforwhichthelimitingATMlayertransfercharacteristicsprovidedbythenetwork
maychangesubsequenttoconnectionestablishment

available capacity
partofthedefinedcapacitythatcanbeused

available codecs list


listofcodecsthatisreturnedinbackwardsignallingtothenodethatoriginatedtheoutof-bandtranscodercontrolandthatcontainsthecodecsthatareavailableforthe
networknodeinterfaceconnection

120

Issue:28

GeneralGlossary

available-executable; AV-EX
stateofasignallinglinkwhenitisworkingnormally

available PLMN; available public land mobile network


publiclandmobilenetwork(PLMN)wherethemobilestationhasfoundasuitablecell

available signalling link /GB/; available signaling link /US/


signallinglinkwhichhassuccessfullycompletedtheinitialalignmentproceduresand
carries,orisreadytocarry,signallingtraffic

average-based C/I method


intheC/I-basedhandovercandidateevaluation,ahandoveralgorithmforcalculatingthe
potentialdownlinkC/Iratioofthehandovercandidatecellthatisbasedontheweighted
averageinterference

average bit rate; average rate


meanvalueofthebitrate,usuallymeasuredinkilobitspersecond,atwhichagiven
virtualcircuitcantransmit

average counter
counterthatgivestheaverageofthecountedeventinoneresultaccumulationperiod

average daily peak hour; ADPH; moving average for peak hours
averageofthepeakhourtrafficofthelasttenworkingdays

average delay
counterthatindicatestheaveragebufferingdelayoftheframeprotocolpayloadper
AAL2prioritisationqueueoveratimeperiod

average of the daily peak full hour; ADPFH; peak hour method; greatest full
hour method; largest full hour method
trafficmeasurementinwhichtheaveragetrafficintensityiscontinuouslymeasuredevery
fullhour,andthehourwithmostintensetrafficisselectedoutoftheresultingtraffic
values

average performance
datathroughputofthesystemmeasuredover24hoursofsustainedactivity

Issue:28

121

GeneralGlossary

average transmitter power; average transmit power


meanofthetotaltransmittedpowerobtainedoveranyspecifiedinterval,including
periodswithnotransmission

AXC manager; AXC EM; AXC element manager


softwareapplicationthatisusedtomanagetheATMcross-connect(AXC)

AXC monitor
inATMcross-connect(AXC),aprocesswhichensuresthatthestateoftheelement
manageriscorrectandhandlesthecommunicationfromtheUImanager

122

Issue:28

GeneralGlossary

4 B
babble
intransmissionsystems,theaggregateofcross-talkinducedinagivenlinebyallother
lines

backbone; BB
primaryconnectivitystructureofahierarchicaldistributedsysteminwhichallsystems
withconnectivitytoanintermediatesystemareassuredofconnectivitytoeachother

backbone network
transmissionfacilitydesignedtointerconnectgenerallylower-speeddistributionnetworks
orclustersofdisperseduserdevices

backbone router
routerthat,togetherwithsimilarrouters,formsthecompletebackbonenetwork

backdoor
functionthatishiddeninthesoftwaretoenableaccesstotheinformationsystem
bypassingthesecurity

backdoor password
passwordthatcanbeusedtounblockaunitwhentheactualpasswordhasbeen
forgotten

back end; BE
nodeorsoftwareprogramthatprovidesservicestoafrontend

background block error; BBE


erroredblocknotoccurringaspartofaseverelyerroredsecond(SES)

background block error ratio; BBER


ratioofbackgroundblockerrors(BBE)tototalblocksinavailabletimeduringafixed
measurementinterval

background class; background traffic class; background best effort


qualityofserviceclassfornon-real-timetrafficwherethedestinationdoesnotexpectthe
datawithinacertaintimeandthepayloadcontentispreserved

Issue:28

123

GeneralGlossary

background debug mode; BDM; background debugger mode


operationalmodeofamicroprocessorwhichhaltstheexecutionofnormalmachinecode
andstartstheinternalmicrocodetoprocesscommandsreceivedfromadedicatedserial
debuginterface

background interference matrix; BIM


matrixofstatisticaldataonsignallevelsthatthemobileterminalshavereportedforthe
servingandadjacentdynamicfrequencyandchannelallocation(DFCA)cellsandthat
providesageneralcell-levelviewofhowthemobileterminalstypicallyexperiencethe
signal-levelratiobetweentheservingcellandtheadjacentcell

background interference matrix update process; BIM update process


processthatisusedtoupdatethebackgroundinterferencematrixtablesperiodicallyby
takingintoaccountthechangesinthetrafficdistributionsofthedynamicfrequencyand
channelallocation(DFCA)cells

background noise
totalsystemnoiseintheabsenceofinformationtransmission,independentofthe
presenceorabsenceofasignal

background processing
executionoflower-prioritycomputerprogramswhenhigher-priorityprogramsdonot
requireanysystemresource

background program
programthatdoesnotrequireinteractionsfromauserandthatisrunwithalowpriority
inamultiprogrammingenvironment

background recovery
inahomelocationregister(HLR),arecoveryinwhichallsubscriberdataistransferred
fromanactiveHLRtoaredundantHLR

backhaul (verb)
togetdatatoapointfromwhichitcanbedistributedoveranetwork

backhaul interface
interfacethatisusedforbackhaulingabasetransceiverstation

124

Issue:28

GeneralGlossary

back lobe; backlobe


lobewithanaxisthatmakesanangleofabout180degreeswiththeforwarddirectionof
theaxisofthemainlobeoftheantenna

backoff mode
stateintowhichamodemmaybeplacedduetoapreviousfaileddialattempt

backplane bus
busofthemotherboardoftheDX200cartridgetowhichtheplug-inunitsareconnected
andthroughwhichtheycantransferdata

backplane interface; BIF


interfacebetweentheunitsandthebackplane

back pressure
congestioncontrolinwhichtheunitsconnectedtotheinputportsoftheATMswitching
fabricareforcedtostopsendingtrafficwhentheirqueuethresholdsareexceeded

back-pressure signalling /GB/; back-pressure signaling /US/


signallingthatisusedintheflowcontrolofthebackwarddirection

back-to-back user agent; B2BUA


useragentthatreceivesarequestandprocessesitasauseragentserver,andinorder
todeterminehowtherequestshouldbeanswered,actsasauseragentclientand
generatesrequests

backup
inNMS,thestatusofthesoftwarebuildthatiscurrentlyrunninginanetworkelement

backup and restore; B&R


functionsthatprovidethemeanstosecurethemandatoryinformationinthedatabase,
theneededfilessystemareas,andnecessaryscriptsforbackingupandrestoringthe
data

backup build; BU
diskcopyofarunningsoftware(SW)buildinmemory

Issue:28

125

GeneralGlossary

backup cluster manager node; BCLM; backup cluster manager; BCLM


node
nodethatbacksupotherclustermanagernodesandothernodesinacluster

backup connection
secondaryconnectionthatcanbeusediftheprimaryconnectiongoesdown

backup copy; backup; safecopy


copyofafileoradatabasethatcanbemadeonthesystem'sharddiskoronexternal
mediaandthatisusedifthefileorthedatabaseitselfisdeleted

backup copying; backup


processofmakingabackupcopyofinformationsothatitcanberestored

backup copying of counters; copying of charging counters


partofstorageofchargingwhichcarriesoutthebackupcopyingofcounterfilesontoa
datadisk

backup D-channel
channelwhichfunctionsasabackupfortheD-channelanddoesnotnormallytransmit
data

backup designated router; BDR


routerintheopenshortestpathfirstareawhichhasthesameinformationasthe
designatedrouterandthattakesoveritsdutiesifthedesignatedroutercrashes

backup Ethernet interface


EthernetinterfacethatisbroughtintouseinanEthernetinterfaceswitchover

backup management
featurethatprovidesameanstobackupandrestoresoftwarepackagesandfilesystems

backup program
programthatisusedforcreatingthebackupcopies

backup server; BS
serverwhichprovidesastoragesystemfordatathatneedstobebackedup

126

Issue:28

GeneralGlossary

backup unit
spareunitthatisusedsimultaneouslywiththeactiveunit

Backus-Naur form; BNF


formalnotationusedforexpressingtheconcretetextualsyntaxofalanguage

backward call indicator


signallingparameterwhichissentinthebackwarddirection,indicatingthe
characteristicsoftheconnection,signallingpath,andcalledsubscriber

backward closed user group indicator; backward CUG indicator


indicatorwhichissentinthebackwarddirectiontoshowwhichCUGindexistobeused
atoutgoingcallset-upusingtheassociatedbasicservicegroup

backward congestion; congestion encountered backward


congestionindicatedwithabackwardexplicitcongestionnotification(BECN)

backward direction
directionfromacalledpartytoacallingparty

backward explicit congestion notification; BECN


bitthatacongestednetworksetstonotifytheuserthatcongestionavoidance
proceduresshouldbeinitiatedwhereapplicablefortrafficintheoppositedirectionofthe
framecarryingthebackwardexplicitcongestionnotification(BECN)indicator

backward handover
handoverinwhichtheradioresourcesarepreparedandreservedinthetargetsystem
beforethesourcesystemcommandstheuserequipmenttoswitchovertothetarget
system

backward indicator bit; BIB


bitinasignalunitrequesting,byitsstatuschange,retransmissionattheremoteend
whenasignalunitisreceivedoutofsequence

backward release with rerouting; backward release


inmobilenumberportability,afeaturethatmakesitpossibletoreleaseacallfromthe
terminatingbasiccallstatemodel,whichmakesthenumberportabilitydatabase(NPDB)
query,andtoprovidetheoriginatingbasiccallstatemodelwiththeroutinginformation

Issue:28

127

GeneralGlossary

backward sequence number; BSN


fieldinasignalunitsentwhichcontainstheforwardsequencenumberofacorrectly
receivedsignalunitbeingacknowledged

backward signal
signalusedfortheestablishment,releaseorothercontrolofaconnection,sentinthe
oppositedirectiontocallset-up

backward signalling /GB/; backward signaling /US/


signallingsentinbackwarddirectionfromthecalledpartytothecallingparty

backward slice
programslicethatconsistsofallprogrampointsthataffectagivenpointintheprogram

bad frame handling; BFH


methodforpreventingshortunpleasantsoundsduringthecallbymutingthesignal
smoothly,ifthereisevidenceoferrors,anddemutingsmoothlyoncegoodframesare
receivedagain

bad frame indication; BFI


partofaheaderthatindicatesthataframehasbeencorrupted,orreceivedinerror

balance
conditioninwhichtwobranchesofacircuithaveidenticalimpedance,relativetoground

balanced code
codethatgeneratesonlygroupsofsignalelementsthathavezerodigitalsum

balanced transmission line


transmissionlineformedoftwosimilarconductorshavingthesameresistanceperunit
lengthandequalimpedancetoearth

balance holder; BH
system,suchasanetworkserver,whichcontainsasubscriber'sprepaidaccount

128

Issue:28

GeneralGlossary

balance impedance
impedancewhosepurposeistobalancetheimpedanceattheoutputoftheinterface,so
thataslittleaspossibleoftheincomingsignalatthe4-wiresidereturnsbacktothe
outgoingdirection

balance management interface; account balance management interface;


balance management API
CORBA-basedapplicationprogramminginterfaceintheUnifiedChargingSuitethat
externalsystemsandclientsusetoperformtop-upeventsandbalanceenquiriesfor
prepaidandpost-paidaccounts

B-alarm
alarmgeneratedwhenequipmentisstilloperationalbutthequalityoftheservices
providedhasdegenerated

band
celltypeindicatingwhetherthecellisaGSM,DCS1800orWCDMAcell

bandwidth; BW; frequency bandwidth


quantitativedifferencebetweenthelimitingfrequenciesofafrequencybandthat
indicatesthewidthofacommunicationchannel

bandwidth class
classificationthatindicatestheavailablebandwidthforacommunicationchannel

bandwidth-delay product; BDP


indatacommunication,aproductofthebits-per-secondbandwidthofthenetworkand
theround-triptime,ordelay,inseconds

bandwidth multiplier; BWM; B/W multiplier


parameterinthemultimediadummycodecthatdefinestherequiredbandwidthforthe
bearer

bandwidth reservation; bandwidth allocation


processofassigningbandwidthtousersandapplicationsservedbyanetwork

banned; BAN
statusofafunctionalunitwhenitisnotallowedtotakepartinrecoveryactions

Issue:28

129

GeneralGlossary

bar
usually,ahorizontalrectangleinauserinterfacewhichcontainsmenus,toolicons,and
otherdisplayentities

barred
stateofafunctionalunitwhenitdoesnottransmitoutgoingtraffic

barred operator
attendantwhomthesystemhasbarredfromamongthegroupofattendantsofferinga
service

barred public identity


publicuseridentitywhichisdisabledtoinitiateorreceivesessionsintheIPmultimedia
subsystem(IMS)

barring
separatingacircuitoracircuitgroupfromthoseoutgoingorbidirectionalcircuitsor
circuitgroupsthatarehuntedwhenestablishingaconnection

barring
actionofrestrictingusersfromsendingorreceivingmessages,ormakingorreceiving
calls,orfromusingcertainservices

barring category
categorywhichspecifiesthebarringconditionsforagroupofcalls

barring manager; BarMan


intheOnlineServiceController(OSC),anapplicationthatbarsserviceswhenthe
accountbalancefallsbelowtheconfiguredthresholdforaservice

barring of all incoming calls; BAIC


incomingcallbarringwhichenablesthepreventionofallincomingcalls

barring of all outgoing calls; BAOC; OCG; CBO


outgoingcallbarringwhichenablesthepreventionofalloutgoingcallsexcluding
emergencycalls

130

Issue:28

GeneralGlossary

barring of all outgoing calls when roaming outside the home PLMN
country; BORO
outgoingcallbarringwhichmakesitpossibleforamobilesubscribertopreventall
outgoingcallswhenthemobilesubscriberisroamingoutsidethehomePLMNcountry.
Thesecallsmaybeassociatedwithallorwithaspecificbasicservice

barring of all packet-oriented services; BAPS


operator-determinedbarringthatpreventstheuseofallpacket-orientedservices

barring of changing a call forwarding number; BCCF


operator-determinedbarringthatpreventsthesubscriberfromchangingthecall
forwardingnumber

barring of incoming calls when roaming outside the home PLMN; BIRN
operator-determinedbarringthatpreventsthesubscriberfromreceivingincomingcalls
whenroamingoutsidethehomenetwork

barring of incoming calls when roaming outside the home PLMN country;
BIC-Roam; BAIC-Roam; BIRO; barring of all incoming calls when roaming
incomingcallbarringwhichenablesthemobilesubscribertopreventallincomingcallsor
justthoseassociatedwithaspecificbasicserviceonlyifthemobilesubscriberroams
outsidethehomePLMNcountry

barring of intrusion
featurebywhichausercanpreventintrusion

barring of invocation of call transfer; BI; BICT; barring of invocation of CT


operator-determinedbarringcategorywithwhichtheinvocationofcalltransfersis
prevented

barring of MS-initiated PDP context activation; BMSP


operator-determinedbarringthatpreventsthePDPcontextactivationwhenitisinitiated
byamobileterminal(MS)

barring of outgoing international calls; BOIC; international call barring


outgoingcallbarringthatenablesthepreventionofinternationalcallsfromaparticular
extension

Issue:28

131

GeneralGlossary

barring of outgoing international calls except those directed to the home


PLMN country; BOIC-exHC; BOIH; barring of all outgoing international non
HPLMN calls
barringofoutgoinginternationalcallswhichmakesitpossibleforamobilesubscriberto
preventalloutgoinginternationalcallsexceptthosedirectedtothehomePLMNcountry
orjustthoseassociatedwithaspecificbasicservice

barring of premium rate calls; BAPR


subscriberdata,storedpermanentlyinthehomelocationregisterandvisitorlocation
register,whichindicatesthecategoryofbarringappliedtothesubscriber

barring of registration of forwarded-to number; BR


operator-determinedbarringcategorywithwhichtheregistrationofforwarded-tonumber
isprevented

barring of roaming
operator-determinedbarringcategorywithwhichroamingisprevented

barring of supplementary service management; BASS


featurewhichpreventssubscriber'scontrolofsupplementaryserviceregistrations,
erasure,activations,deactivations,interrogations,passwordregistrationsandmobileinitiatedunstructuredsupplementaryservicedata(USSD)

base address
addressfromwhichanabsoluteaddressisderivedbycombiningitwitharelative
address

baseband; BB
frequencybandoccupiedbyonesignalorbyanumberofmultiplexedsignalsat
specifiedinputandoutputpointsofatransmissionsystem

baseband branching
protectiondevicewhichislocatedatthecommonmainchannelinterfaceofaredundant
equipmentpairandwhichoperatesonabasebandfrequency

baseband extension mode


modeofoperationofasystemmodulethatisconnectedtotheextensionconnectorport
ofanothersystemmoduletoenablecapacityexpansion

132

Issue:28

GeneralGlossary

baseband hopping; BB hopping


frequencyhoppinginwhichatransceivertransmitsonacertainfrequencywhichis
changedbetweenconsecutivebursts

baseband modem; BBM


typeofdatacircuitterminatingequipmentwhichconvertsbycodeconversionadigital
pulsetrainintoadigitalsignalsuitablefortransmissionoveratransformer-coupledline

baseband module; BBM; BB module


softwaremodulethatprocessesbasebanddigitalsignalsofspeechanddatachannels,
managesallsignallingforspeechconnections,andhandlessoftwaredownloadingand
timingfunctions

baseband processing
setofmethodsusedformodulating,demodulating,filtering,timing,synchronising,
decoding,andrecoveringabasebandsignal

baseband processing unit


unitthathandlesbasebandprocessingforacellorasetofcells

base control function; BCF; base station control function


functionalentityinabasetransceiverstation,whichhandlescommoncontrolfunctions
andthebasetransceiverstationoperationandmaintenancefunctions

base delivery
softwaredeliverythatcontainsafullsetofsoftwaresubsystemsthatformanentire
softwarerelease

base entry
entrythatisusedfordirectoryoperationsinanLDAPdirectory

base group
pre-configuredgroupwhosemembersareallowedtoinvitenewmemberssothatanad
hocprogroupisformed

base interface; BI
mandatorycommunicationchannelinAdvancedTCAthatisimplementedasGigabit
Ethernet

Issue:28

133

GeneralGlossary

baseline capabilities
capabilitieswhichamobilestation(MS)requiresinordertooperatewithinanetwork,but
whichdonotnecessarilyenabletheuseofservices

baseline implementation capabilities; BIC


setofimplementationcapabilitiesineachtechnicaldomainwhichamobilestation(MS)
requiresinordertosupporttherequiredbaselinecapabilities

base platform
platformwhichconsistsofsoftwarecomponentsthatprovidebasiccomputingservices
fortheFlexiServerplatform

base platform image; local image


subsetofasystemimagethatcoversthebaseplatformparts

base platform partition


intheFlexiPlatform,adiskpartitionthatiscommontoallFlexiPlatform-basedproducts

base register; BR
registerwhichisusedforstoringvalues,mostoftenthebaseaddressesofdata
structuresinmemory

base root package


H.248packagethatdefinesmedia-gateway-wideproperties

base station area


partofthenetworkcoveredbyabasestation

base station category


classificationofbasestationswhichaffectsthecategorisationprinciplesofthealarm
urgencylevel

base station controller; BSC


networkelementinthepubliclandmobilenetwork(PLMN)forcontrollingoneormore
basetransceiverstations(BTS)inthecallset-upfunctions,insignalling,intheuseof
radiochannels,andinvariousmaintenancetasks

134

Issue:28

GeneralGlossary

base station gateway; BSGW


routerwhichisthefirstentrypointtotheIPradioaccessnetwork(RAN),providing
dedicateduserdataprocessingandmacrodiversitycombiningfunctions

base station identification


basestationidentificationconsistsofthemobilecountrycode(MCC),mobilenetwork
code(MNC),locationareacode(LAC),andthebasestationcode

base station identity code; BSIC; base transceiver station identity code
blockofcode,consistingofthePLMNcolourcodeandabasestationcolourcode

base station interface equipment; BIE


equipmentinabasetransceiverstationusedasaninterfacetotheAbislinkstowards
thebasestationcontroller

base station line loop; base station circuit loopback; line loop
loopusedinthetestingoftheoperatingconditionofabasetransceiverstation
connection

base station site


installationsiteofabasestation

base station subsystem; BSS


systemconsistingofseveralbasestations(BS)andonebasestationcontroller(BSC),
representingtheradionetworkinaspecificgeographicalarea

base station system; BSS


systemofbasestations(BS)andbasestationcontrollers(BSC)whichisviewedbythe
mobileservicesswitchingcentre(MSC)throughasingleinterface

base station system application part; BSSAP; BSS application part


protocolwhichsupportsmessagecommunicationbetweenthemobileservicesswitching
centre(MSC)andbasestationsystem(BSS)intheAinterface

base station system GPRS protocol; BSSGP


protocolthatconveysroutinginformationandqualityofservicerelatedinformation
betweenabasestationsystem(BSS)andaservingGPRSsupportnode(SGSN)

Issue:28

135

GeneralGlossary

base station system management application part; BSSMAP


applicationpartwhichsupportsallproceduresbetweenamobileservicesswitching
centre(MSC)andbasestationsystem(BSS)thatrequireinterpretationandprocessing
ofinformationrelatedtosinglecallsandresourcemanagement

base transceiver station; BTS; BS; base station


networkelementinamobilenetworkresponsibleforradiotransmissionandreceptionto
orfromthemobilestation

base unit
2NorN+1redundantfunctionalunitthatcanbemovedfromtheoriginalsidetothetrial
sidewithoutdisturbingthetraffic

basic access; BA; BRA; basic rate access; ISDN basic access
simplestandardisedcombinationofaccesschannelsthatconstitutetheaccess
arrangementsforthemajorityofISDNusers

basic adaptation file


adaptationfilethatmodelsthedatathatisvisibleinthenetworkelementO&Minterfaces

basic analysis creation


servicethattheclientusestocreateananalysisforagiventreewithgivendigits,orto
addanalternativewhenalternativeroutingisused

basic analysis deletion


servicethattheclientusestodeleteananalysisfromagiventree,ortodeletean
alternativewhenalternativeroutingisused

basic call
callbetweentwousersthatdoesnotincludeadditionalfeatures

basic call state model; BCSM; BCM; basic call model


genericrepresentationofserviceswitchingpoint(SSP)(IN)callprocessingthatidentifies
thepointswherecallprocessingmaybeinterruptedorresumed

basic call unrelated state model; BCUSM


basiccallstatemodelthatrelatestothecallunrelatedassociatedconnection-oriented
interactionbetweentheuserandtheINservicelogicusingISDNuser-to-network
signallingprocedures

136

Issue:28

GeneralGlossary

basic capacity
capacitythatisavailableinamanagedobjectwithoutalicencekey

basic cell trace


functionthatdeliversdetailedinformationforfeatureandprocessingverification

basic channel band


specificfrequencybandwithintheNMT900frequencyband.Itispreprogrammedinthe
mobilestation(MS),andshallbechangeable.Thisfrequencybandwillbeusedfromthe
outset

basic chip rate


chipratenormallyusedinagivensystem

basic continuity package


H.248packagethatdefineseventsandsignalsforacontinuitytestthatincludesthe
provisionofeitheraloopbackortransceiverfunction

basic encoding rules; BER


setofrules,definedbyITU-T,whichareusedtoencodeinformationstructuredinASN.1
intobinaryrepresentation

basic end
closingofdialoguebetweentheserviceswitchingfunction(SSF)andtheservicecontrol
function(SCF)aftertheSCFhassentthelastoperation(TC_END)totheSSF

basic error correction method


non-compellederrorcorrectionsystembasedonretransmissionandmakinguseof
positiveandnegativeacknowledgement

basic Ethernet switching


featurethatextendsthetransportconnectivityoptionsatI-BTSsiteviathelinklayer
Ethernetswitchingforthetransportsubmodule

basic facility
facilityprovidedasabasicservice

Issue:28

137

GeneralGlossary

basic function
functionwhich,whencombinedwithacomparisonfunction,causesacertainactionin
theserviceexecution

basic handover
procedureinwhichacallishandedoverfromthemobileservicesswitchingcentre
(MSC)underwhichthecallwasoriginatedtoanotherMSC

basic ICD mass management


managementofenduserswhereoneconfigurationfilecontainsmanyend-userandICD
subscriptiondefinitions

basic in-advance credit check


in-advancecreditchecking(IACC)thatprovidesasnapshotofthesubscriber'scurrent
accountbalance

basic input/output system; BIOS


partoftheoperatingsystemthatisheldinthecomputer'smemory,allowingthe
computertostartupandloadtherestofitsoperatingsystemfromadisk

basic integration
integrationthatincludesproceduresthatarecommonlyusedwhenanetworkelementis
integratedinthenetwork

basic object adapter; BOA


objectadapterthatprovidesagivenobjectimplementationwithaccesstotheobject
requestbroker(ORB)functions

basic operation
functionaldefinitionelementthatisusedasabasisforcommercialservices

basic optimal routing; BOR


optimalroutingthatenablesahomelocationregisterenquiryfromaforeignnetworkso
thatthecallcanbedirectedtothevisitednetworkfromaninterrogatingnetworkwithout
extendingthecalltothehomenetwork

basic pulse
pulsetrainthelengthofwhichisonepulse

138

Issue:28

GeneralGlossary

basic pulse charging


specialcaseofpulsetrainchargingwherethelengthofthepulsetrainisonepulse

basic rate interface; BRI


N-ISDNinterfacetobasicrateaccesscomposedoftwoBchannelsandoneDchannel
forcircuit-switchedcommunicationofvoice,video,anddata

basic resource monitoring; BRM


setoffunctionsthatmonitorandgeneratestatisticsonmemoryconsumption,diskspace
usage,andCPUload

basic service
commontelecommunicationservicewhichformsthebasisforofferingsupplementary
services

basic service group; BSG


elementarybasicservicegrouporacompoundbasicservicegroup

basic service group code


servicecodethatidentifiesabasicservicegroup

basic services tones generation package


H.248packagethatdefinessignalsfortheuseoftelephonyservicesandallowsthe
specificationofdirectionality

basic service triggering criterion


servicetriggerthatisstoredinthehomelocationregisterandthatcontainsalistofupto
fivebasicservicecodes,eachofwhichmayrepresentanindividualbasicservicegroup

basic timing signal


timingsignalbymeansofwhichfunctionalunitsofanexchangearesynchronised

basic trial configuration


trialconfigurationformedbytheRecoveryProgramBlockwhichchoosestheunitsforthe
trialside

Issue:28

139

GeneralGlossary

basic warming
warmingthatisimplementedbywarmingupbothfreeandreservedhandsofthe
processfamily

batch processing
methodofexecutingasetofcomputerprogramssothateachprogramiscompleted
beforethenextoneisstarted,withoutoperatorintervention

BATM-internetworking operating system; BiNOS; BiNOS operating system


operatingsystemthatprovidesadministration,management,qualityofservice(QoS),
andsecurityperformancerequirementsofenterprisenetworksbysupportingawide
rangeofIEEEstandardsandindustryconventions,suchasaccesscontrollists

battery-saving facility; battery-saving function; battery saving


functionofthemobilecommunicationsystemwhichsetsthemobilestationintoastate
usingaslittlepoweraspossible

battery-saving period
periodduringwhichamobilestationisinastatewhereitconsumesonlylittleenergy

baud; Bd
unitofmodulationratewhichcorrespondstoarateofoneunitintervalpersecond,used
toexpressthespeedofsignallingordatatransfer

Baudot code; Baudot


datatransmissioncodeinwhichfiveequallengthbitsrepresentonecharacter

baud rate
unitofmeasurementforthemodulationrateordatatransmissionspeedindicatingthe
maximumnumberofvariationsinasignalinasecond

BC anchor node
servingnodethatservesasananchorpointforbearercontrol(BC)duringbearer
redirection

BCCH allocation; BA
allocationofradiofrequencychannelsinacellforbroadcastcontrolchannel(BCCH)
transmission

140

Issue:28

GeneralGlossary

BCCH allocation list; BA; BCCH allocation frequency list; BA list


listofchannelsthatisusedwhenallocatingbroadcastcontrolchannel(BCCH)forthe
mobilestation(MS)

BCCH-BSIC conflict
situationinwhichthebasestationcontroller(BSC)cannotidentifytowhichcellthe
broadcastcontrolchannel(BCCH)andbasestationidentitycode(BSIC)belongs

BCCH layer
layerthatsupportsthebroadcastcontrolchannel(BCCH)transceiver

BCCH super-reuse; BSR


featurethatallowsthereuseofbroadcastcontrolchannel(BCCH)frequenciesfroma
regularlayer

BCF hardware reporting; hardware reporting


administrator'suser-interfaceapplicationthatconductsdatabasesearchesfordataon
hardwareunitswithspecifiedsearchparameters

BCF maintenance mode


basecontrolfunctionmodewhenalarmhandlingparametersofaspecifiedbasecontrol
function(BCF)arechangedsothatrecovery,localprintoutorNMSupdatinghavebeen
denied,orthealarmhandlingofBCFhasbeenblocked

B-channel; bearer channel


channelusedfortransmissionofsubscriberdata

Bd-Channel
B-channeloftheprimaryrateaccess(PRA)orSS7interfaceusedforthesupportofuser
D-channelservices

beacon
shortmessagecontainingthenetworknamethatisbroadcastroughlytentimesa
secondbyanaccesspoint

beaconing
processinwhichawirelessstationlistensforbeaconssentbyanaccesspoint

Issue:28

141

GeneralGlossary

beamwidth; BW
intheradioregimeofanantenna,theanglebetweenthehalf-power(3-dB)pointsofthe
mainlobe,whenreferencedtothepeakeffectiveradiatedpowerofthemainlobe

bearer; data bearer


informationtransmissionpathofadefinedcapacity,delay,andbiterrorrate

bearer adaptor
softwaremodulethatenablesthewirelessprotocolstack(WPS)toworkwithaparticular
bearer

bearer allocation
allocationofbearersintheradioandcorenetworkwithdifferentqualityofservice
classes

bearer association transport; BAT


applicationserviceelement(ASE)thatprovidesatransportmechanismbetweenpeer
bearerindependentcallcontrol(BICC)signallingentities

bearer capability; BC; BCIE; bearer capability information element


informationelementdescribingthebearerservice

bearer capability analysis


internalcallcontrolanalysisthatusesthebearercapabilityinformationelement(BCIE)to
indicatewhichnetworkservicesandteleservicesarerequiredforthecall

bearer channel identifier; bearer channel id


identifierbytethattheusergivestotheframerelayaccess

bearer characteristics package; BCP


H.248packagethatcontainsthefunctionsrequiredtoidentifywhichbearerservicesare
tobesupportedbyamediagateway

bearer control
setoffunctionsthatisusedtosetup,maintain,andreleaseabearer

142

Issue:28

GeneralGlossary

bearer control function; BCF


functionthatcontrolsthebearerconnectionelementsinthefixednetworkinorderto
providebearercapabilitiesrequestedbythecallcontrolfunction(CCF)

bearer control point; BCP


physicalentityinthetelecommunicationnetworkthatperformsconnection-related
switchingandsignallingfunctions

bearer control protocol; BCP


protocolwhichisusedtocontrolbearersassociatedtoamultipartycallthatiscontrolled
independentlybymeansofaseparatecallcontrolprotocol

bearer control tunnelling package /GB/; bearer control tunneling package


/US/; BT
H.248packagethatdescribesthefunctionsrequiredtosupportthetransportofbearer
informationtransportsignalsbetweenamediagatewaycontrollerandamediagateway

bearer-independent call control; BICC; BICC protocol


callcontrolprotocolwhichisdesignedtotransportcallcontrolsignallinginformation
independentoftheusedbearertechnologyandsignallingmessagetransporttechnology

bearer-independent circuit-switched core network; bearer-independent CS


core network
circuit-switchedcorenetworkinwhichcallcontrolandbearercontrolandmanagement
areseparatedfromeachother

bearer information transport; BIT


signalthatissenttoamediagatewayifamediagatewaycontrollerreceivestunnelled
bearercontrolsignallingfromapeermediagatewaycontroller

bearer interworking function; BIWF


functionalentitywhichprovidesbearercontrol,aswellasmediamappingandswitching
functionswithinthescopeofaservingnode

bearer management; BM
managementfunctionthatisusedtoconfigurearadiobearerandtoselectthelogical
channelsforcommunicationbetweenamobileterminalandthebasetransceiverstation
basedonthepropertiesoftheselectedbearer

Issue:28

143

GeneralGlossary

bearer modification; ATM bearer modification


procedurebywhichanyparametervaluesthatdescribebearercapabilitiescanbe
modified

bearer network
networkthatcarriesmessagesofatransport-layerprotocolbetweenphysicaldevices

bearer network connection; BNC; backbone network connection


networkconnectionwithinthebackbonenetwork,consistingofoneormorebackbone
networkconnectionlinks(BNCL)

bearer network connection identifier; BNC-ID; backbone network


connection identifier
uniqueidentifierwithinthescopeofonebearercontrolfunction(BCF)thatidentifiesa
bearernetworkconnection

bearer redirection
mechanismwhichisusedtooptimisethebearerpathwhenanendpointofacall
changesduetotheoperationofanapplicationlayerservice

bearer service bit rate allocation


bearerallocationwithamaximumallowedbitrateforreal-timeandnon-real-time
servicesandamaximumguaranteedbitrateforreal-timeservices

bearer technology
technologythatisusedtotransportdataorsignallingtraffic

bearing; antenna bearing


directiontowhichthemainlobeoftheantennaispointing(angleonthehorizontalaxis,
0towardsNorth)

begin acknowledge PDU; BGAK PDU


protocoldataunit(PDU)thatisusedtoacknowledgetheacceptanceofaconnection
requestbythepeerentity

begin message
transactioncapabilitiesmessagethatisusedtoinitiateatransactionwithanotherpeer
transactionuser

144

Issue:28

GeneralGlossary

beginning of message; BOM


indicator,inthefirstcellofanATMsegmentedpacket,containingtheheaderinformation
forATMadaptationlayer(AAL)

beginning tone; BTO


tonewhichisgivenatthebeginningofavoiceannouncement

begin PDU; BGN PDU


protocoldataunit(PDU)thatisusedtoestablishaServiceSpecificConnectionOriented
Protocol(SSCOP)connectionortore-establishanexistingSSCOPconnectionbetween
twopeerentities

begin reject PDU; BGREJ PDU


protocoldataunit(PDU)thatisusedtorejecttheconnectionestablishmentofthepeer
ServiceSpecificConnectionOrientedProtocol(SSCOP)entity

behaviour /GB/; behavior /US/


groupofresponsesequencestosequencesofstimuli

behaviour aggregate /GB/; behavior aggregate /US/; BA; DS behaviour


aggregate /GB/; DS behavior aggregate /US/
acollectionofpacketswiththesamedifferentiatedservicecodepoint(DSCP)value
crossingalinkinaparticulardirection

behavioural compatibility /GB/; behavioral compatibility /US/


compatibilityofanobjectwithanotherobject,withrespecttoasetofcriteria

Berkeley packet filter; BPF


mechanismthatprovidesarawinterfaceviawhichtheapplicationscanaccessall
networkpacketsdirectlyinaprotocol-independentfashion

Berkeley standard distribution; BSD; Berkeley software distribution; BSD


UNIX
anyofavarietyofUNIX-typeoperatingsystemsbasedontheUniversityofCaliforniaat
BerkeleyBSDoperatingsystem

best-effort operations
bulkoperationswhichcanbepartiallysuccessfulandwhichactindependently

Issue:28

145

GeneralGlossary

best effort PHB; BE


differentiatedbearerserviceper-hop-behaviour(PHB)usedinroutersthatisthedefault
wayofhandlingnon-delay,non-losssensitivedatapacketsinanIP-basedradioaccess
network

best-effort plan
configurationplanwhichdetailschangestotheunderlyingconfigurationsothatallthe
plannedchangeswhichpassdynamicvalidationareimplemented

best effort QoS


lowestqualityofservice(QoS)classwhichdeliverstheQoSiftheguaranteedQoS
cannotbedelivered

best effort service


servicewithminimalperformanceguaranteesallowinganunspecifiedvarianceinthe
measuredperformancecriteria

best server
intheuplink,thecellthatagivenmobilestationcanreachwithminimumtransmission
poweratacertainlocation,andinthedownlinkthecellthathasthehighestreceived
pilotchannelpowerinthearea

BHCA; busy hour call attempts


numberofcallattemptsduringthenetwork'sbusyhour

BHCA value
numberofbusyhourcallattempts

BIC
barringofinvocationofcalltransfer(BI)whereatleastoneofthetwocallsisacall
chargedtotheservedsubscriber

BICB
barringofinvocationofcalltransfer(BI)wherebothcallsarechargedtotheserved
subscriber

146

Issue:28

GeneralGlossary

BICC bearer control tunnelling protocol /GB/; BICC bearer control


tunneling protocol /US/; BCTP; bearer control tunnelling protocol /GB/;
bearer control tunneling protocol /US/
protocolwhichtransportsthetunnelledprotocoldataunits(PDU)ofthebearercontrol
protocolssupportedoverthebearerindependentcallcontrol(BICC)andcallbearer
controlprotocol(CBC)interfaces

BICC IP bearer control protocol; IPBCP; IP bearer control protocol


protocolusedfortheexchangeofmediastreamcharacteristics,portnumbersandIP
addressesofthesource,andthesinkofamediastreamtoestablishandallowthe
modificationofIPbearers

BICI
barringofinvocationofcalltransfer(BI)whenatleastoneofthetwocallsisacall
chargedtotheservedsubscriberatinternationalrates

BICZ
barringofinvocationofcalltransfer(BI)whenatleastoneofthetwocallsisacall
chargedtotheservedsubscriberatinter-zonalrates

bid
singleattempttoobtaintheuseofaresourceofthetypeunderconsideration

bidirectional
qualificationwhichimpliesthatthetransmissionofinformationoccursinbothdirections

bidirectional channel
transmissionchannelthatcancarryinformationinbothdirections

Bidirectional Forwarding Detection; BFD


continuitycheckprotocolformonitoringconnectivityinpacketnetworks

bidirectional IRP
integrationreferencepoint(IRP)whichconsistsofinterfacesthatareusedfor
communicatinginbothdirections

bidirectional protection switching


protectionswitchingforaunidirectionalfaultinwhichbothtrafficdirections,includingthe
affecteddirectionandtheunaffecteddirection,areswitchedtoprotection

Issue:28

147

GeneralGlossary

BID measurement; BID protocol measurement


measurementthatsumsupalltheeventsrelatedtothebindingidentifier(BID)
allocations

bids per circuit per hour; BCH


indicationoftheaveragenumberofbidspercircuitinaspecifiedtimeinterval

big endian; big-endian


formatforstorageortransmissionofbinarydatainwhichthemostsignificantbit(orbyte)
comesfirst

Bi interface
interfacebetweentheIMSchargingfunction,thatis,theonlineservicecontrolleror
charginggateway,andthebillingsystem

bilateral control
controlbetweentwosynchronisationnodessuchthatthefrequencyoftheclockofeach
ofthesenodesisinfluencedbytiminginformationderivedfromtheclockoftheother
node

billing
functionwherethedatareceivedfromchargingisusedtogeneratebillsforsubscribers

billing centre /GB/; billing center /US/; post-processing; operator's postprocessing system; post-processing system
operator'ssystemwheretheoperatorgeneratesbillsfromthechargingdatarecords
(CDR)

billing centre gateway /GB/; billing center gateway /US/; BCGW


gatewayintheservicemanagementaccesspoint(SMAP)prepaidbusinesslogicthat
receivesandlogscharginginformationforcall-unrelatedeventsinthedatabase,
generateschargingrecords(CDR)inappropriateformatfromdatabaseentries,stores
CDRsinfiles,andmanagesthesefilesinsuchawaythatamediationdeviceorbilling
centrecanconnecttothestoragemediumanduploadthegeneratedCDRfiles

billing computer; billing centre /GB/; billing center /US/


administrativecomputerthatprocessesthebillsandhandlestheinvoicingofthe
subscriber

148

Issue:28

GeneralGlossary

billing cycle
timeperiodduringwhichchargesaccumulateinanaccountbeforearequestfor
paymentisgenerated

billing domain; BD
partoftheoperatornetworkthatisoutsidethecorenetwork,andthatreceivesand
processescharginginformationfromthecorenetworkchargingfunctions

billing functions
functionswhichcollectdatafromnetworkelements(NE)whichisusedtodetermine
chargestocustomeraccounts

billing integrity
preservationofaccuracyaccordingtospecifiedperformanceparametersandcriteria
whenpreparingbillstoauserforaservice

billing interface; BIF; billing centre interface /GB/; billing center interface
/US/; BC interface
interfacebetweenanetworkelementandabillingcentre

billing management
setoffunctionsusedtocontroltheformingofchargingrecords(CDR)andtransferringof
themtothebillingcomputer

billing manager
managerthatretrievesonlybillinginformationandgenerateschargingrecords(CDR)for
thelogrecords

billing period; charging period


periodduringwhichthetelephonebillisgathered

billing system; BS
systemthatperformsthebillingprocess

BIM
barringofinvocationofcalltransfer(BI)whenthereisanexistingtransferredcallforthe
servedsubscriberinthesamemobileservicesswitchingcentre/visitorlocationregister
(MSC/VLR)

Issue:28

149

GeneralGlossary

BIM neighbour
cellthatispartofthebackgroundinterferencematrix(BIM)table

BIM scaling
processofcomparinganddeterminingthemeasuredandstatisticalcarrier-tointerferenceratio(C/Iratio)ofthebackgroundinterferencematrix(BIM)andcalculatinga
factorthatcorrespondstotheaveragedifference

BIM table
listofcellsthatspecifiesthecarrier-to-interferenceratio(C/I)ofallthecellsthatcan
causeinterferenceforthecell

binary coded signalling /GB/; binary coded signaling /US/; BCS; binary
signalling /GB/; binary signaling /US
communicationsmodeinwhichinformationispassedbythepresenceandabsence,or
bytheplusandminusvariations,ofoneparameterofthesignallingmediumonly

binary digital signal


digitalsignalwhichcanhavetwodiscretevalues

binary file
filecontaininginformationinmachine-readableform

binary large object; BLOB


largeblockofdatastoredinadatabase,suchasanimageorsoundfile,whichhasno
structurewhichcanbeinterpretedbythedatabasemanagementsystembutisknown
onlybyitssizeandlocation

binary mode
formatofrepresentingdatatobetransmittedfromonecomputertoanotherthatenables
everytypeofdatatobetransferredorcompared

binary output
outputinbinaryformatwhichcannotbeoutputassuch

binary phase shift keying; BPSK; two-phase shift keying


phaseshiftkeyingusingtwophasestates

150

Issue:28

GeneralGlossary

binary report
reportinbinaryformatwhichisstoredonmagnetictapeormoveddirectlytoastatistical
post-processingdeviceoutsidethenetworkelement

binary search; dichotomising search


searchinwhichanorderedsetofitemsisdividedintotwoparts,oneofwhichisrejected.
Thesearchisrepeatedintheacceptedpartuntilitiscompleted

binding
incomputer,communications,andautomaticdataprocessingsystems,assigningavalue
orreferenttoanidentifier

binding
associationthatisvisibleinthemediaproxybetweentwotransportaddresses

binding command
commandthattheSIPapplicationlayergatewayusestorequestamediaproxyto
create,delete,ormodifyabinding

binding identifier; BID; binding ID


identifierthatistheconnectingfactorofcallsignallingatthecontrolplaneandATM
adaptationlayer(AAL)signallingattheuserplane

binding information
informationwhichtiesaspecificservicetypetoacertainsetofrules

BIOS mode
operatingmodebasedonBIOS(basicinput/outputsystem)usedtoloadnewfirmware

bipolar 8 zero substitution; B8ZS; binary 8-zero substitution


techniqueinwhichanystringofeightconsecutivezerosisreplacedwithaspecialcode
patternwhichtheremoteendcanrecognise,andthusconvertbacktoapatternofeight
zeros

BIRZ
barringofincomingcallswhenroamingoutsidethecountrywherethezoneofthehome
network(HPLMN)is

Issue:28

151

GeneralGlossary

B-ISDN inter-carrier interface; B-ICI


networknodeinterfacebetweentwodifferentpublicnetworkprovidersorcarriers

bit-based switching matrix


switchingmatrixinwhichconnectionsareestablishedatthebitlevel

bit error
incompatibilitybetweenabitinatransmitteddigitalsignalandthecorrespondingbitin
thereceiveddigitalsignal

bit error probability; BEP


probabilitythatareceivedbitisinvertedwithrespecttothecorrespondingbitsent

bit error ratio; BER


ratioofthenumberofbiterrorstothetotalnumberofbitstransmittedinagiventime
interval

bit group switch; GSWB


switchthatconveysthetrafficthatpassesthroughthebasestationcontrollerand
switchesthetonestothesubscribersoftheexchangeandtothetrunkcircuits

bit integrity
reproducingthebinaryvaluesofbitsinanoctetattheoutputofasystemexactlyasthey
wereattheinput

bit interleaved parity check; BIP


paritycheckingmethodthatisusedtomonitorbiterrorsinanSDHnetwork

bit interleaving
multiplexinginwhichdatafromthelow-speedchannelsisintegratedintothehigh-speed
bitstreamonebitatatime,thatis,onebitfromchannel1,onebitfromchannel2,...,
onebitfromchanneln

bit map
datafileorstructurewhichcorrespondsbitforbitwithanimagedisplayedonascreen

152

Issue:28

GeneralGlossary

bit map of UE faults; BMUEF


UE-specificbehaviourinformationthatpointstothespecificfaultsofcertaintypesofuser
equipment(UE)

bit number; BN
numberthatidentifiesthepositionofaparticularbitperiodwithinatime-slot

bit pattern; bit combination


orderedsetofbitsfortherepresentationofinformation

bit rate; binary digit rate


rateatwhichbinarydigitspassagivenpoint

bit rate tolerance


featurethatindicateshowadevicetoleratesbitratevariationfromaspecifiedvalue

bit sequence; bit string


stringofbinarydigitsinwhicheachbitpositionisconsideredtobeanindependentunit

bit sequence independence; bit transparency


propertyofabinarytransmissionchannel,telecommunicationcircuitorconnection,that
permitsallsequencesofbinarysignalelementstobeconveyedoveritatitsspecifiedbit
rate,withoutchangetothevalueofanysignalelements

bit synchronous mapping


synchronousmappinginwhichsignalsareprocessedbitbybit

bit timing
timinginformationsentfromtheexchangeterminationusedbythelineterminationto
recoverinformationfromthedigitalbitstream

bit transparent connection


directconnectionoftheD-channelsthroughtheGroupSwitch(GSW)without
interworkingfunctions'(IWF)resources

Issue:28

153

GeneralGlossary

bit transparent operation; bit transparent mode


operationthatprovidesforthetransportofdatatransparentlywithoutalignmentof
informationfromtheinterfaceattheRreferencepointwithintheframetransportinthe
bearerchannel

black box
memoryareaofacomputertowhichadatacollectionprogramcopiesdefineddatafrom
elsewhereinthememorywhenacomputerisrestarted

blacklist; black list


listofmobileequipmentthateitherdoesnotfunctionproperly,isstolenorillegal,or
whoseuseisotherwiseprevented

blacklist
listofinternethostaddressesandaddressrangeswhicharenotavailablefromthe
accesszone

blade
relativelythin,card-likeplug-inunitthatcanbeinsertedinachassisorshelftoprovide
anelectronicfunction

blind handover
handoverthatthebasetransceiverstationinitiatesandinwhichitsimplytransfersthe
mobileterminalwithallrelevantparameterstoatargetcellwithoutrequiringachannel
qualitymeasurement

block
unitofinformationconsistingofaheaderandaninformationfield

block; software block


softwareentitywhichisvisibletotheoutsideastheservicesitusesandoffers

block
setofconsecutivebitsassociatedwiththepath,eachbitbelongingtooneandonlyone
block

block buffer
buffer,locatedintheRAMmemory,wheredatablocksarestored

154

Issue:28

GeneralGlossary

block check sequence; BCS


checksequencethatisaddedtoadatablockandusedtodetecterrorsincodetransparentorcode-independentdatatransmission

block cipher method; block cipher


symmetricencryptionalgorithmwherecharactersofamessagearegroupedintoblocks
whicharetransformedasawhole

block definition
definitionofablocknameandtypeandoftheservicesofferedandusedbyit

blocked; BL
stateofafunctionalunitwhenithasbeenblockedfromoperationanddoesnot
participateincallset-up

blocked command queue


queuetowhichtaskswhicharefoundsemanticallyorsyntacticallyfaultyaretransferred

block error
oneormorebiterrorswithinablockofbits

block error detection code; BEDC


16-bitbitinterleavedparitycheck(BIP)codecalculatedovertheinformationfieldsof
usercellstransmittedsincethelastforwardmonitoringOAMcell

block error ratio; BLER; block error rate


ratioofthenumberofincorrectlyreceivedblockstothetotalnumberofblocks
transferred

block header; BH
groupofselectableinformationfieldswhichausercanselectwiththeformfileeditorand
fillwithaformatterprocesswhichsavesthemtothebeginningofadatablock

block header charging record; HEA CDR


chargingrecordthatisgeneratedinthemobileswitchingcentreforthebeginningofeach
chargingblock

Issue:28

155

GeneralGlossary

block hierarchy
hierarchicstructureoftheDX200systemsoftwaredescribingsystemblocks,service
blocksandprogramblocks

block implementation
descriptionontheimplementationofservicesofferedbyablock

blocking; circuit blocking


takingacircuitofaswitchedtrunkcircuitgroupintheincomingdirectionoutofuse

blocking
situationinwhichnopathsareavailabletocompleteacircuitorinwhichoneactivity
cannotbeinitiateduntilanotherhasbeencompleted

blocking
inthetwo-phasecommitprotocol,thestateofasubtransactionwhenithasdecidedto
commitbutdoesnotgetthedecisionofothersubtransactionsfromtheco-ordinator

blocking rate
number(percentage)ofconnectionattemptswhichmayendupincongestionina
networkelement

block message
messagecontainingreferencetoaseparatedatablock

block payload
bitsintheinformationfieldwithinablock

block trailer
groupofselectableinformationfieldswhichausercanselectwiththeformfileeditorand
fillwithaformatterprocesswhichsavesthemtotheendofadatablock

block trailer charging record; TRA CDR


chargingrecordthatisgeneratedinthemobileservicesswitchingcentreattheendof
eachchargingblock

156

Issue:28

GeneralGlossary

blog; weblog; web log


personalonlinepublicationthatoftenconcentratesonspecifictopicsandisupdated
regularlywithtime-stampedposts

blog service
webserviceforcreatingandpublishingblogs

Blowfish
blockciphermethodwithablocksizeof64bitsandakeylengthofupto448bits

BL-SY state; BL-SY


stateofafunctionalunitwhenithasbeenblockedbythesystem

Bluetooth
technologydesignedtobeembeddedinelectronicdevicesinordertoprovidewireless
andseamlessconnectionsovershortdistances,thusprovidinganalternativetocablebasedinterfacescurrentlyinusetolinkcomputersandcomputerperipherals

Blu-ray Disc; BD
opticaldiscthatisusedtorecord,rewriteandplaybackhigh-definitionvideo,andtostore
data

Bm interface; Bm
chargingdatacollectioninterfacebetweenamultimediamessagingservice(MMS)relay
serverandabillingsystem(BS)

BNC characteristics; bearer characteristics


informationwhichisexchangedbetweenservingnodes(SN)inordertoidentifythe
selectedbearernetworkconnection(BNC)type

BNC connector; BNC; BNC coax connector; bayonet Neill Concelman


connectorforcoaxialcableconnectionsthatisusedinsituationswhichrequireshielded
cableforsignalconnectionsorcontrolledimpedance

BNC cut-through; cut-through


signallingobjectthatindicateswhenthroughconnectionofabearernetworkconnection
(BNC)hasoccurredineitheroneorbothdirections

Issue:28

157

GeneralGlossary

board information block; BIB


inanon-volatilerandomaccessmemory(NVRAM),amemoryblockwhichcontains
variouselementsconcerningtheoperatingparametersofthehardware

board support package; BSP


partoftheChorusoperatingsystemwhichcontainsalldriversnecessaryforbootingup
theoperatingsysteminthegivencentralprocessingunit(CPU)andboardconfiguration

body loss
decreaseintheantennapowerlevelthatiscausedwhentheantennaisclosetotheuser

bonding interface
logicalinterfacethatconsistsofmultipleaggregatedEthernetinterfaces

booking form; order form


intheassistantservicesplatform,aformtowhichdataonacallbookingarefilledin

booking office
operatingsystemsoftwarethatsupportstheuseoftheticketservicemethod

bookmark group
setofbookmarkswithacommonname

bookmark request
shortmessagebywhichtheend-usercanrequestbookmarksofacertainbookmark
group

boolean; bool
typedefinedinapredefinedtypedefinitionwhichhasthevalues"true"and"false"

boot; IPL; initial program load


startingupacomputerbyloadingaprogramintomemoryfromanexternalstorage
mediumsuchasadiskortape

boot (verb)
toloadandinitialisetheoperatingsystemofacomputer

158

Issue:28

GeneralGlossary

bootable archive; system image; boot archive; bootfile


executablefilewhichcontainsaconfiguredversionoftheoperatingsystemandpossibly
someuser-definedapplications

boot actor
actorthatisloadedattheboottimeasapartofthebootarchivewiththeChorusOS
system

boot disk
magneticdiskfromwhichanoperatingsystemkernelisloaded

boot flash; bootflash


separateflashmemoryusedprimarilytostoreinformationrelatedtothesystem
configurationandsomehelpinformation

boot image
bootablearchivethatcontainsaninstanceofanoperatingsystemandapplication
programsfortheuseofahost

booting
settingofcomputertothestateinwhichtheinitialloadingcanbestarted

boot loader; bootstrap loader


programthatisthefirstonetostartwhenacomputeristurnedonandthatloadsenough
othersoftwarefortheoperatingsystemtostart

boot loading; pre-boot; preboot


loadingofsoftwarebuild,whichperformstheinitialloading,fromacomputer'slocalnonvolatilememory

boot memory
externalmemorythatprovidesamethodtoautomaticallyloadaprogramintotheinternal
memoryofadigitalsignalprocessor(DSP)afterapower-uporsoftwarereset

boot monitor; boot program


programcarryingouttheboot

Issue:28

159

GeneralGlossary

boot package; flash memory boot package


softwarepackagethatisstoredintheflashmemoryandthatcontainstheimageofa
bootablearchiverequiredtostartthecomputer

boot partition
baseplatformpartitionthatisduplicatedintheFlexiPlatformforboottimeredundancyfor
nodesthathaveaccesstothebaseplatformdisks

BOOTP relay agent; relay agent


internethostorrouterthatpassesDynamicHostConfigurationProtocol(DHCP)
messagesbetweenDHCPclientsandDHCPservers

BOOTPS configuration file


configurationfile,locatedonaRAMdiskofthehostcomputer,whichcontains
configurationdataofinterfacecomputersofthehostcomputer

bootstrap(verb)
toloadandinitialisetheoperatingsystemonacomputer

bootstrapping
loadingofaprogramusingapartoftheprogramthathasbeenloadedearlieror
composingaprogramminglanguagetranslatorusingthetranslatedtextaslanguage

bootstrapping server function; BSF; bootstrapping function


functionwhichmutuallyauthenticateswiththeuserequipment(UE)byusingthe
authenticationandkeyagreement(AKA)procedure,andagreesonsessionkeysthat
arethenappliedbetweentheUEandanoperator-controllednetworkapplicationfunction
(NAF)

bootstrap processor; BSP


processorthatisthefirstonetostartinamultiprocessorcomputer

Bootstrap Protocol; BOOTP


protocolthatanetworknodeusestodeterminetheIPaddressofitsEthernetinterfaces,
inordertoaffectnetworkbooting

160

Issue:28

GeneralGlossary

bootstrap protocol server; BOOTPS; BOOTP server


serverwhichsupportstheIP/UDPbootstrapprotocol(BOOTP),allowingdisklesshosts
(BOOTPclients)toconfigurethemselvestotheIPnetworkandfindaremoteIPhost,
fromwhichtheycanloadabootablearchiveintotheirmemoryandexecuteit

bootstrap provisioning
provisioningwheretheterminalreceivesthesettingsforthefirsttime

border gateway; BG
GPRSnetworkelementwhichensuresasecureconnectionbetweenvariousPLMNs
(publiclandmobilenetworks)overtheinter-PLMNbackbonenetwork

border gateway protocol; BGP


routingprotocolthatisusedbetweenautonomoussystemstoexchangenetwork
reachabilityinformationandthatisdesignedtodetectroutingloops

border gateway protocol 4; BGP-4; BGP4


version4ofthebordergatewayprotocolthatsupportsclasslessinterdomainroutingand
usesrouteaggregationmechanismstoreducethesizeofroutingtables

border router; BR; ABR; area border router


routerlocatedontheborderofoneormoreopenshortestpathfirst(OSPF)areas,which
actsasagatewaybetweentwoormoreopenshortestpathfirstareasandwhich
connectsthoseareastotheOSPFbackbonenetwork

bot; internet bot; web robot


programthatisabletooperateindependentlywithinsetlimits,especiallyintasksthat
requireagreatamountofwork,repetition,constantupdating,orroutines

both-way bundle
bundlewhichtransmitsoutgoingandincomingtrafficoftheexchangeconsidered

both-way circuit group; mixed circuit group


circuitgroupthattransmitsoutgoingandincomingtrafficoftheexchangeconcerned

botnet
computernetworkthatconsistofzombiesandthatisusedformaliciousorillegal
purposes

Issue:28

161

GeneralGlossary

bottom-up method
techniqueinwhichthelowestlevelsofinstructionsarecombinedtoformahigher-level
operation,whichinturnmaybeusedintheformulationofevenhigher-levelroutines

boundary node
nodethatcontainsacollectionoffunctionsneededtointerconnectthedifferentiated
service(DS)domaintoanotherDSdomainornon-DS-capabledomain

bound rate
parameterthatexpressesthehighestpossiblecallingrate

box controller node; BCN


genericandscalablehardwareplatformthatcanbeusedtoimplementawiderangeof
processing-intensivetelecommunicationproductsthatserveasacontroller,gateway,or
server

BOZH
barringofoutgoinginter-zonalcallsexceptthosedirectedtothecountryofthe
subscriber'shomenetwork

BOZIH
barringofoutgoinginternationalcallsexceptthosedirectedtothecountryofthe
subscriber'shomenetwork,andbarringofoutgoinginter-zonalcalls

Bp interface; Bp
chargingdatacollectioninterfacebetweenacharginggatewayfunction(CGF)anda
billingsystem(BS)

B-priority
functionwhichisusedtoindicatethatsubscriberBisprioritisedandthecallistreatedas
aprioritycall

BPSH
barringofpacket-orientedservicesfromaccesspointsthatarewithinthehomenetwork
whilethesubscriberisroaminginavisitednetwork

BPSR
barringofallpacket-orientedserviceswhilethesubscriberisroaminginavisited
network

162

Issue:28

GeneralGlossary

BPSV
barringofpacket-orientedservicesfromaccesspointsthatarewithinthevisitednetwork
inwhichthesubscriberisroaming

branch
channelinamultipointconnection

branch
selectonefromanumberofalternativesetsofinstructions

branch
celloritssectorwhichthemobilestationcanaddto,replace,ordeletefromitsactiveset
ofcellsparticipatinginsofthandover

branch
sectionofanRFmodulethatcontainsatransmitterandreceiverandcancreateone
sector

branching
distributionofdigitaltransmissionchannelstoothertransmissionpathsinchainandtree
networks

branching station
stationwhichdistributesoneormoretransmissionchannelstoothertransmissionpaths

branching table
tablethatisstoredinanon-volatilememoryandthatdefinesthebranchingsof
equipment

break-in/break-out
servicewhichprovidesagatewayfunctionbetweenabusinessgroupandthepublic
telephonenetwork(PSTN)ortheintegratedservicesdigitalnetwork(ISDN)

breakout gateway control function; BGCF


functionthatselectsthenetworkinwhichaPSTN/circuit-switched(CS)domainbreakout
willoccurforthesession

Issue:28

163

GeneralGlossary

BRI
barringofregistrationofinternationalforwarded-tonumber

bridge (verb)
totransmitidenticaltrafficonboththeworkingandprotectionchannels

bridge
gatewaythatconnectsandpassespacketsbetweentwonetworksegmentsinthesame
network

bridge protocol data unit; BPDU


protocoldataunitthatcarriesSpanningTreeProtocolinformation

bridge table; bridging table


tablethatidentifiesdestinationaddressesknowntoexistinanetwork

bridging
connectingandpassingpacketsbetweentwonetworksegments

BRIH
barringofregistrationofinternationalforwarded-tonumberexceptthenumberwithinthe
homepubliclandmobilenetwork(PLMN)country

broadband access network


accessnetworkthatenablesmulti-servicenarrowbandandbroadbandaccess

broadband activation
processofmakingandregisteringacontractforabroadbandsubscriptionandactivating
thesubscription

broadband communication channel


specificportionoftheinformationpayloadcapacity,availabletotheuserforISDN
services.Abroadbandcommunicationchannelexistsonlyduringacall,assetupbya
signallingoradministrativeprocedure

broadband connection; broadband internet connection


connectioninwhichthedownlinkdatatransmissionrateishigh

164

Issue:28

GeneralGlossary

broadband installation
actionsthataremadeinthecustomerpremisestocreatethedataconnectionthatis
requiredforusingabroadbandsubscription

broadband integrated services digital network; B-ISDN; BISDN; BB-ISDN;


IBCN; broadband ISDN; integrated broadband communications network
integratedservicesnetworkusingATMdatatransmissiontechnology

broadband ISDN user part; B-ISUP; BISUP


SS7protocolthatdefinesthesignallingmessagestocontrolconnectionsandservicesin
B-ISDN

broadband MTP3; MTP3b; message transfer part level 3 for broadband


networks
broadbandversionofthesignallingsystemNo.7(SS7)MTP3protocol,whichisrunover
linkservicesprovidedbythesignallingATMadaptationlayernetworknodeinterface
(SAAL-NNI)

broadband remote access server; BRAS


accessserverthatroutestraffictoandfromthedigitalsubscriberlineaccess
multiplexersonaninternetserviceprovidersnetwork

broadband service provider


serviceproviderthatprovidesbroadbandconnectionsandbroadbandsubscriptions

broadband signalling connection control part /GB/; broadband signaling


connection control part /US/; SCCPb
broadbandversionofthesignallingconnectioncontrolpart(SCCP)whichuseslonger
messagestructuresthantheSCCP

broadband SS7; broadband signalling system No.7 /GB/; broadband


signaling system No.7 /US/
versionofsignallingsystemNo.7thatisoptimisedforbroadbandcommunication

broadband subscription; broadband access


subscriptionforabroadbandinternetconnectionwithanagreeddatatransmissionrate
andoptionallyforotherrelatedservices

Issue:28

165

GeneralGlossary

broadband television; IPTV


televisionserviceprovidedbyatelecommunicationscompanyinitsnetworkandtypically
watchedonatelevisionset

broadband wireless access; BWA


wirelessaccessinwhichtheconnectioncapabilitiesarehigherthantheprimaryrate

broadcast; BC
unidirectionaldistributiontoseveralusers

broadcast; BC
switchingmechanismforconnectinganvirtualcontainerinanincomingsignaltotwoor
moreoutputports

broadcast and unknown server; BUS


multicastserverusedinemulatedlocalareanetworks(ELAN)thatisusedinflooding
trafficaddressedtoanunknowndestinationandinmulticastingandbroadcastingof
traffictotheappropriateclients

broadcast channel; BCH


downlinktransportchannelthatisusedtobroadcastsystem-specificandcell-specific
information

broadcast control channel; BCCH


channelfromabasetransceiverstationtoamobilestationusedfortransmissionof
messagestoallmobilestationslocatedinthebasetransceiverstationarea

broadcasting
unidirectionaltransmissionofdatabetweenasinglesenderandseveralunknown
recipients

broadcast/multicast control; BMC


sublayeroflayer2inradionetworkcontroller(RNC)andmobilestation(MS)devotedto
broadcastingcellbroadcastservice(CBS)messagestomobilestationswithinacertain
areaofaPLMN

166

Issue:28

GeneralGlossary

broadcast multicast service; BCMCS; MCBCS; broadcast/multicast


service; multicast broadcast service
3GPP2servicethatprovidestheabilitytotransmitthesameinformationstreamto
multipleuserssimultaneously

broadcast service area code; SACB


serviceareacodeforthecellbroadcastservicearea

broadcast storm
incorrectpacketbroadcastonanetworkthatcausesmosthoststorespondallatonce,
typicallywithwronganswersthatstarttheprocessoveragain

broadcast suppression
methodforpreventingbroadcasttrafficfromoverwhelmingthenetwork

BRZ
barringofregistrationofinter-zonalforwarded-tonumber

BRZH
barringofregistrationoftheinter-zonalforwarded-tonumberexceptthenumberwithin
thehomepubliclandmobilenetwork(PLMN)country

BSC-BSC interface; BBI


interfacethatisusedtoexchangechannelreservationandmeasurementinformation
betweenneighbouringbasestationcontrollers(BSC)runningthedynamicfrequencyand
channelallocationalgorithm

BSC id
C-numberofthebasestationcontrollerwhichisauniqueidentificationgivenbythe
logistics

BSC-initiated traffic reason handover; BSC-initiated TRHO


featureinadvancedmultilayerhandlingthatdirectstraffictotheappropriatecell
accordingtotheprevailingloadofthenetwork

BSC number
numberidentifyingthebasestationcontroller(BSC)inamobileservicesswitching
centre(MSC)

Issue:28

167

GeneralGlossary

Bs interface; Bs
chargingdatacollectioninterfacebetweentheservicecontrolfunction(SCF)anda
billingsystem(BS)

BSR layer; BCCH super-reuse layer


superlayeronwhichthetransceivershavelowertransmissionpowerthanthe
transceiversontheothersuperlayers

BSS-A
basestationsubsystemfromwhichthemobilestationisbeinghandedover

BSSAP'
non-standardbasestationsystemapplicationpart(BSSAP)thatisusedbetweenthe
mobileservicesswitchingcentre(MSC)andMultimediaGatewayRel.99(MGW)

BSS application part plus; BSSAP+


basestationsystemapplicationpart(BSSAP)thatisusedtosupportsignallingbetween
thevisitorlocationregisterandservingGPRSsupportnodeontheGsinterface

BSSAP protocol measurement


measurementthatprovidesinformationontheprotocolmessagetransactionsontheA'
interface

BSSAP signalling /GB/; BSSAP signaling /US/


signallingthatisbasedontheuseofthebasestationsystemapplicationpart(BSSAP)
andthatisusedwithinthecontrolplanetraffic

BSSAP version
uniquenumberwhichidentifiesabasestationsystemapplicationpart(BSSAP)service
profiledescription

BSS-B
basestationsubsystem(BSS)towhichthemobilestationisbeinghandedover

BSSGP virtual connection; BVC


end-to-endvirtualcommunicationpathbetweenremotenetworkserviceuserentities

168

Issue:28

GeneralGlossary

BSSGP virtual connection identifier; BVCI


identifierofaBSSGPvirtualconnection(BVC),havingend-to-endsignificanceacross
theGbinterface

BSS packet flow context; BSS PFC; PFC; packet flow context
procedurethatenablesthetransferofqualityofservice(QoS)parametersbetweenthe
corenetwork(CN)andthebasestationsubsystem(BSS)

BSS packet flow timer; PFT; packet flow timer


timerthatindicatesthemaximumtimethebasestationsubsystemmaystorethepacket
flowcontext

BSS synchronisation
synchronisationinwhichallBTSsitesinthesynchronisationareaarefixedtoasingle
externalclocksource,andtheconnectionsindifferentcellsarealignedand
synchronisedattimedivisionmultipleaccess(TDMA)burstlevel

BTS AAL2 multiplexing


featurethatimprovesthestatisticalmultiplexinggainintheATMadaptationlayertype2
(AAL2)

BTS AAL2 multiplexing; AAL2 multiplexing


processofmultiplexingandconcentratingindividualAALtype2(AAL2)connectionsin
AAL2virtualchannelconnectionsthatarecomingfromdifferentwidebandapplication
managersofasinglebasetransceiverstationintoaminimisednumberofAAL2virtual
channelconnectionstowardstheradionetworkcontroller

BTS alarm handling; handling of BTS alarms


partofradionetworkmaintenanceinbasestationcontroller(BSC)whichcollectsfault
indicationsofthesystem,handlesthem,activatestheradionetworkrecoverywhen
neededsothattheautomaticrecoveryactionsarestarted,andinformstheuserofthe
faultsbyalarmreports

BTS clock system


synchronisationsourceinabasetransceiverstation(BTS)thatisconnectedtothetraffic
trunksortoanexternalsynchronisationsource

BTS diagnostics
combinationoftoolsinabasetransceiverstation(BTS)todetermineanactualfaultwith
therulemechanism

Issue:28

169

GeneralGlossary

BTS digital signal processor; BTS DSP


digitalsignalprocessor(DSP)thatprovidesdedicated-blocksignal-processingpower
permanentlyforoneradiotime-slotinabasetransceiverstation(BTS)

BTS fault recovery; BTS recovery


partofradionetworkmaintenanceinbasestationcontroller(BSC)whichminimisesthe
effectoffaultsintheradionetworkontheservicelevelprovidedbythebasestation
system(BSS)andwhichcontrolsinitialisationswhenthereareresetsandrestartsinthe
BSSradionetwork

BTS ID; BSID; base station identifier


identifier(ID)thatabasetransceiverstation(BTS)usestoidentifyitselftothenetwork

BTS integrated AXC


ATMcross-connect(AXC)connectingthebasetransceiverstation(BTS)totheradio
networkcontroller(RNC)throughtheIubinterfaceviastandardPDHandSDHinterfaces

BTS local blocking


featurethatisusedtoblockthebasetransceiverstationwiththeBTSmanagerlocallyto
enabledifferentoperations,suchasserviceoperations

BTS manager; BTS EM; base station element manager


elementmanagerthatisusedtomonitorandcontrolabasetransceiverstation

BTS number
numberidentifyingthebasetransceiverstation(BTS)inamobileservicesswitching
centre(MSC)

BTSOM interface; BTSOM; BTS operation and maintenance interface


interfacebetweenabasetransceiverstation(BTS)andtheoperationandmanagement
server

BTS radio resource indication


procedureusedtoinformabasestationcontrollerabouttheinterferencelevelsonidle
andbusytrafficchannelsofatransceiver

BTS site; base transceiver station site


entirebasetransceiverstationsitethatincludesallprocessorunitssuchasthe
OperationandMaintenanceUnit(OMU),FrameUnit(FU)andCarrierUnit(CU)

170

Issue:28

GeneralGlossary

BTS site manager; BTSSM; SM; site manager


Java-baseduserinterfaceapplicationthatisusedtomanageabasetransceiverstation
(BTS)andtransmissionequipment

BTS site rehosting


movingthecontrolofaBTSsitefromoneradionetworkcontroller(RNC)orbasestation
controller(BSC)toanother

BTS site type


identificationofthetypeoftheBTSsite

bucket
unitofstorageonadirectaccessdevicefromwhichdatacanberetrieved

bucket leak rate; leak rate


informationelementthatindicatestheleakratetobeappliedtoaflowcontrolbucket

bucket round robin; BRR


algorithmthatcanbeusedtoprovidedifferentiatedservicesforeachsupportedtraffic
class

buffer; buffer memory; buffer storage


memoryareausedtostoredatatemporarilywhenthedataisdeliveredatadifferent
rate,atdifferenttime,orindifferentorderthanitwasreceived

buffer limit control; BLC; message queue observation


observationwithapurposetorestricttheunit'sloadindifferentloadsituationsandto
preventthemessagebuffersfromrunningout

buffer limit control gate; BLC gate


thresholdvalueforthenumberofunhandledmessageswhichisusedinbufferlimit
controlinthemessagebufferareaofacomputerunitasthecriterionofprotectiveaction

buffer management
functionthatselectswhichcellsorframesaredroppedwhenthereiscongestioninthe
networkelement

Issue:28

171

GeneralGlossary

buffer management and scheduling


trafficmanagementfeaturewhichcoversthebufferreservationrulesandcongestion
controlmechanisms,andtheorderfortransmissionofindividualcellsfromthebuffer

buffer overflow
overflowinwhichaprogramwritesdatabeyondtheallocatedendofabufferina
memory

buffer overflow attack


securityattackinwhichtheattackeroverflowsabuffersothatiteventuallyoverwritesthe
returnaddressoftheprogramcode,andthuscausestheapplicationtocontinue
executinginalocationselectedbytheattacker

build descriptor file


filethatincludesfiledescriptions,fileversions,informationonhardwareunits,andthe
softwarefileserveraddressforasoftwarebuild

building integrated timing supply; BITS; SSU; synchronisation supply unit


/GB/; synchronization supply unit /US/
clockthatprovidesanddistributestimingtoawirelinenetwork'slowerlevels

building of program block


packagingofaprogramentitywiththehelpofabuildingprocedurefile

building procedure; building procedure file


commandprocedurewhichfetchesthesoftwaremoduleswithcorrectversionsfromthe
database,translatesthesourcemodulesintoobjectmodules(OBJ),linkstheobject
modulestogether(LNK)andtransformsthemintoloadablemodules(IMG,MTF,MML)

build-operate-transfer mode; BOT


networkoperatingservicethatNSNprovidesforitscustomerforadefinedperiodoftime

built-out delay
maximumvariabletransmissionandprocessingdelaythatispermittedinawideband
network

bulk bus
logicalmessagebusdedicatedtomassivedatatransmission(forexample,loading
messages)

172

Issue:28

GeneralGlossary

bulk deletion tool


bulktoolusedwhenservicesaredeletedfromseveralsubscribersatthesametimeor
whenthewholeserviceiswithdrawn

bulk info
fieldinacalldatamessagethatdeterminesifthestandardticketofcaseiscreatedand
savedwhenthelinkinfoisset

bulk provision tool


bulktoolusedfortheprovisioningofprepaidservicetoseveralsubscribersatthesame
time

bulk tool
servicemanagementtoolusedwhenitisnecessarytohandleseveralsubscribersatthe
sametimeinthesameway

bump-in-the-stack; BIS; BITS


techniqueinwhichmodulesareinsertedintothehosts,whichsnoopthedataflow
betweenaTCP/IPv4moduleandnetworkcarddrivermodules,translateIPv4intoIPv6
andviceversa,andmakethehostsself-translators

bunched frame alignment signal


framealignmentsignalinwhichthesignalelementsoccupyconsecutivedigittimeslots

bundle
groupoftrunkcircuitsbelongingtothesamecircuitgroupandhavingthesamedirection
andthesamesupervisorysignallingmethod(DX200)

bundling
optionalmultiplexingoperationinwhichmorethanoneuser'smessagesarecarriedin
thesamestreamcontroltransportprotocol(SCTP)datagram

bureau service
customerservicewhichconsistsofproducingreportsandlistingsforcustomers,
preparingtheprintouts,anddeliveringtheminanon-electronicway

burst; NB; normal burst; active part of time-slot


periodofmodulatedcarrierlessthanonetime-slotwhichformsthephysicalcontentofa
time-slot

Issue:28

173

GeneralGlossary

burst
sequenceofalimitednumberofdistinctpulsesoranoscillationoflimitedduration

burst sequence
sequenceofburstsduringtimesharedoperation,startingwithagivenbasestationand
endingwhentransmissionagainstartsfromthesameBTS

burst synchronisation
synchronisationoftimedivisionduplex(TDD)burststhatisachievedbyconnecting
severalmasterradioswiththesynchronisationbusandselectingoneofthemtoactas
thesynchronisingmasterunit

burst tolerance; BT
parameterdefinedbytheATMForumforATMtrafficmanagementdeterminingthesize
ofthemaximumburstofcontiguouscellsthatcanbetransmittedinvariablebitrate
(VBR)connections

bursty traffic
trafficwhichoccasionallyconsistsoflargeamountsofbitstobetransferred,whileat
othertimestheconnectionisalmostidle

bus; data path; highway /US/


commonpathwithinanapparatusorsystemoragroupofparallelpathscarrying
messagesfromonecomputertoanother

business automatic call distribution; ACD; BACD; automatic call


distribution for businesses; business ACD
automaticcalldistributioninwhichincomingcallsaredistributedequallyamongagroup
ofagents

business blog; corporate blog; b-blog


blogthatacompanymaintainsforitsownuse

Business Communication Server


NSNproductthatprovidespersonalusersandenterprisegroupswithsimilarcall
handlingfeaturesasaprivateautomaticbranchexchange

business logic; BL
functionalalgorithmthatprescribeshowbusinessobjectsinteractwithoneanother

174

Issue:28

GeneralGlossary

business logic extension point


user-writtencodethatprovidesanextended,customisedsetoffunctionsthatcanbe
appliedtobusinesslogicthatsupportstheuseofextensionpoints

business logic tier


partoftheoperationssupportsystemsoftwareandhardwarethatconsistsofthe
applicationserversthathandletheactualbusinesslogic

business management layer


managementlayerwhichhasresponsibilityforthetotalenterpriseandisthelayerat
whichagreementsbetweenoperatorsaremade

business operation support systems input zone; BOSS IZ


mPlatformzonethatenablesinteractionfromserviceproviderprovisioning,legacy,and
billingsystems

business PKI
publickeyinfrastructure(PKI)thatprovidessecurity,suchasserverauthenticationand
sessionconfidentiality,forcriticalinfrastructureservicesinbusinessenvironment

Business Process Execution Language; BPEL


XML-basedlanguagethatmakesitpossibletouseacombinationofwebservicesto
sharetasksinadistributedcomputingorgridcomputingenvironment

bus network
networkinwhichconnectionbetweennodesisaccomplishedbyconnectingallnodesto
asingletransmissionmediumsuchaswireorfibre

bus topology
networktopologyusingthincoaxialcableasasinglecabletrunkthatconnectsone
workstationtothenextinadaisychainconfiguration

bus-type interface
interfaceoverwhichsignalsfromanumberofchannelsorequipmentpass,separatedby
timedivisionanduniquelyidentifiedbyheaderinformation

busy
conditionofaresourcethatisinuse,followingitsseizure

Issue:28

175

GeneralGlossary

busy hour; BH; busy telephone traffic hour


continuous60-minuteperiodduringwhichtrafficloadisgreatest

busy hour calls; BHC


numberofcallsduringthebusiesthourofaday

busy hour service request; BHSR


numberofnewserviceinvocationsinabusyhour

busy hour session attempts; BHSA


numberofnewsessioninvocationsduringabusyhour

busy state
stateofaniteminwhichitperformsarequiredfunctionforauserandforthatreasonis
notaccessiblebyotherusers

busy tone; BT; engaged tone


toneadvisingthecallerthatthetelephoneequipmentcalledisbusy

BVC management; BSSGP virtual connection management


functionofthebasestationsystemGPRSprotocol(BSSGP)thatisresponsibleforthe
blocking,unblocking,andBVCresetprocedure

BVC reset procedure


procedurethatisinitiatedbytheservingGPRSsupportnode(SGSN)orthebasestation
system(BSS)tosynchronisetheinitialisationofGPRScontextsthatarerelatedtothe
BSSGPvirtualconnection(BVC)intheBSSorSGSN

BYE message; BYE


sessioninitiationprotocol(SIP)messagewhichaclientsendstothecallagenttorelease
thecall

bypass cross-connection
cross-connectionwhichcanbeusedtobypasstrafficthroughtheunittransparently
withoutterminatingthesignal

176

Issue:28

GeneralGlossary

bypassing
replacingpartofthetrunklinewithadatatransmissionnetworkwhichcanbe,for
example,IPbased

byte; B
seriesofbitswithadefinedlengthrepresentingaunitofinformation

byte basket unit; BBU; waste basket


unittowhichalogicalfilecanbeconnected,whereuponthedatatobewritteninthe
logicalfileisdeleted,butasuccessfulwriteoperationisreportedtothesoftwarewhich
sentthedata

byte interleaving
techniqueforcombiningmultipledigitalsignalsonabyte-by-bytebasisinthesame
digitalbitstream

byte order
orderinwhichnumbersarestoredinacomputerword

byte string file


filethathasnorecordstructure

byte synchronous mapping


synchronousmappinginwhichsignalsareprocessedbytebybyte

byte synchronous monitored mapping


bytesynchronousmappinginwhichthemappedsignalismonitored

byte synchronous terminated mapping


bytesynchronousmappinginwhichtheframeofthemappedsignalisterminatedbefore
mapping

bzip2
publicdatacompressionalgorithmmaintainedbyCygnusSoftware

Issue:28

177

GeneralGlossary

5 C
cabinet
self-supportingframeofstandarddimensionintowhichtheshelves,chassis,subracks,
orcartridgesareinstalled

cable loss
totallossinthetransmissionchainfromtheantennatothebasetransceiverstation
(BTS)

cable modem
modemthatisusedtocreateadataconnectionviathecabletelevisionnetwork

cable modem connection; broadband cable internet connection


fixed-linebroadbandconnectionthatisbasedontheuseofcabletelevisionnetwork

CA CDR; content analyser charging record


chargingrecordthatiscreatedbytheintelligentservicenodecontentanalyser(ISN-CA)
foreachcontenttransaction

cached user information


usernameanduserprofilewhicharesavedinalocalfile

CAC modification analysis; carrier access code modification analysis; CAC


change analysis
multioperatoranalysisthatisusedtochangethecarrieraccesscode(CAC)onthebasis
ofthesubscriberdata

c_actor
actormanagedbytheChorusOSactormanager(AM)systemactor

calendar command
individualMMLcommandinacommandcalendar

calendar task
entityexecutedonthebasisofagiveninput,containingeitheronecalendarcommandor
onecommandfile,andtheexecutionparametersofthecommandorfile

178

Issue:28

GeneralGlossary

calendar time management


internalservicethatsetsthecurrentdateandtimeinformationoftheoperatingsystemto
thecorrectvalueduringcomputerstart-up,andupdatesitwhenthedateandtimeofthe
networkelementarechangedinthesystemmaintenancecomputer

call
inanautomaticsystem,theactionperformedbyacallingpartytoobtaincommunication
withthewantedterminalequipment

call; calling
executionofaprogram,routine,orsubroutine

call
use,orpossibleuse,ofacompleteconnectionset-upbetweenacallingsubscriberand
thecalledsubscriberorservicethatisimplementedasanend-to-endlogicalrelationship
betweentwoormoreparties

call abandonment probability


probabilitythatauserabandonsthecallattemptthroughatelecommunicationnetwork

call account coding


servicewhichisusedtoallocatetelephonecoststodifferentcostcentresorprojectsina
company

call admission control; CAC


processofregulatingtrafficvolumeinvoicecommunications,particularlyinwireless
mobilenetworksandinvoiceoverIP

call alert; ringing; incoming call alert


alertcausedbythecall-arrivalsignalandbymeansofwhichtheunengagedterminal
equipmentindicatesanincomingcall

call and service control


featurethatdefinescallcontrolandservicerelatedfunctionsoftheconnection
processingserver(CPS)bydescribingthebasiccallstatemodels(BCSM)ofcallcontrol
andtheservicecapabilitiesthatcanbeusedtocontrolcall-relatedandcall-unrelated
functionsintheCPS

Issue:28

179

GeneralGlossary

call-associated signalling /GB/ ; call-associated signaling /US/; CAS


signallingbymeansofwhichtheinitialpositionmaybereportedduringcallset-up
signallingforanemergencycall

call attempt; connection attempt


attempttoestablishaconnection

call back; CB
servicewhichallowsausertosetupacalltothenumberofthelastunansweredcaller
ortothenumberofthelastcallerusingasubscribercontrolprocedure

callback
schemeusedinevent-drivenprogramswheretheprogramregistersasubroutineto
handleacertainevent

callback request; CBR


datamessagewhichcontainstheidentityofthecallingpartyandwhichthecallingparty
usestorequestthecalledpartytocallback

callback request chain


mechanismthatisusedtorepeatedlyforwardacallbackrequestiftherecipientcannot
bereached

callback request indicator


indicatorthatinformstheuseraboutareceivedcallbackrequestinaterminal

call barring analysis; outgoing call barring analysis


callcontrolanalysiswhichismadetofindpossibleoutgoingcallrestrictions,handling
supplementaryservicebarringcategoriesandoperator-determinedbarringcategories

call bearer control protocol; CBC; CBC protocol


protocolthatspecifiesaninterfacebetweenacallcontrolentityandabearercontrol
entity,offeringafullsetoftelephony(BICC)serviceswhichareindependentofthe
underlyingtransportnetwork

call booking; call order


requestmadebyasubscribertoanattendanttoformacallbetweensubscribers

180

Issue:28

GeneralGlossary

call-by-call indirect access; call-by-call


indirectaccessinwhichthecallingpartyselectstheoperatorbyusingacarrieraccess
codeeachtimeacallismade

call completion barring


servicebywhichausercanbaralltheincomingcompletionofcallstobusysubscriber
requests

call completion service setup; CCSS


signallingparametersentinaninitialaddressmessageindicatingthatacallisan
automaticrecall(CCBS)asdefinedintheCCBSservice

call completion to busy subscriber; CCBS; automatic recall; completion of


calls to busy subscribers; automatic call back service
servicewhichoffersauserwhocallsabusyuserthepossibilityofhavingthecall
completedautomaticallywithouthavingtoredialthecallednumberwhenthecalleduser
becomesfree

call configuration; CC
configurationthattheoriginatingandterminatingmobileservicesswitchingcentres
definebasedonthetypesofdevicesconnectedtothecallandtherelationshipbetween
thedevices

call confirmed message


signallingmessagethatthecalledmobilestationsendstothenetworktoconfirman
incomingcallrequest

call congestion
situationinwhichabidtoaparticularpoolofresourceswillnotresultinanimmediate
seizure

call connection if busy; call connection to busy; call extending to busy


extension; connection if busy
facilitywhichenablesanattendanttoconnectacalltoabusyextension

call control; CC
interactionbetweenthepartiesofacallinordertosetupandmaintaincalls

Issue:28

181

GeneralGlossary

call control agent function; CCAF


entitywherethefunctionsforprovidinguserswithaccesstocall/serviceprocessing
reside

call control analysis


analysisofBnumbertheresultofwhichmaybeanoutgoingdestination,aspecial
destination,asubscribernumberanalysis,oranannouncementqualifier

call control analysis file; analysis file


fileonwhichthecallcontrolanalysisisbased,andinwhichthecallcontrolanalysis
resultsarestored

call control computer; CCC


functionalunitthatcontrolstheswitchingunitandisresponsibleforthecallhandlingand
trafficadministrationfunctions,networkresourcemanagement,andcommunicationto
othernetworks

call control function; CCF


entitywhereinthefunctionsforprocessingaparticularcallreside

call control internal interface; CCIF; CCIF interface


interfacebetweenincomingcallcontrol(ICC)andoutgoingcallcontrol(OCC),or
betweencallcontrol(CC)andsignallingservice(SS)

call control parameter


parameterthatisusedtodefinethecircuitgrouporroute-specificdatathatthecall
controluses

call control protocol


protocolthatisresponsibleforcallset-up,maintenance,andrelease

call control server


serverthatprovidesswitchingsoftware,implementsthenecessarycomputer-telephone
integrationfunctions,andsupportsavarietyofswitchingenvironments

call control services (service groups); call control services


featuredefiningtheservicegroupswhichofferservicesinthebasiccallstatemodels
(BCSM)

182

Issue:28

GeneralGlossary

call deflection; CD
servicewhichallowstheservedusertorespondtoanincomingcallofferedbythe
networkbyrequestingredirectionofthatcalltoanothernumberspecifiedintheresponse

call delay
delaythatoccurswhenacallarrivesattheswitchingequipmentandnochannelor
facilityisimmediatelyavailabletoprocessthecall

call distribution; CD
INservicefeaturewhichallowsasubscribertohaveincomingcallsroutedtodifferent
destinations,accordingtoanallocationlawwhichmaybereal-timemanagedbythe
subscriber

call divert; divert; call forwarding; call diversion


facilitywhichenablesasubscribertohavehisincomingcallsdivertedtoanexchange,a
PBX,oranothersubscribernumber

call drop announcement; CDA


optionalfeaturebywhichasubscriber,whoisengagedinaconversationconnectedbya
mobileservicesswitchingcentre(MSC),isinformedofafailureinthenetworklink
betweentheMSCandthemobilesubscriber

call drop-back; CDB; call drop back


featurethatenablesthecallingsubscribertomakeacalltoasubscriberCwhohaslefta
messagetovoicemailwithoutreleasingtheongoingcall

call drop-back return


processofre-establishingtheconnectionbetweenthemobileservicesswitchingcentre
andvoicemailsystemwhentheconnectiontosubscriberChassucceededand
subscriberCreleasesthecall

call drop rate; DCR; dropped call rate


ratioofofdroppedcallstothenumberofcompletedoutgoingorincomingcalls

called address
addressinasignallingconnectioncontrolpart(SCCP)messagewhichcontainsthe
informationnecessarytodeterminethedestinationnodeandsubsysteminitorthenode
wherethenextSCCPlevelroutingisdone

Issue:28

183

GeneralGlossary

called IN number; called intelligent network number


signallingparameterindicatingthenumberwhichtheserviceswitchingpointhas
receivedasthecalledsubscribernumberininitialaddress(IAM)andsubsequent
address(SAM)messages

called line identity; CDLI


addressinformationwhichidentifiesthecalledsubscriberincalledlineidentification

called party; called subscriber; subscriber B; callee


subscribertowhomacallismade

called party address; CdPA


addresswithinansignallingconnectioncontrolpart(SCCP)message,consistingofany
combinationofsignallingpointcode,globaltitleandsubsystemnumber

called party initiated call release


functionthatdeletestheswitchedvirtualchannelconnection(SVCC)whenthecalled
partywantstostopthedatatransferwiththecallingparty

called party number analysis


analysisofthecalledsubscribernumberthatproceedsbasedontheusedprotocoland
configurationparameters

called subscriber release; called party release


callreleasethattakesplaceonlyafterthecalledsubscriberhascleared

called terminal identification answer tone; CED; ANS; answer tone


continuous2100Hztonewithaminimumdurationof2.6secondsandmaximum
durationof4.0secondsthataterminaltransmitsfirstwhenitreceivesacall

call error ratio supervision; supervision of call error ratio


partofmaintenancesupervisionwhichgeneratesanalarmifthecallerrorratioexceeds
theparameterisedlimitduringthesupervisionperiod

call establish
functionthatisusedwhenacallingsubscriberwantstocreateaswitchedvirtualchannel
connectionfordatatransferwithoneormorecalledsubscribers

184

Issue:28

GeneralGlossary

call extending
operatorservicewheretheincomingcallistransferred

call-failure signal; CFL


signalsentinthebackwarddirectionindicatingthefailureofacallset-upattemptdueto
thelapseofatimeoutorafaultnotcoveredbyspecificsignals

call file
filewhichisusedforstoringchargingdatawhenacallisactive

call forwarding announcement; announcement on call forwarding


announcementwhichacallinguserreceiveswhenacallisforwarded

call forwarding counter; CFC


counterwhichindicatesthenumberofcallforwardingsexecuted

call forwarding exception; CFE


servicewhichallowsausertoregisteronecallinglineidentityforwhichtheuser'scall
forwardingservicesarenotapplied

call forwarding exception number


user-definedcallinglineidentitytowhichcallforwardingservicesarenotapplied

call forwarding leg indicator; call forwarding indicator


informationelementwhichindicatesacallforwardingperformedintheexchange

call forwarding number; CFW


numberfromwhichincomingcallsareautomaticallyforwardedtoanyansweringlocation
designatedbythereceiverofthecall

call forwarding on busy; CFB; call forwarding busy; call diversion on


subscriber busy; call forwarding if busy
callforwardingthatallowstheservedusertohavethenetworkforwardincomingcallsto
anyothernumbergivenbytheuser,iftheuserisbusy

Issue:28

185

GeneralGlossary

call forwarding on mobile subscriber busy; CFB


callforwardingwhichpermitsacalledmobilesubscribertohavethenetworksendall
incomingcalls,orjustthoseassociatedwithaspecificbasicservice,whichmeet"busy"
toanothernumber

call forwarding on no reply; CFNR; CFNRy; call diversion on no reply; call


forwarding no reply; call diversion no reply; absent subscriber service diversion on no reply, to any number
callforwardingthatallowsausertohavethenetworkforwardacalltoanyothernumber
givenbytheuser,iftheuserdoesnotanswertheincomingcallwithinaspecifiedtime
limit

call forwarding on no reply; CFNRy; CFNA; call forwarding on no reply


service
supplementaryservicewhichpermitsacalledmobilesubscribertohavethenetwork
sendallincomingcalls,orjustthoseassociatedwithaspecificbasicservice,whichmeet
"noreply"toanothertelephonenumber

call forwarding on not reachable; CFNRc; call diversion on not reachable


conditionalcallforwardingthatakesplacewhenasubscriberisnotreachable

call forwarding override; CFO


featurerequestingtheignoranceofcallforwardingssetbythesubscriber

call forwarding prevention analysis; GSA analysis


digitanalysisthatisusedforanalysingoperator-determinedbarringofregistrationof
forwarded-tonumbercategories

call forwarding to voice mail


callforwardingthatenablesthenetworktoforwardacalltoanexternalvoicemail
systemoranexternalvalue-addedserviceplatform

call gapping; GAP; gapping


INservicefeaturewhichallowstherestrictionofthenumberofcallstoaserveduserin
ordertopreventcongestionofthenetworkandtomaintainqualityofservice

CallGap procedure; CG; CallGap


procedureusedtorequesttheserviceswitchingfunction(SSF)toreducetherateat
whichspecificservicerequestsaresenttotheservicecontrolfunction(SCF)

186

Issue:28

GeneralGlossary

call handling
featurethatprovidesalogicalinterfaceforcallcontrolandsignallingtohandlephysical
resourcesassociatedwithacall,andcallidentificationfortheclients

call history information


signallingparameterthatissentinthebackwarddirectiontoindicatetheaccumulated
propagationdelayofaconnection

call hold
operatorfacilitytosetasideanactivecallforlaterhandling

call hold announcement


audibleindicationconnectedbythemobileservicesswitchingcentre(MSC)intheform
ofspeechormusicforthesubscriberwhohasbeenputonhold

call holding; HOLD; call hold


servicethatallowsausertointerruptcommunicationonanexistingcalland
subsequentlyre-establishcommunication

call hold tone


tonethatindicatestothecallingpartythatthecallhasbeenplacedonholdbythecalled
orforwardedsubscriber

call index
indexgivenbythecallcontroltoeachcallcomingtoorgoingfromanoperatorposition
andusedtoidentifyacallifnecessary

call indicator signal; CI


signalthatdatacommunicationsequipmenttransmitstoindicatethegeneral
communicationfunction

call information report; call report


reportthatcontainsthecallduration,releasecauseofthecall,timeelapsedtoacall
attempt,andatimestampwhentheconnectionisreleased

CallInformationReport operation; CIRP; CallInformationReport procedure


operationusedtosendspecificinformationaboutasinglecalltotheservicecontrol
function(SCF)asrequestedbytheSCFinapreviousCallInformationRequestoperation

Issue:28

187

GeneralGlossary

CallInformationRequest operation; CIRQ; CallInformationRequest


procedure
operationusedtorequesttheserviceswitchingfunction(SSF)torecordspecific
informationaboutasinglecallandreportittotheservicecontrolfunction(SCF)using
theCallInformationReportoperation

calling address
addressinasignallingconnectioncontrolpart(SCCP)messagewhichcontainsthe
informationnecessarytodeterminetheoriginatingnodeandsubsysteminit

calling card subscriber; CCS


subscriberwhousesacallingcard

calling channel; CC; PCH; paging channel


logicalchannelthatisassignedtoabasetransceiverstationandusedforsettingupcalls
tomobilestations

calling channel band; CC band


frequencybandinuseforcallingchannels

calling geodetic location


locationinformationthatindicatesthegeodeticlocationofthecallingpartybasedonthe
WorldGeodeticSystem1984

calling line identification; CLIP; CLI; calling line identification presentation;


calling line identity presentation; calling line indication
lineidentificationservicewhichprovidesthecalleduserwiththecallinglineidentity

calling line identification restriction; CLIR; CLIR-A; calling line identity


restriction
servicewhichallowsacallingusertorestrictthepresentationofthecallinglineidentityto
acalleduser

calling line identity; CLI


addressinformationwhichidentifiesthecallingsubscriberincallinglineidentification

calling line identity screening; CLIS; CLI screening


lineidentificationserviceinwhichthevalidityofthecallinglineidentity(CLI)received
fromthesignallingischecked

188

Issue:28

GeneralGlossary

calling line restriction temporary mode


supplementaryservicewhichmakesitpossiblefortheserviceprovidertodefinea
seconddefaultvalueforthecallinglineidentificationrestriction(CLIR)servicein
temporarymode

calling name delivery; CNAM; CNAD


featurethatallowsthenameofthecallingpartytobedeliveredtothecalledparty

calling name delivery blocking; CNAB


featurethatallowsthecallingpartytocontroltheirnamesprivacystatusonaper-call
basis

calling name identification presentation; CNIP


supplementaryserviceofferedtothecalleduserwhichprovidesnameinformation
associatedwiththecallinguser(callingpartyname)tothecalleduser

calling name identification restriction; CNIR


supplementaryservicewhichisofferedtothecallingusertopreventpresentationofthe
user'snameinformationtothecalleduser

calling name presentation; CNAP


supplementaryserviceofferedtothecalledsubscriberwhichprovidesthecalling
subscriber'sname

calling name restriction; CNAR


featurethatisusedtorestrictthepresentationofthecallingpartysnametothecalled
party

calling number delivery; CND


servicewhichallowsananaloguecalledusertoreceivethecallinglineidentity

calling party; calling subscriber; subscriber A; caller


subscriberwhooriginatesacall

calling party address; CgPA


addresswithinanSCCPmessage,consistingofanycombinationofsignallingpoint
code,globaltitleandsubsystemnumber

Issue:28

189

GeneralGlossary

calling party category; CPC


criterionfortheclassificationofcallingsubscribersintheincomingcallcontrol

calling party initiated call release


functionthatdeletestheswitchedvirtualchannelconnection(SVCC)withacalledparty
inPTPcallorwithallcalledpartiesinPTMcallwhenthecallingpartywantstostopthe
datatransfer

calling party number analysis


analysisofthecallingsubscribernumberthatconsistsofthenatureoftheaddress
analysis,digitanalysis,anddefaultanalysis

calling party pays


billingmethodinwhichawirelessphonecallerpaysonlyformakingcallsandnotfor
receivingthem

calling party release


methodofoperationinwhichthereleaseofaconnectionisunderthecontrolofthe
callingpartysothatitbeginsonlywhenthecallingpartyrestores,forexample,the
telephoneordatamodemtoitsquiescentstate

calling rate
numberofcallsperunittime

calling signal; call-arrival signal


signaltransmittedoveracircuittoindicatethataconnectionisdesired

calling station ID
informationthatindicatestheoriginatorofasession

calling tone; CNG


signalthatisusedtoindicateacallingnon-speechterminalthatisintransmitmodeand
readytotransmit

calling tone; CT
tonethatconsistsofaseriesofinterrupted1300Hz15Hzsignalsandthatis
transmittedfromthecallingend

190

Issue:28

GeneralGlossary

call instance code; CIC


inthecontextofbearerindependentcallcontrol(BICC),acodethatidentifiesthe
signallingrelationbetweenpeerBICCentitiesandassociatesalltheprotocoldataunits
(PDU)withthatrelation

call level
uppermostabstractionlevelofthecallfileinwhichtheconnectionscreatedinan
individualcallandtheoperationsbetweenseparatecallsarecontrolled

call limiter; LIM


INservicefeaturewhichallowsaservedusertospecifythemaximumnumberof
simultaneouscallstoaserveduser'sdestination

call logging
serviceofferedtothecentrexgroupforcollectinginformationonincoming,outgoingand
internalcalls

call logging
partofreal-timemonitoringthatprovidesthefunctionsformonitoringallcallsinacellon
aper-userlevelinrealtime

call logging record


call-specificrecordcontainingthedataofonecentrexcall

call logging report; CLR


reportthatcontainsatleastonerecordthatcalllogginghascreated

call management
setoffunctionsformanagingcallset-up,control,andrelease,andthesupplementary
servicesrelatedtothecall

call management system; CMS


systemwhichreceivescallloggingrecordsincludinginformationonaphonecalland
accordingtotheserecordscreatesreportsrequiredbytheuser

call mediation node; CMN


functionalentitywhichprovidesthecallservicefunction(CSF)withoutanassociated
bearercontrolfunction(BCF)entity

Issue:28

191

GeneralGlossary

call model; CM
representationoffunctionsinvolvedinprocessingacall

call modification completed message; CMC; call modification completed


signallingmessagesentinresponsetoacallmodificationrequestmessageindicating
thattherequestedcallmodificationhasbeencompleted

call modification reject message; CMRJ; call modification reject


signallingmessagesentinresponsetoacallmodificationrequestmessageindicating
thattherequesthasbeenrejected

call modification request message; CMR; call modification request


signallingmessagebywhichthecallingorcalledsubscriberrequestsamodificationto
thecharacteristicsofanestablishedcall

call not allowed indicator


identifierwhichinformsthecallinguser,whoistryingtomakeaone-to-onecall,thatthe
callattempttothetargetuserisnotallowed

call number
numbersequencewhichhastobesentfromtheexchangeconcernedtotheoutgoing
connectioninordertodirectthecalltothecalledsubscriber

call number; PABX call number


numbersequencethatidentifiesthePBX

call number suffix; CNS


suffixwhichindicatesthepartsubsequenttotheDCPpoint,identifyinganindividual
extensionwithintheprivatenetwork

call observation
partoftrafficobservationwhichautomaticallyproducesobservationreportsinspecial
circumstances

call origin
parameterwhichindicateswherethecalliscomingfrom

192

Issue:28

GeneralGlossary

call park
supplementaryserviceenablingaCentrexextensionoraCentrexattendanttoparka
callagainstaCentrexextensionbydiallingasubscribercontrolprocedure

call park reminder call


callgeneratedwhenthecallparktimerexpires

call park reminder call timer


centrex-group-leveltimercontrollingthedurationofthecallparkremindercall

call park re-ring


callgeneratedtoananalogueuserwhenanattempttoparkacallisunsuccessfuland
theuserhasreplacedthehandset

call park timer


centrex-group-leveltimercontrollingthelengthoftimeacallcanremainparkedagainst
anextensionbeforeacallparkremindercallisgenerated

call party handling; CPH


functionsthatallowthecreationofnewcalllegs,removalofpartiesfromacall,andthe
controlofthecross-connectionsbetweentheparties

call path indicator; CPI


intheinterconnectuserpart,aninformationelementthatindicatesthetypesof
transmissionandsignallingpathsrequiredforacall

call period
inCAMELapplicationpart(CAP)services,theportionofthesubscriber'saccountthat
theservicecontrolpoint(SCP)assignstotheserviceswitchingpoint(SSP)while
monitoringthesubscriber'screditduringthecall

call pick-up; pick-up


servicewhereasubscribercanpickupacallcomingtoanotheruser'sextensiontohis
ownextension

call processing capacity; call handling capacity


capacityoftheexchangetoprocesscallsduringthebusyhour

Issue:28

193

GeneralGlossary

call processing control; CPC


featurewhichprovidesproceduresforcontrollingincoming,outgoingandtransitcalls
withthesignallingsystemNo.7(SS7)

call processing function


mediagatewaycontroller'sfunctionwhichcontrolsallthelegsofacallviainterfaceto
themediagateway

call processing language; CPL


languagethatcanbeusedtodescribeandcontrolvoiceoverIPservices

call processing state model; CPSM


finitestatemachinemodelofcallprocessingforintelligentnetworkcallprocessing

call processing states


categoryofcircuitstatesthatconsistsofidle,circuitincomingbusy,andcircuitoutgoing
busystates

call processing tasks


functionsperformedinhandlingtraffic

call profile
profilewhichdefinestheparametersrelatedtoacertaincalltype

call progress message; CPG; call progress


signallingmessageindicatingthataneventwhichhassignificanceandshouldbe
relayedtotheoriginatingorterminatingaccesshasoccurred

call progress tone


tonethatindicatesthatapartyonholdinathirdpartycallisabouttobeautoreconnectedandthelocalMSisclearingthecall

call queuing to a single line; CQSL


supplementaryservicewhichenablesanordinarysubscribertohavethequeueing
serviceensuringthatimportantcallsarenotlost

194

Issue:28

GeneralGlossary

call redirection counter; CRC; redirection counter; redirect counter


informationsentintheforwarddirectionindicatingthenumberofredirectionsthathave
occurredonacall

call re-establishment; re-establishment


procedureforrecoveringandmaintainingacallwhichhasfailedonhandover

call reference; call identifier; call ID


circuitindependentsignallingparameteridentifyingaparticularcall

call-related charging
INchargingofINcalls(speech,dataortelefax)

call-related information; CRI; call identifying information; call data


allrelevantinformationaboutthecall

call-related notification
notificationdeliveredtotheprepaidsubscriberataparticularcallphaseofaprepaidcall

call report generation


partofon-linecalllinemonitoringinwhichacallreportisgeneratedtoagivenX.25
address

call rerouting; rerouting


calltransferthatisdonebyreleasingtheoriginalconnectionafterarequestfromthe
calledparty'sexchangetotheoriginatingexchangetoreroutethecall,andreroutingthe
callfromtheoriginatingexchange

call rerouting distribution; CRD


INservicewhichpermitsthesubscribertohavetheirincomingcallsthatencountera
triggeringconditionreroutedaccordingtoapredefinedchoice

call restriction
facilitythatrestrictseitherincomingoroutgoingcalls

call retrieval
changeofcallstatefromparkedstatetoactive

Issue:28

195

GeneralGlossary

call return
servicebymeansofwhichacallisreturnedtoaspecifiednumberifthecalledpartyis
busyordoesnotreply

call return
operatorfacilitythattheoperatorusestoreturnacallfromtheholdqueueintotheactive
state

call return number


numbertowhichthecallistransferredaftertimesupervisionwhenthecallreturnservice
isinuse

call segment; CS
specificportionoftheprocessingofacall

call segment association; CSA


groupofcallsegmentsthatareinvolvedinagivenserviceandthatarecontrolledbythe
servicecontrolfunction

call segment ID; CSID; CS ID


identifierthatisallocatedtoacallsegment

call service function; CSF


functionforcallcontrol,containingacallstatemachine(CSM)foreachactiveendpoint
associatedwiththelocalcallinstance

call session control function; CSCF


functionthatestablishes,monitors,supports,andreleasesmultimediasessions,and
managestheuser'sserviceinteractions

call set-up charge


singlechargewhichthesystemsetsatthebeginningofthecall

call set-up message


signallingmessagethatthecallingmobilestation(MS)sendstothemobileservices
switchingcentre(MSC)formobile-originatingcall,andthattheMSCsendstothecalled
MSforamobile-terminatingcall

196

Issue:28

GeneralGlossary

call set-up time


timerequiredtosetupaconnectionbetweentheusers

call spill-over
receptionofanabnormallydelayedsignallingmessagefromapreviouscallata
switchingcentrewhilstanewcallisbeingsetuponthatcircuit

call state; protocol state


operationalstateofaprocessparticipatinginsignallingprocedures

call state control function; CSCF; call server control function


functionthatperformscallcontrolfunctions,serviceswitchingfunctions,address
translationfunctions,andvocodernegotiationfunctions

call stateful proxy


statefulproxywhichretainsthestateofadialogue,fromtheinitiatingINVITEtothe
terminatingBYEmessage

call state machine; CSM


functionwhichcontrolstheestablishment,routing,maintenanceandclearingofcallsat
theIPtelephony(IPT)level

call supervision
supervisionofcall-relatedconnectionsthatanMSCserveroragatewaycontrolserver
performsbysendingauditcommandstoamultimediagateway

call teardown
processofclosingaconnection

call traceability
featurethatisusedtofindoutanalysesthatareexecutedduringacallandtogetthe
inputandoutputdatafromtheseanalyses

call transfer; CT
servicewhichallowsausertotransferanestablishedincomingoroutgoingcalltoathird
partybyusingasubscribercontrolprocedureorbyreplacingthehandset

Issue:28

197

GeneralGlossary

call transfer by replacing the handset; call transfer by onhook; call transfer
with onhook
calltransferwithwhichausercanbegiventherighttotransfercallsintheringingphase
oftheholdforenquiryconnection,ortoabusyuserwithoutwaitingforthethirduserto
becomeavailable

call transfer notification


notificationthatissenttorequestcalltransfer

call transfer number


signallingparameterwhichissentinbothdirectionstoidentifyeachoftheusersinvolved
inacalltransfer

call transfer recall; CTR


supplementaryservicethatprovidesthetransferringpartywiththepossibilitytohavethe
callreturnediftheparty,towhichthecallistransferred,doesnotanswerthecall

call transfer reference


signallingparameterwhichconveysareferencenumberassociatedwiththeexplicitcall
transfer

call transfer to busy


calltransferfeaturewhichallowsausertotransferanestablishedcalltoabusythird
party

call transfer to ringing


calltransferfeaturewhichallowsausertoforwardanestablishedcalltoathirdpartyin
theringingphaseoftheenquirycall

CallTreatment
parameterwhichtheservicecontrolfunction(SCF)usestospecifywhichtypeof
ApplyChargingReportitisrequesting,ahotrecordoralimitforthecall

call type
callinformationincludedinsubdestinationwhichisusedintheclassificationofthecalls

198

Issue:28

GeneralGlossary

call type discrimination package; ctyp


packagewhichisanextensiontotheH.248.1gatewaycontrolprotocolandwhich
definesthecontrolandmonitoringofaPSTNlineforthesignallingprotocolsusedatthe
beginningofasessionofdatatransmissionforfax,texttelephony,ordata

call-unrelated charging
INchargingthatinvolves,forexample,chargemanagementoperations,prepaidaccount
expirations,andSMScharging,nottheactualusageofthenetwork

call unrelated service function; CUSF


servicefunctionwhich,associatedwithcallcontrolfunction(CCF)andserviceswitching
function(SSF),providesasetofcall-unrelatedservicesrequiredforout-channel
interactionwiththeuser,andalsoprovidesthesetoffunctionsrequiredforinteraction
betweentheuserandservicecontrolfunction(SCF)

call waiting
servicewhichallowsausertoreceiveinformationaboutanewincomingcallduringan
activecall

call waiting announcement


announcementthatindicatestothecallingpartythatthecallisinaqueue

call waiting notification


notificationgiventoacallingISDNuserwhenacalleduserreceivesanindicationabout
awaitingcall

call waiting tone


toneadvisingtheuserofthecallwaitingsupplementaryserviceengagedonacallthat
someoneisattemptingtocallhisnumber

CAMEL application part; CAP


protocolthatsupportscustomisedapplicationsformobilenetworkenhancedlogic
(CAMEL)andthatisbasedonasub-setofthecapabilityset2(CS-2)coreintelligent
networkapplicationprotocol(coreINAP)

CAMEL application part phase 3; CAP3


CAMELapplicationpartwhichsupportsthethirdphaseofthenetworkfeature
customisedapplicationsformobilenetworkenhancedlogic(CAMEL)

Issue:28

199

GeneralGlossary

CAMEL call reference


callreferencethatcontainstwofields:thecallreferencenumberidentifyingthecallinthe
mobileservicesswitchingcentre(MSC),andtheaddressoftheMSCthatallocatedthe
referencenumber

CAMEL capability handling information


partoftheCAMELsubscriptioninformationthatdeterminestheCAMELapplicationpart
versionthatasubscriberuses

CAMEL-originating call CDR; COC CDR


chargingdatarecord(CDR)thatcontainsinformationrelatedtomobile-originatingcalls
withCAMELservices

CAMEL phase 2; CAP2


protocolforphase2ofcustomisedapplicationsformobilenetworkenhancedlogic
(CAMEL)

CAMEL phase 3; CAMEL3


thirdversionofcustomisedapplicationsformobilenetworkenhancedlogic(CAMEL)that
connectsthehomeandvisitedmobilenetworkstovariousintelligentnetwork(IN)
platformsusedthroughoutnationalnetworkstoprovidefeaturessuchaspre-paid
roamingservices,specialnumbers,andclosedusergroups

CAMEL phase 4
fourthversionofcustomisedapplicationsformobilenetworkenhancedlogic(CAMEL)
thatoffersenhancements,whichincludetheabilitytoperformcallpartyhandling

CAMEL service environment; CSE


logicalentitywhichprocessesactivitiesrelatedtooperator-specificservices(OSS)

CAMEL service set; CAMEL SSET


servicesetthatprovidesaproprietarymethodtoinitiateIN-supportedservicesandto
definethetriggeringinformationinwaysotherthanspecifiedincustomisedapplications
formobilenetworkenhancedlogic(CAMEL)standards

CAMEL subscription information; CSI


partofthesubscriberdatastoredinthehomelocationregister(HLR)indicatingthat
CAMELsupportisrequiredforthesubscriberandidentifyingtheCAMELservice
environments(CSE)tobeusedforthatsupport

200

Issue:28

GeneralGlossary

CAMEL terminated call CDR; CTC CDR; CAMEL terminated call charging
record
chargingdatarecord(CDR)thatcontainsinformationrelatedtoterminatingcallswith
CAMELservices

CAMEL traffic measurement


statisticalmeasurementthatprovidesinformationrelatedtoCAMELcalls

CAMEL usage measurement


statisticalmeasurementthatprovidesinformationondialoguesbetweentheservice
switchingpointandservicecontrolpoint

camp band
frequencybandwithinacellthattheuserequipmentcanchooseoncellselectionor
reselectionprocess

camped on a cell
userequipmentstateinidlemodeafterthemobilestation(MS)hascompletedthecell
selectionorreselectionprocessandhaschosenacell

cancel
messagewhichinformstheoperatorabouttheexpiryofanalarm

cancel alarms dialogue


dialogueofthegraphicaluserinterfaceinwhichactivealarmscanbecancelled

cancel file
fileaboutthecancellationofanalarm

cancel identifier; cancel ID


identifierofthealarmthatwascancelled

cancel location message


mobileapplicationpart(MAP)messagethatthehomelocationregister(HLR)sendsto
theservingnetworkentitywhenasubscriberisdeactivated,afterwhichthemobility
management(MM)contextandpacketdataprotocol(PDP)contextareremoved

Issue:28

201

GeneralGlossary

Cancel procedure; CAN; Cancel


servicecontrolfunction(SCF)procedureinwhichthepreviousoperationintheGSM
specialisedresourcesfunction(SRF)orallpreviousrequestsintheGSMservice
switchingfunction(SSF)arecancelled

cancel request; cancellation request


requestwhichcausestheinvalidationofanearliercommand,stopstheexecutionofa
taskordeletesit

C-anchor ASN gateway; C-plane anchor; C-anchor


anchorASNgatewayinthecontrolplanethatimplementspagingcontroller,location
management,authentication,keydistributioncentre,charging,proxymobileIP,and
mobilitymanagementfunctions

canonical format
dataformatassumedbyDX200softwarerunninginx86computers

canonical name; CNAME


persistenttransport-levelidentifierforareal-timetransportprotocol(RTP)sourcethatthe
real-timecontrolprotocol(RTCP)carries

CAP3 interface; CAMEL application part phase 3 interface


interfacethatisusedtoexchangebalanceinformationbetweentheonlineservice
controller(OSC)andtheservicecontrolpoint(SCP)usingtheCAP3protocol

capabilities-exchange-request message; CER message


DiametermessagethatisusedatthebeginningofaDiameter-basedsessiontofindout
thecapabilitiesofthepeer

capability
tokenusedasanidentifierforanobjectsuchthatpossessionofthetokenconfers
accessrightsfortheobject

capability rule
ruleforcheckingthatprerequisitesofasubscriptionarefulfilled

capability set 2; CS-2


capabilitysetwhichspecifiesthesecondphaseintelligentnetworkplatformdefinedby
ITU-T

202

Issue:28

GeneralGlossary

capacity broker
applicationthatreservesminimumcapacityforeachtributaryunitformessaging,and
ensuresthattheentiremultiplexequipmentbandwidthissharedbetweenthetributary
unitsbyconsideringtheusageoftheunit

capacity broking
processinwhichtheavailableresourcesofanupper-levelobjectarerelativelyshared
betweenthelower-levelbottlenecks

capacity demand algorithm


algorithmwhichcalculateswhetherthereisenoughvirtualchannelconnection(VCC)
capacitytotransmitpacketsinagiventimeperiod,andwhetheranadditionalconnection
canbeadmittedornot

capacity feature
featurethataffectsthecapacityofanetworkelementorsystem

capacity indication
applicationthatisusedtomeasureandmonitortheloadandtheremainingcapacityof
thesystem

capacity indication tool


toolwhichmonitorsthecapacityofthesystemandindicatesifthecapacitylimitisabout
tobeexceeded

capacity licence key /GB/; capacity license key /US/


licencekeythatdefinesthecapacityoffered

capacity phase; capacity building


operationalphaseinwhichanetworkoperatorbuildsnetworkcapacityaccordingtothe
predictedamountoftraffic

capacity planning
partofnetworkdimensioningthatdeterminesphysicallinkcapacitiesbetweenadjacent
networknodes

capacity set
declarationoftheapproximate/maximumcomputerstoragecapacityneededbysystems
toprocessthedocumenttypedefinition(DTD)anddocumentinstance

Issue:28

203

GeneralGlossary

capacity sharing
radiolinkoperationalmodewhichallowstheuseoftwoindividualdatachannelsthrough
asingleradiohop

CAP interface
interfacebetweenthecallstatecontrolfunctionandCAMELserviceenvironment

C++ application frameworks domain


collectionofcomponentsandlibrariesthatconstituteaframeworkforthestatemachine
application(FSMA)

capsule
inopendistributedprocessing,aconfigurationofengineeringobjectsformingasingle
unitforthepurposeofencapsulatingprocessingandstorage

capsule manager
engineeringobjectwhichmanagestheengineeringobjectsinacapsule

captive portal; CP
webpagethatrequirescertainactionsfromtheuserofapublicaccessnetworkbefore
accessisgranted

cardinality
thenumberoftuplesinarelation

card operated station; card operated mobile station


mobilestationwhichenablestheusertofeedinallinformationneededforcallset-up
fromhisintelligentcard,whichisthentransferred,togetherwiththeinformationsupplied
bythemobilestation,tothevisitorlocationregisterinthecallset-upphase

card session
linkbetweenthecardandtheexternalworldstartingwithanswertoreset(ATR)and
endingwithsubsequentresetordeactivationofthecard

care-of address; CoA; COA


IPaddressatthemobilenode'scurrentpointofattachmenttotheinternet,whenthe
mobileterminalisnotattachedtothehomenetwork

204

Issue:28

GeneralGlossary

carrier access code; CAC; carrier code


codethatisdialledbeforetheareacodeandbywhichasubscribercanchoosebetween
competingtransittrunknetworks

carrier blade; carrier


bladethataccommodatesoneormoremezzanines

carrier class; CG; carrier grade


qualityofserviceclassthatprovidestheservicelevelofthetraditionaltelephony
networks

carrier generator
signalgeneratorthatproducessignalsofhighlypreciseandstablefrequencyfor
modulationbyeachinformation-bearingsignalinafrequency-divisionmultiplexing
system

carrier-grade Linux; CGL; carrier grade Linux


variantoftheLinuxoperatingsystem,whichconfirmstherequirementsdefinedin
OSDL'scarrier-gradeLinuxspecification

carrier identification code; CIC


four-digitcodethatuniquelyidentifiesanetworkoperator

carrier identification parameter; CIP


optionalparameterinsignallingsystemNo.7thatidentifiesandtransmitsthecarrier
identificationcodeofthepresubscribedcarrierortheaccesscodedialledbythecalling
partytothecustomeraspartoftheinitialaddressmessage

carrierless amplitude phase modulation; CAP


derivativeofquadratureamplitudemodulation(QAM)whichincludescodinganderror
correctingschemestoprovidehigh-speedtransferofdigitalinformationoverthelocal
twistedcopperpairwirelocalloopfordistancesupto2300feet

carrierless mode
communicationmodeinwhichsignalsareonlypresentintheconnectionwhendatais
beingexchanged

carrier network
networkthatisselectedbythecarrierselectionprocedureforroutingacall

Issue:28

205

GeneralGlossary

carrier preselection based indirect access; carrier preselection


indirectaccessinwhichthecallingpartyhasoneoperatorselectedpermanentlyandall
thecallsaresubsequentlyroutedtothatoperator

carrier selection; CS
ANSIISDNuserpartparameterthatconveystheinformationontheselectionoflong
distancecarrierandindicateswhetherthecarrierwasinputdialledornot

carrier sense
inadatatransmissionnetwork,anongoingactivityofaterminaltodetectwhether
anotherterminalistransmitting

carrier-sense IP address
IPaddressthatisconfiguredtotwoormoreintegratedEthernetinterfacesandisactive
ononeinterfaceatatime,whiletheotherinterfacesareusedasbackupinterfaces

carrier sense multiple access with collision avoidance; CSMA/CA


networkcontrolprotocolinwhichacarrier-sensingschemeisused

carrier-to-interference-and-noise ratio; CINR; carrier-to-interference plus


noise ratio
ratiothatdescribessignaleffectivenessandthatisexpressedindecibels(dB)

carrier-to-interference ratio; CIR; C/I; carrier-to-interference power ratio; C/I


ratio
interference-specifyingratiothatisusedinmicrowaverelaysandothercommunication
systems

carrier-to-noise ratio; C/N; carrier/noise ratio; carrier/noise


ratioofthereceivedcarrierpowerandthenoisepowerinagivenbandwidth,expressed
indB

carrier unit; CU
inabasetransceiverstation,afunctionalunitthatoperatesonecarrier,includingbothits
basebandaspectsanditstransmittingandreceivingfunctions

CAS access node; frame relay switch


accessnodeinaframerelaynetworkonwhichtheframerelayinservingGPRSsupport
node(SGSN)isbased

206

Issue:28

GeneralGlossary

cascaded network
physicalarchitecturewhereconnectionsforonetypeofcomponents(forexample
networkelements)followseriallythroughsimilarcomponentsbeforebeingconnectedto
anothertypeofcomponents(forexampleoperationssystem)

cascading menu; cascade menu


submenuinwhichasidemenuofsubcategoriesisdisplayedwhenthepointerisplaced
onthemaincategory

cascading style sheets; CSS


simplestylesheetmechanismthatallowsauthorsandreaderstoattachstyletoHTML
documentsandXMLapplications

case insensitive; case independent


programthatdoesnotdifferentiatebetweencapitalandsmallletters,andtherefore
interpretsinformationorcommandsinthesamewayregardlessofwhethertheyhave
beentypedwithcapitalorsmallletters

case sensitive; case dependent


programthatdifferentiatesbetweencapitalandsmalllettersandthusinterprets
informationorcommandsdifferentlydependingonwhethertheyhavebeentypedwith
capitalorsmallletters

CAS push
actionduringwhichthepositionestimateispushedtothepublicsafetyansweringpoint
(PSAP)inthecallset-upmessage

CAST-128
symmetriccryptographicalgorithmwithavariablekeysizefrom40bitsto128bits

catalogue polling function


functionwhichcanbeusedtotransferthechangesmadeintheexternalservice
cataloguetotheprofilemanager

cause code; reason code


codenumberthatisusedinternallyinanexchangetoidentifyeventsduringacall

cause indicator
signallingparameterindicatingthereasonforsendingthemessage

Issue:28

207

GeneralGlossary

cause value
informationindicatingthereasonforsendingamessage

CBS DRX cycle; cell broadcast service discontinuous reception cycle


timeintervalbetweensuccessivereadingsofbroadcast/multicastcontrol(BMC)
messages

CC anchor node
servingnodethathoststheservicethatinvokesbearerredirectionandthatservesasa
controlpointforcallcontrol(CC)duringbearerredirection

CCB pull
pullmodewherethesubscriptionmanagerretrievesactivationcommandfilesfromthe
businesssupportsystem,includingcustomercareandbilling

CCB push
pushmodewherethebusinesssupportsystem,includingcustomercareandbilling,
sendstheactivationcommandfilestothesubscriptionmanager

CCBS call
callgeneratedbythenetworkfromthecallingsubscribertothecalledsubscriber
resultingfromthecallingsubscriber'sacceptanceofaCCBSrecall

CCBS recall
indicatorthatnotifiesthecallingsubscriberthatthecalledsubscriberisnowfreeandcan
receivethecallcomingfromthecallingsubscriber

CCBS request
facilitysequenceusedbythecallingsubscribertoactivatetheCCBSfeaturethatistobe
registeredattheoriginatingandterminatingnodes

CCBS request retention


networkprovideroptionthatdefineswhethertherequestiskeptactiveifanattemptto
establishaCCBScallfailsbecausethedestinationisbusyagain

C-channel; communication channel


channel(64kbit/stime-slot)onaV5-typeinterfacethatisusedtocarryoneormore
communicationpathsallofdifferenttypes

208

Issue:28

GeneralGlossary

CC-interface and GMR in CPS


featurethatspecifiestheinterfacebetweentheprocessesofsignallingservicesandcall
control(CC)intheconnectionprocessingserver(CPS)

CCNR possible indicator


signallingparameterthatissentinanaddresscompletemessageoracallprogress
messagetoindicatethatitispossibletoinvokeasuccessfulcompletionofcallsonno
reply(CCNR)servicerequest

CCNR request
requestforcompletionofcallsonnoreply(CCNR),asaresultofwhichtheserved
subscriberisinformedwhenthetargetuserhasendedthecurrentprocedureandcan
possiblybereached

CC sink point
pointinanetworkthatissettoreceiveeithercontinuitycheck(CC)cellsorusercells,
andthatraisesalossofcontinuity(LOC)alarmifbotharemissing

CC source point
pointinanetworkthatsendscontinuitycheck(CC)cellsatcertainintervalswhenthere
isanabsenceofusercellsinthetraffic

CCSPCM
incommonchannelsignalling(CCS),thesevenmostsignificantdigitsofthecircuit
identificationcodethatareusedtoindicatethe2Mbit/sPCMcircuitconnectingthe
originatingandterminatingsignallingpoints

CDATA
characterdatathatisnotparsed,usedasescapeblocksoftextcontainingcharacters
whichwouldotherwiseberecognisedasmarkupdata

CDMA; code division multiple access


techniqueinwhichradiotransmissionsusingthesamefrequencybandarecodedina
waythatasignalfromacertaintransmittercanbereceivedonlybycertainreceivers

CDMA2000 1XEV-DO; 1xEV-DO; EV-DO; HRPD; high rate packet data; 1x


Evolution, Data Only; Evolution - Data Only
technologywhichoffershigh-speed,high-capacitywirelessinternetconnectivitywith
dataspeedsofupto2.4Mbpswithinone1.25MHzCDMAcarrierandisoptimisedfor
packetdataservices

Issue:28

209

GeneralGlossary

CDMA2000 1XEV-DV; 1xEV-DV; 1x Evolution, Data and Voice; CDMA2000


Rel C; IS-2000 Revision C
technologythatprovidesintegratedvoiceandsimultaneoushigh-speedpacketdata
servicesatspeedsofupto3.09Mbps

CDMA2000 NXEV-DO; NxEV-DO


widebandextensionofCDMA20001XEV-DOwhereupto151.25MHzcarrierscanbe
assignedtoausertoprovideupto46Mbpsand27Mbpsintheforwardandreverse
links,respectively

CDMA loop; CDMA test loop


testloopwhichverifiestheoperationofthesignalpathfromthewidebandapplication
managertothewidebandtransmitterandreceiverandback

CDMAOne
marketingtermforIS-95basedtechnology

CDR block
groupofchargingdatarecords(CDR)gatheredintoablocktobesenttothecharging
gateway

CDR consolidation; consolidation of charging records; CDR combining


functionofthecharginggatewaytocombineseveralpartialchargingrecords(CDR)that
resultfromintermediateCDRgenerationintoonechargingrecord

CDR counters; record counters


optionalfeaturethatmakesitpossibletomonitorthegenerationofdifferenttypesof
formattedchargingrecords(CDR)

CDR format file; CDR form file


formatfilethatincludesasetoflogicalformats,eachofwhichdescribesthestructureof
onechargingrecord(CDR)

CDR packet
groupofchargingrecords(CDR)ofthesameCDRtypegatheredtobesenttothe
charginggateway

210

Issue:28

GeneralGlossary

CDR sending
functionwherechargingrecords(CDR)aresenttotheCDRsenderwhichthenplaces
theminthesendqueue,fromwheretheyareimmediatelysenttoanactivecharging
gateway(CG)

CDR storage
processofstoringextrachargingrecords(CDR)ondiskbeforetheyaresenttothe
charginggateway

CDR transfer protocol


protocolthatenablestheofflinetransferofchargingrecordsfromtheconnection
processingserver(CPS)tothecharginggateway(CG)

CDSU channel
transmissionchannelwhichisusedinthemobileservicesswitchingcentre(MSC)to
implementtheinternaldatatransmissionconnectionbetweena386computeranda
DSCOplug-inunit

CDSU data channel test


testusedforcheckingtheconditionofasingledatachannelselectedbytheuser

CDSU routine test


testthatautomaticallyrunsonceevery24hourscheckingtheconditionofallCompact
DataServiceUnits(CDSU)intheexchange

CDSU unit test


testthatisusedtochecktheconditionofasingleCompactDataServiceUnit(CDSU)
selectedbytheuser

CEIR interface
interfacebetweentheCentralEquipmentIdentityRegisterandtheequipmentidentity
registers(EIR)thatoffersanautomaticEIRupdatingmechanism

celestial phase of transaction; celestial phase


actionsinaneventwhichareperformedaftercommitment

cell; network cell


inacellularsystem,thesub-areatowhichasetofradioresourcesnotusableinadjacent
sub-areasisallocated

Issue:28

211

GeneralGlossary

cell; cell coverage area


combinedcoverageareaofalltransceiversthatbelongtothesamebasetransceiver
station

cell breathing
variationofthesizeofthecellcoverageareaaccordingtointerferenceandtheresulting
powerdemandonmobilestations

cell broadcast; CB
shortmessagethatthemobilenetworksendsviacertaincellstoallmobilestations
whichsupportthecellbroadcastshortmessageservice(SMS-CB)inacertain
geographicalarea

cell broadcast centre /GB/ ; cell broadcast centre /US/; CBC


corenetworkelementthattheoperatorusesforcentralisedcontrolofmessagetransfer
throughoutacell

cell broadcast channel; CBCH


logicalchannelontheradiointerface,whichisusedfortransferringbroadcastmessages
tothemobilestation

cell broadcast service; CBS; SAB; service area broadcast; SMS cell
broadcast
servicethataninformationprovidercanusetosendashortmessagetoeverypieceof
userequipmentinaspecifiedarea

cell capacity
numberofactiveusersthatonecellcanhandleatatime

cell capacity assurance algorithm


algorithmthatensuresthattheminimumnumberofcallsthatcanbesetupineachcell
ofthenetworkatanytimeisequaltothenumberofcreatedtrafficchanneltime-slotsin
thecells

cell controller
networkelementthatincludesorsupportsacellresourceserver(CRS)andUEcontrol
function(UCF)

212

Issue:28

GeneralGlossary

CELL_DCH state
operationalmodeofthemobilestation(MS)whilereceivingandtransmittinguserdata
onthededicatedtrafficchannel(DCH)

cell delay variation; CDV; CTDV; cell transfer delay variation


variationinthecelltransferdelaythatdifferentcellsbelongingtothesamevirtual
connectionwillgenerallysufferfrominpassingthroughthenetworkduetovarying
queuelengthsintheATMswitches

cell delay variation tolerance; CDVT; CDT; cell delay tolerance


inATM,aQoSparameterusedinconstantbitrate(CBR)transmissionstospecifycell
delayvariationtolerancebydeterminingthelevelofjitterthatistolerableforthedata
samplestakenbythepeakcellrate(PCR)

cell delineation
identificationofcellboundariesinacellstream

cell dependent routing


routingperformedbythemobileservicesswitchingcentre(MSC)foramobile-originating
callonthebasisofthecellfromwhichthecallisoriginated

cell discarding
actionofdroppingATMcellstoensurethedeliveryofhigher-prioritytrafficwhenthe
networkiscongested

cell error ratio; CER


ratiooferroredcellstothetotalnumberofcellssentinatransmission,takenoveratime
interval

CELL_FACH state
modeofthemobilestation(MS)whilereceivinguserdataontheforwardaccesschannel
(FACH)andtransmittingonrandomaccesschannel(RACH)

cell flow path set up


functionwhichconfiguresavirtuallinkterminationpointtobeusedwiththedefinedcell
flowpathbetweenportsofanATMswitchfabric

Issue:28

213

GeneralGlossary

cell gateway; CGW


partofanIPbasetransceiverstation(IP-BTS)thatprovidescommonradioprocessing
functionsforcommonandsharedchannels

cell global identification; CGI; GCI; cell global identity; global cell identity
identitythatuniquelyidentifiesacellwithinallGSMpubliclandmobilenetworks

cell header
bitswithinacellallocatedforfunctionsrequiredtotransferthecellpayloadwithinthe
network

cell ID based positioning; cell coverage based positioning; cell-based


positioning
positioninginwhichtheservingradionetworkcontroller(SRNC)determinestheidentity
(cellID)ofthecellthatprovidescoveragetothetargetuserequipment(UE),afterwhich
thegeographicalco-ordinatesoftheservingcellandthecorrespondingantenna
directionareusedtodeterminethelocationoftheUE

cell identification method


methodwhichthemobileservicesswitchingcentre(MSC)usestoidentifythecellofthe
basestationcontroller(BSC)duringthehandover

cell identity; CI; CID; cell identifier; cell id


blockofcodewhichidentifiesacellwithinalocationarea

cell individual offset


cellcharacteristicthatisusedtobalanceloadamongneighbouringcells

cell list comparison; CLC


featureinwhichitischeckedwhethertheactivecell(thatis,thecellfromwhicha
subscriberoriginatesacall)orthemeasuredcells(thatis,cellswiththenextbest
coverage)oftheoriginatingcallbelongtothesubscriber'slocalisedservicearea(LSA)

cell load
inCDMA,afunctionofinterferencecomingfromboththeanalysedcellandothercells

cell loss priority; CLP


fieldintheATMcellheaderthatdeterminestheprobabilityofacellbeingdroppedifthe
networkbecomescongested

214

Issue:28

GeneralGlossary

cell loss ratio; CLR


inATM,theratioofdiscardedcellstocellsthataresuccessfullytransmitted

cell measurement
partoftrafficmeasurementwhichcanbeusedtofindoutthenumberofcalleventseach
cellhasmanagedduringtheresultsaccumulationperiod

cell measurement report


measurementreportwhichshowsthenumberofcalleventshandledbyeachcellduring
themeasurementperiod

cell misinsertion rate; CMR


ratioofcellsreceivedatanendpointthatwerenotoriginallytransmittedbythesource
endinrelationtothetotalnumberofcellsproperlytransmitted

cell outage detection


featurefordetectingsleepingcellsinthenetwork

cell passing
actionoftransmittingATMcellswithoutanydisturbance

cell payload scrambling


methodthatrandomisesthebitsinthepayloadportionofanATMcelltomakesurethat
thebeginningofeachnewcellisrecognised

CELL_PCH state
operationalmodeofthemobilestation(MS)whilereceivinguserdataonthepaging
channel(PCH)

cell prioritisation algorithm /GB/; candidate cell prioritisation /US/


algorithmutilisingthemeasurementsandspecifiedinputsforagivenuserforcalculating
weightsforeachcandidatecellinthecaseofanincomingcallorhandover,and
reorderingthecandidatecelllistaccordingtotheweights

cell radio network temporary identifier; C-RNTI


mobilestationidentifierwhichisallocatedbythecontrollingradionetworkcontroller
(CRNC)andisuniquewithinonecellcontrolledbytheallocatingCRNC

Issue:28

215

GeneralGlossary

cell ranking criterion


cellreselectioncriterionthatisusedtodifferentiatecellsthathavethesamepriority

cell rate
ratethatisdefinedbytheintervalbetweenthetransmissionofthelastbitofonecelland
thefirstbitofthenextcell,andmeasuredincellspersecond

cell rate decoupling


methodthatisusedtoinsertandsuppressidleATMcellstoadapttherateofthevalid
ATMcellstothepayloadcapacityofthetransmissionsystem

cell rate margin; CRM


measureofthedifferencebetweentheeffectivebandwidthallocationandtheallocation
forsustainablerateincellspersecond,usedtodeterminetheavailableresourcesofan
ATMnetwork

cell relay
networktechnologybasedontheuseofsmall,fixed-sizepacketsorcells

cell reselection; crossover


movementofamobilestationfromonecellareatoanother,whichmayleadto
changeover,handover,orlocationupdating

cell resource server; CRS


partofanIPbasetransceiverstation(IP-BTS)whichmanagesthecellresourcesand
channels

cell search procedure


procedurethattheuserequipmentusestodetectacellandtodeterminethedownlink
scramblingcodeandframesynchronisationofthecell

cell selection
procedurebywhichtheuserequipmentselectsacelltowhichitisconnectedwhenitis
switchedonorwhenithasbeenoutsidenetworkcoverage

cell selection parameter set


parametersetthatisusedforcellselectionandreselectioninidlemodeandin
connectedmode

216

Issue:28

GeneralGlossary

cell spacing
trafficshapinginwhichaminimumcellinter-departuretimeisforcedontheATMcells

cells per second; cps


unitofmeasureusedforATMswitchvolumes,indicatingthenumberofATMcells
transferredinasecond

cell tagging
actionofsettingthecelllossprioritybitofanATMcellto1

cell tariff class; cell tariff


parameterwhichisdefinedintheoriginanalysisanddeterminesthetariffclassofacell

cell transfer delay; CTD


elapsedtimebetweenacellexiteventatmeasurementpoint1andthecorresponding
cellentryeventatmeasurementpoint2

cellular network; cellular radio network; radio cellular network; multi-cell


network
mobilenetworkwhosewholeworkingrangeiscoveredbyusingcontiguouscellsofa
numberofbasetransceiverstations

cellular system; cellular communications system


mobilecommunicationsystemwhichusescellularnetwork

cellular text telephone modem; CTM


modemthatallowsthereliabletransmissionoftextviathespeechchannelofmobile
phonesystemsorpublicswitchedtelephonenetworks(PSTN)

cellular transmission; CT
transmissionbetweennetworkelementsinaGSMnetwork

cell unique UE identifier; RRM UE ID


specificidentifieroftheuserequipment(UE)thatisusedonthecelllevelwithintheradio
resourcemanagement(RRM)framework

Issue:28

217

GeneralGlossary

cell update
locationmanagementprocedurewhichamobilestationperformswhenitchangescell
withinaroutingareainreadystate

central ANR
featurethatduringtheautoconfigurationrequeststheNetActConfiguratorandNetAct
Optimisertoautomaticallygeneratethelong-termevolution(LTE)intra-frequency
neighbourrelationsforanewevolvednodeBinanLTEnetwork,andtoautomatically
updatetheneighbourrelationsofthecorrespondingneighbouringevolvednodeBs

central block; CB
setofcomputerunitswhichperformcentralisedfunctionsinanetworkelementthathas
adistributedprocessorarchitecture

Central Equipment Identity Register; CEIR


centraldatabaseinwhichacommonsetofdataismaintainedaboutallmemberPLMNs
onaworldwidebasis

centralised authentication /GB/ ; centralized authentication /US/


userauthenticationthatanetworkelementperformsusingtheLDAPdirectoryinan
authenticationserver

centralised automatic message accounting /GB/ ; centralized automatic


message accounting /US/; CAMA
automaticmessageaccountingsystemthatislocatedinanexchangebutservesvarious
adjacentexchanges

centralised boot flash updating /GB/ ; centralized boot flash updating /US/
featurewhichofferstheoperatoratooltoupdatethebootflashmemoriesineveryDMX
andChorusunitinsideanetworkelement

centralised-clock interface /GB/ ; centralized-clock interface /US/


interfaceacrosswhichtheassociatedtimingsignalsofboththeexchangeterminalon
thelinesideandtheexchangeterminalontheservicesidearesuppliedbyacentralised
clock

centralised computer unit /GB/ ; centralized computer unit /US/


computerunitwhoseresourcesareincollectiveuseandavailabletoallotherpartsofthe
networkelement

218

Issue:28

GeneralGlossary

centralised functions node /GB/ ; centralized functions node /US/; CFN


inaconnectionprocessingserver,aclientnodewhichincludesthecommonfunctions
andinwhichtheparametermanagervalidatorsaredeployed

centralised operation and maintenance /GB/ ; centralized operation and


maintenance /US/
operationandmaintenanceofagroupofexchangesfromonecentre

centralised part /GB/ ; centralized part /US/; CP; centralised part of the
alarm system
partofthealarmsystemwhichperformsthefinalprocessingofraisingorclearing
requestsreceivedfromthedistributedpart(DP)

centralised part of the signalling connection control part /GB/ ; centralized


part of the signalling connection control part /US/
controllingfunctionsofthesignallingconnectioncontrolpart,andpartofthestatistical
proceduresassociatedwithsignallingtrafficwhichhavebeenimplementedcentrally,and
whichprovideservicesforallsignallingunitsorothercomputerunits

centralised routing /GB/ ; centralized routing /US/


routinginwhichanetworkelementhasasingleopenshortestpathfirst(OSPF)daemon
andthusappearsasoneroutertootherIProutingdevicesinthenetwork

centralised user account /GB/ ; centralized user account /US/


useraccountthatconsistsofausernameandapasswordthatarecreatedusingNetAct
toolsandthatarestoredinanLDAPdirectory

centralised user authentication and authorisation /GB/ ; centralized user


authentication and authorization /US/; CUAA
featurethatNetActspecifiesandprovidesforthecentralisedmanagementof
permissionsformanagementaccesstomultiplenetworkelements

centralised user event log management /GB/ ; centralized user event log
management /US/
featurethatenablescentralisedaggregatingofusereventlogsfromthebasetransceiver
stationstoNetAct

Issue:28

219

GeneralGlossary

centralised user information management /GB/ ; centralized user


information management /US/
featurethatusesadedicatedauthenticationserverasacentralisedrepositoryinwhich
allnecessaryuserinformationisstored

centralised user profile ; centralized user profile


userprofileinwhichtheauthoritiesofaremoteuseraccountaredefined

central management for single nodes; CMS


featurethatallowsoneshortmessageservicecentreinagroupofsingle-nodeSMS
centrestoactasanadministrationnode

central memory; CM; central memory unit


centralisedfunctionalunitinwhichtheprimarycopiesofmemoryfilesarestoredand
fromwhichtheyareprimarilyloaded

central part of statistics; CPS


statisticsfunctionsthatareimplementedcentrally,andthatserveallcallcontrol
computersandothersignallingunits

central processing unit; CPU


partofcomputercontainingthecircuitsthatcontrolandexecuteinstructions.Itgenerally
containsthearithmeticlogicunit,anumberofspecialregistersandcontrolcircuits

central unit
computerunitwhoseresourcesareincollectiveuseandavailableforallunitsinthe
networkelement

centrex; central office exchange service


serviceimplementedinpublictelecommunicationsexchangethatenablesthesubscriber
linesconnectedtotheexchangetousethefacilitiestypicalforprivatebranchexchanges
orkeytelephonesystemextensions

centrex attendant; centrex operator


attendantwhoservesthecallscomingtothecentrexgroupcallnumberandthecalls
comingfromwithinthecentrexgroup

220

Issue:28

GeneralGlossary

centrex attendant position; attendant position; centrex operator position;


operator position
subscriberconnectionatwhichanattendantlogsontoaservicetoprovideanswering
andattendantservices

centrex charging subgroup


centrexsubgroupthatisestablishedforcharging

centrex enhanced attendant call hold; enhanced attendant call hold


callholdserviceavailabletothecentrexattendantconsole,enablingcallstobeputon
holdagainstholdpositions

centrex extension
extensionwhichisacentrexgroupmember

centrex group; centrex service group


groupofsubscribersthatareconnectedtoacentrex

centrex group administrative number


inacentrexsystem,asubscribernumberthatdoesnotrequireasubscriberposition

centrex group call number; call number of centrex group


numberdefinedforthecentrexgroupforcallscomingfromoutsidethegroup

centrex group member; centrex member; member of centrex group


analogueorISDNbasicaccesssubscriberbelongingtoacentrexgroup

centrex hunting; line hunting in centrex


huntingmethodsappliedasthecallscomingtothecentrexgroupcallnumberare
directedtothecentrexgroupmembers

centrex hunting group


huntinggroupthatisformedofcentrexgroupmembers

centrex subgroup
groupestablishedofapartofcentrexgroupmembersdesignatedforspecialpurposes

Issue:28

221

GeneralGlossary

certificate access
intheOSSapplicationplatform,aservicethatgrantscertificates,thatis,digitalidentities,
toauthenticatedusers

Certificate Enrollment Protocol; CEP


certificatemanagementprotocoldevelopedbyCiscoSystemsandVeriSignthat
specifieshowadevicecommunicateswithacertificationauthority

certificate enrolment; certificate enrollment /US/


processofobtaininganewcertificatefromacertificationauthority

certificate management; CM
processwherebythecertificates,certificaterequests,andprivatekeysaregenerated,
stored,protected,transferred,loaded,used,anddestroyed

certificate management protocol; CMP


protocolrequiredtosupportonlineinteractionsbetweenpublickeyinfrastructure(PKI)
components

certificate policy
policythatexplainstheconditionsandlimitationsofuseforadigitalcertificate

certificate repository
repositorythatisusedforstoringanddistributingsecuritycertificates,cross-certificates,
andcertificaterevocationliststotheusersofpublickeyinfrastructure

certificate request message format; CRMF


syntaxandsemanticsthatareusedtoconveyarequestforacertificatetoacertification
authority,possiblyviaaregistrationauthority,forthepurposesofX.509certificate
production

certificate request syntax; CRS


syntaxthatdescribesthedistinguishedname,publickey,andanoptionalsetof
attributesthatarecollectivelysignedbytheentityrequestingcertification,andthatare
requiredtocreateacertificatesigningrequest

certificate revocation list; CRL


timestampedlistsignedbyacertificateauthoritythatidentifiestherevokedcertificates
which,althoughnotexpired,arenolongervalid

222

Issue:28

GeneralGlossary

certificate signing request; CSR; certification request


inthepublickeyinfrastructure,amessagewhichanapplicantsendstoacertification
authoritytoapplyforapublickeycertificate

certification authority; CA; certificate authority


securityauthoritythatissuesandmanagescertificatesbyusingapublickeyalgorithmto
certifythepublickey

certification authority server; CA server


serverthatisusedtoissue,renew,andrevokedigitalcertificates;generatecertificate
revocationlists;andpublishcertificatesandcertificaterevocationliststotheLDAP
directoryserver

certification practice statement; CPS


statementofthepracticesthatacertificationauthorityemploysinissuingcertificates

Certification Request Syntax Specification; PKCS#10; Certification


Request Standard
syntaxthatisappliedtocertificatesigningrequeststhataresenttoacertification
authority

CES interworking function; CES IWF


functionthatisresponsibleforthetransparentexpansionoftheconstantbitratecircuit
overtheATMnetworkwiththeuseofATMadaptationlayertype1(AAL1)

CFNR-ImsiDetach
callforwardingonmobilesubscribernotreachable(CFNRe)inwhichthemobilestation
(MS)hasperformedanIMSIdetachoperation

CFNR-NoPagingResponse
callforwardingonmobilesubscribernotreachable(CFNRe)inwhichthemobilestation
(MS)cannotbepaged

CGI application; HTML/CGI application; CGI program


applicationthatisaccessiblethroughthewebserverviaacommongatewayinterface
(CGI)

CGI-BIN
scriptlanguagethatcreatesactualHTMLpagesatruntime

Issue:28

223

GeneralGlossary

CgiLauncher
Javaapplicationwhichofferslaunchingmechanismsforcommongatewayinterface
(CGI)andweb-basedapplicationsfromaDX200networkelement

chained BTS configuration


configurationthatallowsseveralbasetransceiverstations(BTS)tobecombined

chained list; chain


setofdatainwhicheachentryendsintheaddressofthenextiteminthelist

chained search
searchinwhicheachitemcontainsthemeansforlocatingthenextiteminthesearch

chained service
setoftrafficprocessingfunctionsappliedinsequentialorder

chaining station
stationwhichtransmitsintotwodirectionsasapartofatransmissionchain

chain network; linear network


networkwhichconsistsofalinearseriesofnodeswithaterminalnodeateachendof
thechain

chain protection
protectionmethodwherethenetworkelementsorfunctionalunitsareorganisedina
chainandfunctionindependentlyofeachother

chain topology
networktopologyinwhichthenetworkelementsarelinkedoneaftertheother

Challenge Handshake Authentication Protocol; CHAP


authenticationschemefortheTCP/IPPoint-to-PointProtocol(PPP),wherethepassword
isnotonlyrequiredtobeginaconnectionbutisalsorequiredduringtheconnection

224

Issue:28

GeneralGlossary

challenge-response authentication method; challenge-response;


challenge-response protocol
authenticationprocedureinwhichausermustrespondcorrectlytoachallengetogain
accesstoasystem

changeback
procedureoftransferringsignallingtrafficfromoneormorealternativesignallinglinksto
asignallinglinkwhichhasbecomeavailable

changeback code
fieldinthesignallingnetworkmanagementmessagesusedinthechangeback
procedure.Itisusedtodiscriminatemessagesrelatingtodifferentchangeback
proceduresperformedatthesametimetowardsthesamesignallinglink

change delivery; CD
deliverythatisbasedononeormorechangenotesandthatprovidescorrectionsthat
areimplementedbetweenreleasestothedeliveredfunctions

change delivery remote management; CDRM; CD remote management


featurethatallowstheactivationofchangedeliveries(CD)remotelyfromonecentralised
location

change flow direction procedure; change flow direction


procedurethattheMSCserverusestochangetheflowdirectionbetweenbearer
terminationswithinthecontext

change group
timetablethatdeterminesthechargeratesandchargeratechangemomentswithinone
day

change note management


featurethatisusedtobringchangedeliveriestoasoftwarebuildinanetworkelement

change notification
messagethatanetworkelementsendstoNetActafterarestartorwhenithasactivated
anewsoftwarebuild

Issue:28

225

GeneralGlossary

change of position context


triggerdetectionpointrequest(TDP-R)atwhichthenewservingGPRSsupportnode
(SGSN)sendsaquerytotheservicecontrolfunction(SCF)afteraroutingareaupdate

changeover
procedureoftransferringsignallingtrafficfromonesignallinglinktooneormoredifferent
signallinglinks,whenthelinkinusefailsorneedstobeclearedoftraffic

change-over equipment
equipmentbymeansofwhichprotectedswitchingisimplementedinprotectedsystems

changeover signal
signalwhichindicatestothechangeoverequipmentthatthereisafaultintheredundant
equipmentwhichrequiresanequipmentchangeover

changeover signal; CGS


symmetricalcurrent-controlledsignalthatisusedtoselectthebasictimingsignals
providedasaduplicatedsetandtoselecttheMessageBusInterface(MBIF)which
controlsthemessagebussynchronisationsignal

change time; change moment


momentwhenthedestinationchangesintoanotherone

changing between calls


functionwheretherearetwosubscribersconnectedtooneoperatorandtheoperator
cantalktoonesubscriberatatimewithouttheothersubscriberhearingtheconversation

channel allocation planning


partofdetailednetworkplanninginwhichtherealphysicalconnectionsthroughoutthe
transportnetworkaredefined

channel associated signalling /GB/ ; channel associated signaling /US/;


CAS
methodofsignallinginwhichthesignallinginformationthatrelatestothetrafficcarried
byasinglechannelistransmittedinthechannelitselforinasignallingchannel
permanentlyassociatedwithit

226

Issue:28

GeneralGlossary

channel capacity
maximumamountofinformationthatcanbereliablytransmittedoveracommunications
channel

channel coder digital signal processor; CHDSP


digitalsignalprocessorthatperformsfrequencyhoppingcalculationsandcontrolsthe
radioreceiverandradiotransmitterburstswitchingbetweentransceivers

channel coding; CC
adaptationofasignalproducedbyspeechcodingtoaradiochannel

channel configuration-dependent AGCH buffer size


sizeoftheaccessgrantchannel(AGCH)bufferthatdependsonthechannel
configurationandthatissetduringtransceiverstart-upaccordingtotheconfigurationof
broadcastcontrolchannel(BCCH)time-slots

channel congestion
congestionwherenosuitableradiochannelcanbereservedforacall

channel decoder; CHD; DEC


decoderwhichrecalculatestherealdatabitsfromthereceivedinformationandalsoin
certainlimitscorrectsthebiterrorsoccurredinthechannel

channel decoupling; channel isolation


leveldifference,expressedindB,betweentherequiredsignalandthesignalofthe
adjacentchannel,observedbythedetectorofthereceiverwhenthesignalsareofequal
levelattheinputportofthereceiver

channel element
partofabasetransceiverstationthatencodesthedatainasignalwiththespreading
codes

channel encoder; CHE


encoderwhichcalculates,usingacertainformula,newbitswhichwillbetransmittedas
extrabitsfromthebitstobetransmitted

Issue:28

227

GeneralGlossary

channel finder
measurementtoolwhichgivesinformationonthenetworkqualityandisusedtoimprove
frequencyqualityinthenetwork,toadaptpartsofthenetworktoanewfrequencyplan,
andpreventinterferencewhennewbasetransceiverstations(BTS)ortransceivers
(TRX)areintroducedinthenetwork

channel gate
deviceforconnectingachanneltoabus,orabustoachannel

channel identifier; CID; channel ID


identifierdesignatingtheframerelaysubchannelidentifierforvoiceoverframerelay

channel interleaving; interleaving


methodofmappinginformationfromdifferentchannelstothesametime-slot

channel monitor
devicethatprovidesinformationonthenatureorrelativequalityofaspeechorvoicebanddatasignalpresentonavoicecircuit

channel order
channelorderincludesforexample,typeofactionorstatusdefinedforthechannel

channel priority
prioritylevelappliedtoachannel

channel quality indicator; CQI


inhigh-speeddownlinkpacketaccess,anindicatoroftherelativeinstantaneouschannel
qualitythatiscalculatedusingthetransmissiontimeintervalandinstantaneousand
relativechannelthroughput

channel quality indicator channel; CQICH


channelthatprovidesfastchannelinformationfeedbacktoenabletheschedulerto
choosetheappropriatecodingandmodulationforeachallocation

channel quality measurement


measurementthatisusedtocollectanddisplayparametersthatreflectthequalityofthe
userdatatravellingthroughatransmissionchannel

228

Issue:28

GeneralGlossary

channel request message; channel request


messagethatamobileterminalsendstothebasestationsystemontherandomaccess
channeltorequesttheestablishmentofaradioresourceconnection

channel separation
radiolinkoperationalmodewhichprovidestwoindependentdatachannelsfortraffic
overtworadiohops

channel service unit; CSU


functionalunitthatconnectstoadigitaldatacircuitwhichatelephonecompanyhas
provided

channel signal
signalreceivedortransmittedbymultiplexequipment

channel spacing
differenceinfrequencybetweensuccessivechannels

channel state information; CSI


signallingchannelinformationthatindicatesthenumberofdatastreamsthatcanbe
transmitted,howtotransmitthedatastreams,andthechannelqualityindicatorforeach
datastream

channel switching
switchingofsinglechannelsfortheexclusiveuseoftheconnectionforthedurationofa
call

channel time-slot
timeslotoccupyingaspecificpositioninaframeandallocatedtoaparticulartimederivedchannel(Inadditiontoitsmainfunctionoftransmittingacodeword,achannel
timeslotmayalsobeusedforin-slotsignallingorfortransmittingotherinformation.)

channel type; CT
searchattributewhichallowstheusertodeterminewhatchanneltypeswillorwillnotbe
takenintoaccountinthesearch

character; char
memberofacharactersetusedfororganising,controllingorrepresentingdata

Issue:28

229

GeneralGlossary

character data
textintheelement'scontentexceptmarkuptags

character error rate; CER


ratioofthenumberofcharactersincorrectlyreceivedtothetotalnumberofcharacters
sent

characteristic information
signalofcharacteristicrateandformatwhichistransferredwithinandbetweensubnetworksandpresentedtoanadaptionfunctionfortransportbytheserverlayernetwork

characteristics of call; COC


parameterthatindicatesthecalltype,whichcanbeanormal,anemergency,ora
servicecall

characteristics of number; CON


parameterindicatingthetypeofnumberwhichcanbeanationalnumber,an
internationalnumberoralocalnumber

character position
storageinamemoryordatamediumwhichcancontainonecharacter

charge
pricethatisdefinedforaneventoraservice

chargeable duration; CDUR


timeforwhichacallshouldbecharged,measuredinminutesandseconds

chargeable event
activityutilisingtelecommunicationsnetworkinfrastructureandrelatedservicesforuser
tousercommunication,orforusertonetworkcommunication,orforinter-network
communication,orformobility,whichthenetworkoperatorwantstochargefor

chargeable service component


serviceorpartofitthatischargedinacertainwaybyusingaspecificchargingmethod

230

Issue:28

GeneralGlossary

chargeable user identity; CUI


attributethatindicatesaroamingsubscribersothatthehomenetworkcanchargethe
subscriberfortransactionsthatoccurinthevisitednetwork

charge advice information; CAI


informationthemobilestation(MS)issuppliedwithatthechargingpointonaper-callbasiswhichtheMSusestocomputetheadviceofcharge(AOC)valuefortherelevant
call

charge determination point; CDP


exchangeorIN-SCP/serviceproviderthatdetermineswhichtarifforadd-oncharge
shouldbeapplied

charged number
numberreceivedinsignallingtowhichchargingforthecallisdirected

charged party
partywhichhastopaysomeorallthechargesofachargeableevent

charge-free access
accessinwhichthecallsarefree-of-chargeforthecaller

charge generation point; CGP


exchangeinwhichtheonlinechargingisperformedbyconvertingtariffpertimetocost

charge indication; call charge indication; indication of charge


realtimeinformationobtainedduringacallonanincreaseinthenumberofhome
meteringpulses

charge indicator; charging indicator


indicatorshowingwhetherornotthecallischargeable

charge message; CHG; CHG-message


messageinwhichtariffinformationofcallsistransferredfromoneexchangetoanother

Issue:28

231

GeneralGlossary

charge number; CN
parameterthatuniquelyidentifiestheorganisationtobechargedfortheusageofthe
carrierinasysteminwhichequalaccessisused

charge rate
timebetweentwometeringpulsesortworepeatedpulsetrainsintime-basedcharging

charge rate change


actionperformedundercontroloftherealtimeclockwhenacurrentchargerateis
changedtoapredeterminednewchargerate

charge rate moment


timewhenonechargerateperiodstopsandthenextchargerateperiodstarts

charging; CNG
networkfunctionforcreatinginformationrequiredtochargethesubscriberforthe
servicesused

charging acknowledgement
inpushtotalkovercellular(PoC),anoptionalfeaturethatenableschargingifthe
terminalreceivingatalkburstacknowledgesthetalkburstafterithasended

charging acknowledgement information; CRGA


messagewhichisusedinthecallingsubscriber'sexchangetoacknowledgeaCHGmessage

charging adapter; clearing adapter


softwarecomponentofthedeliveryserverwhichintegratesthedeliveryserverto
chargingandbillingsystems

charging administration; tariff and charging administration


DX200commandclass

charging agent
agentthatcollectschargingdatarecordsanddeliversthemtothecharginggateway
functionthroughtheGPRStunnellingprotocol.

232

Issue:28

GeneralGlossary

charging analysis
analysisthatisusedtofindoutthechargingdataofacallafterroutingdatahasbeen
obtainedinnormaldigitanalysis

charging and statistics function; CSF


setoffunctionsforcreatingchargingrecords(CDR),fieldreporting,service
measurement,andmobileapplicationpart(MAP)measurement

charging area; CA
parameterwhichisusedtoattachacelltoagivencharging

charging attribute analysis; CHA


attributeanalysisthatismadebeforethedigitanalysisandresultsinnewchargingorigin
informationortheoriginalchargingorigininformation

charging automaton
partoftimechargingwhichisassociatedwitheitherasubscriberortheuseoftrunklines

charging based on CHG-messages


methodofcharginginwhichpulsesarenotutilisedbutinsteadthebasisofchargingis
thepriceofthecall

charging based on distance


regionalchargingwhichallowsmobile-originatingcallstobechargedaccordingtothe
distancebetweenthecallingandcalledparties

charging based on home area


regionalchargingwhichallowsmobile-originatingcallstobechargedaccordingtothe
locationofthecallingpartyinthecellularnetwork

charging block; RAM block of charging; CDR block


blockoffixedlengthintherandomaccessmemory(RAM)oftheChargingUnit(CHU)
wheretheformedchargingrecordsarefirststored

charging case
resultofchargingcaseanalysiswhichisobtainedthroughchargingindexandcharging
originandwhichisusedforspecifyingchargingdata

Issue:28

233

GeneralGlossary

charging case analysis


call-specificpartofcharginganalysis,inwhichthechargingindex,chargingorigin,and
transmissionmediumrequirementareanalysed

Charging Center
NSNproductthatisusedforchargingmobiledataservices

charging centre /GB/ ; charging center /US/; CC


systemwhichenablescallanalysisandthecalculationofthecostofacallonthe
groundsoftransmittedchargingrecords(CDR)

charging characteristics
informationthatindicatesthechargingmethodthataGPRSsubscriberisusing

charging class
attributethatdefinescharginginformationforaspecificIPflow

charging collection function; CCF


functionthattransferscharginginformationfromIPmultimediasubsystem(IMS)
elementstothebillingsysteminofflineIMSchargingarchitecture

charging data function; CDF


functionthatreceiveschargingeventsfromthechargingtriggerfunctionviatheRf
interfaceandconstructsthechargingrecords(CDR)basedontheinformationcontained
inthechargingevents

charging data record; CDR; charging record


recordgeneratedbyanetworkelementforthepurposeofbillingasubscriberforthe
providedservice

charging disk file


diskfileontheharddiskoftheChargingUnitwherechargingdataisstored

charging file; CDR file


groupofchargingrecords(CDR)onamassmemoryunit,suchasdisk,magnetictape,
ordigitaldatastorage(DDS)tape

234

Issue:28

GeneralGlossary

charging gateway; CG; mediator


networkelementthatreceiveschargingrecords(CDR)fromothernetworkelements,and
gatherschargingrecordsofonecalltogetherandthenforwardsthecollectedcharging
recordstothebillingsystem

charging gateway function; CGF


function,specifiedby3GPP,whichprovidesamechanismfortransferringcharging
informationfromtheservingGPRSsupportnodes(SGSN)andgatewayGPRSsupport
nodes(GGSN)tothenetworkoperator'scustomercareandbillingsystem(CCBS)

charging identifier; C-ID; CI; charging ID


identifierthatconsistsofthePDPcontextidentifierandtheGGSNaddressandisused
toidentifythedifferentchargingrecordscreatedbytheGPRSsupportnodesbelonging
tothesamePDPcontext

charging index
resultofadigitanalysisoracontinuationanalysisofchargingwhichisusedasinput
datainchargingcaseanalysis

charging information message; CRG; charge information message


signallingmessagesentforchargingoraccountingpurposes

charging information transfer


processoftransferringthecontentsofachargingdiskfiletothebillingcentre

charging interface
interfacewhichisusedtocommunicatewiththechargingsystem,enablingcharging
functionssuchasthetransferofchargingdata,in-advance-credit-check,andcustomised
CDRcreation

charging mediator; CME


networkoperator'sdevicethatfetchesorreceivesthechargingrecords(CDR)tobesent
totheoperator'sbillingsystemfromthepushtotalkcallprocessorifthecharging
gatewayisnotused

charging message
charginginformationmessageormeteringpulsemessagethatissenttotheincoming
circuitorservicecontrolpoint

Issue:28

235

GeneralGlossary

charging method
methodofgeneratingchargingdatawhichisbased,forexample,onvolume,events,
pulses,duration,flatfee,oranycombinationofthose

charging mode
wayofexecutingthechargingofacall

charging modification
partofcharginganalysisthatisusedtoobtaininformationonhowtochangecharging
data

charging modification analysis


analysiswherebythetariffcanbechangedduringthecallaccordingtopredefined
subscribercharacteristics

charging module
softwaremodulewhichimplementstheapplicationprogramminginterface(API)for
charging

charging monitoring counter


counterthatcollectscallinformationwhichisdividedintodifferentcountersonthebasis
ofthedirectionofthecallsinamobilenetwork

charging observation
actionsbywhichtheexchangeaimstocheckthecorrectnessofcharginggeneratedboth
byitselfandonahighernetworklevel

charging observation charging


partofstorageofcharging,whichstoresthechargingpulsesgeneratedduringthecall
ontothechargingobservationcounters

charging of facility calls


charginginwhichthefeefromfacilitycontrolisstoredasaone-timechargeintoa
separatechargingrecord

charging of operator calls; charging of attendant calls


applicationofcharginginwhichthreedifferenttypesofchargingcanbedirectedtoacall:
chargingcomingtotheoperator,chargingoriginatingfromtheoperator,andservice
profilecharging

236

Issue:28

GeneralGlossary

charging on delivery
chargingwhichin-advancecreditchecking(IACC)enables,inwhichareservationis
madewhenmakingthein-advancecreditcheck,andthebalanceisupdatedafterthe
messageisdelivered

charging on submit
chargingwhichin-advancecreditchecking(IACC)enables,inwhichthebalanceis
updatedwhenmakingthein-advancecreditcheck

charging origin; CORG


datawhichisreceivedonthebasisofcalloriginandwhichisusedasinputdatain
chargingcaseanalysis

charging plan
planthatdefinesthechargingparameterstobeused

charging point; CHP


exchangegeneratingchargingpulsesforacall

charging profile
shareduserdatathatcontainsthechargingfunctionaddressesandthatisreferredtoby
aspecificidentifierintheIMSsubscriptiondata

charging reference identifier; CRI


identifierwhichconsistsofapresetnetworkidentificationuniqueforeachexchangeand
areferenceidentifiergeneratedforeachcall

charging rule
rulewhichdefineshowchargingisperformedbydescribingtheratinggroupsandrelated
chargingmethodsandtariffintervalsforeachservice

charging server; ChS


inapushtotalkcallprocessor,aserverinthecontrolplanewhichisusedforcollecting
andstoringthechargingdatacomingfromtrafficandcontrolservers

charging subgroup
groupwithagroup-basedmainchargingzoneandanadditionalchargingzone

Issue:28

237

GeneralGlossary

charging supplementary services


supplementaryservicesbymeansofwhichitispossibletoaffecttheformationofthe
phonebillortomodifythepresentationofthebill

charging system
entitythatconsistsofallproductsandservicesthatcanberesponsibleforchargingthe
userfortheservicesused

charging tariff information; CRGT


partofISDNuserpart(ISUP)messagewhichenablesthechargingofcallattemptsin
caseofunsuccessfulcalls

charging trigger function; CTF


functionthatgenerateschargingeventsbasedontheobservationofnetworkresource
usage

charging type
chargingparameterwhichindicatesthepaymentmethodandstatesthereal-time
requirementsforcharging

charging zone; tariff zone


areaseenfromtheexchangeinquestionforwhich,whencalledto,thesamechargerate
andchangegroupapply

charging zone counter


counterwhichstoresthenumberofpulsesthathavebeengeneratedinthecharging
zone

chase combining; CC; convolution code


hybridautomaticrepeatrequestinwhicheachretransmissionrepeatsthefirst
transmissionorpartofit

chat
real-timeinterchangeofmessagesoftwoormoreusersinacommunicationsnetwork

chat room
virtualroomwhereachatsessiontakesplace

238

Issue:28

GeneralGlossary

check bit; CK
bitassociatedwithacharacterorblockforthepurposeofcheckingtheabsenceoferror
withinthecharacterorblock

check box; checkbox


UIcontrolintheshapeofabox,accompaniedwithtext,whichauserclickstoselector
deselectanoption

check digit
parametervalueusedtoensurethatinternationalmobilestationequipmentidentities
(IMEI)areenteredcorrectlyintheblackorgraylistsoftheequipmentidentityregister
(EIR)

checking history passwords


featurewhichpreventstheoperatorpersonnelfromreusingoldpasswordswhen
changingapasswordwithMMLcommands

check loop
devicewhichisattachedtointerconnectthegoandreturnpathsofacircuitatthe
incomingendofacircuittopermittheoutgoingendtomakeacontinuitycheckonaloop
basis

checkpoint
pointintimewhenthecontentsofadatabaseareforcedinaconsistentwaytoa
permanentmediatobeusedforrecovery

checkpointing
functionthatsavesthecurrentstateofaprogramanditsdata,includingintermediate
results,todiskorothernon-volatilestorage,sothatifinterruptedtheprogramcanbe
restartedatthepointatwhichthelastcheckpointoccurred

checkpoint supervision
activesupervisioninwhichthesupervisingsystemexpectsamessagefromtheportofa
supervisedactoratpredefinedintervals

check report
reportwhichiscreatedtocheckanitem'sbehaviourandstate

Issue:28

239

GeneralGlossary

check request
requestthatissenttotheOnlineServiceController(OSC)todeterminetheaccountto
bechargedandthebalanceoftheaccount

check sequence; CS
sequenceofbitsthatoffersacyclicredundancycheck(CRC)toallowthedetectionof
errors

checksum; CKS; check sum


calculationofasetofdataitems(forexamplefile)forerrordetectionanddata
authenticitycontrollingpurposes

check word
machinewordusedtorepresentachecksymbol

child cell
microcellequippedonlywithsuper-reusetransceivers

child unit
amongnestedfunctionalunits,alower-levelfunctionalunitinthehierarchy

CHILL; CCITT high-level language


highlevelprogramminglanguageforprogrammingSPCtelephoneexchanges
(developedbyITU-TandfullydescribedinrecommendationZ.200)

chip
equallengthsignalsegment

chip rate
numberofchipstransmittedinonesecond

chip selection signal


signalthatselectsandenablesaparticularperipheraldeviceormemorycircuitfordata
transfer

240

Issue:28

GeneralGlossary

chip select logic


electroniccircuitrywiththetasktoselectoneofmanyindividualintegratedcircuits
(chips)tobeactiveonacommonresource,forexample,amicroprocessorbus,thatis
connectedtomultiplechips

chooser
toolforchoosingbetweendifferentoptionsorsettingsintheuserinterface

chop
setofallprogrampointsaffectedbetweentwopoints,thechopsourceandthechop
target

chopper
deviceforperiodicallyinterruptinganelectriccurrentorbeamofradiationtoproducea
pulsedcurrent

Chorus computing platform; CCP


computingplatformwhichisacollectionoffeaturesthatprovidearuntimeenvironment
forfault-tolerantapplicationsonthetopofacommercialreal-timeoperatingsystem
(RTOS)inadistributed,heterogeneousnetworkelement

Chorus I/O manager; IOM; input/output manager


inChorusOS,anactorthatcontainsthemostofBSDkernelcodeandimplements
POSIX(portableoperatingsysteminterfaceforUNIX)I/Oservices

Chorus IPC
basicinter-processcommunication(IPC)messagingmechanisminChorusOS

Chorus netboot
featurewhichdefinestheloadingofthebootablearchiveofaChorusunitwithnetwork
bootingusingthebootstrapprotocol(BOOTP)

ChorusOS operating system; ChorusOS; Chorus


commerciallyavailable,hardware-independentoperatingsystemdevelopedbySun
MicrosystemsInc

ChorusOS profile; profile


collectionofChorusOSmodulesandsystemvariablevaluesthatprovidesselected
services

Issue:28

241

GeneralGlossary

Chorus platform
platformwhichconsistsofChorusOSandsupportingservices

Chorus preprocessor platform


Chorusplatformwhichisonapreprocessor

Chorus service terminal


serviceterminalthatallowsaccesstoaChorusunitandprovideslow-levelcommands
fortestingandlocatingerrors

chronology management
incharging,thecontrolofthedifferentversionsofoffersandthetrackingofservice
accesstomakesuretheuserischargedcorrectly

C/I-based handover candidate evaluation


functionofthebasestationcontroller(BSC)thatisusedtoestimatethelevelofpotential
co-andadjacentchannelinterferenceofeachhandovercandidateandtousethis
informationinthetargetcellevaluationprocedure

CIMD2
versionofthecomputerinterfacetomessagedistribution(CIMD)protocolusedbetween
theshortmessageentities(SME)andtheservicecentrewhentransferringmessages
betweenmobilestationsandSMEs

CIMD2 application capacity control; CACC


SMSCenterfeaturefordefiningandprovidingflexiblecapacityforagroupof
applicationsforsubmittingmessages

CIMD2 application-terminated overload control; CATOC


featurewhichautomaticallyrejectsandacceptsmessagesperapplication,andso
preventsapplication-terminatedmessagesfromfillingtheshortmessageservicecentre
(SMSC)databasewhentheapplicationscannothandletheirapplication-terminated
trafficproperly

CIMD interface
interfacethatusestheCIMDprotocolfortransferringmessagesbetweenshort
messagingapplicationsandtheshortmessageservicecentre(SMSC)

242

Issue:28

GeneralGlossary

CI number
numberwhichidentifiesthecellinalocationarea(LA)

cipher-based MAC; CMAC; cipher-based message authentication code


block-cipher-basedmessageauthenticationcodethatisusedtoprovideassuranceof
theauthenticityandintegrityofdata

cipher block chaining mode; CBC; cipher block chaining


blockencryptionalgorithmwherethefirstplain-textblockisXOR'edwithaninitialisation
vector(IV),andsubsequentblocksareXOR'edwiththepreviouscipher-textblock,
beforetheblockisencrypted

ciphering key; Kc
cryptographickeyusedinconjunctionwiththealgorithm5(A5)tocipheruserand
signallingdata

ciphering key sequence number; CKSN


numberassociatedwiththecipheringkeyKcandstoredtogetherwithitinthemobile
stationandinthenetwork

ciphering serial number


informationelementwhichcontainstheserialnumberusedincipheringthebroadcast
message

ciphertext
dataproducedthroughtheuseofencipherment

circuit administration
procedurewhichtakespartinaddinganewcircuit,modifyingthestateofacircuit,and
removingacircuit

circuit blocking and unblocking reception; BLR


procedurewhichtakescareofthereceptionofthesignallingsystemNo.7(SS7)
messagesconcerningtheblockingandunblockingofthecircuit

circuit blocking and unblocking sending; BLS


procedurewhichtakescareofthesendingofthesignallingsystemNo.7(SS7)
messagesconcerningtheblockingandunblockingofthecircuit

Issue:28

243

GeneralGlossary

circuit emulation service; CES


servicethatenablesuserstomultiplexorconcentratemultiplecircuitemulationstreams
forvoiceandvideowithpacketdataonasinglehigh-speedATMlinkwithoutaseparate
ATMaccessmultiplexer

Circuit Emulation Service over Packet Switched Network; CESoPSN; CES


over PSN
protocolthatisusedforencapsulatingstructuredtime-divisionmultiplexed(TDM)signals
aspseudowiresoverpacket-switchednetworks

circuit emulation service pass-through function; CES pass-through


functionthatallowstoaddaconnectionfromaTDMinterfacetoanotherTDMinterface

circuit endpoint
connectionterminationpointattheboundaryofatransmissionnetwork

circuit group; CG; CGR


groupofcircuitsthathavethesamepurposeandaretraffic-engineeredasaunit

circuit group administration


functionswhichareusedtomanagetheexternalcircuitgroupsandtrunkcircuits
accordingtotheuser'scommands

circuit group blocking acknowledgement message; CGBA; circuit group


blocking acknowledgement
signallingmessagesentasaresponsetoacircuitgroupblockingmessagetoindicate
thattherequestedgroupofcircuitshasbeenblocked

circuit group blocking message; CGB; circuit group blocking


signallingmessagesenttotheexchangeattheotherendofanidentifiedcircuitgroupto
causeanengagedconditionofthiscircuitgroupforsubsequentcallsgoingoutfromthat
exchange

circuit group counter


counterwhichstoresthenumberofpulsesthathavebeengeneratedinthecircuitgroup

244

Issue:28

GeneralGlossary

circuit group error ratio supervision; supervision of error ratio in circuit


groups
partofmaintenancesupervisionwhichsupervisestheerrorratioincircuitgroupsby
usingthelimitsdefinedbytheuserandgivesanalarmifthelimitisexceeded

circuit group measurement; traffic measurement on circuit groups; circuit


group traffic measurement
partoftrafficmeasurementwhichgivesinformationonthetrafficintensityonthecircuit
groupsdefinedbytheuser

circuit group measurement report


measurementreportwhichshowsthenumberandtypeofcallsandcallattemptsineach
circuitgroupduringtheresultsaccumulationperiod

circuit group query message; CQM; circuit group query


signallingmessagesentonaroutineoron-demandbasistorequestthefar-end
exchangetogivethestateofallcircuitsinaparticularrange

circuit group query response message; CQR; circuit group query response
signallingmessagesentasaresponsetoacircuitgroupquerymessagetoindicatethe
stateofallcircuitsinaparticularrange

circuit group reset acknowledgement message; GRA; circuit-group-resetacknowledgement message; circuit group reset acknowledgement
signallingmessagesentinresponsetoacircuitgroupresetmessageandindicatingthat
therequestedgroupofcircuitshasbeenreset

circuit group reset message; GRS; circuit-group-reset message; circuit


group reset
signallingmessagesenttoreleaseanidentifiedgroupofcircuitswhen,duetomemory
mutilationorothercauses,itisunknownwhetherareleaseorreleasecomplete
messageisappropriateforeachofthecircuitsinthegroup

circuit group reset reception; CGRR


procedurewhichtakescareofreceptionofthesignallingsystemNo.7(SS7)messages
concerningacircuitgroupreset

circuit group reset sending; CGRS


procedurewhichtakescareofsendingofthesignallingsystemNo.7(SS7)messages
concerningacircuitgroupreset

Issue:28

245

GeneralGlossary

circuit group supervision message type


signallingparameterinacircuitgroupblockingorunblockingmessage,indicating
whetherblockingorunblockingismaintenanceorientedorhardwareoriented

circuit group to number destination measurement


measurementwhichshowsthenumberandtypeofcallsorcallattemptsreceivedin
eachdefinedpairofacircuitgroupandanumberdestinationduringtheresults
accumulationperiod

circuit group unblocking acknowledgement message; CGUA; circuit group


unblocking acknowledgement
signallingmessagesentasaresponsetoacircuitgroupunblockingmessagetoindicate
thattherequestedgroupofcircuitshasbeenunblocked

circuit group unblocking message; CGU; circuit group unblocking


signallingmessagesenttotheexchangeattheotherendofanidentifiedcircuitgroupto
causecancellationofanengagedconditioninthatcircuitgroup

circuit identification code; CIC


partofthelabelinasignallingmessagethatindicatesonespeechcircuitamongthose
thatinterconnectthedestinationandoriginatingpointsdirectly

circuit layer network


layernetworkprovidinguserswithend-to-endtelecommunicationsservicesby
transferringinformationbetweencircuitlayeraccesspoints

circuit network media termination


mediagateway(MGW)functionwhichterminatesbothA-lawandMu-lawE1andT1
pulsecodemodulation(PCM)circuitsontheswitchedcircuitnetwork(SCN)side

circuit observation
partoftrafficobservationwhichhandlesindividualcircuitsforeachcallseparately

circuit pool; CIP


groupofcircuitsthatsupportsasetofchannelmodesandrelatedspeechcodec
algorithms

circuit recovery action


recoveryactionwiththepurposeofreleasingacircuitwhichisinsomeundefinedstate

246

Issue:28

GeneralGlossary

circuit reservation acknowledgment message; CRA; circuit reservation


acknowledgment
signallingmessagethatanapplicationintheISDNuserpartlayerofanexchangeuses
toindicatethatithasreservedacircuit

circuit reservation message; CRM; circuit reservation


signallingmessagethatanexchangesendstoanapplicationintheISDNuserpartlayer
ofanotherexchangetoreserveacircuit

circuit reset; CRS


procedurewhichhandlesthesendingandreceptionofthesignallingsystemNo7(SS7)
circuitresetmessages

circuit seizure
proportionoftimeduringwhichthecircuitshavebeenseizedduringacertainperiodof
time

circuit seizure supervision


supervisionforfindingoutwhichcircuitsarefreeandwhicharereservedduringthe
supervisionperiod

circuit state indicator


signallingparameterthatindicatesthestateofacircuitaccordingtothesending
exchange

circuit switched; CS
switchedbymeansofcircuitswitching

circuit-switched call; CS call


callthatisroutedthroughthecircuit-switchedcorenetwork(CSCN)domain

circuit-switched connection; CS connection


temporaryconnectionthatisestablishedonrequestbetweentwoormorestationsin
ordertoallowtheexclusiveuseofthatconnectionuntilitisreleased

circuit-switched data; CSD


dataconnectionwhichusesspecificallyreservedresources

Issue:28

247

GeneralGlossary

circuit-switched data call


datacallthatisbasedoncircuitswitchingandthustiesupnetworkresourcesforthe
durationofthecall

circuit switched data package


H.248packagethatcontainstheinformationneededtobeabletosupportGSMand
UMTScircuit-switcheddatafromthemediagateway

circuit-switched data server; CDS; CS data server


dataserverthatprovidestheinterworkingfunctionsforacircuit-switcheddatacall
betweenapubliclandmobilenetwork(PLMN)andafixednetwork

circuit-switched data transmission; circuit-switched transmission


transmissionmodeinwhichcircuitsarereservedacrossthesystemforthesoleuseofa
singlecommunication,evenwhenthereisnotransmissionofdata,thatis,silenceonthe
line

circuit-switched domain; CS CN domain; circuit-switched core network


domain; CS domain
setofcorenetworkelementswhichareneededtoprovidecircuit-switchedservices

circuit-switched gateway; CSGW; CS-GW


gatewaythatisanaccesspointforcircuit-switchedtrafficfromthecorenetworkand
otherradioaccessnetworks(RAN)totheAll-IPRAN

circuit-switched network
switchednetworkthatprovidescommunicationschannelforexclusiveusebythe
subscribersofacalloraservicebyinterconnectingtransmissionchannelsor
telecommunicationcircuits

circuit-switched public data network; CSPDN


generalcircuit-switcheddatatransmissionnetwork

circuit-switched service; CS service


servicethatisimplementedbymeansofcircuit-switchedconnections

circuit-switched territory
radioresources,mainlyradiochannels,thatareallocatedforcircuit-switchedtraffic

248

Issue:28

GeneralGlossary

circuit switching; CS
switchingofcircuitsfortheexclusiveuseofaconnectionforthedurationofacall

circuit transfer mode


transfermodeinwhichtransmissionandswitchingfunctionsareachievedbypermanent
allocationofchannels/bandwidthbetweentheconnections

circuit validation response message; CVR; circuit validation response


signallingmessagethatisusedinthecircuitvalidationtesttoreportthetestresults

circuit validation test; CVT


procedureusedtoensurethattwoexchangeshavesufficientandconsistenttranslation
dataforplacingacallonaspecificcircuit

Cisco Discovery Protocol; CDP


protocolthatisprimarilyusedtoobtainprotocoladdressesofneighbouringdevicesand
discovertheplatformofthosedevices

CLA
nodethatisusedtorunservicesthatarecriticaltotheFlexiServerplatform

cladding; fibre cladding /GB/; fiber cladding /US/


dielectricmaterialofanopticalfibresurroundingthecore

C language virtual operating system; CVOPS


developmentandruntimeenvironmentforanydistributedsystembuiltupfromasetof
entitiescommunicatingwitheachotherbymessagepassing

CLAS node
nodethatincludesaclustermanagernode(CLM)andanapplicationservernode(ASN)

class
abstractionthatrepresentssetofobjectsthatshareacommonstructureandcommon
behavior,thatis,thesameattributes,operations,relationships,andsemantics

Issue:28

249

GeneralGlossary

class 0 short message; short message class 0


shortmessagethatthemobilestation(MS)acceptsanddisplays,butthatisnotstoredin
thesubscriberidentitymodule(SIM)ormobileequipment(ME)

class 1 short message; class 1 SMS


shortmessagethatisstoredeitherinthesubscriberidentitymodule(SIM)ormobile
equipment(ME)

class based queuing; CBQ


queuinginwhichthetrafficisdividedintodifferentprioritybuffersaccordingtoitspriority

class diagram
diagramthatshowsthestaticstructureofclassesandtheirrelationshipsinthesystem

classifier; filter
entitywhichselectspacketsbasedonthecontentofpacketheadersaccordingto
definedrules

classless interdomain routing; CIDR; classless routing


routingprotocolwhichallowsthegroupingofroutersinordertocutdownonthequantity
ofroutinginformationcarriedbythecorerouters

class model
combinationofclassdiagramsanddatadictionary,usedasabasisforobjectmodel
designandbehaviouraldesign

class of operation
numberindicatingwhetheranoperationreportssuccessorfailure,failureonly,success
only,orneither

class of SCCP service


numberchosenbytheuserofthesignallingconnectioncontrolpart(SCCP)toselect
oneoutoffournetworkservicesprovidedbytheSCCP

class of service; CoS


classificationthatisusedtomanagetrafficinanetworkbygroupingsimilartypesof
traffictogetherandtreatingeachtypeasaclasswithitsownlevelofservicepriority

250

Issue:28

GeneralGlossary

class of service plan; COS plan


setofparameters,suchasfiltersordailymessagelimits,whichareconfiguredfora
groupofsubscribers

class tree
treestructuredescribingtheinheritancehierarchy

clear
tocauseoneormorestoragelocationstobesetinaprescribedstate,usuallythat
correspondingtozeroorthatcorrespondingtothespacecharacter

clearance angle; terrain clearance angle


anglemeasuredfromthemobilestationtowardsthetransmittingantenna

clear back line signal; clear back


linesignalwhichstartstheclearingofaconnectioninthebackwarddirection

ClearCase
configurationmanagementsystemdesignedtohelpsoftwaredevelopmentteamstrack
thefilesanddirectoriesusedtocreatesoftware

clear code
causecodewhichidentifiesthereasonforclearingacalloracallset-up

clear code observation; failed calls observation; observation of failed calls


partoftrafficobservationwhichhandlestheobservationofcallsthatendedwitha
certain,definedclearcode

clear forward line signal; clear forward


linesignalwhichstartsthenormalcallclearingsequenceintheforwarddirection

clearing cause
informationwhichistransferredbythesignallingsystembetweenexchangespresenting
thereasonwhyacalliscleared

Issue:28

251

GeneralGlossary

clearing delay; cancellation delay


timeperiodduringwhichaclearingofanalarmisfilteredifanapplicationraisesthe
samekindofalarm

clearmode mechanism
standardmechanismforcarrying64kbit/schanneldatatransparentlyinRTPpackets
throughvoiceoverIPnetworks

clearmode pseudo-codec; clearmode codec


codecthatisspecifiedtocarrysample-oriented64kbit/schanneldatatransparentlyin
RTPpacketswith8bitspersample

cleartext; plaintext
intelligibledatawhosesemanticcontentisavailable

CLI checking
lineidentificationservicewhichconsistsofcheckingthetypeofnumber(TON)ofthe
callingnumber

CLI conversion
conversionthatisusedtomodifythenumberdeterminedinCLIformattingaccordingto
specificcriteriabeforethenumberispassedontothenextexchangeortothecalled
subscriber

CLicS licence key stock /GB/ ; CLicS license key stock /US/; centralised
licence key stock /GB/; centralized license key stock /US/
inNSNStandardLicenseKeyGenerator(CLicS),alicencekeystockthatiscreated
basedonthecustomerlicencesalesordersandfromwhichtheuserscangenerate
network-element-specificlicencekeysoverawebinterfaceoranSMSinterface

CLicS stock for NE SW licensing


methodofsoftware(SW)assetprotectionforhigh-volumeproductsinwhich
authenticatedusersareallowedtogeneratenetworkelement(NE)specificlicensekeys,
thatis,licencekeycodes,fromtheNSNStandardLicenseKeyGenerator(CLicS)
licencekeystockoverawebinterfaceoranSMSinterface

CLI enhancement service; CLI-E service


service,providedandcheckedinthehomelocationregister,whichenablesthe
subscribertoreceivethecallinglineidentity(CLI)andgenericnumbertothevisitedMSC
viathemobileapplicationpart(MAP)

252

Issue:28

GeneralGlossary

client
computersystemorprocesswhichrequestsanothercomputersystemorprocess
(server)inthesamenetworktoperformcertaintasks

client-accept message; CAT; client-accept


messagewhichisusedasapositiveresponsetotheclient-openmessage

client address adapter; CAA


softwarecomponentthatperformsaddressresolutionofclientnetworkaddresses

client API
applicationprogramminginterface(API)thatisusedforbuildinguserinterfaceclients

client authentication
authenticationoftheclientbysendingtheusercertificateforvalidationtoaserver

client-close message; CC; client-close


messagewhicheitherthepolicydecisionpoint(PDP)orpolicyenforcementpoint(PEP)
canissuetonotifytheotherthataparticulartypeofclientisnolongersupported.

client configuration
configurationmechanismthatenablesasystemadministratortoconfigureclient
machinescentrally

client handle
handlewhichidentifiesauniquerequeststateforasinglepolicyenforcementpoint
(PEP)perclient-type

client-open message; OPN; client-open


COPSprotocolbasedmessagefromthepolicyenforcementpoint(PEP)tothepolicy
decisionpoint(PDP),specifyingtoPDPtheclient-typesthePEPcansupport,thelast
PDPtowhichthePEPconnectedforthegivenclient-type,andclient-specificfeature
negotiation

client PC
computerwithinanetworkofcomputersthattheuserorrecipientoftheserviceor
applicationuses

Issue:28

253

GeneralGlossary

client random
inaSecureSocketsLayerbasedsession,arandombytesequencethattheclient
selectsforaconnection

client-server architecture
architectureinwhichtheexecutionofthetaskisdividedbetweentheuser'sworkstation
andtheserversspecialisedindifferentpartsofthetask

client-server interface; client/server interface


interfacewhichspecifiestheclient'saccesstotheserver

client-server model
meansofdescribingnetworkservicesandthemodeluserprocessesofthoseservices

client-server protocol; CSP


protocolbetweennetworkedcomputersinwhichtheservicesofonecomputer(the
server)arerequestedbytheother(theclient)

client-server relationship; client/server relationship


relationshipbetweenfunctionalentities(forexample,managedobjectsornetwork
layers)inwhichoneentityusesaserviceprovidedbyanother

client service
NetworkElementManagementUnit(NEMU)servicethatisofferedtypicallythrough
commonobjectrequestbrokerarchitecture(CORBA)interfacestoexternalclients

client session
processthatreceivesaservicerequestandcreatesaclientservice,andterminatesthe
clientservicewhentheclientlogsout

client-specific information object; ClientSI; client-specific information


COPSprotocoldefineddataobjectthatcontainstheclient-type-specificinformationfor
whichapolicydecisionneedstobemade

client tier
logicallayerofadistributedsystemthattypicallypresentsdatatoandprocessesinput
fromtheuser

254

Issue:28

GeneralGlossary

CLI formatting
lineidentificationservicewhichisusedinaparticulartypeofcallandinwhichthe
operatorcandeterminewhetherthenumberusedastheCLIisthecallingnumber,the
callednumber,thelastforwardingpartynumber,ortheoriginalcalledpartynumber

CLI formatting set


setofparametersthatindicatehowthecallinglineidentity(CLI)needstobeformatted

CLI modification; calling line identity modification


modificationofthecallinglineidentity(CLI)madeforanon-netcallorforacall
forwardedtoanothervirtualprivatenetworkgroupmembertoreflecttheshortnumberof
thecallingparty

clipping
lossofspeechenergycausedbyvoiceorspeechactivateddevices

CLIR override; CLRO; calling line identification restriction override


servicethatenablesthecalledparty(forexamplethepolice)toseethenumberofthe
callingpartyalthoughthecallingpartydoesnotwantittobeshown

CLIR override indication


feature,whichisanenhancementtotheCLIRoverrideservice,bywhichthecalledparty
whohasactivatedthesubscriptionoptionoverridecategorynoticesifthecallingparty
usesCLIR

CLIR temporary mode


optionalfeaturethatenablestheserviceprovidertodefineaseconddefaultvalueforthe
callinglineidentificationrestriction(CLIR)inthetemporarymode

CLI support for roaming subscriber


featurewhichprovidesanalternativerouteforthecallinglineidentity(CLI)transportation
viathemobileapplicationpart(MAP)

clock; clock signal generator


equipmentthatprovidesacyclictimingsignal

clock channel
transmissionchannelwhichisusedtoimplementtheinternaldatatransmission
connectionbetweena386computerandtheclockandtonegenerator

Issue:28

255

GeneralGlossary

clock control signal


signalthatdirectlycontrolsthephaseorfrequencyofaclock

clock frequency
frequencyofanexternalclockcircuitoranoscillatorwhichsetsthetimingforthe
functions

clock interrupt
typeofinterruptwhichoccursatregularintervals,forexample,toinitiateprocessessuch
aspolling

clock rate
rateatwhichbitsorwordsaretransferredfromoneinternalelementinacomputerto
another

clock signal
outputsignalofaclocksignalgenerator,usedfortiming

close button
buttonthatisusuallylocatedinthetitlebarandisusedtoclosetheassociatedwindow
byclickingit

closed access control; closed access


accesscontrolwherethenetworkletsonlytheregistereduserstoobtainservicesina
specificcell

closed group
virtualprivatenetworkgroupmemberswhohavethesamerestrictions

closed join-in group; restricted chat PoC group; restricted group; private
ad hoc group; ad hoc pro group
join-ingroupwhichonlythoseuserswhohavetherighttojoinandwhoknowthegroup
identificationcanjoin

closed-loop MIMO
multipleinputsmultipleoutputs(MIMO)inwhichtheradiotransmitteruseschannelstate
informationtopre-processthedatasignalsbeforethetransmission

256

Issue:28

GeneralGlossary

closed loop power control; CLPC; closed loop control


powercontrolinwhichthereceivermeasuresthequalityofthesignalofatransmitter,
comparesittoagiventargetandcommandsthetransmittertoadjustitspower

closed talk group


inthePoCsystem,ajoin-ingroupinwhichaccesscontrolisused

closed user group; CUG; closed group


facilitywhichenablesuserstoformgroupstoandfromwhichaccessisrestricted

closed user group call; CUG call


callwhichisrestrictedtoapredefinedgroupofusers

closed user group indication; CUG indication


informationthatindicatestothecalledterminalequipmenttowhichclosedusergroup,if
any,theincomingcallbelongs

closed user group member; CUG member


userwhohassubscribedtotheclosedusergroupfacilityandisoneoftheusersina
particularclosedusergroup

closing flag
flagthatfollowstheframechecksequencefield,indicatingtheendofasignalunit

cloud
abstractionthatisusedtorepresenttheunderlyingnetworkinfrastructurethatprovidesa
poolofconfigurablecomputingresources

cloud computing; cloud computing service


processofusingahostedserviceovertheinternet

cloud computing infrastructure


public,private,internal,orexternalenvironmentwheretheneededresourcesare
dynamicallyprovisionedsothatcloudcomputingcanbeexecuted

Issue:28

257

GeneralGlossary

cloud framework; CFW


cloudmanagerapplicationofNSNformanagingandsupervisingthevirtualmachineand
softwareclientinstances

cloud gate
internalplatformforthedelivery,monitoring,lifecyclemanagement,andrelayofinvoicing
dataforNSNcloudapplicationsthataredeployedonthetopofthirdpartycloud
computinginfrastructures

cloud manager application; CMA


managerapplicationthatstarts,stops,manages,andsupervisesthevirtualmachineand
softwareclientinstancesincloudcomputingenvironments

clumping; frame clumping


shorteningofinter-arrivaltimesofDE=0frames

cluster
groupofhostsornetworkelementsthatarelogicallyconnectedandpossiblydedicated
toonetask

cluster fault management; CFM


FlexiServersubsystemwhichstartsrequiredsoftwarebuildswhenanodebecomes
operational,synchronisesstart-ups,preventsfaultpropagationbyisolatingfaulty
components,startsandsynchronisescorrectiveactionsonfailedunitstominimise
servicedowntime,andperiodicallyattemptstorepairfailedcomponentssothat
temporaryfaultsdonotrequiremanualintervention

cluster file system; CFS


filesystemthatmaybeaccessed,readfrom,andwrittento,byallmembersofacluster
atthesametime

clustering
connectingatleasttwocomputerstogetherinsuchawaythattheybehavelikeasingle
computer

cluster interconnection; CI
communicationfacilitythatlinkstheclusternodes,routingmessages,data,andother
clustercommunicationstraffictoco-ordinateeachnode'saccesstosharedresources

258

Issue:28

GeneralGlossary

cluster management and event processing node; CPN


nodethatisusedtoruncommonfunctionsintheclustermanagernode,ratinglogicin
theratingprocessingnode,andmediationlogicinthemediationprocessingnode

cluster management and mediation processing node; CMN


nodethatisusedtoruncommonfunctionsintheclustermanagernodeandmediation
logicinthemediationprocessingnode

cluster manager node; CLM; cluster manager; CLM node


FlexiServernodewhichtakescareofclustermanagement

cluster node; database cluster node


nodethatisconfiguredtobeamemberofacluster

CM analyser /GB/ ; CM analyzer /US/


applicationthatisusedtochecktheconsistencyofradionetworkconfigurationdata

CM basic; CMB
partoftheO&Mmodellinglanguagethatdefineshowconfigurationmanagement
conceptsinanadaptationcanbemodelled,whatfeaturesmetamodelscanhave,and
howthesefeaturescanbeusedandcombinedtocreateexpressiveandconcise
metamodels

CM basic adaptation file


adaptationfilethatcontainsthemanagedobjectclassdefinitions,attributes,and
relationships

CMB metamodel; configuration management basic O&M metamodel


metamodelthatspecifiesCMbasic

CM core adaptation
coreadaptationthatprovidestheconfigurationmanagement(CM)relatedabstractobject
classes,attributes,anddatatypesthatadaptationmodelsusebyinheritance

CM editor
planeditingtoolwhichenablestheusertomodifythecontentoftheradionetwork
configurationplansonlineintheradioaccessconfiguratordatabase

Issue:28

259

GeneralGlossary

CMIS server
backgroundprocessthatprovidescommunicationsinASCIIformtoaQ3network
element

CML data block; data block


partoftheCMLresponsewhichcontainsthedataoutputbythecommandproducedby
theMMLdesigner

CML end block; end block


lastpartoftheCMLresponsewhichisoutputbytheMMIsystemandwhichendsthe
CMLresponse

CML response
responseofanMMLcommanddeclaredintheformalCMLlanguageformat

CML start block; start block


firstpartoftheCMLresponseproducedbytheMMIsystem

CM meta access SQL API


metaaccessAPIthatisusedtoreadinformationaboutmanagedobjectclasses,their
attributes,andrelationshipsbetweenthem,directlyfromthedatabasebyusingthe
structuredquerylanguage(SQL)

CM plan manager
applicationthatisusedtoexportthemanagedobjectstoexternaltools

CM provisioner
toolwhichimplementstheplannedconfigurationsinthenetworkanduploadstheactual
configurationfromthenetworktotheRACdatabase

CM UI metamodel; configuration management user interface O&M


metamodel
partoftheO&Mmodellinglanguagethatprovidesanadaptationinterfaceforconfiguring
theoperationandmaintenance(O&M)userinterfacetopresentmanagedobjects

C-NBAP; CNBAP; common NBAP


partoftheNBAPprotocolwhichusesthecommonsignallinglinkbetweenthebase
transceiverstation(BTS)andradionetworkcontroller(RNC)

260

Issue:28

GeneralGlossary

CN deactivate trace procedure; CN deactivate trace


elementaryprocedureforinstructingtheradionetworkcontroller(RNC)tostop
producingatracerecordfortheindicatedtracereference

CN domain indicator
informationelement(IE)thatindicatesthecorenetwork(CN)domainfromwhichthe
messageoriginatesortowhichthemessageissent

CN invoke trace procedure; CN invoke trace


elementaryprocedureforinstructingtheradionetworkcontroller(RNC)tostart
producingatracerecordofatypeindicatedbythecorenetwork(CN)andrelatedtothe
mobilestation

C-number; system C-number


deliverynumberwhichisgiventoasystem,suchasanetworkelement,thatisaddedto
theoperationandmaintenancenetwork

C-number search type in call forwarding


subscriber-specificsearchtypewhichthenetworkoperatorcanchooseusinga
subscriber-specificparameteronhowtohandletheC-numberlistinfixedcallforwarding
services

coarse acquisition code; clear acquisition code; CA code; C/A code


pseudonoisecodethatisuniqueforeachGPSsatellite,enablingthereceiversto
distinguishbetweendifferentsatellites

coaxial pair
transmissionlinethatconsistsoftwoconductors,ofwhichoneisawireortubethatis
coaxiallysurroundedbytheother,whichisintheformofatube

COCA channel
D-channelintheCOCA(communicationandcontroladapter)andEC1P(echocanceller)
plug-inunitswhichisusedfordatatransmissioninsidethesysteminsteadofDMX
messagebus

COCA-controlled pool; previous generation pool


datapoolcontrolledbytheCOCAplug-inunit

Issue:28

261

GeneralGlossary

COCEN; Communication Controller for Ethernet


inanetworkelementthatusesasubrackconstruction,anEthernetinterfacewhichis
usedtoestablishaconnectionbetweenthenetworkelementandtheequipment
connectedtotheEthernet

co-channel interference; CCI


interferencebetweentwosignalsofthesametypeonthesameradiochannel

COD download
genericOTAtwo-phasedownloadmodelinwhichthecontentobjectdescriptor(COD)is
usedasadownloaddescriptorfileandcontentisdeliveredafterterminalhas
acknowledgeditcanreceivecontent

code base; codebase


databasewheretheapplicationisstored

code blocking
methodthatisusedtorestrictortotallypreventtraffictocertainnumbersbyblockingthe
wholedestinationfromspecificdigits

codec; coder-decoder
combinationofanencoderandadecoderoperatinginoppositedirectionsof
transmissioninthesameequipment

codec category
classificationthatisusedtomatchthecodeccharacteristicswithservicepoolingand
resourcemanagementofdigitalsignalprocessing

code channel
channelthatisdistinguishedfromacodedbitstreamusingaspreadingcode

codec mismatch resolution


optionalfeaturethatisusedtoselectacodecmodethatalltheaffectednodessupport
whentandem-freeoperationestablishmentisunsuccessfulbecauseofnon-compatible
codecs

codec mode adaptation


procedurefortheAMRspeechcodecthatisusedtoselectthemostappropriatespeech
andchannelcodecmodetoapplyatagiventime

262

Issue:28

GeneralGlossary

codec mode request; CMR; mode request


signalthatthespeechreceiver(decoder)sendstothespeechsender(encoder)to
indicatethecodecmodeitprefers

codec modification
procedureinwhichthesystemchangestheusedcodecduringcallset-uporongoingcall

codec negotiation
operationthatisperformedinthecallset-upphaseiftwoIPtelephonygatewaysarenot
initiallyconfiguredorsetasdefaulttothesamecodectype

code conversion; transcoding


conversionofdigitalsignalsinonecodetothecorrespondingsignalsinadifferentcode

codec optimisation; codec type optimisation


optionalfeaturethatisusedtodeterminewhichoftheexistingcodectypescouldprovide
bestspeechqualitywhileoperatingintandemfree-operation

codec server
inamultimediagateway(MGW),aserverwhichhandlesspeechtranscodingand
speechenhancementtasksandprovidesthetexttelephony(TTY)functions

codec translation function


mediagateway(MGW)functionwhichroutesthemediastreamsbetweentheIPdomain
andtheswitchedcircuitnetwork(SCN)domain

coded composite transport channel; CCTrCH


datastreamresultingfromencodingandmultiplexingofoneorseveraltransport
channels

coded domain processing


signalprocessingthatisperformeddirectlyuponanencodedspeechsignalby
manipulatingencodedspeechparameters

code-division multiplexing; CDM


multiplexinginwhichseparatechannelstransmitbitsinacodedchannel-specific
sequenceofpulses

Issue:28

263

GeneralGlossary

coded mark inversion; CMI


two-levelnon-return-to-zerocodeinwhichbinary0iscodedsothatbothamplitude
levelsA1andA2areattainedconsecutively,eachforhalfaunittimeinterval(T/2)

Code of Federal Regulations; CFR


codificationofthegeneralandpermanentrulespublishedintheFederalRegisterinthe
USA

code planning
planningcodereuseschemes

code violation
twoconsecutivemarksofthesamepolarity,excludingintentionalviolationscausedby
zerosubstitutioncode

code violation; CV
performancemonitoringparameter,indicatingaviolationofthelinecodeforanelectrical
interface

code word; PCM word


setofsignalelementsrepresentingthequantisedvalueofasampleinpulsecode
modulation(PCM)

coding rate
fractionofadatastreamcontainingerrorcoding

coding scheme selection


selectionofthecodingschemetobeusedintemporaryblockflowaccordingtodefined
rules

codirectional interface
interfaceacrosswhichtheinformationanditsassociatedtimingsignalaretransmittedin
thesamedirection

coherent differential phase-shift keying; CDPSK


phase-shiftkeyingthatisusedfordigitaltransmissioninwhichthephaseofthecarrieris
discretelymodulatedinrelationtothephaseofareferencesignalandinaccordance
withdatatobetransmittedandinwhichthemodulatedcarrierisofconstantamplitude
andfrequency

264

Issue:28

GeneralGlossary

cohesion
degreetowhichthetasksperformedbyasinglesoftwaremoduleorcomponentare
functionallyrelatedandformameaningfulunit

coin box telephone


publicorrentedtelephonefromwhichcallscanbepaidforatthetimetheyaremadeby
meansofcoins

cold active/standby pair; active/cold standby pair


pairofrecoveryunits,oneofwhichisintheactiverolewhiletheotheroneisinthecold
standbyrole

cold reset; power-up reset


unitrestartafterapowerfailure,inwhichallthecodeandfilesareloaded

cold restart
powerstart-uprestartmodewhereallthecodeandfileswillbeloaded

cold standby; CSB


protectionsystemwherethestandbyequipmentispoweredonlywhenafaultoccursin
theequipmenttobeprotected

cold start logic


logicinthepowersupplyunitthatswitchesontheheatingelementswhenthe
temperaturedropsbelowaspecifiedvalueintheBTScabinet

cold swapping; cold swap


substitutionofareplacementunitinasystem,wheresystemoperationmuststopand
powermustberemovedfromthesystemtoperformthesubstitution

collapse (verb)
tomovefromalowerlevelofahierarchytoahigherlevelofthehierarchybytemporarily
concealingthelowerlevels

collect call request; CCI; collect call indicator


signallingparametersentintheforwarddirectiontoindicatewhetheracallisacollect
call

Issue:28

265

GeneralGlossary

collect call restriction; CCR


restrictionthatalocalnetworkoperatorcansettopreventtheuseofreversecharging
service

CollectInformation procedure; CI; CollectInformation


procedurethatrequeststheserviceswitchingfunction(SSF)toperformthebasic
originatingcallprocessingactionswhichwillcollectdestinationinformationfromacalling
party

collection of charging data


partofcharginginwhichtheservingGPRSsupportnode(SGSN)collectscharging
informationconcerning,forexample,userlocationandtransferreddatavolumes

collective routing
routinginwhichaswitchingcentreautomaticallydeliversmessagestoaspecifiedlistof
destinations

collector API; CAPI; collector application programming interface


applicationprogramminginterfaceinacharginggatewaythatisusedtocollecteventor
flowdata,storethedata,andprovidefacilitiesforperformingqueriesonthedataforthe
purposeofaccountingandactivitytracking

collimation
processbywhichadivergentorconvergentbeamofelectromagneticradiationis
convertedintoabeamwiththeminimumdivergenceorconvergencepossibleforthat
system(ideally,abundleofparallelrays)

collimator
devicethatrendersdivergentorconvergentraysmorenearlyparallel

collinear antenna array; collinear array


arrayofdipoleantennasmountedinsuchamannerthateveryelementofeachantenna
isinanextension,withrespecttoitslongaxis,ofitscounterpartsintheotherantennas
inthearray

collision
inadatatransmissionsystem,thesituationthatoccurswhentwoormoredemandsare
madesimultaneouslyonequipmentthatcanhandleonlyoneatanygiveninstant

266

Issue:28

GeneralGlossary

collision detection; CD; collision handling


processbywhichanodedeterminesthatacollisionhasoccurred

collision domain
groupofEthernetdevicesinaCSMA/CDlocalareanetworkthatareconnectedby
repeatersandcompeteforaccesstothenetwork

column address select; CAS; column address strobe


indynamicrandomaccessmemory(DRAM)devices,asignalwhichindicateswhenthe
lowerhalfoftheaddressispresentonitsmultiplexedaddressbus

combined attribute
attributeformedofprimaryoriginattributesbyperforminglogicaloperations

combined charging
chargingthatcombinesmultiplechargingrecords(CDR)generatedinthenetworkfor
onecommunicationsession

combined delivery; combined delivery method


digitalrightsmanagement(DRM)methodthatenablesusagerulestobesetforthe
mediaobject

combined GPRS and IMSI attach


attachwherethemobileterminalisattachedtotheGPRSservicesandperformsIMSI
attachviatheservingGPRSsupportnode(SGSN)

combined GPRS and IMSI detach


detachwherethemobilestationthathasbeenattachedtobothGPRSandcircuitswitchedservicesperformsdetachfrombothservicessimultaneously

combined hard handover and SRNS relocation; combined hard handover


procedureinwhichtheservingradionetworkcontroller(SRNC)changesandthemobile
terminaltransfersfromthesourceSGSNtothetargetSGSNwhileperformingahard
handover

combined jitter
accumulatedjitterfromtwoormorejitter-generatingfunctions

Issue:28

267

GeneralGlossary

combined link set


loadsharingcollectionofoneormorelinksets

combined local-transit exchange


exchangeinwhichsubscribers'linesterminateandwhichisalsousedasaswitching
pointfortrafficbetweenotherexchanges

combined observation
partoftrafficobservationinwhichcircuitobservation,clearcodeobservation,and
directionalobservationcanbecombinedtoagroupoftwoorthreeobservations

combined RA/LA update; combined RA and LA update; combined routing


area update; combined routing and location area update
locationmanagementprocedurethattakesplacewhenamobilestationinidlemode
entersanewroutingareaorwhenaGPRS-attachedMSperformsIMSIattachorwhen
theperiodicRAupdatetimerexpireswhilethemobilestationremainsIMSIandGPRSattached

combined service priority list


listthattheradionetworkcontrollerproducesbasedontheIuinterfaceservicepriority
informationandtheservicepriorityhandoverprofiletable

combi-SGSN; combi SGSN


servingGPRSsupportnode(SGSN)thatcanserveboth2Gand3Gsubscribersinthe
samenetworkelement

combo box; dropdown combo box


combinationofatextboxandalistbox,allowingtheusertochoosefromalistortotype
datadirectlyintotheeditbox

COM component; component object model component


componentaccordingtoMicrosoft'scomponentobjectmodel

comet message; COMET


sessioninitiationprotocol(SIP)messagewhichthesessioninitiatorsendstothe
terminatingendpointviathesignallingpathestablishedbytheinvitemessagewhenthe
resourcereservationiscompleted

268

Issue:28

GeneralGlossary

comfort noise; CN
pseudo-randomnoisethatisinsertedintothesilentintervalstopreventtheintervalsof
speechwithbackgroundnoisefollowedbyintervalsofsilence

comfort noise injection


processofinsertingcomfortnoisetothelistenersideduringsilentperiods,tomaintaina
naturalvoicequality

comfort tone
featurewhichprovidesinformationforthecallingsubscriberindicatingthatcall
establishmentisproceeding

COM interface; component object model interface


interfacethataCOMcomponentexposes

command
completespecificationofafunctionthatthesystemisrequiredtoperform

command-and-control server
serverthatisusedforthemanagementandcontrolofabotnetandcomputersinit

command blocking
preventingtheexecutionofacommand,acommandgroup,acommandcalendarora
groupofsinglecommands

command button; push button


buttononthedisplay,usedtoinitiateanaction,suchascarryingoutorcancellinga
command

command calendar
programentitythattiescommandexecutionstocalendartimeortotransactionstaking
placeinsideanexchange

command class
setofcommandgroupsassociatedwiththesamefunctionalentity

Issue:28

269

GeneralGlossary

command code; command abbreviation


abbreviationconsistingofafewletterswhichidentifiesacommand

command file; disk command file


filethatconsistsofMMLcommandsandtextualcomments

command frame
indatatransmission,aframe,containingacommand,transmittedbyaprimarystation

command group; MML command group


setofcommandsimplementedbyoneMMLprogramorbyMMLmacros

command interpreter file


filethatinterpretsthegivencommandssothattheoperatingsystemknowswhatto
execute

command language; control language


sourcelanguageconsistingprimarilyofproceduraloperatorsthatindicatethefunctions
tobeperformedbyanoperatingsystem

command-line interface; CLI; command line interface


interfaceinwhichtheusersinteractwiththeircomputersbytypingtextintoacommand
line

command register
registerintowhichcommands,alongwiththeaddressanddatainformationneededto
executeeachcommand,arestored

command short message; command SM


shortmessage(SM)thatenablesamobileterminaltoinvokeanoperationattheshort
messageservicecentreonapreviouslysubmittedshortmessage

comma separated value; CSV


fileformatinwhicheachlineisoneentryorrecordandthefieldsinarecordare
separatedbycommas

270

Issue:28

GeneralGlossary

comment; comment comment


explanationofaprogramintextualform

comment
textinanXMLdocumentthatisignored,unlesstheparserisspecificallytoldto
recogniseit

commercial mobile radio service; CMRS


servicethatisprovidedbyanetworkoperatororlicenseewhosewirelessnetworkis
connectedtothepublicswitchedtelephonenetworkand/orisoperatedforprofit

commercial service
serviceoragroupofservicesthatthenetworkoperatorortheserviceproviderhas
createdandofferstocustomers

commission
tobringsoftwareorhardwareintouseforthefirsttime

commissioning
processofbringingsoftwareorhardwareintouseforthefirsttime

commissioning file
extensiblemarkuplanguage(XML)filewhichisusedinthecommissioningphaseto
configureanetworkelement

commissioning report
reportthatanetworkelementgeneratesforcommissioningacceptanceasaresultofa
successfulcommissioning

commissioning wizard
wizardthatguidestheuserthroughcommissioning

commit
guaranteethattheimpactsofaneventaretransmittedtoadatabaseafteritiscertain
thattheintegrityofthedatabaseisretained

Issue:28

271

GeneralGlossary

commit bit
bitthatisusedinInternetKeyExchange(IKE)synchronisationtoensurethatencrypted
materialisnotreceivedpriortocompletionofthesecurityassociation(SA)establishment

commitment decision
decisionofmakingthecommitmentortheabortionofthedatabasetransaction

commit point
pointintimeafterwhichthecompletionofthedatabasetransactionisguaranteedto
succeed

commit protocol; commitment protocol


protocolwhichoffersawaytoguaranteetheatomicityofadatabasetransaction

committed bit rate; CBR


bitratethatisbasedonasetamountofdatabandwidthregardlessofitsuse

committed information rate; CIR


transmissionrateatwhichanetworkofferingframerelayservicesiscommittedto
transferundernormalconditions

committed read; read committed


isolationlevelthatallowsonlycommittedrecordstoberead,butdoesnotlockany
records

common adaptation file


adaptationfilethatcontainsadaptation-wideinformation,includingtheadaptation
identifierandadaptationreleaseinformation,andthatdeclareswhichotheradaptations
theadaptationinquestiondependson

Common Alarm MIB; NCAM


proprietarymanagementinformationbase(MIB)thatisusedforfaultmanagementina
networkelement

common BCCH control; common broadcast channel; common BCCH


featurethatallowstheintegrationofresourcesfromdifferentfrequencybandsintoone
cell

272

Issue:28

GeneralGlossary

common channel; CCH


channelnotdedicatedtoaspecificmobilestation

common channel service


servicethatisusedtocreatethecommonchannelsofonebasetransceiverstation

common channel setup


featurethatenablestheuseofacommonchannel,suchasrandomaccesschannelor
forwardaccesschannel,insteadofadedicatedchannelforconnectionsetup

common channel signalling /GB/ ; common channel signaling /US/; CCS


signallingmethodinwhichthesignallinginformationthatrelatestoamultiplicityof
circuitsorfunctionsorfornetworkmanagementisconveyedoverasinglechannelby
addressedmessages

common channel signalling network administration /GB/ ; common


channel signaling network administration /US/
DX200commandclass

common channel signalling system /GB/ ; common channel signaling


system /US/
SignallingSystemNo.7oftheITUorasignallingsystembasedontheSS7andadapted
tothenationaltelecommunicationnetwork

common client interface; CCI


applicationprogramminginterface(API)thattheclientsorapplicationcomponentsuseto
accessdatainanenterpriseinformationsystem(EIS)

common control channel; CCCH


point-to-multipointbidirectionalcontrolchannelprimarilyintendedtocarrysignalling
informationnecessaryforaccessmanagementfunctions,thatis,allocationofdedicated
channels

common control physical channel; CCPCH


fixedratedownlinkphysicalchannelusedtocarrythebroadcastcontrolchannel(BCCH)
andforwardaccesschannel/callingchannel(FACH/CC)

Issue:28

273

GeneralGlossary

common core; cCore


partoftheNetworkElementManagementUnit(NEMU)systemthatcontainsservicesto
accessthefunctionsofNEMU

common data
dataconcerningtheinternationalmobilestationequipmentidentities(IMEI)thatthe
CentralEquipmentIdentityRegister(CEIR)collectsfromallthepubliclandmobile
networks(PLMN)

common data model; CDM


datamodelthatisbasedontheNGOSSstandardandthatprovidesalooseframefor
bothvendor-specificandvendor-independentnetworkdatamodels

common gateway interface; CGI


interfacebetweenthewebserverandtheapplications

common ID procedure; common ID


elementaryprocedureforinformingtheradionetworkcontroller(RNC)aboutthe
permanentnon-accessstratum(NAS)mobilestation(MS)identityofauser

common information model; CIM


informationmodelthatdefinesmanagementabstractionsforprofiles,policies,devices,
protocols,andserviceusers

common language location identification; CLLI


descriptorthatisusedinNorthAmericatoidentifyexchanges,pointsofinterconnection,
andothertypesoftelephonenetworkelementsandtheirlocations

common management information protocol; CMIP


applicationlayerprotocolwhichprovidesthecommonmanagementinformationservice

common management information service; CMIS


servicewhichgivesexternalaccesstotheOSImanagementinformationbase

common management information service element; CMISE; common


management information service
applicationserviceelementwhichprovidesbasicservicesforthetransferand
manipulationofmanagementinformation

274

Issue:28

GeneralGlossary

common message header


messageheaderthatconsistsoftheadaptationlayerversion,messageclass,message
type,andmessagelengthfields

common MSISDN number


mobilesubscriberinternationalISDNnumberthatidentifiesthemultiSIMsubscription

common NBAP signalling entity /GB/ ; common NBAP signaling entity /US/
setofbasetransceiverstationorcontrollingradionetworkcontrollerfunctions
responsibleforthelogicalresourcemanagement,broadcastchannelmanagement,and
communicationcontextcreationforonebasetransceiverstation

Common Object Request Broker Architecture; CORBA


generalandopenstandardforworkingwithdistributedobjects,developedbytheOMG
(ObjectManagementGroup),allowingtheinterconnectionofobjectsandapplications
regardlessofthecomputerlanguageoftheapplications,thegeographicallocationofthe
computer,andthearchitectureofthecomputersinvolved

common O&M metamodel; common metamodel


partoftheO&Mmodellinglanguagethatdefineshowtheusercanmodelthebasic
conceptswhichapplytotheadaptationmetadata

common OSS component


operationssupportsystem(OSS)applicationthatenablesfault,configuration,
performance,orsecuritymanagementoperationsindependentlyoftheusednetwork
technology

common packet channel; CPCH


transportchannelthatcarriesuserpacketsifthecommonresourcesofthesystemare
usedforthispurpose

common part convergence sublayer; CPCS; CSCP; convergence sublayer


common part
portionoftheconvergencesublayerofanATMadaptationlayer(AAL)thatremainsthe
sameregardlessofthetraffictype

common part indicator; CPI


indicatorintheATMadaptationlayertype3/4(AAL3/4),representingtheunitsofthe
bufferallocationsize(BAsize)andlengthfield

Issue:28

275

GeneralGlossary

common part sublayer; CPS


layerwhichsuppliesthebasicfeatureofATMadaptationlayertype2(AAL2)andwhich
doesnotdependonservices

common part sublayer protocol data unit; CPS-PDU; CPS protocol data
unit
protocoldataunitthatconsistsofastartfieldofoneoctetand47octetsofpayload

common pilot channel; CPICH; pilot channel


commoncontrolchannelthatprovidesareferencesignalforcoherentdetection,cell
acquisition,andhandoverincodedivisionmultipleaccess(CDMA)

common radio resource management; CRRM; centralised radio resource


management
radioresourcemanagementthatintegratesdifferentradioaccesstechnologiesand
managesallthenetworkresourcesasasinglepoolbasedonqualityofservice
requirements

common radio resource manager; CRMS; common resource management


server; common radio resource management server
serverwhichenablestheintegrationofmultipleradioaccesstechnologiesbasedonthe
qualityofservice(QoS)management

common resource management server application protocol; CRMSAP;


CRMS application part
radionetworklayerprotocolimplementingtheCRMSservices

common signalling /GB/ ; common signaling /US/


signallingthatconsistsoftheelementaryproceduresthatarecommonbetweendifferent
controlplanefunctionsrelatedtoradioresourcecontrolandS1andX2Application
Protocols

common statistics
featurethatprovidesthemeanstomeasureandmonitortheexchange'sperformance
andgradeofservice

common traffic channel; CTCH


point-to-multipointunidirectionalchannelwhichisusedtotransferdedicateduser
informationforalloraspecifiedgroupofuserequipment(UE)

276

Issue:28

GeneralGlossary

common transmit clock configuration; CTC


configurationinwhichthetransmitclocksofallthelinkswithintheIMAgrouparederived
fromthesameclocksource

common trunk network maintenance; CTNM


featureforsupervisingthetrunknetworkforpossibledefectsituations,notifyingusersof
thosedefects,andcollectingstatisticalinformationonthedefects

communication
transferofinformationaccordingtoagreedconventions

communication alarm; communications alarm


alarmthatisassociatedwiththeproceduresorprocessesrequiredtoconveyinformation
fromonepointtoanother

communication barring; CB
supplementaryservicethatonbehalfoftheterminatinguserrejectstheincomingand
outgoingcommunicationsthatfulfilsetconditions

communication context
informationaboutallactivityinonetrafficterminationpointrelatedtoamobilestation

communication forwarding unconditional; CFU; CDU; communication


diversion unconditional
supplementaryservicethatenablesaservedusertohavethenetworkdiverttoanother
usercommunicationsthatareaddressedtotheserveduser'saddress

communication lost
notificationwhichthestreamcontroltransmissionprotocol(SCTP)invokeswhenithas
lostcommunicationtoanendpointcompletelyordetectsthattheendpointhasperformed
anabortorgracefulshutdownoperation

communication management
operatingsystemfeaturethatenablescommunicationbetweenprocesses

communication network connection supervision


featurewhichenablesahitlessswitchoveroflocalareanetworks(LAN),switches,and
Ethernetinterfaces,andtheidentificationofpossiblefaultpointsintheLAN

Issue:28

277

GeneralGlossary

communication network state management


LANdeviceintegrationsubfeaturethatoffersmeanstoseparateEthernetinterfaces,
Ethernetports,localareanetworks(LAN),andLANdevicesfromactiveEthernettraffic,
andsoprovidescontrolledandalmosthitlessroutingfornetworkelementmaintenance
operations

Communications and Database Server; CDS; Comm&DB Server


inNMS,aserverrunningtheOracledatabaseandoperatingasacommunications
gatewaybetweentheworkstationnetworkandothernetworkelements

communications driver
softwareusedtomanageaparticulartypeofcommunicationshardware

Communications Server; CS; Comm Server


workstationrunningHP-UX(HewlettPackardUnix)thatservesandimplements
connections

communication up
notificationwhichthestreamcontroltransmissionprotocol(SCTP)invokeswhenitis
readytosendorreceiveusermessages,orwhenalostcommunicationtoanendpointis
restored

communication waiting; CW
supplementaryservicethatisusedtoinformtheuserthatverylimitedresourcesare
availablefortheincomingcommunication

community ; virtual community; online community; web community


groupofpeoplewhomainlyinteractusinganinformationnetwork

community
characterstringinarequesttoanagentfromanapplication,whichtheagentusesto
verifywhethertheapplicationhasreadorwriteaccesstothemanagementinformation
base(MIB)

community-based SNMP version 2; SNMPv2c


experimentalsimplenetworkmanagementprotocol(SNMP)thatsupplementstheSNMP
frameworkbyintroducingaspecificmessageformat

278

Issue:28

GeneralGlossary

community of interest supplementary services


serviceforagroupingofsubscriberswhogenerateasignificantproportionoftheirtraffic
incallstoeachother

community service data manager; CSDM


serverthatprovidesasinglecontactpointforgroupandlistmanagementoperationsfor
PoCterminalsandstoresthesharedlists

community string; community name


textstringthatactsasapasswordandisusedtoauthenticatemessagessentbetweena
managementstationandaroutercontaininganSNMPagent

COM object; component object model object


inthecomponentobjectmodel,asetoffunctionscollectedintointerfaceswith
associateddata

Comp 128-2 algorithm; COMP 128-2


combinedauthenticationandcipheringkeygenerationalgorithmbywhichtheeffective
lengthofthecipheringkeygeneratedbytheA8algorithmisincreasedfrom54to64bits

Comp 128-3 algorithm; COMP 128-3


furtherdevelopmentoftheComp128-2algorithmthatprovidesa64-bitcipheringkey
andsoallowsextendedsecurity

Compact Data Service Unit; CDSU


functionalunitthatoffersstandardcircuit-switcheddataserviceswhichincludemodembaseddigitalconnectionstowardsthepublicswitchedtelephonenetwork(PSTN)and
digitalconnectionstowardstheintegratedservicesdigitalnetwork(ISDN)

CompactFlash card; CF
memorycardthatisdesignedwithflashmemorytechnology

compactPCI bus; CPCI; compact peripheral component interconnect;


compactPCI
peripheralcomponentinterconnect(PCI)busadaptedforindustrialandembedded
applicationsthatrequireamorerobustmechanismthanadesktopPCI

Issue:28

279

GeneralGlossary

companding
applicationofcompressionfollowedbyexpansion,usuallywiththeobjectofimproving
theratiobetweenthesignalandanynoiseorinterferenceintroducedintothe
transmissionpathbetweenthepointsatwhichtheprocessesareapplied

company network; private network; corporate network


dedicatednetworkestablishedforacertainorganisation

comparative charging
partoftrunkcircuitchargingcarriedoutbytheexchangeifthemainchargingpointison
ahigherlevelthantheexchangeconcerned

comparison function
functionwhichsetsconditionsandcomparestheactualsession-relatedvalueswiththe
parametervaluesdefinedfortheserviceorthesubscription

comparison test
testthatisusedtocomparetheincomingandoutgoingPCMtrunkcircuit

compartment
inSignallingCompression,anapplication-specificgroupingofmessagesthatisrelated
toapeerendpoint

compatibility launcher
applicationthatrequestsfromthebasetransceiverstation(BTS)thesoftwareversion,
managementinterfaceversion,andBTStypeparameters,andfromtheinstalledBTS
sitemanagersthesoftwareversionandmanagementinterfaceversion,andbasedon
theseparameterslaunchestheappropriateBTSsitemanager

compatible codec
codecthatiscompatiblewithanothercodecsothatthereisnoneedfortranscoding
betweenthem

compatible software update; compatible SW update


softwareupdatethatispurelyfunctionalandinwhichthedatatobeupdatedis
compatiblesothatnotrafficdisturbancesarecaused

280

Issue:28

GeneralGlossary

compelled signalling /GB/ ; compelled signaling /US/


signallingmethodinwhich,afteronesignalormessagehasbeensent,thesendingof
anyfurthersignalsormessagesinthesamedirectionisinhibiteduntilthesignalsent
hasbeenacknowledgedintheoppositedirectionbythereceivingterminalandthe
acknowledgementhasbeenreceived

competing destination
destination,areacode,orinternationalprefixonwhichoperatorscancompete

competitive local exchange carrier; CLEC


companythatbuildsandoperatescommunicationnetworksinmetropolitanareasand
providesitscustomerswithanalternativetothelocaltelephonecompany

compilation
processoftranslatingstatementswritteninaparticularhigh-levelprogramminglanguage
intocomputerlanguage

compilation switch
switchthatisusedtodecidethepropertiesofthemasterlibraryandthegeneratedCcode

compiler
translatorwhichtranslatesaprogramexpressedinahighlevellanguageintoaprogram
expressedinacomputerlanguage

compiler for abstract syntax notation one; CASN


compilerusedtogenerateC-typesandencodinganddecodingroutinesforthesetypes
fromtheASN.1definitions

complementary N+1 redundancy


redundancywhereoneoremoreextracomputerunitsarereservedforusesothatthe
systemcanbearthefailureofoneunit

complete command
MMLcommandwhichendsinanendcharacterspecifiedforit

complete loopback
physicallayerloopbackmechanismwhichoperatesonthefullbitstream

Issue:28

281

GeneralGlossary

complete service mode; complete mode


usagemodeoftheservletSLEEinwhichtheservletSLEEprovidesservicesonlyto
thoseuserswhouseitastheirsoleserviceplatform

completion of calls on no reply; CCNR; CCNA; call completion on no


answer
supplementaryservicewhichenablesacallingsubscriberwhoisencounteringa
destinationB,whichdoesnotanswerthecall,tohavethecallcompletedwithouthaving
tomakeanewcallattempt

completion phase
partofasoftwareupgradeinwhichthenetworkelementconfigurationiscompletedwith
anewsoftwarebuild,andtheredundantconfigurationisreturnedbyloadingthe
redundantunitswithnewsoftware

completion ratio
ratioofcompletedcallattemptstothetotalnumberofcallattempts,asmeasuredata
givenpointofanetwork

complex file
filethatcontainsbothpermanentandchangeabledata

compliance boundary; limit distance; limit boundary


physicaldistancefromanantennawithinwhichthebasicrestrictionsareexceeded

component
protocoldataunitexchangedbetweenTC-users,viathecomponentsublayerof
transactioncapabilities

component build
softwarebuildthatproducesallthedeliverablesforasoftwarecomponent

component correlation
associationofoperationinvocationsandreplies

component extension API; Cx API


applicationprogramminginterface(API)betweentheDiameterapplicationandan
application

282

Issue:28

GeneralGlossary

component framework; CFRAME


collectionofrulesandinterfacesthatgoverntheinteractionofcomponents

component implementation technology


commerciallyavailablecomponentmiddlewaretechnologyanditsassociated
connectivitycapabilities

component object model; COM


fundamentalcomponent-basedprogrammingmodelandtechnologyinWindows

component portion
thepartofaTCmessagecontainingthecomponents

component sequence list; CSL


listwhichdeterminestheorderinwhichtheservicesareexecuted

component system
compositionofcomponentsthatcanbestructuredintoanumberofcomponent
frameworks

composite echo
echothatisacombinationofelectricechoandacousticechocausedbyreflectedsignals
athybridsandacousticenvironments

composite object
mediaobjectthatcontainsoneormoremediaobjects

compound basic service group; CBSG


basicservicegroupthatasubscriberusesinsupplementaryservicemanagement

compound parameter
parameterthatconsistsofaparameterwithasinglevalueoptionallyfollowedbyzeroor
moreadditionalvalues

Issue:28

283

GeneralGlossary

compressed mode
operationalmodeinwhichaconnectedmobilestation(MS)isequippedwithasingle
receivertomakeinter-frequencymeasurementsbycompressingdataintime,thereby
freeingupslotsforinter-frequencymeasurements

compressed SLIP; CSLIP


SerialLineInternetProtocol(SLIP)whichperformscompressionofIPheaderstomake
betteruseoftherelativelylowbandwidthprovidedbyseriallinks

compressed user part interface


messageinterfaceusingacompressedheaderstructure

compression
processinwhichtherangeofamplitudesofasignalisautomaticallyreducedina
specificmanner

compression
SGSNfunctionwhichoptimisestheuseofradiopathcapacitybytransmittingaslittleof
theexteriorPDU(protocoldataunit)aspossiblewhileatthesametimepreservingthe
informationcontainedwithinit

compression
partofalarmcorrelationwhereanalarmisshownonlyoncetotheuser,evenifthere
havebeenseveraloccurrencesofthealarmactiveatthesametime

compression function
functionthatreducesthesizeofadatablockbyapplyingspecificcompressionalgorithm

compression ratio
insignalcompression,theratioofthedynamicrangeofcompressorinputsignalstothe
dynamicrangeofthecompressoroutputsignals

computational knowledge engine


searchservicethatanalysesthequestionthattheuserhasmadeandrepliesbasedon
theinformationithasavailable

computational relationship; computational relation


relationbetweentheobjectcollectionsthatdescribesthedirectionandthetypeofthe
relation(functionalorpluralisticdependency,weaknessoftherelation)

284

Issue:28

GeneralGlossary

computer address table


arraywhichhelpstheoperatingsystemconvertlogicalcomputeraddressesintophysical
computeraddresses

computer aided instruction


learningorpractisingwiththehelpofacomputerutilisinganinteractiveprogramor
simulation

computer aided software engineering; CASE


useofcomputerprogramstoautomatecertainpartsofthesoftwaredevelopmentcycle

Computer Emergency Response Team; CERT


organisationthatstudiesvulnerabilitiesininternetsecurityandprovidesassistanceto
sitesthathavebeenattacked

computer interface to message distribution; CIMD


proprietarydedicateddataexchangeprotocolforconnectinganapplicationtoaservice
centre

computer language; machine language


low-levellanguagewhoseinstructionsconsistonlyofcomputerinstructions

computer log; computer log file


computer-unit-specificfileinacomputerunittowhichapplicationprogramblocksrecord
datadefinedbythemselves

Computer-Machine Language; CML


formattedMML(man-machinelanguage)outputthatreplacesthestandardtextualMML
outputandcanbehandledbyaprogram

computer network; computer net


networkofcomputerscommunicatingwitheachotherthroughoperatingsystem
supportedmessagetransmission

computer pair
pairofcomputersthatexecutethesametasks

Issue:28

285

GeneralGlossary

computer-telephony integration; CTI


mergeroftraditionaltelecommunications(PBX)equipmentwithcomputersandcomputer
applications

computer unit; CU
functionalunitwhosevitalpartistheprocessorplug-inunit,andwhichspecialisesin
whatitdoesusingthespecialsoftwareandfilesloadedintoit

computing environment
allsoftwareinsideanoperatingsystemthatcompetesfortheoperatingsystem's
resources

computing platform; CPF


platformthatisastrictlydefinedentitycomposedofcomputerhardwareandsoftware,
andthatservesasacommonbasisandprovidesthenecessarycomputingresourcesfor
certainkindsofapplications

concatenated addressing; concatenated addressing method


addressingthatisusedinthesignallinginterfaceandinwhichtheroutingnumberand
directorynumberareconcatenatedinoneparameter

concatenated message; concatenated short message


groupofmessagesformedofseveralstandardlengthshortmessagestobesent
togetherasiftheywereonelongermessage

concatenation; catenation
mappingmultipleprotocoldataunitsintooneservicedataunit

concentrating interface
connectionofusedtributarychannels,only,toaggregatechannelswhenthenumberof
aggregatechannelsissmallerthanthenumberoftributarychannels

concentration
configurationwhereinthenumberofinletsintotheswitchingstageislargerthanthe
numberofoutlets

concentration
configurationofaV5.2interfacewherethenumberofsubscribersislargerthanthe
numberofbearerchannels

286

Issue:28

GeneralGlossary

conceptual schema
graphicrepresentationofthedatabaseschema

concerned point code; CPC


pointcodethatisconnectedtoasignallingpointandcanexchangeinformationabout
statuschangesintherelatedlocalsubsystem

concrete syntax
thoseaspectsoftherulesusedintheformalspecificationofdatawhichembodya
specificrepresentationofthatdata

concurrency control
actionsforguaranteeingtheintegrityofadatabasewhenseveralseparateeventstake
placesimultaneously

concurrent mode
operationalmodeofasoftware-definedradioinwhichitcanoperateon/usingtwoor
moreradiotechnologiessimultaneously

concurrent versions system; CVS; concurrent versioning system


open-sourcenetwork-transparentversioncontrolsystemthatcanbeusedtorecordthe
historyofsourcefiles

condition
functionaldefinitionelementthatsetsprerequisitesforthebasicoperations

conditional branching table


branchingtablewhichisvalidonlyundercertainconditions

conditional call forwarding; CCF; CFC; call forwarding conditional


callforwardingthattakesplacewhenacertainconditionisfulfilled

conditional cross-connection
cross-connectionwithconditionsattachedtoit

conditional cross-connection table


cross-connectiontablewithconditionsattachedtoit

Issue:28

287

GeneralGlossary

conditional expression
expressioncontainingabooleanexpressionwhichcontrolswhethertheconsequent
expressionoranalternativeexpressionisinterpreted

conditional receiving
receiptofamessageonlyifamessageiswaiting

condition variable; event variable


semaphorewhosevaluecanbeincrementedtoonewithasinglecall

conducted emission; CE
interferenceresultingfromconductedradionoiseorunwantedsignalsenteringa
transducer(receiver)bydirectcoupling

conducted interference
interferencethatpropagatesthroughaconductorsuchaswiringoranymetallic
structure,forexample,sharingcommonreturnlines

conference bridge
facilityorservicethatallowsusersfromseveraldiverselocationstobeconnectedfora
conferencecall

conference call; conference


callbetweentheparticipantsofaconferencecall

conference calling; CON; CF; telephone conference; conference facility;


conference call service
teleconferencebetweenthreeormoresubscribersbasedonanormaltelephonecall

conference-factory-URI
SIPuniformresourceidentifier(URI)thatidentifiesaPoCserviceinthehomePoC
network

conference treatment indicator


signallingparameterthatissentinbothdirectionstoindicatehowamultipartycallis
treated

288

Issue:28

GeneralGlossary

confidentiality
characteristicofinformationwhichensuresthattheinformationisnotavailableor
disclosedtounauthorisedusers,entities,orprocesses

configuration and software management operations; CoSMO


setoffunctionsthatarehandledbytheGPRSbackbonenetworksubsystemandthat
includetheconfigurationandsoftwaremanagementoperations

configuration backup; configuration data backup


backupcopyofconfigurationdataofadeviceoranetworkelement

configuration change notification; CCN


changenotificationthatanetworkelementsendstoNetActviatheoperationand
managementservertostartaconfigurationoperation

configuration context; CC
setofconnectivityandapplicationconfigurationsofamobileterminalthatapplytoa
certaincontext

configuration data; configuration management data


datawhichdescribestheservice-relatedconfigurationsthataredeployedinnetwork
elements

configuration data event management; event management


featurethatinformsthenetworkmanagementsystemimmediatelywhenthenetwork
configurationhasbeenchangedlocallyusingman-machinelanguage(MML)

configuration-dependent paging queue depth


pagingqueuethatisdependentonthedynamicsizeofthepagingcommandbufferin
thebasetransceiverstation(BTS)

configuration entity; CONFE


setofsystemprogramsconfiguringtheTCP/IPstackaccordingtothestatusinformation
generatedbythesupervisionentities

configuration file
filethatcontainsconfigurationdata

Issue:28

289

GeneralGlossary

configuration group
setofnetworkelementsthatsharethesameserviceconfiguration

configuration management; CM
setoffunctionsusedtocontroltheconfigurationofthesystem,thatis,tocontrolthe
extensionorreductionofasystem,thestatusoftheconstituentparts,andtheidentityof
theirallocation

configuration management data mediator; CMDM; CM data mediator


networksubsystem(NSS)configurationtoolwhichprovidesnetworkoperatorswitha
graphicaluserinterface(GUI)tomodifytheexistingconfiguration

configuration management parameter


parameterwhosevaluehasaneffectontheconfiguration

configuration manager
tool,andtherelateduserinterface,whichcanbeusedtomodifythesoftware
configurationofaserver

configuration message
messagethatcontainsconfigurationdata

configuration option
alternativeswhichcomposetheconfigurationatagivenpointoftime

configuration parameter
parameterthathasavaluethataffectstheconfiguration

configuration plan
planofthespecificmake-upoftheunitsofasystem,indicatingthewayinwhichthe
systemisconfigured

configuration plan management


setoffunctionsthatoffersaframeworkforconfigurationplanhandling

configuration register
registerthatcontainsasystem'sorunit'soperatingparameters

290

Issue:28

GeneralGlossary

configuration request message; configuration request


COPSprotocolbasedmessagefromthepolicyenforcementpoint(PEP)tothepolicy
decisionpoint(PDP)forprovidingpolicydatathatthePDPmayhaveforthePEP

configuration script
scriptthatincludestheconfigurationdata

configuration service
servicewhichanetworkelementprovidestoanotherelementsothattheotherelement
canrequestaconfiguration

configuration set
listofexistingresourcesandtheirquantities

configuration table
exchangedeliveryspecifictablelistingthetypesofthecomputerunitsconnectedtothe
messagebusandloadedintoallunits

configuration upgrade tool


Javaprogramthatallowstheusertotransfertheconfigurationfromtheoldrelease's
executioncontexttothenewexecutioncontext

confirmation message
messagethattheterminalmanagementserver(NTMS)sendstotheend-usertogetthe
enduser'sacceptancefortheprovisioning

confirmation request
automaticmessagethatasksarecipienttoconfirmtheactiontheyhavemade

confirmed indication
signallingmessagethataPoCserversendstoconfirmthatit,alltheintermediary
networkelements,andtheterminatingPoCclientareableandwillingtoreceivemedia

confirmed push
mechanisminwhichthepushinitiatorpushesmessagestothepushproxygateway
(PPG),whichforwardsthemessagestotheshortmessageservicecentre(SMSC)for
delivery

Issue:28

291

GeneralGlossary

confirmed session set-up mode; confirmed set-up mode


sessionestablishmentmodewherethetargetterminalispagedbeforetheready-to-talk
indicationisgiventothesessioninitiator

confirm primitive
primitivetypeusedbythelayerprovidingtherequestedservicetoconfirmthatthe
activityhasbeencompleted

conformance definition
definitionthatunambiguouslyspecifiestheconformingcellsofaconnection

confusion message; CFN


signallingmessagesentinresponsetoanymessage(otherthanaconfusionmessage)
iftheexchangedoesnotrecognisethemessageordetectsapartofthemessageas
beingunrecognised

congested traffic
partoftheoverflowtrafficthatisnotcarriedbysubsequentpoolsofresources

congestion
inaswitchingsystem,inabilitytomakeaconnectionorobtainaservicebecausethe
devicesneededfortheconnectionorserviceareinuse

congestion avoidance
congestioncontrolalgorithmthattheTransmissionControlProtocolusestoslowdown
thetransmissionrateduringcongestion

congestion control
setofactionstakentorelievecongestionbylimitingthespreadanddurationofit

congestion indication bit; congestion indicator; CI bit


bitinaresourcemanagementcellthatallowsanetworkelementtoindicatethatthereis
congestioninthenetwork

congestion indicator primitive; CIP


congestionindicationfromthemessagetransferpart(MTP)totheuserpart(UP)

292

Issue:28

GeneralGlossary

congestion management
setoffunctionsthatincludesnetworkengineering,andOperations,Administrationsand
Maintenance(OAM)procedurestodetectcongestion,andreal-timemechanismsto
preventorrecoverfromcongestion

congestion tone
toneadvisingthecallerthatthetrunkcircuitsorswitchingequipmentnecessaryforthe
setting-upoftherequiredcallorfortheuseofaspecificservicearetemporarilyengaged

congestion window; cwnd


streamcontroltransportprotocol(SCTP)variablethatlimitsthedata,innumberof
octets,thatasendercansendintothenetworkataparticulardestinationbefore
receivinganacknowledgement

connected call; established call; existing call


connectionwhichhasbeenputthroughatallnecessaryswitchingpoints

connected line identification presentation; COLP; connected line identity


presentation; called number identification presentation
servicewhichprovidesacallingusertheconnectedlineidentityincallconnection

connected line identification restriction; COLR; connected line identity


restriction; called number identification restriction
servicewhichallowsausertorestrictthepresentationoftheirlineidentityasconnected
lineidentitytocallingusers

connected line information


informationwhichconsistseitheroftheconnectedlineidentity(LI),screeningindicator
(SI)andpresentationindicator(PI),orthemerePI

connected mode; connected state


stateofamobilestationwhenitisswitchedonanditsradioresourcecontrol(RRC)
connectionisestablished

connected mode mobility


mobilityofamobileterminalthatisintheconnectedmode

Issue:28

293

GeneralGlossary

connected service
logicalservicethatcanberequestedindependentlyfromlegsandcanbeconnectedto
theleg(s)later

connection
transmissionopportunitybetweentwoormorepoints

connection admission control; CAC


procedurewithinthecontrolpartofnetworknodesusedtodecidewhetherornota
requestforavirtualconnectioncanbeacceptedbasedontherequestedusage
parametersandalreadyestablishedconnections

connection completion rate


ratioofsuccessfullycompletedconnectionstothetotalnumberofattemptedconnections

connection configuration
configurationconsistingofacalloracallattemptbetweentwosubscribers

connection configuration object; CoCo


managedlogicalobjectintheradionetworkconfigurationmanagement,displayingthe
transmissionintheIubinterfaceandspecifyingtheIublinkconfigurationtotheATMlevel

connection confirm message; CC; connection confirm


messageusedinthesignallingconnectioncontrolpart(SCCP)connection-oriented
servicetoacknowledgetheestablishmentofasignallingconnection

connection end-point; CEP


signallingpointwhichmaybeeitheroriginatingordestination

connection endpoint suffix; CES


valueselectedbythelayer3ormanagemententitytoaddressthedatalinklayerentity

connection established indication; CEI


messagethatanetworkelementsendstoanoperationandmanagementserverto
whichitissettingupanewconnection

294

Issue:28

GeneralGlossary

connection established response; CER


messagethatanoperationandmanagementserversendsasaresponsetoa
connectionestablishedindicationthatithasreceivedfromanetworkelement

connection establishment; establishment of a connection


reservingradioresourcestosetupaconnection

connection function
functionusedtohandleconnectionstolegs

connection identification
numberwhichidentifiesunambiguouslyacertainconnectionattheinterfacebetweenthe
signallingconnectioncontrolpart(SCCP)andauserfunction

connection identifier; CID


16-bitvaluethatidentifiesatransportconnectionoranuplink/downlinkpairofassociated
managementconnectionstoequivalentpeersinthemediumaccesscontrollayerofthe
basetransceiverstationandsubscriberstation

connectionless; connectionless connection mode


connectionmodethatenablesanexistingnetworktosenddatawithoutestablishingthe
connectionbeforehand

connectionless network protocol; CLNP


OpenSystemInterconnection(OSI)protocolthatprovidestheOSIconnectionless
networkservice,adatagramservice

connectionless network service; CLNS; connectionless service


networkservicethattransfersinformationbetweenenduserswithoutestablishinga
logicalconnectionorusingvirtualcircuits

connectionless transport protocol; CLTP


OSIprotocolthatdescribesend-to-endtransportdataaddressinganderrorcontrol,with
noguaranteeofdeliveryandnoflowcontrol

connection level
secondmostabstractionlevelofthecallfiledescribingoneconnectionmadeduringthe
callandformingalogicalconnectionbetweentwosubscriberlevelelements

Issue:28

295

GeneralGlossary

connection loopback
testloopbackwhereasignalcomingfromalineisconnectedtoserveasasignalgoing
outtotheconnectionintheswitchingnetwork

connection management; CM
functionalentityofthemobilecommunicationsystemusedtocontrolmobileoriginating
andterminatingcalls

connection management
feature,whichisapartoftheATMconnectioncontrol,managingthebasicoperations
relatedtodifferenttypesofcross-connections,andmanagingthebasictopologies,
levels,andtypesofconnections

connection manager
managerthattheDesktopFrameworkusestocreateauthenticatedconnectionsto
services

connection matrix; CM
circuitwhichimplementstheconnectionsdefinedintheconnectiontable

connection measurement
computer-unit-levelmeasurementwhichcollectsinformationaboutthetrafficloadand
trafficabilityinthemultimediagateway(MGW)

connection mobility control; CMC


evolvednodeBradioresourcemanagementfunctionthatcontrolstheuserequipment
measurementsofservingandneighbouringcells,andprovidingofhandoverandcell
changedecisions

connection mode
typeofassociationbetweentwopointsasrequiredbythebearerserviceforthetransfer
ofinformation

connection monitoring
monitoringofalltheconnectionsthatcrosstheuser-networkinterfaceornetworknetworkinterface

connection-oriented; connection-oriented connection mode


connectionmodethatrequirestheestablishmentofavirtualcircuit

296

Issue:28

GeneralGlossary

connection-oriented bearer independent; COBI


callcontrolinstancecapableofhandlingcallunrelatedPBXsignalling

connection-oriented network protocol; CONP


opensystemsinterconnection(OSI)protocolprovidingconnection-orientedoperationto
upper-layerprotocols

connection-oriented network service; CONS


networkservicethatestablisheslogicalconnectionsbetweenendusersbefore
transferringinformation

connection-oriented transport service; COTS


servicespecificationforthetransportlayer(layer4ofOSImodel)asspecifiedinISO
8072

connection plan download and activation


featurewhichenablesthedownloadandactivationoftheATMlayerandIPlayer
configurationplanforeachradionetworkcontroller(RNC)elementintheradioaccess
network(RAN)

connection point
pointrepresentinganexistingconnectionbetweentwolegs

connection point; CP
referencepointwheretheoutputofatrailterminationsourceoraconnectionisboundto
theinputofanotherconnection,orwheretheoutputofaconnectionisboundtotheinput
ofatrailterminationsinkoranotherconnection

connection processing engine; CPE


partoftheconnectionprocessingserverthatimplementstheIPmultimediaconnection
processingfunctions,thatis,thecallstatecontrolfunction(CSCF)rolesandtheserving
profiledatabase

connection processing server; CPS; CPServer


serverwhichprovidesconnectionsignallingbetweennetworkelementsandsupports
severalsimultaneousconnectionsthroughoutadistributednetwork

Issue:28

297

GeneralGlossary

connection quality
collectiveeffectofserviceperformance,whichdeterminesthedegreeofsatisfactionofa
userwiththeparticularconnection

connection refused message; CREF; connection refused


messageusedinthesignallingconnectioncontrolpart(SCCP)connection-oriented
servicetorefusetheestablishmentofasignallingconnection

connection release; release of a connection


releasingtheradioresourcesthathavebeenreservedforaconnection

connection report
measurementreportproducedasaresultofconnectionmeasurement,containing
informationaboutthenumberofconnectionattemptsandthenumberofattemptsper
interface

connection request
signallingparametersentonbehalfofthesignallingconnectioncontrolpart(SCCP)
requestingtheestablishmentofanend-to-endconnection

connection request message; CR; connection request


messageusedinthesignallingconnectioncontrolpart(SCCP)connection-oriented
servicetoestablishasignallingconnection

connection retention
probabilitythataconnection,onceobtained,willcontinuetobeprovidedfora
communication

connection section
sectionofansignallingconnectioncontrolpart(SCCP)connectionbetweenendpointsor
betweenanendpointandanintermediatepointorbetweenintermediatepoints

connection segment; CS
specificportionofacompleteconnectionrepresentedbylegsandconnectionpoints

connection segment identifier; CSID


identifierthatisallocatedtotheconnectionsegmentsothatitcanbepointedto

298

Issue:28

GeneralGlossary

connection server
NMSbackgroundapplicationthatprovidestransparentconnectionstoclients

connection service
servicethatDesktopFrameworkprovidesforcreatingauthenticatedconnectionsto
services

connection setup; connection establishment; call setup; call establishment


processofcreatingaconnectionfromaterminal

connection string
characterstringthatdefinestheconnectionparameterstobeusedwhenconnectingto
anopendatabaseconnectivity(ODBC)datasource

connection supervision
functionusedformonitoringtheintegrityofaconnection

connection supervision agent; CS agent


agentwhichislocatedineveryhostandoffersaninterfacetocollectconnectivity
information

connections warming
warminginwhichtheconnectiondataofa2Nredundantspareunitisupdatedwiththe
correspondingdataofanactiveunit

connection table
tablethatisstoredinanon-volatilememoryandthatdefinestheconnectionsand
branchingsofequipmentandisusedtocontroltheconnectionmatrix

connection tag
informationfieldattachedtoastandardATMcellincellswitchingthatprovidesa
referencetoatargetvirtuallinkterminationpoint

connection termination point; CTP


terminationpointinatrailoracircuit

Issue:28

299

GeneralGlossary

connection topology
structurethatdescribeshowconnectionsinasystemarearranged

connection type
routinginformationprovidedbythesubdestinationwhichcontainsdataaboutthe
propertiesoftheconnectionsinuse

connection view; CV
descriptionofthestateandfeaturesprevalentintheconnectionsegment(CS)

connectivity attribute
partoftheagentobjectthatthemediationusestoopenaconnectiontotheO&Magent

connectivity functions
oneofthetwomajorfunctionalareasofmPlatform,managingthesecurityandnetwork
interfacesrequiredtobridgethemobileanddataworlds

connectivity layer
inthelayeredarchitectureofathirdgenerationnetwork,alayerthatconsistsofthecore
networkequipmenthandlingvoiceanddatadelivery

connectivity service network; CSN


corenetworkoftheWiMAXsystemthatprovidescontrolandmanagementforthe
accessservicenetworkandinternetconnectivityforsubscribers

connect message; CON


signallingmessagewhichindicatesthatalltheaddresssignalsrequiredforroutingthe
calltothecalledsubscriberhavebeenreceivedandthatthecallhasbeenanswered

connect onwards
makeaconnectionfromanoperatortotherequiredsubscriberinconnectionwith,for
example,directoryassistanceorcountrydirect

connector
SDL/GRsymbolwhichiseitheranin-connectororanout-connector.Aflowlineis
impliedfromout-connectorstotheassociatedin-connectorinthesameprocessor
procedureidentifiedbyhavingthesamename

300

Issue:28

GeneralGlossary

connector proxy
back-to-backuseragentthathasnologicbetweentheuseragentserveranduseragent
clientpartsandthusalwaysbehavesasaproxy

Connect procedure; CON; Connect


procedureusedtorequesttheserviceswitchingfunction(SSF)toperformthecall
processingactionstorouteacalltoaspecificdestination

ConnectSMS procedure; CONSMS; ConnectSMS


operationwhichisusedtorequestthegsmSSForgprsSSFtoperformtheshort
messageprocessingactionstorouteashortmessage(SM)toaspecificdestination,or
toinfluenceotherSMset-upinformation

ConnectToResource operation; CTR; ConnectToResource


operationthattheGSMservicecontrolfunctionusestoconnectacallfromtheGSM
serviceswitchingfunctiontoaspecialisedresourcepoint,afterwhichtheinteractionwith
thecallingpartycantakeplace

consecutive severely errored seconds; CSES; consecutive SES


eventthatoccurswhenaconsecutivesequenceof2to9severelyerroredseconds
(SES)isdetected

consistency
creatinganewandvalidstateofdata,or,ifanyfailureoccurs,returningalldatatothe
statebeforethetransactionwasstarted

consistency check
checktodeterminewhetherspecificdataitemsarecompatible

consistent
compliantwithconsistencyrequirements

consistent database
databasewhichisnotinconflictwiththegivencriteria

console; controlling terminal


userterminalforcommunicationbetweenanoperatororamaintenanceengineeranda
computersystem

Issue:28

301

GeneralGlossary

consolidate
togrouptransactionlogsbyeventtypepersubscriberonascheduledbasis

consolidated charging record; consolidated CDR


chargingrecord(CDR)thatconsistsofseveralpartialchargingrecordsandthatisthe
resultofCDRconsolidation

consolidation
allocationofserver-layertrailstoclient-layerconnectionssothateachserver-layertrailis
fullbeforethenextisallocated

constant
namewhichrepresentsavalue

constant amplitude zero auto-correlation sequence; CAZAC; constant


amplitude zero auto-correlation waveform
complex-valuedsignalthathasmodulusoneandout-of-phaseperiodicauto-correlation
thatisequaltozero

constant bit rate; CBR


bitratethatsupportstransportservicesthatrequirerigoroustimingcontroland
performanceparameters

constant bit rate service


telecommunicationservicecharacterisedbyaservicebitratespecifiedbyaconstant
value

constant-delay service
networkserviceinwhichthetransitdelayofthenetworkservicedataunits(NSDU)
betweenthenetworkconnectionendpointsremainsconstantforthedurationofthe
connection

constraint
relationthatdefinesconditionsfortheoccurrenceofanaction

consumer object
incommunication,anobjectwhichistheuseroftheinformationconveyed

302

Issue:28

GeneralGlossary

consumer replica
replicathatreceivesupdatesfromasupplierreplica

consuming device
entitythatconsumesdigitalcontentaccordingtotheusagerules

contact header
SIPheaderwhichprovidesauniformresourceidentifier(URI)whosemeaningdepends
onthetypeofrequestorresponseitisin

contact list
listinthepresenceserverwithwhichausercanauthoriseanotherusertosubscribeto
hisprivatepresenceinformation

contact page web server; CPWS


HTTPserverthatisusedtostoreIPmultimediasubsystem(IMS)subscribers'personal
contactpages

container
structuralpartofanSTM-1frameconsistingofapayloadwithaspecifiedformat

container
intheFlexiServercontext,aprocessthatgivestheexecutionenvironmenttoseparately
loadedsoftwareentitiesandiscapableofrunningtheseentitiesinit

container
storageforinformationthatissharedbetweenagentsonthecomponentsequencelist,
orbetweentheagentsandthesessioncontroller

container element
XMLelementthatcancontainotherelements

container-managed persistence; CMP


persistencethatincreasestheindependenceofanapplicationanddatabasetierby
leavingdirectdatabaseaccesstobehandledbytheEnterpriseJavaBeans(EJB)server

Issue:28

303

GeneralGlossary

containment; containment relationship


structuringrelationshipformanagedobjectsinwhichexistenceofamanagedobjectis
dependentontheexistenceofacontainingmanagedobject

containment tree
hierarchicalarrangementofmanagedobjectinstanceswherethehierarchyisorganised
onthebasisofcontainmentrelationships.Amanagedobjectinstancecontaininganother
managedobjectinstanceishigherinthehierarchythanthecontainedobject.The
containingmanagedobjectinstanceisreferredtoasbeingthesuperiorofthecontained
object,whichisreferredtoasthesubordinate

content adaptation; CA
functionoftheMMSCenter,whichisusedtoadaptthemessagecontenttotherecipient
terminalcapabilities

content addressing; content retrieval


informationretrievalbasedonthecontentoftheinformationwithoutindividualisingthe
searchedrecord

content analyser /GB/ ; content analyzer /US/; CA


toolthatdetectsandanalysesthecontentoftheinformationdownloadedtothecustomer

content analyser service editor; CA service editor


editorthatisusedtoeditcontentanalyserserviceattributes

content barring
barringofcontentsubscriptionsbasedonoperatorandfilteringprofiles

content-based charging; content charging; content-based billing; content


billing
chargingthatisbasedonthetypeandamountofdeliveredcontent

content-based filtering; CBF


inashortmessageservicecentre,anoptionalfeaturethatisusedtofilteroutshort
messagesthatcontainbannedwords

content catalogue document; CCD


XMLdocumentthatisusedtoexposedifferentvariantsofadownloaditemfordifferent
typesofterminals

304

Issue:28

GeneralGlossary

content category
categorytowhichthedownloadedcontentbelongs

content chunk
extensiblemarkuplanguage(XML)objectthatrepresentsadefinedsectionofa
documentorafieldattributeinaform

content convention
applicationconventiongoverningdatacontent

content delivery; content distribution; content releasing


processofmakingthecontentavailableforuserswhohaverequestedit

content description
descriptionofthecontentwhichthedeliveryserverdeliverstotheterminalsothatthe
customercandecidewhethertobuytheactualcontent

content encoding
actionofconvertingacontentobjectfromoneformattoanother

content encryption key; CEK


symmetriccryptographickeythatisusedtoencryptapieceofdigitalcontent

content handler
logicalcomponentofthedeliveryserverthatisresponsibleforfetchingandfilteringthe
content

content identifier; CID; content ID


identifierthatindividualisesapieceofcontentinagloballyuniqueway

contention; access contention


conditioninwhichtwoormorenetworkdevicesattempttotransmitatthesametimeover
asharedchannel,ortotransmitatthesametimeintwo-wayalternatecommunication

content-length header
SIPheaderthatindicatesthesizeofthemessagebodysenttotherecipient

Issue:28

305

GeneralGlossary

content management module; CMM


softwaremoduleinadeliveryserver(DLS)thatenablesthemanagementofthelifecycle
fromcontentproviderstotheendusersforvarioustypesofcontentobjects

content management query interface; CMQ interface


externaldeliveryserverinterfacewhichisusedtopublishcontentprofilesfromthe
contentmanagementmodule(CMM)toportals

content management tool; content management tool interface; CMT


interface
toolwhichisusedtomanagecontentinthecontentmanagementmodule(CMM)

content name
nameoftherequesteddownloaditem

content object
file,oracontainerconsistingofmultiplefiles,thatisusedtodeliverthecontent

content only charging


chargingrelatedtothe2.5Gand3Gnetworksandserviceswhereonlythecontentis
chargedwithoutanyadditionalchargingfortheconnectionassuch

content packaging tool; CPT


toolforencryptingapieceofcontent

content plus charging


chargingrelatedtothe2.5Gand3Gnetworksandserviceswherethesubscribercan
benefitfromcertaintypeofinformationqueries

content production; content providing


productionofdatawhichistobeprovidedasaserviceorasadataproduct

content profile
setofparameterswhichdescribeacontentobjectoradescriptorfile-contentfilepair

306

Issue:28

GeneralGlossary

content profile management


setoffunctionsinthecontentmanagementmodule,whichprovidestheregistrationof
thecontentprofiles,theirapproval,publicationonaportal,andremoval

content provider
serviceproviderproducingmaterialtobesuppliedasatelecommunicationsservice

content provider charging function; CPCF


functionthathandleschargingrequestsfromthecontentserver,andrelaysthemtothe
subscribercontentchargingfunction(SCCF)

content provider dynamic interface; CPDI; CPD interface


HTTPinterfacethatallowscommunicationbetweenthedeliveryserver(DLS)andthe
presentationportal

content provider interface; CP interface


applicationinterfaceinthedeliveryservercore(DLSC)formanagingcontentprovider
profilesandbusinessrulesfordownload,initiatingcontentprovisioningtoendusers,and
providingdownloadreports

content provider management


setoffunctionsthatprovidesmeanstocreate,edit,anddeletecontentproviderprofiles
andcontentprovideruseraccounts,andtocreatecontentprovidermessages

content provider message


message,whichthedeliveryservercoregenerates,tobeshowntocontentproviders
whenevertheyaccessthecontentprovidertool

content provider profile


profilethatincludesthedeliverypolicy,thebusinessterms,andtheaccountandbilling
preferences

content provider store


dataareaforanapplicationtostoredataaboutasubscriberforretrievalwhenthat
subscribernextenterstheapplication

content provider tool; content provider tool interface; CPT interface


toolofthecontentmanagementmodule(CMM)viawhichcontentproviderscansubmit
content

Issue:28

307

GeneralGlossary

content security module; CSM


softwarebuildingblockofthedeliveryserverwhichchecksthecontentitemsbeforethey
aredownloadedtoterminals

content selection; content selection feature


featurewithinthedeliveryserverthatisusedtoselectsuitablecontentfordifferenttypes
ofterminals

content server; content storage


serverwhichholdscontentthatcanbedownloadedtoterminals

content service
servicethatisdeliveredbyacontentprovider

content service provider; CSP


serviceproviderwhichbuildsorprovidesthecontentofwebpages

content storage interface


HTTPinterfacethatthedeliveryserverusesforfetchingdownloaditemsfromthe
contentstorage

content subscription barring


barringofcontentsubscriptionsbasedonfilteringprofiles

content-type header
SIPheaderthatindicatesthemediatypeofthemessagebodysenttotherecipient

content URL
URLaddresspointingtothedownloadablecontentinthecontentstorage

context
withinH.248,anassociationbetweenacollectionofterminations

context access; content access


setofcontextaccesspointswhichhavethesameaccesspointname

308

Issue:28

GeneralGlossary

context access point; CAP


accesspointinthegatewayGPRSsupportnode(GGSN)thatisvisibletotheserving
GPRSsupportnodeandusedforGGSNselection

context function
functionthatisusedtoexchangemobilesubscribercontextinformationinordertosetup
anystateorretrieveanystateinanetworkelement

context ID
withinH.248,auniquereferencewhichthemultimediagatewaygivesforeachcallor
connection

context management
managemententitythatprovidesaframeworkforclientapplicationstomaintainthe
requiredinformationinasharedmemoryinastructuredmanner

context manager; CMA


featurethatprovidesmanagementservicesfortheMSCserverbysupervisingacontext
anditsterminations,storinginformationrelatedtothem,andbyencodinganddecoding
actionrequests

context provider
softwarethatcandelivercontextinformation

continuation analysis for charging


partofcharginganalysisusedforanalysingthecallednumber

continuation license /US/ ; continuation licence /GB/


licensethatisusedtoextendthevaliditytimeofanotherlicensethatalreadyexistsina
networkelement

continuation of message; COM


indicatorusedbytheATMadaptationlayer(AAL)toindicatethataparticularATMcellis
acontinuationofahigherlayerinformationpacketthathasbeensegmented

continuation tree
analysistreewheretheanalysiscanbecontinuedwhennecessary

Issue:28

309

GeneralGlossary

continue message
transactioncapabilitiesmessagethatisusedtocompletetheestablishmentofa
transactionandtocontinueanestablishedtransaction

Continue procedure; CUE; Continue


procedureusedtorequesttheserviceswitchingfunction(SSF)toproceedwithcall
processingatthedetectionpoint(DP)atwhichitpreviouslysuspendedcallprocessing
toawaittheservicecontrolfunction's(SCF)instructions

ContinueSMS procedure; CUESMS; ContinueSMS


operationwhichisusedtorequestthegprsSSForgsmSSFfortheshortmessage
service(SMS)toproceedwithprocessingatthedetectionpoint(DP)atwhichit
previouslysuspendedprocessingtoawaitgsmSCFinstructions.

ContinueWithArgument; CWA; ContinueWithArgument operation;


ContinueWithArgument procedure
operationusedtorequesttheserviceswitchingfunction(SSF)toproceedwithcall
processingatthedetectionpoint(DP)atwhichthecallprocessingwassuspendedto
awaitservicecontrolfunction(SCF)instructions,andtoprovideadditionalservicerelated
informationtoauserwhilstthecallprocessingproceeds

continuity check; CCR


checkmadetoacircuitorcircuitsinaconnectiontoverifythatanacceptablepath(for
example,forthetransmissionofdataorspeech)exists

continuity check request message; CCR; continuity-check-request


message
signallingmessagewhichanexchangesendstotheexchangeattheotherendofa
circuit,requestingcontinuitycheckingequipmenttobeattachedandcontinuitycheckto
beperformedonthecircuit

continuity check transponder


devicewhichisusedtointerconnectthegoandreturnpathsofacircuitattheincoming
endwhichondetectionofachecktone,returnsanotherchecktonetotheoriginatingend
topermitacontinuitycheckingofa2-wirecircuit

continuity message; COT


signallingmessageindicatingwhetherthereiscontinuityontheprecedingcircuitstothe
followingexchange,includingverificationofthecommunicationpathacrossthe
exchangewiththespecifieddegreeofreliability

310

Issue:28

GeneralGlossary

continuous checking
checkingofanitemforgoodperformanceatthetimeitisactive

continuous hourly traffic profile; continuous hourly traffic profile of peak


hour measurement
averagetrafficloadduringeachhourofthedayascalculatedduringtheentire
measurementhistoryofthesystem

continuous order; continuous every day order; permanent order


callorderaccordingtowhichthecallissetupseveraltimes

continuous packet connectivity; CPC


setoffeaturesincludingdiscontinuousuplinkDPCCHtransmissionanddiscontinuous
downlinkreceptionwithhigh-speedpacketaccess(HSPA)thataimstooptimisethe
supportofpacketdatausersinaHSPAnetwork

continuous phase modulation; CPM


phasemodulationwherethephasechangescontinuouslyinsteadofindiscretesteps

continuous provisioning; terminal management


provisioningwherethesettingsofapreviouslyconfiguredterminalaremodified

continuous timing advance update procedure


generalpacketradioservice(GPRS)procedureinwhichamobileterminalsendsan
accessbursttothebasetransceiverstationonthepackettimingcontrolchannelandthe
basetransceiverstationthenestimatesthedistancetotherespectivemobileterminal
andreturnstheappropriatetimingadvancemessage

continuous wave; CW
radioorradarwavethatmaintainsaconstantamplitudeandaconstantfrequency

contract subscriber
subscriberwhohasacontractwithatelecommunicationscompanyoroperatoron
directingtrafficorchargingorbothfortrunktrafficorinternationaltraffic

contradirectional interface
interfaceacrosswhichthetimingsignalsassociatedwithbothdirectionsoftransmission
ofthesignalstobetransferred,aredirectedtowardsthesamesideoftheinterface

Issue:28

311

GeneralGlossary

contributing source; CSRC


sourceofastreamofRTPpacketsthathascontributedtothecombinedstream
producedbyanRTPmixer

contribution; contribution application


useofabroadbandserviceorchannelfortransferringaudioorvideoinformationtoa
userforpost-productionprocessingandsubsequentdistribution

control action
parameteraffectingselectivecircuitreservationandspecifyingwhattodowithbarred
calls

control bit
framebitwhichisreservedforcontrolsignalsdeterminedbytheuser

control block
blockwhichcommunicateswiththeotherblocksintheequipmentandcontrolstheir
operation

control bus
databusthatisusedtocontrolequipmentorasystem

control channel; CCH


logicalchannelthatcarriessystemmanagementmessagesbetweenabasetransceiver
stationandamobilestation

control channel element; CCE


basicelementofacontrolchannel,groupofwhichareconcatenatedtoachievedifferent
codingrates

control channel management; CCM


managementfunctionthatprovidesmeanstoconfigureconnectionsbetweenavirtual
pathidentifier/virtualchannelidentifierinnetworkinterfaceunit(NIU)andaprotocol
terminationpointinthecomputerunit

control character
characterwhoseoccurrenceinaparticularcontextinitiates,modifiesorstopsanaction
thataffectstherecording,processingorinterpretationofdata

312

Issue:28

GeneralGlossary

control computer unit


high-performancecomputerunitthattypicallyperformssignalling,connectioncontrol,call
control,andnetworkelementmanagementtasks

control connection
connectionbetweentheclientandserverfortheexchangeofcommandsandreplies

control connection socket; CCS


socketwhichisanendpointforanFTPcontrolconnection

control file
filewhichdiagnosticshandlinggenerateswithI/Osystemforswitchingplatformand
applicationdiagnosis

control file
fileusedtoco-ordinatethefiletransferbetweentheMessagingGatewayandoperator's
billingsystem

control format indicator; CFI


signallingmessagethatindicatestheamountofresourcesthatareallocatedforthe
controlchanneluseinthedownlinkdirection

controllable load
loadcausedbybest-effortnon-real-timepacketdatatraffic

controlled maintenance
methodofsustainingadesiredqualityofservicebythesystematicapplicationof
analysistechniques

controlled rerouting
procedureoftransferringinacontrolledway,signallingtrafficfromanalternative
signallingroutetothenormalsignallingroute,whenthishasbecomeavailable

controlled roaming
servingGPRSsupportnode(SGSN)featurethatenablestheoperatortogivespecific
roamingrightstodifferentsubscribergroups

Issue:28

313

GeneralGlossary

controlled slip
irretrievablelossorgainofasetofconsecutivedigitpositionsinadigitalsignal,inwhich
boththemagnitudeandinstantofthatlossorgainarecontrolled,toenablethesignalto
accordwitharatedifferentfromitsown

Controller Area Network; CAN; CAN bus


messagebusstandardthatisdesignedforvehicleapplicationstoallowtheelectronic
devicestocommunicatewitheachotherwithoutahostcomputer

controlling IN service
INsupportedservicewhichhascontroloverthecallcontrolfunction

controlling PoC function


functionthatisimplementedinaPoCserverandthatprovidescentralisedPoCsession
handling,includingRTPmediadistribution,floorcontrol,policyenforcementfor
participatingingroupsessions,andparticipantinformation

controlling RNC; CRNC; controlling radio network controller


radionetworkcontroller(RNC)thathastheoverallcontrolofthelogicalresourcesofits
UMTSterrestrialradioaccessnetwork(UTRAN)accesspoints

controlling SCP connection


connectionforacontrollingINservice

controlling SSP connection


connectionthatisformedbetweentheservicecontrolpoint(SCP)andserviceswitching
point(SSP)whentheINsupportedservicerequiresapossibilitytocontrolcallcontrol
functions

control memory
memorysectioninaswitchingunitfromwhichthereadaddressesarecontinuously
beingreadtotheswitchingmemory

control of media, MRF and MGW


featurethatisusedtohandlethemediacontrolwhichtheconnectionprocessingserver
(CPS)hassituatedinthemultimediaresourcefunction(MRF)andmediagateway
(MGW)

314

Issue:28

GeneralGlossary

control option
actionthatthecallcontroltakesifthecheckoftheautomaticcongestioncontrol,
selectivetrunkreservation,orotherconditionfails

control part
partofDX200switchingsystemwhichcontrolstheoveralloperationofit,composedofa
MessageBus(MB)andcomputerunits

control-part-connected preprocessor
preprocessorwhichisconnectedtothecontrolpartcomputerwithahighcapacitybus,
forexamplewithDMCbusorPCIbus

control PDU; C-PDU


protocoldataunit(PDU)thatcontainsinformationforsettinguptheradiobearerservice
andotherparametersthatarenecessarytothetargetuserequipment

control plane; C-plane


layerperformingthesignallingfunctionsnecessarytosetup,supervise,andrelease
callsandconnections

control plane
mediatrafficwhichcarriessignallinginformation

control plane accounting


accountingthatisbasedonuserplanedestinationreference(UPDR)indices

control plane application


applicationprovidingfunctionsonthecontrolplane

control plane platform


platformthatconstitutesacommonhardwareandsoftwarelayerforcontrolplane
applications

control plane product


productthatiscomposedofsellableitemsandthatistargetedatthecontrolplane

Issue:28

315

GeneralGlossary

control plane routing


partofroutingthatconsistsofananalysisofcallcontrolrelatedparameters,previouscall
controlanalysis,andananalysisofthereceivedcalledpartynumber

control plane traffic


trafficthatconsistsofSIGTRANprotocolandsessioninitiationprotocol(SIP)based
communicationbywhichtheconnectionprocessingserver(CPS)controlsthegateway's
functions

control register
registerthattheoperatingsystemusestospecifyandmonitorbasicfunctionsof
processorbehaviour

control unit; CU
partofthebasestationthatprovides,forexample,thestartandstopofatransmitterand
faultindication

control unit
deviceorprogramblockengagedincallcontrol

control unit measurement; control unit traffic measurement


partoftrafficmeasurementthatproducesinformationonthetraffichandledbydifferent
controlunits

control unit measurement report


measurementreportthatshowsthenumberandtypeofcallsorcallattemptsthatare
controlledbyeachcontrolunitduringtheresultsaccumulationperiod

control word
numericalvaluethechangeofwhichchangesthefrequencyoftheoscillator

convenience library
librarythatimplementsawrapperforanintegrationreferencepoint(IRP)oran
integrationinterface

conventional database
databasethatcanhandleonlytextandnumericalvalues,andthatprovidesquery
functionsbasedonstringmatchingandnumericalvaluecomparison

316

Issue:28

GeneralGlossary

conventional hunting
huntingthatalwaysstartswiththefirstmemberandthenprogressesinafixedorderto
theendofthehuntinggroup,unlessafreememberisfound

converged SDP
sessiondescriptionthatiscontainedintheSDPofferorSDPanswerthattheSIP
applicationlayergatewaygeneratesbasedonasubscriber'sneedsandthecontribution
ofamediaproxy

convergence
comingtogetheroftwoormoredisparatedisciplinesortechnologies

convergence sublayer; CS
service-dependentpartoftheATMadaptationlayer,thatconvertsbetweenATMand
non-ATMformats

convergent charging; convergent charging service


chargingthatsupportsalloperatorservicesandchargingplansfortheentirecustomer
base,irrespectiveofthemethodofpayment

convergent charging server; CCS


chargingserverthatprovidesservicecreationandexecutioncapabilitiesandsubscriber
accountsforconvergentcharging

convergent mediation engine; CME; mediation engine


partoftheconvergentchargingserverthatprovidesflexiblemediationforonlineand
offlinedataprocessingwithasetofdataprocessingandinterfacecapabilities

conversational class; conversational RT


qualityofserviceclassforreal-time(RT)conversationcharacterisedbylowtransfer
delayandpreservedtimevariationbetweeninformationentities,forexamplepackets,of
thestream

conversational service
interactiveservicewhichprovidesforbidirectionalcommunicationbymeansofreal-time
(notstore-and-forward)end-to-endinformationtransferfromusertouser

conversation phase; speech phase


callphasewhichstartsafterthecallisanswered

Issue:28

317

GeneralGlossary

conversation state
statethatexistsinatelephonenetworkwhenacalledsubscriberhasrespondedtoa
callingsignal,andacircuitismadetoenableaconversationtotakeplace

conversation time
thatpartofaseizuretimewhichcanbeusedforconversation

conversion program
applicationthatisusedforrunningfileconversionsduringsoftwareupdates

convert
changepresentationmodewithoutchanginginformationcontent

convolutional code; CC
error-correctingcodethatisgeneratedbyfinite-fielddivisionofthedatasequence,
regardedasapolynomialoverafinitefield,byageneratorpolynomial

convolutional turbo coding; CTC


channelcodingthatusesparallelconcatenationfortworecursivesystematic
convolutionalcodesthatareseparatedbyanon-uniforminterleaver

cookie
auxiliaryfilewhichcontainsidentificationandpersonalisationdatatobeusedinthe
controloftheconnectionbetweenthebrowserandtheserver

cookie acknowledgement; COOKIE ACK


datachunkwhichisusedtoacknowledgethereceptionofacookieecho

cookie echo; COOKIE ECHO


datachunkwhichtheinitiatorofanSCTPassociationsendstoitspeertocompletethe
initialisationprocess

co-operative multitasking
multitaskingmethodinwhichaco-routineregularlytransferscontroltootherco-routines
toallowthemtoreceiveexecutiontime

318

Issue:28

GeneralGlossary

coordinated multipoint transmission; CoMP


transmissionmethodinwhichthereceptionoftransmissionfromdifferentcellsorsectors
istightlycoordinatedwhichresultsinhighersystemcapacityandimproveddataratesat
thecelledge

co-ordinator; coordinator
specialdatabasenodetowhichthesubtransactionssendtheirdecisionaboutabortingor
committingtothedatabasetransaction

coprocessor
additionalprocessorwhichtakescareofspecifictasks,theobjectivebeingtoreducethe
loadonthemaincentralprocessingunit(CPU)

COPS client
DMXprocessfamilythatimplementsCOPS-PRinanetworkelement

COPS-PR
commonopenpolicyserviceprotocol(COPS)forthesupportofpolicyprovisioning(PR)
whichisindependentofthetypeofpolicybutfocusesonthemechanismsand
conventionsusedtocommunicatetheinformationbetweenpolicydecisionpoints(PDP)
andpolicyenforcementpoints(PEP)

COPS server
serverapplicationinthepolicydecisionpoint(PDP)whichhandlesallCOPSprotocol
relatedcommunicationwithaparticularpolicyenforcementpoint(PEP)

copying
operationinwhichthecontentofamemoryfileorpartofitisfetchedfromadiskfileor
fromamemoryfile

CORBA naming service; CNS


CommonObjectRequestBrokerArchitecture(CORBA)servicethatprovidestheability
toassociateanamewithanobjectreference,andsoallowstheuserstolocateobjects
inasystemusingcommonnamesthatareboundtotheobjects

core; fibre core /GB/; fiber core /US/


centralregionofanopticalfibrethroughwhichtheopticalpoweristransmitted

Issue:28

319

GeneralGlossary

core adaptation
preinstalledadaptationmetadatathatintroducestheOpenEMSSuitebuilt-inconcepts,
suchasmanagedobjects,networkresources,andmaintenanceregions,thatcanbe
usedbyotheradaptations

core business entity; CBE


entitythatrepresentsthebasicconceptspresentintheday-to-dayrunningofevery
enterprise

core business entity model; CBE model


subsetofthesharedinformationanddatamodel(SID)thatisbasedontheneedsofthe
existingOSSthroughJavainitiative(OSS/J)applicationprogramminginterfaces(API)

core driver
devicedriverlocatedintheboardsupportpackage(BSP)

core gateway
primaryroutersintheinternet

core group
logicalprocessingentitythatincludesatleastoneprocessorcoreandthatrepresentsa
logicaldivisionoftasksthatareexecutedparallelly

core integration services


applicationservicesgearedtowardsprovidingtheintegrationframeworkforaservice

core intelligent network application protocol; core INAP


intelligentnetworkapplicationprotocolusedbetweentheserviceswitchingpoint(SSP)
andtheservicecontrolpoint(SCP)toachievemaximumopenness

core network; CN
combinationofexchangesandthebasictransmissionequipmentwhichtogetherform
thebasisfornetworkservices

core service
NEMUservicethatbelongstothecollectionofservicesofferedbycommoncore

320

Issue:28

GeneralGlossary

core site
sitecontainingtheequipmentofthemobilecorenetwork

core unit
unitthatisrequiredforinter-computermessaging

co-routine
programvoluntarilygivingturntootherco-operatingprograms

corporate code
codewhichreferstoacorporation

corporate code group


combinationofthecorporatecodeandtheassociatedserviceprovider(SP)andnetwork
codes

corporate personalisation
personalisationallowingacorporatecustomertopersonalisemobilestations(MS)that
theyprovidefortheiremployees'orcustomers'usesothattheMScanonlybeusedwith
thecompany'sownSIM

corporate virtual private network; corporate VPN


severalvirtualprivatenetworks(VPN)combinedusingthePSTNnetwork

correction delivery
softwareupdatewhichconsistsofchosencorrectionstofaults

correction factor
inpropagationmodels,afactorusedforcalculatingattenuationtocompensatefor
differencesintopographyandmorphography

correction release ; correction


releasethatcontainsonlycorrectionsorperformanceimprovementstoanexisting
productbutnonewfeatures

Issue:28

321

GeneralGlossary

correction software build; correction build; correction SW build


softwarebuildthatconsistsofchosencorrectionstofaultsandthatisusedwhenfaults
arecorrectedtoawholesoftwarebuild

correction update
updateusedtorepairfaultsthathavebeendetected,butnonewfeaturesareintroduced
andnetworkelementsfunctionasbeforewithinterfacesunaltered

corrective maintenance; repair


thatpartofmaintenancecarriedoutafterfaultrecognitionandintendedtorestorean
itemtoastateinwhichitcanperformitsrequiredfunction

correlated notification
notificationwhichindicatesthecorrespondingalarminthecancelmessage

correlation
interdependenceofparameters

correlation data
datathatisstoredinaPoCregisterandthatindicatestherelationbetweendifferent
authorisationserversandusers,groups,andfoldersinaPoCsystem

correlation function; CF
functionwhichisresponsibleforproducingchargingdataaboutasinglesessionbased
onchargingdatafromdifferentsources

correlation ID
signallingparameterthattheservicecontrolfunctionusesforcorrelationwithaprevious
connection

correspondent (N)-entities
entitiesofalayerwithanextlowerlayerconnectionbetweenthem

corruption
harmfulchangingofthecontentsofthemainmemoryorafileasaresultofa
programmingmistake,virus,orphysicalfault

322

Issue:28

GeneralGlossary

corruption detection
techniquefordetectingcorruptedinformationinordertoensuretheintegrityofthe
information

co-shopping
practiceusedinelectroniccommerceinwhichthepricedecreasesgraduallywhen
certainamountofpurchaserssendtheirparticipationinagiventime

co-siting
locatingnetworkequipmentwhichfunctionsondifferentfrequencybandsononesite

COST-231-Walfisch-Ikegami model
propagationmodelthatisextendedfromtheWalfisch-Ikegamimodelandusedinanonline-of-sightsituationwhentheantennaofthetransmitterisbelowtherooftopsofthe
surroundingbuildingsandthetransmittingwaveistravellingthroughstreetcanyonsand
notovertherooftopsasassumedintheoriginalWalfisch-Ikegamimodel

cost control
methodoflimitingthecostofaprepaidcallbyenteringacodetotheendofthedialled
numberbeforethecallisconnected

co-unit
memberofacomputerpair

count
partofalarmcorrelationwhereanewalarmisgeneratedwheneverapre-specified
numberofadefinedalarmhasbeenreceivedwithinacertaintimeframe

count-down
countingmethodwherethevalueofacounterisrepeatedlyreducedbyoneconstant
fromthemaximumtotheminimum

countdown value; CV
headerfieldthatthemobileterminalsendsineachuplinkradiolinkcontrol(RLC)data
blocktoindicatetothenetworktheabsoluteblocksequencenumber(BSN)ofthelast
RLCdatablockthatwillbesentintheuplinktemporaryblockflow(TBF)

counter
registerwhichisincrementedordecrementedeachtimeaneventoccurs

Issue:28

323

GeneralGlossary

counter alarm
alarmthatindicatesthatacertainthresholdhasbeenexceeded

counter mode; CTR mode


modeofencryptioninwhichanarbitrarynumberisusedasacounterthatchangeswith
eachblockoftextbeingencrypted

counterpart; partner program block


nameforaprocesswhenitcommunicateswithanMMLprogramthroughmessage
interchange

counter reading
readingthatismainlyusedinstatisticsandforaccountingpurposes,suchasbalancing
theaccountsbetweennetworkoperators

counter set
groupofcounterswithauniquenumberidentifyingtheenvironmenttowhichthe
countersbelong

country code; CC; international access code


combinationofone,twoorthreedigitscharacterisingthecalledcountry

country direct
telecommunicationserviceforreservingareserverchargecallcollectcallfromthe
operatorofthecountrywhichiscalled

coupling
signallingconnectioncontrolpart(SCCP)functionwhichprovidesanassociation
betweenconnectionsectionsatarelaypoint

coupling
measureoftheinterdependenceamongmodulesinacomputerprogram

coverage area; network coverage


areathatiseffectivelyservedbyagivenradiotransmitter

324

Issue:28

GeneralGlossary

coverage-based cell reselection


inter-systemnetwork-controlledcellreselectionthatthebasestationcontrollerinitiates
whenaWCDMAcellbecomesavailableorwhenGSMcoverageends

coverage building; coverage phase


operationalphaseinwhichanetworkoperatorbuildstheinitialcoverageofanetwork

CPCS protocol data unit; CPCS-PDU; common part convergence sublayerprotocol data unit
protocoldataunitwhosepayloadconsistsofacommonpartconvergencesublayerservicedataunit(CPCS-SDU)

CPCS service data unit; CPCS-SDU; common part convergence sublayerservice data unit
protocoldataunittobedeliveredtothereceivingATMadaptationlayer(AAL)bythe
destinationcommonpartconvergencesublayer

CPL script
scriptthatiswritteninthecallprocessinglanguage(CPL)andthatdescribesaparticular
setofservices

C programming language; C
general-purposecompiledprogramminglanguagethatisespeciallysuitableforsystems
programmingandthatwasoriginallydevelopedbyDennisRitchieandBrianKernighan
attheAT&TBellLaboratories

C++ programming language; C++


general-purposeprogramminglanguagewithabiastowardssystemsprogrammingthat
supportsproceduralprogramming,dataabstraction,object-orientedprogramming,and
genericprogramming

CPS charging record; CPS CDR; C-CDR; call processing server - call detail
record
chargingrecordthatisgeneratedbytheconnectionprocessingserver(CPS)

CPS/HSS statistics
featurethatdescribesthecall-relatedperformancemanagementsystemofthe
connectionprocessingserver(CPS)bydefiningtheitemsthataremeasuredintheCPS
andinthehomesubscriberserver(HSS)

Issue:28

325

GeneralGlossary

CPS service data unit; CPS-SDU; common part sublayer service data unit
servicedataunitthatistransferredfromonecommonpartsublayer(CPS)userto
anotherthroughtheATMnetwork

CPU node
physicalentitythatconsistsofoneormorecentralprocessingunits(CPU)

CPU-time
amountoftimeneededtoexecuteasetofinstructionsinthecentralprocessingunit
(CPU)

cracking program
programthatisusedforthedatasystembreak-in

crankback
mechanismforpartiallyreleasingaconnectionset-upinprogressthathasencountereda
failureandallowingtheprivatenetwork-networkinterface(PNNI)toperformalternate
routing

crash
situationwherethesystembecomesinoperativeduetoahardwareorsoftware
malfunction

crash information; crash-dump information


informationthatisstoredbeforethesystemfails

CRC-32
algorithmforcalculatingacyclicredundancycheckvalueof32bitsandusedtoverifythe
correctnessofuncompresseddata

create request; create


actioncausingthecreationandstartingofanewprocessinstanceofaspecifiedprocess
type

creation of a connection description


creationofaconnectionbetweenthefunctionalplug-inunitandtheswitchingnetwork
andthedescriptionofthisconnectioninthefilesanddatabases

326

Issue:28

GeneralGlossary

creation of an equipment description


storingofthedataconcerningracks,subracks,functionalunits,andplug-inunitsintothe
equipmentdatabasebymeansofMMLcommands

creation of subscriber; subscriber creation


creationofsubscribermeansgivinganoperationalcommandwhichinformsthesystem
thatasubscriberisconnectedtotheexchange

credential access; credential service


servicethatprovidesapplicationswithcredentialstoaccessnetworkelementsand
certainsystemservices

credentials; access key; user credentials


authenticationinformationwhichidentifiestheuser

credit
servicespecificconnectionorientedprotocol(SSCOP)parameterusedtoco-ordinate
notificationstolayermanagement

credit-based flow control; CFC


methodoflimitingtherateoftransactionrequestssenttoareceiveraccordingtothe
amountofcreditunitsgivenbythereceiver

credit-based flow control gate; CFC gate


partofthetransactionprocessingsoftwarewhichimplementsthecredit-basedflow
control(CFC)forcontrollingtheflowrateofthetransactions

credit card call; CCC


callpaidwithacreditcard

credit card recharging interface; credit card recharging IF


interfacetoavalidationserverusedtoverifythesuppliedcreditcarddetailsaftera
rechargewithcreditcard

credit control; bill limitation


methodtolimittheaccumulatedchargesbasedonanagreementbetweentheservice
providerandthesubscriberwhichstatesthatincaseacertainlimitisexceeded,the
serviceproviderwillnotallowanymorecallswhichincreasethecharges

Issue:28

327

GeneralGlossary

Credit-Control-Answer message; CCA; credit control answer


Diametermessagethatisusedbetweenthecredit-controlserverandtheDiameter
credit-controlclienttoacknowledgeaCredit-Control-Requestmessage

Credit-Control-Request message; CCR; credit control request


DiametermessagethatisusedbetweentheDiametercredit-controlclientandthecreditcontrolservertorequestcreditauthorisationforagivenservice

CreditExpired state
statethattheprepaidsubscriberenterswhenthecreditexpiresmakingitimpossibleto
makeorreceivechargedcalls

credit expiry
prepaidexpirythatdefinesacertaintimeperiodwhenthesubscribercanusethemoney
fromtheprepaidaccount

credit expiry date


datewhenthecreditofaprepaidaccountisnolongervalid

credit limit
predefinedmaximumamountofthesubscriber'stelephonebill

C reference point; C interface


interfacebetweenthemobileservicesswitchingcentre(MSC)andthehomesubscriber
server(HSS)

critical actor
actorthatisessentialtoaunitsothatifitisdetectedasfaultyorfailstostart,thewhole
unitneedstobereset

critical DMX family; critical family


processfamilythatisessentialtoaDMXunitsothatifitisdetectedasfaultyorfailsto
start,thewholeunitneedstobereset

critical error log


logthatrecordsinformationaboutseriousmalfunctionsthatpreventtheapplicationfrom
operating

328

Issue:28

GeneralGlossary

critical event
eventthatendangerscontinuedsuccessfuloperationandrequiresimmediateattention

criticality diagnostics
informationelementthattheradionetworkcontrollersendstothecorenetworkifpartsof
areceivedmessagecannotbeinterpretedoraremissing,orifthemessagecontains
logicalerrors

critical limit
security-counter-specificlimittheexceedingofwhichwithinasupervisionperiodcauses
analarmandoutputofacounterreport

critical resource
resourceintheexchangewhichdifferentdiagnosticjobscannotusesimultaneously,but
oneatatime

critical state
stateofanitemassessedtoresultininjurytopersonsorsignificantmaterialdamage

CRL distribution point


directoryentryorotherdistributionsourceforacertificaterevocationlist(CRL)

CRMS-b interface; CRMS-b


terrestrialinterfacebetweenacommonresourcemanagementserver(CRMS)andIP
basestation(IP-BTS)

CRMS identifier; CRMS ID


identifierofacommonresourcemanagementserver(CRMS)thatisuniqueinthewhole
network

CRMS-p interface; CRMS-p


terrestrialinterfacebetweentwocommonresourcemanagementservers(CRMS)

cron
UNIXcommandforschedulingjobstobeexecutedinthefuture

Issue:28

329

GeneralGlossary

crontab; cron table


filethatcontainsaschedulethatspecifieswhenthecronentriesarerun

cross-certification
authenticationinwhichacertificationauthorityissuesasecuritycertificatetoanother
certificationauthoritythatisnotadjacenttoitinahierarchy

cross-compiler; cross compiler; cross-assembler


compilerthatgeneratesobjectcodeforexecutiononadifferentcomputerthanthatin
whichitisrunning

cross-connection; CC
fixedorflexibleconnectionbetweentwoterminationpointswiththesamedatarate

cross-connection granularity; granularity


bitrateatwhichacross-connectionismade

cross-connection table; cross-connection bank


informationbasewhichdefinesthecross-connectionsofanetworkelement

cross-connector; digital cross-connector


transmissionequipmentthatactsasanautomateddistributionframeallowingthetraffic
tobesortedandroutedonasemipermanentbasisunderlocalorremotecomputer
control

crossed media dependent interface; MDIX


mediadependentinterface(MDI)portonahubthathasaninternalcrossoversignal

cross-fleeting
extendingaclosedusergroupwithpre-configuredsettingsbetweendifferent
organisations

crosslink
connectionbetweenportsoftwoswitchesthatareonthesamelevel

cross-office check; cross-exchange check


checkmadeacrosstheexchangetoverifythatanacceptablespeechpathexists

330

Issue:28

GeneralGlossary

cross-office delay; cross-office transit delay


timetakenforamessagetopassthroughanexchange

cross-polarisation discrimination /GB/ ; cross-polarization discrimination


/US/; XPD; cross-polarisation decoupling /GB/; cross-polarisation isolation
/GB/; cross-polar discrimination; cross-polarization decoupling /US/;
cross-polarization isolation /US/
antennaperformancecriteriondescribingtheabilityofanantennatoradiateandreceive
electromagneticwavesofaspecifiedpolarisation

cross-polarised antenna; X-polarised antenna


antennathatallowsdiversitytobeimplementedinthesameantennabyplacingthemain
anddiversitydipolesata45degreeangletoeachother

cross-polarised signal /GB/ ; cross-polarized signal /US/


linearlypolarisedelectromagneticradiation,thepolarisationlevelofwhichis90degrees
higherorlowerthanthatoftheotherlinearlypolarisedradiation,whichpropagatesinthe
samedirection

cross-service bundling
bundlingwhereasetofdifferentservicesisofferedtoasubscriberasapackageata
certainprice

crosstalk
unwantedtransferofenergyfromacircuitknownasthedisturbingcircuitintoanother
circuitknownasthedisturbedcircuit

cryptanalysis
analysisofacryptographicsystemoritsinputsandoutputstoderiveconfidential
variablesorinformation

cryptographic algorithm; encryption algorithm; encipherment algorithm


algorithmthatisusedforenciphermentanddeciphermentinacryptographicsystem

cryptographic key; key


setofsymbolsusedwithanencryptionalgorithmforprotectingeithertheconfidentiality
orintegrityofdata

Issue:28

331

GeneralGlossary

cryptographic key element


datastructurewhichcontainsallinformationrelatedtoacryptographickey

cryptographic library; crypto library


librarythatcontainsimplementationsofcryptographicalgorithms

Cryptographic Message Syntax; PKCS#7; Cryptographic Message Syntax


Standard
syntaxthatisappliedtodatatoenablecryptographyunderapublickeyinfrastructure
(PKI)

cryptographic system
system,whichisusedinenciphermentanddecipherment

cryptography
disciplinethatembodiesprinciples,means,andmethodsforthetransformationofdatato
hideitsinformationcontent,confirmitsintegrity,andpreventunauthoriseduse

crypto platform
featurethatprovidesasecureplatformforimplementingdifferentdataprotection
methodsinDX200networkelements

CSCF discovery procedure; CSCF discovery


procedurethatisperformedtofindoutthecorrectservingcallstatecontrolfunction
(CSCF)

CS fallback; CSFB; circuit-switched fallback


functionthatswitchesavoicecallandothercircuit-switchedservicesfromtheevolved
UTRANtothecircuit-switcheddomain

CS-MGW; circuit-switched media gateway


multimediagateway(MGW)whichterminatesbearerchannelsfromaswitchedcircuit
networkandmediastreamsfromapacket-switchednetwork

CSN-anchored mobility
inaWiMAXsystem,mobilitythatallowsthepointofattachmentofamobileterminalto
bechangedwithinaconnectivityservicenetwork(CSN)

332

Issue:28

GeneralGlossary

CSRC list
listofsynchronisationsource(SSRC)identifiersthattheRTPmixercreatesfor
identifyingthecontributingsources(CSRC)ofthepayloadcontainedinapacket

CSV file; comma-separated values file


filewhichisusedtocollectdatafromatabletoanothertable-orientedapplicationin
comma-separatedvalues(CSV)format

CS voice over HSPA


featurewithwhichspectralefficientHSPAtransportchannelsareusedforcircuitswitched(CS)voicetraffic

CTM adaptor; CTM adapter


functionwhichtransformsthereceivedITU-TV.18texttelephone(TTY)signallingtothe
cellulartexttelephonemodem(CTM)TTYsignallingandviceversa

CTM receiver
partofcellulartexttelephonemodem(CTM)thatdecodesthereceivedaudiosignalinto
texttelephone(TTY)characters

CTM signal
audiosignalwhichthecellulartexttelephonemodem(CTM)createsandwhichcanbe
transmittedintotheanaloguedomainorcodedintoPCMsamples

CTM text transport package


packagewhichisanextensiontoH.248protocolsanddefinesamechanismtotransport
real-timetextconversationthroughavoicechannelovermobilenetworksusingacellular
texttelephonemodem(CTM)

CTM transmitter
partofthecellulartexttelephonemodem(CTM)thattransformsthetexttelephone(TTY)
charactersintoanaudiosignalthatcanbetransmittedrobustlyviathespeechcodec
andtheradiotransmissionpathofcellularphonesystems

CTS analysis; analysis tree dialling analysis; CM tree selection analysis


internalcallcontrolanalysiswhichcanbeusedtochangetheanalysistree

Issue:28

333

GeneralGlossary

CUG/CF check
actionwhichistakenbythevisitorlocationregister(VLR)andhomelocationregister
(HLR)whendeterminingwhethercallforwarding(CF)isallowedwiththecloseduser
group(CUG)parametersoftheoriginatingandforwardingsubcriberssuppliedtothem

CUG index; CI
indexthatthecallinguserusestoselectaparticularclosedusergroup(CUG)when
originatingacall

CUG subscriber
userwhohassubscribedtoaclosedusergroup(CUG)

CUG with incoming access; IA; c+i; incoming access


accessarrangementwhichallowsamemberofaclosedusergroup(CUG)toreceive
callsfromoutsidetheCUG

CUG with outgoing access; OA; c+o; outgoing access


accessarrangementwhichallowsamemberofaclosedusergroup(CUG)toestablish
callsoutsidetheCUG

cumulative counter
counterwhichisincrementeduntilthemaximumvalueisreachedafterwhichitcontinues
fromzero

cumulative measurement
measurementthatincludesallthemeasurementvaluesaccumulatedsincethestart-up
ofthestatisticalcompilation

cumulative usage-based charging


charginginwhichthechargingdataiscollectedintointermediaterecordsovera24-hour
periodoraccordingtoanumericthreshold

current call meter; CCM


informationstoredinsidethemobileterminalaboutthenumberunitsusedforacurrently
ongoingcallorforthelastcallmade

current cell rate; CCR


fieldinresourcemanagement(RM)cellsetbythesourcetoaspecificallowedcellrate
(ACR)whengeneratingaforwardRMcell

334

Issue:28

GeneralGlossary

current counter
valuethatrepresentsthecurrentsituationofameasuredeventinanetworkelement

current directory
directoryoftheoperatingsysteminwhichtheuserisatthemoment,andwhichis
automaticallythetargetofthecommandsusedunlesstheyhaveadirectoryattribute

current load counter


statisticalcounterthatcalculatesthecurrentserverload,andwhichisupdatedeveryten
seconds

current location
locationestimateoftheuserequipmentwithatimestampassociatedatacertainpointof
time

current security context; CSC


cipheringandintegritykeysetwiththesetidentifier

current serving BS
BSwhoseonechannel(TCH,DCCH,orCCC)theMSiscurrentlyoperatingon

custom backup
backupthatallowstheusertochoosetheitemstobeincludedinbackupcopying

customer access point


genericnetworkelementthatrepresentstheequipmentlocatedatthecustomer's
premisesthroughwhichacustomerisconnectedtothenetwork

customer care and billing system; CCBS; CCB; customer care and billing
networkoperator'ssystemthatgatherstogetherthechargingrecord(CDR)information
sentthroughthebillinginterface,forexamplebyacharginggateway,tobeusedinthe
billingofthecustomer

customer care system


systemthroughwhichoperatorsandserviceprovidersmanagetheservicesofferedto
theircustomers

Issue:28

335

GeneralGlossary

customer extension set indicator


triggerdataindicatingthatdifferentcustomerspecialitiesareallowed

customer-facing service; CFS


serviceseenbythecustomerthatcanbepublishedonapublishingorprovisioning
system

customer form
formthatdescribesthestructureofoneCDR(chargingrecord)orreport

customer format file; customer form file


formatfilethatdescribesthestructureofrecords,forexample,thestructureofa
chargingrecord(CDR)

customer life process; CLP


processtoevaluatehowcustomersusetechnologiesthroughouttheirentirelife

customer management
processformaintainingcomprehensivecustomeradministrationinformationinasingle
customerdatabase

customer premises equipment; CPE


terminalequipmentlocatedatthepremisesownedorcontrolledbythecustomerusing
networkservices

customer profile management; CPM


INservicefeaturewhichallowsasubscribertomanagehisserviceprofile,thatis,
terminationdestinations,announcementstobeplayedorcalldistributioninrealtime

customer reporting interface


interfaceusedtocreatereportsofprepaidsubscribersandtheiraccounts

customer service representative; CSR


personwhoisresponsibleforcustomercontactsintheserviceproviderornetwork
operatororganisation

336

Issue:28

GeneralGlossary

customer VLAN; C-VLAN


dedicatedvirtuallocalareanetwork(VLAN)thatcarriesthetrafficofaspecified
subscriber

customisable business logic /GB/ ; customizable business logic /US/; CBL;


custom business logic
businesslogicthatisusedtoserveseveraltypesofnetworkaccessandservices,andto
adapttospecificoperatorrequirements

customisable service logic


servicelogicthatextendstheterminalmanagementserverwithasoftwaremodulethat
modifiesthesentsettingsbasedoninformationretrievedfromanexternaldatabase

customised applications for mobile network enhanced logic; CAMEL


networkarchitectureprovidingthemechanismstosupportINsupportedservicestoa
roamingsubscriber

customise dialogue /GB/ ; customize dialog /US/


dialogueofthegraphicaluserinterfaceinwhichtheusercandefinethecomponents
shownonthewindow

customised recorded announcement; CRA; customized recorded


announcement /US/
INservicefeaturewhichallowsacalltobecompletedtocustomisedterminating
announcementinsteadtosubscriberline

custom tag; JSP custom tag


JavaServerPages(JSP)mechanismthatallowstheencapsulationofdynamicfunctions
inobjectsthatareaccessedthroughextensionstotheJSP

cut
extracttextorapicturethroughtheclipboardforthepurposeoftransferringittosome
otherlocation

cut and paste


extractandrelocatetosomeotherlocation

Issue:28

337

GeneralGlossary

cutover
procedureinwhichthetrialsidestartstransmittingtrafficandoneunitfromeachunit
typeisleftontheoldside

cutover
deploymentinwhichtheswitchingcapacityismovedinstantaneouslyfromonesliceto
another

cutover phase
partofasoftwareupgradeinwhichthenewtrialsoftwarebuildiscommandedtotake
careoftheswitchingcapacity

cutover update; non-compatible SW update; non-compatible update


softwareupdatewhereinterfacesbetweencontrolprocessorschangesothatdifferent
softwarepackagescannottransmittraffictogether

Cx interface application part; CxAP; Cx application part


proprietaryprotocolwhichisderivedfromthemobileapplicationpart(MAP)andisused
inlocation,subscriberdata,androutingrelatedoperationsinthehomesubscriberserver
(HSS)

Cx reference point; Cx interface


interfacebetweenthecallstatecontrolfunction(CSCF)andhomesubscriberserver
(HSS),supportingthetransferofdatabetweenthem

cybercrime; network crime


crimethatutilisestheservicesorfeaturesofaninformationnetwork

cyberschool; virtual school


serviceoftheinformationnetworkwhichenablesinstructedstudyingandtheacquisition
ofstudyattainments

cybersquatting; domain name grabbing; domain name piracy


actionofregisteringaninternetaddressthatisthesameasotherorganisationsinternet
addressortrademark,orresemblesthat

cycle
completerangeofstatesorvaluesthroughwhichaphenomenonorperiodicfunction
passesbeforerepeatingitselfidentically

338

Issue:28

GeneralGlossary

cyclic buffer; ring buffer; circular buffer


buffermemorythatisreadandwritteninacyclicorder

cyclic delay diversity; CDD


delaydiversitythatisusedinorthogonalfrequency-divisionmultiplexing(OFDM)based
telecommunicationsystemstotransformspatialdiversityintofrequencydiversity,thus
avoidinginter-symbolinterference

cyclic hopping; cyclic frequency hopping


freuquencyhoppinginwhichfrequenciesareusedoneafteranotherinascendingorder

cyclic hunting
huntingthatstartsfromthecircuitafterthecircuit(orotherresource)whichwaslast
chosen,andthencontinuesinfixedorder

cyclic prefix; CP
insertedpartatthebeginningofeachorthogonalfrequency-divisionmultiplexing(OFDM)
symbolthatconsistsofaduplicationofthelastpartoftheOFDMsymbol

cyclic redundancy check; CRC


methodfordetectingerrorsinthetransmissionofdatausingapolynomialcodeand
cycliccheckcharacter

cyclic redundancy check 4; CRC-4; CRC4


cyclicredundancycheckusedonE1trunklinestoevaluateeachreceivedmultiframe

cyclic redundancy check 6; CRC-6; CRC6


cyclicredundancycheckusedonT1andJT1trunklinestoevaluateeachreceived
multiframe

cyclic redundancy check character; CRCC


characterofoneorseveralbytesaddedtoadatablocktocheckitsaccuracy

Issue:28

339

GeneralGlossary

6 D
daemon
independentprocesswithinthebackgroundprocess,carryingoutmaintenanceand
controlfunctionsusefulforoperatingorfilesystems

daisy chain
interconnectionofcomputerdevices,peripherals,ornetworknodesinseriesoneafter
another,withoutformingaloop

D-alarm
rackalarmindicatingthatanalarm(AorB)hasbeenacknowledgedbutthefaulthasnot
yetbeenrepaired

dangerousness class
divisionofcommandsbasedonhowdangeroustheyarewithregardtotheoperating
capacityofthesystem

DAP component
componentthatiscommontoallDiameterapplications

DAP downgrade procedure; dynamic Abis pool downgrade


procedureinwhichthebasestationcontroller(BSC)downgradesallpacket-switched
trafficchannelsfromthepacketcontrolunit

DAP upgrade procedure; dynamic Abis pool upgrade


procedureinwhichthebasestationcontroller(BSC)upgradesthetrafficchannelsfor
packet-switcheduse

dark fibre /GB/ ; dark fiber /US/; unused fibre /GB/; unused fiber /US/
fibre-opticconnectionthatisleasedwithoutanyactiveequipmentconnectedtoit,and
whoseentirecapacityisreservedforusebetweenitsterminalequipment

dark site
websitethathasbeencreatedtobepublishedinexceptionalcircumstances

340

Issue:28

GeneralGlossary

data access
intheOSSapplicationplatform,aservicethatconvertsgenericqueriesfortheselected
back-endsystem,executesthequeries,andreturnstheresultsinagenericformat

data access object; DAO


object-orientedapplicationprogramminginterface(API)thatisusedforaccessing
structuredquerylanguage(SQL)databases

data aggregation
processofcollectinginformationandexpressingitintheformofasummaryforanalytical
purposes

data and macro diversity processor group; DMPG


inaDataandMacroDiversityCombiningUnit(DMCU),agroupofprocessorsthat
containsthedistributedpartoftheDSPresourcemanagementfunction

database; DB
collectionofdatadescribingaspecifictargetareaandusedandupdatedbyoneormore
applications

database access control


partoftheNMSsystemsecuritywherethoseentitledtoaccessthenetwork
managementsystem(NMS)databasearedividedintouseraccountswithdifferent
privileges

database application
softwarethatimplementstheDX200databasedefinitions(logicalandphysicalstructure)
anddatabaseproceduredefinitions

database cleaner; database cleaning tool


softwarewhichdeletesoldentriesfromadatabase

database cluster
collectionofdatabasesthatisaccessiblethroughasingleinstanceofarunning
databaseserver

database connection supervision


supervisionoftheconnectionsfromtheworkstationtothedatabase

Issue:28

341

GeneralGlossary

database disk log; disk log


databaselogstoredonadisk

database disk updating


operationbywhichthelogbuffersaresavedtodisk,thecontentsofthelogbuffersare
updatedtothediskcopyofdatabase,thedatabasefromthediskisloadedtomemory,
andthedatabaseisdumpedfrommemorytodisk

database distributor in HSS


featurewhichdefinesaserviceforfindingacorrectdatabasedistributorunitwherethe
subscriberdataislocatedonthebasisoflogicalname,aserviceforaddinglogical
name/databaseunitpairinformationtothenewdistributeddatabase,andaservicefor
removingalogicalname/databaseunitpairfromthedistributeddatabase

database distributor unit; DBDU


computerunitthatdistributestothecorrectunitsubscriberrelateddatacomingfrom
eitherthenetworkoradministrativeunit

database failover node; DFN


designatedadaptiveservertowhichthedatabasepackageismovedifthedatabase
server(DS)fails

database fastread; fastread


databaseprocedurewhichdoesnotupdatethedatabase

database file
filewhichispartofthephysicalimplementationofadatabase

database fragment
partofadistributeddatabasewhichhasauniqueindexwithinacluster

database identification; db id
identifierforeachDX200databaseoccurrence

database implementation; database implementation specification


databaseproceduredefinitionthatspecifieswhichdatastructuresareusedtoimplement
theTDLdatabaseobjectsandwhichkindsofhelpstructuresspeedupaccessfromthe
database

342

Issue:28

GeneralGlossary

database local interface


interface,whichdatabaseapplicationprovidestoexecutedatabaseprocedures,usedto
accessadatabaseresidinginthesamephysicalunitastheapplication

database log
logintheformofsequentialfiletowhichdataonexecutedtransactionsisrecorded

database log item


inadatabaselog,theinformationthatdescribesonedatabaseupdate

database main copy; main copy of a database


databaseoccurrencewheretransactionsareexecuted

database management system; DBMS


generalsoftwaredesignedforthemanagementofadatabase

database manager
processfamilywhichimplementsthedatabasemanagementsystemserverandwhich
canalsobeusedtoexecutedatabaseproceduresusingthedatabaseapplication

database measurement
measurementwhichprovidesperformancedataabouttheregisterdatabasesfromthe
applicationpointofview

database node; DBN; DB node


noderepresentingthecomputerunitwherethedatabaseor,inthecaseofadistributed
database,partofitislocated

database occurrence; occurrence


databaseconstructedonthebasisofacertaindatabasedescriptionandagivenstorage
structurewithreservedphysicalstoragestructures

database occurrence number


numberidentifyingthedatabaseoccurrenceswithagivenname

Issue:28

343

GeneralGlossary

database procedure
operationsdirectedatadatabase,whichareprocedureswrittenintheTDLlanguage
andconsistofelementaryoperationswhichlogicallybelongtogether

database procedure execution request


messagefromtheapplicationtothedatabasewhichstartsthedatabasetransaction
executionprotocol

database procedure execution response; database procedure response


messagefromthedatabasetotheapplicationwhichendsthedatabasetransaction
executionprotocol

database query
querythatisusedtorequestinformationfromadatabase

database RAM log; RAM log; log buffer


databaseloginrandomaccessmemory(RAM)

database remote copy; remote copy


copyofadatabaselocatedinaremoteunit

database remote interface


interface,whichdatabaseapplicationprovidestoexecutedatabaseprocedures,used
whenthedatabaseandapplicationresideindifferentunitsorwhentheapplication
updatesthedatabase

database schema
descriptionofthelogicalstructureofadatabase

database server; DS
stand-aloneserverinalocalareanetworkthatholdsandmanagesthedatabase

database snapshot; snapshot; snap-shot


stateofadatabaseataparticularpointintime

database system; DBS


entityconsistingofadatabaseanditsmanagementsystem

344

Issue:28

GeneralGlossary

database transaction; transaction


databaseprocedurewhichtransformsadatabasefromoneconsistentstatetoanother

database transaction execution protocol


protocolwhichisusedbetweenanapplicationandthedatabaseandbetweenthe
differentdatabasenodestoexecuteadatabasetransaction

database transaction throughput


numberofdatabasetransactionexecutionsinaspecifiedtimeinterval

database type
logicaldatabasedescriptionwithauniquenametowhichseveralphysicalstorage
structurescanbedefined

database upgrade tool


Javaprogramthatallowstheusertocollect,format,andsaveinformationfromtheold
release'sdatabaseandtodistributeittothenewrelease'sdatabase

data bit; information bit


bitoriginatedbythedatasourceandnotusedforerrorcontrolbythedatatransmission
system

data block
blockwhichiscreatedbyaformattingprocessandsenttooperator'spost-processing
system

data boundary check


checkofadatavaluemadetoensurethatthevalueisinaccordancewithpredefined
requirements

data call
callinwhichtheinformationcarriedisinbinaryformat

data call measurement


network-element-specificmeasurementwhichcollectsinformationontheuseand
numberofdatacalls,andontheerrorsthatoccurindatacallsinamultimediagateway
(MGW)

Issue:28

345

GeneralGlossary

datacasting; datacast
broadcastingwhereadditionaldataissentwiththesignal

data channel; DC
channelusedfordatatransmission

data channel propagation time; Tp


periodwhichstartswhenthelastbitofthesignalunithasenteredthedatachannelat
thesendingsideandendswhenthelastbitofthesignalunitleavesthedatachannelat
thereceivingend,irrespectiveofwhetherthesignalunitisdisturbedornot

data check
serviceinterrogationwhichcomparesthedataenteredbyauserduringtheinterrogation
procedurewiththeinformationstoredinthenetwork

data checkpointing
mechanismbywhichtheapplicationstateistransmittedfromanactiveapplication
instancetooneormorestandbyinstances

data chunk; chunk


unitofinformationwithinastreamcontroltransportprotocol(SCTP)datagram,
consistingofaheaderandspecificcontents(userdata)

data circuit
combinationofdataprocessingnodesandconnectionsbetweenthem

data coding scheme; DCS


parameterwhichidentifiesthealphabetorcodingemployedfortheuserinformationand
messagehandlingatthemobilestation(MS)andispassedtransparentlyfromthecell
broadcastcentre(CBC)totheMS

data collection processor


communicationsdeviceservingasmediationequipmentinthetelecommunication
managementnetwork,whichprovidesconcentration,protocolconversionandoperations
functionssuchasaccumulationandthresholding.OneormoreNEsmaybeconnected
toeachphysicalport

346

Issue:28

GeneralGlossary

data collector; DC
functionthatcollectsthemeasureddatafromthenetworkelementandtransfersittothe
NetworkElementManagementUnit(NEMU)

data communication
telecommunicationswherecommunicationisdoneusingdataprocessedviacomputers

data communication function; DCF


functionprovidingthemeansfordatacommunicationtotransportinformationrelatedto
telecommunicationmanagementbetweentelecommunicationsmanagementnetwork
(TMN)functionblocks

data communication network; DCN; data transmission network; data


network
telecommunicationnetworkmainlymeantfordatatransmission

data communications channel; DCC


auxiliarychannelwithinsectionoverheadwhichisusedfornetworkmanagementrelated
communicationbetweenoperationssystemsandnetworkelements

data communications equipment; DCE


anyhardwareinvolvedinstartingacommunicationslink

data communication service; DaCS


servicewhichsupplementsthefunctionswhichtheTCP/IPstackoftheunderlyingrealtimeoperatingsystem(RTOS)provides

data compression; DC; compression


techniquethatsavesstoragespacebyreplacingdigitalcharacterstringswithshort
codes

data connection
connectionthatiscreatedfortransferringdata

data connection socket; DCS


socketwhichisanendpointforanFTPdataconnection

Issue:28

347

GeneralGlossary

data/control field; D/C; D/C field


fieldinthePacketDataConvergenceProtocolprotocoldataunit(PDCPPDU)that
indicatesiftheprotocoldataunitcontainsbothdataandcontrolinformation

data country code; DCC


ATMaddressformatthatspecifiesthecountryinwhichanaddressisregistered

data description
descriptionthatlinksthevariablesintheservicelogictotheirvaluesstoredinotherparts
ofthesystem

data description template


templatethatisusedforthecreationofthedatadescriptionsusedinserviceexecution

data dictionary
collectionofdatathatcontainsadministrativeinformationassociatedwiththedatabase,
itsstructure,andthedatawithin

Data Distribution Protocol; DDP


protocolthatprovidesafault-tolerantdatatransfermechanismoverIPnetworks

data download
mechanismtoinformtheDX200softwarerelatedtothepreviouslydownloadedfile
aboutanewfileoraversionofthefilesothatthefilemaybebroughtintouse

data exchange interface; DXI


networknodeinterfacebetweendataterminalequipmentandaspecialATMCSU/DSU
thatconvertsbetweenthevariable-lengthDXIframesandthefixed-lengthATMcells

data field
definedareainadatamediumormemory,whichisusedforstoringsomepieceofdata

data field element


radiolinkcontrolservicedataunitoritssegmentthatismappedtothedatafield

data file
datatypeloadmodule

348

Issue:28

GeneralGlossary

data flow; flow


identifiablestreamofdata

data flow indicator


indicatorwhichshowstherelativespeedatwhichdataistransferred

data form 1; DT1


messageusedinthesignallingconnectioncontrolpart(SCCP)connection-oriented
servicetotransferdata

data form 2; DT2


signallingconnectioncontrolpart(SCCP)messagethateitherendofasignalling
connectioncansendtopassSCCPuserdatatransparentlybetweentwonodes

datagram
independent,self-containedmessagethatissentoverthenetworkandwhosearrival,
arrivaltime,andcontentarenotguaranteed

datagram socket
socketthatmayconnectmultipletimestochangeitsassociationandthatmaydissolve
theassociationbyconnectingtoaninvalidaddress,suchasanulladdress

data haven
countryorregionwheremaintainingapersonregisterisnotrestrictedorcontrolled

data header
groupofselectableinformationfieldswhichausercanselectwiththeformfileeditorand
fillwithaformatterprocesswhichsavesthemtothebeginningofacreatedcharging
record(CDR)orreport

data independent
independentofthelogicalorphysicalstructureofdata

data integrity; integrity


characteristicofdatathatensuresthattheinformationhasnotbeenalteredordestroyed
inanunauthorisedmannerorbyaccident

Issue:28

349

GeneralGlossary

data interface; DI
asynchronousinterfaceusedtoextendtheQ1managementbusoveradatachannel
accessedthroughfreebitsoradedicatedframe

data interface unit; DIU; data unit


unitthatprovidesstandarduserdatainterfacesandconnectsthedatainterfacesignals
totheaggregatesignalsintheinternalconnectionbusesof,forexample,multiplex,
branching,ornodeequipment

data interface unit pool; DIU pool


datapoolthatconsistsofdatainterfaceunits(DIUs)andhandlesunrestricteddigital
information(UDI)callrequests

data item
setoflogicallyrelateddatatreatedasaunit

data link
ensembleofterminalinstallationsandtheinterconnectingnetworkoperatingina
particularmodethatpermitsinformationtobeexchanged

data link connection; DLC


connectionestablishedinthelinklayertoprovideforinformationexchangebetweentwo
ormoreserviceaccesspoints(SAP)

data link connection identifier; DLCI


identifierofadatalinkconnection(DLC),whichisuniquewithinonebearerchanneland
composedofnetworkservicevirtuallinkidentifierandthebearerchannelidentifier

data logging
intheOSSapplicationplatform,aservicethatstoresinformationonthebehaviourof
applications

data management
functionofcontrollingtheacquisition,analysis,storage,retrieval,anddistributionofdata

data management high availability services; data management HA services


partofdatamanagementwhichaimstoimprovetheavailabilityofdatastores,
supervisesdatabasesforanyerrors,andreportstheerrorstothealarmsystem

350

Issue:28

GeneralGlossary

data mediator
functionthatactsasanintermediatepartybetweenthenetworkelement'sdataproviders
andthedatacollector

data migration
processoftranslatingdatafromoneformattoanotherormovingdatafromonestorage
deviceorenvironmenttoanother

data model
structureusedfordescribingadatabase

data on the exchange's grade of service


partoffieldreportingwhichcontainsdataontheanswered,unanswered,andlostcalls
andareportoncallsterminatedinclearcodegroupsdefinedbytheuser

data origin authentication; origin authentication


authenticationthatverifiestheidentityoftheclaimedsourceofdata

data path function; DPF; DP function


functionthatmanagestheset-upofthebearerplanebetweentwopeers,includingthe
set-upoftunnelsandadditionalfunctionsthatmayberequiredforhandlingthebearer
plane

data PDU type


fieldintheIuuserplane(UP)protocoldataunit(PDU)indicatingthePDUtypethatis
usedfortransferringuserdata

data processing node; DPN; data node


nodeatwhichoneormoredataprocessingsystemsarelocated

data protection; privacy protection


partofdatasecuritywhichaimsatpreventingunauthorisedusageandseizureofdata

data protection key


lowerlevelcryptographickeyusedforprotectingsubscriberauthenticationkeys(Ki)and
otherdataitems

Issue:28

351

GeneralGlossary

data provider
functionthatcollectsstatisticalinformationfromthemultimediagateway(MGW)and
writesittoafile

data radio bearer; DRB


radiobearerthatisestablishedbetweentheevolvednodeBanduserequipmentto
transportuserplanedataonly

data radio bearer identifier; DRB ID


uniqueidentifierofadataradiobearer

data receiving
functionwhichforwardsdatareceivedbySAR(segmentationandreassemblysublayer)
onthereservedVCC(virtualchannelconnection)totheclientprocess

data record transfer request


messageusedincharginginthepacketswitchedcorenetwork(PS)domaintotransmit
chargingrecord(CDR)information

data record transfer response


messagesentasaresponsetoareceiveddatarecordtransferrequest

data recovery; data salvage; data salvaging


processofbringingdatafromadamageddatamediumbackintouse

data reporting system; DRS; data and reports system


systemthatintegratesdatafromvarioussourcesintoasinglerepository

data request
serviceinterrogationwhichenablesausertorequestthestoreddataforaparticular
serviceonitsnetworktermination

data restoration
processofcopyingdatafromabackupcopyorfromdeleteditemsandbringingitback
intouse

352

Issue:28

GeneralGlossary

data risk; information risk


threatofanincidencerelatedtodataortheirusewhich,ifittakesplace,causesdamage
orloss

data risk; information risk


totaleffectofthevulnerabilityofinformationorasystemandthethreatdirectedatthem,
whichresultsindamage,ifthethreatisrealised

data security
informationsecuritythatprotectsdatafrombothaccidentalandintentionalunauthorised
modification,destruction,anddisclosure

data sending
functionthatsendsdataviareservedvirtualchannelconnection

data service unit; DSU


functionalunitthatisusedfordatacommunicationservicesthroughthemobileservices
switchingcentre(MSC)

data service unit measurement


measurementthatgivesinformationaboutdatatrafficintensityfordifferentcalltypesand
dataserviceunits

data service unit measurement report


measurementreportthatindicatesthedatatrafficintensityfordifferentcalltypesand
dataserviceunits

data session denial


capabilitytodenyadatasessionwhenthesubscriber'saccountbalanceisnotsufficient
forservicedelivery

data signal
signalwhichconsistsofdataarrangedtorepresentinformationandwhichmayinclude
checkdigitsaddedtothedata

dataslot
partofrandomaccessmemory(RAM)intowhichthedatacollectedbydatacollecting
servicesisstored

Issue:28

353

GeneralGlossary

data source node


nodethatincludesareferencetoadatasourcefromwhichunderlyingobjectsare
fetched

data store management


cluster-widedatamanagementwhichconsistsoftakingandrestoringbackupcopiesand
managinginformationindatastores

data striping; RAID 0


segmentationoflogicallysequentialdata,suchasasinglefile,sothatsegmentscanbe
writtentomultiplephysicaldevicesinawaysimilartoround-robin

data structure
systemofrelationshipsbetweenitemsofdata

data subsystem
subsystemthatcontainsIMSandservicesubscriptiondataandservicedata

data synchronisation service /GB/ ; data synchronization service /US/


networkservicethatpermitsnetworkeddevicestoensurethatthelocaldataonthe
deviceisconsistentwiththenetworkdataononeormoreremotedatabasesconnected
tothenetworkservice

data system break-in; data trespass; cracking; hacking


enteringaprotectedinformationsystemorstudyingdatastoredinitwithoutauthorisation

data terminal equipment; DTE


pieceofequipmentownedbythesubscriberthatisconnectedtothenetwork:remote
terminalofadataprocessingsystem(forexample,aprinterorascreen)oracomputer

data tier
logicallayerofadistributedsystemthatgivestheapplicationsaccesstorequired
repositories

data tier
partoftheoperationssupportsystemsoftwareandhardwarethatconsistsofthedata
serversthathandlethetopology,relations,managedobjects,andattribute-relateddata

354

Issue:28

GeneralGlossary

data transfer process; DTP


processwhichestablishesandmanagesdataconnections

data transfer rate range; transfer rate range; data speed range
datatransmissionratevariationbetweenthemaximumandminimumvalues

data transmission; data transfer; transfer


datatransmissionwhichusescomputersortheirperipheralunitsasterminalequipment

data transmission rate; data transfer rate; transfer rate


averagenumberofbits,characters,orblocksperunittimepassingbetween
correspondingequipmentinadatatransmissionsystem

data type
definitionofadatastructurewhichhasanameandinaddition,itmaydefinearangeof
allowedvaluesandasetofoperatorsignatures

data type definition; DTD


definitionwhichdescribesadatatype

data upload
mechanismtonotifyexternalobjectsthatthereisafileintheDX200filesystemreadyto
beuploaded

data upload and download; DUD


featurewhichconsistsofuploadingvariousfilesfromDX200intoexternalsystem,and
downloadingconfigurationfilesfromexternalsystemintoDX200andtakingtheminto
useinacontrolledmanner

data user part; DUP


userpartspecifiedfordataservices

data volume based charging


chargingmethodwhichisbasedontheamountofcarrieddata

Issue:28

355

GeneralGlossary

data volume report procedure; data volume report


elementaryprocedurethatthecorenetworkusestorequesttheunsuccessfully
transmitteddownlinkdatavolumeforaspecificradioaccessbearer

data warehouse
databaseorcollectionofdatabasesforstoring,retrievingandmanaginglargeamounts
ofdata

DAXNode; dynamic access node


switch-independentaccessnode

day class
codespecifiedforeachcalendardayaccordingtowhichthechargeratechange
momentsareselected

day class group


setofdayclassesdefinedforeachdayoftheweek

dBr
electricalpowerdifference,expressedindecibels,betweenanypointandareference
pointselectedasthezerotransmissionlevelreferencepoint,usedtoexpressrelative
transmissionpowerlevels

D-bus
busofabasetransceiverstationthatisusedforserialdatatransmissionandthetransfer
ofcallsandcontrolsignalsrelatedtothecalls

D-bus allocation
allocationoftheBTStransmissioncapacityontheD-bus

D-channel; data channel


ISDNchannelusedforsignallingandothermessage-baseddatatransmission

D-channel link set


channellinksetformedbyD-channelsbetweentheentitiesofthelayer3communicating
witheachother

356

Issue:28

GeneralGlossary

D-channel system; DCS


systemwhichidentifiestheD-channelinsideonesignallingunit

DCN adapter
adapterthatfacilitatestheconnectionofQ1-managedequipmenttoupper-level
managementsystems

DCN interface
logicalinterfacethatprovidestransportfunctiontowardsdatacommunicationnetwork
(DCN)

DCN settings
settingsthatimplementthelogicalandphysicalconnectionsoftheexchangestodata
communicationnetworks(DCN)accordingtotheDCNplanningresults

DCP point; common part length


pointindicatingthelengthofthecommonpartofthein-diallingnumberandthegroup
callnumber

DDI part of the number


partofthenumberthatisformedbydigitsaftertheDCPpointandforwardedtothe
extension

deactivate (verb)
toremoveaservicefromanactivestate

deactivateSS
operationinwhichasupplementaryserviceistakenoutofanoperativestate

deactivation
processbywhichaserviceisremovedfromanactivestate

dead letter storage


mediationfunctionthatprovidesaspeciallocationformessagesthatcannotbedelivered
tothetargetsystem

Issue:28

357

GeneralGlossary

deadlock
errorconditioninwhichprocessingcannotcontinuebecausebothpartiesofaprocess
arewaitingforanactionbyorresponsefromeachother

dead peer detection; DPD


methodofusingInternetProtocolSecuritytrafficpatternstodetectanunavailable
InternetKeyExchange(IKE)peer

dead spot
geographiclocationwithinthecoverageareaofawirelessnetworkwhereradiosignals
cannotbereceived

deaf-aid telephone
specialtelephonedesignedforpeoplehavingimpairedhearing,whichcanbeusedfor
receptionandsendingoftext,aswellasvoice

debug (verb)
todetect,isolate,andcorrectamistakeinacomputerprogramorthecomputersystem
itself

debugger
programwhichassistsintestingandtracingerrorsinanapplicationprogram

debugger state
statethatacomputercanbesetintoaftertheinitialloadingandinwhichonlylimitedset
ofprogramsarestartedsothatonlythelocalcommandlanguageinterface(CLI)is
availablefordebuggingpurposes

decadic signalling /GB/ ; decadic signaling /US/


signallingmethodinwhichdiallingiscarriedoutinsignalswhichconsistofaseriesof
identicalpulsesandwhichcorrespondinnumbertothevalueofthedigititrepresents

decapsulation
SGSNfunctionwhichremovestheadditionaladdressingandcontrollinginformationfrom
theencapsulatedmessage(PDU)andrevealstheoriginaldataunit

decentralised control /GB/ ; decentralized control /US/


typeofcontrolofatelephoneexchangeinwhichthecontrolfunctionshavebeendivided
betweenseveralindependentdevices

358

Issue:28

GeneralGlossary

decimal position number; DP


seepositionnumber

decipherment; decryption
methodthatcancelsinformationtransformation(encipherment)

decision
actionwithinatransitionwhichasksaquestiontowhichtheanswercanbeobtainedat
thatinstantandaccordinglychoosesoneoftheseveraloutgoingtransitionsfromthe
decisiontocontinueinterpretation

decision circuit
circuitthatdecidestheprobablevalueofasignalelementofareceiveddigitalsignal

decision instant of a digital signal; decision instant


instantatwhichdecisionistakenastotheprobablevalueofasignalelementofa
receiveddigitalsignal

decision message; DEC; decision


messagewhichthepolicydecisionpoint(PDP)sendsasaresponsetoarequest
message(REQ)thatthepolicyenforcementpoint(PEP)hassent

decision object
variable-lengthdataobjectwhichcarriesadditionalstatelessinformationthatcanbe
appliedbythepolicyenforcementpointlocally

decision value
valuethatdefinestheboundarybetweenadjacentquantisingintervals

declarative SDL
partofspecificationanddescriptionlanguage(SDL)whichcontainstheblock,interface,
datatype,signal,andalarmdefinitions

decode (verb)
togeneratereconstructedsamples

Issue:28

359

GeneralGlossary

decoder
devicethatperformsdecoding

decoding
generationofreconstructedsamples

decompression
reversaloftheprocedureconductedbydatacompression

decryption function
functionthatisusedtodecrypttheencrypteddatawiththehelpofakey

dedicated alarm
alarmwhosenameindicatesthefailure

dedicated bearer; dedicated EPS bearer


EPSbearerthatisestablishedbetweentheuserequipmentandapacketdatanetwork
thatarealreadyconnectedbythedefaultbearer

dedicated control SAP; DC SAP


serviceaccesspoint(SAP)thatprovidesservicesintendedforspecificuserequipment

dedicated data channel; DDCH


datachannelorcircuitthatisreservedfortheuseofoneparticularsession

dedicated file; DF
filecontainingaccessconditionsand,optionally,elementaryfiles(EF)orotherdedicated
files(DF)

dedicated GPRS capacity; CDED


partofthedefaultGPRScapacitythatcanbereservedtotallyforgeneralpacketradio
service(GPRS)trafficandthatcanbeblockedaltogetherfromcircuit-switcheduse

dedicated GPRS resources


radiotime-slotsthatarepermanentlyreservedforGPRSuse

360

Issue:28

GeneralGlossary

dedicated IP address
IPaddressvisibletoexternalnetworkelementsandinternalnodes

dedicated medium access control; MAC-d; MACd; dedicated MAC; medium


access control d
mediumaccesscontrolthathandlesdedicatedtransportchannels

dedicated mode
transfermodeinwhichthemobileterminalhasacircuit-switchedconnectionandin
whichthemobileterminalisallocatedatleasttwodedicatedtrafficchannels,onlyoneof
thembeingaslowassociatedcontrolchannel

dedicated mode
operationalmodeofasoftware-definedradioinwhichitusesoneradiotechnologyata
timebutcanchangetoanotherradiotechnologybyusingsoftware

dedicated NBAP signalling entity


setofbasetransceiverstationorradionetworkcontrollerfunctionsresponsibleforthe
radiolinkmanagementforagroupofmobilestations

dedicated network; DNW


telecommunicationnetworkdedicatedforaspecialusergroup

dedicated physical channel; DPCH


physicalchannelwhichisassignedtoadedicatedconnectionbetweentheuser
equipmentandnetwork

dedicated physical control channel; DPCCH


dedicatedphysicalchannelwhichisusedtocarrycontrolinformationgeneratedatthe
physicallayer

dedicated physical data channel; DPDCH


dedicatedphysicalchannelwhichisusedtocarrythededicatedtransportchannel

dedicated port load-balancing service; LBSDP


load-balancingservicewhichdistributesincomingtrafficaccordingtothetargetport
numbers

Issue:28

361

GeneralGlossary

dedicated protection
protectionarchitecturewhosecapacityisusedbyoneentityonly

dedicated traffic channel; DCH; DTCH; dedicated channel


trafficchannelforusertrafficandsignalling

deduct request
requestthatissenttotheOnlineServiceController(OSC)tosubtractcreditfromthe
account

de-emphasis
establishmentofasignaltoitsoriginalformafterpre-emphasis

deep packet inspection; DPI


advancedmethodofpacketfilteringthatfunctionsattheapplicationlayerandisusedto
find,identify,classify,reroute,orblockpacketswithspecificdataorcodepayloadsthat
conventionalpacketfiltering,whichexaminesonlypacketheaders,cannotdetect

deep web; invisible web; hidden web; deepnet


partofthewebthatisnotvisiblefortheusersviasearchservices

default analysis
analysiswhichoffersauniformcalladdressinformationformattotheroutingand
charginganalysis(centralmemorydigitanalysis)

default as no NN flag; DNN


flagwhichindicatesthatthedefaultcallinglineidentity(CLI)isthenetworknumber(NN)
fornon-privatenumberingplan(PNP)calls

default bearer; default EPS bearer


EPSbearerthatisestablishedwhentheuserequipmentconnectstoapacketdata
networkandthatremainsestablishedthroughouttheconnectionlifetimetoprovidethe
userequipmentwithalways-onIPconnectivity

default CLI display qualifier; DDQ


qualifierusedforsettingtheCLIblockingindicator(CBI)andtheidentityqualifier(IQ)for
thedefaultcallinglineidentity(CLI)

362

Issue:28

GeneralGlossary

default codec
codecthatisusedonanestablishedlegwhennocodecnegotiationisperformed

default GPRS and EGPRS capacity; default (E)GPRS capacity


partoftheGPRSandEGPRSterritorythatthegeneralpacketradioservice(GPRS)and
enhancedGPRScanusewhenitisnotneededforcircuit-switchedtraffic

default IP multimedia handling; default handling


parameterthatindicateswhethertoabandonmatchingoflowerprioritytriggersandto
releasethedialogue,ortocontinuethedialogueandtriggermatching

default ISDN number


ISDNnumberwhichiscommonforallterminalsofabasicaccessinmultiplesubscriber
numbering(MSN)

default MSS
MSCserver(MSS)whichiscontactedbytheMSSswhodonothaveinformationof
multipleMSSsservinginthelocationarea

default output device


primaryoutputdeviceofalogicalfile

default PHB; DEF


per-hop-behaviour(PHB)thatisusedtoprovidethecommonbesteffortservice

default port
portwhichisautomaticallycreatedfortheactorbytheoperatingsystem

default preanalysis
diallingpreanalysisthatoffersauniformcalladdressinformationformattothedigit
analysisinthecentralmemory

default preferred inter-exchange carrier; DPIC


carrieridentificationcode(CIC)thatidentifiesthedefaultnetworkoperatorofapublic
landmobilenetwork(PLMN)tobeusedinalong-distancecall

Issue:28

363

GeneralGlossary

default preferred inter-exchange carrier locked; DPLOCK


PLMN-specificsettingthatcanbeusedtopreventroamingsubscribersfromselecting
thecarrieraccesscode

default profile; default user profile


userprofilethatisdefinedforthesystemintheconfigurationphaseoftheproduction
process

default result of subanalysis; subanalysis default result


analyticaldataachievedbypartialanalysiswhenacallcaserelatedvalueofanattribute
doesnotmatchavaluedefinedtopartialanalysisbytheoperator

default route
routingtableentrywhichisusedtodirectpacketsaddressedtonetworksnotexplicitly
listedintheroutingtable

default routing
routingwhichcanbeusedwhennormalroutingfails

default sequence list; DSL


listthatisusedasatemplateforcreatingacomponentsequencelist

default service number


servicenumberdefinedforacentrexanalogueorISDNphoneattendantwhichcontrols
servicenumber-specifichandlingofoutgoingtrafficfromtheoperator

default SMS IN information


informationthatconsistsoftheshortmessageservice(SMS)servicecontrolpoint
addressandtheservicekeyofmobile-originatedshortmessages

default software build; default SW build; default build


softwarebuildloadedtothecomputerunitsofanetworkelementininitialloadingand
whenthenetworkelementisrestarted

default value
valuegiventoaparameterintheabsenceofaspecificvalueinthecommand

364

Issue:28

GeneralGlossary

default version; disk version


versionofafileinadirectory,whichtheapplicationsnormallyuseforoperations

default zone
zonewhichisdefinedbythezonecodesstoredinthepubliclandmobilenetwork
(PLMN)parameters

deferred delivery
messagedeliveryinwhichthemessagerecipientdoesnotrequestamessagefromthe
messagingcentreimmediatelyafterreceivinganotificationofthemessagebutatalater
time

deferred location request


locationrequestforwhichanimmediateresponseisnotrequired

deficit weighted round robin; DWRR; deficit WRR


weightedroundrobinforpacketsinanATMnetwork,inwhichcertaincreditsare
allocatedtoeachqueue,andateachroundthequeueisservedifithasenoughcredits
fortransmittingthenextpacket

defined capacity
capacitythatisconfiguredtobeusableinamanagedobject

definition level
parameterthatisdefinedforthefunctionaldefinitionelements

deflected-to number; DTN


numbertowhichanincomingcallisredirectedwhenthenetworkacceptsacall
deflectionrequestfromtheservedsubscriber

degradation of performance
undesireddepartureintheoperationalperformanceofanydevice,equipmentorsystem
fromitsintendedperformance

degraded minute; DM
groupof60consecutiveseconds,afterexcludingseverelyerroredseconds(SES),with
anexcessivebiterrorratio(BIR)

Issue:28

365

GeneralGlossary

degraded service
servicethathasdegradedasaresultofanomaliesordefectsthatcauseadegradation,
butdonotresultintotalfailureoftheservice

delay class
qualityofserviceparameterdefinedforeachPDPcontext,whichspecifiestheend-toendtransferdelayincurredinthetransmissionofservicedataunitsthroughtheGPRS
networkornetworks

delay distortion; delay-frequency distortion


distortioncausedbydifferentpropagationspeedsofelectricsignalsinatransmission
mediumduetotheirdifferenceinfrequency

delay diversity; DD
transmissionmodeinwhichthecellcoverageareaisextendedbysendingthesame
radiotime-slotsorburst,withaslightdelay,simultaneouslythroughtwotransmittersand
antennas,regardlessofthelogicalchannel

delayed backward tunnelling ; delayed backward tunneling /US/


tunnellinginwhichbearercontrolinformationiscarriedinthefirstbackwardapplication
transportmechanism(APM)messageandsubsequentAPMmessages

delayed delivery
messagedeliverywhichisdelayedbasedonthemessagesendersindicationthatthe
messageshouldnotbedeliveredimmediatelybutonlyafteradefinedperiod

delayed forward tunnelling ; delayed forward tunneling /US/


tunnellinginwhichbearercontrolinformationiscarriedinapplicationtransport
mechanism(APM)messagesfollowingthefirstbackwardAPMmessage

delayed release message; DRS


signallingmessagesentineitherdirectonindicatingthatthecalledorcallingpartyhas
disconnectedbutthatthenetworkisholdingtheconnection

delayed TBF release; delayed downlink TBF release


TBFreleaseafterapredefineddelayperiod

366

Issue:28

GeneralGlossary

delay since last SR; DLSR


RTCPpacketfieldthatshowsthedelaybetweenreceivingthelastRTCPsenderreport
(SR)fromthesourceandsendingtheRTCPreceiverreport

delete request state message; DRQ; delete request state


COPSprotocolbasedmessagewhichthepolicyenforcementpoint(PEP)sendstothe
remotepolicydecisionpoint(PDP)toindicatethatthestateidentifiedbytheclient
handleisnolongeravailableorrelevant

DeleteSubscriberData operation; DSD; DeleteSubscriberData


operationthatthehomelocationregisterusestoinformthevisitorlocationregisterthata
servicehasbeenremovedfromthesubscriberprofile

deletion of subscriber
informationgiventothesystembyanoperationalcommandofthefactthatthe
subscriberisnolongerconnectedtotheexchange

delimiter
characterorstringusedtoseparate,ormarkthestartorendof,itemsofdata

delivered QoS; delivered quality of service


qualityofservicewhichisgrantedtoauser

deliverer
processofthepostofficewhichreceivesmessagesfromthebus

delivery acknowledgement
acknowledgementindicatingthesuccessfuldeliveryofanitem

delivery attribute
attributewhichisusedtosettheshortmessagehandlingmodeinthemessagedelivery
phaseinashortmessageservicecentre

delivery monitoring; RTCP delivery monitoring


end-to-enddeliveryservicewhichtheRTP/RTCPprotocolprovidesfordatawithrealtimecharacteristicstomeasurethepacketloss,throughput,androundtripdelay

Issue:28

367

GeneralGlossary

delivery of erroneous SDUs


qualityofserviceparameterindicatingwhethertheservicedataunits(SDUs)detectedas
erroneousshallbedeliveredordiscarded

delivery order
qualityofserviceparameterindicatingwhethertheUMTSbearershallprovideinsequenceservicedataunit(SDU)deliveryornot

delivery report; DR
responsefromthenetworkortherecipienttoamessagefromamessagingcentreora
mobilestation,whicheitherconfirmsthedeliveryofthemessage,orisafailurereport
thatinformstheoriginatorthatthemessagewasneverdeliveredandthereasonwhy

delivery report object; DR-O


internalrepresentationofadeliveryreportinamultimediamessagingservicecentre
(MMSC)

delivery server; DLS


serverthatmanagesbusinessrulesforcontentdownload,fetchescontentfromcontent
storage,andreliablydeliversittoamobileterminal

delivery server core; DLSC


deliveryserver'ssoftwarebuildingblockwhichcontrolsthedownloadofcommercial
contentitemstoterminals,andprovidesintegrationtochargingandbillingsystems

delivery width
attributeofalogicalcomputeraddressthatdetermineswhetherthelogicaladdressofa
computerpairreferstotheactiveorspareunit,ortoboth

delta CRL
certificaterevocationlist(CRL)thatcontainscertificatesthathavebeenrevokedor
suspendedsincethelastcompleteCRLwaspublished

delta file
siteconfigurationfilethatcontainsinformationonobjectswhoseconfigurationneedsto
bemodified

368

Issue:28

GeneralGlossary

delta modulation
formofdifferentialpulsecodemodulationinwhichonlythesignofthedifference
betweeneachsampleanditspredictedvalueisdetectedandencodedbyasinglebit

demand priority protocol; DPP


protocolthatseekstoprovideahigh-speed,sharedmediaLANtoreplaceslowerspeed
networkprotocolswhileusingtheexistingmedia

demand service; demand telecommunication service


typeoftelecommunicationserviceinwhichthecommunicationpathisestablished
almostimmediately,inresponsetoauserrequesteffectedbymeansofuser-network
signalling

demilitarised zone /GB ; demilitarized zone /US/; DMZ


computerhostorsmallnetworkbetweenacompany'sprivatenetworkandtheoutside
publicnetworkthatpreventsoutsideusersfromgettingdirectaccesstoaserverthat
containscompanydata

democratic mutually synchronised network /GB/ ; democratic mutually


synchronized network /US/; democratic network
mutuallysynchronisednetworkinwhichallclocksareofequalstatusandexertequal
amountsofcontrolovertheothers.Thenetworkoperatingfrequency(digitrate)isthe
meanofthenatural(uncontrolled)frequenciesofalltheclocks

demultiplexer
equipmentthatperformsdemultiplexing

demultiplexing
separationofmultipleinputstreamsthatweremultiplexedintoacommonphysicalsignal
backintomultipleoutputstreams

denial of service; DoS


preventionofauthorisedaccesstoresourcesorthedelayingoftime-criticaloperations

denial-of-service attack; DoS attack


attackthatismadeviatheinformationnetworkwiththepurposetocomplicateorprevent
theuseofaservice

Issue:28

369

GeneralGlossary

dense wavelength division multiplexing; DWDM


implementationofwavelength-divisionmultiplexing(WDM),usingmorethan2optical
channelsinthesamewavelengthwindow

dependability
performancecriterionthatwithinagivenobservationalintervaldescribesthedegreeof
certaintyorsuretywithwhichafunctionisperformed

dependency relationship; dependency


relationshipbetweentworesources,inwhichachangetotheindependentresourcewill
affectthedependentresource

de-personalisation
removalofpersonalisedfeaturesfromamobilestation

deploy (verb)
tomakeaservicereadyforprovisionandactivation

deployment; service deployment


processofmakingaservicereadyforprovisionandactivation

deployment descriptor
Javaobjectthatdescribesthecontentsofadeploymentunit,configurescomponents
andapplicationsfortheirenvironment,andenablesthemanagementoftherelationships
betweenthecomponentswithoutwritingorchangingtheprogramcode

deployment rule
rulewhichdefineshowaserviceorservicecomponentisdeployedinthenetwork

deployment target
logicalrepresentationofaphysicalelementthatincludesonlyservice-relatedparameters

deposit function
functionwhichisusedtocalculatethenewcreditbalanceofaprepaidaccountaftera
recharge

370

Issue:28

GeneralGlossary

deregistration; de-registration
withCSCF,aprocessinwhichtheuserequipmentendsitscurrentregistrationtothe
servingcallstatecontrolfunction(S-CSCF)

deregistration request message; DEREG REQ; deregistration request


signallingmessagethatanapplicationserverprocess(ASP)sendstoindicatetoa
remotepeerthatitwishestoderegisteragivenroutingkey

deregistration response; DEREG RSP


signallingmessagethataremotepeerusesasaresponsetoaderegistrationrequest
message(DEREGREQ)

DES algorithm; DES; DEA; data encryption algorithm; data encryption


standard algorithm
symmetriccryptographicalgorithmthatconvertsacharacterstringintopiecesof64bits,
scramblesthebitsandcomputesanewcharacterstringfromthemwithmulti-phase
formulas

descending direction
directionofcallsfromahighernetworkhierarchyleveltoalowerone

descrambler
deviceforprocessingascrambledsignalinordertorestoretheoriginalsignal

descrambling
processforrestoringtheoriginalsignalfromascrambledsignal

descriptor
contentsofadescriptortablerecord

descriptor
syntacticelementoftheprotocolthatgroupsrelatedproperties

descriptor file
filewhichallowsamobileterminaltoverifythatthedesiredmediaobjectissuitedtothe
terminalbeforebeingdownloaded

Issue:28

371

GeneralGlossary

descriptor slot
recordinadescriptortable

descriptor table
tablecontainingdescriptors

designated router; DR
routerinanopenshortestpathareathatgathersinformationontheotherrouters'link
stageorcostsandforwardstheinformation

designated transit list; DTL


listofnodesandoptionallinkIDsthatcompletelyspecifyapathacrossasingleprivate
network-networkinterface(PNNI)peergroup

design for assembly; DFA


processduringwhichadesignofaproductoraproductconceptisanalysed
systematicallytooptimiseitsassembly

design for excellence; DFx


processforcombiningandharmonisingbestpracticesinassembly,manufacture,testing,
anddemand/supplychainforexcellentdesignthattakesintoaccountalsoenvironmental
andreliabilityissues

design traffic capacity; design transaction processing capacity; designed


traffic capacity
trafficcapacitythatthemanufacturerrecommendsasthehighesttrafficloadfora
networkelementwithoutviolatinganycapacityconstraints

desired delivery time


earliesttimewhenamessageshouldbedelivered,asindicatedbythesenderofthe
message

Desktop Framework
JavaGUIplatformthatprovidesuserinterfacemodulesfordifferentfunctions

Desktop Framework SDK


partoftheSoftwareDevelopmentKit(SDK)thatsupportsthecreationofuserinterface
applicationsthatareintegratedintoDesktopFramework

372

Issue:28

GeneralGlossary

Desktop Framework tool


graphicaluserinterfacetoolthatismanagedbyDesktopFramework

Desktop module; module


JavaArchiveFile(JAR)thatprovidesuserinterfaceservicesandcomponentstothe
DesktopFramework

desktop user interface adaptation file


adaptationfilethatisusedfortheDesktopFrameworkadaptation

despreading
processinwhichthereceivedwidebandsignalismodulatedwiththesynchronised
spreadingcodetogetanarrowbandsignalinspreadspectrumsystems

destinating user prompter; DUP


INservicefeaturethatenablestopromptthecalledpartywithaspecificannouncement

destination address; DAD; DA


addressoftheuserorunittowhomacall,message,orsignallingisdirected,orinwhich
dataisbeingtransferred

destination address prefixing; DAPR


waytorequesttogglingofanonymitypermessage

destination address suffixing


mechanismwhichamessagingcentreusestoadddigitstotheendofthedestination
addresstoidentifyeachofoneormoresimultaneouslyreceivedmessagesdestinedfor
thesameapplication

destination available message; DAVA; destination available


signallingmessagethatasignallinggatewaysendstoallconcernedapplicationserver
processes(ASP)toindicatethatithasdeterminedthatoneormoresignallingsystem
No.7(SS7)destinationsarenowreachableandnotrestricted

destination B
entityaddressedintheoriginalcallset-up

Issue:28

373

GeneralGlossary

destination barring
restrictionoftraffictocertainroutedestinations

destination binding reference


informationelementthatindicatesthebeareridentifierinthedestinationmultimedia
gateway

destination end station; DES


endstationthatisthedestinationforATMmessagesofaconnectionandisusedasa
referencepointforavailablebitrate(ABR)services

destination IP address
IPaddressofdatacommunication'sdestination

destination load observation; route destination load observation


partofloadobservationwhichobservestheloadonthedefineddestinations

destination local exchange; DLE


networkelementtowhichremoteusersareconnected

destination number triggering criterion


servicetriggerthatisstoredinthehomelocationregisterandthatcontainsalistofupto
tendestinationnumbersand/oruptothreenumberlengths

destination point code; DPC


partofthelabelinasignallingmessageindicatingthesignallingpointforwhichthe
messageisintended

destination port number


inastreamcontroltransmissionprotocol(SCTP)datagramheader,theSCTPport
numbertowhichthedatagramisdestined

destination restricted message; DRST; destination restricted


signallingmessagethatasignallinggatewaysendstoallconcernedapplicationserver
processes(ASP)toindicatethatithasdeterminedthatoneormoresignallingsystem
No.7(SS7)destinationsarenowrestricted

374

Issue:28

GeneralGlossary

destination state audit message; DAUD; destination state audit


signallingmessagethatanapplicationserverprocess(ASP)sendstoasignalling
gatewaytoaudittheavailabilityorcongestionstateofsignallingsystemNo.7(SS7)
routestooneormoredestinations

destination unavailable message; DUNA; destination unavailable


signallingmessagethatasignallinggatewaysendstoallconcernedapplicationserver
processes(ASP)toindicatethatithasdeterminedthatoneormoresignallingsystem
No.7(SS7)destinationsareunreachable

destination user
entitytowhichcallstothegeneralpacketradioservice(GPRS)aredirected

destination user part unavailable message; DUPU; destination user part


unavailable
signallingmessagethatasignallinggatewaysendstoinformanapplicationserver
process(ASP)thataremotepeerMTP3-useruserpartatasignallingsystemNo.7
(SS7)nodeisunavailable

desynchroniser /GB/ ; desynchronizer /US/


functionthatsmoothesoutthetiminggapsresultingfromdecodedpointeradjustments
andvirtualchannelpayloaddemappinginthetimedomain

detached signature
digitalsignaturethatisstoredseparatelyfromthedataitisasignatureof

detailed charging; call associated charging


charginginwhichthestoreddataofasinglecallcanbeusedtopresentdetailed
informationaboutthecall

detailed charging; call-associated charging


servicethatprovidesthesubscriberwithadetailedlistofchargedcallsfromthenetwork
operator

detailed interrogation
interrogationinSGSNstatisticswhichisusedforinterrogatinganSGSNmeasurement
andwhichdisplaysallmeasurementparametersofonechosenmeasurementtype

Issue:28

375

GeneralGlossary

detailed network planning


partofnetworkplanningwhichisperformedforgeneratingthesourcedatatobeused
duringtheimplementationofthenetwork

detected set
setofcellsthataredetectedbytheuserequipmentbutarenotincludedintheneighbour
cellBCCHallocationlistoftheuserequipmentorinthecurrentactiveset

detection point; DP; call detection point


pointinbasiccallprocessingatwhichaprocessingeventmaybereportedtotheservice
controlfunctionandtransferofprocessingcontrolcanoccur

deterministic ATM
modeoftheasynchronoustransfermodeinwhichaconstantinformationtransfer
capacityexpressedintermsofapredeterminedlimitingvalueforagivenserviceis
providedtotheuserthroughoutacall

deterministic multiplexing
multiplexinginwhicheachmultiplexedchanneltakesaconstantpredeterminedspace

development host
hostinwhichtheprogramsourcesarecompiled,alsocontainingeditinganddebugging
facilities

development library; work library


Mentorcomponentlibrarywhereacomponentcopiedfromthesourceorreleaselibrary
iseditedandtested

deviation in the peak hour traffic intensity


deviationvaluewhichshowsthedifferencebetweenthepeakhourtrafficvalueofthe
finalcalculationdayandtheweightedaverage

device certificate
certificatethatthedevicemanufacturerissuestotietheidentityofthedevicetoits
attributes

376

Issue:28

GeneralGlossary

device detection application; DDA


applicationthatdetectswhenanewdeviceentersthenetworkandallowsittobe
automaticallyconfiguredbythedevicemanagementapplicationusingover-the-air
activationmechanisms

device driver framework; DDF


architecturethatspecifieshowthedevicedriversaremanagedandused,andthatsets
guidelinesforthedevicedriverimplementation

device driver interface; DDI


interfacethatdefinesseverallayersofapplicationprogramminginterfaces(API)between
differentdrivercomponents

device locator record


sensordatarecordthatdescribesthelocationofasensorinthesysteminanintelligent
platformmanagementinterfaceformat

device management; DM; OMA device management


setoffunctionsthatallowsathirdpartytocarryouttheprocedurestoconfiguremobile
devicesonbehalfoftheuser

device management server


serverthatprovidesservicesettingstoaterminalusingover-the-air(OTA)messages

device-originated call CDR; DOC CDR; DOC; device-originated call


chargingdatarecord(CDR)whichcanbegeneratedinthemobileservicesswitching
centrewhenanannouncementhasbeengivenbythespecialisedresourcepoint,or
whenonlinecallmonitoringisinuse

device presence verification; DPV


processthatthehardwaremanagementsegmentcontroller(HWMSC)performsby
pollingeachdeviceontheDPVlisttoverifytheredundantcommunicationpathstoeach
managedcomponent

DFCA hopping
frequencyhoppinginwhichthetransceiversupportsindependentcyclichopping
sequencesthatcanbefreelyselectedforeachtime-slotatchannelactivation

Issue:28

377

GeneralGlossary

DHCP client
internethostthatusesDynamicHostConfigurationProtocol(DHCP)toobtain
configurationparameterssuchasanetworkaddress

DHCP proxy
proprietaryDHCPserverextensionthatisusedbetweenDHCPrelaysandtheactual
DHCPserver

DHCP server; Dynamic Host Configuration Protocol server


internethostthatreturnsconfigurationparameterstoDHCPclients

DHCP switch manager


DHCP/TFTPserverwhichprovidesconfigurationtoLANswitchesandinformsLAN
hardwaresupervisionaboutthestatusoftheconfiguration

Dh interface
interfacebetweentheapplicationserverandsubscriptionlocatorfunction

diagnosis
resultoffaultdiagnosis

diagnosis job
sequenceofdiagnosisprogramsforfunctionalunit

diagnosis program; diagnostic program


programtestingcertainhardwarefunctions,orsearchingforcertainfaulttypes

diagnosis report
alarmreportoutputtothemaintenancepersonnelthatcontainsdataonthelocationofa
fault

diagnostic path
dynamiclistofthefunctionalunitswhichhavetobeinorderduringadiagnosticjob

diagnostics and testing


DX200commandclass

378

Issue:28

GeneralGlossary

diagnostics handling
featurethatcontrolsthelocalisationofhardwarefaultsbystartingthediagnosisjobsand
handlingdiagnosisreports

diagnostic task
sequenceintheexecutionofdiagnosticprogramsperformedforafunctionalunit

diagnostic test
testspeciallydesignedtoidentifymoreprecisely,preferablytoasinglereplaceableunit,
thelocationofahardwarefault

dialled services CAMEL subscription information ; dialed services CAMEL


subscription information /US/; D-CSI
CAMELsubscriptioninformationwhichidentifiesthesubscriberashavingCAMEL
servicessubscribedinthehomenetwork

dialling ; dialing /US/; selection


actorprocessprovidedatatelephoneinstrumentorswitchboardthatenablesthe
subscribernumberofacalledpartytobeinsertedintoanautomaticallyswitched
telephonesystem

dialling preanalysis ; dialing preanalysis /US/


internalcallcontrolanalysisforidentifyingcodeswhichdeviatefromordinarydialling

dialling-time ; dialing-time /US/


timeintervalbetweenthereceptionofdialtoneandtheendofdiallingofthecallinguser

dialogue ; dialog /US/


completeinteractiveprocedureforinterchangingdatabetweenuserandsystem

dialogue context ; dialog context /US/


partofthecontainerthatcontainstheinformationwhichispersistentforthedurationof
thewholeSIPdialogueor,incaseofastand-alonetransaction,forthedurationofaSIP
transaction

dialogue diagram ; dialog diagram /US/


diagramthatillustratesthedialogueandwindowstructureofaprogramblock

Issue:28

379

GeneralGlossary

dialogue identifier ; dialog identifier /US/; dialogue ID; dialog ID /US/


identifierthatisusedtoseparatedialoguesfromeachotherandtoattachoperationsand
linkedcomponentstodialogues

dial-out group
talkgrouptowhichthecallingpartyinvitesotherparticipants

dial tone; DT; dialling tone; dialing tone /US/


tonethatadvisesthattheexchangeisreadytoreceivecallinformationandthatinvites
theusertostartsendingcallinformation

dial-tone delay
timeintervalbetweenoffhookandthereceptionofthedialtone

dial-up access
accesstoadatacommunicationsnetworkthroughapublicswitchedtelecommunication
network

Diameter agent
Diameternodethatprovideseitherrelay,proxy,redirect,ortranslationservices

Diameter API
applicationprogramminginterface(API)betweentheDiameterapplicationandDiameter
protocolthatprovidessupportforpeeringAAAtransactionsacrosstheinternet

Diameter application
applicationthatextendstheDiameterbaseprotocolforaspecificserviceortask

Diameter base protocol; Diameter protocol


authentication,authorisation,andaccounting(AAA)protocolusedfornetworkaccess
services,suchasdial-upandmobileIP

Diameter client
Diameternodeattheedgeofanetworkthatperformsaccesscontrol

380

Issue:28

GeneralGlossary

Diameter client address; DCA


addressthatidentifiesaDiameterclientintheservingcallstatecontrolfunction(SCSCF)whenanIPmultimediasubsystemsubscriberisregisteredtoIPmultimedia
servicesorapublicserviceidentityuserhasanassignedS-CSCF

Diameter connection
transport-levelconnectionbetweentwopeersthatisusedtosendandreceiveDiameter
messages

Diameter credit-control application; DCCA; Diameter CCA


Diameterbaseprotocolbasedapplicationthatcanbeusedtoimplementonlinecredit
controlforavarietyofend-userservices

Diameter Direct Debit procedure


inevent-basedonlinecharging,aprocedureinwhichaDiameterserverandaclient
exchangemessagestodeductcreditfromtheaccount

Diameter Direct Refund procedure


inevent-basedonlinecharging,aprocedureinwhichaDiameterserverandaclient
exchangemessagestocancelacreditreservationandrestorecredittoanaccountwhen
servicedeliveryfails

Diameter interface
interfacethatisusedfortransportingmediagatewaycontrolfunction(MGCF)charging
informationforcallsthatoriginateorterminateinthecircuit-switchednetwork.

Diameter load-balancing service; LBSDia


application-layerload-balancingservicefortheDiameterbaseprotocol

Diameter message
messagethataDiameterclientgeneratestorequestauthentication,authorisation,and
accountingservicesfortheuser,oramessagethataDiameterservergeneratesto
respondtoanAAArequestsentbyaDiameterclientoranunsolicitedmessage
generatedbyaDiameterserver

Diameter multimedia application; Cx application


DiameterapplicationfortheCxinterface

Issue:28

381

GeneralGlossary

Diameter node
hostprocessthatimplementstheDiameterprotocolandactsasaclient,agent,orserver

Diameter proxy agent; Diameter proxy


Diameternodethatforwardsrequestsandresponsesbasedonrouting-relatedattributevaluepairs(AVP)andrealmroutingtableentries,andmakespolicydecisionsrelatingto
resourceusageandprovisioning

Diameter redirect agent; redirect agent


DiameternodethatprovidesthelocationsofDiameterserverstoDiameterclientsand
allowsthemtocommunicatedirectly

Diameter relay agent; Diameter relay


Diameternodethatforwardsrequestsandresponsesbasedonrouting-relatedattributevaluepairs(AVP)andrealmroutingtableentrieswithoutmodifyingthenon-routing
attribute-valuepairs(AVP)inthemessage

Diameter server
Diameternodethatperformsauthentication,authorisation,andaccountingrequestsfora
particularrealm

dictionary attack
securityattackonasecretpasswordinwhichanattackertriestofindapasswordsina
specificlist,suchasanEnglishdictionaryoralistofmostcommonlyusedpasswords

differential backup
partialbackupthatisusedtocopythefilesthathavebeenmodifiedoraddedtothe
systemsincethelatestfullbackup

differential GPS; DGPS; D-GPS; differential global positioning system


globalpositioningsystem(GPS)whichcorrectsthebiaserrorsatonelocationwith
measuredbiaserrorsataknownlocation

differential link delay; DLD


delayonthephysicallinksbelongingtotheinversemultiplexingforATM(IMA)group

differential phase shift keying; DPSK


modulationschemeinwhichtheinformationisconveyedbychangesincarrierphase
duringoneintervalrelativetotheprecedinginterval

382

Issue:28

GeneralGlossary

differential pulse code modulation; DPCM


processinwhichadigitalsignalissampled,andthedifferencebetweeneachsampleof
thissignalanditsestimatedvalueisquantisedandconvertedbyencodingtoadigital
signal(Theestimatedvaluesofthesignalarecalculatedbyapredictorfromthe
quantiseddifferencesignal.)

differential quadrature phase shift keying; DQPSK; differential quaternary


phase shift keying
quadraturephaseshiftkeying(QPSK)inwhichonlythedifferencesbetweenthevalues
ofthephaseofthesinewavearetransmitted,insteadofthefullabsolutevalue

differential voltage gain


ratioofthedifferentialoutputvoltageofanamplifiertothedifferentialinputvoltageofthe
amplifier

differentiated charging
chargingthatappliesdifferenttariffsbasedonthetypeofusertrafficorothervarying
factors

differentiated queuing; differentiated queueing


trafficschedulinginwhicheachqualityofserviceclassisgivenanindependentsetof
parameterssothatcriticaltrafficcanbeprioritised

differentiated service; DiffServ; DS


servicewhosequalityofservice(QoS)dependsonthesubscribedprofileand
applicationsprovidedbythenetworkoperator

differentiated services code point; DSCP; DiffServ code point


fieldintheIPheaderthatpromptsnetworkrouterstoapplydifferentgradesofserviceto
variouspacketstreams

differentiated services field; DiffServ Field; DS field


typeofservice(TOS)octetofanIPv4header,ortheIPv6trafficclassoctet,inwhichsix
bitsareusedtostoreadifferentiatedservicescodepoint(DSCP)

differentiated services quality of service policy information base; DiffServ


QoS PIB; DS-PIB; DiffServ policy information base
policyinformationbasewhichdefinesprovisioningclassesfordevicesthatimplements
thedifferentiatedservicesarchitecture

Issue:28

383

GeneralGlossary

differentiated services urgency importance; DSUI; DiffServ urgency


importance
qualityofservice(QoS)modelinwhichthepacketsaremarkedbytwoprioritiesthatgive
informationtothenetworknodesabouttherelativeimportanceandurgencyofthe
packets

differentiated UBR
servicecategoryforcarryingdifferentiatedserviceswithinanunspecifiedbitratevirtual
channel(UBR-VC)

Diffie-Hellman key exchange; DH


methodforkeyexchangebetweentwoparties,inwhicheachsideofthecommunication
generatesaprivatekey,thenapublickeywhichisaderivativeoftheprivatekey,after
whichthepartiesexchangetheirpublickeys

digest
representationoftextintheformofasinglestringofdigits,createdusingamessage
digestalgorithm(one-wayhashfunction)

digest schema; digestion schema


encryptionmethodusedinauthentication

digilogue channel
channelinwhichinformationisrepresentedbyadigitalsignalatoneendandthesame
informationisrepresentedbythecorrespondinganaloguesignalattheotherend

digit
memberselectedfromafiniteset

digital
describingaphenomenonwithsamplestakenfromitatfixedintervalsandencodingthe
sampleasoneoftwostates,eitherbinary"0"(off)orbinary"1"(on)

digital access and cross-connect system; DACS; digital access crossconnect system
digitalswitchingdeviceforroutingandswitchingT1linesamongmultipleT1ports

384

Issue:28

GeneralGlossary

digital AMPS; D-AMPS; digital advanced mobile phone service


digitalversionofAdvancedMobilePhoneService(AMPS)thataddstimedivision
multipleaccess(TDMA)toAMPStogetthreechannelsforeachAMPSchannel,tripling
thenumberofcallsthatcanbehandledonachannel

digital audio broadcasting; DAB


systemdesignedforthedeliveryofhigh-qualitydigitalaudioprogramanddataservices
formobile,portable,andfixedreceptionfromterrestrialorsatellitetransmitters,aswell
asfordistributionthroughcablenetworks

digital audio tape; DAT


digitalstoragesystemmeantforstoringaudiophonicaldataindigitalformat

digital block
combinationofadigitallinkandassociateddigitalmultiplexequipment

digital branching equipment


deviceorsystemwhichenablesthebranchingofdigitaltransmissionchannelsor
channelgroupstodifferenttransmissionconnections

digital cellular system; DCS; GSM/DCS


digitalcommunicationstandardformobilecommunicationsanddigitalmobiletelephone
transmissionsbasedonGSMtechnology,whichusesahigherradiofrequencythan
thoseoriginallyusedbyGSMnetworks,increasesnetworkcapacityandreducessystem
congestion

Digital Cellular System for 1800 MHz; DCS1800


mobilecommunicationssystemthatisbasedonthespecificationsofGSMandthataims
atmoreefficientuseofmicrocells

digital certificate; certificate


securitymechanismusedasadigitalversionofanIDcardandissuedbyacertificate
authoritytoestablishtheidentityofauseroranorganisationwhendoingbusinesson
theinternet

digital circuit
circuitusedfortransferringpulsecodemodulation(PCM)signalsorotherdigitalsignals

Issue:28

385

GeneralGlossary

digital circuit multiplication equipment; DCME


generalclassofequipmentwhichpermitsconcentrationofanumberof64kbit/spulse
codemodulation(PCM)encodedinputtrunkchannelsonareducednumberof
transmissionchannels

digital connection
concatenationofdigitaltransmissionchannelsordigitaltelecommunicationcircuits,
switchingorotherfunctionalunitssetuptoprovideforthetransferofdigitalsignals
betweentwoormorepointsinatelecommunicationnetwork,tosupportasingle
connection

digital connectivity of teleservices


servicewhichenablesausertobeconnectedtoadigitalcircuitfromtheoriginating
exchangetothedestinationexchange

digital cross-connect; DXC


physicallayerdeviceinwhichdigitalchannelsareswitchedbetweeninterfaces

digital cross-connect system; DCS; digital cross-connect node


networkelementthatisusedtoarrangelowerleveldigitalsignalsamonghigherlevel
digitalbitstreams

digital data storage; DDS


formatfordatastoragedriveswhichuseandarebuiltondigitalaudiotape(DAT)
technology

digital demultiplexer
equipmentthatseparatesacompositedigitalsignalintoitscomponentdigitalsignals

digital demultiplexing
separationofacompositedigitalsignalintoitscomponentdigitalsignals

digital distribution frame; DDF


structurethatprovidesflexibilityofsemipermanentinterconnectionofdigitalchannelsor
digitalcircuits

Digital European Cordless Telecommunications; DECT


standardfordigitalcordlesstelecommunicationsissuedbyEuropean
TelecommunicationsStandardsInstitute(ETSI)

386

Issue:28

GeneralGlossary

digital exchange; DX
electronicexchangethatswitchesinformationindigitalformthroughitsswitching
devices

digital filling
additionofsignalelementsatregularintervalstoadigitalsignaltochangethedigitrate
fromitsoriginalvaluetoapredeterminedhighervalue

digital IF loop; digital intermediate frequency loop


testloopwhichverifiestheoperationofthesignalpathfromencoderviaspreaderto
widebandtransmitterandreceiverandbacktoencoderviaadecoderblock

digital interface
interfaceinwhichthesignalisindigitalform

digital interface controller; DIC


functionalunitthatisusedforinterworkingwiththeintegratedservicesdigitalnetwork
(ISDN)unrestricteddigitalinformationservice(UDI)inanasynchronousdatacall

digital line equipment


devicefortransmittingdigitalsignalsovercableconnectionssuchasasymmetricpairor
coaxialpair

digital line link


digitallinkthatcomprisesadigitallinesectionoranumberoftandem-connecteddigital
linesections

digital line section


digitalsectionimplementedonasingletypeofmanufacturedtransmissionmediumsuch
asasymmetricpair,coaxialpair,oropticalfibre

digital line system


digitaltransmissionsystemthatprovidesadigitallinesection

digital link; digital transmission link


transmissionlinkforthetransmissionofadigitalsignalofspecifiedratebetweentwo
digitaldistributionframes(orequivalent)

Issue:28

387

GeneralGlossary

digital loop carrier; DLC


carrier'slocalloopinfrastructurethatconnectsenduserslocatedmorethan18,000feet
or3.5milesawayfromthecentraloffice

digital loss pad; digital pad


deviceormethodbywhichadigitalsignalisalteredtoproduceawantedstandard
attenuationonthecorrespondingdecodedanaloguesignal

digital microwave radio; DMR; MWR; microwave radio


radiolinkthatisusedfortransmissioninsideabasestationsystem

digital multiplex equipment


combinationofadigitalmultiplexerandadigitaldemultiplexeratthesamelocation,
operatinginoppositedirectionsoftransmission

digital multiplexer
equipmentthatcombinesseveraldigitalsignalsintoasinglecompositedigitalsignalby
timedivisionmultiplexing

digital multiplex hierarchy


seriesofdigitalmultiplexersgradedaccordingtocapabilitysothatmultiplexingatone
levelcombinesadefinednumberofdigitalsignals,eachhavingthedigitrateprescribed
foralowerorder,intoadigitalsignalhavingaprescribeddigitratewhichisthen
availableforfurthercombinationwithotherdigitalsignalsofthesamerateinadigital
multiplexerofthenexthigherorder

digital multiplexing; DM
formoftimedivisionmultiplexingappliedtodigitalchannelswhichconveydigitalsignals

digital multiplexing radio; DMR


microwaveradioequipmentusedincellulartransmission

digital multiprocessor control bus; DMC processor bus; DMC bus


internalprocessorbusofonemicrocomputerintheDX200system

digital network
telecommunicationnetworkwheredataistransmittedindigitalform

388

Issue:28

GeneralGlossary

digital PABX; DPBX; digital branch exchange


privateautomaticbranchexchange(PABX)thatswitchesinformationindigitalform

digital private network signalling system; DPNSS


systemforPBX-to-PBXsignallingoveraprivate-networkdigitallocalcircuittothe
integratedservicesdigitalnetwork(ISDN)

digital radio link


digitallinkthatcomprisesadigitalradiosectionoranumberoftandem-connecteddigital
radiosections

digital radio section


digitalsectionimplementedonaradio-relaysystem

digital radio system


digitaltransmissionsystemthatprovidesadigitalradiosection

digital rights management; DRM


rightsmanagementsystemwhichensuresthatcontentcanonlybeusedwhenthe
relevantconditions,determinedbythecopyrightowner,havebeenmet

digital rights management module; DRMM; DRM module


softwaremodulewhichhandlestherightsobjectsfordigitalrightsmanagement(DRM)
protectedcontent,andprovidesamechanismtopackageandencryptcontentwithin
OpenMobileAlliance(OMA)DRMspecification

digital rights management module interface; DRMM interface


internalinterfaceinthedigitalrightsmanagementmodule(DRMM)forgeneratingDCFs,
DRMmessages,orrightsobjectsforthedeliveryservercore(DLSC)

digital section
wholeofthemeansofdigitaltransmissionofadigitalsignalofspecifiedratebetween
twoconsecutivedigitaldistributionframes(orequivalent)

digital section level


OAMlevelthatextendsbetweendigitalsectionendpointsandcomprisesamaintenance
entity

Issue:28

389

GeneralGlossary

digital signal
discretelytimedsignalinwhichinformationisrepresentedbyanumberofwell-defined
discretevaluesthatoneofitscharacteristicquantitiesmaytakeintime

digital signalling data link /GB/ ; digital signaling data link /US/
datalinkthatprovidesaninterfacetosignallingterminalsandismadeupofdigital
transmissionchannelsanddigitalswitchesontheirterminatingequipment

digital signal processing; DSP


studyofsignalsinadigitalrepresentationandtheprocessingmethodsofthesesignals

digital signal processing platform; DSP platform


platformontopofwhichthedigitalsignalprocessingapplicationsarebuilt

digital signal processing software; DSP SW; DSP software


softwarethatprovidesdigitalsignalprocessinginnetworkelements

digital signal processor; DSP


processordesignedfordigitalsignalhandling,resemblinganordinarymicroprocessor

digital signature; signature


characterstringcalculatedusingcryptographicmethods,bymeansofwhichthe
transmittingparty'sidentityandtheintegrityofthematerialcanbeensured

digital signature algorithm; DSA; signing algorithm


publickeyalgorithmfordigitalsignaturesbasedonthedigitalsignaturestandard

digital signature standard; DSS


standard,definedbytheNationalInstituteofStandardsandTechnology(NIST),for
digitalsignaturesusingthedigitalsignaturealgorithm(DSA)andtheimprovedversionof
thesecurehashalgorithm,SHA-1

digital subscriber line; xDSL; DSL


familyofdigitaltelecommunicationstechnologiesdesignedtoallowhigh-speeddata
communicationovertheexistingcoppertelephonelinesbetweenend-usersand
telephonecompanies

390

Issue:28

GeneralGlossary

digital subscriber line access multiplexer; DSLAM; DSL access multiplexer


multiplexingequipmentthatcontainsahighconcentrationofcentralofficesplitters,xDSL
modems,andotherelectronicequipmenttoconnecttraffictothewideareanetwork
(WAN)

Digital Subscriber Signalling System No. 1 ; Digital Subscriber Signaling


System No. 1 /US/; DSS 1
commonchannelsignallingsystemusedinthedataterminalequipment(DTE)signalling
ofanISDNsubscriberconnection

digital sum
algebraicsumofthedisparitiesofasequenceofconsecutivedefinedgroupsofsignal
elements

digital sum variation


differencebetweenthemaximumpossibledigitalsumandtheminimumpossibledigital
sumofaspecifiednumberofgroupsofsignalelements

digital switching
switchingbymeansthatmayassumeintimeanyoneofadefinedsetofdiscretesignal
states,inordertoconveydigitalsignals

digital switching node; digital node


nodeatwhichdigitalswitchingoccurs

digital telecommunication circuit; digital circuit


combinationoftwodigitaltransmissionchannelspermittingbidirectionaldigital
transmissioninbothdirectionsbetweentwopoints,tosupportasinglecommunication

digital television; DTV; digital TV


televisionsystemforbroadcastingandreceivingmovingpicturesandsoundbymeansof
digitalsignals

digital terminal equipment


terminalequipmentwhichconnectsacomputerunittodigitaldatanetwork

digital terrestrial television; DTTV


digitaltelevision,basedontheDVB-Tstandard,thatusesterrestrialbroadcasting
insteadofdirectsatellitebroadcasting

Issue:28

391

GeneralGlossary

digital-to-analogue converter ; digital-to-analog converter /US/; DAC; d/a


converter
devicethatconvertsadigitalinputsignaltoananalogueoutputsignalcarrying
equivalentinformation

digital transmission
transmissionofdigitalsignalsbymeansofachannelorchannelsthatmayassumein
timeanyoneofadefinedsetofdiscretestates

digital transmission channel; digital channel


meansofunidirectionaldigitaltransmissionofdigitalsignalsbetweentwopoints

digital transmission system


specificmeansofprovidingadigitalsection

digital transparency; transparency


propertyofadigitaltransmissionchannel,telecommunicationcircuitorconnectionthat
permitsanydigitalsignaltobeconveyedoveritwithoutchangetothevalueororderof
anysignalelements

digital trunk circuit; digital circuit


trunkcircuitwhichtransmitsinformationsignalsindigitalformbetweentwoexchanges.It
includesterminationequipmentbutnotswitchingstages

digital video broadcasting; DVB


standardfordigitalsatellite,cable,andterrestrialbroadcasting

digital video broadcasting; DVB


seriesofinternationallyaccepted,openstandardsfordigitaltelevision,determiningthe
meansofdistributionofthesignal

Digital Video Broadcasting-Cable; DVB-C


digitalvideobroadcastingstandardthatdetermineshowthesignalistransferredinthe
cablenetwork

Digital Video Broadcasting-Satellite; DVB-S


digitalvideobroadcastingstandardthatdetermineshowthesignalistransferredvia
satellites

392

Issue:28

GeneralGlossary

Digital Video Broadcasting-Terrestrial; DVB-T


digitalvideobroadcastingstandardthatdetermineshowthesignalistransferredinthe
terrestrialdistributionnetwork

digital watermark; watermark


dataprotectionmethodinwhichdigitalcontentistaggedwithidentifyinginformation

digital wireless local loop; DWLL; digital WLL


digitalwirelesslocalloopsystem

digit analysis
analysisusedtodefinetheroutedestinationofacallaccordingtothereceiveddigit
sequenceincludedinincomingsignallingandtheoriginoftheincomingrouteor
subscriberclass

digit analysis basic functionality


featurethatprovidesthedigitanalysiswiththeanalysisstartingpointselection,address
analysis,addresstypeanalysis,routeselection,andconfigurationandmanagement
functions,andtherequiredinterfaces

digit analysis test state


testanalysisbymeansofwhichthedigitanalysiscanbetestedwithtesttrafficbeforeit
isimplementedfornormaltraffic

digit analysis tree


analysistreeusedfortheanalysisofdigitsequences

digit position
positionintimeorspaceintowhicharepresentationofadigitmaybeplaced

digit rate
numberofdigitsperunittime

digit sequence; digit string; number


stringofdecimaldigits

Issue:28

393

GeneralGlossary

digit sequence integrity


propertyofadigitaltransmissionchannel,telecommunicationcircuitorconnection,that
permitsadigitalsignaltobeconveyedoveritwithoutchangetotheorderofanysignal
elements

digit time-slot
timeslotallocatedtoasingledigit

dimensioning period; dimensioning period of peak hour measurement


periodoftimeduringwhichthedimensioningvalueisdeterminedandafterwhichthe
totalreportisoutput

dimensioning scale
tablecomposedforthedimensioningofroute,whichcontainsthenumberofcircuitsfor
differentdimensioningvaluesandcongestions

dimensioning value; dimensioning value of peak hour measurement


sumofthepastyear'sbiggestaveragedailypeakhour(ADPH)valueandarealistic
trafficprognosis

diplexer
couplingsystemthatallowstwodifferenttransmitterstooperatesimultaneouslyor
separatelyfromthesameantenna

dipole antenna
antennathatproducesaradiationpatternapproximatingthatofanelementaryelectric
dipole

direct access; DMA; direct memory access


datatransmissionmethodwheredataistransmittedbetweenhardware(forexample,a
diskdriveanddisplay)andmemorywithoutputtingitthroughthecentralprocessingunit
andthusloadingit

direct access; direct access connection element


equipmentprovidingtheconcatenationofallfunctionalgroupsrelevanttoanindividual
orgroupofrelatedaccessconnectionelements

394

Issue:28

GeneralGlossary

direct access
accessusingonlytheGSMpubliclandmobilenetwork(PLMN)bearerservicesand
signalling

direct access procedure; direct access


intra-BSChandoverinwhichthebasestationcontroller(BSC)performsahandoverto
thesuper-reusetransceiverwithoutthecarrier-to-interferenceratioevaluation

direct access to desired layer/band; DADL/B


handoverthatcanbeusedinadual-bandenvironmenttodirecttrafficfromastandalonededicatedcontrolchannel(SDCCH)oftheaccessedcelltoatrafficchannel(TCH)
ofanothercellthatisallocatedfromthefrequencybandoftheaccessedcell

direct address; one-level address


addressthatdesignatesastoragelocationofadataitemwhichistreatedasanoperand

direct announcement
announcementwhichisgivenwhenthesubscribercallsaspecificannouncement
servicenumbersuchasthetimeservice

direct billing class


contract-basedinformation,whichissettothesubscriberorincomingcircuitgroupdata,
tellingwhichinternationalcarrieraccesscodes(CAC)havetobereplacedwithanother
CACorwiththecorrespondingdirectbillingcodes

direct billing code


codeequivalenttotheoperator'scodewhichcanbeusedtocarryoutchargingonan
operator-specificbasis

direct billing contract


contractwithwhichasubscribercanarrangeforhisorherlongdistanceorinternational
callsorbothtobebilleddirectly

direct current signalling /GB/ ; direct current signaling /US/


signallingmethodinwhichthesignallinginformationmayberepresentedbycontrolling
thedirectcurrentmagnitude,polarity,anddurationoracombinationthereof

Issue:28

395

GeneralGlossary

direct data access; DDA


featurethatsupportsasynchronousdatatransmissionbetweenaGSMmobilestation
andtheinterworkingfunction(IWF)orexternaldevice

direct data access pool; DDA pool


poolthatconsistsofprotocolcontrollerswithexternalV.24/V.28interfaces(LAN)
providedfordirectdataaccess

direct dialling-in /GB/ ; direct dialing-in /US/; DDI; direct dialling in /GB/;
direct inward dialing /US/
servicewhichenablestheusertocallanotheruserdirectlyonaprivateautomaticbranch
exchange(PABX)orotherprivatesystemtelephonewithoutattendantintervention

direct dialling-in call return /GB/ ; direct dialing-in call return /US/; DDI call
return
callreturnfacilityforcentrexinwhichcallsremainingunansweredinacentrexgroupare
divertedtothecallreturnnumberafteradefinedtime-out

direct dialling-in number /GB/ ; direct dialing-in number /US/; in-dialling


number /GB/; direct number; direct inward number; DDI number; in-dialing
number /US/
subscribernumbertheuseofwhichforwardsthecalldirectlytotheextensionwithoutthe
attendant'sassistance

direct digital synthesis; DDS; direct-digital frequency synthesis


frequencysynthesisinwhichlogicandmemoryareusedtodigitallyconstructthedesired
outputsignal,andadigital-to-analogueconverterisused

directed retry; DR; directed retry handover; DR handover; directed retry


procedure
functioninacellularradiosystemthatallowsthemobilesubscribertomakeasecond
callset-upattemptifthefirstfailsduetocongestion

direction
propertyoftrunks,bundlesorcircuitgroupsdefiningthetrafficdirectioninrelationtothe
exchangeconcerned(Thedirectioncanbeincoming,outgoingorbidirectional.)

directional antenna; beam antenna


antennathatradiatesorreceivesradiowavesmoreeffectivelyinsomedirectionsthanin
others

396

Issue:28

GeneralGlossary

directional coupler
deviceputinamicrowavesystem'swaveguidetocoupleatransmitterandreceiverto
thesameantenna

directional observation
partoftrafficobservationinwhichsingleincomingoroutgoingnumberdestinationorpair
ofnumberdestinationscomposedofthesecanbeobservedcall-specifically

directional pattern; radiation diagram; radiation pattern


representationofthestrengthanddirectionofelectromagneticradiationinthevicinityof
atransmittingantenna

direction of transmission
directioninwhichsignalistransmitted

directly routed call; DRC


calltypethatconsistsofcallsthatareroutedusingtheirprimarysubdestination

direct manipulation
useofthefunctionsofaninformationsystemaccordingtothechoicesoftheuser

direct memory access controller; DMAC; DMA controller


systemthatallowsI/Odevicestotransferdatadirectlytoandfrommemory

direct message delivery


processofdeliveringmessagesdirectlytotheterminatingnetworkelementoverthe
networkinterfacewithoutinteractionwiththemessagingcentre

directory
structurecontainingoneormorefilesandadescriptionofthosefiles

directory assistance service; DAS; DA; directory assistance; directory


inquiry service
informationservicebywhichcallerscanbeinformedofsubscribers'telephonenumbers

Issue:28

397

GeneralGlossary

directory-enabled networking; DEN


industry-standardinitiativeandspecificationonhowtoconstructandstoreinformation
aboutanetwork'susers,applications,anddatainacentraldirectory

directory name lookup cache; DNLC


cachewhichstoresdirectorylookupinformationforfileswhosenamesareshorterthan
30characters,preventingtheneedtoperformdirectorylookupsatanytime

directory number
subscribernumberlistedinatelephonedirectory

directory number analysis


functionproducingauniquereferencetothedatabaseaccordingtotheanalysed
number,thusofferinganaidtoaccessuserdatabasewiththehelpofdirectorynumber

directory schema; schema


setofrulesandconstraintsconcerningdirectoryinformationtree(DIT)structure,object
classdefinitions,attributetypes,andsyntaxeswhichcharacterisethedirectory
informationbase(DIB)

directory server
serverthatprovidescentraladministrationofdirectorynamingobjectsandthusfacilitates
areductionoftheworkeffortassociatedwithaddingorrelocatingservices

directory table
tablethatcontainsinformationonqueuesthatarestoredinadiskfileusedbythe
disseminator

directory tool
toolforaccessingdatastoredinadirectoryandmakingadministrativeactionsforthe
contentsofthedata

directory tree; DIT; directory information tree


hierarchicaltree-likestructurewiththepurposeofmanagingfiledirectories

direct pool controller; DIPC


functionalunitthatisusedforestablishingaconnectiontoapacket-switchednetworkor
alocalareanetwork

398

Issue:28

GeneralGlossary

direct read
specialfastreadwherethefastreadismadethroughbypassingthemanagementsystem
ofadatabase

direct routing
routinginwhichthecallsarerouteddirectlyfromtheoriginatingnetworkwithinthe
portabilitydomain

direct routing; direct PSI routing


PSIroutinginwhichtheSIPmessagesarerouteddirectlyfromtheinterrogatingcall
statecontrolfunction(I-CSCF)totheapplicationserverwithoutusingtheservingcall
statecontrolfunction(S-CSCF)

direct sequence
phasemodulationofacarrierbyadigitalcodesequencewhosechiprateismuchhigher
thantheinformationsignalbandwidth

direct sequence spread spectrum; DSSS


spreadspectrumradiotechnologyinwhichnetworkdevicestransmitalldataonafixed
frequency

direct short message delivery; direct SM delivery


featurethatenablesshortmessagedeliverywithoutinvolvingtheshortmessageservice
centre(SMSC)

direct-to-home; DTH
satellitebroadcastingwhereTV-programscomedirectlyfromasatellitetoaresidential
satelliteantenna

direct traffic
trafficdirectedtotheprimarysubdestinationofthefirstcircuitgroup

direct transfer application part; DTAP


userpartwhichtransmitsthemessagestransparentasregardsthebasestationsystem
(BSS)betweenamobilestation(MS)andthemobileservicesswitchingcentre(MSC)

direct transfer procedure; direct transfer


elementaryprocedureforcarryingsignallingmessagesbetweenthemobilestationand
corenetworkovertheIuInterface

Issue:28

399

GeneralGlossary

direct tunnel
functionthatisusedtorouteGTP-Upacketsdirectlybetweenaradionetworkcontroller
andgatewayGPRSsupportnode,orbetweenanevolvednodeBandaservinggateway
orpacketdatanetworkgateway,sothattheservingGPRSsupportnode(SGSN)orthe
mobilitymanagemententity(MME)isremovedfromtheroute,whiletheGTP-Croutingis
retainedviatheSGSNorMME

disabling
actiontakenbytheuseronapercallbasistopreventtheactionoftheservice

DisconnectForwardConnection message; DFC;


DisconnectForwardConnection
messagewhichisusedtodisconnectaconnectionwithaspecialisedresourcesfunction
(SRF)previouslyestablishedwithaConnectToResourceandaninitiatingservice
switchingfunction(SSF)fromanassistingSSFanditsassociatedSRF

DisconnectForwardConnectionWithArgument procedure; DFCWA;


DisconnectForwardConnectionWithArgument
operationthattheGSMservicecontrolfunctionusestodisconnectaconnectiontoa
resource,thatis,aGSMspecialisedresourcesfunctionthathasbeenestablished
previouslywithaConnectToResourceoranEstablishTemporaryConnectionoperation

disconnection
actionwhichismadebyconnectingthecircuittobereleasedtothestandardsignalofa
freetimeslotofthetonegenerator(TG)

disconnection
actionofdeactivatingthePDPcontextofacertainuser

DisconnectLeg
CS-2INAPoperationthatallowstheservicelogicprogramtoforcealeg(asubscriber)to
bedisconnectedfromtheconnectionpointinserviceswitchingfunction

discontinuous reception; DRX


meansofsavingbatterypower(forexampleinhand-portableunits)byperiodicallyand
automaticallyswitchingthemobilestationreceiveronandoff

400

Issue:28

GeneralGlossary

discontinuous transmission; DTX


featurewhichenablessavingbatterypower(forexampleinhand-portableunits)and
reducinginterferencebyautomaticallyswitchingthetransmitteroffwhennospeechor
dataaretobesent

discrete frequency interference


verynarrowbandinterferingsignaloccurringononefrequencywhichmaybemodulated
bysuchaslowsignalthatitsspectrumisnotsignificantlybroadened

discretely-timed signal
signalcomposedofsuccessiveelementsintime,eachelementhavingoneormore
characteristicswhichcanconveyinformation,forexample,itsduration,itswaveformand
itsamplitude

discrete multi-tone modulation; DMT


wavemodulationschemethatdiscretelydividestheavailablefrequenciesinto256
subchannelsortonestoavoidhigh-frequencysignallosscausedbynoiseoncopper
lines

discrete reflectance
ratioofreflectedpowertopropagatingpower

discriminator
managedobjectthatallowsasystemtoselectmanagementoperationsandevent
reportsrelatingtoothermanagedobjects

discussion group; news group; news


internetservicethatenablestheuserstoreadacollectionofarticles,announcements,
advertisements,oropinionsarrangedbytopic,andparticipateontheongoing
discussionsthroughe-mail

disk cache
storagemediuminthecomputer'sextendedmemory,whichsavesinformationreadfrom
theharddisk

disk caching
storingintoorreadingfromadiskcache

Issue:28

401

GeneralGlossary

disk copy of a memory file


diskfilewithaheaderstructurethatthememoryfilesystemrecognises

disk drive; disk unit


operatingdeviceforadiskpackorharddisk

disk drive
hardwareentitywhichcontrolsthebasicfunctionsofadisk

disk drive cross-sharing; disk cross-sharing


methodinwhichtwocomputerssharetheresourcesofeachothersdiskdrives

diskette; floppy disk


thinflexiblemagnetic-coateddiskcontainedinarigidorsemi-rigidprotectivejacket

diskette unit; FDD; diskette drive; floppy disk drive


operatingdeviceofadiskette

disk file
filestoredinthedisksofaunit

disk file header


headerthatcontainstheidentitydataofthefilesthatbelongtothesoftwarebuild

disk file system


filesystemthatisdesignedforthestorageoffilesonadiskdrive,whichcanbedirectly
orindirectlyconnectedtoacomputer

disk handling
operationswithwhichausercancontroladiskoritsfilecontents

disk image; image file


filethatcontainsafullcopyofthecontentandstructureofacomputerharddisk,disk
partition,orotherdisk

402

Issue:28

GeneralGlossary

diskless host; BOOTPC; bootstrap protocol client; BOOTP client


clientwhichsupportstheIP/UDPbootstrapprotocol(BOOTP)

disk loading
loadingmodeinwhichthedataisloadedtothesystemfromtheOperationand
MaintenanceUnits(OMU)disk

disk log manager


partoftheNetworkElementWebManagerthatprovidesagraphicaluserinterfaceand
facilitatesthemanagementofcomputerlogs

disk management
setoffunctionsforinitialisingaharddisk,maintainingitscondition,andmanagingits
organisationandcontent

disk mirroring
methodwhereadiskhasaphysicalduplicatedisktopreventdatalossintheeventof
diskfailure

disk name
identificationofaphysicaldisk

disk partition; partition


partofthediskthatiscapableofholdingdataandthatistheresultofdividingthe
memoryspaceonadiskdeviceintosectionsofvaryingsizes

disk system image; disk boot


bootablearchivethatisloadedfromanexternalsource

disk update of memory files; disk update


operationinwhichamemoryfile(orpartofit)locatedinthecomputer'srandomaccess
memory(RAM)iscopiedtoadisk

disk updating log


databasedisklogthatcontainsdisk-update-relateddata

Issue:28

403

GeneralGlossary

disk updating system


systemthatperformsthedatabasefunctionsrelatedtodisks

disparity
algebraicsumofthevaluesofthedeparturefromnotionalzerolevelofoneormore
consecutivesignalelementsformingadefinedgroup

disparity
digitalsumofoneormoreconsecutivesignalelementsformingadefinedgroup

dispatcher
inDX200,anobjectwhichreceivesrequestsfromtheexternalsystemandnotifications
frommanagedresources

dispatcher; scheduler
systemthatmanagesworkload,forexamplestartsandendstasks,manages
concurrentlyrunningprocesses,andallocatessystemresources

dispersion; CD; chromatic dispersion


dependenceofapropagationparameteronwavelength

displacement
addressspecifiedintermsofitsrelationshiptoagivenbaseaddress

display information
signallingparameterindicatingatextstringtobesenttotheuser

display name
optionalpartofaSIPheader,whichindicatesthesenderorrecipientthatcanbe
displayedtotheuser

display pager
pagerequippedwithascreen,usedinalphanumericpagingserviceorradiodisplay
paging

404

Issue:28

GeneralGlossary

disseminator
event-forwardingdiscriminatorwhichprovidesaqueuingandloggingmechanismwhen
thedestinationisnotavailable

distance vector multi-protocol routing; DVMPR; distance vector


multiprotocol routing protocol
inacommunicationserver,anIProutingprotocolwithwhichmulticastcommunication
serversusingprotocolindependentmulticast(PIM)caninteroperatewithothermulticast
communicationservers

distance vector protocol


protocolusedinlocalareanetwork(LAN)routerstominimisethenumberofhopswhich
apacketmusttravelfromtheoriginatingdevicetotheterminatingdevice

distinct PSI
completepublicserviceidentity(PSI)whichisdefinedinanIMSsubscriptionandrouted
eitheraccordingtothenormalIPmultimediasubsystem(IMS)routingprinciplesor
directlyfromtheinterrogatingcallstatecontrolfunction(I-CSCF)totheapplication
server

distinguished encoding rules; DER


encodingrulesthatprovideconstraintsonthebasicencodingrules(BER)byselecting
oneencodingfromthoseallowedbyBERandeliminatingallofthesender'soptions.

distinguished name; DN
nameofamanagedobjectwhichconsistsofasequenceoftherelativedistinguished
namesofitssuperiorsinthenamingtree,startingattherootandworkingtothe
managedobjecttobeidentified

distinguished participant
PoCuserwhosendsRTPmediatoallordinaryparticipantsina1-many-1session,and
whocanreceiveRTPmediafromanyordinaryparticipant

distributed antenna system; DAS


networkofspatiallyseparatedantennanodesthatareconnectedtoacommonsource
viaatransportmediumthatprovideswirelessservicewithinageographicareaor
structure

Issue:28

405

GeneralGlossary

distributed architecture
networkarchitectureinwhichtherearenofixedconnectionsbetweenanynetwork
elements

distributed calculation
featureusedtooptimiseworkstationresourceusageandcalculationtimebysharing
time-consumingoperationsamongtheworkstationsinalocalnetworkarea

distributed component object model; DCOM


language-independentcomponentarchitecturemeanttobeageneral-purposeobjectorientedmeansfortoencapsulatecommonlyusedfunctionsandservices

distributed computer unit


computerunitwhoseresourcesaresemipermanentlyordynamicallyconfiguredfor
certainexternaltransmissioninterfaces

distributed configuration agent


softwarethatreceivesservicerequestsfromacentralprocessandexecutesthe
requestedcommand

distributed database; DDB


logicallyuniformdatabaselocatedatseveralpointsofacomputernetwork

distributed database management system; DDBMS


generalsoftwareforcontrollingadistributeddatabase

distributed database procedure


databaseprocedurewhoseexecutionisdividedintoseveraldatabasenodes

distributed database system; DDBS


databasesystemwherethedatabaseorthegeneralsoftwarecontrollingitissharedby
differentpointsinacomputernetwork

distributed feedback laser transmitter; DFB laser transmitter


lasertransmitterthathasasinglelongitudinalwavelengthmodeproducedbya
corrugatedanddistributedgratingresonatorontheactiveregion

406

Issue:28

GeneralGlossary

distributed frame alignment signal


framealignmentsignalwhosesignalelementsoccupynon-consecutivedigittimeslots

distributed functional plane; DFP; IN distributed functional plane


planeintheINconceptualmodelthatcontainsfunctionalentitiesandrelationships

distributed item
inadistributeddatabase,anitemwhichhasatleastoneuniqueidentifierandwhichis
locatedinasingledatabasefragment

distributed multiradio architecture


distributedarchitectureofanAll-IPradioaccessnetwork(RAN)inwhichboth
GSM/EDGEandWCDMAaresupported,andthelocationofthefunctionsensures
optimumperformance

distributed part; DP; distributed part of the alarm system


partofthealarmsystemwhichprovidesaninterfaceforapplicationstoraiseandclear
alarms

distributed part of statistics


statisticsfunctionsthataremeantforreal-timehandlingofsignallingmessagesandthat
areimplementedinadistributedmannerincallcontrolcomputersorothersignalling
units

distributed part of the signalling connection control part


softwarethatisdistributedtocomputerunitsanddesignedforthereal-timehandlingof
connectionlessorconnection-orientedsignallingmessages

distributed queue dual bus; DQDB


cellrelaythatpermitsmultiplesystemstointerconnectusingtwounidirectionallogical
buses

distributed replicated block device; DRBD


Linux-basedsoftwarecomponentthatcanbeusedtoreplaceasharedstoragesystem
withnetworkedmirroringandsomakeitpossibletomaintainconsistencyofdataamong
multiplesystemsinanetwork

Issue:28

407

GeneralGlossary

distributed routing
routinginwhichanetworkelementhasseveralopenshortestpathfirst(OSPF)daemons
runningindifferentunitsandlookslikeaclusterofseparaterouterstootherIProuting
devicesinthenetwork

distributed site
sitesolutionwherethedistancebetweenthesystemmoduleandRFmodulesorremote
radioheadscanbeupto15kilometres

distributed transaction
databasetransactionwhichisexecutedinseveralnetworksites

distribution; distribution application


useofabroadbandserviceorchannelfortransferringaudio,video,orotherinformation
toauseroranumberofuserswhowillnotbeexpectedtoapplypost-production
processingtotheinformation

distribution list; distrib. list; mailing list; list


listofaddresseswhichisusedtosendthesamemessagetoallthelistedparticipantsat
thesametime

distribution list application; DLA


applicationthatfunctionsasadistributionlistprocessorandmessageforwarderbetween
aserviceproviderandaservicesubscriber,enablingthesendingofmessagestoa
groupofsubscribersbyusingtheinternetmailormobile-originatedshortmessages
(MO-SM)

distribution list application back information processor; DLAB


applicationthatisusedtoforwardthesubscriber'smessagestotheserviceprovider
whenthesubscriberswhohavereceivedthemessagessubmittedtoadistributionlist
wanttosendareplytotheirserviceproviderdn

distribution service
servicecharacterisedbytheunidirectionalflowofinformationfromagivenpointinthe
networktootherlocations

distribution service without user individual presentation control


distributionservicewhichuserscanaccesswithouthavinganycontroloverthestartand
orderofthepresentationofthedistributedinformation

408

Issue:28

GeneralGlossary

distribution service with user individual presentation control


distributionserviceinwhichtheinformationisprovidedasasequenceofinformation
entities,forexample,frameswithcyclicalrepetition,sothattheusercanselectindividual
informationentitiesandcontrolthestartandorderoftheinformation

distribution tier
logicallayerofadistributedsystemthatisresponsiblefordistributingtheclientrequest
tothecorrectdatarepositories

distributor
processwhichimplementsthecentralisedpartofadatabase

distributor API; DAPI; distributor application programming interface


applicationprogramminginterfaceinacharginggatewaythatisusedtogetthecharging
records(CDR)fromthequeuesandsendthemtoaCDRpost-processingsystemwitha
definedtransferprotocol

disturbance observation
transient,non-recurrentdisturbanceinthesystem,detectedbythesupervisionor
applicationprogramblocks

diversion bypass
PBXfeaturesupportedbythedigitalprivatenetworksignallingsystem(DPNSS)protocol
requestingthatcallforwardingisignored

diversity antenna
antennathatiscapableofswitchingoperationfromoneworkingelementtoanotherin
whichthereceivedsignalisstronger

diversity combining
techniquethatisappliedtocombinethemultiplereceivedsignalsofadiversityreception
deviceintoasingleimprovedsignal

diversity gain
ratioofthesignalfieldstrengthobtainedbydiversitycombiningtothesignalstrength
obtainedbyasinglepath

diversity handover; DHO; diversity handoff /US/


typeofhandoverthatmakesuseofmacro-diversitytechniques

Issue:28

409

GeneralGlossary

diversity improvement
improvementofthequalityofcommunicationwhenusingdiversityreceptioninsteadof
singlereception

diversity reception
methodofreceptioninwhichasingleoutputsignalisderivedfromacombinationof,or
selectionfrom,apluralityoftransmissionchannelsorpaths

diverted call; transferred call


callwhichhascomethroughtheautomaticcalldistributionandwhichanattendanthas
transferredtoanannouncement,toanotherservicenumber,toanotherattendantortoa
supervisor

DLSC interface
inadeliveryserver,aninternalinterfacebetweenthedeliveryservercore(DLSC)and
digitalrightsmanagementmodule(DRMM),contentmanagementmodule(CMM),or
contentsecuritymodule(CSM);oranexternalinterfacebetweenthedeliveryservercore
andexternalserversandsolutions

DLS cluster
clusterwhichincludesseveraldeliveryserver(DLS)instancesanddatabasesinstalled
onanumberofphysicalmachines

DMA-channel
channelusedfortransmittingdatapastthecentralmemory

Dm channel; Dm
ISDND-channelappliedtomobileservice

DMS
degrees,minutes,andsecondsformatusedforspecifyingalocation

DMX byte order


orderinwhichthebytesthatbelongtolarger-than-bytedatablocksarestoredinDMX
computerunitmemoryandtransferredinDMXmessages

DMX identity; DMX process identity


uniqueidentifierforaDMXprocessinsideasinglecomputerconsistingofDMXfamily
identifier,processidentifierandfocusvalue

410

Issue:28

GeneralGlossary

DMX message
operatingsystemmessagesentinsidetheDX200system

DMX name service


applicationprogramminginterface(API)whichallowsprogramblockstosearchforthe
providersofspecificDMXmessagebasedservices,andadvertisetheirownservices
globally

DMX operating system; DMX


proprietaryoperatingsystemthatisusedinDX200computerunits

DN mapping
basictransformationbetweenalocaldistinguishednameandafullyqualifieddomain
name

DNS client
applicationthatusesdomainnameserverstocarryoutnameresolution

DNS/ENUM
systemformappingtheE.164numberspaceaddressesintothedomainnamesystem

DNS management server


primaryserverofthedomainnamesystem(DNS)zonethatislocatedintheoperations
supportsystemandinwhichtheDNSinformationismanaged

DNS name space


namespaceofthedomainsthatcombinetoformacompletedomainnameinadomain
namesystem(DNS)

DNS resolver
programthatextractsinformationfromnameserversinresponsetoclientrequests

DNS security; DNSSEC; domain name system security


domainnamesystemwithsecurityextensionssuchasdigitalsignatures,cryptographic
keys,dataintegrityanddataoriginauthentication

Issue:28

411

GeneralGlossary

docking mode; mode


modeofagraphicaluserinterfacecomponentthatisdisplayedinthetabbedpartofa
window

documentation access
intheOSSapplicationplatform,aservicethatprovidesstorageofandaccesstothe
onlinecustomerdocumentation

document icon
iconrepresentingadocumentwindowthathasbeenminimised

document instance; instance


unitofinformationdefinedbyonedocumenttypedefinition

document object model; DOM


platform-andlanguage-neutralinterfacethatallowsprogramsandscriptstodynamically
accessandupdatethecontent,structure,andstyleofdocuments

domain
partofthedomainnamesystem(DNS)naminghierarchy

domain-agnostic application
applicationthatenablesoperationstoberuninanydomainindependentlyoftheused
networktechnology

domain format identifier; DFI


fieldofthedomainspecificpartofanaddressusedtodefinethetypeofaddresscarried
intheIDfield

domain model
definitionofthefunctions,objects,data,requirements,relationships,andvariationsina
particularnetworkdomain

domain name
addressofanetworkconnectionthatidentifiestheownerofthataddressina
hierarchicalformat:server.organization.type

412

Issue:28

GeneralGlossary

domain name component; DC


inadistinguishedname(DN),anattributethatisusedtoconverttheDNintoafully
qualifieddomainnamethatfollowsthedomainnamesystem(DNS)

domain name server; DNS; GPRS domain name server


elementoftheGPRSbackbonenetworkintowhichtherelationbetweenthelocation
areacode(LAC)andtheSGSNIPaddressissaved

domain name server; DNS; name server


serverthatresolvestheIPaddressorIPaddressesofthecorrespondinginternet
address

domain name service; DNS


servicewhichmapsfullyqualifieddomainnamestoIPaddressesandviceversa

domain name space


tree-structuredhierarchywhichcontainsallthehostnamesinthedomainnamesystem

domain name system; DNS


systemthatprovidesareplicateddataqueryservicethatinvolvesthetranslationofhost
namesintoIPaddressesandviceversa

domain name system zone; DNS zone


partofadomainforwhichanindividualdomainnameserverisresponsible

domain-specific access class restriction; DSACR


featurethatoffersthepossibilitytoregulateaccesstothenetworkbyusingseparate
accessclassbarringlistsforcircuit-switchedandpacket-switcheddomain

Domain Specific Part; DSP


partoftheNSAPaddress,whichisallocatedtotheoperatorofthenetwork

domain-specific part; DSP


partoftheNSAPaddressrelevanttothedomainwhichhasbeenaccessedbeyondthe
domainspecifiedwiththeinitialdomainidentifier(IDI)

Issue:28

413

GeneralGlossary

domain transfer function; DTF


functionthatsupportsvoicecallcontinuitybetweenthecircuit-switchedandIP
multimediasubsystemdomainsbyperformingthevoicecalltransfer

dominance area
areawherethesignallevelofthetransmitterishigherthanthesignallevelofallthe
othertransmittersofthenetwork

dominant role; DR
replicationmethodwherebythetrafficisreturnedautomaticallytotheprimaryhome
locationregisterwhenitstartsworkingagain

dongle
hardwarethatisconnectedtoacomputertoauthenticateandauthorisetheuseof
software

donor exchange
exchangewherethesubscriberwasconnectedbeforebeingported

donor network
initialnetworkwhereanumberwasallocatedbeforebeingported

do not disturb; do not disturb service


servicewhichenablesausertoforwardincomingcallstoanannouncementortoa
centralisedservicelocation

do not disturb; DnD; ISB; incoming PoC session barring; incoming session
barring
PoCservicesettingthatblocksallincomingsessionrequeststoauser,andthat
preventstheuserfrommakinganycalls

Doppler shift
magnitudeofthechangeinfrequencyofasignalorwavelengthofawave,causedbya
changeinthedistancebetweenthesourceandthereceiver

DOSDX
MS-DOSsoftwarethatenablestheusertohandleDX200floppydisksinanMS-DOS
environment

414

Issue:28

GeneralGlossary

dotted decimal notation; dotted quad notation


syntacticrepresentationfora32-bitintegerthatconsistsoffour8-bitnumberswrittenin
base10withperiods(dots)separatingthem

double
tosecureoperationbyusingtwoparalleldevices,circuitsorsystems

double density
featureofafloppydisktodoublethenumberoftracksoneachdisktherebyreducingthe
accesstimeanddoublingthecapacity

double EAP
authenticationmethodinwhichthedatathatisauthenticatedwiththeExtensible
AuthenticationProtocol(EAP)isauthenticatedagainwithEAP

double-ended synchronisation /GB/ ; double-ended synchronization /US/


methodofsynchronisingaspecifiedsynchronisationnodewithrespecttoanother
synchronisationnodeinwhichsynchronisationinformationatthespecifiednodeis
derivedbycomparingthephasedifferencebetweenthelocalclockandtheincoming
digitalsignalfromtheothernode,withthephasedifferenceattheothernodebetweenits
localclockandthedigitalsignalincomingfromthespecifiednode

double superheterodyne receiver


receiverequippedwithtwointermediatefrequencies

double superheterodyne transmitter


transmitterequippedwithtwointermediatefrequencies

double talk
simultaneousoccurrenceofnearendandfarendspeech

double-talk detector; DTD


functionthatswitchesoffthenon-linearprocessorintheechocancellerwhennear-end
speechispresent

double telephone number; by-pass number


facilitywhichenablestheconnectionoftwotelephonenumbers,thedirectorynumber
andasecretnumber,tothesamesubscriberline

Issue:28

415

GeneralGlossary

double word; dword


numericentitycomprisingtwicethenumberofbitscontainedinanormalcomputerword

downlink; DL; forward link


physicallinkfromthetransmittingbasetransceiverstationtowardsthereceivingmobile
station

downlink
connectionfromtheIPnetworkdowntotheswitch

downlink advanced receiver performance; DARP


methodtoreduceinterferencebydetectingunwantedsignalsinacellandsuppressing
them

downlink channel descriptor; DCD


mediumaccesscontrol(MAC)messagethatdescribesthephysicallayercharacteristics
ofadownlinkchannel

downlink control information; DCI


controlinformationthatistransmittedinthephysicaldownlinkcontrolchannel

downlink data threshold


inchargingconfiguration,thenumberofbytesinthedownlinkwhichcausescharging
record(CDR)triggeringwhenitisreachedforaPDPcontextofanormaluser

downlink direct transfer


directtransferprocedureinwhichNASsignallingmessagesarecarriedfromthemobility
managemententitytotheuserequipment

downlink discontinuous transmission; downlink DTX


transmissionmodeinwhichthebasetransceiverstationalwaysusesdiscontinuous
downlinkbursts,andinwhichdiscontinuoustransmission(DTX)isusedonthemain
carrier

downlink diversity; transmit diversity


transmissionmodeinwhichthebasetransceiverstationutilisesmorethanone
transmitteronasingleradiochannel

416

Issue:28

GeneralGlossary

downlink interval usage code; DIUC; DL interval usage code


downlink-specificcodethatidentifiesaparticularburstprofilefortheuseofadownlinkor
uplinktransmissioninterval

downlink iteration
iterationdoneinthedownlinktofind,forexample,thecorrectcelltransmissionpowerfor
eachmobilestation,thebestserverandtheoutage

downlink load control


overloadcontrolusedfordecidingwhichmobilestationsgotooutagewhenthesystem
isoverloaded

downlink pilot time-slot; DwPTS


time-slotthatisusedfordownlinksynchronisationandinitialcellsearch

downlink reference signal transmit power


linearaverageofthepoweroftheresourceelementsthatcarrycell-specificreference
signalsthataretransmittedbytheevolvednodeBwithinitsoperatingsystembandwidth

downlink shared channel; DSCH


downlinktransportchannelwhichisintendedtocarrydedicateduserdataandcontrol
information,andwhichcanbesharedamongseveralusers

downlink shared data channel; DL-SCH


downlinksharedchannelthatisusedtotransmitpacketdatatothemobileterminal

downlink TBF; DL TBF


temporaryblockflow(TBF)fromabasetransceiverstationtoamobileterminal

download (verb); downloading


totransferdataorprogramsfromaservertoalocalsystem

download descriptor file; download descriptor; DD file


filecontainingmetadataaboutthecontenttobedownloadedandinstructionstothe
downloadagentinthedeviceonhowtodownloadthemediaobject

Issue:28

417

GeneralGlossary

download item
objecttransmittedduringonedownloadtransaction

download model
modelwhichspecifiesroutinesaccordingtowhichtheitemwillbedownloaded

download provisioning interface; DPI; delivery server's download


provisioning interface
HTTPinterfaceinthedeliveryserverthroughwhichaservicecandynamicallysubmita
downloadworkordertodeliveryserverinordertogeneratedownloadURLs

download request
requestforadownloadtransactionwhichincludesonecallandtypicallycausesone
response

download server; DLS


serverthatisresponsibleforthedownloadtransactionfromtheserver'sperspective

download service
servicethathandlesthedownloadingoffilesfromtheweb

download transaction; content download transaction; transaction


transactionwhichstartswhenadownloadrequestissubmitted,andendseitherwhen
theterminalhassuccessfullyreceivedtheitem,orwhenthedownloadeventis
acknowledgedbytheterminal

download transaction interface


HTTPinterfacewhichallowstheuserstodownloadcontenttotheirterminals

download transaction object


objectthatcontainsthelocationoftheactualcontenttobedownloadedinthedownload
transaction

download URL
URLaddressinservice,identifyingadownloadtransactionthatistakingplacethrough
thedeliveryserver

418

Issue:28

GeneralGlossary

download work order; work order; download provisioning request


requestthataservicemakestothedeliveryserverandthatcontainsalltheinformation
requiredtocreateacompleteticket

downstream
directionfromthenodetonetwork

downstream suppression
mutingofallspeechwhichissenttoauserwhoisspeaking

down time; downtime


timeintervalduringwhichanitemisinadownstate

doxygen
open-sourcedocumentationsystemforCandC++programminglanguages,Java,
interfacedefinitionlanguage,andabstractsyntaxnotationone

DP Analysed_Information; DP3; Analysed_Information


detectionpoint(DP)thatindicatestheroutingaddressavailabilityandthenatureof
addressindicator

DP Collected_Info; DP2; Collected_Info


detectionpoint(DP)thatindicateswhethertheoriginatingCAMELsubscription
informationisactiveandanalysed

DPNSS1/DASS2 type D-channel


Dchannelwhichimplementsthedatatransmissiontoprivateautomaticbranch
exchanges(PABX)

DP Route_Select_Failure; DP4; Route_Select_Failure


detectionpoint(DP)thatindicatesthatallthealternativerouteshavebeentriedoutand
theconnectionset-uphasfailed

D reference point; D interface


interfacebetweenthevisitorlocationregister(VLR)andthehomesubscriberserver
(HSS)

Issue:28

419

GeneralGlossary

drift
generallyslow,temporalchangeofaproperty,suchasfrequencyorvoltagelevel,ina
certaindirection

drift BTS
basetransceiverstation(BTS)whichmanagesphysicalresourceswithinacell

drift radio network controller; DRNC; drift RNC; drifting RNC


radionetworkcontroller(RNC)ofadriftradionetworksubsystem(DRNS)thatsupports
theservingRNCwithradioresourceswhentheconnectionbetweentheradioaccess
network(RAN)andthemobilestation(MS)needstousethecellscontrolledbythisRNC

drift RNS; DRNS; drift radio network subsystem


radionetworksubsystem(RNS)thatsupportstheservingRNSwithradioresources
whentheconnectionbetweentheUMTSterrestrialradioaccessnetwork(UTRAN)and
themobilestationneedtousethecellorcellscontrolledbythisRNS

drift RNTI; D-RNTI; drifting RNTI


radionetworktemporaryidentifier(RNTI)usedbytheservingradionetworkcontroller
(RNC)toidentifythemobilestation(MS)tothedriftRNC

driver; device driver


programthatimplementshardware-relatedlow-levelservices

DRM content; DRM-protected content; DRM object


digitalcontentthatisconsumedaccordingtoasetofrights

DRM content format; DCF; digital content format; content format


encryptedformatofcontentwhichisobtainedbyencryptingthemediaobjectsusing
keysandaspecifiedalgorithm

DRM forward lock; forward-lock; forward lock


OpenMobileAlliance(OMA)specifiedfunctionthatenablestheserviceproviderto
configurecontenttypesthatarenotallowedtobeforwardedorcarboncopied

DRM message
messagecontainingamediaobjectandanoptionalrightsobject

420

Issue:28

GeneralGlossary

DRMM user interface; DRMM UI


web-baseduserinterfaceforcarryingouttheadministrationandmonitoringtasksinthe
digitalrightsmanagementmodule(DRMM)

DRM option
setofpermissionsandconstraintsthatdefinehowtheusermayusethecontent

drop-down arrow
arrowbuttonusedforopeningalistofoptions

drop-down list; dropdown list box; list box


ingraphicaluserinterfaces,alistboxwithalistofoptionsfortheusertoselectfrom

dropout
lossofsignalthatoccurswhentheuserofamobilestationpassesthroughanarea
wheretheradiosignalisblockedorreducedbygeographicalorstructuralobstructions

dropped octets
counterthatindicatesthenumberofframeprotocolpayloadbytesthataredroppeddue
toAAL2prioritisationbufferoverflow

dropper
devicethatperformspolicing

drop precedence
amongassuredforwardingPHBgroups,avaluethatdeterminesapacket'sdiscard
probabilityincaseofcongestion

DRX cycle; discontinuous reception cycle


individualtimeintervalbetweenreadingtwoconsecutivepiecesofinitialpaging
informationforspecificmobilestation

dry loop
featurewhichallowsaPSTN/ISDNinterfacetobeisolatedfromthesubscriberloop,after
whichitcanbetested

Issue:28

421

GeneralGlossary

DSL modem; xDSL modem


modemthatisusedtocreateadataconnectionviatheexistingtelephonelinesusinga
digitalsubscriberline(DSL)

DSP measurement
measurementthatprovidesstatisticalinformationontheuseandbehaviourofdigital
signalprocessors(DSP)inanetworkelement

DSP packet forwarder service


serviceforforwardingpacketsbetweenanytypesofconnectionsinadigitalsignal
processor(DSP)

DSP resource management


processofmanagingthesignalprocessingresourcesofanetworkelement

DSP resource manager; SPRM; signal processing resource manager


featurebywhichthesignalprocessingresourcesofanetworkelementcanbemanaged

DSP resource measurement; DSP performance measurement


measurementthatprovidesstatisticalinformationonmissedandsuccessfulcalls
handledbythesignalprocessingresourcemanager,andinformationonongoing
servicesandfreeresources

DSP service pooling


methodthatenablesoptimaluseofdigitalsignalprocessor(DSP)applicationand
platformresourcesbydefiningthatcertainDSPunitsprovideonlycertainDSPservices

DSP statistics
featurewhichisrequiredtogetstatisticalinformationonmissedandsucceededcalls
handledbythesignalprocessingresourcemanager(SPRM),andtogetinformationon
ongoingservicesandfreeresources

DTL originator
firstswitchingsystemwithintheentireprivatenetwork-networkinterface(PNNI)routing
domaintobuildtheinitialdesignatedtransitlist(DTL)stackforagivenconnection

DTMF codec
codecthatisusedtoencodeanddecodeDTMFtonessothattheycanbetransferredin
avoicecallasRTPdatapackets

422

Issue:28

GeneralGlossary

DTMF detection package


H.248packagethatdefinesthebasicdual-tonemultifrequency(DTMF)tonesdetection

DTMF dialling /GB/; DTMF dialing /US/


meansoftransferringdiallinginformationfromtheusertotheexchangebymeansof
dualtonemulti-frequencypulses

dual-band BTS configuration


configurationthatallowstheuseofGSM/EDGE900/1800,800/1800,and800/1900
transceivercombinationsinthesamebasetransceiverstation(BTS)cabinet

dual-band network operation


optionalfeaturethatsupportstheuseoftwofrequencybandsatatimeinthebase
stationcontroller

dual-cell HSDPA
HSDPAthatusestwoadjacentWCDMAcarrierstotransmitdataforasingleuser
equipment

dual data rate random access memory; DDR-SDRAM; DDR-RAM


randomaccessmemory(RAM)orsynchroniseddynamicrandomaccessmemory
(SDRAM)thattransfersdataonbothclocktransitions

dual Iub
Iubinterfaceinwhichthetrafficissplittotwodifferentpaths,oneoverATMandanother
overIP

dual port memory


memoryusedforinteractionbetweentwounits,whichbothmemoriescanreadandwrite
to

dual-port RAM; DPRAM; dual-port random access memory


randomaccessmemory(RAM)withtwoindependentports,eachofwhichiscapableof
beingreadorwrittensimultaneouslywithandindependentlyoftheotherport

dual-rate traffic channel


trafficchannelthatfunctionsatbothfullandhalfrate

Issue:28

423

GeneralGlossary

dual seizure; double seizure


conditionwhichoccursinatwo-wayoperationwhentwoexchangesattempttoseizethe
samecircuitortimeslotsimultaneously

dual stack; dual-stack


operationalmodeinwhichbothIPv4andIPv6addressesareused

Dual Stack Mobile IPv6; DSMIPv6


extensiontotheMobileIPversion6(IPv6)thatsupportsthecare-ofaddressofthe
InternetProtocolversion4(IPv4)andcarriestheIPv4trafficonbidirectionaltunnels
betweenmobilenodesandtheirhomeagents

dual-tone multifrequency; DTMF


signallingmethodemployingsetcombinationsoftwospecificvoice-bandfrequencies,
oneofwhichisselectedfromagroupoffourlowfrequencies,andtheotherfromagroup
ofthreeorfourrelativelyhighfrequencies

dual transfer mode; DTM


transfermodeinwhichamobilestationissimultaneouslyindedicatedmodeandpacket
transfermode

dummy burst; DB
burstthatistransmittedasafillerinunusedtime-slotsinthecarrier

dump (verb)
towritethecontentsofastorage,orpartofastorage,toadatamediumoranexternal
memory

dumping of a file; dumping


eventinwhichthedatacontentsofadiskfilearefetchedfromamemoryfile

duplex
simultaneoustwo-wayandindependenttransmissioninbothdirections

duplex filter; duplexer filter; duplexer


filterthatisusedtoconnectthetransmitterandreceiveroftheradiorelayequipmentto
theantenna

424

Issue:28

GeneralGlossary

duplex frequency; duplex spacing; transmit to receive spacing


differencebetweentransmittingandreceivingfrequencies

duplex operation
amethodofoperationwherebytransmissionispossiblesimultaneouslyinbothdirections

duplicate address detection; DAD


procedurethatanIPv6hostperformstodeterminethattheaddressitwishestouseon
thelogicallinkisnotalreadyinuse

duplicate CDR prevention; duplicate CDR packet prevention; duplicate


CDR checking; CDR duplicate checking
enhancedGPRStunnellingprotocol(GTP')functioninthecharginggatewayforensuring
thatachargingrecord(CDR)isprocessedonlyonce

duplicated unit
functionalunitthatisdividedintoanactiveunitthatisinworkingstateandatleastone
spareunit

duplicate port interface


interfacethatisprovidedforaredundantunit

durability
remainingoftheresultsofaneventinadatabaseregardlessoferrorsoccurringafter
commitment

duration
predefineddatatypewhichdenotesatimedifference

DVB-H; Digital Video Broadcasting-Handheld


digitalvideobroadcastingstandardthatdetermineshowthesignalistransferredto
mobiledevices

DX error code mapping


featureformappingthevaluesofDXerrorcodestotheerroranddescriptiontexts

Issue:28

425

GeneralGlossary

DX image file; image file


filethatcontainsanexactcopyofthecontentsofaDXfilesystem

Dx interface
interfacebetweenthecallstatecontrolfunctionandsubscriptionlocatorfunction

DX interface; DXI
interfacewhichperformstheapplication-dependentadaptationsandprovidesforits
clientsalogicalviewtotheDXsystem

DX number type
featurethatstandardisestherepresentationandusageofthesequencesofaddress
digitsusedinternallyinaDX200exchangewiththepurposeofprovidingabstract
methodsforhandlingthedigitsequencesandacommonrepresentationfortheirstorage

dynamic Abis
featurethatoptimisestheloadingoftheAbisinterfacebysplittingthepulsecode
modulationbetweenpermanenttime-slotsandadynamicpool

dynamic Abis allocation


functionthatallocatesAbistransmissioncapacitytocellswhenneeded,insteadof
reservingafullfixedtransmissionlinkforeachtransceiver

dynamic Abis enhancement


enhancementthatimprovestheperformanceofdynamicAbisallocationbymodifyingthe
basestationcontrollersinternalresourceallocationproceduresandalgorithms,including
PCUandEDAPresources

dynamic Abis pool; DAP


poolforradiotime-slotsthatrequiremorethan16kbit/stransmissioncapacityfromthe
Abisinterface

dynamic access class restriction


featurethatenablesthenetworkoperatortoprovidetheradionetworkaccessregulation
functionseparatelyintwodifferentlocationareasandthedomain-specificaccessclass
restrictioninfourdifferentlocationareasforbothcircuit-switchedandpacket-switched
service

426

Issue:28

GeneralGlossary

dynamic actor starting


serviceoftheChoruscomputingplatformwhichisresponsibleforstartingloaded
programsinanappropriatestart-upphase

dynamic address; dynamic PDP address


addressbelongingtotheoperatoraddressingspacethatisgiventothemobilestationat
PDPcontextactivationbythegatewayGPRSsupportnode

dynamic allocation; DA
mediumaccessmethodinwhichamobileterminalmonitorsdownlinktrafficforuplink
stateflags(USF)onthetime-slotsthathavebeenallocatedforthemobileterminalin
uplink

dynamically armed detection point; dynamically armed DP


detectionpointthatisarmedbytherequestoftheGSMservicecontrolfunction
(gsmSCF)duringtheexecutionofaservice

dynamically linked library


librarywhoseaddressintheprocessaddressspaceisnotknownuntiltheprocessis
started

dynamically loaded actor


actorwhichisnotstartedaspartofthebootarchive

dynamically partitioned file


workfileofasetofprocesseseachofwhichwritesonlytoadataunitorasetofdata
unitsinthatfile.Therelationsbetweentheprocessesusingaportionofthefileis
establishedpertask

dynamical reference channel; dynamical reference


datachannelusedasareferencechannelagainstwhichanotherdatachannelistested

dynamic attribute
attributethatcanbecreated,modified,anddeletedduringruntime

dynamic bandwidth allocation; DBA


functionthatprovidesarequiredinternalflowcontrolmechanismforanATMswitch

Issue:28

427

GeneralGlossary

dynamic bandwidth management; DBM


bandwidthmanagementprotocolthatcansupportfasteffectiveend-to-endbandwidth
controlforIPtraffictransportedoveranATMnetwork

dynamic buffering for hot billing data


featurewhichoffersawaytousecapacityofthehotdatabuffereffectivelybymakingthe
sizeofthebufferadjustable

dynamic CAC
connectionadmissioncontrolwherethebandwidthallocationtoagroupofconnections
sharingaqueueisinfluencedbythetrafficinotherqueuesdestinedforthesame
outgoinglink

dynamic capacity
capacityofanetworkelementorsystemexpressedasthenumberoftransactionsthat
canbeperformedwithinagivenamountoftime

dynamic CDR format


chargingrecord(CDR)formatinwhichallnecessarycharginginformationofasessionis
storedwithinonechargingrecord

dynamic channel allocation; DCA; dynamic channel management; dynamic


allocation of base station channels
methodthatmakestheuseofradiochannelsinacellularnetworkmoreeffectiveby
directingthemfromonebasestationtoanother,accordingtothetrafficrequirements

dynamic channel selection


techniqueusedinradiotransmissionwhichutilisesafreeradiochannel,appropriateata
time

dynamic charging configuration


chargingconfigurationthatenablesthenetworkoperatortomodifythecharging-related
parameters

dynamic compression
SignallingCompressionbasedmessagecompressionprocessinwhichpreviouslysent
messagesareusedtoimprovecompressionefficiency

428

Issue:28

GeneralGlossary

dynamic computer group


computergroupformedwhenneeded,consistingofcomputersfreeofchoice

dynamic configuration; DynCo


methodofmodifyingtheconfigurationfilesofadministrativetoolsandothercommon
resourceswhenindividualsystemsareinstalledtooruninstalledfromthesystem

dynamic data formatting


featureallowingthecontentofthechargingrecords(CDR)andreportsthatthe
exchangegeneratesaboutconnectionstobechangedwiththeformfileeditor

dynamic deployment data; dynamic deployment


inthecontextofFlexiServer,deploymentdatathatisdependentontheclusterruntime
structureandsize

dynamic disk
diskthatsupportsthespanningofphysicalorlogicalvolumesovermultipledisks

dynamic DNS protocol; DDNS protocol


protocolthatautomateszonedatabaseupdatesofthedomainnamesystem(DNS)viaa
setofupdatemessagesthatareexchangedbetweenauthenticatedserversandclients

dynamic domain name system; DDNS; dynamic DNS


domainnamesystemthatallowsthedomainnamedataheldinadomainnameserverto
beupdatedinrealtime

dynamic downlink diversity; DDD


transmissionmodeinwhichonlythetime-slotsthatareofbadqualityareduplicated
insteadofduplicatingeverytime-slot

dynamic executable script


executableservicescriptthathasvariabledata,suchasparameters

dynamic flow control


flowcontrolforhigh-speeddownlinkpacketaccess(HSDPA)trafficbetweentheAAL2
andMAClayersintheradionetworkcontroller(RNC)thatpreventspacketdropsin
AAL2buffersintheRNCandincreasessystemperformanceandend-userqualityof
service

Issue:28

429

GeneralGlossary

dynamic frequency and channel allocation; DFCA; dynamic frequency and


channel assignment
functionthatprovidesadesirablecarrier-to-interferenceratio(CIR)foreveryconnection
byassigningtheradiochanneldynamicallybasedondownlinkmeasurementreports,
cell-levelCIRstatistics,andtheknowledgeoftheusedradiochannelsinthesurrounding
cells

Dynamic Host Configuration Protocol; DHCP


protocolusedfordynamicIPaddressallocation

dynamic invocation interface; DII


applicationprogramminginterface(API)thatallowsaclienttomakedynamicinvocations
onremotecommonobjectrequestbrokerarchitecture(CORBA)objects

dynamic IP configuration
GboverIPconfigurationinwhichonlyoneIPaddressandUserDatagramProtocol
(UDP)portintheremoteservingGPRSsupportnode(SGSN)isneededtoestablishthe
networkservicevirtualconnectionsontheGbinterface

dynamic Iub
advancedIubinterfacewhichenablesthedimensioningoftheratioofradionetwork
controllers(RNC)andbasetransceiverstations(BTS)basedontheaverageloadofthe
basetransceiverstations

dynamic library
libraryintheChorusOSoperatingsystemthatisloadedatruntimeandisnotincludedin
theexecutablefile

dynamic link library; DLL


functionlibrarythatcanbeloadedintomemoryonceandcalledbyoneormore
applicationssothattheoperatingsystemdynamicallyresolvestheentrypoints,orthe
addressesofthecalledroutines,atruntime

dynamic load sharing; LB; load balancing; distributed load sharing


sophisticatedtypeofloadsharinginwhichtheloadrateismeasuredconstantlyand
takenintoaccountwhenmakingroutingdecisions,sothatnosingledeviceorroutegets
overwhelmed

dynamic memory; dynamic storage


memorythatdependsontimeorsituationorchangesconstantlyorveryoften

430

Issue:28

GeneralGlossary

dynamic memory management


managementofmemoryinanobjectcomputerwithmeansthatallowforreuseof
memoryspaceoncereservedandreleased

Dynamic Menu Control Protocol; DMCP


protocolwhichenablesover-the-airupdateofthemobilephonemenustructure

dynamic message
messagethecontentandlengthofwhichcanchangeindifferentphasesofthecall

dynamic mobile address


IPaddressthatisvalidonlyduringPDPcontextactivation

dynamic node equipment n x 2 Mbit/s; DN2


nodeequipmentthatenablesflexibleandnon-blockedconnectionandbranchingof
subratechannelsinthe30/31-channelframestructureofa2Mbit/ssystem

dynamic parameter guidance


parameterguidancewherethesemanticinformationoftheguidancetextdependsonthe
configurationofthesystem

dynamic payload type


payloadtypeinwhichthemappingisdefinedduringsessionset-up,oftenusingthe
SessionInitiationProtocolorReal-TimeStreamingProtocol

dynamic problem class


problemclassthatisautomaticallydeletedwhennocorrespondingproblemsexistinthe
servicequalitymanager(SQM)database

dynamic provisioning
provisioningthatallowsenduserstoactivatenewservicesforthemselvesdirectlyinreal
time

dynamic RAM; DRAM; dynamic random access memory


randomaccessmemorythatstoresinformationincapacitorsthatmustbeperiodically
refreshed

Issue:28

431

GeneralGlossary

dynamic resource allocation; DRA


radioresourcemanagementfunctionthatcoordinatesthetransmissionpowerand
frequenciesusedinacell

dynamic routing
routingthatadjustsautomaticallytonetworktopologyortrafficchanges

dynamic routing for non-hierarchical networks; DRNHN


featurewhichtheoperatorcanusetodefinethattheselectedsubdestinationistheleast
loadedone

dynamic routing key registration


routingkeyregistrationthatallowsIP-basednodestoautomaticallyregisterorderegister
routingkeysandsubsequentlydirecttraffictowardsorawayfromthemselveswithoutthe
needformanualoperatorintervention

dynamic SDCCH
featurethatallowsthebasestationcontrollertoreconfigureatrafficchannelasasetof
stand-alonededicatedcontrolchannels(SDCCH),whentheloadingoftheSDCCHis
high

dynamic skeleton interface; DSI


applicationprogramminginterface(API)thatprovidesawaytodeliverrequestsfroman
objectrequestbroker(ORB)toanobjectimplementationwhenthetypeoftheobject
implementationisnotknownatcompiletime

dynamic subscription provisioning; dynamic provisioning


provisioningasubscriptionthatisdoneinnearlyrealtimeandenforcedwithouthavingto
setupanewPDPcontext

dynamic validation
validationthattheattributeownerorobjectownerperformsforaconfigurableattributeor
objectagainstapredefinedruleset

dynamic web page; dynamic page


webpageinwhichtheinformationispulledfromanoutsidesource

432

Issue:28

GeneralGlossary

7 E
E1; E1 system; European Digital Signal 1; CEPT1
EuropeanPCMsystemthatcarries32channelsina256-bitframetransmittedat2.048
Mbit/sbasicmultiplexrate

E.164
publicnetworkaddressingstandardutilizinguptoamaximumof15digits

E1/T1 converter
devicethatconvertspulsecodemodulationbetweenE1andT1circuitsand,ifrequired,
betweentheA-lawandMu-law

E3; CEPT3
34.368Mbit/srateusedbytheEuropeanCEPTcarriertotransmit16E1splusoverhead

EAP integrity key; EIK


integritykeythatisusedtoprotecttheExtensibleAuthenticationProtocol(EAP)user
authentication,basedonkeysgeneratedduringdeviceauthentication

earliest deadline first scheduling; EDF; earliest deadline first


dynamicschedulingprincipleinwhichtheprocessclosesttoitsdeadlineinthepriority
queueisscheduledforexecutionnext

early call forwarding; ECF


callforwardingbeforethecallhasbeenextendedtothevisitednetwork(VPLMN)ofthe
forwardingsubscriber

early classmark sending; controlled early classmark sending


procedurethatamobileterminalusestoprovideamessageassoonaspossibleafter
accessingthenetwork

early connect
functionthatbringsamobileterminaltotheactivestateassoonasthemobileservices
switchingcentrereceivestheaddresscompletemessageoralertinginformation

Issue:28

433

GeneralGlossary

early IMS security


authenticationmethodwhichthe3GPPhasspecifiedtosupporttheauthenticationof
earlyimplementationsoftheIPmultimediasubsystem(IMS)thatareonlypartly
compliantwiththe3GPPIMS

early media
establishmentmodeofaPoCsession,inwhichthesessioninitiatorisgivena"readyto
speak"indicationwhenthePoCserverhasauthorisedtheset-up,butthetargetterminal
hasnotyetbeenpaged

early packet discard; EPD


mechanismthatsomeATMswitchesusefordiscardingacompleteAAL5framewhena
thresholdcondition,suchasimminentcongestion,ismet

early RAB assignment


RABassignmentprocedurethatisusedtoestablishtheradioaccessbearer(RAB)endto-endbeforetheuserequipmentstartsalerting

ear reference point; ERP


virtualpointforgeometricreferencethatislocatedattheentrancetothelistener'sear

earth fault /GB/ ; ground fault /US/


faultthatiscausedbyaconductorbeingconnectedtoearthorbytheinsulation
resistancetoearthbeingbelowthespecificvalue

Earthquake and Tsunami Warning System; ETWS; Earthquake and


Tsunami Warning Service
publicwarningsystemthatdeliversearthquakeandtsunamirelatedwarningnotifications
throughthe3GPPnetworktomobiledeviceslocatedinnotificationareas

EBHext
externalbalanceholder(EBH)componentoftheOnlineServiceController(OSC)that
implementstheGPRSserviceswitchingfunction(gprsSSF)

EBH interface
interfaceoftheexternalbalanceholder(EBH)thatisusedtotransferchargesandother
typesofaccount-relatedinformationbetweentheOnlineServiceController(OSC)and
anEBH

434

Issue:28

GeneralGlossary

EBH poller
intheOnlineServiceController(OSC),amodulewhichsynchronisestheaccounts
betweentheexternalbalanceholder(EBH)andtheglobalbalancehandler(GBH)by
collectingalltheaccountswhosebalancelevelorexpirystatushasbeenupdatedfrom
theEBH

EBH sweeper
intheOnlineServiceController(OSC),acomponentthatselectsandsendsaggregate
chargestotheexternalbalanceholder(EBH)throughtheEBHinterface

Eb/I0
ratioofsignalenergyperbittointerferenceandnoisedensity

Eb/No; energy per bit-to-noise density ratio; energy per bit-to-noise power
spectral density ratio
ratioindecibels(dB)oftheenergyofeachinformationbittothenoisepowerspectral
density

Eb/Nt
narrowbandsignal-to-interferenceratio(SIR)(bitenergytonarrowbandnoiseratio)

e-business; electronic business


wayofconductingbusinessoperationsbyusingdatanetworks,usuallybyusinginternetbasedapplications

ECCS circuit group; ECCS; ECCS CGR


commonchannelcircuitgroupwhichconsistsoftheterminationIDsofthemedia
gateway

E-channel
channelprimarilyusedtocarrysignallinginformationforcircuitswitchingbytheISDN

echo
inthecontextoftelecommunication,aphenomenoninwhichatelephoneuser,aftera
certaindelay,hearstheirownvoicereflectedback

echo cancellation
transmissionmethodusedindigitaltransmissionsystemsinwhichbi-directional
transmissionoccurssimultaneouslyonthesamelineandinthesamefrequencyband

Issue:28

435

GeneralGlossary

echo cancellation measurement


network-element-specificmeasurementthatcollectsechocancellationinformationfrom
theinterfacesignallingunits

echo canceller /GB/ ; echo canceler /US/; EC


voiceoperateddeviceplacedinthe4-wireportionofacircuitandusedforreducing
near-endechopresentonthesendpathbysubtractinganestimationofthatechofrom
thenear-endecho

echo canceller parameter enhancement /GB/ ; echo canceler parameter


enhancement /US/
featurethatoffersauserinterfacetocontroltheoperationandchangetheparametersof
anechocanceller

echo check; echo checking; echoing


methodofcheckingtheaccuracyoftransmissionofdatabysendingthereceiveddata
backtothesendingendforcomparisonwiththeoriginaldata

echo control device; ECD


devicethatisabletoremovesomeorallofthereturnedechosignalfromavoicecircuit

echo control device indicator


indicatorshowingwhetherornotanechocontroldeviceisincludedintheconnection

echo control information


signallingparameterthatisusedtorequesttheactivationanddeactivationofecho
controldevices,andtorespondtosuchrequests

echo control procedure


procedurewhichisusedonapercallbasistoconveyinformationbetweenexchange
nodesaboutdemandandabilitytoinsertechocontroldevices

echo path
transmissionpathbetweenthereceive-outportandsend-inportofanechocanceller

echo path capacity


maximumechopathdelayforwhichanechocancellerisdesignedtooperate

436

Issue:28

GeneralGlossary

echo path delay


delayduetothedelaysinherentintheechopathtransmissionfacilities

echo request; echo request message


messagesentonapathtoanotherGPRSsupportnode(GSN)orradionetwork
controller(RNC)tofindoutifthepeerGSNorRNCisalive

echo response; echo response message


messagesentasaresponsetoareceivedechorequest

echo return loss; ERL; echo loss; echo attenuation


attenuationofasignalonanechopathduetotransmissionandhybridloss

echo return loss enhancement; ERLE


attenuationoftheechosignalasitpassesthroughthesendpathofanechocanceller

echo suppressor
voice-operateddevicethatisplacedinthe4-wireportionofacircuitandusedfor
insertinglossinthetransmissionpathtosuppressecho.Thepathinwhichthedevice
operatesmaybeanindividualcircuitpathorapathcarryingamultiplexedsignal

Ec/I0
ratioindecibels(dB)ofthepilotenergyaccumulatedoveronePNchipperiod(Ec)tothe
totalpowerspectraldensityinthereceivedbandwidth(I0)

Eclipse file system; EFS


filesystemthatisusedintheEclipseplatformtoremoveimplementationdetailsabout
whatfilesystemisusedtostoredataintheworkspace

Eclipse platform
Java-basedopensourcesoftwareplatformforbuildingintegrateddevelopment
environmentsthatcanbeusedtocreateapplications

Ec/No
ratioofenergypermodulatingbittothenoisespectraldensity

Issue:28

437

GeneralGlossary

e-commerce; EC; electronic commerce


partofe-businessthatdealswithbuyingandsellingproductsandservices,including
electronictransactions

E-DCH absolute grant channel; E-AGCH


sharedenhanceddedicatedtransportchannel(E-DCH)thatallocatesanabsolute
resourceforoneorseveralitemsofuserequipment

E-DCH dedicated physical control channel; E-DPCCH


dedicatedphysicalcontrolchannelthatisusedtocarrythecontrolinformation
associatedwiththeenhanceddedicatedtransportchannel(E-DCH)

E-DCH dedicated physical data channel; E-DPDCH


dedicatedphysicaldatachannelthatisusedtocarrytheenhanceddedicatedtransport
channel(E-DCH)

E-DCH hybrid ARQ indicator channel; E-HICH


enhanceddedicatedtransportchannel(E-DCH)thatcarriespositiveacknowledgement
ornegativeacknowledgementsignallinginformationofthecorrespondinguser
equipment

E-DCH relative grant channel; E-RGCH


enhanceddedicatedtransportchannel(E-DCH)thatallocatesdedicatedresourcestothe
userequipment

EDGE; enhanced data rates for global evolution; enhanced data rates for
GSM evolution
radiointerfacemodulationtechniquethatincreasesHSCSD(high-speedcircuit-switched
data)andGPRS(generalpacketradioservice)datarates

edge device
physicaldevicethatforwardspacketsbetweenlegacyinterworkinginterfacesandATM
interfaces

edge router
routerinanIPnetwork,whichcarriesouttasksthatrelatetoencryption,authentication,
andserviceselection

438

Issue:28

GeneralGlossary

EDP-N service
serviceofaneventdetectionpoint,whichtheINservicelogichasspecifiedasanevent
detectionpointnotification(EDP-N),whenthecallprocessingissuspendedatthis
specifiedpoint

EDP-R service
serviceofaneventdetectionpoint,whichtheINservicelogichasspecifiedasanevent
detectionpointrequest(EDP-R),whenthecallprocessingissuspendedatthisspecified
point

EF address
addressofanISDNsubscriberinaV5interface

effective capacity
actualdatatransfercapacitywhichisavailableforusersandapplications

effective coding rate; ECR


codingrateforaservicethatiscalculatedbydividingthenominalservicebitratebythe
nominalcapacityoftheservice

effective enquiry
operationalstateenquirythatrequestsinformationabouttheoperationalstateofthe
enquiredconnectionandabouttheconnectionsunderneathit

effective isotropic radiated power; EIRP; equivalent isotropic radiated


power; equivalent isotropically radiated power
transmittedpowermultipliedbytheantennagainreferencedtoanidealisotropicradiator

effective radiated power; ERP; equivalent radiated power


transmittedpowermultipliedbytheantennagainreferencedtoahalf-wavedipole

EGPRS; enhanced GPRS


generalpacketradioservice(GPRS)whosedatarateisincreaseduptothreefoldwith
enhanceddataratesforglobalevolution(EDGE)modulation

EGPRS dynamic Abis pool; EDAP


poolbetweenthebasetransceiverstationandbasestationcontrollerthatisdynamically
allocatedin16kbit/sblocksforEDGEdatacalls

Issue:28

439

GeneralGlossary

EGPRS packet channel request; EPCR


messagethatanenhancedgeneralpacketradioservice(EGPRS)capablemobile
terminalsendstoperformanEGPRSone-phaseaccessrequest,EGPRSshortaccess
request,orEGPRStwo-phaseaccessrequest

EGPRS territory downgrade


procedurethatthebasestationcontroller(BSC)useswhenitneedstoreducetheshare
oftime-slotsintheEGPRSterritory,forexample,whenthereisanincreaseinthecircuit
switchedtrafficload

EGPRS territory upgrade


procedurethatthebasestationcontroller(BSC)usestoallocateresourcesfromthe
circuit-switchedterritorytotheEGPRSterritory

egress direction; egress


trafficdirectionoutofanetworkelement

E interface
interfacebetweenmobileservicesswitchingcentres

EIR - CEIR interface; CEIR interface


interfacebetweenanequipmentidentityregister(EIR)andtheCentralEquipment
IdentityRegister(CEIR)

EIR list tracing; list tracing


tracingofallequipmentthatisontheblack,grey,orunknownlistoftheequipment
identityregister(EIR)

EIR statistics
statisticaldataaboutthenumberofmobileterminalsondifferentlistsoftheequipment
identityregister(EIR)andthenumberofrequeststhateachterminalonthelistshas
made

EJB container
containerthatimplementstheEnterpriseJavaBeans(EJB)componentcontractofthe
Java2EnterpriseEdition(J2EE)architecture

440

Issue:28

GeneralGlossary

electrical PDH physical interface; EPPI


functionwhichconvertsanelectricalPDHinterfacesignalintoaninternal-logic-level
PDHsignalandviceversa

electrical SDH physical interface; ESPI


functionwhichconvertsaninternal-logic-levelSTM-NsignalintoanelectricalSTM-N
interfacesignalandviceversa

electrical-to-optical converter; E/O converter; electrical-to optical


transducer; E/O transducer
deviceinwhichamodulatedelectricalsignalisconvertedintoanopticalsignalhaving
theoriginalmodulationinformationcontent

electric echo
echowhichconsistsofreflectedsignalscausedbythenear-endimpedancemismatchat
a2-to-4-wireconversionunit(hybrid)

electromagnetic compatibility; EMC


abilityofequipmentorasystemtofunctionsatisfactorilyinitselectromagnetic
environmentwithoutintroducingintolerableelectromagneticdisturbancestoanythingin
thatenvironment

electromagnetic disturbance
electromagneticphenomenonwhichmaydegradetheperformanceofadevice,
equipmentorsystem,oradverselyaffectlivingorinertmatter

electromagnetic field; EMF


physicalfielddeterminedbythesetoffourvectorswhichcharacterizetheelectricand
magneticstatesofamaterialorvacuum

electromagnetic interference; EMI


degradationoftheperformanceofequipment,atransmissionchannel,orsystemcaused
byelectromagneticdisturbance

electromagnetic radiation
phenomenonbywhichenergyintheformofelectromagneticwavesemanatesfroma
sourceintospace

Issue:28

441

GeneralGlossary

electromagnetic shielding; EMS


shieldingusedtosubstantiallyreducethemagnitudeofelectricandmagneticfieldsfrom
incidentelectromagneticradiation

electronic auction; e-auction; online auction


auctionorganisedusinganelectronicimplementationofbiddingmechanismsalsoknown
fromtraditionalauctions

electronic code book; ECB


basicblockciphermodeinwhicheachplaintextblockisencryptedindependentlyand
oneblockofciphertextisproducedoutofoneblockofplaintext

electronic data interface; EDI


interfacethatisusedforthetransmissionoftransactionaldatabetweencomputer
systems

electronic exchange
exchangesysteminwhichboththecontrolequipmentandswitchingnetworkare
composedofelectroniccomponents

electronic form; e-form


onlinedocumentthatcontainsblankspacesforausertofillinwithrequestedinformation
andthatcanbesubmittedthroughanetwork

electronic identity; electronic ID


informationthatreliablyidentifiesauserinaninformationsystem

electronic magazine; electronic newspaper


publicationregularlyeditedfortheinformationnetworkcontainingtypicalpressmaterial

electronic media; e-media


mediainwhichelectronicsorelectromechanicalenergyisusedsothatuserscanaccess
thecontent

electronic numbering; ENUM; electronic number mapping; telephone


number mapping
distributeddirectorysystemthatisbasedonthedomainnameservice(DNS)andthatis
usedformappingtelephonenumberstowebaddressesorURLaddresses

442

Issue:28

GeneralGlossary

electronic prepaid recharging


rechargethatispaidatapointofsaleandcarriedoutbasedonatextmessagethatthe
salespersonsendsfromadedicatedSIMcardtoapre-definednumber

electronic shopping centre /GB/ ; e-mall /US/; electronic mall /US/


virtualcollectionofe-shopsusuallyenhancedbyacommonumbrella,forexample,a
well-knownbrandoraspecialtheme

elementary basic service group; EBSG


basicservicegroupusedinthesubscriberdatatransfer

elementary cable section


wholeofthephysicaltransmissionmediumbetweenthesectionterminationattheoutput
ofonepieceofequipmentandthesectionterminationattheinputofthefollowingpiece
ofequipment

elementary diagnosis
partofadiagnosticprogramwhichtestsacertainhardwarefunctionorsearchesfor
certainfaulttypes

elementary file; EF
filecontainingaccessconditionsanddataandnootherfiles

elementary procedure; EP
signallingprocedurethatconsistsofaninitiatingmessageandpossiblyaresponse
message,andthatsupportsthefunctionsoftheIuorS1interface

elementary regenerator section; regenerator section


inagivendirectionoftransmission,anelementarycablesectiontogetherwiththe
immediatelyfollowingregenerativerepeater

elementary repeater section


inagivendirectionoftransmission,anelementarycablesectiontogetherwiththe
immediatelyfollowinganaloguerepeater

element configuration
configurationdatawhichiswrittenintheICDservicedirectory(ISD)bythenetwork
elements

Issue:28

443

GeneralGlossary

element configuration management


configurationmanagementatsinglenetworkelementlevelthatincludesthe
managementofconfigurationparametersandplan-basedconfigurationmanagement

element declaration
markupdeclarationthatcontainstheformalspecificationofthepartofanelementtype
definitionthatdealswiththecontentandmarkupminimisation

element management; EM
networkmanagementatthelevelofanindividualnetworkelement

element management framework; EMF


frameworkthatprovidesasetofapplicationprogramminginterfaces(API),system
interfaces,componenttechnologyanddatamanagementforelementmanagement
systems

element management functions; EMF


setoffunctionsforthemanagementofnetworkelementsonanindividualbasis

element management interface; EMI; element manager interface


interfaceforaweb-basednetworkmanagementsystem,usedforcommunication
betweenanetworkelementandmanagementapplication

element management layer; EML


managementlayerwhichmanageseachnetworkelementonanindividualbasisand
supportsanabstractionofthefunctionsprovidedbytheNElayer

element management system; EMS


partofthenetworkmanagementsystemthatprovidesthemanagementfunctionsfora
setofnetworkelements

element management user interface; EM UI


graphicaluserinterface(GUI)formanagingtheconfigurationofanetworkelement

element manager; EM
basictoolforinstallationandoperationalpurposesthatisusedtocontrolandmonitor
onenetworkelement

444

Issue:28

GeneralGlossary

element manager application; EM application


applicationsupportingmanagementtasksperformedinaspecificnetworkelement(NE)

element manager client; EMC; element management client


entitythatusestheelementmanager'sservices

element manager client user; EMC user


userwhousestheelementmanagementinterfacetoconnecttothepushtotalkover
cellular(PoC)systemforperformingoperationandmaintenancetasks

element manager domain


architecturalentityoftheFlexiServerplatformsoftwarethatimplementstheuser
interfaceofFlexiServer-basedproducts

element manager integration framework; EMI; EMI framework


frameworkthatisusedforintegratingnetworkelementmanagementapplicationsin
NetActwiththegoalofofferingeasyaccesstoelementmanagerapplicationsfromthe
NetActuserinterface

element manager platform; EMP; element management platform


functionwhichprovidesaframeworkforbuildinglocalnetworkelementmanagement
interface

element manager tool


partofanelementmanagerthatismeanttomanageoneparticularaspectofanetwork
element

element manager workstation


workstationthatcontainstheinstalledelementmanagerandthatisusedforoperational
tasks

elliptical waveguide
waveguidewhichhasanellipticalcrosssectionandacorrugatedwallgivingitgood
flexibility

EM action log; element manager action log


logfileintheNetworkElementManagementUnit(NEMU)thatcanbeusedtoreadand
writeinformationrelatedtooperation,securityanderrorevents

Issue:28

445

GeneralGlossary

e-mail folder
storageofe-mailmessagesoftheuser

e-mail smart push; ESP; email smart push


serviceoftheapplicationgatewaythatallowssubscriberswithmultimediaphonesto
sendandreceivemultimediamessages(MM)toandfromtheinternetbyperforming
bothinbound(e-mailtoMS)andoutbound(MStoe-mail)conversions

e-mail smart push subscriber; email smart push subscriber


subscriberwhohasamultimediaphoneandhassubscribedtoe-mailsmartpush

e-marketing; electronic marketing


partofe-businessthatdealswithmarketingactivities

e-marketplace; web marketplace


onlineelectronictradinglocation,whichisfacilitatedbyoneorseveralmarketmakers,
andwherebuyersandsellersmeet

embedded adaptive differential pulse code modulation; embedded ADPCM


embeddedADPCMalgorithmsareADPCMalgorithmsthatquantisethedifference
betweentheinputandtheestimatedsignalintocorebitsandenhancementbits

embedded control channel; ECC


channelusingadatacommunicationschannelasthephysicallayerforcommunication
betweenSDHnetworkelements

embedded operations channel; EOC; embedded data communication


channel
channelwhichisprovidedasanintegralpartofacommunicationsfacilityforthepurpose
ofcarryingoperationsmessages

embedded software
softwarethatformsacomponentofsomelargersystemandthatisexpectedtofunction
withouthumanintervention

embedded system; embedded computer system


computersystemwhichisintegraltoalargersystemwhoseprimarypurposeisnot
computational

446

Issue:28

GeneralGlossary

embedded web services interface component; EWSIC


OpenMobileAlliance(OMA)compliantwebservicesinterfacecomponentfornetwork
servers

Embedded Workshop; EWS


ChorusOSoperatingsystemandintegrateddevelopmentenvironmentforcreating
applicationsthatrunonChorusOSorembeddedsystemsbasedonChorusOS

EMB LAN
localareanetwork(LAN)usedinanEthernet-basedmessagebus(EMB)

emergency action
modifiedactionorproceduretobeusedwhennormalactivitycannotre-establishthe
handlingoftraffic

emergency call; emerg. call


callwhichisinitiatedbydiallingaspecialemergencynumber

emergency call indicator


signallingobjectwhichindicatesthattheterminationsandbearerconnectionsinthe
specifiedcontextareassociatedwithanemergencycall

emergency call origin; ECO


numberthatisgiveninsubscriberinformationandthattellstowhichemergencyareathe
subscriberbelongsintheirownMSCarea

emergency call/positioning of caller


featurethatisusedtohandletheemergencyserviceswithinanAll-IPcorenetworkvia
theconnectionprocessingserver

emergency call session control function; E-CSCF


callsessioncontrolfunctionforemergencycallsthathandlestheroutingofemergency
requeststothecorrectemergencyservicecentreorpublicsafetyansweringpoint

emergency changeover
modifiedchangeoverproceduretobeusedwheneverthenormalonecannotbe
accomplished,thatis,incaseofsomefailuresinthesignallingterminalequipmentorin
caseofinaccessibilitybetweenthetwoinvolvedsignallingpoints

Issue:28

447

GeneralGlossary

emergency service; ECS; emergency call service


specialservicesforemergencypurposes,forexample,firealarm,police,orfirstaid

emergency services message entity; ESME


entityintheemergencyservicesnetworkwhichservesasthepointofreferencetoa
mobileservicesswitchingcentre(MSC)forcommonchannelemergencyservices
messaging

emergency services network entity; ESNE


entityintheemergencyservicesnetworkthatservesasthepointofinterfacetoamobile
servicesswitchingcentre(MSC)foravoiceortelecommunicationsdeviceforthedeaf
(TDD)orteletypewriter(TTY)services

emergency services query key; ESQK


ten-digitnon-diallablenumberthatuniquelyidentifiesanongoingemergencycalland
correlatestheemergencycallwiththeassociateddatamessages

emergency services routing digits; ESRD


stringofdigitsthatuniquelyidentifiesaspecificbasestation,cellsite,orsectorinan
emergencycall

emergency services routing key; ESRK


stringofdigitsthatuniquelyidentifiesanongoingemergencycall

emergency session
sessionbetweenauserandanemergencyservice

emergency traffic origin


parameterinthesubscriberdata,theanalysisofwhichleadstoaseparateemergency
traffictree

emergency traffic origins


featurewhichenablestheoperatortodividelocalorRemoteSubscriberStage(RSS)
subscribersofoneexchangeto31differentcategories

emission; electromagnetic emission


phenomenonbywhichelectromagneticenergyemanatesfromasource

448

Issue:28

GeneralGlossary

E&M signalling /GB/ ; E&M signaling /US/


methodofsignallingbetweenjunctionequipmentinanexchangeandasignallingunit
associatedwiththetransmissionequipmentusingtwoleads-areceive(E)leadanda
transmit(M)lead

E&M signalling channel /GB/ ; E&M signaling channel /US/


signallingchannelfortransferringE&Msignallinginformation

E&M signalling unit /GB/ ; E&M signaling unit /US/; E&M signalling
multiplexer /GB/; E&M signaling multiplexer /US/
deviceforconvertingthesignallingusedinFDMequipmentandtransmittedviaa
separatesignallingchannelintosignalsofthesignallingtimeslotofthePCMframe
accordingtothestandardisedmultiframestructure

EMT connection
connectioninwhichtheexternalmessagetransfer(EMT)protocolisusedtotransfer
DMXmessagesbetweentwonetworkelements

emulate (verb)
toimitateacomputersystembyacombinationofhardwareandsoftwarethatallows
programswrittenforonecomputertoberunonanother

emulation
theabilityofadeviceorprogramtomimicanother,correspondingfunction

emulation layer
softwarethatprovidesemulationoffeaturesthatarenotpresentinthesystem

emulator
specialpurposehardwareorsoftwarewhichenablesonemachinetoactasifitwere
another

EM user interface client; EM UI client


elementmanager(EM)applicationthatisusedtoviewthecontentsoftheEMactionlog,
andtosetthefilteringpropertiesforwritingtotheoperationlog

encapsulating delivery style; EDS; encapsulated delivery style


deliverymethodinwhichamobilenodeencapsulatesthepacketsitreceivesanddirects
themattheforeignagent,addingthedestinationaddressinanewheader

Issue:28

449

GeneralGlossary

encapsulating security payload; ESP; IP encapsulating security payload


headerthatprovidesintegrityandconfidentialityforIPdatagramsbyencryptingand
encapsulatingthepayloaddatatobeprotected

encapsulation
actofenclosingadataunitofoneprotocolintoadataunitofanotherprotocol

encapsulation
SGSNfunctionwhichaddsaddressingandcontrollinginformationtoamessagebeforeit
istransferredacrosstheGPRSbackbonenetwork

encapsulation
softwareimplementationmethodinwhichasystemfunctionorasetofdataand
operationsonthatdataareisolatedwithinamoduleandaprecisespecificationisgiven
forthemodule

enchanced RED algorithm; ERED; enhanced random early detection


intheQoSbuffermanagement,anenhancementtorandomearlydetection(RED)that
worksinthebasestationsystemGPRSprotocol(BSSGP)buffer

encoded provisioning instance data; EPD


dataobjectusedtocarrytheencodedvalueofaprovisioninginstance

encoder; ENC
devicethatperformsencoding

encoding; coding
generationofacodewordtorepresentaquantisedvalue

encoding law
lawthatdefinestherelativevaluesofthequantisingintervalsusedinquantisingand
encoding

encryption acceleration
processofacceleratingthecomputingincryptographicoperations

450

Issue:28

GeneralGlossary

encryption function
functionthatisusedtotransformcleartextinputintoaciphertextobjectthecontentsof
whichcannotbeseenorutilisedunlessanalgorithmisappliedtotransformthe
ciphertextobjectbacktocleartextobject

encryption function bit; encryption mode bit; E bit


bitthatisusedtoindicatewhethertheinformationandframechecksequence(FCS)
fieldsoftheunnumberedinformation(UI)frameareencryptedtoprovideuserdata
confidentiality

encryption information
informationelement(IE)thatcontainsthekeysandpermittedalgorithmsusedtocontrol
anyencryptionequipmentattheradionetworkcontroller

encryption key; Ki
dataprotectionkeyusedforprotectingtheconfidentialityofdataitems

encryption key index


indexthatidentifieswhichoneoftheseveralencryptionkeysavailableistheactiveone

end acknowledge PDU; ENDAK PDU


protocoldataunit(PDU)thatisusedtoconfirmthereleaseofaServiceSpecific
ConnectionOrientedProtocol(SSCOP)connection

end bit; E bit


inapacket,abitthatindicatesthatthispacketcontainstheendofaneventwhenits
valueissettoone

end entity
userorequipmentthathasacertificatethatacertificationauthorityhasissued

endless call forwarding loop prevention


featurewhichpreventsmultiplecallsbeingforwardediftheyallconcernoneindividual
subscriberinthecallset-upphase

end message
transactioncapabilitiesmessagethatisusedtoterminateatransactionwithanother
peertransactionuser

Issue:28

451

GeneralGlossary

end office /US/; EO


switchingsystemwhereaccesslinesareterminatedforpurposesofinterconnectionto
eachotherandtotrunks

end of file; EOF


controlcharacterorbyteusedindatacommunicationwhichindicatesthatthelast
characterofafilehasbeenread

end of life treatment; EOL; end of life


environmentallyconscioushandlingofhazardoussubstancessuchasobsolete
electronicequipment

end of line; EOL


characteroracharactersequencewhichisusedtoterminatealineoftext

end of message; EOM


indicatorusedintheATMadaptationlayer(AAL)toidentifythelastATMcellcontaining
informationfromadatapacketthathasbeensegmented

end of optional parameters


fieldinasignallingmessageindicatingthattherearenomoreoptionalparametersinthe
message

end-of-pulsing signal; ST signal


multifrequencysignalthattheoriginatingexchangeusestoindicatethataccordingtothe
digitanalysisthefinaldigithasbeensent

end-of-selection analysis; EOS analysis; end-of-dialling analysis /GB/; endof-dialing analysis /US/
internalcallcontrolanalysiswhichinformsofcallset-upresults(end-of-diallingor
congestion)

end-of-talkburst indicator; end-of-talkburst tone


indicatorthatindicatestothereceivinguserthattheoriginatinguserhasreleasedthe
pushtotalkbutton,sothattheotherscantaketurns

end PDU; END PDU


protocoldataunit(PDU)thatisusedtoreleaseaServiceSpecificConnectionOriented
Protocol(SSCOP)connectionbetweentwopeerentities

452

Issue:28

GeneralGlossary

endpoint; ep
networkreferencepointatwhichacircuit,apath,asection,oravirtualconnection
beginsorends

endpoint group
groupofendpointsforaspecificroutewhichareorganisedaccordingtocertain
characteristics

endpoint name resolution part; ENRP


protocolthatprovidesafault-tolerantreal-timetranslationservicethatmapsanametoa
setoftransportaddressespointingtoaspecificgroupofnetworkedcommunication
endpointsregisteredunderthatname

end station; ES
devicethatenablesthecommunicationbetweenATMendstationsandendstationson
"legacy"LANoramongATMendstations

end system; ES
nodeoftelecommunicationnetworkthattransmitsandreceivesmessages

end system hello; ESH


end-system-originatedpacketthatpassesinformationtoanintermediatesystem

end system identifier; ESI


identifierindomainspecificpartoftheNSAPaddressthatdistinguishesmultiplenodes
atthesamelevelincasethelowerlevelpeergroupispartitioned

end system to intermediate system routing protocol; ES-IS; ES-IS protocol


protocolforconnectingasystemtoatelecommunicationsnetworkwheretheISO
InternetProtocol(IP)isusedforsendingmessages

end-to-end connection
connectionbetweentwoendpoints

end-to-end loopback; ELB


loopbackinwhichacellisinsertedatanATMconnectionendpoint,andswitchedbackat
thecorrespondingfar-endATMconnectionendpoint

Issue:28

453

GeneralGlossary

end-to-end retransmission; EER


retransmissionmodelinwhichalostpacketistransmittedagainusingthewhole
transmissionpathfromthesendertothereceiver

end-to-end signalling /GB/ ; end-to-end signaling /US/


capabilitytotransfersignallinginformationofendpointsignificancedirectlybetween
signallingendpointstoprovidearequestinguserwithabasicorsupplementaryservice

end-to-end supervision
supervisionforensuringthattheconnectionsbetweentheendpointsareworkingas
expectedovertheIPnetwork

end-to-end transfer delay; ETD; end-to-end delay


transferdelaythatcontainsthecumulativedelaysthatoccurredduringpackettransfer

end-user
functionalentityabovethesignallingconnectioncontrolpart(SCCP)upperlayer
boundaryindirectlyusingtheservicesoftheSCCP

end-user class
classificationwhichthenetworkoperatororserviceprovidercandefinefortheendusers

end-user interface
userinterfacefortheend-userstoaccessthesystem

end-user service profile; end-user profile


serviceprofilethatincludesend-useridentificationdataandinformationaboutthe
subscribedservicesandtheirservicesettingsandcharging

end-user session
end-to-endconnectionbetweenusersorbetweenauserandapplications

end-user template
templatethatcanbeusedtoprovideenduserswithapredefinedsetofservices

engineered traffic capacity; engineered transaction processing capacity


trafficcapacityofanetworkelementtakingintoaccountallthecapacityconstraints

454

Issue:28

GeneralGlossary

engineering order-wire; EOW; order-wire


connectionusedtoprovideavoicecommunicationchannelbetweennetworkelements

enhanced automatic frequency control; E-AFC; E-DDAFC; enhanced


automatic frequency correction; enhanced decision-directed AFC
featurethatimprovestheEDGEreceiveralgorithmtosupportfast-movingusersof
speechanddataservicesthatarebasedonGaussianminimumshiftkeying

enhanced circuit switched data; ECSD


basestationcontroller(BSC)featurethatprovidesincreaseddataratesintheradio
interfaceforend-userapplications

enhanced coverage by frequency hopping; ECFH


frequencyhoppingwhichprovideshandoversbetweenhigh-powerandlow-power
transceiverswithoutdeterioratingthequalityoftheradionetwork

enhanced coverage by frequency hopping; ECFH


featureinthebasestationcontrollerthatsupportsintelligentcoverageenhancement
solutionstoallowoperatorstousetransceiverswithdifferenttransmittingpower

enhanced dedicated transport channel; E-DCH; enhanced DCH


dedicatedtransportchannelthatisofanewtypeoranenhancementtoanexisting
dedicatedtransportchannel

enhanced event control function


functionthatisanenhancementtotheeventreportmanagementfunctionandprovides
thecapabilityforconfiguringmanagedsystemstobeabletoretaineventsincasethe
connectiontothemanagementsystemislost

enhanced full rate; EFR


speechcodingwheretheinformationbitsfirstgothroughpreliminarychannelcodingand
thenthroughthebasicchannelcoding

enhanced full-rate speech codec; EFR; EFRC; enhanced full-rate codec


codecprovidinggoodspeechqualitytotheenduserbyselectingcorrectresources,
basedontheinformationreceivedfromthemobilestation(MS),andrelayingthe
informationtothebasestationsystem(BSS)

Issue:28

455

GeneralGlossary

Enhanced GPRS Tunnelling Protocol; GTP'; GPRS Charging Protocol


GPRSTunnellingProtocolthatincludesfunctionsforcharging

Enhanced GPRS Tunnelling Protocol version 2; GPR' v2; GPR' 2; GTP'


version 2
improvedversionoftheEnhancedGPRSTunnellingProtocol(GTP')

enhanced High Rate Packet Data; eHRPD


enhancementof1xEV-DOthatenablesLTEtoCDMAhandover

Enhanced Hot Standby; HSB/E


equipmentredundancywhereoneofthetransceiversiscontinuouslyonandtheantenna
ispoweredupwhereasthelocaloscillatorforthestandbytransceiverisoff.Intheevent
ofafaultintheoperatingequipment,thestandbyequipmenttakesoverandthefaulty
equipmentisautomaticallyswitchedoff

enhanced measurement report; EMR


measurementreportthatthemobileterminalprovidestothesystemandthatincludes
enhancedmeasurementsabouttheservingandadjacentcells

enhanced MSISDN dialling


MSISDNdiallinginwhichthesystemmakesaquerytoanexternalENUM-DNSserver
usingtheMSISDNnumberasinputandreceivesthecorrespondingSIPuniform
resourceidentifier(SIPURI)valueinreturn

enhanced multi-level precedence and pre-emption; eMLPP


multi-levelprecedenceandpre-emptionthatthenetworkcanuseinacongestion
situationtoreleaseorputintoaqueueconnectionsintheradiochannel,andtoadd
prioritytodataandvideocallsinordertoguaranteeservicequality

enhanced observed time difference; E-OTD


positioningmethodinwhichthelocationofamobilestationiscalculated,basedonthe
measurementoftimedifferenceofarrivalofburstsfromnearbypairsofbasetransceiver
stations(BTS)

enhanced PDF; ePDF


policydecisionfunction(PDF)thatprovidesthebasicchargingrulesfunctionand
service-basedlocalpolicyproceduresovertheGoandGxinterfaces,andsupports
tokenlessbindingmechanisms

456

Issue:28

GeneralGlossary

enhanced quality of service; EQoS; enhanced QoS


featurethatconsistsofasetofenhancementsthatarenecessaryforsupportingtraffic
classesandguaranteedbitrateservices

enhanced tariffing
tariffinginwhichthetariffanalysisisdoneintheservicecontrolpoint(SCP)usingtariff
modelsandaccordingtothisanalysis,theSCPsetsthetariffinthemobileservices
switchingcentre(MSC)bysendingachargingzoneore-parameters

enhancement build
softwarebuildthatcontainsenhancementsforthewholedeliveredsoftwarebuild

enquiry call; hold for enquiry


partofthethreepartyservice(full)whichenablesasubscriberwhoisengagedonan
establishedcalltosetupanothercalltoathirdparty,switchfromonecalltotheotheras
required,releaseonecallandretaintheotherorintroduceacommonthreeway
conversation(see:three-wayconversation)

enquiry call connection


connectiontothethirdpartysetupbythecontrollingsubscriberwithanenquirycall
duringanestablishedcall

enquiry call to attendant; enquiry call to operator


enquirycalltocentrexattendantbymeansofattendantincallidentifier

Enterprise Archive file; EAR file


JavaArchivefilethatisusedfordeployingaJava2EnterpriseEdition(J2EE)
applications

enterprise bean
server-sidecomponentthatiswrittenintheJavaprogramminglanguageandthat
encapsulatesthebusinesslogicofanapplication

Enterprise Java Beans; EJB; Enterprise Java Beans architecture


componentarchitectureforthedevelopmentanddeploymentofcomponent-based
distributedbusinessapplications

entire backup
safecopyoftheentiresoftwarebuildincludingthedatabasesofthenetworkelement

Issue:28

457

GeneralGlossary

entity
groupofdatahandledasaunittogetherwithcodeorinformationrelatedtoprocessingof
thedata

entity bean
enterprisebeanthatrepresentsabusinessobjectinanon-volatilememory

entity declaration
entryinadocumenttypedefinitionthatassignsanSGMLnametoanentitysothatitcan
bereferredto

EntityReleased procedure; EntityReleased


procedurethatthecallsegmentassociationusestoinformtheGSMservicecontrol
functionaboutthereleaseofalogicalentitycausedbyanexceptionorerrors

entry
collectionofinformationaboutadirectoryobject

entry descriptor; descriptor


C-datastructuregeneratedbytheCASNcontaininginformationononeC-type

entry descriptor table


descriptortablegeneratedbytheCASNcontainingalltheentrydescriptorsofoneASN.1
descriptor

entry page
webpageviawhichtheuserentersawebsite

enumeration; ENUM
typedefinitionwhichlistsandnamesthevaluesofatype

ENUM record
resourcerecordthatindicatesthemappingbetweenanE.164number(thedirectory
number)andauniformresourceidentifier(URI),basedonelectronicnumbering

458

Issue:28

GeneralGlossary

ENUM server
serverthatprovidestranslationfromamobilesubscriberinternationalISDNnumber
(MSISDN)toaSIPuniformresourceidentifier

environmental alarm
alarmprincipallyassociatedwithaconditionthatrelatestotheenclosurecontainingthe
equipment

environment control list; ECL


listofenvironmentdefinitioncomponents,mainlythoseofmessages,alarmsandfiles,
includingtheirversiondata,whichbelongtoacertainsoftwareenvironment

environment of a system; system environment


externalworldoftheviewedsystem

environment variable
key-valuepairthatsoftwarecansetandreadwithoperatingsystemservicesbefore
startingtheexecutionofaprogram

EOS attribute analysis; end-of-selection attribute analysis


attributeanalysisthatisexecutedifitisindicatedintheresultoftheEOSanalysis

E-parameter; e-parameter
setofparameters(e1-e7)containingtheelementswhichtogetherdefinetherateat
whichthecallistobecharged(foradviceofchargepurposes),timedependence,and
unitincrements

ephemeral termination
inthecontextofH.248signalling,terminationthatisusedforanIPconnection

epoch; epoch date


dateandtimeinhistorythatisusedasareferencefromwhichtimeismeasured

e-project management; E-PM


partofe-businessthatdealswithmanagingthee-businessprojecttasksonlinein
collaborationwithprojectstakeholders

Issue:28

459

GeneralGlossary

EPS authentication and key agreement; EPS AKA


authenticationandkeyagreementthatisusedtoprovidemutualauthenticationbetween
theuserandthenetworkandagreeonthekeyaccesssecuritymanagemententity

EPS bearer; evolved packet system bearer


bearerthatisusedtotransportuserdatabetweentheuserequipmentandthepacket
datanetworkgatewayortheservinggateway

EPS connection management; ECM


connectionmanagementforasignallingconnectionbetweentheuserequipmentandthe
evolvedpacketsystem(EPS)

EPS encryption algorithm; EEA


algorithmthatusesa128-bitinputkeyfordataconfidentialityinevolvedpacketsystem
(EPS)sessionkeys

EPS integrity algorithm; EIA


algorithmthatusesa128-bitinputkeyfordataintegrityinevolvedpacketsystem(EPS)
sessionkeys

EPS mobility management; EMM


mobilityandsecuritymanagementfortheuserequipmentintheevolvedpacketsystem
(EPS)

EPS session management; ESM


sessionmanagementthatsupportstheEPSbearercontexthandlingintheuser
equipmentandinthemobilitymanagemententity

equal access; US equal access


featurewhichprovidesawayforthesubscribertoselectthenetworkoperatorwhen
makinglongdistanceorinternationalcalls,regardlessofcontractsmadewithoperators

equal access end office; EAEO


localexchangethatprovidesallthefeaturesrequiredforequalaccess

equal cost multipath routing; ECMP


IProutingwherepacketscanbesenttoasingledestinationviamorethanoneinterface

460

Issue:28

GeneralGlossary

equalisation /GB/; equalization /US/; compensation


processofreducingdistortionovertransmissionpathsbyputtingincompensating
devices

equaliser /GB/ ; equalizer /US/; equaliser network /GB/; equalizer network


/US/
correctivenetworkplacedattheinputofarepeaterorterminalequipment,which
compensatesforamplitudeordelaydistortionbyprovidinganattenuation-frequencyor
delay-frequencycharacteristicoppositetothatoftheprecedingtransmissionpath

equaliser digital signal processor; EQDSP; equalizer digital signal


processor /US/
digitalsignalprocessorthattakescareofbitdetectionandequalizingofreception
functions

equipment alarm
alarmwhichisgivenbyequipmentoraunitandmaybetransferredintothetransmission
managementsystem

equipment database; EQUIPM; EQDATA


databaseinwhichthehardwareconfigurationdataisstoredbyhardwareconfiguration
managementprograms

equipment domain
objectclasstodescribehardwareorsoftwareoracombinationofboth,notnecessarily
physicallydistinctwithinacomputersystem

equipment identity register; EIR


databaseofamobilecommunicationnetworkcontaininginformationaboutqualification
approvedmobilestations(MS)andtheirstates

equipment loopback; loop to equipment


methodfortestingtheoperationofaninterfaceinwhichtheoutgoingsignalislooped
backtotheinput

equipment management
featureformakingchangestoequipmentdatadescriptionsintheequipmentdatabase
andtooutputexistingequipmentdata

Issue:28

461

GeneralGlossary

equipment redundancy; equipment protection


redundancyschemeinwhich,whenthestandbyequipmentfails,theunbroken
equipmentischosenandthebrokenequipmentisswitchedoff

equipment trace; equipment tracing


tracingthatisbasedontheinternationalmobileequipmentidentity(IMEI)andthatis
definedinthevisitorlocationregister(VLR)

equipment vendor development engineering community; development


engineering community
measurementusercommunitywhosemembersexpectthatthewireless
telecommunicationnetworkisfullyoperational,adequatelyengineered,andin
commercialservice,andwhoseprimaryobjectiveistoguaranteethatthe
implementationsanddesignsconformtoreal-worldobservationsofthefixednetwork
equipmentoftheoperatingcompany

equipment vendor performance modelling community /GB/ ; equipment


vendor performance modeling community /US/; performance modelling
community /GB/; performance modeling community /US/
measurementusercommunitywhosemembersexpectthatthewireless
telecommunicationnetworkisfullyoperational,adequatelyengineered,andatsome
levelofcallcapableservice,andwhoseprimaryobjectiveistoguaranteethatthe
modelsusedduringanalysisanddesignconformtoreal-worldobservationsofthefixed
networkequipmentoftheoperatingcompany

equivalent binary content


numberofbinarydigitsthatisstrictlynecessarytoconveythesameinformationasa
definednumberofsignalelementsinagivendigitalsignal

equivalent bit rate


valueofthebitratestrictlynecessarytoconveythesameinformationinthesametime
asagivendigitalsignalatagivendigitrate

equivalent PLMN per LAC; ePLMN per LAC


featurethatenablestheoperatortohavedifferentequivalentPLMNlistsforeach
locationareaandinternationalmobilesubscriberidentityrange

erasable programmable read-only memory; EPROM; erasable


programmable ROM
fixedsemiconductivememory(read-onlymemory)whosecontentcanbezeroed,for
example,withultravioletlightandreprogrammedwithelectricalsignals

462

Issue:28

GeneralGlossary

erase
toremovefromadatamedium

erase
toremoveinformationstoredforaparticularserviceinaprecedingregistration

eraseSS
operationinwhichasupplementaryserviceisdeactivatedandtheregistrationdatais
removed

erasure
processbywhichinformationstoredforaparticularserviceinaprecedingregistrationis
removed

erlang; E; Erl
unitofcarriedtrafficintensity

ER model; entity-relationship model


object-based,logicaldatamodelwhichcanbeusedforplanningdatabases

error; digital error


inconsistencybetweenadigitinatransmitteddigitalsignalandacorrespondingdigitin
thereceiveddigitalsignal

error burst
groupofbitsinwhichtwosuccessiveerroneousbitsarealwaysseparatedbylessthana
givennumber(x)ofcorrectbits.Thenumberxshouldbespecifiedwhendescribingan
errorburst

error cause value; error cause


causevaluewhichisusedtoindicatethereasonfortheerror

error checking and correction; ECC; EDAC; error detection and correction
collectionofmethodstodetecterrorsintransmittedorstoreddataandtocorrectthem

Issue:28

463

GeneralGlossary

error code
indicationaboutanerrorthatcancompriseanoutputtext,ashortdescriptionoftheerror
situation,andpossiblyinstructions

error concealment; frame substitution; muting procedure


methodthatanAMRspeechcodecusestomutetheoutputtoconcealtheeffectof
erroneousorlostspeechframes

error-correcting code; ECC


codeinwhicheachsignalconformstospecificrulesofconstructionsothatdepartures
fromthisconstructioninthereceivedsignalscanbeautomaticallydetected,permitting
theautomaticcorrectionofsomeorallerrorsatthereceivingterminal

error correction
signallingchannelfunctionthatusesacknowledgementsandretransmissionofcorrupted
datatoensureerror-freemessagetransmission

error correction mode; ECM


facsimilemodeintheautomaticfacsimilegroup3servicethatallowsafaxpagetobe
brokenintoHDLC-likeframeswhichallowtransmissionerrorstobedetected

error counter
counterwhosevalueindicatesthenumberoferrorsrelatedtoanevent

error descriptor
descriptorthatthereceiverofatransactionrequestincludesinitsresponsetothe
requestsenderifitencountersanerrorwhenprocessingtherequest

error-detecting code; EDC


codeinwhicheachsignalconformstospecificrulesofconstructionsothatdepartures
fromthisconstructioninthereceivedsignalscanbeautomaticallydetectedbutnot
corrected

error detection
signallinglinkfunctionthatdetectserrorsbymeansofcheckbitsincludedineachsignal
unit

error detection code


mechanismforerrordetectionofOAMcells

464

Issue:28

GeneralGlossary

errored block; EB
blockinwhichoneormorebitsareinerror

errored second; ES
periodoftimeofdurationonesecondduringwhichoneormoredigitalerrorsoccurina
givendigitalsignal

errored second ratio; ESR


ratiooferroredseconds(ES)tototalsecondsinavailabletimeduringafixed
measurementinterval

errored second type A; ESA


attributethatidentifiesacountoferroredsecondscontainingonedigitaltransmission
error

errored second type B; ESB


attributethatidentifiesacountoferroredsecondscontainingatleasttwo,andnomore
thanadefinednumberofdigitaltransmissionerrors

error event
abnormalsituationnoticedbythecharginggatewaywhichwarrantsloggingtheeventin
anerrorlogfile,andpossiblyanotificationtoacentralmonitoringfacility,usuallyan
alarmmonitoringsystem

error event frame


framethatisusedtohandleerroreventproceduresandtoinformthepeerIuuserplane
protocolentityofanyerrorconditions

error event handling subsystem


routineslinkedtoeachcharginggatewaymodulewhichenablesthemoduletogenerate
alarmeventsandpassthemtothealarmdispatcher

error-free second; EFS


ratioofthenumberofone-secondintervalsduringwhichnobitsarereceivedinerrorto
thetotalnumberofone-secondintervalsinthetimeinterval

error indication procedure; error indication


elementaryprocedurethatanodeinitiatestoreportdetectederrorsinanincoming
message,providedthattheerrorscannotbereportedbyanappropriatefailuremessage

Issue:28

465

GeneralGlossary

error log
logintowhichinformationabouterrorsinacomputerisgathered

error message
noticewhichisoutputduetoanerrorinacommand

error message
messagethatinformstheuserthattherequestedtaskcannotbeperformedduetoan
error

error multiplication; error extension


propertyofanapparatuswherebyasingledigitalerrorintheinputsignalpresentedtoit
resultsinmorethanonedigitalerrorintheoutputsignal

error multiplication factor


ratioofthenumberofdigitalerrorsintheoutputsignaltothenumberofdigitalerrorsin
theinputsignal

ERROR packet
trivialfiletransferprotocol(TFTP)packetwhichsignifiesanerrorsituationinfiletransfer

error protection; error control procedure


procedurefordetecting,reducing,andpossiblycorrectingtheeffectsoferrorsgenerated
duringtheprocessofdatatransmission

error ratio; error rate


ratioofthenumberofdigitalerrorsreceivedinaspecifiedperiodtothetotalnumberof
digitsreceivedinthesameperiod

error ratio counter


counterwhichisreservedtoobservethesuccessofacertaintransaction

error ratio monitoring; error rate monitoring


continuousmeasurementoferrorratioonadigitaltransmissionlink

466

Issue:28

GeneralGlossary

error recovery
featurethatensuresthat,ifthecharginggatewaycorecrashes,everychargingrecord
(CDR)isprocessed

error recovery acknowledge PDU; ERAK PDU


protocoldataunitthatisusedtoacknowledgetherecoveryfromaprotocolerror

error recovery PDU; ER PDU


protocoldataunitthatisusedforrecoveringfromprotocolerrorsthatoccurduringthe
connectioncontrolphase

error reporting
functionthatreportstostatisticscertainprotocolerrorsandoperations,andtheerrors
discoveredduringcallset-uponingressside,whencallrequesthasnotyetbeen
forwardedtotheserviceuser

error value
valueinthereturnerrorcomponentindicatingthecauseoftherejection

error vector magnitude; EVM


withdigitalmodulationformats,formofmodulationmeasurementcarriedoutfora
transmitter,forfindingoutthedeviationoftheactualfromtheidealwaveform

escape code
indicatorconsistingofoneormoredigitswhichisdefinedinagivennumberingplanand
whichisusedtoindicatethatthefollowingdigitsarefromadifferentnumberingplan

e-shop; e-store; web shop; web store; net shop


e-marketplaceusedtopromoteacompanyandtosellitsproductsand/orservices

ESME client information


systemidentityofemergencyservicesmessageentity(ESME)clientsthatisusedto
accesstheE911interface

Es/No
ratioindecibels(dB)oftheenergyofeachsymboltothenoisepowerspectraldensity

Issue:28

467

GeneralGlossary

essential element
informationelementthatmustbeincludedinthemessagefortheprocedureinquestion
tobeexecutedcorrectly

essential UE requirement (conditional)


requirementwhichhastobeimplementedundercertainserviceconditions,forexample,
AMRspeechcodecinuserequipment(UE)whichsupportsthespeechservice

essential UE requirement (unconditional)


requirementwhichhastobeimplementedinany3Guserequipment(UE)inorderto
existinandcommunicatewitha3Gnetwork(forexample,achiprateof3.84Mcps)

establish confirm message; ECF


messagethatthemediagatewaycontrollersendstoconfirmthereceptionofthe
establishindicationmessage

established mobile operator


incumbentnetworkoperatorwithanexistingmobilenetwork

establish indication message


messagethatthemediagatewaysendstothemediagatewaycontrollertoindicatethat
aD-channelisinservice

establishment code of hotCDR; establish code of hotCDR


codewhichtellsthereasonforhotbilling

establish request message; ERQ


messagethatthemediagatewaycontrollersendstothemediagatewaytorequestthata
D-channelisbroughtintoservice

EstablishTemporaryConnection; ETC
messagethatservicecontrolpoint(SCP)usestoconnectthecallfromserviceswitching
point(SSP)totheexternalintelligentperipheral(IP)

ESYMAC
setofJavasoftwarethatimplementstheNE3Sinterface

468

Issue:28

GeneralGlossary

ET channel
transmissionchannelwhichisusedtoimplementtheinternaldatatransmission
connectionbetweena386computerandanExchangeTerminal(ET)

ET group; ETGR; Exchange Terminal Group


setofexchangetermination(ET)functionalunitsconfiguredinthesametrack,thatis,in
thesameinstanceofaplug-inunit

EtherChannel
logicalaggregationofmultipleEthernetinterfacesthatisusedtoformasinglehigherbandwidthroutingorbridgingendpoint

Ethernet
localareanetwork(LAN)thatusescarriersensemultipleaccesswithcollisiondetection
(CSMA/CD)andconnectspersonalcomputersbymeansofcoaxialcableortwisted-pair
conductors

Ethernet-based internal messaging


messaginginwhichanEthernet-basedmessagebus(EMB)isused

Ethernet-based IP interface; IEIF


IPinterfacetowardsanexternaltransportnetworkthatusesEthernetatthelinklayer

Ethernet-based message bus; EMB


messagebusthatisusedformessagingovertheEthernetlocalareanetwork(LAN)

Ethernet card; Ethernet network interface card


networkinterfacecardthatisusedtocreateanEthernetconnection

Ethernet connection
fixed-linebroadbandconnectionthatisbasedontheuseofgenericcablingandEthernet
standard

Ethernet controller
unitthatconnectsadevicetotheEthernetcable

Issue:28

469

GeneralGlossary

Ethernet convergence sublayer; ETH CS; Ethernet CS


service-specificconvergencesublayerthatdistributesEthernetservicedataunitsforthe
properMACconnection

Ethernet driver
driverthatinitialisesandsetsuptheEthernetinterface,managesbuffers,andinteracts
withtheoperatingsystem

Ethernet frame
framewithasizebetween64and1518octets,usedtodeliverdatabetweencomputers
inanEthernet-basedsystem

Ethernet interface
concreteconnectionbetweenacomputerandEthernet

Ethernet interface measurement; Ethernet interface performance


measurement
measurementthatprovidesinformationontheEthernettrafficoverinterfaces,including
informationoncollisions,erroredpackets,thenumberoftransmittedandreceived
packetsandbytes,andontheIPlayeroftheEthernetinterface

Ethernet interface switchover; interface switchover


actionofbringingthebackupEthernetinterfaceintouseandthusautomatically
recoveringfromaninterfacefailure

Ethernet over ATM; EoATM


networkstructureinwhichEthernettrafficiscarriedontopofanATMnetwork

Ethernet plug-in unit; EPIU


plug-inunitofFIU19Eprovidingtwo10/100Base-TEthernetinterfacesforcarryingupto
2x32Mbit/sEthernetpayloadtrafficovertwomicrowaveradiolinks

Ethernet port
portthatconnectsacomputertoanothercomputer,alocalnetwork,oranexternaldigital
subscriberlineorcablemodeminanEthernet-basedsystem

Ethernet priority bits; P-bits


inavirtuallocalareanetwork(VLAN)frameheader,afieldthatindicatesthequeuing
disciplineanddiscardeligibilitytobeappliedinpriorityqueuingonaninterface

470

Issue:28

GeneralGlossary

Ethernet switch; ESW; Ethernet LAN switch


networkdevicethatconnectslocalareanetworks(LAN)andiscapableofswitching
packetsfromoneEthernetsegmenttoanother

Ethernet synchronisation messaging channel /GB/ ; Ethernet


synchronization messaging channel /US/; ESMC
channelthatthesynchronousEthernetlinksusetoconveythesynchronisationstatus
messageswheninterworkingwithexistingSONET/SDHinfrastructure

Ethernet terminal equipment


terminalequipmentwhichimplementstheEthernetterminalfunction

European Geostationary Overlay Service; EGNOS


firstpan-Europeansatellitenavigationsystemthatincreasesthepositioningaccuracyof
theGPSsystemtoafewmeters

European Telecommunications Standards Institute; ETSI


EuropeanstandardsorganisationthatproducesEuropeanstandardswhichareapplied
andacceptedintheareaoftelecommunications

E-UTRA absolute radio frequency channel number; EARFCN; evolved


absolute radio frequency channel number
integerthatidentifiesthecarrierfrequencyinboththeuplinkanddownlinkdirectionsin
theevolvedUTRA

E-UTRAN cell global identifier; ECGI


identifierthatgloballyidentifiesacellinanevolvedUTRAN(E-UTRAN)

E-UTRAN radio access bearer; E-RAB; evolved radio access bearer


radioaccessbearerthatdefinestheconcatenationofanS1ApplicationProtocolbearer
andthecorrespondingdataradiobearer

evaluation model
I/Odevicemodelwherethedesignisnotcomplete

evaluation unit
sampleofevaluationmodel

Issue:28

471

GeneralGlossary

event
notificationofachangeinthestateofanodeorofamomentaryproblem,usuallyinthe
communicationbetweenthenodeandthelocalexchange

event administration
faultmanagementapplicationthatisusedtocollectandforwardsettingsandtocleanup
theeventrepository

event-based report transfer


featurethatenablestheonlinetransferofobservationreportsfromthemobileservices
switchingcentre(MSC)orthehomelocationregister(HLR)totheoperationssupport
system(OSS)

event charging function; ECF


functionthatperformstransaction-basedcharginginonlineIPmultimediasubsystem
(IMS)chargingarchitecture

event charging record; event CDR


chargingrecordthatisgeneratedincaseofacall-unrelatedeventrelatedtotheprepaid
account

event charging with unit reservation; ECUR


transaction-basedchargingthatincludestheprocessofrequesting,reserving,releasing,
andreturningunusedunits

event code
causecodeusedforidentifyingeventsduringacall,exceptclearing

event collecting; event collecting and storing


faultmanagementapplicationthatcollectseventsfromthenetworkandstoresthemin
theeventrepository

Event Collection Engine


partoftheFaultManagementPlatformthatensuresreliablealarmeventcollection,basic
alarmeventruleprocessing,andstorageinthefaultmanagementdatabase

event consumer; EC
processwhichcanconnecttotheeventchanneltoreceivethesubscribedeventsfrom
theeventforwarder

472

Issue:28

GeneralGlossary

event converter
servicethatconvertsDMXmessagesintoXMLorotherpreferredformatusingthegiven
templates

Event Correlation Engine


partoftheFaultManagementPlatformthatprovidescorrelationruleprocessing,
correlationrulemanagement,andruledesign

event counter measurement; ECM


measurementtypewheremeasurementinformationiscollectedbasedontheevent
countingintheservicecontrolpoint(SCP)

event descriptor
descriptorthatcontainsevent-relateddatasuchastheH.248package,event,andevent
parameternames,andtheirpossiblevalues

event detection point; EDP


detectionpointfromwhichaneventisreportedtotheservicesoftware(SCP)duringthe
service

event detection point notification; EDP-N


eventdetectionpoint(EDP)innotificationmodethatisdynamicallyarmedwithinthe
contextofaCAMELcontrolrelationshipandtheprocessingofwhichisnotsuspended
whenencounteringthedetectionpoint(DP)

event detection point request; EDP-R


eventdetectionpoint(EDP)inrequestmodethatisdynamicallyarmedwithinthecontext
ofaCAMELcontrolrelationshipandtheprocessingofwhichissuspendedwhen
encounteringthedetectionpoint(DP)

event flag
combinationofeventsthatcontainsabitmaskwithbitson(eventposted)orbitsoff
(eventcleared)

event forwarder; EF
setofprocessesthattogetherprovidethemulticastingofDMXmessagesbypassing
eventsbetweeneventproducersandeventconsumers

Issue:28

473

GeneralGlossary

event forwarding
faultmanagementapplicationthatsendseventstohigher-levelsystems

event forwarding discriminator; EFD


managedobject,forexample,partofacircuitorsoftware,thatcontrolsthediscrimination
filteringandforwardingofeventreportsrelatingtoothermanagedobjects

event forwarding service; EFS


servicewhichallowstheapplicationstoorderasynchronousnotificationsaboutevents
thatoccurinthesystem,andtogenerateeventswhicharedistributedtoapplications
interestedinthem

event handler
objectthatreceivesevents(DMXmessages),convertsthemintoXMLorotherpreferred
formatwithservicesprovidedbytheeventconverter,filtersthemaccordingtothegiven
filterattribute,sendsthemtoagroupoftargetaddressesusingthegivenprotocol,and
logsthemintoacyclicbufferonasystemdisk

event header
inaSIPSUBSCRIBEmessage,aheaderthatindicateswhicheventorclassofeventsa
subscriberhassubscribed

event listener; listener


managedobjectthatisnotifiedwhenaparticulartypeofeventoccurs

event log
loginwhichinformationabouttheoccurredeventsissaved

event log backup mark; backup mark


informationontheeventlogaboutthebeginningandendingofthefallbackcopying

event log buffer


buffermemoryintowhichtheeventlogsavestheeventsbeforetransferringthemintoa
diskfile

event log stream; service request log stream; SRL stream


groupofeventssavedoneafteranother

474

Issue:28

GeneralGlossary

event loop
procedurethatmonitorsforeventsexternaltotheapplicationand,whenoccurring,
deliversthemtovariouspartsoftheapplicationcodeascallbacks

event message
messagethatamanagementapplicationusestosendinformationrelatedtoasignificant
orcriticalsystemmanagementeventithasdetected

event monitoring
faultmanagementapplicationthatisusedtovisualiseandstudycollectedevents

EventNotificationCharging; ENC
messagethatserviceswitchingpoint(SSP)usestoreportachargingeventthathas
beenpreviouslyrequestedbytheservicecontrolpoint(SCP)bymessage
RequestNotificationChargingEvent

event processing
faultmanagementapplicationthatfilters,reclassifies,andcorrelateseventsbeforethey
arestoredintheeventrepository

event-processing node; EPN


nodethatisabletohandlerequestsfromarouter,andthatsendstheprocessedevents
tothegatewayordatabasenode

event processor
subsystemintheOnlineServiceController(OSC)thatprocessesincomingcharging
files,ratesthem,andupdatestheaccountbalancesaccordingly

event producer
processwhichcanconnecttotheeventchannelanddelivereventstotheevent
forwarder

event queue
queuewhosecalendartasksareexecutedonthebasisofagivenalarm

event record; ER; EDR; event data record


recordofinformationgeneratedforacertaineventortransaction

Issue:28

475

GeneralGlossary

event report
reportthatcontainsanotificationaboutanalarmorsomeotherevent

EventReportBCSM; ERB
messagethattheserviceswitchingpoint(SSP)usestoinformtheservicecontrolpoint
(SCP)ofanencounteredcallrelatedeventthathasbeenpreviouslyrequestedbythe
servicecontrolpoint(SCP)withRequestReportBCSMEvent

event report management function; ERMF


functionthatallowsamanagertocontrolthetransmissionofeventreportsfrom
managedobjectsindependentlyofthedefinitionofthemanagedobjects

EventReportSMS procedure; ERBSMS; EventReportSMS


operationwhichisusedtonotifythegsmSCFofashort-message-relatedevent
previouslyrequestedbythegsmSCFinaRequestReportSMSEventoperation

event type
typethatindicatesthecategoryofanevent

event type of alarm; event type


parameterthatcategorisesanalarminoneoffivebasiccategories

event vector; EV
measurementdatawhichisgeneratedafterprocessingastatisticallyrelevantevent,and
whichcontainsthetriggerinformationandalltheimportantrawdataconcerningan
individualevent

evolvability
abilityofasystemtobeimprovedbyincorporatingnewtechnologiesandcomponents

evolved HSPA; HSPA+; evolved high-speed packet access


HSPAthatusesmultipleinputsmultipleoutputsandhigh-orderquadratureamplitude
modulationforincreaseddatatransmissionrates

evolved node B; eNodeB; eNB; E-UTRAN node B


basetransceiverstationthatcontrolsallradio-relatedfunctionsintheradioaccesspart
oftheevolvedUTRAN(E-UTRAN)

476

Issue:28

GeneralGlossary

evolved packet core; EPC


IP-basednetworkthatisanevolutionofthe3GPPsystemwithahigherdatarate,lower
latency,andpacketoptimisation,andthatsupportsmultipleradio-accesstechnologies

evolved packet data gateway; ePDG


packetdatagatewaybetweentheevolvedpacketcoreandfixednon-3GPPnetworks
thatrequiresecureaccess

exception
exceptionalhandlingofanexecutedinstructionoraninterrupt

exception handler
functionassociatedwithprocessing,whichthehardwareautomaticallyinvokeswhenthe
specifiedexceptionhappens

exception management
setoffunctionsthatdetectsexceptions,writesthenecessarylogs,raisesalarms,and
informsthesupervisionsystem

excess bandwidth scheduler; EBS


packetschedulerthatredistributestheunusedbandwidthfromtheguaranteed
bandwidthschedulertochannelsthatarewaitingforthetransmissionofpackets

excess information rate; EIR; extended information rate


transmissionratethatspecifiestheframerelaydataratethresholdabovewhichthe
networkwillnotacceptdataduetooverload

excessive bit error rate; EBER


biterrorrate(BER)atwhichcorrupteddataexceedstheacceptablelevelforspecified
end-serviceintegrityand/orquality

excessive error rate; EER


errorratethatisgreaterthanadefinedthreshold

Issue:28

477

GeneralGlossary

exchange; CO /US/; switching exchange /GB/; switching centre /GB/;


central office /US/
aggregateoftrafficcarryingdevices,switchingstages,controllingandsignallingmeans,
andotherfunctionalunitsatanetworknodethatenablessubscriberlines,
telecommunicationcircuits,and/orotherfunctionalunitstobeinterconnectedasrequired
byindividualusers

exchange access; EA
accesstoatelephonenetworkinwhichexchangeservicesareprovidedforinterexchangetelecommunicationsoriginatingorterminatingwithintheMSCarea

exchange access international signaling /US/; EAIN; EAI; exchange access


international /US/
signallingprotocolofBellcorethatprovidesa7or10-digitcalledpartynumber,aswellas
10-digitautomaticnumberidentification

exchange access North American signaling /US/; EANA; exchange access


North American /US/
signallingprotocolthatprovidescertaincallservices,suchasemergencycalls

exchange call-release delay


intervalfromtheinstantatwhichthelastinformationrequiredforreleasingacallinan
exchangeisavailableforprocessingintheexchangetotheinstantthattheswitching
networkthrough-connectionisnolongeravailablebetweentheincomingandoutgoing
circuitsandthedisconnectionsignalissenttothesubsequentexchange.Thisinterval
doesnotincludethetimetakentodetectthereleasesignal,whichmightbecome
significantduringcertainfailureconditions,forexample,transmissionsystemfailures

exchange call set-up delay


intervalfromtheinstantwhenthedigitsrequiredforsettingupacallareavailableinthe
exchangeortheaddressinformationisreceivedattheincomingsignallingdata
transmissioncontroloftheexchangetotheinstantwhentheseizingsignalissenttothe
subsequentexchangeorthecorrespondingaddressinformationissentfromthe
outgoingsignallingdatatransmissioncontrol

exchange concentrator; traffic concentrator; concentrator


switchingstagewhereinanumberofsubscriberlinesortrunkcircuitscarryingrelatively
lowtrafficvolumescanbethrough-connectedtoacoupleofcircuitscarryinghighertraffic
volumes

478

Issue:28

GeneralGlossary

exchange connection
connectionthatisestablishedthroughanexchange,betweentheterminationsonthat
exchange,oftwoormorechannelsorcircuits

exchange hierarchy; network hierarchy


networkarrangementthatincludestheinterlinkingoftrunkexchangesbytransmission
pathstoprovideasubscriberswitchingservice

exchange identity; XID; exchange identification


setofparametersforlogicallinkcontrol(LLC)andsubnetworkdependentconvergence
protocol(SNDCP)layersthatarenegotiatedbetweenamobilestation(MS)anda
servingGPRSsupportnode(SGSN)duringdatalinkestablishmentormodification
procedure

exchange overload supervision; supervision of exchange overload


partofthemaintenancesupervisionwhichgivesanalarmiftheparameterisedmaximum
numberforcallsisexceededduringthemonitoringperiod

exchange termination; ET
unitorfunctionontheexchangesideoftheswitching/transmissioninterface

excitation; impulse
situationoreventthattriggerstheexecutionofadataprocessingtask

exclusive access
accesstothecellsbelongingtooneormorelocalisedserviceareas(LSA)permitedonly
forusershavingthesecellsincludedintheallowedlocalisedserviceareas

exclusive lock; write lock


lockwhichcanbeusedonlybyoneapplicationatatime

exclusive restriction
restrictiontypedeterminingthatonlytheusersforwhomtheallowedparameteror
attributetypevaluesofarestrictedoperationhavebeendefinedmayexecutethe
restrictedoperationinquestion

exec shield
securitypatchfortheLinuxkernelthataddsanoexecute(NX)bittothecentral
processingunit(CPU)

Issue:28

479

GeneralGlossary

executable and linking format; ELF


portableobjectfileformatthatworkson32-bitIntelarchitectureenvironmentsfora
varietyofoperatingsystems

executable service script


scriptdefiningaservice

execution environment
environmentinwhichprogramscanberun

execution error printout


print-outwhichindicatesthatagivencommandcannotbeexecuted

execution printout
outputwhichindicatesthatagivencommandisexecuted

execution queue
queuewherecalendartaskswaitforexecution

execution subsystem
subsystemthathandlesthefunctionsthattheend-userexperiences

execution time
pointintimeatwhichacommandorcommandfilestartstoqueueupforanMML
session

execution unit
run-timeunitofsoftwarethatperformswell-definedfunctionsknownbythecomputing
environmentandthatcanbestarted,monitored,andstoppedbythebasesoftwareofthe
computingenvironment

executive; EX
stateofafunctionalunitinwhichitisreadytoperformitstasks

Ex interface
proprietaryinterfacebetweentheRADIUS-Diametertranslationagentandtheuser
mobilityserver

480

Issue:28

GeneralGlossary

existence check
checkthatisruntodeterminewhetheranobjectexists

exit
elementaryactiondenotingthatacertainsequenceofelementaryactionshasbeen
completedsuccessfully

exit message; EXM


signallingmessagethatissentinthebackwarddirectionfromanoutgoinggateway
exchangetoindicatethatacallhasbeensuccessfullytransferredtotheadjacent
network

expansion
processinwhichtherangeofamplitudesofasignalisautomaticallyincreasedina
specifiedmanner

expansion
configurationwhereinthenumberofinletsintotheswitchingstageissmallerthanthe
numberofoutlets

expected message authentication code; XMAC; expected MAC


messageauthenticationcodethattheuserequipmentcalculatesand,intheintegrity
check,compareswiththemessageauthenticationcodereceivedfromtheserving
network

expected user response; XRES; expected response


partoftheauthenticationquintupletwhichisusedasareferencevaluefortheresponse
tothechallengeduringtheauthenticationandkeyagreement(AKA)

expedited data; ED
datatransferredwithprioritywhichbypassesthenormaldataflowcontrol

expedited data transfer


functionusedtobypasstheflowcontrolofnormaldataTPDU(ExpediteddataTPDU
flowiscontrolledbyseparateflowcontrol.)

expedited forwarding PHB; EF; expedited forwarding


differentiatedservices(DS)per-hop-behaviour(PHB)whichcanbeusedtobuildalow
loss,lowlatency,lowjitter,assuredbandwidth,end-to-endservicethroughDSdomains

Issue:28

481

GeneralGlossary

expiration timer
timermechanismwhichdetectschargingrecords(CDR)whichstayfortoolonginthe
recyclingfile(storageforcombining),andforwardsthemtotheoutputdirectory

expired licence file /GB/ ; expired license file /US/


licencefilewhoseendtimehasbeenreached

expires header
SIPheaderwhichgivesthedateandtimeafterwhichaSIPmessageoritscontent
expires

expiry fee
servicefeethatisrelatedtoprepaidexpiryandthatcanbechargedatcreditexpiryand
atsubscriptionexpiryindependentlyofthecallsmade

expiry fee charging


servicefeechargingwherethesubscriberischargedanexpiryfee

expiry function
functionwhichisusedtocalculatethenewcreditexpirydateandsubscriptionexpiry
datewhenarechargeisperformed

explicit call transfer; ECT; CTE


calltransferwhichenablesaserveduser,whohastwocalls,toconnectthetwocalls
togetherintoonecall

explicit congestion notification; ECN


bitthatthenetworksetsto"1"tonotifyaboutcongestioninthenetworkandaboutthe
networkresourcesbeinginsufficienttosupporttherelayingofframesatthecurrentrate

explicit diversity gain


effectivegainachievedusingdiversitytechniques

explicit flow control


functionusedtoregulatetheflowoftransportprotocoldataunits(TPDUs)betweentwo
transportentitiesononetransportconnection

482

Issue:28

GeneralGlossary

explicit forward congestion indication; EFCI


indicationintheATMcellheader,whichmaybesetbyanetworkelementinan
impending-congestedstateoracongestedstatesothattheindicationmaybeexamined
bythedestinationend-system

explicit IMSI detach from GPRS services


IMSIdetachthattheservingGPRSsupportnode(SGSN)usestoindicatetothevisitor
locationregister(VLR)thatthemobilestationhasbeenIMSIdetachedfromGPRS
serviceandthereforethattheassociationbetweentheSGSNandtheVLRhastobe
deactivated

explicit IMSI detach from non-GPRS services


IMSIdetachthattheservingGPRSsupportnode(SGSN)usestoindicatetothevisitor
locationregister(VLR)thatthemobilestationhasperformedIMSIdetachfromnonGPRSserviceandthereforethattheassociationbetweentheSGSNandtheVLRisno
longeractive

explicit rate; ER
fieldinresourcemanagement(RM)cellusedtolimittheallowedcellrate(ACR)toa
specificvalue

explicit registration
registrationtotheIPmultimediasubsystem(IMS)inwhichauserselectsonepublicuser
identityandregistersonlythatpublicuseridentity

explicit request
requestfortheactivationofuser-to-usersignalling

exploder URI
uniformresourceidentifier(URI)thatidentifiesaSIPURI-listservice

export (verb)
tostoreafileinadifferentformatforusebyanotherapplication

export
storingofafileinadifferentformatforusebyanotherapplication

Issue:28

483

GeneralGlossary

exported number
inthecontextofmobilenumberportability,atelephonenumberthathasbeenexported
fromonenetworkoperatortoanother

exported subscription
subscriptionwhichismovedfromthehomepubliclandmobilenetwork(PLMN)to
anotherPLMN

expression
sourcelanguagecombinationofoneormoreoperations

expression language; EL
languagethatenablesaccesstotheapplicationdatastoredinEnterpriseJavaBeans
componentsanditsmanipulationwithouthavingtousescriptletsorrequest-time
expressions

express message
internalsignalbetweenthesubautomatonswithinaprocess

ext3 journalling file system /GB/ ; ext3 journaling file system /US/; ext3
journallingfilesystemthatisusedwiththeLinuxoperatingsystem

extendability; expandability
propertyofasystemthatdescribestheeasewithwhichthesystemoritscomponentcan
bemodifiedtoincreaseitsstorageorfunctionalcapacity

extended Backus-Naur form; EBNF


anyvariationofthebasicBackus-Naurformmeta-syntaxnotationwithsomeadditional
constructs

extended cell
handoverfeatureinwhichacallishandedoverfromanoutercelltoaninnercell

extended command language


man-machinelanguagewithwhichitispossibletousecommandcodesandexecute
MMLmacrosduringanMMLsession

484

Issue:28

GeneralGlossary

extended dynamic allocation; EDA; extended dynamic allocation mode


extensionofdynamicallocationthatenablesahigheruplinkthroughputbyremovingthe
needforthemobileterminaltodetectuplinkstateflags(USF)separatelyforeach
allocateduplinktime-slot

extended GSM 900 band; E-GSM900 band


extensionoftheGSM900systemthatoperatesintheareaof880-890MHzuplinkand
925-935MHzdownlink

extended message-signalled interrupt /GB/ ; extended message-signaled


interrupt /US/; MSI-X
message-signalledinterruptthatsupportsdistinguisheddestinationsandadelivery
methodforeachinterruptmessageofadevice

extended MSK; EMSK; extended master session key


additionalmastersessionkeythatisexportedbyanExtensibleAuthenticationProtocol
methodandthatcannotbesharedwithathirdparty

extended naming service framework; ENSF


inaconnectionprocessingserver(CPS),asystemcomponentthatprovidestheservice
availabilityfunctionsfortheclientsintheCPS,serviceandsubscriptionrepository
(SSR),andusermobilityserver(UMS)

extended number formatting


featurethatenablesthemobileservicesswitchingcentretohandletypeofnumber
attributes;torecognisemobile-originated,mobile-terminated,andcallforwardingcases;
andincallforwardingcases,tousetheforwardingpartyroamingstatustodeterminethe
callingpartyroamingstatus

extended packet access burst


accessburstthatistransmittedonthepacketrandomaccesschannelandthatcarries
11databits

extended passive bus


bususedtoreachaclusterofterminalslocatedamaximumofabout500metresfrom
thenetworktermination(NT)

extended pedestrian A model; EPA


multipathfadingchannelmodelthatspecifiesadelayprofileforalowdelayspread
environment

Issue:28

485

GeneralGlossary

extended preanalysis; EXPANA


featurewhichisusedfortheselectionofroutingbasedonthenumberofdigitsthatthe
userhasdialled,oronthenumberofdigitsreceivedfromincomingsignalling

extended preanalysis starting point; ESTP


resultofadiallingpreanalysiswhosevalueindicateswhethertheextendedpreanalysis
needstobeexecuted

extended presence information


presenceinformationincludingspecificmanufacturer,vendor,orserviceprovider
extensionattributesandextensionfields

extended range cell; extended cell range


basestationsystemfeaturethatisusedtoincreasethecellradius

extended real-time polling service; ertPS; enhanced real-time polling


service
pollingservicethatisdesignedforreal-timetrafficwithvariabledatarate

extended sequence number


sequencenumberfieldofthemessagetransferpartlevel2(MTP2)signalunitwhichhas
beenextendedto12bits

extended superframe format; ESF; extended super frame


framingtypeusedonT1circuitsthatconsistsof24framesof192bitseach,withthe
193rdbitprovidingtimingandotherfunctions

extended trader constraint language; ETCL


filteringconstraintlanguagedefinedbytheObjectManagementGroup(OMG)
notificationservicespecification

extended typical urban model; ETU


multipathfadingchannelmodelthatspecifiesadelayprofileforahighdelayspread
environment

extended unitdata; XUDT


messageusedinthesignallingconnectioncontrolpart(SCCP)segmenting
connectionlessservicetotransferdata

486

Issue:28

GeneralGlossary

extended unitdata service; XUDTS


messagethatisusedinthesignallingconnectioncontrolpart(SCCP)connectionless
servicetoreturnanextendedunitdata(XUDT)messagethatcannotbedeliveredtoits
destination

extended uplink TBF mode


modeofoperationofamobilestation,inwhichtheuplinktemporaryblockflow(TBF)is
maintainedduringtemporaryinactiveperiods,whenthemobilestationhasnoradiolink
control(RLC)informationtosend

extended vehicular A model; EVA


multipathfadingchannelmodelthatspecifiesadelayprofileforamediumdelayspread
environment

extensibility
abilityofasystemtobeextended,andtherebyenhancedorcustomised,byathirdparty

Extensible Authentication Protocol; EAP


protocolthatsupportsmultiple,optionalauthenticationmechanismsforthePoint-to-Point
Protocol(PPP),includingcleartextpasswords,challenge-response,andarbitrary
dialoguesequences

extensible stylesheet language; XSL; extensible style language


stylesheetlanguageforextensiblemarkuplanguage(XML)

extensible stylesheet language transformations; XSLT


WorldWideWebConsortium(W3C)standardfortransformingXMLdocumentsinto
otherXMLdocumentsorotherformats

extension
subscriberconnectionservedbyaPABXoracentrex

extension
mechanismprovidedbythecoreintelligentnetworkapplicationprotocol(INAP)toextend
theprotocolwithvendor-specificparameters

extension attribute; presence extension attribute


presenceattributethatispartoftheextendedpresenceinformation

Issue:28

487

GeneralGlossary

extension header flag; E


fieldinaGTPheaderindicatingthepresenceofthenextextensionheaderfieldwhenit
issetto'1'

extension indicator
indicatorineveryoctetofamulti-octetparameterfieldwithvariablelength,indicating
whethertheoctetisthelastoneorfollowedbyanotherone

extension interface
interfacethatisusedasadatabusinthechainedBTSconfigurationandthatprovides
connectionstotransmissionnodes

extension number; extension


numberofaPABXoracentrexextension

extension update
featurelevelupdatewhichincludesanextensiontoasoftwarebuild

exterior gateway protocol; EGP


internetprotocolusedtoexchangeroutinginformationbetweenautonomoussystems

external account balance management


accountbalancemanagementformanaginginrealtimetheprepaidaccountbalance
thatresidesintheexternalbalancemanagementsystem,suchasanIN-basedprepaid
systemoranexternalbalanceholder

external alarm; EA
alarmconcerningasupervisedexternaldevicelocatedoutsidethenetworkelement

external alarm definition data


datawhichidentifiesanexternalalarm

external alarm handler


alarmsystemprocesswhichhandlestheexternalalarmsandtherelatedtasksreceived
fromtheuserinterface

488

Issue:28

GeneralGlossary

external alarm input


connectionofasingleexternalalarmtotheexternalalarminterfaceplug-inunit

external alarm input characteristic


characteristicwhichidentifiestheuseofexternalalarminput

external alarm interface


interfaceviawhichthesystemiskeptinformedaboutexternalalarms

external application; EA
applicationwhichresidesonanexternalhost

external assisting IP; assisting external IP; external IP


internetprotocolthatcanbeusedwhentheservicecontrolpoint(SCP)requeststhe
connectiontotheexternalinternetprotocol(IP)withEstablishTemporaryConnection
operation

external ATM interface; external ATM line


ATMinterfacebetweenthenetworkandanetworkelement

external authentication adapter; external authentication module; external


authorisation adapter
plug-insoftwarethatimplementstheapplicationprogramminginterfaceforauthentication
andintegrateswiththesubscriberdatabasethroughthedeliveryserver

external balance holder; EBH


networkserverwhichisusedasabalanceholderandresidesoutsidethenetwork
elementconcerned

external call circuit group


circuitgroupbetweenthesuperiorexchangeandtheprivateautomaticbranchexchange
(PABX)switchingincomingtrafficandtrafficgoingoutofthegroupinaPABXcentrex

external client
clientthatresidesoutsidethenetworkelement

Issue:28

489

GeneralGlossary

external clock supervision


supervisionoftheexternal8kHzbasictimingsignalusedforgeneratingthe100Hz
clockinterruptsignal

external command
serviceterminalcommandthatisimplementedasaseparateextensionprogramthathas
itsownexecutablefile

external connection
virtualconnectioninwhichthesecondendpointislocatedoutsidethenetworkelement

external content storage


contentstoragewhichmakescontentavailableoverawebserver

external event forwarder and log; EEFL


featurethatprovidesthemeansforexternalsystemstoreceiveeventsfromaDX200
networkelement

external handover
handoverinwhichamobileterminalwithanongoingconnectionmovestoanothercell
sothatthebasestationcontrollerchanges

external identification number; external identifier


identificationdatawhichtheattendantcanuseasasearchkeywhenretrievingbooking
formsfromthesystem'smemory

external IN service
INsupportedservicewhichfollowstheoriginalideaofintelligentnetwork(IN)
architecture

external interface
interfacebetweennetworkelementsorbetweenhardwareunits

external IP address of the DLS instance


virtualIPaddressontheexternalnetwork,assignedbythenetworkaddresstranslator
(NAT)toeachDLSinstanceinthecluster

490

Issue:28

GeneralGlossary

external LAN; external local area network


localareanetworkwhichisusedforexternalclienttraffic

external loop
testloopbackwhereasignalisconnectedthroughtheswitchingnetwork

external machine interface; EMI


interfacebetweentheshortmessageservicecentre(SMSC)systemandothercomputer
systemsandapplications

external memory interface; EMIF


interfacefromamicroprocessortoexternalmemoriessuchasflashmemoryorstatic
RAM

external message
messagesentoverthemessagebus

external message transfer; EMT


proprietaryprotocolthatprovidesthemeansforsendingandreceivingmessages
betweenanetworkelementandanexternalsystemthroughTCP/IPconnections

external monitoring application; EMA


stand-aloneapplicationbasedontheremotemethodinvocation(RMI),whichconstantly
sendskeep-aliverequeststotheservicedrivers(SD)andchecksiftherequestscome
backafteracertaintimeoutperiodfromthekeep-aliveoutputoftheSDs

external parsed entity; external entity


parsedentitywhichstoresitsnameandareferencetoanothercontainerthatholdsits
content

external PCM circuit; ET-PCM; external PCM


PCMcircuitthatgoesoutwardfromanetworkelement

external port
portthatconnectsaplug-inunittoanexternalconnectioninanothernetworkelement

Issue:28

491

GeneralGlossary

external provisioning interface; EPI


interfacethattransmitsinformationbetweenthebarringmanagerandaccessservers

external provisioning system; EPS


softwarethatrunsthesubscriberuserinterface(SUI)oftheMessagingGateway

external rating engine


networkserverthatresidesoutsidetheonlineservicecontroller(OSC)andactsasa
ratingengineprovidingratingcapabilitiesfordifferentkindsofservices

external rating interface


interfacethatallowstheonlineservicecontroller(OSC)tosendratingrequeststothe
externalratingsystemwhilereceivingratedeventsinreturntobeusedinchargingand
accessmanagement

external reference clock; ERC


referenceclockthatsendsasynchronisationsignalfromanotherdevice

external ringing tone server; ERS


serverthatisconnectedtothespeechpathduringtheringingtonedeliverytoplaythe
ringingtonebasedonarequestthatthemobileservicesswitchingcentremakes

external route; external direction


routewherethecallisdirectedifthereceiveddigitsequencebelongstothecallnumbers
ofanotherexchange

external service catalogue


servicecataloguethattheprofilemanagersupportsandthatcontainstheavailable
servicesasservicedefinitions

external service creation environment; ESCE


servicecreationenvironmentexternaltothehomesubscriberserver(HSS)whicha
networkoperatorcanusetocreatetheservicesandtransferthemtothemanagement
dataserver(MDS)fromwheretheoperatorcandeploythem

external service provider; ESP


serviceproviderthatisindependentofthetheserviceuser'sorganisation

492

Issue:28

GeneralGlossary

external SNMP application; ESA


stand-aloneapplicationbasedontheremotemethodinvocation(RMI),whichprovides
interfacetowardstheterminalmanagementserver(NTMS)maininstance,external
monitoringapplication(EMA)andotherexternalcomponentsofNTMS,andsendsalarm
notificationstoNetAct

external SRP; ExtSRP; external specialised resource point


specialisedresourcepointthatisusedinIN-supportedservicesasaninterfacetowards
thesubscribers

external storage system; storage system


partofdatabaseclusterthatisusedasacentralrepositoryforserviceandcustomer
data

external switched circuit group


switchedcircuitgroupconsistingoftrunkcircuits,whichisusedfortransmittingcircuitswitcheddatabetweenexchanges

external synonym
constantofapredefineddatatypewhichobtainsitsvaluefromoutsidethesystem

external termination point


linkterminationpointforthetransmissiononanetworkinterface(user-networkinterface
ornetworknodeinterface)

external test
testmadewiththehelpofaunitofadifferenttypefromtheunittobetested

external timing
timingthatisbasedontheuseofanexternalreferenceclock

external unparsed entity; unparsed entity


generalentitywhosecontentsmayormaynotbeXML,withanassociatednotation
declaration

external update notification; EUN


notificationgeneratedbytheservicecontrolpoint(SCP)databasemanagementsoftware
whenthedatabaseisupdated

Issue:28

493

GeneralGlossary

external voucher database interface


interfacetoavoucherdatabasefromathirdpartyvendor,forexampleavoucher
databaseresidinginaprepaidservicenode

extinction ratio; EX
logarithmicrelationbetweenalogical"1"andalogical"0"

extra filename; alias name


additionalnameforafile

extranet
informationnetworkbetweenorganisations,aimedatalimitedgroupofusers

extra SDU delivery probability


ratiooftotal(unrequested)extraservicedataunits(SDU)tototalservicedataunits
receivedbyadestinationuserinaspecifiedsample

eye diagram; eye pattern


representationresemblinghumaneye,whichconsistsofallpossibletracesofthe
potentialofabasebanddatasignalasafunctionoftime

eye diagram aperture; eye diagram clearance; eye diagram opening; eye
aperture
figureindicatingthesizeofthebrightcentreoftheeye-shapedpatternwhichhasbeen
obtainedbymeasurementsoftheeyediagramofthereceiver

eye pattern mask; mask for the eye diagram; signal mask for the eye
diagram
transmitterpulseshapecharacteristicssuchasrisetime,falltime,pulseovershoot,
pulseundershoot,andringing,specifiedintheformofamaskofthetransmittereye
diagram

494

Issue:28

GeneralGlossary

8 F
F4/F5 flow loopback; OAM F4/F5 Loopback
operationinwhichOAMcellsarrivinginthevirtualpath(VP)connectionareloopedback
toATMnode

fabric
groupofinterconnectionsbetweenports,whichprovidestransportandswitchingfor
differenttypesofsignals

fabric interface; FI
optionalcommunicationinterfaceinAdvancedTCAthatcanbeconfiguredwithdifferent
optionsasspecifiedintheAdvancedTCAspecifications

FACCH call setup; FACCH call set-up procedure


callsetupinwhichthemobileterminalisassignedfromthecommoncontrolchannel
(CCCH)tothetrafficchannel(TCH)withtheimmediateassignmentprocedure,andthe
fastassociatedcontrolchannel(FACCH)isusedforcallset-upsignalling

facility
technicalbasisfortherealisationofafunctionoraservice

facility accepted message; FAA


signallingmessagesentasaresponsetoafacilityrequestmessageindicatingthatthe
requestedfacilityhasbeeninvoked

facility category
grouptowhichafacilitycanbespecifiedonaper-categorybasis

facility group number


callnumberofacentrexsubgroupbasedontheuseoffacilities

facility indicator
signallingparametersentinfacilityrelatedmessagesidentifyingthefacilitieswithwhich
themessageisconcerned

Issue:28

495

GeneralGlossary

facility indicator code; FIC


codewhichisusedintheserviceinformationmessage(SIM)toprovidesupplementary
serviceinformation

facility list
listoffacilitiesandconfigurationparameters

facility message; FAC


signallingmessagethatcanbesentatanyphaseofthecalltorequestanactionat
anotherexchange

facility reject message; FRJ


signallingmessagesentasaresponsetoafacilityrequestmessageindicatingthatthe
requestedfacilityhasbeenrejected

facility request message; FAR; FRQ


signallingmessagesentfromoneexchangetoanotherexchangetorequestactivationof
afacility

facility telephone
versatilephonewhichiseasytouseandisoftenequippedwithadisplayforthebenefit
ofeasieruseofthefacilitiesprovidedbytheexchange

factory setting
initialsettingforanparametergivenatthefactory

fade margin; fading margin


designallowancethatprovidesforsufficientsystemgainorsensitivitytoaccommodate
expectedfading,forthepurposeofensuringthattherequiredqualityofserviceis
maintained

fading
variationintimeoftheintensityand/orrelativephaseofanyorallfrequencycomponents
ofareceivedsignalduetochangesinthecharacteristicsofthepropagationpath

fading depth
ratioofreceivedsignalleveltothelevelreceivedinunfadedcondition

496

Issue:28

GeneralGlossary

fading margin measurement; FMM


measurementoffadingmarginthatisusedtoverifythequalityoftheradiolinkby
comparingthemeasuredvaluetotherequiredfadingmarginvalue

failback
processofmigratingbacktoanodeafterithasbeenrepaired

failure counts; FC
optionalparameterfordeterminingwhethertheunavailableseconds(UAS)orseverely
erroredseconds(SES)countistheresultofasinglefailureormultiplefailures

failure in time; FIT


unitusedinfaultobservationformeasuringtheintensityoffailures

failure mode and effect analysis; FMEA


processofanalysingeachpotentialfailuremodeineverycomponentofaproductto
determinetheeffectofafailureonthecomponent'sreliabilityandonthereliabilityofthe
productorsystemandontherequiredfunctionofthecomponent

failure notification
notificationwhichinformsthereceiveraboutanabnormalsituationthatcanaffectthe
managedobject'soperation

failure operation; FOP


triggerdatawhichindicateswhatthecallcontrolhastodoifitfailstocontacttheservice
controlpoint(SCP)

failure response time


elapsedtimefromtheinstantasignallingpointrecognisesthatasignallinglinkis
unavailableuntiltheinstantwhenthesignallingpointcompletessendingachangeover
(oremergencychangeover)ordertotheremotesignallingpoint

fallback; FB; fallback copy


backupcopystoredonthesystem'sharddisk;forexampleafallbackcopyofaSWbuild
storedontheharddiskofanetworkelement

fallback
inNMS,thestatusofasoftwarebuildpreviouslyruninanetworkelement

Issue:28

497

GeneralGlossary

fallback
callset-upprocedurewhereanyfull-ratetrafficchannelormulti-slotconfiguration
parametersareignoredbecauseoneofthepartiesdoesnotsupportorusethegeneral
bearerservicesconcept

fallback; fall-back; fall back


mechanismwherebyarequestforateleservice,whichincludesanindicationthatan
alternativeteleserviceisacceptable,resultsinacallusingthealternativeteleservice

fallback build; FB
softwarebuildthatisafallbackcopyofthebackupbuildandcanbeusedassafecopyif
backupbuildiscorrupted

fallback saving; FBS


backupcopyingofGTP'packetsintoastoringdevicewhenimmediateGTP'transferis
notfastenoughordoesnotworkatall

false call
seizurethatoriginatesfromasubscriberlineoratrunkcircuitandthatisnotfollowedby
diallinginformation

family control block; FCB


datastructureoftheoperatingsystemthatcontainscontroldataofaprocessfamily

family identifier; DMX family identifier; family ID


identifierthatidentifiesaprocessfamilyinsideacomputer

family restart
operationwherebythemasterrestartstheprocessfamily

family table
parametertablewhichdefinestheprocessfamiliesthataretobecreatedinacomputer

FAP context
datastructureinmemorytostoreallinformationrelatedtoafemtoaccesspoint(FAP)

498

Issue:28

GeneralGlossary

far end
sideofanechocancellerwhichdoesnotcontaintheechopathonwhichtheecho
cancellerisintendedtooperate

far-end block error; FEBE


maintenancesignaltransmittedinthephysicallayer(PHY)overheadindicatingthatabit
errororbiterrorshavebeendetectedatthephysicallayeratthefarendofthelink

far-end loop
loopattheremoteendofalinkthatisusedfortestinganddiagnosis

far-end remote failure; FERF


alarmthatindicatesfailureordefectatthefarendofanetwork

far-field region
regionofthefieldofanantennawheretheangularfielddistributionisessentially
independentofthedistancefromtheantenna

farm
areacontaininganumberofsimilarstructures

far pointer; FAR


qualifierwhichdefinesthepointerasafarpointerifaprocessorcontainspointersof
varyinglengths

fast associated control channel; FACCH; fast ACCH


associatedcontrolchannelthatisavailableforcontrolsignallingwhentheuplinkor
downlinkoftheassignedchannelisnotinusefortraffic

fast auto-tuning
fasttuningofparametersbasedonactualfast-changingdatafromthecellswithin
specifiedlimits

fast averaging
methodthatenablesthebasestationcontrollertostarttheaveragingoflevelandquality
fromthefirstmeasurementsample

Issue:28

499

GeneralGlossary

fast BTS switching; FBSS; fast BS switching


switchingmechanismthatisusedtoimprovelinkqualitybyallowingthemobileterminal
toexchangedatawithonlyoneoftheservinganchorbasetransceiverstationsatany
givenframe

fast database; FDB


NSN'proprietaryhigh-speedin-memorydatabasefortheshortmessageservicecentre

fast data structure; FDS


in-memorydatastructurethatissharedbyseveralprocessesandthatisusedtogain
highperformance

Fast EtherChannel; FEC; Fast Ethernet channel


EtherChannelthatallowsmultiplephysicalFastEthernetlinkstocombineintoone
logicalchannel

Fast Ethernet; FE; 100Base-T


IEEEstandardforhighspeedl00MbpsEthernet

fast fading
fadingthatiscausedbymultipathpropagation

fast-forward message handling


methodwhereamessagingcentrereceivesamessagefromthemessageoriginatorand
attemptstoforwardittotherecipient,andonlyifthedeliveryattemptfails,storesthe
messageinthedatabase

fast forward tunnelling /GB/ ; fast forward tunneling /US/


tunnellinginwhichbearercontrolinformationiscarriedintheinitialaddressmessage
(IAM)andsubsequentapplicationtransportmechanism(APM)messages

fast Fourier transform; FFT


algorithmthatisusedinsignalprocessingtoconvertdatafromthetimedomaintothe
frequencydomain

fast frequency hopping; FFH


frequencyhoppinginwhichthefrequencychangerateisfasterthanthemodulationrate

500

Issue:28

GeneralGlossary

fast frequency shift keying modulation; FFSK modulation


continuouslyphasedbinaryfrequencymodulationwherethedifferenceofsignal
frequenciesishalfofthemodulationrate("1"=1200Hz,"0"=1800Hz)

fast link adaptation


linkadaptationthatisusedtoadapttochangingmodulationandcodingschemesandso
enhancethethroughputperformanceinarapidlychangingradiochannel

fast link pulse; FLP


periodicburstofnormallinkpulsesthatencapsulatestheinformationusedinthe
autonegotiationforidentifyingthespeedandmodeatwhichadeviceoperates

fast moving MS; FMMS


mobileterminal(MS)thatgeneratesmanyhandoversoverashortperiodoftimeinthe
microcellularnetwork

fast packet switching


packet-orientated,digitaltechnologythatdiffersfromtraditionalpacketswitchingina
numberofways,themostobviousbeingthatittransmitsalldatainasinglepacket
formatwhethertheinformationisvideo,voice,ordata

fast power control


radiofrequencypowercontrolthatcombatsthefadingeffectsandreducestheaverage
powerlevelthusincreasingcapacity

fast reroute; FRR


multi-protocollabelswitching(MPLS)protectionschemethatprovidesfasttraffic
restorationinthecorenetworkfortime-sensitiveapplications

fast subscriber management; FSM


featurewhichoffersanopenandfastmachine-to-machineCORBAinterfacetohandle
thedataofonesubscriberatatimeindifferentnetworkelements

fatal error
unexpectedconditionwheresignaltransferisnolongerpossible

fatal error
typeoferrorinacomputerprogramthatresultsintheterminationoftheexecutionofthe
program

Issue:28

501

GeneralGlossary

fatal state
stateofadatabasethatoccursafterswitchoverifthenewworking(WO)databasenode
cannotcompletethetransactions

Fault and Configuration Management Unit; FCMU


duplicatedunitinthefrontendthatcontainsthefunctionsofaPLMN,faultinformation,
andforwarding

fault classification; fault categorisation /GB/; fault categorization /US/; fault


class
classificationofanalarmthatindicatestheeffectofafaultontheobjectthatis
suspectedofbeingfaulty

fault code; FC
numberthatidentifiesthefaulttypeofafaultonapieceoftransmissionequipment

fault diagnosis
actionstakenforfaultrecognition,faultlocalisation,andcauseidentification

fault event; alarm point event; alarm event


eventwhichindicatesafaultinthehardware,amalfunctioninthesoftware,ora
decreaseinthesystem'sreliabilityorgradeofservice

fault hypothesis
assumptionofthefault,madebythealarmsystemanddeterminedonthebasisof
supportrulesandoneormoredisturbanceorfaultobservations

fault localisation /GB/ ; fault localization /US/; fault detection


findingthegeneralpartoftheequipmentinwhichthefaultexistsandfaultfinding,thatis,
determiningthefaultyitemoftheequipment

fault localisation time


partofactiverepairtimeduringwhichfaultlocalisationisperformed

fault localization for ATM switching fabric


featurewhichisusedtolocalisethehardwarefaultsintheplug-inunitsoftheATM
SwitchingFabricUnits(SFU)

502

Issue:28

GeneralGlossary

fault localization for network interface units


featurethatisusedforfaultlocalisationinthenetworkinterfaceunitsofanetwork
element

fault management; FM; maintenance management; trouble management


setoffunctionsthatenablesthedetectionandlocationoffailuresinthenetwork,the
schedulingofrepairs,andthetestingandreturntoserviceofrepairedequipmentand
software

fault management cell


specificOAMcellusedforfaultmanagement.Varioustypesoffaultmanagementcells
aredefinedtospecificfunctions

fault management GUI; FM GUI


graphicaluserinterface(GUI)applicationforthehandlingofalarms

fault management main window


mainwindowofthefaultmanagementgraphicaluserinterface(GUI)whichhastwotabs,
theactivealarmstabandthealarmhistorytab

Fault Management Platform; FM Platform


NSNproductthatprovidestheextraction,loading,filtering,andcorrelationofeventsthat
arerelatedtofaultmanagement

fault monitor
userwhoisresponsibleforfaultmonitoring

fault observation
permanentfailureinthesystem,detectedbythesupervisionorapplicationprogram
blocks

fault propagation
processinwhichamanagedobjectthatdiscoversamalfunctioninitselfpassesa
notificationofthefaulttothecontainmenthierarchy

fault rate monitoring; FRM


statisticalmonitoringoffaultsinthesystem

Issue:28

503

GeneralGlossary

fault rate monitoring alarm; FRM alarm


alarmthatthesystemsetsiffaultratemonitoringindicatesthatthegeneralservice
qualityofaconnectiondegrades

fault recovery
partoffaultrecoveryandstateadministrationofinterfacecomputerswhichmanages
automaticrecoveryactionsforeliminatingtheeffectsoffaultyunits

fault recovery and state administration of interface computers; fault


recovery and state administration
featurewhichcontrolstherestartingoftheinterfacecomputersandhostsbydetermining
inwhichorderthecomputersarerestartedinsystemrestartandinwhichordertheyare
allowedtomovetocertainrestartphases

fault report point


pointwhichcanreceivefaultreportsofdifficultiesfromdifferentsourcesandmakesuch
reportstootherpoints,aswellasinitiatethefaultlocationandclearingoperations

faultsman's ringback service


supplementaryservicewhichenablestheuserstocheckthenumberoftheiraccessline

fault tree analysis; FTA


analysistodeterminewhichfaultmodesofthesub-itemsorexternalevents,or
combinationsofthem,mayresultinastatedfaultmodeoftheitem,resultinginafault
tree

faulty IMEISV to BMUEF register; FIB register


centraldatabasethatcontainsthetypeallocationcodeandsoftwareversionnumberof
theinternationalmobilestationequipmentidentityandsoftwareversionnumber
(IMEISV)thatthemobileservicesswitchingcentreandservingGPRSsupportnodeuse
toderivetheUESBI-Iu

fax; telefax; facsimile


telecommunicationsservicewhichcanbeusedtotransmitacopyofatext,drawingor
imagethroughatelecommunicationsnetwork

fax and CS data call detection


featurethatenablestheMSCservertodifferentiatebetweenspeech,fax,andmodem
datacallsbymonitoringtheuserplaneanddetectingsignalsrelatedtofaxandmodem
negotiation

504

Issue:28

GeneralGlossary

fax and modem detection


functionthatcontinuallymonitorsanddetectsfaxandmodemcarriertones

fax/modem tone detector; TD; fax/modem detector


functionthatcontrolstheexecutionofautomaticlevelcontrolandechocancellation
algorithmsandcanindicatetonedetectionforbackbonecodecmodification

fax/textphone/modem tones detection package; ftmd


H.248packagethatdefinesthecontrolandmonitoringofalineforthesignalling
protocolsusedinthebeginningofadatatransmissionsessionforfax,texttelephony,or
data

F bus
busthatisusedfordatatransmissionandsignallingbetweentransceiverunits

FC-AL protocol; Fibre Channel Arbitrated Loop protocol


simplefibre-channelprotocolformassstoragedevicesandotherperipheraldevicesina
infibre-channelarbitratedlooparchitecture

FCAPS management functional areas; FCAPS


constituentpartofthefunctionalarchitectureofatelecommunicationsmanagement
network(TMN),listedinITU-TRecommendationM.3010anddescribedinITU-T
RecommendationM.3400containingfivespecificfunctionalareaswhicharefault,
configuration,accounting,performance,andsecuritymanagement

FC hub
device,eitherstand-aloneorembedded,usedinfibre-channel-arbitratedloop(FC-AL)
systems,bringinganumberofdeviceportstoaninterconnectionpoint

FCPS
partoftheFCAPSmanagementfunctionalareasinwhichaccountingisexcluded

FDMA; frequency division multiple access


techniqueinwhicheachuserreceivesaradiochannelofitsownonacommon
frequencyband

feature code
uniqueidentifierforafeaturethatisused,forexample,asakeywordthatconnectsa
licencekeytothecorrectfeature

Issue:28

505

GeneralGlossary

feature group D; FG-D; FGD


telecommunicationtrunkthatprovidesequalaccesscapabilityfromtelecommunication
carriersandexchangestotheaccesstandem

feature in licence file /GB/ ; feature in license file /US/


featureinformationinalicencefilethatconsistsofauniquefeaturecodeidentifierand
thefeaturename

feature interaction management; FIM


managementthatdefinesandhandlesinterworkingbetweenseparatefeatures

feature interaction manager; FIM


systemthatenablesthecontrolofservicesthataresimultaneouslyactive

feature level
developmentstageofasystemreleasewhichisestablishedwhenfeaturesareaddedto
thesystemorthepreviousleveliscompletedinsomeotherway

feature-level update
withinonereleaselevel,anupdatethatintroducesanewminorfeatureorfeaturegroup
tothenetworkelement

feature management; FM
setoffunctionsforcontrollingfeatures

feature pack; FP
packthatisusedtodistributeanewproductfeatureoutsidethecontextofaproduct
releaseandthatistypicallyincludedinthenextfullproductrelease

feature status check; status check


serviceinterrogationwhichinformsauserwhichservicesarecurrentlyactive

federal information processing standards; FIPS


standardsandguidelineswhichconcernsecurityandinteroperabilityissuesinfederal
computersystemsdevelopedbytheNationalInstituteofStandardsandTechnology
(NIST)

506

Issue:28

GeneralGlossary

federated identity management; FIM; federated ID management


functionthatenablestheuseofthesameauthenticationmethodinsystemsthatare
independentofeachother

feeder; feed
portionofanantennathatdirectstheelectromagneticradiationfromthefocusofthe
paraboloidtothereflectorandviceversa

feederless BTS site; feederless site


BTSsitewherethesystemmoduleandradiomodulesareinstalledapartfromeach
otherandwherenofeedersarerequiredbetweenthebasetransceiverstation(BTS)and
antennas

feed resistance
resistancethroughwhichananalogueuserlineisfed

femto access point; FAP


accesspointthatprovidesallthetransmissionandcontrolfunctionsthatarenecessary
forradiocoverageofonefemtocell

femto application platform interface; FAPI


interfacethatenablesprotocollayers,includingthemediaaccesscontrollayerandthe
layersaboveit,touseservicesprovidedbythephysicallayer

femtocell; femto cell


cellthatisbasedonthecoverageareaofafemtoaccesspointwitharadiusofupto
about30metres

femtocell network; femto cell network


radioaccessnetworkthatconsistsofoneormorefemtoaccesspointsandoneormore
femtogateways

femtocell service provider


serviceproviderthatprovidesfemtocellnetworkservicesandmanagesthesubscriptions
ofthefemtosubscribers

femto gateway; FGW


gatewaythroughwhichspecifiedfemtoaccesspointsgetaccesstothemobileoperators
corenetwork

Issue:28

507

GeneralGlossary

femto management system


managementsystemthatprovidesfunctionsforbothremoteandlocaloperationand
maintenanceofafemtocellnetworkandforrecordinginformationaboutitsperformance

femto provisioning manager; FPM


managerthatinterfaceswiththecustomerrelationshipmanagementsystemtoprovide
informationfromthefemtoaccesspointtotheoperationandmanagementserver

femto radio modem interface; FRMI


interfacethatenablesthebasebandprocessortousetheservicesprovidedbyradio
transmitterandreceiverfunctions

femto subscriber
subscriberwhoisresponsibleforaspecificfemtoaccesspoint,controlstheaccesslist,
andhasasubscriptionwiththefemtocellserviceprovider

femto user
mobileuserwhoisauthorisedtoaccessandusetheservicesinaspecificfemtozone

femtozone
zonewherefemtocellnetworktariffsandservicesareavailable

fetch
locateandloadaquantityofdatafromstorage

FIA tool; FIA


TNSDLtestapplicationwithaholisticintegrationtester(HIT)userinterfacewhichisused
fortestingasynchronousandsynchronousservicesandtheircombinations

fiber distributed data interface network; FDDI network


100Mbit/slocalareanetwork(LAN)usinganopticalfibremediumbasedonatoken
passingringprotocol,characterisedbylowdown-time

fibre channel; FC
high-speedtechnologythatisusedprimarilyforstoragenetworkingtotransmitdata
betweenserversandclusteredstoragedevices

508

Issue:28

GeneralGlossary

fibre-channel-arbitrated loop; FC-AL; FCAL


arbitratedlooptopologyforfibre-channelsystems

fibre channel-arbitrated loop hub; FC-AL hub


hubthatprovidesaportby-passfunctionandverifiesvalidsignalqualityineachport

fibre channel-arbitrated loop interface; FC-AL interface


fastserialbusinterfaceforasmallcomputersysteminterface(SCSI)onhigh-end
servers

fibre channel hub


hubthatconnectsstoragedevicesandserversonasinglefibrechannelloop

fibre channel multipath


fibrechannelredundancymechanismthatallowstheoperatingsystemtoseethesame
physicaldiskdeviceviamultiplepathswithoutdetectingthedifferentpathstothesame
deviceasseparatedevices

fibre channel network


networkthatisbasedonthefibrechannelprotocolandthatconsistsofendsystemsand
switchingelements

fibre distributed data interface /GB/ ; fiber distributed data interface /US/;
FDDI
standardspecifiedbyAmericanNationalStandardsInstitute(ANSI)forfiberopticlinks
withdataratesupto100Mbit/s

fibre-optic duct cable /GB/ ; fiber-optic duct cable /US/; optical fibre duct
cable /GB/; optical fiber duct cable /US/; duct optical cable
opticalcabledesignedforductinstallation

field
specifiedareainarecordusedforaparticularcategoryofdata

field data warehouse; FDW


datawarehouseofDX200hardwaredeliveryandfailureinformation

Issue:28

509

GeneralGlossary

field engineering workstation; FEWS


workstationthatisusedfornormaloperationaltasksandforallcommissioningtasks,
suchasbootinghardwareoverthenetworkforthefirsttime

field manipulation language; FML


languagethatincludesasetofClanguagefunctionsfordefiningandmanipulating
storagestructures,whichcontainattribute-valuepairsinfields,wheretheattributeisthe
field'sidentifierandtheassociatedvaluerepresentsthefield'sdatacontent

field-replaceable unit; FRU; field replacement unit


hardwarecomponentthatcanberemovedandreplacedon-siteseparatelyfromother
resources

field reporting
functionsoftrafficadministrationthatprovidetheuserwithinformationonthesystem's
availability,reliability,andgradeofservice

field reporting of routing components; routing component field reporting


partoffieldreportingwhichmakesitpossibletomonitortheroutingthatiscontrolledby
attributes

field reporting report


measurementreportwhichcontainsinformationobtainedthroughfieldreportingon
usability,reliability,andgradeofserviceofanetworkelement

field strength
magnitudeofacomponentofspecifiedpolarisationoftheelectricormagneticfield

field trial; field test


compliancetestordeterminationtestmadeinthefieldwhereoperating,environmental,
maintenanceandmeasurementconditionsarerecorded

file
setofrelatedrecordstreatedasaunit,orabytestring

file access data unit; FADU


datastructurethatFTAM(filetransfer,accessandmanagement)fileaccessservicesuse
whenaccessingdataonafile

510

Issue:28

GeneralGlossary

file administration
alltheoperationalfunctionsthatareusedfordefining,modifying,andoutputtingunitspecificandsystem-specificfilesinthesystem

file allocation table; FAT


indexwhichkeepstrackofwherethevariouspiecesofeachfileonadiskarestored

file association
operatingsystemfunctionthatconnectsafilewithaprogramthatcanopenit

file-based ICD provisioning


provisioningwheretheprovisioningdefinitionsandotherinformationiswrittentoCSV
files

file catalog
listthatgivesfilenames

file-compatible update
softwareupdateduringwhichdiskupdateoperationsaretransmittedfromtheoldtothe
newsoftwarepackageandviceversaandwherefilestructuresdonotchange

file compression
datacompressionofafile,usuallytoreducestoragerequirements

file conversion
operationinwhichafile'sstructureischanged

file descriptor
integerthatidentifiesafilewithinaprocess,obtainedasaresultofopeningafile

file distribution; distribution


eventinwhichachangemadeinonefileistransferredtothecopiesofthefilesituatedin
otherunitsoftheexchange

file fetcher
FTPclientwhichtransferschargingfilesbetweentheOnlineServiceController(OSC)
andthenetworkelements

Issue:28

511

GeneralGlossary

file format
datacodingthatisusedinafile

file handle
parametergiventoanapplicationwhenitopensamemoryfile,tobeusedinotherfile
operations

file handler
entitythatretrieveslogrecordsandwritesthemtothefilespecifiedintheFileHandler
parameter

file hosting service; online file storage service; online storage service
networkserviceforstoringdataintheserviceprovidersinformationsystemviathe
internet

file identifier; FID


twobyteswhichaddressafileinthesubscriberidentitymodule(SIM)

file loading; loading


eventinwhichthedatacontentsofatargetfilearefetchedfromasourcefile

file maintenance
activityofkeepingafileuptodatebyadding,changingordeletingdata

file management
processoffacilitatingaccessto,andmaintenanceof,files,folders,andtheirdirectory
structure

file monitoring
resourcemonitoringthatperiodicallymonitorsandcleansarchivedandoldfilesto
preventthesystemfromrunningoutofmemory

file name; filename


combinationofalphanumericcharactersusedforidentifyingaconcretefile

512

Issue:28

GeneralGlossary

file name extension; filename extension; file extension; extension


charactersthatareaddedtotheendofthefilenametoidentifythetypeofdataheldin
thefile

file scanning
fileoperationinwhichitispossibletoreferencearecordorsubrecordcontainingthe
desiredinformation

file set
entityoffilesanddirectoriesondigitaldatastorage(DDS)tapethatarereferredtoby
usingauniquename

file slice
partofafiletowhichthereadandwriteoperationsofeachobservedprocessare
restricted

file store; file storage


non-volatilememorythatprovidesphysicalmeansforpreservingdataonfiles

file system
inacomputer,thewayinwhichfilesarenamedandhowtheyareplacedlogicallyfor
storageandretrieval

Filesystem Hierarchy Standard; FHS; File System Hierarchy Standard


standardthatdefinesthemaindirectoriesandtheircontentsintheLinuxoperating
systemandotherUNIX-likeoperatingsystems

file system interface; FI


applicationprogramminginterface(API)whichisusedtoreadtheconfigurationdata
fromconfigurationfilesofTFTPandBOOTPserversandtoreadthefilesrequestedby
TFTPclients

file template
textualfilemodelintextualformwhichcanbemodifiedorfilledintomakeafile
containingsite-specificdata

file transfer, access, and management; FTAM


intheOSImodel,anapplicationlayerprotocoldevelopedfornetworkfileexchangeand
managementbetweendiversetypesofcomputers

Issue:28

513

GeneralGlossary

file transfer service


servicethatisusedtoperformfileoperationsonthefilesinafilestoreusingapreviously
establishedfiletransferconnection

file writing
fileoperationinwhichanapplicationcanwriteinafilebyroutineswhichcopythe
desiredpartintothefile

filler; PAD; padding


partofadatastructurewhichextendsastringtotherequiredlength

filler blade; dummy blade


modulethatispluggedinaslotwhichisnotpopulatedwithanyfunctionalbladeto
ensureelectromagneticcomptibility(EMC)shieldingandtoactasairseal

filling bit
bitwithnospecificmeaningusedtofillatimeofcommunicationduringwhichthereare
nosignificantbitstobetransmitted

fill-in signal unit; FISU


signalunitcontainingonlyerrorcontrolanddelimitationinformation,whichistransmitted
whentherearenomessagesignalunitsorlinkstatussignalunitstobetransmitted

fill-in site; coverage fill-in site


sitewhichincludesalow-capacityandlow-powerbasetransceiverstationtoadd
networkcoverageorcapacitylocally

fill ratio
ratiothatindicateshowmuchadatabaseormemoryisfilled

filter
mechanismthatspecifiesthesetofassertionsthatdefinesthefilteringtesttobeapplied
tothemanagedobject

filter action
actionthatoccurswhenthefiltercriteriaismet

514

Issue:28

GeneralGlossary

filter code
interpretedbinarycodethatisusedtodecidehowtoprocessanIPpacket

filter condition
conditionsettothefilterthatdeterminesthefilteraction

filter criteria; FC
informationthattheservingcallstatecontrolfunction(S-CSCF)receivesfromthehome
subscriberserverortheapplicationserver,andthatdefinestherelevantservicepointsof
interest(SPI)foraparticularapplication

filter dialogue /GB/ ; filter dialog /US/


dialogueofthegraphicaluserinterfaceinwhichtheuserdefinesthefilteringcriteria
usedforchoosingthealarmsandothereventstobeshown

filtering
methodforfindingthetotalnumberofsubscribersmatchingagivensearchconditionor
conditions

filtering application
applicationwhichreceivesamessagefromanetworkelement(NE),processesthe
message,andthensendsthemessageormessagestatusinformationbacktotheNE

filtering of alarm input state change; alarm input state change filtering;
filtering
operationwhichpreventsthenotificationaboutthefasttransitionfromonelogicstateat
analarminputtoanotherlogicstateandback

filtering of log entry


filteringoftheprintingoflogtoserviceterminalorMML-terminalaccordingtoseveral
rules

filtering profile
profilethatisusedtobarservicebaseduponservicecategoryoruponthetimeofday

filtering time
periodduringwhichthegappinggateisactive

Issue:28

515

GeneralGlossary

filter name
namethatidentifiesafilterintheprocessinglist

filter order
orderwhichisappliedwhenthereismorethanonefilterpermessage

final assembly code; FAC


partoftheinternationalmobileequipmentidentity(IMEI)thatidentifiestheplaceof
manufactureorfinalassemblyforamobileterminal

final calculation; final calculation of peak hour measurement


updatingofthevaluesrelatedtopeakhourmeasurements

final filter
filterwhichdeterminesthefinalfilteractionwhenthefilterconditionismet

final response
lastoperationthattheservicecontrolfunction(SCF)sendstotheserviceswitching
function(SSF)allowingthecallcontrolfunction(CCF)toproceedwiththecall

final result of extended preanalysis


resultdataachievedinanextendedpreanalysis

final semantic check


semanticcheckinwhichthesemanticsofeachparameterblockischeckedfirst,followed
bythecorrelationcheckbetweentheparameterblocks

final state plan


configurationplanwhichdescribesthedesiredconfigurationstateunderparameter
management

financial customer report; financial prepaid report; financial report


customerreportgeneratedbythenetworkoperatorwiththecustomerreportinginterface
tocreateanoverviewofthefinancialsituationconcerningtheprepaidsubscriptionsofa
serviceprovider

516

Issue:28

GeneralGlossary

finger; rake finger; RAKE finger


receiverunitthatdespreadsonemultipathsignal

fingering
establishingconnectiontothehostcomputerforthepurposeofobtaininginformationon
itsusers

fingerprint
identificationbitcodewithwhichthecryptographickeycanbeguaranteedtobelongto
itsclaimedowner

finite state automaton; state automaton; automaton; finite state machine;


state machine
abstractmachinethat,onthebasisofaninputanditsinternalstatus,givesanoutput
andtakesonanewstate

finite state machine model; finite state model


operationalmodelofanentitythatisdescribedbythefinitesetofstatestheentitycanbe
inandthefinitesetoftransitionspossiblefromonestatetoanother

F interface
interfacewhichconnectsworkstationsremotelytotheoperationssystemsfunction(OSF)
ormediationfunction(MF)throughadatacommunicationsnetwork

firewall
systemoragroupofsystemsthatenforceaccesscontrolbetweentwonetworks

firmware
softwarethathasbeenpermanentlybondedtohardware

firmware hub; FWH


flashmemorythatcontainsthebasicinput/outputsystemofacomputer

first call attempt


firstattemptofacalldemandthatreachesagivenpointofthenetwork

Issue:28

517

GeneralGlossary

first extension number; FIS


extensionnumberwhichisthefirstinaprivatenetwork'sorcentrexgroup'sextension
numberspace

first in first out; FIFO


queuingdisciplineinwhicharrivingentitiesarehandledintheorderofarrival

first-in first-out shift register; FIFO shift register


shiftregisterthatprovidesanelasticbufferbyshiftingdatainatarateindependentfrom
thedatabeingshiftedout

first-level bit rate


lowestbitratedependingonthetransmissiontechniqueused

first line maintenance; 1st line maintenance


levelofmaintenancewhichreferstothesimplerepairandreplacementprocess

first ringing
firstpartofacallingsignalthatissentimmediatelyaftertheconnectiontothecalled
partyhasbeenestablished

fixed allocated announcement


fixedphrasetransmittedtoalllisteningusersbyusingpermanentlyreserved
transmissionchannelortime-slot

fixed allocation
mediumaccessmodethatcanbeusedduringtemporaryblockflowandthatis
characterisedbyfixeddistributionofradioblocksandpacketdatachannels(PDCH)in
theassignmentmessagewithoutanassigneduplinkstateflag(USF)

fixed call forwarding busy; call forwarding busy, fixed; fixed call
forwarding on busy
callforwardingbusywhichallowsausertoforwardallincomingcallstoanothernumber
includedinpredefinedlistofmaximum10numbers

fixed call forwarding no reply; call forwarding no reply, fixed; fixed call
forwarding on no reply
callforwardingnoreplywhichallowsausertoforwardallincomingcallstoanother
numberincludedinpredefinedlistofmaximum10numbers

518

Issue:28

GeneralGlossary

fixed call forwarding unconditional; call forwarding unconditional, fixed;


fixed unconditional call forwarding
callforwardingunconditionalwhichallowsausertoforwardallincomingcallstoanother
numberincludedinpredefinedlistofmaximum10numbers

fixed CDR format


chargingrecord(CDR)formatinwhichthefieldsofthechargingrecordaredefined
beforehand

fixed circuit group


circuitgrouppermanentlyreservedforacertaintask

fixed-content announcement; fixed announcement


fixedphrasedistributedbybroadcastmethodtoalllisteningusers

fixed data pattern; fixed data


bitpatterntransmittedinaconnectionnotallocatedtonormaltraffic

fixed destination
destinationusedintimecontrolledrouting(TCR)iftherearenochangetimesforsome
dayclassorwhenanalysisisdetachedfromTCR

fixed destination call; FDC; direct call; hot line /US/


servicewhichestablishesacalltoapredefinednumberwhenauserliftsthehandsetor
theterminalstartsacall

fixed destination call number


calledsubscribernumberforthefixeddestinationcallregisteredbyanetworkoperator
orauser

fixed destination call with time-out; fixed destination call, subscriber


controlled with time-out; delayed direct call
fixeddestinationcallwhereaconnectiontoapreviouslydefineddestinationis
establishedunlessthesubscriberdialsanothernumberwithinatimelimit

fixed file
filethecontentsofwhicharethesameinallbuilds

Issue:28

519

GeneralGlossary

fixed hunting; FH
huntingmethodinwhichthehuntingisstartedfromafixedorrotatingstartingpoint

fixed length record


recordthatalwayshasthesamelengthasallotherrecordswithwhichitislogicallyor
physicallyassociated

fixed-line broadband connection


broadbandconnectionthatisbasedontheuseoftelecommunicationscables

fixed-line wireless broadband connection


wirelessbroadbandconnectionthatcanbeusedinalimitedarea

fixed-mobile convergence; FMC; FMI; fixed-mobile integration


convergenceoffixedandmobileservicesintoanintegratedserviceinvolvingtherelated
networks

fixed network; landline network


telecommunicationsnetworkinwhichmostoftheconnectionsarepermanentlyfixed

fixed network user rate; FNUR


userratebetweenthemobileservicesswitchingcentreinterworkingfunction(MSCIWF)
andthefixednetwork

fixed outgoing call barring; OCB-F


supplementaryservicewhichenablescallsbelongingtocertaintypestoberejectedif
theyareoriginatedbytheserveduser

fixed password
passwordthatcannotbechanged

fixed reference channel; FRC


referencemeasurementchannelthatisusedforastraightforwardcomparisonofinitial
performanceresultsofathroughputmeasurement

520

Issue:28

GeneralGlossary

fixed soft switch; Fss


softswitchthatisusedtoconnectthepublicswitchedtelephonenetwork(PLMN)and
theservicesitprovidestotheIPmultimediasubsystem

fixed switching centre /GB/ ; fixed switching center /US/; FSC


fixednetworkelementwhichperformstheswitchingfunctionsinitsareaofoperation

fixed username
usernamethatcannotbechanged

fixed WiMAX
WiMAXthatprovidesbroadbandaccessforbusinessandresidentialusers

fixed wireless; WLL; RLL; FRA; FWA; fixed wireless access; wireless local
loop; radio local loop; fixed radio access
partoftheaccessnetworkwheretheconnectionbetweenthesubscriberstationandthe
exchangeisimplementedpartlyorcompletelybytheradiopath

fixed WLL terminal; fixed terminal


WLLterminalwhichisconnectedtoalocalexchangeofafixednetworktrougharadio
pathwiththehelpofateleadapterandaradiopart

flag; F
uniquepatternonthesignallingdatalinkusedtodelimitasignalunit

flame
abusiveorpersonallyinsultinge-mailmessageornewsgroupposting

flash bank
memorybankthatislocatedintheflashmemory

flash boot
bootablearchivethatisstoredintheflashmemory

Issue:28

521

GeneralGlossary

flash memory; FEPROM; flash erasable programmable read-only memory;


flash EPROM
non-volatilememorythatcanbeelectricallyerasedinthecircuitandreprogrammed,and
thatallowsblocksofdatatobestored,booted,andrewrittenasnecessary

FLASH-OFDM
airinterfacetechnologythatisbasedonorthogonalfrequency-divisionmultiplexing
(OFDM)andthatisdesignedforthedeliveryofinternetservicesinthemobile
environment

flat fading margin


valueindBthatshowshowmuchthereceivedsignallevelcandecreasebeforethe
qualityofthedetectedsignalfallsbelowagivencriterion

flat-rate charging; fixed-rate charging


chargingbasedonafixedfee,inwhichapre-definedpriceischargedforapre-defined
billingperiod

flat rate subscription


subscriptioninwhichthesubscriberpaysthesamerateforeachbillingperiodandcan
usetheoperator'sservicesforthatamountduringeachbillingperiod

fleet
pre-definedsetofuserswhobelongtothesameorganisation

flexibility
abilityofasystemtoadapttochangingrequirementsandbusinessneeds

flexible Iu; multipoint Iu


featurethatprovidesastandardisedmechanismforconnectingmultiplemobileservices
switchingcentres(MSC)andservingGPRSsupportnodestoaradionetworkcontroller
withinasingleoperatornetwork

flexible RLC
featurethatenableshigherbitratesforindividualusersandhigheroverallthroughputin
thenetwork

522

Issue:28

GeneralGlossary

flexible waveguide
waveguideconstructedtopermitlimitedbendingandtwistingwithoutappreciable
changeinitselectricalproperties

FlexiGateway GGSN; FGN


gatewayGPRSsupportnode(GGSN)thatisbasedontheFlexiGatewayhardware
platformandincludestrafficanalyserfunctions

FlexiHub Manager
NSNelementmanagerwithagraphicaluserinterfaceforinstallingandoperating
FlexiHopperandFlexiMultiradioproducts

Flexi Multiradio BTS


NSNproductthatsupportstheevolvednodeBfunctions

Flexi Network Gateway


NSNproductthatsupportstheservinggatewayandpacketdatanetworkgateway
functions

Flexi Network Server


NSNproductthatsupportsthemobilitymanagemententityfunctions

FlexiPlatform; FlexiServer platform


platformforserver-basedapplications,especiallyforcontrolplaneapplications

Flexi System Module; FSM


NSNsystemmodulethatcontainsthecontrolandmanagementplanefunctionsforan
evolvednodeB

Flexi Transport Module; FTM


partofalong-termevolutionbasetransceiverstation,thatis,theevolvednodeB,that
performstheterrestrialtransportfunctionsandthatisvisibleasaseparateentityinthe
radionetworktopology

floating SW licensing
technicallicensingmethodinwhichthelicence-key-restrictedpermissiontousethe
softwareissharedbetweenusersoractorsthatarelocatedinaspecifiedarea

Issue:28

523

GeneralGlossary

floating transceiver; redundant TRX; floating TRX


transceiverthatcanbedynamicallyswitchedtooperateinanyofthesectorsofthebase
transceiverstationandthatisalsousedasareplicatingtransceiverautomaticallythat
automaticallyreplacesafaultybroadcastcontrolchannel(BCCH)transceiver

flooding
inareal-timenetwork,sendingalargeamountofdata,forexample,toanotheruserorto
apublicwebserver

floor
righttoaccessormanipulateasharedobjectorresource

floor control; talk burst control


featurethatenablesapplicationsoruserstogainsafeandmutuallyexclusiveornonexclusiveinputaccesstoasharedobjectorresource

floor control protocol; FCP; TBCP; talk burst control protocol


protocolthatisusedtoconveyfloorcontrolmessagesamongthefloormoderators,floor
controlserver,andtheparticipantsofthesession

floor deny
floorcontrolmessagewhichthePoCserverusestonotifytheuserequipmentthatithas
beendeniedpermissiontousethemediaresource

floor grant
floorcontrolmessagewhichthePoCserverusestonotifytheuserequipmentthatithas
beengrantedthefloorandthereforehasbeengrantedpermissiontousethemedia
resource

floor idle
floorcontrolmessagewhichthePoCserverusestonotifytheuserequipmentthatnooneownsthemediaresourceandthefloorisopenandavailablefortheusers

floor release
floorcontrolmessagewhichtheuserequipmentusestonotifythePoCserverthatitis
releasingthemediaresource

524

Issue:28

GeneralGlossary

floor request
floorcontrolmessagewhichtheuserequipmentusestorequestthePoCserverto
allocatemediaresourcesforitsuse

floor revoke
floorcontrolmessagebywhichthePoCserverrevokesthemediaresourcefromthe
userequipment

floor taken
floorcontrolmessagewhichthePoCserverusestonotifyallusers,excepttheuserthat
hasbeengrantedthefloor,thatthefloorhasbeengrantedtoanotheruser

flow-based charging; FBC


chargingthatenablestheapplicationofdifferentiatedchargingforthetrafficflows
belongingtodifferentservices,thatis,differentservicedataflows,eveniftheyusethe
samePDPcontext

flow classification
processofcategorisingpacketflowstodistinctclassesbasedontheirbehaviour

flow control; FC
setofmechanismsusedtopreventanetworkfrombecomingoverloadedbyregulating
theinputratetransmissions

flow identifier; flow ID


identifierofanIPflowwithinamediacomponentassociatedwithaSIPsession

flow label
20-bitfieldintheIPv6headerthatcanbeusedbyasourcetolabelsequencesof
packetsforwhichitrequestsspecialhandlingbytheIPv6routers

flow line
linerepresentingaconnectionpathbetweensymbolsinadiagram

flow-through provisioning
provisioninginwhichtheprovisioningsystemunderthecustomerrelationship
management(CRM)systemexecutesserviceactivationrequeststhroughtheCRM
system,withoutusinganysubscriber-awarefeatures

Issue:28

525

GeneralGlossary

flush (verb)
todeleteorclearsomething,ortoabortanoperation

flush message protocol; flush protocol


ATMprotocolthatensuresthedeliveryofdataframesinthesameorderinwhichthey
weretransmitted

flush procedure; flush; flushing


procedurethatisusedtodeleteorclearsomething,ortoabortanoperation

FM basic; FMB
partoftheO&Mmodellinglanguagethatcoversthefaultmanagementaspectssothat
themanagementsystemsandthenetworkelementsfaultmanagement(FM)databases
canbekeptsynchronised

FM basic adaptation file


adaptationfilethatcontainsalarmdescriptionsandbasicalarmrules

FM CORBA interface
interfacebasedonCommonObjectRequestBrokerArchitecture(CORBA)for
forwardingfaultmanagement(FM)datatoathird-partysystem

FM rule editor
applicationthatisusedforcreatingandmodifyingrulesforalarmflowreduction

FM service subscriber
initiatingsubscriberwhoisallowedtomodifythefollow-me(FM)dataofaremoteparty
whohasbeenregisteredtoanotherinitiatingsubscriberforthefollow-meservice

FM south mediation interface


southmediationinterfaceforimportingfaultreportsfromnetworkelementsintotheFault
Management(FM)Platform

fmtp
inthesessiondescriptionprotocol(SDP),aformat-specificattributethatlistsall
supportedeventsthatarenotvendor-specific,andallowsparametersthatarespecificto
aparticularformattobeconveyedinsuchawaythatSDPdoesnothavetounderstand
them

526

Issue:28

GeneralGlossary

FNIM channel
transmissionchannelwhichimplementstheinternaldatatransmissionconnection
betweenthecallcontrolcomputerandFNIM

focus
identifierseparatingtasksperformedbyaprocesstodifferentcustomers

folder
storagelocationwhichisusedforgroupingorganisations,users,andgroupsintosuitable
talkgroups

follow-me; FMD; follow-me diversion; follow-me service


servicewhichenablesausertocontrolthecallforwardingunconditionalserviceremotely

follow-me function node; FFN


networknodeinthepubliclandmobilenetworkoftheremotepartyinwhichtheremote
partyhasstoredfollow-medata

follow-me service
facilitybywhichausercanhavehisincomingcallsautomaticallytransferredtoanumber
wherehehasactivatedthefacility(thesubscribermayalsofurtherretransferthecalls.
Follow-meservicecanonlybedeactivatedfromthehomestation.Inordertousethis
facility,thesubscriberneedsaspecialidentificationcode.)

follow-on call
featurewhichenablesausertomakeaseriesofcallattempts

footer
informationthatfollowsdata

forced control
usercommand(MMLcommandoraswitchintheequipment)whichcannotberealised
undercontrolledcircumstances

forced control parameter; FCD


parameterthatisusedtointerruptaunitthathasongoingtasksandsocannotbe
interruptedinacontrolledmanner

Issue:28

527

GeneralGlossary

forced detachment
procedurebywhichthemanagementuserdetachesauserorgroupofusersfromatalk
group,orterminatesanentiretalkgroup

forced half-rate mode; forced HR mode


methodthatisusedinchannelrateselectionbetweenfull-rateandhalf-ratechannels
basedontheaverageoftheestimatedincomingdownlinkcarrier-to-interferenceratios
(C/I)ofdynamicfrequencyandchannelallocations(DFCA)inacell

forced handover; FHO


handoverusedtorapidlyclearthebasestation(BTS)ortransceiver(TRX)fromtrafficby
usinglockingcommandswithoutdisturbingtheongoingcalls

forced lock; flock


actionbywhichtheadministrativestateofaresourceisforciblychangedtolockedso
thatitsuseisimmediatelyinterrupted

forced mode
Ethernetoperationalmodeinwhichthecommunicationrateandduplexmodeofalink
aresetmanually

forced on-net call


on-netcallwherethecallingsubscriberusesthedirectorynumberofthecalled
subscriberandthecallistreatedasifitwasanon-netcall

forced on-net routing


featureofthevirtualprivatenetwork(VPN)thatallowscallsmadetoVPNgroup
membersusingadirectorynumbertobetreatedastheyweremadeusingashort
number

forced reference
synchronisationreferencewhichtheoperatorsetsforthesystemclock

forced release
facilitywherebyacircuitortraffic-carryingdevicecanbearbitrarilyreleased,
independentlyofanyreleaseactiontakenbythecallingorcalledparty

forced release line signal; forced release


linesignalwhichclearsthecallwithoutanyactionbythecallparties

528

Issue:28

GeneralGlossary

forced rerouting
procedureoftransferringsignallingtrafficfromonesignallingroutetoanother,whenthe
signallingrouteinusefailsorisrequiredtobeclearedoftraffic

forced retransmission
errorcorrectionprocedureusedtocomplementthepreventivecyclicretransmission
procedure

forced routing
routinginwhichthecircuitisreservedbyusingtesthunting

forced state transition


statechangeofafunctionalunitwhichausercan,inexceptionalcircumstances,doby
usingforcedcontrolparameters

forced switch
commandthattheoperatorusestoforcetheprotectionswitchingoperationtohappen

forced switchover
switchoverprocedurethatmakesastandbyunitactivewhenanactiveunitgoesoutof
service

forceful shutdown
shutdowninwhichtheservernotifiesallapplicationsandsubsystemstodropallcurrent
workandreleaseallresources

foreign actor
actoroutsideoftheChorussite,orinanothercommunicationsdomain

foreign agent; FA
mobilityagentontheforeignnetworkthatcanassistthemobilenodeinreceiving
datagramsdeliveredtothecare-ofaddress

foreign agent advertisement


messagethatanaccesspointsendstoamobileterminalwhenitdetectsthatthemobile
terminalhasmovedtoadifferentsubnetworkandenteredthecellinwhichitislocated

Issue:28

529

GeneralGlossary

foreign base transceiver station; foreign BTS


neighbouringbasetransceiverstationnotmanagedbyNMS

foreign PLMN
anyPLMNotherthanthehomePLMN

foreign subscriber
mobilesubscribertoaforeignpubliclandmobilenetwork(PLMN)

foreign TLLI; foreign temporary logical link identity


temporarylogicallinkidentity(TLLI)builtbythemobilestation(MS)onthebasisofthe
packettemporarymobilesubscriberidentity(PTMSI)allocatedinanotherroutingarea
(RA)

formal parameter
variablenametowhichconcretevaluesareassignedorwhichisreplacedbyconcrete
variables

formal parameter list


listwhichcontainsformalparameters

format
arrangementorlayoutofdataonadatamedium

format
makeanunuseddatamediumreadyforuse

format file; form file


filethatcontrolswhichfieldsofreceiveddataaresavedintoarecordorreport

format, resolution, and proportional size reduction policy; FRS


policyusedforcontentadaptation,whichdetermineshowtheformat,resolution,orsize
ofamediacomponentofamultimediamessageischangedtomeetthecapabilitiesof
therecipient

530

Issue:28

GeneralGlossary

format statement; format


statementorexpressionforthepresentationofaninput-outputoperationwhich
describesthepresentationmodeofdatatobetransmittedordataalreadytransmittedin
aprogramminglanguage

formatter
classwhichisresponsibleforproducingthesyntaxoftheactualoutput

format type
informationfieldinarawdatamessagewhichtellswhichformwillbeusedwhen
creatingachargingrecord(CDR)orareport

form file editor


featureusedtocreateandmodifyformfilesusedintheexchangetoformatcharging
records(CDR)

forming of charging records; generation of charging records; CDR


generation
partofdetailedchargingwhichformsadetailedchargingrecordfromthedefined
chargingcases

forward access channel; FACH


downlinktransportchannelthatmobileterminalsusetoreceivecontrolinformationand
packetdata

forward address message; FAM


groupofmessagesthataremeanttobeforwardedandthatcontainaddressinformation

forward call indicator


signallingparameterwhichissentintheforwarddirection,indicatingthecharacteristics
oftheconnection,signallingpathandcallingsubscriber

forward congestion; congestion encountered forward


congestionindicatedwithaforwardexplicitcongestionnotification(FECN)

forward direction
directionfromthecallingpartytothecalledparty

Issue:28

531

GeneralGlossary

forwarded call charging record; FORW CDR; forwarded call CDR; forward
CDR
chargingrecordthatcontainschargingdatarelatedtocallforwarding

forwarded-to number; FTN


numberoftheusertowhomacallisforwarded

forward error correction; FEC


techniqueallowingthereceivertocorrecterrorsoccurringonatransmissionchannel
withoutrequiringretransmissionofthedata

forward explicit congestion notification; FECN


bitthatacongestednetworksetstonotifytheuserthatcongestionavoidance
proceduresshouldbeinitiatedwhereapplicablefortrafficinthedirectionoftheframe
carryingtheforwardexplicitcongestionnotification(FECN)indication

forward indicator bit; FIB


bitinasignalunitwhichindicatesthestartoftheretransmissioncycle

forwarding behaviour
featuresselectedbynodeswithinthedifferentiatedservice(DS)domainforpackets
basedontheirDScodepoint(DSCP)

forwarding leg
legthatisestablishedbetweentheforwardingpoint,suchasthecalledsubscriber,and
theforwardedpoint,suchassubscriberC

forwarding number analysis


analysisthatisexecutedataforwardingserviceinvocationandthatincludescalledparty
numberanalysisandredirectingpartyanalysis

forwarding prefix
firstdigitofthenumberwhichcausesaspecificnotificationtothecallingorcalled
subscriberwhenthecallisforwarded

forwarding subscriber; forwarding party; forwarding user


calledsubscriberofthelegprecedingthecallforwarding,orcalledsubscriberoftheleg
succeedingthecallforwarding

532

Issue:28

GeneralGlossary

forwarding table; FIB; FDB; filtering database; forwarding information base


tableinthekernelthatcontrolstheforwardingofpackets

forwarding triggering criterion


servicetriggerthatisstoredinthehomelocationregisterandthatcontainsanindicator
thatdeterminesthattriggeringoccursonlyinaGSM-forwardedcallorinCAMELcontrolledcallforwarding

forward routing
calltransferinwhichanexchangeredirectsacalltoanotherexchangeortoanother
subscriberinthatexchange

forward sequence number; FSN


signalunitusedtoidentifythetransmittedmessagesignalunits

forward signal
signal,usedfortheestablishment,releaseorothercontrolofaconnection,sentinthe
samedirectionascallset-up

forward signalling /GB/ ; forward signaling /US/


signallingsentinforwarddirectionfromthecallingpartytothecalledparty

forward slice
programslicethatconsistsofallprogrampointsthatareaffectedbyagivenpointinthe
program

forward transfer message; FOT; forward transfer


signallingmessagesentintheforwarddirectiononsemi-automaticcallswhenthe
outgoinginternationalexchangeoperatorwantsthehelpofanoperatorattheincoming
internationalexchange

FORW charging
chargingwhichisstartedfortheforwardingsubscriberforthelegfromtheforwarding
subscribertothethirdparty

fourth-order multiplex equipment


multiplexequipmentwhichcombinesanumberoftributarysignalsintoandseparates
themfromone139264kbit/ssignal

Issue:28

533

GeneralGlossary

four-way uplink diversity; 4-way uplink diversity


functionbywhichabasetransceiverstation(BTS)usesfourantennasandfourreceivers
simultaneouslyonasinglechanneltoobtainimprovedoverallBTSreceiversensitivityin
anenvironmentthatissubjecttorandommultipathfading

four-way wideband combining; 4-way wideband combining


signal-combiningtechniqueinwhichtransmittersignalsarecombinedintooneantenna
usingtwoparallelwidebandcombinersinaserieswithasinglewidebandcombiner

four-wire circuit; four-wire line


circuitthatconsistsoftwopairsofconductorsor,inthecaseofphantomcircuit,oftwo
groupsofconductors,fromwhichonepairisusedingodirectionandanotherinreturn
direction

four-wire switching
switchingusingaseparatepath,frequencybandortimeintervalforeachdirectionof
transmission

fractional DPCH; F-DPCH


dedicatedphysicalchannel(DPCH)thatsharesthesamedownlinkcodechannelamong
severalHSPAusersforthededicatedphysicallayersignalling

fractional interface
interfacewherecapacitycanbeallocatedfullyorpartially

fractional load
ratioofthereceivedpowercausedbythemobilestationsoftheowncelland
surroundingcellstothetotalinterferencepowerreceived

fragment
groupingofalimitednumberofobjectclassdefinitions.Eachfragmentdealswitha
particularsubject

fragmentation and reassembly


processofbreakingpacketsintosmallerpiecesthatfitintotheframesusedinthe
underlyingnetwork,andreassemblingthepiecesintotheoriginalpacketsinthe
receivingsystem

534

Issue:28

GeneralGlossary

fragment header
IPv6extensionheaderusedbyanIPv6sourcetosendapacketlargerthanwouldfitin
thepathmaximumtransmissionunit(MTU)toitsdestination

frame
cyclicsetofconsecutivetime-slotsinwhichtherelativepositionofeachtimeslotcanbe
identified(Identificationtakesplacebyreferencetoaframealignmentsignal.Itdoesnot
necessarilyoccurasawholeorevenpartlyineachframe.)

frame
Inhigh-leveldatalinkcontrolprotocol(HDLC),abracketedsequenceofcontiguousbits
thatincludesbothopeningandclosingflagsatlayer2oftheOSIreferencemodel

frame
inaTDMsystem,arepetitivegroupofsignalsthatresultfromthesignalsamplingofall
channelsincludinganyadditionalsignalsneededforthepurposesofsynchronisation
andotherrequiredsysteminformation

frame abort
eventthatoccurswhenalinklayerentityignoresaframethatitiscurrentlyreceiving

frame alignment; FA
stateinwhichtheframeofthereceivingequipmentissynchronisedwiththatofthe
receivedsignal

frame alignment recovery time


timethatelapsesbetweenavalidframealignmentsignalbeingavailableatthereceiving
terminalequipmentandframealignmentbeingestablished

frame alignment signal; FAS; frame alignment sequence


distinctivesignalinsertedineveryframeoronceineverynframes,alwaysoccupyingthe
samerelativepositionwithintheframe,andusedtoestablishandmaintaintheframe
alignment

frame alignment time slot


timeslotoccupyingthesamerelativepositionineveryframeandusedtotransmitthe
framealignmentsignal

Issue:28

535

GeneralGlossary

frame alignment time-slot


time-slot,occupyingthesamerelativepositionineveryframe,usedtotransmittheframe
alignmentsignal

frame alignment word; FAW


framesynchronisationpattern,whichispartoftheframealignmentsignal(FAS),and
consistsof"0011011"inbits2-8oftheFASinevenframes,complementedbyan"1"in
bit2ofthesucceedingoddframe

frame-based MPLS
modeofmulti-protocollabelswitching(MPLS),inwhichallMPLSframesbetweentwo
MPLSdevicesmovewithinasinglepoint-to-pointchannel

frame bit
bitwhichisusedtosynchronisethesendingandreceivingunitsandtocarry
maintenancedata

frame check sequence; FCS


cyclicredundancychecksequencederivedoveranentireframe(excludingflags)

frame control layer; FCL


partoftheprotocolstackinthelurinterfacethatattachestransportblockinformationto
theuserplaneformacrodiversitycombining,outerlooptransmissionpowercontroland
synchronisation

frame counter
binarycounterusedforframing

framed interface
interfacewheretheserialbitstreamissegmentedintoperiodicphysicalframes.Each
frameisdividedbyafixedpartitionintoanoverheadandaninformationpayloadportion

frame discard
partofcongestioncontrolwhichallowsthediscardingofmultiplecellsinaframe,aspart
oftheframeislostduetoalostormis-insertedcell

frame erasure probability; FEP


valuethatreferstotheestimatedprobabilitythataspeechframeiserased

536

Issue:28

GeneralGlossary

frame erasure rate; FER


ratioofthetotalnumberofspeechframestothenumberoferasedspeechframes

frame error rate; FER


ratioofthenumberoferroredframestothetotalnumberofframestransmittedinagiven
timeinterval

frame handling protocol; FHP


userplaneprotocolforinformationtransmittedorreceivedonadedicatedtransmission
channelbetweenthebasestation(NodeB)andcombiningorsplittingequipmentinthe
radionetworkcontroller(RNC)

frame number; FN
identifierforthepositionofaparticularTDMAtime-framewithinahyperframe

frame per PW packet; FPP


parameterthatdefineshowmanytime-divisionmultiplexedframesareusedtogenerate
onepseudowire(PW)packet

frame protocol; FP
protocolwhichisusedtotransportuserdataframesbetweentheservingradionetwork
controller(SRNC)andthebasetransceiverstation(BTS)overtheIubandIurinterfaces

frame quality classification; FQC


informationelement(IE)whichisusedforclassifyingthecontentsofaframedepending
onwhethererrorshaveoccurredinframetransmissionornot

frame reject; FRMR


messagesentinthecaseofalogicallinkcontrolerrorthatresultsfromthereceiptofan
undefinedorincorrectframeandthatcannotbecorrectedbyretransmittinganidentical
frame

frame relay; FR
fastpacketswitchingthatusesaunitofdataofvariablelength(frame)andleaveserror
correctionfortheendpoints

frame relay bearer channel


logicalentitycontainingalltheequipment,software,andmemoryresourcesallocatedfor
theuseofoneframerelayuserconnection

Issue:28

537

GeneralGlossary

frame slip
lossorgainofacompleteframeofconsecutivedigittime-slotsinadigitalsignal,where
thelossorgainoftheframecannotbecorrected

frame structure; transmission frame structure


datastructurethatisusedinradiotransmissioninthelinklayer,inwhichpacketsofdata
arepackedinframes

frame synchronising signal /GB/ ; frame synchronizing signal /US/


basictimingsignalthatisusedinafunctionalunittosetthebeginningoftheexchange's
internalPCMframe(DX200)

frame tunnelling mode; FTM


modeofdatatransmissioninwhichthecircuitstransferhigh-leveldatalinkcontrol
protocol(HDLC)framedataasynchronously

framework
structuralplanordescriptionforclassifyingandorganisinginformation

framework policy information base; framework PIB


policyinformationbasewhichdefinesasetofprovisioningclasses(PRC)andtextual
conventionsthatarecommontoallclientsthatprovisionpolicyusingCOPSfor
provisioning

framing
controlprocedureusedwithmultiplexeddigitalchannelswherebitsareinsertedsothat
thereceivermayidentifythetimeslotsallocatedtoeachsubchannel

framing bit; F bit


bitintroducedintoabitstreamthatidentifieswhereoneframeendsandthenextone
begins

framing protocol
protocolthatisusedinthethirdgenerationnetworksonIurandIubinterfacestoframe
channelssupportedbetweentheservingradionetworkcontrolleranduserequipment

fraud detection
partoffraudmanagementinvolvingactionstakentodetectfraudulentuseofthenetwork
andpossiblyfraudulentsubscriberswhomisusethenetwork

538

Issue:28

GeneralGlossary

fraud detection system; FDS


systemthatordersthehomenetwork(HPLMN)tocollectfraudinformationgathering
system(FIGS)dataaccordingtocertainprinciplesforgivensubscribers

fraud information gathering system; FIGS


featurethatprovidesthemeansforthehomenetwork(HPLMN)tomonitortheactivities
ofitssubscribersinavisitednetwork(VPLMN)

fraud management
activitiesforthelimitation,monitoring,anddetectionoffraudulentuseofthenetworkand
theorganisationforhandlingtheseactivities

fraud prevention
partoffraudmanagementinvolvingactionstakentopreventandlimitfraudulentuseof
thenetwork

fraud profile
combinationofsubscriber-specifictimelimitsfordifferentcallsandthemaximumnumber
ofallowedservices

FreeBSD
advancedBSDUNIXoperatingsystemfortheIntelcompatible(x86),DECAlpha,and
PC-98architectures

freeform radio frequency hopping; freeform RF hopping


radiofrequencyhoppingthatintroducesmoreefficienthoppingthroughsynchronised
cells,reusedmobileallocations(MA),andspeciallyorganisedmobileallocationindex
offsets(MAIO)

free-line call; free call


calltoasubscribernumbermadewithoutcharge

free numbering
functionthatisusedtoimplementtheapplicationlocationregister

free-of-charge service; FoC


servicethatisprovidedforthesubscriberorcustomerforfree

Issue:28

539

GeneralGlossary

freephone; FPH; freephone service


telecommunicationserviceallowingareversechargingwherebyasubscribercanbe
allocatedaspecialnumberandchargestothisnumberarepaidbythatsubscriber
insteadofbythecallers

freephone indicator
signallingparameterthatissentintheforwarddirectiontoindicatewhetheracallisa
freephonecallornot

freephone service charging


applicationofchargingwhichmakestheuseofchargingzonecountersmorediversified
in,forexample,servicenumbercharging

free-run
stateofasystemclockwhenthesystemispoweredup,orwhenthereisnoreferenceto
thesystemclockandtheoperatorhasgivenacontrolwordvalueofdigital-to-analogue
converter

free-run frequency; free-running frequency


frequencyofoperationofanormallysynchronisedoscillatorthatoperatesintheabsence
ofasynchronisingsignal

free running mode; free-run mode


operatingconditionofaclock,theoutputsignalofwhichisstronglyinfluencedbythe
oscillatingelementandnotcontrolledbyservophase-lockingtechniques

free-space loss; free-space attenuation


basicpathattenuationbetweenisotropicantennasthatoccurswhenalleffectsfrom
obstruction,scatter,orreflectionaresufficientlyremovedtohavenoeffecton
propagationandwhenthepropagatingmediumisfreespace

free traffic channel; free marked traffic channel


channelwhichissendingtheidentifierframeofafreetrafficchannel

freeware
program,thewriterofwhichhaspartlyrenouncedthecopyright,allowingtheprogramto
beusedanddistributedwithoutcharge

540

Issue:28

GeneralGlossary

F reference point; F interface


interfacebetweenthemobileservicesswitchingcentre(MSC)andtheequipmentidentity
register(EIR)ofthehomesubscriberserver(HSS)

frequency correction channel; FCCH


logicalchannelinGSMsystemsthatisusedtotransmitafrequencycorrectiondata
burstthatconsistsofzerosonly

frequency counter
instrumentinwhichfrequencyismeasuredbycountingthenumberofcycles(pulses)
occurringduringapreciselyestablishedtimeinterval

frequency deviation
infrequencymodulation,thepeakdifferencebetweentheinstantaneousfrequencyofthe
modulatedwaveanditscarrierfrequency

frequency diversity
propagationorequipmentprotectionwhereseveralfrequenciesareusedforthe
transmissionofsignals

frequency division duplex; FDD


duplexwhereuplinkanddownlinktransmissionsusetwoseparateradiofrequencies

frequency-division multiplexing; FDM; fdm


multiplexinginwhichaseparatefrequencybandisallocatedtoeachtributarychannelin
thecommonchannel

frequency-domain equalisation /GB/ ; frequency-domain equalization /US/;


FDE
orthogonalfrequency-divisionmultiplexingtechniquethatcanbeusedinhigh-data-rate
wirelesscommunicationsystemsthatsufferfromalonginter-symbolinterference

frequency equaliser /GB/ ; frequency equalizer /US/


devicethatcanamplifyorattenuatecertainfrequenciesonaspeechchannel

frequency error
systemfrequencyminusthescheduledfrequency

Issue:28

541

GeneralGlossary

frequency hopping; FH
techniqueinwhichtheinstantaneouscarrierfrequencyofasignalis,accordingtoa
predeterminedcode,periodicallychangedtootherpositionswithinafrequencyspectrum
thatismuchwiderthanthatrequiredfornormaltransmission

frequency hopping digital signal processor; FHDSP


digitalsignalprocessorthatcontrolsfrequencyhopping

frequency hopping spread spectrum; FHSS


spreadspectrumradiotechnologyinwhichthesignalhopsamongdifferentchannels
severaltimespersecondtoavoidinterferenceandtoreduceopportunitiesoreavesdrop

frequency hopping system; FHS


systemthatdefinestheprinciplesoffrequencyhopping

frequency locking
lockingofonesignaltoanothersignalsothatthefirstsignalfollowsthefrequencyofthe
secondsignal

frequency measurement control; FMC


managedobjectintheradionetworkconfigurationmanagement,includingthe
parametersformeasuringthetransmissionfrequencies

frequency planning
planningfrequencyreuseschemes

frequency redefinition procedure; frequency redefinition


procedurethatthenetworkusestochangethefrequenciesandhoppingsequencesof
theallocatedchannels

frequency reuse factor; reuse factor


factorthatvariesbetween0and1anddescribeshowmuchofthetotaltheoretical
capacityisavailable,calculatedastheothercellinterferencedividedbythetotal
interference

frequency shift keying; FSK; frequency shift keying modulation


frequencymodulationinwhichthemodulatingsignalshiftstheoutputfrequencybetween
predeterminedvalues

542

Issue:28

GeneralGlossary

frequency stability
abilityofelectronicequipmenttomaintainthedesiredoperatingfrequency

frequency standard
stablefrequencysourceusedforfrequencycalibration.Itusuallygeneratesa
fundamentalfrequencywithahighdegreeofaccuracy,andharmonicsofthis
fundamentalareusedtoprovidereferencepoints

frequently asked question; FAQ


documentorawebpagelistingcommonquestionsandanswersonaparticularsubject,
oftenpostedoninternetnewsgroups

Fresnel zone; first Fresnel zone


zonewherethesumofdistancesfromthetransmittingaerialandreceivingaerialtoany
pointinthezonedoesnotvarybymorethanhalfawavelengththroughoutthezone

from header
SIPheaderthatindicatesthelogicalidentityoftheinitiatoroftherequest,typicallythe
user'saddress-of-record

front end; FE
nodeorsoftwareprogramthatrequestsservicesofabackend

front-end application
applicationwithwhichapplicationusersinteractdirectly

front-to-back ratio; F/B ratio


foradirectionalantenna,theratiooffieldstrengthinfrontoftheantennatofieldstrength
behindtheantenna(180degrees+-40degrees)

FRU data
non-volatilememoryinwhichafield-replaceableunit(FRU)canrecordinformationabout
itself

FSIP tool; FSIP


toolthatprovidesacommandlineinterfaceforconfiguringtheIPnetwork

Issue:28

543

GeneralGlossary

Fss interface
IPnetworkinterfaceintheMGWforIMStowardsafixedsoftswitch(Fss)

FTAM application interface


interfaceprovidingfileservicesforaremotedevice

FTAM security
featurewhichpreventsunauthorisedusersfromusingtheharddisksoftheDX200
networkelementsviaremotefilehandlingfunctions

FTM identifier; FTMID


uniqueruntime-specificidentifierassignedforeachmethodandusedforidentifyingdata
associatedwiththemethodthroughouttheprocessing

FTP; file transfer protocol; file transfer protocol over TCP/IP


applicationprotocol,partoftheTCP/IPprotocolstack,usedfortransferringfilesbetween
networknodes

FTP client
featurewhereaclientusesthefiletransferprotocol(FTP),enablingthetransferoffiles
fromanetworkelementtoaserverandthefetchingoffilesfromaservertoanetwork
elementoveraTCP/IPnetwork

FTP configuration file


configurationfilewhichallowstheend-userstochangevariousdefaultparametersofthe
FTPserverwithoutmakingchangestothesourcecodeandwithoutusingtheDX200
messageinterface

FTP connection supervision


supervisionoftheFTPconnectionsbetweentheconnectedregionalsystemsandthe
globalcluster

FTP log file; FTP command log


logfileinwhichtheFTPserverstoresallconnectionandcommandinformation

FTP over socket interface


featurethatimplementsalogfilecreationfacilityusingPOSIXfilesystemservices

544

Issue:28

GeneralGlossary

FTP server
serversupportingthefiletransferprotocol(FTP),bywhichcompletefilescanbecopied
ortransferredfromonesystemtoanotheroveraTCP/IPnetwork

full availability
arrangementinwhicheveryinputtoaswitchingstagehasorcanhaveaccesstoevery
outputfromthestage

full backup
backupthatcoversallthefiles,includingthedatabaseandfilesystem

full binding
bindinginwhichthemediaproxyknowsbothtransportaddresses

full duplex
capableoftransmittinginbothdirectionssimultaneously

full process identifier


identifierthatdesignatesaprocessinsideacomputer

full pseudo-wire backhaul


operatingmodeofthehybridBTSbackhaulfeatureinwhichalltrafficthroughtheIub
interfaceiscarriedoverthepacket-switchednetworkwhenahighqualityconnectionis
available,soavoidingtheneedfortwotransportnetworks

full-rate adaptive multi-rate codec; FR AMR


AMRspeechcodecfortheGSMsystemthatsupportseightnarrowbandspeech
encodingmodeswithbitratesbetween4.75kbit/sand12.2kbit/s

full-rate ADSL
ADSLservicethatprovidesfulltransmissionratescomplianttoITU-TG.992.1andANSI
T1.413issue2standards

full-rate speech codec; full-rate codec


codecwhichhasaframelengthof260bitsandinwhicheveryframeiscodedintoone
33octetbuffer

Issue:28

545

GeneralGlossary

full-rate traffic channel; TCH/F


channelthatfunctionsat16kbit/s

full restore
restoreprocedureinwhichallbackuptypesarerestored

full switch mode


radiolinkoperationalmodeinwhichtheEthernetplug-inunit(EPIU)operatesasa
standardEthernetswitchwithfourports,twooftheseportsbeingconnectedtothe
Flexbusinterfaces

full text search


contentaddressingdirectedatthewholetext

full usage of subchannels; FUSC; full usage of subcarriers


subchannelallocationthatusesallthesubchannelsandemploysfull-channeldiversity
bydistributingtheallocatedsubcarrierstosubchannelsusingapermutationmechanism

fully functional
periodoftimethatall-functionalaspectsofthesystemareavailableandusable

fully operational
periodoftimethatallfeatures,bothfunctionalandnon-functional,ofthesystemare
availableandusable

fully qualified domain name; FQDN; absolute domain name


fulllogicalnameofacomputersystem,ratherthanjustitshostname

fully qualified partial CDR; FQPC


partialCDRthatcontainsacompletesetofthechargingrecord(CDR)fields

fully routed call attempt; successful call attempt


callattemptthatreceivesintelligibleinformationaboutthestateofthecalleduser

function
taskorgroupoftasksofadefinedpartofthesystem

546

Issue:28

GeneralGlossary

function-affecting maintenance
maintenanceactionthataffectsoneormoreoftherequiredfunctionsofamaintained
item

functional architecture
descriptionofappropriatedistributionoffunctionsthatallowsforthecreationof
functionalblocksfromwhichaTMNofanycomplexitycanbeimplemented.These
functionblocksareseparatedbyreferencepointsandleadtotherequirementsforthe
TMN-recommendedinterfacespecifications

functional component
sub-elementwithinaTMNfunctionblock

functional definition element; FDE


basicbuildingblockofanINsupportedservice,whichrepresentsthehighlevellogical
featuresoftheservicefunction

functional dependence
indicationoftheinterrelationshipsofattributesinarelation

functional entity; FE
subsetoffunctionsinasinglelocationrequiredtoprovideaservice

functional entity
undividedentityconsistingofoneormorefunctionsinwhichseparatefunctionsfollow
eachother

functional entity; FE
partofanetworkelement

functional entity action; FEA


actionperformedbyafunctionalentityasaresultofaspecificstimuluswhilethe
functionalentityisinaspecificstate

functional mailbox; functional address


mailaddressofanorganisationoritscertainfunctionthathasoneormoreauthorised
userswhocanreceiveandreadmailssenttothataddress

Issue:28

547

GeneralGlossary

functional model
layeredstructureoffunctionsandtheirlogicalinterfacesrepresentingtheTMN

functional state model; FSM


modelinwhichthefunctionalstatestructureandthetransitioncontrolsaredefined

functional unit; PFU; physical functional unit


entityofhardwareandsoftware,oronlyhardware,capableofaccomplishingaspecial
purpose

functional unit hierarchy


relationsbetweennestedfunctionalunits

functional unit set


groupoffunctionalunitsthatcontrolsimilarresources

functional unit type and index


datawhichisusedforfunctionalunitidentificationthroughoutthesystem

function analysis
internalcallcontrolanalysiswhichthecallcontrolusestoanalysesubscriberfacilitiesor
clearcodes

function attributes
propertiesorcharacteristicsoffunctionswhichallowdifferentiationbetweenrealisations
tobespecifiedbymeansofparameters

function block
constituentpartofthefunctionalarchitectureofaTMN

function block
setofprogramblocks,loadmodules,andfileswhichprovidesknownservicesandwhich
isindivisiblefromthesystemconfigurationpointofview

function class
setoffeaturesgroupedtoformanentity

548

Issue:28

GeneralGlossary

function degrading maintenance


maintenanceactionthataffectsoneormoreoftherequiredfunctionsofamaintained
item,butnottosuchextentastocauseacompletelossofallthefunctions

function permitting maintenance


maintenanceactionthatdoesnotaffectanyoftherequiredfunctionsofthemaintained
item

function point
unitformeasuringthenumberandcomplexityoffunctionsinasoftware

function point analysis; FPA


methodfordefiningthesizeofsoftwarebasedonfunctionalaspects

function preventing maintenance


maintenanceactionthatpreventsamaintaineditemfromperformingarequiredfunction
bycausingacompletelossofallthefunctions

fundamental frequency
frequencywhosevalueisthehighestcommonfactorofallthefrequenciespresentinthe
wave

furnish charging information; FCI; FurnishChargingInformation procedure


operationbetweentheservicecontrolpoint(SCP)andtheserviceswitchingpoint(SSP)
thatisusedtodeterminethegenerationofachargingrecord(CDR)intheSSP,ortoadd
informationtoaCDRgeneratedintheSSP

FurnishChargingInformationSMS procedure; FCISMS;


FurnishChargingInformationSMS
operationwhichisusedtosendcharging-relatedinformationtoalogicalshortmessage
(SM)record

Issue:28

549

GeneralGlossary

9 G
G.711
algorithmdesignedtotransmitandreceivepulsecodemodulatedvoiceatdigitalbitrates
of48,56,and64kbit/s

G.723.1
codecbywhichthespeechorotheraudiosignalcomponentofmultimediaservicescan
beencodedordecodedataverylowbitrate

G.729
algorithmforthecodingofspeechsignalsat8kbit/susingConjugate-Structure
Algebraic-Code-ExcitedLinear-Prediction(CS-ACELP)

G.729A
speechcodecalgorithmthatcompressesaudioinframesof10milliseconds

Ga interface
interfacebetweenaGPRSsupportnode(GSN)andcharginggateway(CG)inaGa
network

Galileo
globalnavigationsatellitesystemthatwasinitiatedbytheEuropeanUnionandprovides
anaccurate,guaranteedglobalpositioningserviceunderciviliancontrol

Ga network
partofathirdgeneration(3G)networkincludingthe3GservingGPRSsupportnode(3G
SGSN),gatewayGPRSsupportnode(GGSN),andcharginggateway(CG)

gapping gate
basiccomponentofthecallgappingrestrictionmethod

GARP Multicast Registration Protocol; GMRP; Group Multicast


Registration Protocol
protocolprovidingamechanismthatallowsparticipantstodynamicallyregisterand
deregisterinformationwiththemediaaccesscontrol(MAC)bridgesattachedtothe
samelocalareanetwork(LAN)segment

550

Issue:28

GeneralGlossary

GARP VLAN Registration Protocol; GVRP


registrationprotocolwhichenablesthecreationofvirtuallocalareanetwork(VLAN)
configurationsbypropagatinginformationbetweenswitchesandendstationsthroughout
theEthernet

gate
descriptorwhichcontrolstheoperationofaprocessorinhandlinginterruptsignalsand
otherinterruptsandinjumpsandcallsbetweensegments,whentheselectorpartofan
addresspointstoagate

gate
unidirectionalIPflowwhichisusedforcontrollingmediaflowsandwhichisdescribedby
packetclassifiers

gatekeeper; GK
deviceprovidingaddresstranslationandcontrollingaccesstothelocalareanetworkfor
H.323terminals,Gateways,andMCUs

gateway; GW
devicethatperformsconversionofinformationfromoneprotocolstacktoanotherforone
particularapplication

gateway control protocol; GW-ctrl


protocolthatisusedforsignallingbetweentheradionetworkaccessserver(RNAS)and
radionetworkgateway(RNGW)

gateway control server; GCS


serverforbothGSM,3G,andAll-IPnetworks,providingamediagatewaycontrol
function(MGCF)basedonthe3GPPreleases4and5,andcentralisedinterconnection
controlonthetransitlevelfortheMSCserver,andperformingHLRinquiriestolocatethe
calledsubscriber'svisitingMSCserver

Gateway Discovery Protocol; GDP


Ciscoprotocolthatenablesaroutertolearnaboutroutestoothernetworks

gateway-gateway protocol; GGP; gateway-to-gateway protocol


protocolthatisusedtoupdatetheroutingtable,todetermineconnectivitytonetworks
andneighbouringgateways,andtoimplementadynamic,shortest-pathrouting
algorithm

Issue:28

551

GeneralGlossary

gateway GPRS support node; GGSN


GPRSsupportnodewhichactsasagatewaybetweentheGPRSnetworkandpacketswitchedpublicdatanetwork(PSPDN)

Gateway Load Balancing Protocol; GLBP


protocolthatprovidesloadbalancingovermultipleroutersusingasinglevirtualIP
addressandmultipleMACaddresses

gateway mobile location centre /GB/ ; gateway mobile location center /US/;
GMLC; MPC /US/; mobile positioning center /US/
mobilenetworkequipmentwhichtransmitslocationinformationproducedbythelocation
serverfromthemobilenetworktotheapplicationswhichprovidelocation-basedservices

gateway MSC; GMSC; GWMSC; gateway mobile services switching centre


/GB/; gateway mobile services switching center /US/; gateway MTX
mobileservicesswitchingcentre(MSC)thatmakestheroutinginterrogationformobileteminatingcalls

gateway MSC for short message service; SMS-GMSC; gateway MSC


gatewayMSCthatiscapableofreceivingashortmessagefromashortmessage
servicecentre(SMSC),interrogatingahomelocationregister(HLR)forrouting
informationandSMSinformation,anddeliveringtheshortmessagetothevisitedMSCof
therecipientmobilestation(MS)

gateway MSC of subscriber A; GMSCA


gatewayMSCintheinterrogatingpubliclandmobilenetwork

gateway MSC of the subscriber B; GMSCB


gatewayMSC(GMSC)inthehomenetworkofthecalledparty

gateway MSC of the subscriber C; GMSCC


gatewayMSC(GMSC)inthehomenetworkofthesubscriberC

gateway MSC server; GMSS; GMSC server


functionsofanMSCserverwhichcontrolthemultimediagateway(MGW)thatperforms
interworkingbetweenthepacketcorenetworkandthePSTN/ISDNnetwork

552

Issue:28

GeneralGlossary

gateway plane
enhancedIPnetworkinglayerwhichprovidesefficientsupportforallservicesthatare
transportedovertheInternetProtocol(IP),supportforincreasedaddressspacethrough
integratedsupportoftheInternetProtocolversion6(IPv6),andinterworkingwith
externalnetworks

gateway platform
platformforapplicationsperformingswitchingandgatewayfunctionsbetweencircuitswitchedandpacket-switchedenvironments

gateway policy information base; GW-PIB


policyinformationbasecontainingasetofprovisioningclassesthatdescribequalityof
service(QoS)policiesforgatewaynetworkelements

gauge
dynamicvariablethatisusedwhenthedatabeingmeasuredcanvaryineitherdirection
duringtheperiodofmeasurement

Gaussian minimum shift keying; GMSK; Gaussian filtered minimum shift


keying
modulationtechniquethatisusedinGSMnetworks

Gb interface
interfacebetweenthebasestationsystem(BSS)orradionetworkcontroller(RNC)and
theservingGPRSsupportnode(SGSN),allowingtheexchangeofsignallinganduser
data

GBIP tool; GBIP


toolthatcanbeusedtoacquiretheIPaddressorportnumberinformationforany
processinamanagedobject

Gb over IP; Gb over IP interface


featureinwhichthesubnetworkoftheGbinterfaceisbasedontheInternetProtocoland
thephysicallayeristheEthernet

GBR bearer
EPSbearerthathasdedicatednetworkresourcesrelatedtotheguaranteedbitrate
(GBR)permanentlyallocatedatthebearerestablishmentormodification

Issue:28

553

GeneralGlossary

GBS data service measurement; GBS data service usage measurement


measurementwhichgivesinformationaboutthegeneralbearerservices(GBS)
requestedandreceivedbytheuser

Gc interface; Gc reference point


interfacebetweenthegatewayGPRSsupportnode(GGSN)andthehomelocation
register(HLR)

Gd interface
interfaceconnectingservingGPRSsupportnodes(SGSN)toshortmessageservice
gatewayMSC(SMS-GMSC)andtoshortmessageserviceinterworkingMSC(SMSIWMSC)

GDMO template
definedstandardformatsforthedocumentationofmanagedobjectclassdefinitions,
conditionalpackages,specificerrors,namebindings,attributes,groupattributes,
behaviourdefinitions,actionsandnotifications.

Ge interface
interfacebetweenaservingGPRSsupportnode(SGSN)andaservicecontrolpoint
(SCP)

general bearer service; GBS


conceptthatreducesthenumberofbearerservicesandtelephonenumbersrequiredby
asubscriber

general circuit interface; GCI


standardsynchronousISDNtiminginterfaceinwhichthe2B+Ddataismultiplexed
togetherwithcontrolandsparebitsandloopmaintenancedata

general communication service; GCS; general communication stack


communicationstackthatisusedbyNSNagents,alarmmanagers,nodemanagers,and
NMS/10commandscripting(RCM)tocommunicatewithNSN'plesiochronousdigital
hierarchy(PDH)primaryratenetworkelements

general control SAP; GC SAP


serviceaccesspoint(SAP)thatbroadcastsinformationtoalltheuserequipmentina
certaingeographicalarea

554

Issue:28

GeneralGlossary

general entity
entitywhichisreferredtoaspartofanXMLdocument'scontent,declaredinthe
documenttypedefinition(DTD)

general executable script


staticexecutablescriptthatissuitableformanysubscriberswithoutmodifications

general group address


physicalcomputeraddressacknowledgedbythecomputersofthegeneralgroup

General Inter-ORB Protocol; GIOP


abstractprotocolthatspecifiesthetransfersyntaxandstandardsetofmessageformats
toallowindependentlydevelopedobjectrequestbrokers(ORB)tocommunicateover
anyconnection-orientedtransportservice

general parameter file


parameterfilethatisusedbyanumberofprograms

general protection fault; GPF; general protection error; protection error


errorthatanapplicationprogramcauseswhenittriestoaccessstoragethatisnot
designatedforitsuse

general-purpose four-wire interface; G4WIF; general 4-wire interface;


generic 4-wire interface
logicalportintheswitchinginfrastructureassociatedwithasingleanaloguelineinterface
intheexchange

general-purpose interface bus; GPIB; IEC-bus


IEEEstandardinterfacebus

general-purpose processor; GPP; general processor


processorthatiscapableofperformingarangeofdifferentprocessingtasks

general service
servicevisibletoawholesystem

Issue:28

555

GeneralGlossary

general state model


downloadmodelwhichconsistsofonerequestandoneresponseandcanbeusedwhen
asinglefileisdownloadedtoamobileterminal

general switch management protocol; GSMP


generalpurposeprotocoltocontrolanATMswitch

general trouble ticket interface


interfacethatintegratesregionalandglobalclusterswithathird-partytroubleticket
system

generation of charging
partofchargingwhichallowsgenerationandverificationofcharging

generator
incompletedatatypedescription

generic announcement package


H.248packagethatprovidesamediagatewaycontrollerwiththeabilitytocontrol
announcementsinamediagateway

Generic Attribute Registration Protocol; GARP; Group Address


Registration Protocol
layer2transportprotocolthatletsswitchesandendsystemspropagateuseful
informationthroughouttheswitchingdomain,anddeliversIPmulticastswithout
compromisingnetworkperformance,scalability,ormanagement

generic bearer connection package


H.248packagethatprovidesthefunctionsthatarerequiredtobeabletoestablish,
modify,orreleaseabearerconnection

generic bootstrapping architecture; GBA


architecturethatdefineshowtoestablishasharedsecretbetweenanoperatorandthe
mobileterminalandthatisbasedontheuser'ssubscriptionbyusingtheauthentication
andkeyagreement(AKA)

generic cabling
standard-basedcablingsystemthatcanbeadaptedtodifferentwaysofuse

556

Issue:28

GeneralGlossary

generic cell rate algorithm; GCRA


inATM,analgorithmthatdeterminesforeachcellarrivalwhetherthecellconformsto
thetrafficcontract

generic definitions
definitionsofobjectclasses,attributetypes,notificationtypesoroperationtypes,made
availableforgeneraluse

generic digits
signallingparameterthatcontainsdigitinformationthatcannotbesentwithinthe
numberingaddressandthatissentinbothdirectionstoconveyinformationbetween
exchangesduetosupplementaryservice

generic event handler; GEH; general event handler


eventhandlerthatconvertsextensiblemarkuplanguage(XML)formattednotificationsto
networkinterfacefor3rdgenerationnetwork(NWI3)formatandforwardsthemtothe
networkmanagementsystem

generic flow control; GFC


fourbitfieldintheATMcellheaderwhichcanbeusedtoprovidelocalfunctions,for
example,flowcontrol

generic licence key /GB/ ; generic license key /US/


target-lockedlicencekeythattheNSNStandardLicenseKeyGenerator(CLicS)orNSN
NMSlicencemanagergeneratestopermittheuseofalllicensedapplicationsinagiven
networkelementorinasetofnetworkelementsforacontractedtime-limitedperiod

generic network element


representationofanetworkelementorasubnetworkthatisnotsupporteddirectlybythe
networkmanagementsystem

generic network user authentication


featurewhichaddsanextendedprofiletoauser,authenticatesusers,andcheckstheir
profiles

generic number; GN
numberinformationsentineitherdirectiontoenhancenetworkoperationorfor
supplementaryservices

Issue:28

557

GeneralGlossary

generic OTA; generic content download


over-the-air(OTA)downloadmodelinwhichthemobileterminalfirstverifieswitha
downloaddescriptorthatitcandownloadandstorethecontent,thenrequeststheactual
content,andfinallyconfirmstothedeliveryserverthesuccessfulinstallation

generic radio access network; GRAN


radioaccessnetwork,whichisanaccesspartoftheUniversalMobile
TelecommunicationsSystem(UMTS),consistingofbasetransceiverstations(BTS)and
aradionetworkcontroller(RNC)

generic recharging
optionalfeaturethatallowsrechargeofaccountwithmoney,andenablesdevelopment
ofvariousrechargingapplications

generic relay function; stateless functional relay


functionthatrelaysaccessservicenetwork(ASN)controlmessagesfromsourceto
destinationentitiesintheASN,withoutinterpretingorchangingthecontentofmessages

generic reporting conversion to XML


conversionfeatureforNetworkElementManagementUnit(NEMU)applicationsfor
adaptinglogandreportfilestoanXMLfile

generic request handler; GRH


eventproducerthatreceivesservicerequestsfromthenetworkmanagementsystem,
convertsthemtoDMXmessageformat,andforwardsthemtothenetworkelement

Generic Routing Encapsulation; GRE


protocolforperformingencapsulationofanarbitrarynetworklayerprotocoloveranother
arbitrarynetworklayerprotocol

generic service
standardserviceofferedintheinformationnetworkusedforrecurringtaskssuchasuser
authenticationorbilling

generic signalling transport service /GB/ ; generic signaling transport


service /US/
functionthatenablesasignallingentitytocommunicatewithapeersignallingentity
independentlyoftheunderlyingsignallingtransport

558

Issue:28

GeneralGlossary

generic terminal; ASCII terminal


character-basedterminalemulatorthatallowstheusertocommunicatewiththenetwork
usingman-machinelanguage(MML)

generic terminal session


remotesessionmadeusingagenericterminal

generic tunnel interface; GIF


pseudodeviceforbothInternetProtocolversion4(IPv4)andInternetProtocolversion6
(IPv6),whichtunnelsIPdatagramsoverIPv4andIPv6networks

generic user profile; GUP


collectionofuserprofilecomponentsthataffectsthewayinwhichanindividualuser
experiencesservices

geographical area description; GAD; geographic area description


informationthatspecifieshowtocodethelocationofapointorareaontheearth,used
foranylocation-relatedapplication

geographical information
locationinformationthatindicatesthelocationoftheservedsubscriberbylatitudeand
longitude

geographically distributed exchange


exchangewherenotallsub-systemssuchasswitchingstagesandcontrolmeansareat
thesamelocation

geographical number portability; geographical NP


numberportabilityinwhichthesubscriber'sdirectorynumberdoesnotchangewhen
movingtoanotherplace

geographical privilege
privilegeforsupervisingthemanagedobjectsofthegeographicalareaforwhichtheuser
isresponsible

geographical routing
routinginwhichtheprotocoldataunit's(PDU)geographicalareadefinition,which
specifiestheareainwhichthePDUwillbebroadcast,isconvertedintoanequivalent
radiocoveragemap

Issue:28

559

GeneralGlossary

geographical view
viewofthemanagedobjectsintheirrelativegeographicalpositions

GERAN radio network temporary identifier; G-RNTI


identitythatthebasestationsystem(BSS)allocatestoamobilestation(MS)whenan
radioresourcecontrol(RRC)connectionisestablishedbetweentheMSandGERAN

GERAN registration area; GRA


specifiedsetofacellwhichcanbeidentifiedonthepacketbroadcastcontrolchannel
(PBCCH)whenlocatingamobilestation(MS)

get history dialogue


dialogueofthegraphicaluserinterfaceinwhichthealarmhistorycanbefetchedusinga
searchcriterion

getter
Javaobjectthatdefinesthecodewhichiscalledtoretrievethevalueofaproperty

getter/setter
accessmethodtogetorsetavalueofapropertyofanobject

Gf reference point; Gf interface


interfacebetweentheservingGPRSsupportnode(SGSN)andtheequipmentidentity
register(EIR)

GGSN charging identifier; GCID


identifierthatconsistsofthepacketdataprotocol(PDP)contextidentifier,theassociated
flowindexintothesessiondescriptionprotocol(SDP)fromthesessioninitiationprotocol
(SIP)signalling,andtheauthorisationtokenassociatedwiththePDPcontext

GGSN charging record; G-CDR; gateway GPRS support node - call detail
record
chargingrecordgeneratedbythegatewayGPRSsupportnode

GGSN Ga address
IPaddressoftheGainterfacetothegatewayGPRSsupportnode(GGSN)

560

Issue:28

GeneralGlossary

GGSN IP address
IPaddressofthegatewayGPRSsupportnode(GGSN)totheGPRSbackbone

GGSN network identifier; gateway GPRS support node network identifier


APNnetworkidentifierthatdefinesthedefaultexternalIPnetworkdomainnamesystem
(DNS)namethatisusedwhenthemobilestationdoesnotrequestanyaccesspoint
name(APN)andthemobilestation'ssubscriptionrecordinthehomelocationregister
(HLR)containsawildcardAPN

GGSN operator identifier; gateway GPRS support node operator identifier


APNoperatoridentifierthatdefinesthedefaultdomainnamesystemnameofthe
gatewayGPRSsupportnodeperPDPtype

GGSN service
servicethatthegatewayGPRSsupportnode(GGSN)provides

ghost session
sessionwhichtakesplaceiftheeventprocessorneverreceivesastopmessageforan
opensession

ghost session manager


toolforcancellingghostsessionsforwhichastoporterminatemessagehasnotbeen
received

Gigabit Ethernet; GE; Gb Eth


IEEEstandardforhighspeedl000MbpsEthernet

gigabit interface converter; GBIC


transceiverthatconvertsserialelectricsignalstoserialopticalsignalsandviceversa

gigabit passive optical network; GPON; gigabit PON


passiveopticalnetworkwherethedatatransferrateisover1Gbit/s

gigabit switch router; GSR


routerwithscalablebandwidthforthecorenetworkofaserviceproviderandenterprise
IPbackbones

Issue:28

561

GeneralGlossary

Gi interface; Gi reference point


TCP/IPbasedinterfacefromthegatewayGPRSsupportnode(GGSN)toexternaldata
networkssuchastheinternet

G interface
interfacebetweenvisitorlocationregisters(VLR)

GIZMOS interface
NSN'sproprietaryinterfacethatconnectsthehomelocationregistertotheNSN
SubscriberRepositoryfortransferringsubscriptiondata

global balance handler; GBH


componentintheeventprocessorthatmanagesbalancesofprepaidsubscriber
accounts

global call reference; GCR


callreferencewhichissharedamongallthenetworkelementsandcalllegsthatprovide
chargingrecordsforthecall

global cluster
clusterthatoffersaviewtotheentirenetwork,coveringallareasandnetwork
technologies

global CN-ID
identifier(ID)thatgloballyidentifiesanetworkelementinthecorenetwork(CN)

global data
informationthatisstoredbothintheservicecontrolpoints(SCP)andthedatabase
clusterandchangesinfrequently

global descriptor table; GDT


descriptortablethatcontainsdescriptorsavailabletoallprocesses

global disk
diskthatcontainstheglobaldata

562

Issue:28

GeneralGlossary

global file system; GFS


diskfilesystemfornetworkedstoragesharedbyaclusterofcomputers

global functional plane; GFP; IN global functional plane


planeintheINconceptualmodelwhichdefinesserviceindependentbuildingblocks
usedinprovidingservicefeatures

global interface table; GIT


process-wideplaceholderforinterfacepointers

globally unique identifier; GUID; UUID; universally unique identifier


identifierthatconsistsof128bitnumbersandthatisassignedtoanydataobjectwhichis
guaranteedtobeunique

globally unique MME identifier; GUMMEI


partofthegloballyuniquetemporaryidentity(GUTI)thatuniquelyidentifiesthemobility
managemententity(MME)thathasallocatedtheGUTI

globally unique temporary identity; GUTI


identifierthatthemobilitymanagemententitycreatesforeachpieceofuserequipment
whosestateisEMMregisteredtouniquelyidentifytheuserequipmentwithintheevolved
packetcore

global navigation satellite system; GNSS


satellitesystemthatcanbeusedtofindouttheexactlocationofauser'sreceiver
anywhereintheworld

global RNC-ID
identifier(ID)thatgloballyidentifiesaradionetworkcontroller(RNC)

global service
servicethatisvisibleineverycomputerofaserviceprovider

global service number


subscriberdialledservicenumberfromwhichthecallisroutedtotherightservice
numberbasedonthelocationofthemobilestation

Issue:28

563

GeneralGlossary

global sponsoring
service-specificsponsoringwhereacertainserviceissponsoredforallsubscribers

global text telephony; GTT


3GPP-specifiedfeaturethataddsthecapabilitytouseatextconversationcomponentin
aconversationalsession

global title; GT; SCP global title


address,suchasdigitsdialledbythecustomer,whichrequiresanaddressconversion
beforethemessagesaresenttomessagetransferpart(MTP)

global title analysis; GT analysis


analysisinwhichthenumberingplan,natureofaddress,andtranslationtypedetermine
ananalysistreefromwhichtheanalysisresultisderived,basedonthedigitsequence
includedintheaddressortranslationtype

global title format


formatoftheglobaltitle(GT)thelengthofwhichisvariableanddependentontheglobal
titleindicator

global title indicator; GTI


indicatorwhichdefinestheformoftheglobaltitleandindicateswhichpartofthe
translatorselectorisincludedintheglobaltitle

global title modification


functionwhereanexistingglobaltitleismodifiedbeforesendingasignallingmessageto
thedestination

global title modification data


informationonhowtheglobaltitleshouldbemodified

global title translation; GTT


analysisoftheglobaltitleinordertofindoutthesignallingconnectioncontrolpart
(SCCP)routingaddress

global title translation result; translation result


signallingconnectioncontrolpart(SCCP)routingaddressthatconsistsofthenameof
thesignallingnetwork,destinationpointcode(DPC)and,potentially,subsystemnumber
(SSN)oranewglobaltitle

564

Issue:28

GeneralGlossary

global user
userwhoserightsandprofilearesetupcentrallyandappliedthroughoutthedistributed
network

global virtual network service; GVNS


globalswitchedvirtualprivatenetworkservicesupportedbymultiplenetworksand
offeredtocustomersoverPSTNandISDN

global virtual path identifier; GVPI


identifierforaspecificvirtualpath

GLONASS
radio-basedsatellitenavigationsystemoperatedfortheRussiangovernmentbythe
RussianSpaceForces

glue code
codeimplementingplatform-specificservicesforportablesoftwarecomponents
implementedbytheSSH

GMII; gigabit media-independent interface


media-independentinterfaceintheGigabitEthernetprotocolarchitecture

GMM context
informationstoredinamobilestation(MS)andtheSGSNwhenthemobilestationhas
beenattachedtoGPRS

Gm reference point; Gm interface


interfacebetweenthecallstatecontrolfunction(CSCF)andtheuserequipment(UE)

Gn interface
interfacewhichconnectstheservingGPRSsupportnode(SGSN)totheGPRS
backbonenetworkandallowstheSGSNtocommunicatewiththeGPRSsupportnodes
(GSN)ofthehomenetwork(HPLMN)

GNMRS data
informationthatisusedtoexpresstherelationshipsbetweenmanagedobjects

Issue:28

565

GeneralGlossary

GNMRS upload; generic network model relationship services upload


functionthatisusedtouploadGNMRSdatafromaregionalsystemorfromanASCIIfile
totheglobalclusterdatabase

Gn network
partofathirdgeneration(3G)networkincludingthenetworkelementsconnectedbythe
Gninterface

Gn reference point
referencepointbetweenaservingGPRSsupportnodeandamobilitymanagement
entityorpacketdatanetworkgateway

GNU GRUB
multibootbootloadersoftwarepackagefromtheGNUprojectthatallowssimultaneous
bootingoftwoormoreoperatingsystemsinstalledonasinglecomputer

GNU name service switch


capabilityoftheGNUClibrarytoprovideaflexiblewaytoconfigureaccesstotypical
databasesinaUnix/Linuxenvironment

GNU zip; gzip; GZIP


datacompressionalgorithmforreducingthesizeofthenamedfilesusingLempel-Ziv
coding

Go interface
interfacebetweenapolicydecisionfunction(PDF)andagatewayGPRSsupportnode
(GGSN)

Gold code
inspread-spectrumsystems,acodethatisgeneratedbysumming,usingmodulo-two
addition,theoutputsoftwospread-spectrumcode-sequencegenerators

goodbye RTCP packet; BYE; BYE packet


RTCPpacketindicatingthatoneormoresourcesarenolongeractive

Government Emergency Telecommunication Service; GETS


telecommunicationsservicethatprovidesNationalSecurityandEmergency
Preparedness(NS/EP)userswithpriorityswitchedvoiceandvoicebanddata
communicationsduringperiodsofemergencyorcrisis

566

Issue:28

GeneralGlossary

G-PDU
tunnelledprotocoldataunit(T-PDU)thatcontainsaGPRStunnellingprotocol-user
plane(GTP-U)header

Gp interface
interfacebetweentheservingGPRSsupportnodes(SGSN)ofdifferentoperators'
PLMNs(publiclandmobilenetwork)

Gp reference point
referencepointbetweenaservingGPRSsupportnodeandapacketdatanetwork
gatewaywhileroaming

GPRS; general packet radio service


mobileservicewhichgivespacket-switchedaccessoverGSMtoexternaldatanetworks

GPRS and EGPRS territory; (E)GPRS territory; packet-switched territory


radioresources,mainlyradiochannels,thatareallocatedforgeneralpacketradio
service(GPRS)andenhancedGPRStraffic

GPRS attach
attachinGPRSmobilitymanagementwhichestablishesaconnectionbetweenthe
mobilestationandtheGPRSnetwork

GPRS backbone network


IPbasedmobilenetworkviawhichallthedatapacketsareroutedbetweenfunctional
GPRSelements

GPRS backbone server; GPRS backbone management server; backbone


server
serverthatcollectsthetopology,alarm,andperformancedatafromtheIP-basedGPRS
backbonenetworkdevices

GPRS CAMEL subscription information; GPRS-CSI; G-CSI; GCSI


CAMELsubscriptioninformationwhichidentifiesthesubscriberashavingtheGPRS
CAMELservice

GPRS CDR
chargingrecord(CDR)thatisgeneratedinaGPRSsupportnode(GSN),thatis,inthe
gatewayGPRSsupportnode(GGSN)orservingGPRSsupportnode(SGSN)

Issue:28

567

GeneralGlossary

GPRS charging identifier; GCID; GPRS charging ID


chargingidentifierspecifictoaPDPcontextthatisgeneratedinthegatewayGPRS
supportnode(GGSN)anddeliveredtotheservingGPRSsupportnode(SGSN)

GPRS ciphering key sequence number; GPRS-CKSN


numberassociatedwiththeGPRScipheringkey,GPRS-Kc,andstoredtogetherwiththe
GPRS-Kcinthemobilestationandinthenetwork

GPRS connection
connectionimplementedwithgeneralpacketradioservice(GPRS)

GPRS core network


corenetworkconsistingoftheservingGPRSsupportnode(SGSN),thegatewayGPRS
supportnode(GGSN),thecharginggateway,andtheIPbackbonenetwork

GPRS detach
detachintheGPRSmobilitymanagementwhichisusedtoterminateaconnectionofthe
subscribertotheGPRSnetwork

GPRS encryption algorithm; GEA; GPRS-A5


cryptographicalogrithmthatusessymmetricstreamcipherdesignedtoprovide
confidentialitybycipheringbothuserdataandsignallingallthewaybetweenthemobile
stationandtheservingGPRSsupportnode(SGSN)

GPRS encryption algorithm 3; GEA3


versionofGPRSencryptionalgorithm(GEA)thatcanbeusedwithinEGPRSandGPRS
systems

GPRS mobility management; GMM; GMM layer; mobility management


layerwhichsupportstheproceduresneededformobilityandsecuritymanagement
betweenamobilestationandaservingGPRSsupportnode(SGSN)

GPRS mobility management and session management; GMM/SM


protocolthatsupportsmobilitymanagementinGPRS

GPRS multiple subscriber profile; MSP; multiple subscriber profile


subscriberprofileassociatedwitheachGPRSsubscriberatthetimethesubscriber
registersforGPRSservice

568

Issue:28

GeneralGlossary

GPRS network; general packet radio service network


GSM-basednetworkthathaspacketdatacapabilityandtheabilitytousemorethanone
GSMtime-slotatatime

GPRS pool
setofdedicated,default,andadditionalgeneralpacketradioservice(GPRS)traffic
channelsthatconsistofconsecutiveradiotime-slots

GPRS prepaid; GPRS prepaid service


prepaidservicethatenablesonlinechargingofgeneralpacketradioservice(GPRS)
datacalls

GPRS roaming exchange; GRX


partoftheIPbackbonethatenablesmobileinternetservicestobeaccessedthroughan
IPnetworkthatismanagedandoperatedbyathirdparty

GPRS service
servicethatusespacket-switchedconnectionsimplementedwiththegeneralpacket
radioservice(GPRS)

GPRS service switching function; gprsSSF


serviceswitchingfunctionthatcreatesaninterfacebetweentheservingGPRSsupport
node(SGSN)andtheGSMservicecontrolfunction(gsmSCF)

GPRS short message service; GPRS SMS; GSMS


shortmessageservicethatisadoptedtogeneralpacketradioservice(GPRS)andthat
usestheservicesofthelogicallinkcontrol(LLC)layer

GPRS subscriber
subscriberofaGPRSservice

GPRS subscriber profile


profileassignedtoGPRSsubscriberforanagreedcontractualperiod,containing
informationaboutthesubscribedservices,qualityofservice,andthesubscriptionprofile

GPRS support node; GSN


GPRSnetworkelementinchargeofpacketroutingandconnectingthepublicland
mobilenetwork(PLMN)toothernetworks

Issue:28

569

GeneralGlossary

GPRS suspension; GPRS suspension procedure


procedurethatenablesthenetworktodiscontinueGPRSservicespacketflowinthe
downlinkdirectionforamobilestationwhichisIMSIattachedforGPRSservices,for
example,whenacircuitswitchedcallinterruptsaGPRSpacketflow

GPRS territory downgrade


procedurethatthebasestationcontroller(BSC)useswhenitneedstoreducetheshare
oftime-slotsintheGPRSterritory,forexample,whenthereisanincreaseinthecircuit
switchedtrafficload

GPRS territory update guard time; GTUGT; territory update guard time
parameterwhichisusedtomodifytheguardtimewhichthePacketControlUnit(PCU)
hastowaitbetweensuccessiverequestsforGPRSterritoryconfigurationupdates

GPRS territory upgrade; general packet radio service territory upgrade


procedurethatthebasestationcontroller(BSC)usestoallocateresourcesfromthe
circuit-switchedterritorytotheGPRSterritory

GPRS transparent transport protocol; GTTP


protocolthatisusedtotransmitGPRSmobilitymanagementandsessionmanagement
(GMM/SM)signallingmessages

GPRS Tunnelling Protocol; GTP; GPRS Tunneling Protocol /US/


protocolthatisusedinthegeneralpacketradioservice(GPRS)fortransmittinguser
datapacketsandsignallingbetweenGPRSsupportnodes(GSN)overGPRSbackbone
network

GPRS Tunnelling Protocol - control plane; GTP-C; GTP control plane


protocolforthecontrolplanesignallingbetweenGPRSsupportnodes(GSN),allowing
theSGSNtoprovidepacketdatanetworkaccessforamobilestation

GPRS Tunnelling Protocol - user plane; GTP-U; GTP user plane


protocolthatprovidespackettransmissionandreceptionservicestouserplaneentities
inthegatewayGPRSsupportnode(GGSN),theservingGPRSsupportnode(SGSN),
andtheradionetworkcontroller(RNC)

GPS; global positioning system


satellite-basedpositioningsystemthatisusedforreadinggeographicalpositionandasa
sourceoftheco-ordinateduniversaltime

570

Issue:28

GeneralGlossary

GPS assistance data


datawhichtheservingradionetworkcontroller(SRNC)signalstothemobileterminalto
enablemeasurementswhichthemobileterminalhastoperform,andtoprovidemeans
forpositioncalculation

GPS module
modulethatprovidesasoftwaremanagementinterfaceforfetchingthegeographical
coordinatesandtheCoordinatedUniversalTimeinformation

GPS navigation message


continuous12.5minuteslong50bitsperseconddatastreammodulatedontothecarrier
signalofeveryGPSsatellite

GPS satellite; space vehicle


satellitethatispartoftheglobalpositioningsystem(GPS)andthatbroadcastssignals
coupledwithaprecisetimemessage

GPS signal
radiosignalthatcomestotheGPSantennainaglobalpositioningsystem

graceful shutdown
featurewhichallowstheapplicationstobenotifiedofshutdown,thusenablingthemto
rejectnewincomingrequestswhilestillcontinuingtohandleexistingdialogues

graded-index fibre /GB/ ; graded-index fiber /US/; GIF; gradient-index fibre


/GB/; gradient-index fiber /US/
opticalfibrehavingagradedindexprofile

graded index profile


indexprofileinwhichtherefractiveindexvariescontinuouslyinthecoreasafunctionof
distancefromtheaxis

grade of service; GOS


guaranteedserviceincomparisonwiththedeliveredormeasuredqualityofservice

grading message
messagefromthenodetothelocalexchangeaboutdegradedISDNlinequality

Issue:28

571

GeneralGlossary

granted expiration time


registrationlifetimewhichtheservingprofiledatabase(SPD)setsbasedonthe
requestedvalue

granularity period
periodicityofthegenerationofresultsbyameasurementjobwithinthetimeframe
specifiedintheschedulingattributes

graph
entityformedofdataitemsandtheirinterconnections,usuallyinawaythateachitemis
directlyconnectedtoatleastoneotheritem

graphical adjacency management; GAM


adjacencymanagementthatenablestheusertoviewandmanipulatecelladjacency
relationsviaagraphicaluserinterface

graphical user interface; GUI


userinterfaceforinteractingwithcomputersoftwarebasedonwindowsandgraphical
icons

graphical user interface server; GUIS


serverthatprovidesgraphicaluserinterfaceservicesforsystemcomponentsrunningon
otherservers

gratuitous ARP; gratuitous ARP message


addressresolutionprotocol(ARP)messagethatupdatesthehosts'cachedEthernetand
IPaddresspairentries

GRC parameter
variableintheglobalresourceconfiguration(GRC)filewhichisusedtodefinea
particularpermanentconfigurationsetting

GRC section
partoftheglobalresourceconfiguration(GRC)filewhichcontainstheconfiguration
parametersofacharginggateway(CG)module

greenfield operator
networkoperatorwithnoexistingnetworkorcustomersinthespecificfield,suchas
mobilenetworks

572

Issue:28

GeneralGlossary

GRE key
keywhosevalueisnegotiatedbetweentheASNgatewayandbasetransceiverstation,
orbetweentwoASNgateways,toidentifyatunnelthatisformedbyusinggeneric
routingencapsulation(GRE)

GRE tunnel
tunnelthatisformedbyusinggenericroutingencapsulation(GRE)

grey list
intheequipmentidentityregister,alistofmobileequipmentunderobservation

grid computing
distributedprocessingthatisbasedontheuseofanumberofcomputersinanetwork

Gr interface
interfacethroughwhichthehomelocationregister(HLR)orthehomesubscriberserver
(HSS)communicateswiththeservingGPRSsupportnodes(SGSN)

grooming
allocationofserver-layertrailstoclient-layerconnectionsbygroupingtogetherthose
client-layerconnectionswhichhavecommoncharacteristics

grooming; traffic grooming


mergingofpartiallyfilledtransmissionlinesintoalmostfullyutilisedlinesforincreased
transmissionefficiency

ground expression
expressionthatcontainsonlyoperators,synonyms,andliterals

group
setofmembersallowedtoparticipateinthegroupcall

group abbreviated dialling; group abbreviated dialing /US/


facilitywherecommonabbreviatednumbersaredefinedforacentrexgrouporthe
extensionsofaprivatebranchexchange

Issue:28

573

GeneralGlossary

group address; physical group address


physicalcomputeraddressacknowledgedbymorethanonecomputer

group address table


arraylistingthegroupaddressesinuseandtheindividualaddressesofthecomputers
belongingtoeachgroup

group administrator
personwhohasrightstomanagesubscribers'profiles,thatis,canadd,delete,and
modifygroupsandgroupmembers

group advertisement indicator


indicatorthatinformstheuseraboutareceivedPoCgroupadvertisementinaterminal

group advertising; group advertisement


methodbywhichanewgroupisintroducedtousersinordertoaddthegrouptothe
terminals'phonebooks

group and access list management interface


interfacebetweenaPoCcallprocessorandPoCterminalsthatthenetworkoperators
canusetoprovidegroupandaccesslistmanagementservicestotheusers

group and list management


featurethatenablesPoCuserstoperformmanagementactionsontheirpersonalPoCrelateddata

group and list management interface


openinterfacethatispartoftheOMAPoCclientinterfaceandresidesbetweenthepush
totalkovercellular(PoC)XDMSfunctionsofthePoCcallprocessorandtheaggregation
proxyfunctionstandardisedbytheOpenMobileAlliance(OMA)

group attachment; attachment


actionwhereauserattachestoatalkgroup(thatis,joinstoagroup)

group box
frameorboxusedtokeepdialogueboxcontrolstogetherinalogicalway

574

Issue:28

GeneralGlossary

group call
pagingwherethesamepagingmessagecanbesenttoseveralpersonsatthesame
time

group call
relationshipthatexistsbetweenthemembersofagroupforthepurposeoftransferring
data

group call initiator


memberofagrouporathirdpartyauthorisedtoinitiateagroupcall

group call number; hunting group call number


commoncallnumberassignedtothemembersofagroup

group call participant


memberofagroupparticipatinginaparticulargroupcallatagiventime

group call pick-up; group pick-up


pick-upservicewhichenablesasubscribertopickupcallscomingtoanothersubscriber
lineinthesamepick-upgroupbyusingaservicecode

group call server


logicalentitythatprovidesthegroupcallservicetothemembersofapredetermined
group

group communication
allactivitiesinwhichatalkgroupisactuallyusedforcommunication

group controller
memberofagrouporathirdpartyresponsibleforgroupcreationandmembership
control

group control server; GCS


inapushtotalkcallprocessor,aserverinthecontrolplanewhichhandlesthecontrol
actionsandend-usersignallingtransactionsrelatedtotalkgroups

Issue:28

575

GeneralGlossary

group detachment; detachment


actionwhereauserdetachesfromatalkgroup

group icon
iconrepresentingseveralprogramswhichopensintoawindoworintoagroupoficons
representingtheseprograms

group identifier
first0-2digitsintheextensionnumberwhichidentifythecentrexgroup

group identity; group ID


indicationoftheidentityofthetalkgroup,whichisshowntotheterminatinguserwhen
theuserisinvitedtojoinagroup,andwhentheuserreceivestrafficfromthegroup

grouping identifier
identifierwhichconnectstheresourcessituatedindifferentcomputerunits

group key; PK; pairwise key


cryptographickeythatcanbeusedbyallcommunicatingentitiesinthenetworkorinthe
vicinity

group key encryption key; GKEK


encryptionkeythatisgeneratedrandomlyinthebasetransceiverstation(BTS)to
encryptgrouptransportkeysusedbetweenthebasetransceiverstationandmobile
subscriberstations

group key management protocol; GKMP


protocolwhichprovidestheabilitytocreateanddistributekeyswithinarbitrary-sized
groupswithouttheinterventionofaglobalorcentralisedkeymanager

group list management function; GLMF


PoCsubsystemwhichhandlesthelistandgroupmanagementfunctions

group list server; GLS; GLMS; group and list management server
inaPoCcallprocessor,aserverwhichparticipatesinuserauthentication,provides
groupandaccesslistmanagementservicesforusersandothersoftwareentities,and
storestheusers'groupmemberandaccesscontrollists

576

Issue:28

GeneralGlossary

group management
allactionsforcreatinganddeletingtalkgroupsanddefiningwhichusershaveaccessto
thosegroups

group member list


inthePoCsystem,auser-definedlistthatcontainstheallowedmembersofagroup

group member list and ACL management; list management and access
control
setofmanagementfunctionsthattheoperatorprovidestoPoCuserssothattheusers
canformclosedusergroupsanddefinefromwhomtheywishtoreceiveone-to-onecalls
anddial-outgroupinvitations

group member query


servicewhichallowsaparticipantinagroupsessiontofindouttheidentitiesoftheother
participants

group operation
inapushtotalkovercellular(PoC)system,theactualend-useractionstojoingroup
sessionsandtocommunicateinthem,andtodepartgroupsessions

group participant information; subscription to conference state event


package
listofcurrentparticipantsinagroupsession,whichanyuserwhoispartic