You are on page 1of 363

Buddhismus-Studien

Buddhist Studies
5/2006

Hinweise der Herausgeber


In der Reihe Buddhismus-Studien / Buddhist
Studies erscheinen deutsch- und englischsprachige Arbeiten, die weithin unbekannte
Aspekte des Buddhismus erschlieen und zu
weitergehenden Untersuchungen stimulieren sollen. Die einzelnen Beitrge folgen unterschiedlichen Anstzen und behandeln unterschiedlichste Themen. Sie sind geeignet,
einseitige Vorstellungen ber den Buddhismus" durch ein treffenderes Bild zu ersetzen.
Autorinnen und Autoren, die Arbeiten zur
Verffentlichung anbieten mchten, sollten
sich an eine der nebenstehenden Adressen
wenden.

Prof. Dr. Gregor PAUL


Klauprechtstr. 41
D-76137 Karlsruhe
Tel.: +49-(0)721-816802
E-mail:
Gregor.Paul@t-online.de

Prof. Dr. AOYAMA Takao


Haus der Japanischen Kultur
Brggener Weg 6
D40547 Dsseldorf
Tel.: +49-(0)211-577918-0
E-mail:
Aoyama@eko-haus.de

Dieter Schlingloff

Ein buddhistisches Yogalehrbuch


Unvernderter Nachdruck der Ausgabe von 1964
unter Beigabe aller seither bekannt gewordenen Fragmente

Herausgegeben von
Jens-Uwe Hartmann und Hermann-Josef Rllicke

Buddhismus-Studien
Buddhist Studies
5 / 2006
herausgegeben von Gregor Paul und Takao Aoyama

Eine Verffentlichung
des Hauses der Japanischen Kultur (EK)
in Dsseldorf

Abbildung auf der Rckseite des Bandes:


Der chinesische buddhistische Gelehrte Xuan Zang (600-664) bei seiner Rckkehr aus Indien.
Gem einem Portrait, das 1933 nach einer Song-zeitlichen (960-1279) Darstellung
gefertigt wurde.

Bibliografische Information
Der Deutschen Bibliothek
Die Deutsche Bibliothek verzeichnet diese Publikation in der Deutschen Nationalbibliografie;
detaillierte bibliografische Daten sind im Internet ber http://dnb.ddb.de abrufbar.

IUDICIUM Verlag GmbH Mnchen 2006


Alle Rechte vorbehalten
Umschlaggestaltung: Gregor Paul
Druck- und Bindearbeiten: Ludwig Auer GmbH, Donauwrth
Printed in Germany
ISBN 10: 3-89129-694-0
ISBN 13: 978-3-89129-694-3

Vorwort
Mit dem Neudruck des seit langem vergriffenen Buddhistischen Yogalehrbuchs in der
Edition von Dieter Schlingloff, einer der wichtigsten philologischen Arbeiten der
Buddhologie in der zweiten Hlfte des 20. Jhs., macht das EK-Haus der Japanischen
Kultur e.V., Dsseldorf, in seiner Reihe der Buddhismus-Studien" ein fundamentales
Quellenwerk des Buddhismus wieder zugnglich, das in einem wesentlichen Punkt mit
der eigenen Lehrtradition dieses Hauses, derjenigen des Buddhismus des Reinen Landes,
und mit einem konstitutiven Grundzug der Entstehung des Mahyna berhaupt in
sachlicher Verbindung steht: nmlich in der ritualisierten, mandalafrmigen Schau und
der kontemplierenden weltbefreienden Betrachtung. In diesen Komplex gehren nicht
nur Mahyna-Schriften wie das Pratyutpanna-samdhi-stra, das Be trachtung s-stra
der Reine-Land-Tradition, das Gandavyha-stra oder bestimmte bis heute in Tibet
praktizierte Visualisationsbungen, sondern hierher gehrt auch das bislang immer noch
nicht gengend zur Kenntnis genommene und hier wieder zugnglich gemachte Yogalehrbuch von der Seidenstrae. Es lt sich als ein wichtiges Bindeglied zwischen dem
lteren und dem Mahyna-Buddhismus Zentral- und Ostasiens verstehen.
Das EK-Haus hat sich zu dieser Publikation ber 40 Jahre nach ihrem ersten
Erscheinen nicht nur entschlossen, um die betroffenen Fachwissenschaftler und die
historische Philologie wieder mit dieser Arbeit auszustatten und so das wichtige, aber
noch von vielen Rckstnden betroffene Wissenschaftsgesprch darber neu zu entfachen, sondern auch, um der interessierten breiteren und nicht nur spezialisiert fachkundigen ffentlichkeit diese erstaunliche Schrift zu Studium und Bedenken besonders
ans Herz zu legen. Da dies nicht geschehen kann, ohne den hchsten wissenschaftlichen Ansprchen zu gengen, ist eine der Grundberzeugungen des Herausgebers. Die
Wahrnehmung des Buddhismus im Westen wrde ohne die Verbindlichkeit und Expertise der zugehrigen Wissenschaften doch immer graduell ein Defektzustand bleiben
mssen.
Das Yogalehrbuch entfaltet eine komplexe und in sich wohlintegrierte geschaute
Welt. Den Sichtraum dieser Schau lt der Adept nach der Vorgabe der Schrift im
Gang seiner Versenkung aus sich selbst entstehen. Dieser Raum umfat alle Dinge. Der
buddhistische Yogin ist selbst ein Wesen dieses Raumes, als sei er das schlagende Herz
dieses aus ihm entstehenden und wieder in ihn zurckkehrenden schaubaren Ganzen der
Welt. Das zuvor Verborgene, das dank der Weltvernderung seines achtsam atmenden
bens sichtbar wird, ist zugleich auch das Erlsungsbedrftige, das erst noch zum
Erlschen zu Bringende alles Leidens der Welt. Was als diese Schau Erkenntnis" oder
Erleuchtung" heien kann, ist eine von Farbe und Gestalt, von Ritus und Kosmologie
durchdrungene, alle Gebiete des Sinnens und Denkens umfassende mythologische
Raumanordnung, die ihre liturgische Vergegenwrtigung in dem hat, was wir darstellende Kunst" nennen, insbesondere in der Architektur und Malerei der Seidenstrae.

vi

Vorwort

Die hohe Bedeutung der Arbeit Schlingloffs fr dieses Thema kam in einem interdisziplinren religionsphilosophischen Symposion des EK-Hauses im September 2004
unter dem Titel ,Betrachtung' und ,Schau', ,Gesicht' und ,Vision' in der religisen
bung" zum Tragen. Hier zeigte sich besonders, da das Herausfordernde der Frage
nach der Schau" fr die westlichsprachige Welt nicht vom historisch-philologischen
Handwerk allein bewltigt werden kann, sondern zuknftig erst in der Selbstberprfung
der europischen Hermeneutik dieser Literatur zum Vorschein wird kommen knnen.
Die Ergebnisse dieses Symposions werden in Krze in der Zeitschrift Hrin: Vergleichende Studien zur japanischen Kultur verffentlicht. In denselben Zusammenhang
gehrt auch Dieter Schlingloffs Aufsatz Mrdhacchidra", den wir schon frher, in
Band 10 (2003) dieser Zeitschrift, publiziert haben.
Der Ansatzpunkt der hier angesprochenen, weniger philologischen als hermeneutischen Frage ist folgender: In welchem Sinne und in welcher Weise kann die in der
Versenkung und rituellen Strenge, wie das Yogalehrbuch sie dartut, erst entstehende
Welt des Lichts und der Gestalten Bild" heien? Und wird dieses Bild" von dem
benden gewissermaen technisch gemacht" oder hergestellt" oder gerade nicht? Die
selber schon auslegende Idee, da ein solches Sehen und ein solcher Bildraum ein
Weltbild" bezeuge, konnte erst unter Bedingungen der europischen Neuzeit entstehen;
sie ist keine Eigentmlichkeit dieser Schrift selbst. So darf Schlingloffs Formulierung
in der Einleitung, es handle sich hier um Vorstellungen ber den Weltbau", um
visionre Erlebnisse" und um das Zeugnis eines Weltbilds" heute selbst noch einmal
zu etwas eigens fraglich zu Machendem werden. Die Mglichkeit zu denken, solche
Bilder" seien gar Produkte einer Weltanschauung", brachte erst das spte 19. Jh. in
Europa und die philosophische Umgebung etwa Wilhelm Diltheys auf. Die Unselbstverstndlichkeit und Fraglichkeit gerade solcher Deutungen erkennend, sagte Martin
Heidegger 1938 in seinem Vortrag Die Zeit des Weltbildes": Warum fragen wir bei
der Auslegung eines geschichtlichen Zeitalters nach dem Weltbild? Hat jedes Zeitalter
der Geschichte sein Weltbild und zwar in der Weise, da es sich jeweils um sein
Weltbild bemht? Oder ist es schon und nur die neuzeitliche Art des Vorstellens, nach
dem Weltbild zu fragen?" Hier ist ein abgrndiges Problem im Hin-und-her-Gehen
zwischen den Kulturen in der Differenz ihrer Geschichten angesprochen, das eine bisher
vermutlich noch nicht gengend geprfte Automatik unseres neuzeitlichen Denkens auf
die Probe stellt. In diesem Falle macht es sich auch in unserem Umgang mit dem
Yogalehrbuch geltend. Fraglich machen knnen wir hier unser eigenes hermeneutisches
Denken und Sprechen, whrend der Text des Yogalehrbuchs selbst, zu dem der Westen
bisher in keinem berlieferungszusammenhang stand, davon unangetastet bleibt. Eine
Philologie aber und dazu gehren auch das bersetzen und Kommentieren , die sich
nicht auch hermeneutisch ausweisen und fraglich machen lasseh mte, drfte es nicht
geben.
Mit welchem Recht also machen wir das gebte und angeleitete Entstehenlassen des
Raumes, der dem erwachenden, dem durch die Auslschung des Leidens sich ffnenden
Auge zugleich auch schaubar wird, zu einer Vorstellung"? Wie wre es, wenn wir den
visionren Raum des Yogalehrbuchs gar nicht als etwas zu deuten htten, das durch
menschliches, und sei es durch religise Technik mglich gemachtes Vor-uns-Hinstellen

Vorwort

vii

und Neuerfinden aus der bloen Quelle eigenen Tuns und Machens entsteht, sondern als
eine Welt, die sich in der rituellen Vergegenwrtigung der stufenweisen Versenkung von
sich aus ffnet als ein Raum und Anblick sowohl der qualvoll durchlittenen als auch der
erlsten Welt, zu der jegliches Wesen in der Geschichtswelt des Textes gehrt? Wie
wre es, wenn die wirkliche" Welt, insofern wir das Wirkliche in der Tat jederzeit als
etwas Vorgestelltes" verstehen, im Aufgehen jener ganz anderen des Yogalehrbuchs sich
gerade hierdurch als recht eigentlich blind und verblendet herausstellen wrde? Ist es
nicht das Markante dieser Schrift, da jene uns vorher unbekannte Schau der Welt in
ihrer Befreiung erst durch die Erlsungstat des Yogin entsteht? Durch sein Verdienst und
seine Bemhung um alle Wesen der Welt wird gerade ausdrcklich sichtbar (d.h. es
bleibt gerade nicht unsichtbar), wie sie alle befreit werden. Knnte dieses sichtbar
Werdende nicht, obwohl es durch ihn sichtbar wird, doch etwas anderes sein als eine
Vorstellung", ein Weltbild", eine Anschauung" und gar eine Weltanschauung"? Ob
der buddhistische Yogin dieser Schrift verschrnkt sitzt in der Position eines neuzeitlichen Subjekts, dem alle Gestaltwerdung auer ihm zu einem Werk seiner eigenen
produkthaften, technischen, objektivierenden Hervorbringung wird, das wird noch
besonders zu bedenken sein. Denn auch er mu erst noch erfahren, welches Sehen und
welcher Anblick sich in seiner bung auftun mssen. Er erfhrt dies aber nicht aus sich,
sondern aus einer rituellen Anweisung, deren Vorgaben er erst auf richtige Weise folgen
soll. Sein Mandala ist also schon da, ehe er es produzieren kann. Alles Sichtbare kehrt
in dieser bung wieder ins Unsichtbare zurck, und die befreite Welt verschwindet am
gleichen Ort, an dem ihre Befreibarkeit sichtbar wurde: im Leib des Rettenden, des
Yogin. Sein Leib erweist sich in der weitesten ffnung des schaubar gewordenen
Raumes als mit dieser Welt ganz identisch. Weil aber sein Leib in dieser grten
Weitung des geschauten Raumes nichts anderes ist als das Ganze der Welt selbst, gibt
es auch kein Wesen, das er nicht erretten knnte. So zu sehen", erfordert letztlich das
geffnete Auge eines Buddha. Auch Buddhas werden nicht technisch hergestellt, sondern
sie knnen nur werden", indem ein Wesen sich in der bung dazu lt.
Das EK-Haus dankt besonders herzlich Herrn Professor Jens-Uwe Hartmann,
Universitt Mnchen, fr die groe Mhe und den wohltuenden Luxus seiner Expertise,
mit denen er die Neuedition fachlich betreut und das Werk um den heutigen Forschungsstand ergnzt und bereichert hat. Ein groer Dank gebhrt ebenso Herrn Professor Yamabe Nobuyoshi, Tokyo Ngy Daigaku, der freundlicherweise bereit war, die
Ergebnisse seiner Arbeiten zum Text des Yogalehrbuchs dieser Publikation beizusteuern.

Hermann-Josef Rllicke
EK-Haus der Japanischen Kultur e.V., Dsseldorf

Inhaltsverzeichnis

Einleitung zum Nachdruck von Jens-Uwe

HARTMANN

Faksimile von
Ein buddhistisches Yogalehrbuch, Textband

xi
1

Faksimile von
Ein buddhistisches Yogalehrbuch, Tafelband

261

Korrekturen und Verbesserungsvorschlge zur Textausgabe des Yogalehrbuchs

305

Nachdruck von
Jens-Uwe

HARTMANN:

Neue Fragmente aus dem Yogalehrbuch

309

Jens-Uwe

HARTMANN:

Drei weitere Fragmente aus dem Yogalehrbuch

319

Nobuyoshi YAMABE: Fragments of the Yogalehrbuch in the Pelliot Collection

325

Einleitung zum Nachdruck


Jens-Uwe Hartmann

Die Edition des sogenannten Yogalehrbuches stellt eine hchst beeindruckende Leistung
im Rahmen der Bearbeitung zentralasiatischer Sanskrit-Texte dar. Die Handschrift ist
unvollstndig, und sie war in zahlreiche Bruchstcke zerfallen; anders als bei den
meisten buddhistischen Werken, die in Zentralasien berliefert worden sind, kennen wir
bislang aber weder eine Parallelversion des provisorisch als Yogalehrbuch bezeichneten
Werkes in Sanskrit noch bersetzungen ins Tibetische oder Chinesische. Sowohl
Parallelfassungen wie bersetzungen knnten als eine Art Raster fr die korrekte
Anordnung der Fragmente dienen und wrden damit eine unschtzbare Hilfe fr den
Bearbeiter bieten. Sehr anschaulich beschreibt Dieter SCHLINGLOFF, wie er statt dessen
etwa die Maserung der Birkenbltter geradezu detektivisch herangezogen hat,1 um in
Verbindung mit inhaltlichen Kriterien die erhaltenen Teile der Handschrift wieder
zusammenzufgen. Dies ist ihm in staunenswerter Weise gelungen. Als Ergebnis seiner
mhevollen Arbeit konnte er schlielich groe Teile des Inhalts wiedergewinnen und
der Fachwelt ein im Rahmen der buddhistischen Sanskrit-Literatur bis dato einzigartiges
Werk vorlegen.
Da dieses Werk zunchst nicht die Aufmerksamkeit fand, die es vom ersten
Moment an unbedingt verdiente, mag wesentlich an vier Grnden gelegen haben. Der
erste Grund hat vor allem mit der bereits angesprochenen Bruchstckhaftigkeit zu tun;
trotz SCHLlNGLOFFs vorbildlicher Bemhungen um eine Erschlieung auch der schlecht
erhaltenen Passagen durch seine deutsche bersetzung macht der Erhaltungszustand
eine zusammenhngende Lektre und ein Gesamtverstndnis des Textes unmglich.
Zweitens drfte gerade der Umstand, da es sich um einen singulren Text zu handeln
scheint, fr den keine eng verwandten Fassungen in den berlieferungen anderer
buddhistischer Traditionen nachgewiesen werden konnten, ein weiterer Grund fr das
marginale Interesse gewesen sein. Ferner deutete das Fehlen von Parallelversionen
und/oder bersetzungen an, da hier ein nichtkanonischer Text vorliegt, der mglicherweise berhaupt erst in Zentralasien entstanden war und daher nicht beanspruchen kann,
reprsentativ fr den indischen Buddhismus zu sein. Und schlielich war das Interesse
an Meditationstexten, noch dazu an solchen, in denen Visualisierungen beschrieben
werden, die weit ber das hinausgehen, was man aus der Pli-Literatur kannte, und die
bereits in Richtung tantrischer Meditationspraktiken zu weisen scheinen, in den Jahren
nach Erscheinen des Yogalehrbuches noch wenig entwickelt. Insgesamt blieb damit der
Blick auf den einzigartigen Inhalt verstellt.

YL, S. 10-11.

xii

Jens-Uwe Hartmann

Mglicherweise hat sogar Dieter SCHLINGLOFF selbst mit seiner Wahl des Titels ein
wenig zu dieser Situation beigetragen. Anfang und Ende des Textes sind nicht erhalten,
und es gibt daher keinerlei Hinweis auf den ursprnglichen Titel des Werkes. SCHLINGLOFF war also vor die Notwendigkeit gestellt, den Text wenigstens tentativ zu benennen.
Interessanterweise enthlt die Handschrift vorangehend ein weiteres Werk, dessen Titel
dem Kolophon zufolge Yogavidhi lautet. Dieser Text besteht aus kurzen, sehr schwer
verstndlichen Lehrstzen und bietet in der traditionellen indischen Form eines Lehrbuches eine rein theoretische Darstellung der Meditation. Daher wre der Titel Yogalehrbuch" eigentlich fr den Yogavidhi angemessener gewesen, whrend der jetzt unter
Yogalehrbuch bekannte Text eine konkrete Meditationsanleitung fr den praktischen
Gebrauch beinhaltet.2 Inzwischen hat sich dieser fraglos griffige Titel jedoch durchgesetzt; daher ist er auch hier durchgngig verwendet, und zwar ohne Anfhrungszeichen, aber in dem Bewutsein, da er eines Tages vielleicht zu korrigieren sein wird,
wenn uns nmlich ein Glcksfund doch noch ein Blatt mit dem Titel oder dem Kolophon bescheren sollte.
All dies hat jedenfalls dazu gefhrt, da das Yogalehrbuch in der wissenschaftlichen
Auseinandersetzung mit dem Buddhismus zunchst relativ wenig Niederschlag fand.
Eine bemerkenswerte Ausnahme bildete allerdings der auerordentlich gehaltvolle
Besprechungsaufsatz von David SEYFORT RUEGG, der 1967 erschien und nicht nur
einige wichtige Verbesserungsvorschlge, etwa zum Verstndnis des Begriffes pratipaksa,3 enthielt, sondern auch die inhaltlichen Besonderheiten des Werkes herausstellte
und sie in Beziehung zu anderen geistesgeschichtlichen Entwicklungen im Buddhismus
zu setzen suchte. Wiewohl auf Englisch erschienen, vermochte aber auch jener Aufsatz
zunchst keine weitergehende Rezeption des Werkes auszulsen, und es blieb vor allem
SCHLINGLOFF selbst, der in seinen Arbeiten immer wieder auf die einzigartigen Informationen zurckgriff, die das Yogalehrbuch bot.4
Inzwischen hat sich diese Situation grundlegend gewandelt, und seit etwa fnfzehn
Jahren wird dem Werk allmhlich die Aufmerksamkeit zuteil, die es unbedingt verdient.
Einerseits rckten nmlich in den achtziger Jahren des letzten Jahrhunderts Meditationstexte mehr und mehr in den Bereich wissenschaftlichen Interesses, und andererseits
erlebte die Beschftigung mit den zentralasiatischen Sanskrit-Texten einen neuen
Aufschwung. Das Interesse an Meditationsinhalten und -techniken fhrte dazu, da man
sich strker mit dem Inhalt des Yogalehrbuches auseinanderzusetzen begann, und die
Beschftigung mit den Manuskripten hatte zur Folge, da unter den in den westlichen
Sammlungen schlummernden Handschriftenfragmenten weitere Bruchstcke des Yoga-

SEYFORT RUEGG 1967: 157 whlt nach dem Fundort die Bezeichnung QMl text" und vermeidet
damit eine inhaltliche Zuordnung, aber dieser Name hat sich nicht durchgesetzt.
3

SEYFORT RUEGG 1967:

158.

Von SCHLINGLOFF 1962/1963 II: 88-99 bis SCHLINGLOFF 2003: 110 und 116. Vgl. auch BRETFELD
2003: 169.

Einleitung zum Nachdruck

xiii

lehrbuches entdeckt und bereits bekannte, aber bislang unverffentlichte Fragmente


endlich publiziert wurden. Diese Entwicklung hlt erfreulicherweise bis heute an.5
Erwhnung verdient hier auch, da der gesamte Text des Yogalehrbuches fr die
Auswertung im Sanskrit-Wrterbuch der buddhistischen Texte aus den Turf an-Funden
und der kanonischen Literatur der Sarvstivda-Schule (SWTF) erfat worden ist; da
es sich dabei um ein Belegstellenwrterbuch nach dem Thesaurusprinzip handelt, knnen Wortschatz und Diktion des Yogalehrbuches in Beziehung zu derjenigen buddhistischen Literatur gesetzt werden, vor deren Hintergrund das Werk entstanden ist. Dies
ist das Umfeld der Schule der (zentralasiatischen) Sarvstivdins; schon SCHLINGLOFF
selbst hielt fest, der Text gehe in seinen dogmatischen und mythologischen Grundlagen
nicht ber die bekannten Lehren der Sarvstivdin hinaus".6 Um so bemerkenswerter
ist ebenfalls in den Worten von SCHLINGLOFF seine ethische Haltung, die das
Bodhisatva-Ideal widerspiegelt, das in den Schriften des Mahyna im Zentrum der
Betrachtungen steht".7 Hier wird ein bergang sichtbar, der einmal mehr deutlich
macht, wie flieend in der Realitt die Grenzen zwischen Mahyna und den Schulen
des lteren Buddhismus vielerorts gewesen sein mssen. Gerade das Yogalehrbuch zeigt
eindrucksvoll, wie in der tatschlichen Praxis das eine gewissermaen nahtlos in das
andere bergeht, so da die vertrauten und allzu ungern in Frage gestellten Einordnungskategorien vllig verschwimmen.
Das Yogalehrbuch stellt, wie bereits erwhnt, weniger ein Lehrbuch dar, sondern
enthlt vielmehr eine Anleitung fr eine konkrete Meditationspraxis, nmlich fr eine
spezifische Abfolge von Visualisierungen. Betrachtet man die Art der mndlichen und
schriftlichen berlieferung vergleichbarer Meditationspraktiken im tibetischen Buddhismus, dann stellt man schnell fest, da hier bestimmte Variationsmglichkeiten in
Wortlaut und Abfolge bestehen, da beide also nicht als unvernderliche Gren
angesehen werden, deren genaue Einhaltung fr den Erfolg der bung entscheidend ist.
hnliches scheint fr die berlieferungssituation des Yogalehrbuches zu gelten, wie
sich inzwischen aufgrund der zunehmenden Zahl von Handschriften immer deutlicher
herausstellt.8 Es gibt offenbar nicht den mageblichen Text, sondern wohl nur eine im
Prinzip unendliche Zahl von Varietten, die einen durch die feststehende Reihenfolge
der Meditationsobjekte und der damit verbundenen Bilder vorgegebenen Ablauf beschreiben. Diese Beschreibung kann, vielleicht auch in Abhngigkeit von den Interessen
oder Vorkenntnissen des jeweiligen Benutzers, lnger oder krzer ausfallen, eher
stichpunktartig oder in grerer Ausfhrlichkeit erfolgen. Darin wre vielleicht auch

Als Beispiele fr eine Auswertung der Informationen zur Meditation wren etwa zu nennen
1987, YAMABE 1999, BRETFELD 2003 und zuletzt GETHIN 2006, der auf den
S. 96-97 das Yogalehrbuch als Quelle fr die Beschreibung von Visualisationen mitheranzieht. Weitere
zentralasiatische Sanskrit-Fragmente des Textes wurden publiziert in HARTMANN 1996 (unten, S. 309 ff.),
YAMABE 1997 (unten, S. 325 ff.) und HARTMANN in diesem Band (unten, S. 319ff.).
6
YL, S. 10; vgl. SEYFORT RUEGG 1967: 157 ff., SCHMITHAUSEN 1970: 112, Anm. 257, ferner
SCHLINGLOFF 2003: 119, Anm. 20, und BRETFELD 2003: 171, Anm. 10 mit dem Verweis auf DIETZ 2003
im selben Band wie sein eigener Beitrag.
7
YL, S. 10; vgl. aber auch die Bemerkungen in SEYFORT RUEGG 1967: 161-162.
8
Vgl. unten, S. 320.
KLOPPENBORG/POELMEYER

xiv

Jens-Uwe Hartmann

noch ein weiterer Grund fr die auffallende Nachlssigkeit in orthographischer Hinsicht


zu sehen,9 die alle Handschriften charakterisiert.
Wenn man also von der Annahme ausgeht, da es sich um ein Werk mit Textvarianten handelt und nicht um eng verwandte, aber doch unterschiedliche Einzelwerke, dann
liegen heute insgesamt wenigstens sieben verschiedene Handschriften des Werkes vor.
Sechs davon stammen mit grter Wahrscheinlichkeit aus Kuc:
1. SHT 150 aus Qizil (Kuc); die Haupthandschrift des YL, auf Birkenrinde geschrieben; das Manuskript hat mindestens noch einen weiteren Text, nmlich den Yogavidhi,
enthalten.
2. SHT 164a aus Qizil (Kuc); zwei Bruchstcke aus einem Blatt einer Papierhandschrift; sechszeilig beschrieben; Blattziffer 64; vgl. YL, S. 23.
3. SHT 183a aus Qizil (Kuc); vier Bruchstcke aus drei Blttern einer Papierhandschrift;10 achtzeilig beschrieben; vgl. YL, S. 23 f.
4. Pelliot Sanskrit Numero Rouge 9.1-6 aus Duldur-aqur (Kuc), vgl. INOKUCHI 1989:
8-10; ein fast vollstndiges Blatt und fnf Bruchstcke einer Papierhandschrift; siebenzeilig beschrieben; publiziert in YAMABE 1997 und nachgedruckt unten, S. 325 ff.
5. Zwei unnumerierte Fragmente in der Sammlung Hoernle (Hoernle 149add. o. Nr.,
Mikrofilm IOL 17A, Folios 170 und 178; folios 156-180 contain unnumbered fragments from H. 149add.", SKLERV0 2002: xxxvi), wahrscheinlich ebenfalls aus dem
Raum Kuc und wahrscheinlich aus derselben Papierhandschrift; sechszeilig beschrieben; publiziert in HARTMANN 1996 und nachgedruckt unten, S. 309 ff.
6. Hoernle 150/84 und Hoernle 150/76 wahrscheinlich aus dem Gebiet von Kuc (Wille
2005: 61: According to Konow's cover letter, the fragments of the consignment H.
150/41-127 (sets i-vi) were found at Kamtura (Qumtura), Kizil (Qizil) and Yak-Arik
near Kuc." Vgl. auch SKLERV0 2002: lxii und xlvii); zwei Fragmente aus einem Blatt
einer Papierhandschrift; vierzeilig beschrieben; Blattziffer 29; publiziert unten, S. 320.
7. SHT 407a aus Sorcuq; ein vollstndiges Blatt einer Papierhandschrift; fnfzeilig
beschrieben; Blattziffer 85; vgl. YL, S. 24.
Ein weiteres unnumeriertes Fragment einer Papierhandschrift aus der Serie Hoernle 156
(jetzige Signatur Or. 15003/257), wahrscheinlich aus Kuc (MS. scraps, from Tunguz
Bash (Kucha?), sent by Indian Aksakal Sabat Ali from Kucha", SKLERV0 2002: xlii);
mindestens fnfzeilig beschrieben; eine Zugehrigkeit zu Nr. 5 lt sich nicht ausschlieen; publiziert unten, S. 322.
Damit erreicht das Yogalehrbuch zwar bei weitem nicht die Hufigkeit, mit der
beispielsweise das Prtimoksastra, das sogenannte Beichtformular der buddhistischen
Mnche, oder der Udnavarga, eine ungemein populre Sammlung von Aussprchen
des Buddha in Versform, unter den in Zentralasien gefundenen Sanskrit-Handschriften

SCHLINGLOFF sieht andere Erklrungsmglichkeiten, s. YL, S. 13 ff.


Das vierte ganz winzige Bruchstck ist inzwischen in den Ergnzungen und Korrekturen in SHT
VII (S. 247-248) publiziert worden.
10

Einleitung zum Nachdruck

XV

vertreten sind.11 Fr einen nichtkanonischen Gebrauchstext ist die Zahl von mindestens
sieben Manuskripten aber bereits erstaunlich hoch, und sie lt erahnen, da das
Yogalehrbuch in der religisen Praxis der Bewohner der ostturkistanischen Oasen
mglicherweise eine viel wichtigere Rolle spielte als die kanonischen Werke; deren
Vervielfltigung bot nmlich anders als bei solchen Texten wie dem Yogalehrbuch
eine Mglichkeit zum Erwerb religisen Verdienstes, und sie lt daher nicht notwendigerweise auf eine ber den rituellen Rahmen hinausgehende intensive Benutzung
schlieen.
Immer wieder sind die im Yogalehrbuch beschriebenen Visualisierungen mit Attributen wie mystisch" und visionr" belegt worden. Ob es sich dabei aber wirklich
um eine Fundgrube echt mystisch-visionrer Erlebnisse" so Paul HORSCH in seiner
Rezension aus dem Jahre 1967 handelt, erscheint mir mindestens fraglich. Zwar
kennen wir, um noch einmal auf das Beispiel des tibetischen Buddhismus zurckzukommen, durchaus Beschreibungen, in denen die Entwicklung solcher Meditationsanleitungen als visionr inspiriert geschildert wird. Diese Beschreibungen stammen
jedoch alle aus der Zeit nach dem 11. Jahrhundert und sind in einem Milieu angesiedelt,
in dem mystische und visionre Erfahrungen eine wesentliche Rolle spielen. Beim
Yogalehrbuch hingegen ist weder die Zeit noch der regionale Hintergrund seiner
Entstehung bekannt. SCHLINGLOFF nimmt aufgrund charakteristischer Verschreibungen
in der Birkenrindenhandschrift an, da sie von einem lteren und daher mglicherweise
indischen Manuskript in Gupta-Schrift abgeschrieben sei.12 Dies wrde uns etwa zur
Mitte des ersten nachchristlichen Jahrtausends zurckfhren, ohne aber einen konkreten
Hinweis auf den genauen geographischen Hintergrund zu bieten.13 Darber hinaus liegen
uns keinerlei Zeugnisse vor, die Aufschlu ber die tatschliche Genese dieses oder
hnlicher Texte geben knnten. Daher empfiehlt sich Zurckhaltung bei der
Verwendung von Begriffen wie mystisch", die hier keinen wirklichen heuristischen
Nutzen entfalten knnen; ein Verzicht auf solche Klassifizierungen schmlert keineswegs die Einzigartigkeit der im Yogalehrbuch beschriebenen Bildsequenzen.14

Zum Nachdruck
Dieter SCHLINGLOFFS Ausgabe des Yogalehrbuches ist seit langem vergriffen. Das
zunehmende Interesse an dem Text lt einen Nachdruck inzwischen als lngst berfllig erscheinen, und es ist besonders erfreulich, da das Haus der Japanischen Kultur

11

Vgl. SCHLINGLOFF 1968: 5, Anm. 3, und HARTMANN/WILLE 1992: 22-23.


YL, S. 13.
13
SEYFORT RUEGG hlt eine Herkunft aus Kaschmir fr wahrscheinlich (It is in fact likely that the
'Qizi'l text' or at least the doctrines and techniques it expounds came from Kasmlr", SEYFORT
12

RUEGG 1967:
14

157).

Zu einigen nur auf Chinesisch bewahrten und mglicherweise apokryphen Stras mit hnlichen
Bildern und den Beziehungen zum Yogalehrbuch s. die Arbeiten von Nobuyoshi YAMABE, besonders
YAMABE

1999.

xvi

Jens-Uwe Hartmann

(EK) in Dsseldorf nicht nur bereit war, einen solchen Nachdruck vorzunehmen,
sondern zugleich darauf bestand, er habe auf Deutsch zu erfolgen. Diese Besttigung
des Deutschen als einer immer noch gltigen Wissenschaftssprache wird nicht nur den
Verfasser des Buches erfreuen.
Zunchst war berlegt worden, den Text mit einem trainierbaren Texterfassungsprogramm einzuscannen, um Druckfehler beseitigen und Lesungskorrekturen einarbeiten
zu knnen, die sich aus den seit der Erstverffentlichung hinzugekommenen Fragmenten
ergeben hatten. Herr Dr. Reinhold GRNENDAHL von der Universittsbibliothek Gttingen war so freundlich, einen Probelauf vorzunehmen, der allerdings zeigte, da die
Fehllesungen des Programms in dem hochkomplizierten Sanskrit-Text einfach noch zu
zahlreich sind, als da sich der Korrekturaufwand lohnen wrde, von der Entstehung
neuer Druckfehler einmal ganz abgesehen. Daher blieb ein Faksimile-Nachdruck von
Text- und Tafelband als einzige Alternative, und es wurde entschieden, Druckfehler in
einer gesonderten Liste anzufgen.15 Daraus erklrt sich auch, da fr den Nachdruck
von Text- und Tafelband die originalen Seitenzahlen beibehalten worden sind; das
Druckfehlerverzeichnis nimmt dann allerdings die tatschliche Seitenzahl des hier
vorgelegten Buches auf, und diese Zhlung wird fr die sich anschlieenden, ebenfalls
neu hinzugekommenen Teile beibehalten.
Um dem Benutzer alle heute verfgbaren Informationen zum Text des Yogalehrbuches an die Hand zu geben, sind auch die beiden Aufstze mitreproduziert, in denen
weitere Fragmente aus dem Yogalehrbuch ediert worden waren, nmlich HARTMANN
1996 und YAM ABE 1997, ersterer unverndert, aber mit einem Anhang zu Lesungskorrekturen, und letzerer in einer geringfgig verbesserten Fassung. Frau Dr. Inge
WEZLER vom Verlag fr orientalistische Fachpublikationen in Reinbek ist fr die Nachdruckgenehmigung von HARTMANN 1996 zu danken und dem Prsidenten des Kyushu
Ryokoku Junior College (Kysh Kykoku Dankidaigaku) fr die Nachdruckgenehmigung von YAMABE 1997. Schlielich sind drei bisher unverffentlichte Bruchstcke aus
der Sammlung Hoernle in London hier erstmals ediert.
Neben Reinhold GRNENDAHL, der zudem bei bibliographischen Fragen behilflich
war, habe ich ganz besonders meinem Freund und Kollegen Klaus WILLE, Gttingen,
fr seine trotz aller gesundheitlichen Probleme nie erlahmende Hilfsbereitschaft bei der
Bearbeitung der Handschriften und beim Korrekturlesen zu danken. Seine konstante
Freude am Transliterieren selbst uerst bruchstckhafter Sanskrit-Handschriften aus
Zentralasien und seine brillante Lesefhigkeit der einschlgigen Schriftvarianten, die
derjenigen von Dieter SCHLINGLOFF kaum nachstehen drfte, ermglichten mir die
Identifizierung der drei hier erstmals vorgestellten Fragmente aus dem Yogalehrbuch.
Dieter SCHLINGLOFF machte mir wichtige Materialien fr die Einleitung zum Nachdruck
zugnglich; Nobuyoshi YAMABE war sofort bereit, seinen Aufsatz zur Verfgung zu
stellen, und bot an, ihn bei dieser Gelegenheit zu berarbeiten; Ursula SIMS-WILLIAMS
15
Diese Liste enthlt ausschlielich Verbesserungen zum Sanskrit-Text. Die angesichts des hochkomplizierten Satzes erstaunlich wenigen Druckfehler im deutschen Text (z.B. Seitentuch" statt Seidentuch",
S. 83, Zeile 14, oder ab-iegenu statt ab-legen", S. 175, Zeile 19/20) sind, soweit erkennbar, nirgends
sinnentstellend und bleiben daher unbercksichtigt.

Einleitung zum Nachdruck

XV

von der British Library half bei der Beschaffung von digitalisierten Reproduktionsvorlagen; Elisabeth Schaidhammer vom iudicium verlag lste smtliche editorischen
Probleme; ihnen allen sei herzlich gedankt.
Rezensionen zu Dieter SCHLINGLOFFS Ausgabe des Yogalehrbuches
Hermann BERGER, Gttingische Gelehrte Anzeigen 219 (1967), S. 309-310
Erich FRAUWALLNER, Wiener Zeitschrift

fr die Kunde

Sdasiens

10 (1966), S.

223-224
Paul HORSCH, Asiatische Studien 21 (1967), S. 140-141
F.J. MEIER, Orientalistische Literaturzeitung 65, Nr. 5/6 (1970), S. 292-294
David SEYFORT RUEGG S.U. SEYFORT RUEGG 1967

Abkrzungen und Literatur


2003
Sven BRETFELD: Visuelle Reprsentation im sogenannten buddhistischen Yogalehrbuch" aus Qi'zil",
Indien und Zentralasien: Sprach- und Kulturkontakt. Vortrge des Gttinger Symposions vom 7. bis 10.
Mai 2001, ed. Sven Bretfeld und Jens Wilkens, Wiesbaden (Verffentlichungen der Societas UraloAltaica, 61), S. 167-205.
BRETFELD

2003
Siglinde DIETZ: Die Kosmologie nach den buddhistischen Sanskrit-Texten aus Zentralasien", Indien und
Zentralasien: Sprach- und Kulturkontakt. Vortrge des Gttinger Symposions vom 7. bis 10. Mai 2001,
ed. Sven BRETFELD und Jens WILKENS, Wiesbaden (Verffentlichungen der Societas Uralo-Altaica, 61),
S. 207-225.
DIETZ

GETHIN 2006
Rupert GETHIN: Mythology as Meditation: From the Mahsudassana Sutta to the Sukhvatlvyha Stra",
Journal of the Pali Text Society 28, S. 63-112.
HARTMANN

1996

Jens-Uwe HARTMANN: Neue Fragmente aus dem Yogalehrbuch"", Festschrift, Dieter Schlingloff zur
Vollendung des 65. Lebensjahres dargebracht von Schlern, Freunden und Kollegen, ed. Friedrich
WILHELM, Reinbek, S. 127-135.
HARTMANN/WILLE

1992

J.-U. HARTMANN, Klaus WILLE: Die nordturkistanischen Sanskrit-Handschriften der Sammlung Hoernle
(Funde buddhistischer Sanskrit-Handschriften, II)", Sanskrit-Texte aus dem buddhistischen Kanon:
Neuentdeckungen und Neueditionen, 2, Gttingen (Sanskrit-Wrterbuch der buddhistischen Texte aus den
Turfan-Funden, Beiheft 4), S. 9-63.
INOKUCHI

1989

INOKUCHI Taijun u.a.: A Catalogue of the Sanskrit Manuscripts Brought from Central Asia by Paul
Pelliot Preserved in the Bibliotheque Nationale, Kyoto.
KLOPPENBORG/POELMEYER

1987

Ria KLOPPENBORG, Roland POELMEYER: Visualizations in Buddhist Meditation", Effigies Dei. Essays on
the History of Religions, ed. Dirk van der PLAS, Leiden etc. (Studies in the History of Religions, 51), S.
83-96.

xvi

Jens-Uwe Hartmann

SCHLINGLOFF 1962/1963
Dieter SCHLINGLOFF: Die Religion des Buddhismus, Bd. III, Berlin (Sammlung Gschen Band 174, 770).
SCHLINGLOFF 1968
Dieter SCHLINGLOFF: Die Buddhastotras des Mtrceta, Faksimilewiedergabe der Handschriften, Berlin
(Abhandlungen der Deutschen Akademie der Wissenschaften zu Berlin 1968, Nr. 2).
SCHLINGLOFF 2003
Dieter SCHLINGLOFF: Mrdhacchidra", Hrin 10, S. 109-124.
SCHMITHAUSEN 1970
Lambert SCHMITHAUSEN: Zu den Rezensionen des Udnavargah", Wiener Zeitschrift fr die Kunde
Sdasiens 14, S. 47-124.
SEYFORT RUEGG 1967

David SEYFORT RUEGG: On a Yoga Treatise in Sanskrit from Qizil", Journal of the American Oriental
Society 87, S. 157-165.
SHT = Sanskrithandschriften aus den Turfanfunden, Teil 1 -9, ed. Ernst WALDSCHMIDT, Lore SANDER,
Klaus WILLE, Wiesbaden/Stuttgart 1965-2004 (Verzeichnis der orientalischen Handschriften in Deutschland X, 1-9).
SKLERV0 2002
Prods Octor SKLRV0: Khotanese Manuscripts from Chinese Turkestan in the British Library, A Complete
Catalogue with Texts and Translations, With Contributions by Ursula Sims-Williams, London (Corpus
Inscriptionum Iranicarum, Part II Inscriptions of the Seleucid and Parthian Periods and of Eastern Iran
and Central Asia, Vol. V: Saka, Texts VI).
SWTF = Sanskrit-Wrterbuch der buddhistischen Texte aus den Turfan-Funden und der kanonischen
Literatur der Sarvstivda-Schule, hrsg. von Heinz BECHERT, bearbeitet von Georg von SlMSON, Michael
SCHMIDT u.a., Bd. Iff., Gttingen 1994ff.
2005
Klaus WILLE: Some recently identified Sanskrit fragments from the Stein and Hoernle collections in the
British Library, London (1)," Annual Report of the International Research Institute for Advanced
Buddhology at Soka University 8, S. 47-79.
WILLE

WILLE 2006a

Klaus WILLE: Some recently identified Sanskrit fragments from the Stein and Hoernle collections in the
British Library, London (2)", The British Library Sanskrit Fragments, vol. I, ed. Seishi KARASHIMA and
Klaus WILLE, Tokyo (Buddhist Manuscripts from Central Asia), S. 27-64.
WILLE 2006b

Klaus WILLE: The Sanskrit Fragments Or. 15003 in the Hoernle Collection", The British Library
Sanskrit Fragments, vol. I, ed. Seishi KARASHIMA and Klaus WILLE, Tokyo (Buddhist Manuscripts from
Central Asia), S. 65-153.
YAMABE 1997
YAMABE Nobuyoshi: New Fragments of the ,Yogalehrbuch"\ Kyushu Kykoku Dankidaigaku Kiy 43,
S. 11-39.
YAMABE 1999

YAMABE Nobuyoshi: The Significance of the ,Yogalehrbuch' for the Investigation into the Origin of
Chinese Meditation Texts", Buddhist Culture 9, S. 1-74.
YL = Dieter SCHLINGLOFF: Ein buddhistisches Yogalehrbuch, Berlin 1964 (Sanskrittexte aus den
Turfanfunden, 7).

DEUTSCHE AKADEMIE DER WISSENSCHAFTEN ZU BERLIN


INSTITUT FR ORIENTFORSCHUNG
VERFFENTLICHUNG NR. 59

Sanskrittexte aus den Turfanfunden


herausgegeben im Auftrage der Akademie von Ernst Waldschmidt

VII

DIETER SCHLINGLOFF

EIN BUDDHISTISCHES
YOGALEHRBUCH
TEXTBAND

AKADEMIE-VERLAG
1964

BERLIN

HERRN PROFESSOR

FRIEDRICH WELLER
ZUM 22.7.1964 GEWIDMET

INHALT

EINLEITUNG
A. Zur Textgeschichte
Fundort und Restauration der Birkenrindenhandschrift Schreibfehler und
Spracheigentmlichkeiten Ergnzende Papierhandschriften

B. Zum Inhalt
Der dogmatische und mythologische Hintergrund Die grundlegenden Meditationserlebnisse und ihre dogmatische Sinngebung Die ethische Haltung . .

26

TEXT UND BERSETZUNG


Vorbemerkungen zum Text

58

I. bung der Hlichkeiten (aubhaprayoga)

59

II. Entfaltung der Atmungsachtsamkeit (rlpnasmrtibhvan)

63

III. bung der Elemente (dhtuprayoga)

85

IV. Betrachtung der Gruppen (skandhaparik#)

96

V. Betrachtung der Bereiche (yatanaparik$)

104

VI. Betrachtung des Entstehens in Abhngigkeit (pratityasamutpdaparlk) 111


VIIX. Die Unermelichkeiten (apramna)
VII. Gte (maitri)
VIII. Mitleid (Jcarun)

115
118
134

IX. Freudigkeit (mudit)

149

X. Gleichmut (upeJcs)

156

XI. Meditationen ber den Buddha, die Lehre, die Gemeinde, die Tugend
und die Gottheiten (buddha-, dharma-, samgha-, sila-, devatnusmrti) . .

173

WRTERVERZEICHNIS

190

ABKRZUNGS- UND LITERATURVERZEICHNIS

256

EINLEITUNG

A. Zur Textgeschichte
Auf der dritten deutschen Turfan''-Expedition 1 berichtete ALBERT VON L E C O Q in einem
Brief vom 8. April 1906 an das Berliner Museum fr Vlkerkunde 2 ber Handschriftenfunde
in der alten Mnchssiedlung bei Kyzil, 36 km nordwestlich von Kutscha:
Bartus3 ist auf eine Bibliothek gestoen, aus der eine Anzahl Birkenrinde-Mss. zu Tage
gekommen sind einige grere Stcke, viele halbe Bltter in brauchbarem Zustande4
zu seinem und unserem groen Kummer fand sich der Boden des kl(einen) Raumes5 und
das aus Stein gehauene Bcherregal6 dicht bedeckt mit dichten Schichten gnzlich vermoderter poihis" meist mit centralasiat(ischer) Brahmi, einige aber auch in Gupta
oder einer zwischen echtem Gupta-Brahmi stehenden bergangsform7 es ist miserabel,
solche Grfte aufdecken zu mssen."
Dieser Brief ist die einzige, aber ganz sichere8 Erwhnung des Fundortes der unserer Text-

Die dritte Deutsche (=- zweite Preuische) Turfan-Expedition (16. Sept. 1905 bis Juni 1907)
veranstaltete in der Umgebung von Kutscha Grabungen in Kumtura, Kyzil und Kirisch.
2
Der Brief ist unter den Akten der deutschen Turfan-Expeditionen im Museum fr Vlkerkunde zu
Berlin aufbewahrt. Ich danke Herrn Dr. HEBBEBT HBTEL, mir die Durcharbeitung dieser Akten
ermglicht zu haben.
3
THEODOB BABTUS, 18571941, der technische Mitarbeiter der Expedition.
4
Diese Angabe bezieht sich wohl auf die rechten und linken Eckstcke der Bltter 130135,148153
u. a., die freilich nicht die Hlfte, sondern weniger als den vierten Teil der Bltter darstellen.
5
Die Reste des ersten und des letzten erhaltenen Blattes der Handschrift (Blatt 170), sowie eine
Anzahl kleiner Fragmente waren zusammengeballt und mit Lehm verschmiert; wahrscheinlich gehren
diese Stcke zu den Teilen der Handschrift, die auf den Boden gefallen und dort durch Feuchtigkeit
der Zerstrung in besonders hohem Mae ausgesetzt waren.
6
GBNWEDEL, Kultsttten, S. 86, erwhnt ein Bcherregal aus Holz in einem Bibliotheksraum in
Kyzil; in Soruq wurden Handschriften in den Fen der Kultbilder gefunden (ebenda, S. 196, 198
u. 208).
7
Zu den verschiedenen Schrift typen der in Berlin aufbewahrten Birkenrindenhandschriften vgl.
SCHLINGLOFF, Birkenrindenhandschriften, S. 122.
8

In dem angefhrten Brief schreibt A. VON L E COQ weiterhin, er habe die Photographic eines Blattes
an Geheimrat PISCHEL gesandt; die Negativplatte dieser Photographie, es handelt sich um Blatt 169
Vorderseite, ist im Museum fr Vlkerkunde erhalten. In einem ebenfalls in den Akten der Turfanexpeditionen aufbewahrten Antwortschreiben an A. VON LECOQ bedankt sich PISCHEL fr die Zusendung der Photographie, ohne aber auf den Inhalt einzugehen.

10

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

edition zugrunde liegenden Birkenrindenhandschrift. Diese entstammt also denselben Mingi" von Kyzil, denen wir die wertvollsten indischen Palmblatthandschriften 1 , sowie eine
beraus groe Zahl zentralasiatischer Papierhandschriften verdanken. Hier in Kyzil blhte
die zum Hinayna gerechnete Mnchsschule der Sarvstivdin. Weiter nach Osten, in
Soruq und in der Umgegend von Turfan, lassen sich neben den Sarvstivdin Anhnger der
Schule der Mlasarvstivdin nachweisen2, die auch mahynistische Texte verbreiteten 3 .
In Kyzil dagegen wurde keine einzige Mahynaschrift gefunden.4 Auch unser Text geht in
seinen dogmatischen und mythologischen Grundlagen nicht ber die bekannten Lehren der
Sarvstivdin hinaus. 5 Um so berraschender ist seine ethische Haltung, die das BodhisatvaIdeal widerspiegelt6, das in den Schriften des Mahyna im Zentrum der Betrachtung steht.
Durch die leichte Brchigkeit der ausgetrockneten Birkenrinde war unsere Handschrift
in zahllose Fragmente zerfallen, die mit den Bruchstcken anderer Birkenrindenhandschriften
vermengt in der Berliner Akademie aufbewahrt wurden. Die Fragmente unterschieden sich
von denen der anderen Handschriften dadurch, da sie nicht in einer Form der indischen
Schrift beschrieben waren, sondern in der durch die Papierhandschriften gelufigen spteren
zentralasiatischen Brhmi. Sie konnten deshalb leicht gesondert und einzeln unter Glas gelegt werden; ihre Zusammensetzung erschien jedoch hoffnungslos, bis dann eine eigentmliche Beobachtung den Schlssel zur Wiederherstellung der Handschrift lieferte: Mehrere
Fragmente lieen sich zu Gruppen zusammenstellen, die sich jeweils in ihrem Aussehen, vor
allem im Verlauf der fr die Birkenrinde charakteristischen dunkleren Luftkanle (Lentizellen) haargenau glichen. Die Hersteller des Handschriftenmaterials hatten also dickere
Rindenstcke von den Birken gelst, diese in der Form der Handschrift zurechtgeschnitten
und dann die einzelnen Lagen der Rinde voneinander getrennt 7 , wodurch sie aus einem Stck
manchmal bis zu sechs Bltter gewannen.8 Um die Handschrift zusammenzusetzen, gengte

Vgl. LDEBS, Buddh. Dramen, S. 1; Kalpanmanditik, S. 1; Das Zeichen fr 70, S. 121 ( = Phil.
Ind., S. 723-724); Ktantra und Kaumralta, S. 502 ( = Phil. Ind., S. 681); Das riputraprakarana,
S. 388 ( = Phil. Ind., S. 191); SCHLINGLOFF, Chandoviciti, S. 10, Anm. 1-3.
2
Fragmente aus dem Vinaya der Mlasarvstivdins fanden sich in Sngim, 36 km stlich von
Turfan; vgl. HRTEL, Karmavcan, S. 502ff.; ROSEK, Vinaya vibhahga, S. 230ff,; dazu kommen eine
Reihe bisher unpublizierter Fragmente aus derselben Gegend. Zu vergleichen sind auch die Inschriften
ber den Pranidhi-Bildern im neunten Tempel von Bzklik bei Murtuq, die nach HTJBER, fitudes
bouddhiques, S. 11, ebenfalls dem Vinaya der Mlasarvstivdins entstammen.
3
So fanden sich in Soruq Fragmente des DaSabhmihastra (Katalog-Nr. 507) und anderer mahynistischer Stras. Aus Sorcuq stammt auch die Handschrift einer Prajnpramit (vorl. Katalog-Nr. 1)
in lterer Schrift im Groformat (Hhe 24,5 cm!); in Turfan wurden gedruckte Bltter der SatasaJiasrik Prajnpramit (ebenfalls im Groformat: 65 x 19,3 cm) gefunden.
4
Vgl. auch SCHLINGLOFF, Buddh. Stotras, S. 16: Bemerkenswert ist, da das (R)hulastava, das
einen stark mahynistischen Charakter zeigt, sich in keiner der in Kyzil gefundenen Handschriften
findet." Ebenso ist das Gunparyantastotra nur in Soruq belegt; s. ebenda S. 5 Anm. 1 u. S. 21 (Katalog-Nr. 1246).
5
Vgl. zur Dogmatik unten, S. 26ff., sowie die Vorbemerkungen zu den einzelnen Kapiteln; zum
mythologischen Weltbild vgl. unten S. 31 ff.
6
Vgl. unten S. 54ff.
7
Nur in einem Falle (Blatt 12226) wurden die Lagen erst voneinander gelst und dann die Bltter
einzeln zurechtgeschnitten.
8
Jeweils folgende Bltter stammen von dem gleichen Rindenstck: 115; 11617; 118; 119; 120;
121; 122-26; 127; 128-31; 132-36; 137-39; 140-43; 144-47; 148-51; 152-53; 154-56; 157; 158-63;
164; 165-69 (auer 166); 170.

Einleitung

A. Zur Textgeschichte

11

es also, da ein Blatt einer Gruppe hinreichend bestimmt war; es lieen sich dann auch kleine
und kleinste Fragmente der brigen Bltter dieser Gruppe nach ihrer [Lage im Blatt genau festlegen und dadurch oft lckenlos aneinanderpassen. Die Aufeinanderfolge der Bltter konnte
dann durch Spuren von Schriftabdrcken sicher bestimmt werden.1 So war es mglich, im
Laufe der Zeit mit geringen Ausnahmen alle Bruchstcke, die zu unserem Text gehren, zu
bestimmen und zu ordnen.2 Hatte ich jedoch anfangs gehofft, auf diese Weise die Handschrift
vollstndig wiederzugewinnen, mute ich bald zu meiner Enttuschung sehen, da sich zwar
eine Anzahl von Blttern aus vielen Fragmenten zusammensetzen lie3, andere Bltter aber

1
Auf einigen Blttern sind die Abdrcke so deutlich, da sich die Schrift mit einem Spiegel lesen
lt. Leider finden sich fast nur Abdrcke solcher Blattstcke, die selbst erhalten sind; der Abdruck
wird also erst nach der ersten Zerstrung der Handschrift whrend der jahrhundertelangen aufeinandergepreten Lage erfolgt sein.
2
Diese Arbeit war um so schwieriger, als die Bearbeitung der Fragmente ihrer auerordentlichen
Brchigkeit wegen nur zwischen gerahmten Glasplatten vorgenommen werden konnte. Bei der Identifizierung mute auch bei kleinsten Fragmenten jedesmal eine neue Rahmung des Blattes durchgefhrt
werden, bei welcher oft die vorher eingeordneten Fragmente vllig durcheinanderfielen. Bei dieser
langwierigen Arbeit konnte ich mich der Hilfe meiner Frau erfreuen; ihrer Geduld und Geschicklichkeit ist die Identifizierung zahlreicher Fragmente zu verdanken.
Es ist unmglich, im einzelnen ber die Kriterien, die zur Bestimmung der Bltter gefhrt haben,
Rechenschaft zu geben. An dem Beispiel der Bltter 115127 sei hier das Zusammenwirken verschiedener Methoden zur Bestimmung der Blattzusammengehrigkeit gezeigt:
Die erste sicher erhaltene Blattzahl ist die des Blattes 128; durch die gleichen Bruchstellen ist ein
weiteres Blatt als 127 festgelegt. Drei rechte Eckstcke zeigen die gleichen Bruchformen wie die rechten
Eckstcke der Bltter 127 und 128; es handelt sich also um die Bltter 124, 125, 126, deren Aufeinanderfolge durch Spuren von Schriftabdrcken sichergestellt ist. Diese drei Bltter sind aus demselben
Rindenstck geschnitten, zu dem auch noch kleine Fragmente zweier weiterer Bltter, der Bltter 122
und 123 also, gehren. Ihre Aufeinanderfolge ist nur aus dem Inhalt zu bestimmen: die Kategorie
(sarvak)yapratisam(vedanym) auf der Rckseite des einen Fragmentes geht der Kategorie (p)r(a)srabdhakayasamsk(ratayam) auf der Vorderseite des anderen Blattes voraus (vgl. S. 65). Um die vorhergehenden Bltter zu bestimmen, mssen wir von der Beobachtung ausgehen, da alle Blattzahlen
des ersten Teiles unserer Handschrift auf der helleren, am Stamm der Birke nach auen gekehrten
Seite der Bltter stehen; im zweiten Teil ist umgekehrt die dunklere Seite die Rckseite mit der Blattzhlung. Nun trgt das erste Blatt, das zu dem Kapitel ber die Entfaltung der Atmungsachtsamkeit
gehrt, die Blattzahl 11[8] oder 11[9~\ noch auf der hellen Seite. Auerdem fanden sich zwei kleine linke
Eckstcke, die gleichmig gebrochen sind, also aufeinandergelegen haben. Auf beiden Blttern ist von
der Blattzahl nur das Zeichen fr 100 erhalten, und zwar auf dem einen Blatt auf der hellen Seite wie im
ersten, auf dem anderen Blatt auf der dunklen Seite wie im zweiten Teil der Handschrift. Dieses zweite
Blatt bringt also den Wechsel der Blattzhlung von der hellen zur dunklen Seite der Bltter. Da diese
beiden linken Eckstcke keine Fortsetzung des Textes der rechten Eckstcke von Bl. 122ff. enthalten,
knnen sie also nur zu den Blttern 119, 120 oder 120, 121 gehren. Inhaltlich gehren zu dem Kapitel
aber noch zwei groe Fragmente eines Blattes, die nach ihrer Lage zu keinem der bisher behandelten
Bltter gehren knnen; es mu sich also um Reste des 121. Blattes handeln. Damit sind die beiden
linken Eckstcke als Bl. 1(19) und 1(20) und das erste Blatt des Kapitels als 11[8] bestimmt. Zu dem
vorhergehenden Kapitel der Hlichkeiten gehren drei Fragmente von verschiedenen Blttern, von
denen zwei auf einander liegende Stcke zwar nicht von demselben Rindenstck, aber von der Rinde
desselben Baumes wie Blatt 11[8] stammen. Da das hintere der beiden Fragmente auch inhaltlich an
den Schlu der bung gehrt, kann man mit einiger Sicherheit annehmen, da die beiden Stcke zu
Blatt 116 und 117 gehren. Aus der Parallelhandschrift 458 (vgl. S. 12f.) lt sich berechnen, da der
Text in unserer Handschrift kaum vor dem 114. Blatt begonnen haben kann. Das dritte zu dieser bung
gehrende Fragment stammt also wahrscheinlich aus dem 115. Blatt.
3
Von folgenden Blttern sind die Blattzahlen ganz oder teilweise erhalten: 11[8], 1(19), 1(20),

[1](27), 128, 129, 130, (1)31, 1(36), (1)[4]2, (1)43, [1]44, 146, [1](47), 148, 1[49], 1(50), [1]52, 1(58)9
[15](9), 160, 161, 162, 1[6](5), 166, 167, 169.

12

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

nur durch wenige Fragmente vertreten sind.1 Insgesamt ist etwa 42% unseres Textes erhalten 2 ; ob die anderen Stcke der Handschrift schon vor dem Eintreffen der Expedition
verschleppt, oder ob sie so zerstrt waren, da die Expeditionsteilnehmer die Mitnahme der
kleinen Fragmente fr zwecklos hielten, bleibt ungewi. Die Lcken lassen sich jedoch soweit
berbrcken, da wir ein einigermaen getreues Bild des Inhaltes der Handschrift gewinnen
knnen.
Bei der Durchsicht der Fragmente zeigte sich sehr bald, da die Handschrift zwei Texte
enthielt, die in ihrer Diktion so verschieden voneinander sind, da sich auch kleine Bruchstcke mit Sicherheit dem ersten oder dem zweiten Text zuordnen lassen. Die beiden Werke wurden wohl nur deshalb in einer Handschrift vereinigt, weil sie beide denYoga zum Thema haben.
Im Gegensatz zu dem zweiten Text behandelt der erste dieses Thema aber rein theoretisch:
philosophische Lehrstze (Stras) werden kommentiert. Die Herausgabe dieses Werkes,
dessen Name Yogavidhi in mehreren Kolophonen belegt ist, bleibt einer gesonderten Publikation vorbehalten. 3 Der Yogavidhi endet in unserer Handschrift etwa auf dem 114. Blatt. 4
Der anschlieende Text, der die folgenden Bltter bis zum Ende der Handschrift kurz nach
dem 170. Blatt umfat, ist in der vorliegenden Publikation bearbeitet.

Um die grtmgliche Treue gegenber dem handschriftlichen Befund zu wahren, ist


dieser Text sowohl in der Textwiedergabe, als auch im Wrterverzeichnis und in den Anmerkungen mit all seinen Schreibfehlern und Schreibeigenheiten genau wiedergegeben. Wir
mssen uns dabei vor Augen halten, da dieses uns vorliegende Textbild nur das zufllig
erhaltene Glied einer langen schriftlichen berlieferungskette ist. Es vereint in sich Elemente
verschiedenster Herkunft: die Sprache der Verfasser und der mndlichen Tradition; die
Sprache, das Textverstndnis und die Gestaltungstendenzen der verschiedenen Schreiberschulen und -generationen. Eine einzige fragmentarisch erhaltene Handschrift reicht freilich
nicht aus, um die Textgeschichte von ihren Ursprngen an zu rekonstruieren; einige Hauptlinien lassen sich jedoch sicher nachzeichnen.
Unser Werk ist in klassischem Sanskrit abgefat; der uns vorliegende Text ist jedoch von
zahlreichen Fehlern und Versten gegen die Regeln der Grammatiker durchsetzt. Unter den
Fehlern sind die falsch g e s c h r i e b e n e n K o n s o n a n t e n von besonderem Interesse:
t statt n:
tirudhyala 147V4;
abahumatt 156V6;
paramrsat\ 134V3;
Vsampannat] 131R4.
n statt t:
jvalinan 134V3.

t statt d:
trsyamnte 162V 5;
prasvsat v 127V1.
d statt t:
amdarmukha 121V 6.
tm statt nm:
anyajtmikam 158R5.

ty statt ny:
yogavitysa 147V4.
dhy statt ty:
blacaritaradhy(u)pek(?)a
159V 6.
ndh statt ddh:
upanibandha0 153V5, 155R2.

1
Der gesamte Text, sein Umfang betrgt etwa 70% der Lnge des Mahaparinirvanasutra, umfate ca. 40000 Aks.; davon sind ca. 17000 Aks. erhalten. Die Zahl der zu dem ersten Text (Bl. 1-114)
erhaltenen Fragmente ist geringer, so da von der gesamten Handschrift etwas weniger als der vierte
Teil erhalten ist.
2
Schwerwiegende Lcken enthalten besonders die Kapitel I ,,bung der Hlichkeiten", VI Btrachtung des Entstehens in Abhngigkeit" und VII Gte".
3

Vgl. SCHLINGLOFF, Yogavidhi, S. 146 ff.

Vgl. S. 11, Anm. 2 unten.

Einleitung
s statt g:
(k)tsrai 165R4.
pt statt sth:
pdmgupte 136R6.
t statt v:
tarne 152V3;

A. Zur Textgeschichte

tejastino 163V1;
tathaita 134R1.
v statt t:
svsvirnaparyamkas 143R4.
v statt d:
vtyamandalo 124V2.

13
v statt p:
yugavac 146E3;
svandamnam 133V1.
p statt m:
paranpanayanam 144R5.
fi statt n:
sarvahy asuci0 130V1.

Die Liste zeigt, da die verwechselten Konsonanten in den meisten Fllen keine hnlichkeit in ihrem Lautwert aufweisen. In Ostturkistan wurden liturgische Texte nach der Rezitation oder dem Gedchtnis aufgezeichnet und enthalten deshalb Ton- und Aspirationsfehler.1 Dagegen liegen in unserem Text reine Abschreibefehler vor. Die Aksaras t ( ^ ) , n (fr)

) stehen sich tatschlich in ihrem Schriftbild so nahe, da die Mglichkeit der Verwechselung bei einer schlecht geschriebenen Vorlage auf der Hand liegt. Auffllig ist dagegen
die viermal belegte Verwechselung der ganz unhnlichen Aksaras t (fi) und v i^f).
Sie erklrt sich aber sofort, wenn wir nicht die Schrift unseres Texts, sondern die ltere
indische Guptaschrift zugrunde legen 2 ; hier bedarf es nur eines kleinen dunkleren Fleckens
im Schreibmaterial, um ein t ( ^ ) ganz wie ein v ( J ) aussehen zu lassen. Auch p (t)
und m (t) sehen sich in der Guptaschrift zum Verwechseln hnlich: %(-$/, ebenso
h ( 0 ) und n (fjjfr): 2$f)Q. Wir werden also zu dem Schlu gefhrt, da ein Schreiber
unseren Text von einer Vorlage in Guptaschrif t, also wohl von einer lteren indischen Handschrift, abgeschrieben hat.
Dies ist vielleicht auch eine Erklrung fr die eigenartige Tatsache, da unser Text, als
einziger in zentralasiatischer Brhmi geschriebener Sanskrittext 3 , nicht auf dem blichen
Papier, sondern auf Birkenrinde geschrieben wurde: Birkenrinde war, neben Palmblttern,
der Beschreibstoff indischer Handschriften, also wohl auch der Vorlage unserer Textabschrift,
und der Abschreiber wollte diese Vorlage in ihrem Material nachahmen. Solche antiquierenden Neigungen lassen sich auch bei manchen Papierhandschriften beobachten, die die Form
indischer Palmbltter getreu kopieren.4
Die nicht immer leichte Lesbarkeit der lteren Vorlage wird viel zu der fehlerhaften berlieferung unseres Textes beigetragen haben. Insbesondere werden zahlreiche A u s l a s s u n g e n
von Aksaras oder Aksarateilen darauf beruhen, da der Schreiber die betreffende Stelle nicht
mehr entziffern konnte (Ausgelassene Buchstaben sind in Fettdruck eingefgt):
1

Vgl. etwa die Fehlerliste in SCHLINGLOFF, Buddh. Stotras, S. 17.


Die zum Vergleich herangezogenen Aksaras entstammen der Handschrift Katalog-Nr. 545, einer
Palmblatthandschrift aus Kyzil, die kanonische Stras, poetische Straerklrungen, Schenkungsformulare u. a. zum Inhalt hat.
3
Hier ist noch die Bilingue Tocharisch-Sanskrit zu nennen; vgl. SCHLINGLOFF, Birkenrindenhandschriften, S. 127. Die zu dieser Handschrift verwendete Rinde unterscheidet sich durch ihre Dicke und
Festigkeit wesentlich von der sonst gebruchlichen Birkenrinde.
4
Vgl. WALDSCHMIDT, Kleine Brhmi-Schriftrolle, S. 17, Anm. 1: Die von der 3. Turfan-Expedition
im Rotkuppelraum der Ming-i von Kyzil bei Kuca gefundene Handschrift 534
entspricht im
Format also ungefhr einer Palmblatthandschrift"; SCHLINGLOFF, Buddh. Stotras, S. 21 (Hs. 1246):
Die Lnge der Bltter war 18,4 cm, die Hhe durchschnittlich 3,5 cm, nach rechts schmaler werdend.'^!) Auch Leder als Beschreibstoff wurde in der Form der Palmbltter geschnitten; vgl. LDERS,
Medizinische Sanskrittexte, S. 157 ( = Phil. Ind., S. 586): ,,Die Form, die man den Lederhandschriften
gegeben hat, ist jedenfalls indisch; das Palmblatt ist das Vorbild gewesen."
2

14

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(a)stanakhaprabhabhih 144R1; (kr)tv 141R2; blacari(ta)ratyupeksa 158R5; praticch(ad)eyam


149V 2; yata(na)citni 136V2; pratyutpamn(n)pnasmrtibhavan 128V 4; pratisthit{ni) 127V3;
vajrasana(ni) (statt sanni) 165V3; sauvarna(ni) (statt varnni) 151V4; u(pa)samayamti 141R5;
u(pa)ri 146V1; a(hhi)samksipte 146V3; daksina(y)m (statt daksinym) 142R4; asra(ye) 127V6;
ktgrai(r a)va 159R3; Okosthg(r)ais 132V5; candramanda(la)cit 152R1; a(va)tisthate 130R4;
(va)straprvrta 148V4; (niru)padhise(se) 164R4; ams(d) budbuda0 132R4; putrakava(t) sta~
nesu 145R4; mrdh(n) 135V1; (ca)tu{r)varnc 146R5.

In 141R2 hat der Schreiber die Unleserlichkeit seiner Vorlage dadurch angedeutet, da er
den Raum fr das fehlende Aksara kr zwischen (cittopaniba)ndham und tv cimtayati freigelassen hat 1 ; andere Auslassungen, wie die des ye von sraye am Blattende von 126V mgen
auf Unachtsamkeit beruhen. Das n in pratyutpamn(na)pnasmrtibhvan kann vielleicht
von dem Schreiber, der das doppelte nn seiner Vorlage fr ein Versehen hielt, bewut ausgelassen worden sein; wir werden solchen bewuten Korrekturen der Vorlage noch mehrfach
begegnen.2 In diesem Zusammenhang ist die fehlende D o p p e l k o n s o n a n z 3 zu nennen:
kuhutyndavad 137V1; tusitabhavan cyava0 164R1; nimajamnam 125R3;
nisanam 131R5; odriyamnam 125R4; vas duscarita 158R1.

bhavisyajagat 150R2;

In den lteren ostturkistanischen Handschriften findet sich hufig eine K o n s o n a n t e n v e r d o p p e l u n g in Verbindung mit r 4 . In jngeren Handschriften wird meist auf diese verzichtet ; auch unser Text hat sie unterdrckt, mit einigen wenigen Ausnahmen:
attra 118V 6; tattra 121R4; *sttvam 138R1.

Wahrscheinlich hat der Schreiber diese Doppelschreibung in seiner Vorlage vorgefunden


und bei der Abschrift in den meisten Fllen getilgt, wobei er, in Verkennung ihrer Bedeutung,
auch die Doppelkonsonanz in ^oddriyamnam und vielleicht auch in den anderen angefhrten
Worten unterdrckt hat.
Neben den Auslassungen finden wir an einigen Stellen Z u s t z e von Silben oder Buchstaben :
bhagavmgopeksa 160V1; nirgaechatya 135V1; budbudacittnm 132R6; vaidryabhjanacitto
169R3; jvalair baddham 170V2; tadupeksdosansya 156V3.

Diese Zustze werfen ein bezeichnendes Licht auf die Fhigkeiten der ostturkistanischen
Schreiber, die vielleicht wie die Maler gar keine Mnche, sondern im Auftrage der Klster arbeitende^Handwerker waren 5 : Neben den fr die Gestaltung des Schriftbildes wichtigen grammatischen Regeln haben sie Kenntnis von einigen Sanskritwrtern, wie bhagavm, upeks, citta,
gacchati, jvla. Sie fhlen sich berechtigt, mit diesen Kenntnissen Textverbesserungen vorzunehmen ; da ihnen dabei das Verstndnis des Sinnzusammenhanges vllig abgeht, zeigt vor
1

Dieselbe Erscheinung findet sich in einer Papierhandschrift grammatischen Inhaltes aus Soruq;
vgl. SIEG, Neue Bruchstcke der Sanskritgrammatik, S. 6: Die Auslassung von Zeichen ist brigens
mehrfach in diesem Manuskript zu konstatieren, und zwar handelt es sich dabei um absichtlich ausgelassene, wie der dafr freigelassene Raum beweist."
2
Siehe unten.
3
Die im klassischen Sanskrit geforderte Doppelkonsonanz in sattva findet sich in buddhistischen
Texten nur in den Gilgit-Mss. In allen anderen Handschriften ist nur satva (auch in bodhisatva) belegt.
4
Vgl. WALDSCHMIDT, Bhiksuni-Prtimoksa, S. 19: Der Schreiber des lteren Manuskriptes Pa
pflegt Konsonanten in Verbindung mit r zu doppeln." Vgl. auch SIEG, Neue Bruchstcke der Sanskritgrammatik, S. 6; WEKLER, Jtakaml, S. 12f.; SCHLINGLOFF, Chandoviciti, S. 12 u. Anm. 1; HBTEL,
Karmavcan, S. 21, 5.
5
Oft finden sich in den Sanskrithandschriften zwischen den Zeilen Verbesserungen, Zustze und
anderssprachige Erklrungen, die von lesenden Mnchen stammen und sich, wie die Klosterrechnungen,
durch eine kursivere, nachlssige Schreibweise von dem zwar fehlerhaften, aber kalligraphisch einwandfreien Schriftbild der Handschriften unterscheiden.

Einleitung

A. Zur Textgeschichte

15

allem das Miverstndnis bhavmgopeks als bhagavm-gopeksa.1 bhavmgopeks ist berdies,


ebenso wie nirgatya, -cita und tadapeksadosansya mehrfach belegt.

Neben den Fehlerquellen, die in der Unleerlichkeit der Vorlage und in der Nachlssigkeit
des Schreibers liegen, haben wir also mit verunglckten Textkorrekturen zu rechnen. Dies
gilt auch fr die hufigen Irrtmer in der Vokalquantitt 2 :
0 statt :
Q

aditya 126V5; alambanP 145V 6; asvdsa0 118R2; akasaP 118V 4; kasa 129V'5, 129R2; anagate0143R1, 153R5; Oavbhasitam 169V 2; karunyasya 150V5; dharino 146R2; narakm 149R2;
nnacitni 153R6; santam 121R5, 139V4; pravahh 135R1; prakraP 144R3; bhagasas 160R2;
bhajane 124V'5; manasikaro 153V1; sariraP 147R6, 148V'2, 148V5; aghanistha 146V 2; anamta
127R5; ankura 121V 4; apara 151R3; alambana 153V3; upeksa 158R5, 159V6, 159R4, 160V1;
oktas 147V4; *kirna 167R2; gata 154R6; Ueval54V5; Uharah 160R3; nirgata 145R4; cara
153V3; Opaksa 147R3; Oprna 135V2; buddha 133R2; bhajana 166R3; OmuktaP 136V 5; *yoga
147R3; bhvayamta 129R4; vajrsana 165V3; Harna 155R4; varta 147R3; Hityasa 147V4 \
vedanaP 132V 4; vymisra 115R3; sveta 165V 4; sarva 146R3; satva 135R5; samudra 131V 2;
siktah 145V 5; hasta 165V6; samudra 131V 2; bhagavan 159V4; mrdhna 165R3; nbhyah
152V 2; prnam 130R3; sukhitam 153R5; spandamnam 131R3: gatany0 169R2; Hvrany
143R6; sunyani 134R2; prahinanam 127V1; satvanam 159R6; sthananm 162V 3; (pariksa)mansya 159V6; grhyamana 147R3; avatrpyadhipati0 159V1; raksadhi0 143V 2; citasrayah 165V4; buddhasraP 164V 4; dharmanu0 165R5; yogcrasrayam 135R2; vajrasanesu
144V 6; satvasatva0 169V2; suvarnabhni 153R5; ^hitadhysaya0 145V 6; gunenanaP 143R1;
camtah 160R5; cakasa0 118V 4; caprati 147V 6; casya 128V 3, 153V6; padyabhio 146V 3.

statt a:
avbhasitam 169V 2; ankura 121V4; ^nmtaram 136R2; abdhtuh 160V 3, 160V 6; ^anadi^ 137V1;
MambanP 157V2; ^avsyya^ 131R3; ^panayanP 153V1; enjne 126R5; kpalam 137V 3;
rjasy 129V 4; ndya 168R2; paripavanvac0 136V3; syinm 160V4; smanamta(ra)m 153R5;
sraym 130R2; ogatm 161V1; (balada)rakm 125R3; bodhisatvmP 164V 6; %uddhm 128V5;
mtrm 155V 5; %arsam 152V6; sasanam 154R3; saktm 127R2; Oatmanm 170V 2; mrdhanm 128R5; bhagavmmukh0 159R5; Qprabhaya 144V 6, 144R1; nirgatya 135V1; mansya
159V6; paiyatsP 132V 4; ^srotobhyas^ 153R5; <>cah 128V 2; adhs 136V2, 150R6; Hv 133V5;
tatrl36R3; na 161V 5.

1 statt i:
^asivisP 158V5; QpariksP 133V4;
164V6; HtdlaP 128V2.

pariksa0

U8R5;

pratitya<> 159V6;

pradip

136V3; <hAryaP

l statt i :
Oadhimtram 155V 5; ^abhlmukhi 158R2; (aka)likah 165R6; ^cchxdrl 136V4; tlryak 118V1, 145 R5,
146R1, 169V 6; duhkhita0 153V1; pldxtah 158V 4; puskirini 136V 2; bilm 160V 2; (v)isiryate
130V 3; mudltP 153R3; saktinam 157 Rl.

u statt u:
rupa 132V 3, 132R5, 146V 4, 153V 3, 154V1, 159R69 160R4, 160R6, 162R19 162R6, 169V1; rupinah
134V 2, 144V 3; HunyaP 129V3, 129V 4, 130V6, 134R2, 136V 5, 160R4; <>adMrudhaP 136R1, 144V3,
153R6, 150R6, 159R1, 165V4, 165V5; uruh 116V'5; urdhvaP 129R6, 136V 2, 136R1; duri 157R4;
purayo 130R2, 133R4, 146V 2; vaiduryaP 144V 4, 144V'5, 169R3; osuryao 124R4; %pagudham
153R6; QdhtumV 129R5, 160V 6; vyun 118V 2.

statt u:
%chrtv 128R2; OpursaP 136V 2, 137R3; ^rdhiraP 135V 6; ^pahatam 147R6;
1

utpadyate 144V 4.

Spter wurde das ga mit einem dnnen Strich durchgestrichen; diese Korrektur stammt wohl von
einem Leser, nicht von dem Schreiber der Handschrift, denn die Schreiber pflegen Streichungen durch
eine punktierte Linie anzudeuten.
2
Die Unsicherheit gegenber Lngen und Krzen der Vokale ist deshalb besonders gro, weil die
Quantitt, anders als in liturgischen Texten, durch kein metrisches Schema festgelegt war. Das Gefhl
fr den Wortsinn ging frher verloren als das fr den Wortrhythmus.

^g

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

e statt ai, o statt au:


OJcter0 162B2; vyo 136B5; ponahpunyena 122V3.
au statt ai:
"nihsrtaurQ 151E4.
u statt a:
gurudcfl 130V3.
Viele Fehler der Liste werden lediglich auf der Nachlssigkeit des Schreibers beruhen;
falsche Kasusbildungen knnen absichtliche nderungen aus grammatischem Miverstndnis
sein. Bemerkenswert sind die Krzen in buddhistischen Fachausdrcken, die vielleicht auf
eine berlieferte prkritische Aussprache zurckzufhren sind. Hierher gehren die Schreibungen santa (Pli santa), sunya (P. sunna)1, parihs (P. parikhha), pratitya (P. paticca),
virya (P. viriya) und urdhva (P. uddha).2
In der folgenden Liste sind die Flle der D e h n u n g eines kurzen a im Kompositum am
Ende eines Wortes zusammengestellt. Diese Dehnung, die in unserem wie auch in anderen
ostturkistanischen Texten hufig belegt ist 3 , ist kein Schreiberversehen, sondern eine Spracheigentmlichkeit, die sich schon im Veda findet4 und wohl in indogermanische Zeit zurckgeht*:
vajrmayah 144V5; Ovsdeva0 152B2; samvarvijnapti 169V3; satvsamudrah 148V2; satvhita0 145V 6; sukhvedan0 158R1; sthannirvedhaP 128R2; srutsram 136V'S; hrdaydvrain0
141B4, 143R6; apeksdosa 159V 3; avacaradevparivrto 147V1; yatandvrany0 157B4; Oottarvibhgena 166B1; kmrp 147V1; OkyasamskraP 118V 5; grhitasuvarna0 151B6; damdpadmni 144V1; duhkhsukhym 158V 3; putnirbhjanaP 133V3; madhysthm 157V1; omukhnihsrtairQ 159B5; ratnbhajanam 130B2; nUabhmuktahar<> 127V6; prnvaidrya 169B3.
Wenden wir uns nunmehr der Betrachtung des Satz s a n d h i zu, mssen wir von einer
Regel des buddhistischen Sanskritgrammatikers Kumralta ausgehen, nach der ein Vokal
am Ende eines Wortes um der Deutlichkeit des Sinnes willen unverndert gelassen werden
kann. 6 Dementsprechend ist auch in unserem Text, wie in anderen buddhistischenSanskrit-

unya ist die gebruchliche Schreibung der Handschriften; iunya findet sich, auer in Matrcetas
Satapaiicsatka, nirgends. Vgl. zu dieser Schreibung LDEBS, in HOER:NXE, Manuskript Remains
253a i (SdhP.), S. 156: "and others, such as dunyn,
may be imperfect and incorrect Sanskrit
renderings of Prakrit forms, due, not to a mistake of the scribe, but to the ignorance of the author of
the text."
2
Auffllig ist die hufige Kurzschreibung von rupa, rupin. Man knnte hierbei an tocharischen
Einflu denken (Toch. A: rup, B aber: rpi). Die Schreibungpurusa ist in ostturkistanischen Sanskrithandschriften mehrfach belegt; s. WALDSCHMIDT, Mahvadnastra I, S. 52 (132, 3); S. 51, Anm. 9:
Das Manuskript schreibt fast berall pursa an Stelle von puru$a"; Zum ersten buddhistischen
Konzil, S. 823 (M147(2), VI).
3
Vgl. etwa WALDSCHMIDT, Mahparinirvnastra I, S. 18 (32,1): dvaidhnirayena; S. 20 (35,5):
andhakratamisr; Catusparisatstra I, S. 43 (80,3): rgrakts; (80,4): alparajaskajtiyh; S. 59
(149,3): (k)rbhogena; Mahvadnastra, S. 18 (14,2): sryacandramasv; S. 41 (79,4): dharmaniymakovid; S. 49 (116,5): suukladamstro; S. 51 (124,4): rjadhnym.
4
WACKERNAGEL, Altindische Grammatik, II, S. 130ff.
& Ebenda, S. 133.
6
LUDERS, Ktantra und Kaumralta, S. 42 ( = Phil. Ind. S. 702) ergnzt und bersetzt den Text
folgendermaen: v(rttrsayor v)rthavyakt(y)apek?ay ca9 In metrischen Texten, in der Sprache der
Rsis und mit Rcksicht auf die Deutlichkeit des Sinnes (bleibt ein auslautender Vokal) beliebig (unverndert)". Vgl. WALDSCHMIDT, Stra 25 of the Nidnasamyukta, S. 574, Anm. 1.

Einleitung

A. Zur Textgeschichte

17

texten1, der H i a t hufig nicht vermieden:


ca anamtam 150R5; ca apanita0 145R5; ca abhraktair 161R1; Hasya (adhi)pati0 147V2; sayasya apramna0 145R1; rasena sraym 130R2; samksipya sray(t) 123V1; yogcrasra0 127V6;
eva asvsaP 121R6; Qksena iti 143R3; ca upadese 128R2; prvrta tpadyate 148V4; iva upa
128V2; csya upeksa 158V3; bhvena eva 154V2; esa eva 159R5; drstv adhi0 150R4; iyat
a(na)gataP 128V6; bhitv apayaP 146R6; <>y apra0 145V6; esa apra0 145V'6; tath amitre 140V2;
Harna avadata0 161V2; bh() av{a)d{)ta 148V4; bhitv (kasat) 135R3; bhitv p 129R2;
irsyarati0 152R6; pravisat iti 118V3; peks tpadyate 161V2; c(i)t utpadyat(e) 167V4; esa
upasama0 136R1; sthit upeksa0 16IV3; ti abhi0 160R3; ti asvasatah 127R2; naksatran(i
i)st{a) 157V5; upari uru 128V5; mrduni evam 140V2-, nadl (srayam) 151R6/152V1; rpt
amtahP 127Rl; stri avadata0 162V6; stri utpadyat(e) 155R4; tesu ditya0 166R3; sraye anityam
136R2; ime abhyudayikena 154V5; sve sane 149R6.
An zwei Stellen sind die aufeinanderstoenden Vokale zustzlich durch ein Satzzeichen
getrennt:
tatra ca\swi(s) 129V5; m(ai)trnusaren\ upeksa 161V5.
Im ersten Falle ist das Trennungszeichen ein einfacher Punkt (*), wie er sich hufig am Satzende findet, im zweiten ein Doppelpunkt ( | ) , also das Zeichen fr den Visarga. Die hufige
Verwechselung beider Zeichen in unserem Text weist darauf hin, da der Visarga von den
Schreibern weitgehend als ein reines Wort- oder Satztrennzeichen aufgefat wurde. In dieser
Verwendung findet sich auch in anderen ostturkistanischen Sanskrittexten statt eines besonderen Satzzeichens oft der Visarga, unter Nichtbeachtung der Sandhiregeln, am Ende eines
Satzes, Halbverses oder sonstigen Sinnabschnittes. 2 Eine auffallende Besonderheit unseres
Textes ist, da der Visarga in dieser Funktion in das Innere des Satzgefges gedrungen ist;
die Wrter stehen also, mit V i s a r g a (oder einfachem Punkt) im A u s l a u t , ohne Beachtung
der Sandhiregeln, nebeneinander:
Auslautendes -ah3:
ksobhah agni0 16IV4; gajah ag(ra) 125V5; gatah a(ghan)i{sth)m 148V5; srotasah adhipati0
169V3; pravhah adho 152V1; sabdah anamta0 161R3; vrksah anamtam 131R5; (vrksa)h
anamt 127V2; Qraddhah angata0 158V5; bhagavamtah aneka0 127R5; varsah amta 169R2;
samudrah abhi0 153R1; nirgatah abhra0 143V1; virahah ayam 160R1; bhyah alta0 149R5;
svasatah avadata0 127V4; karmanah avasthita0 130R4; cetasah astau 148R5; vicaray{a)t(a)h

Zu der ostturkistanischen Schreibweise vgl. etwa WALDSCHMIDT, Mahparinirvanastra I, S. 7,


Anm. 1: Hufigkeit von Hiaten, insbesondere Vermeiden der Ausstoung von a privativum; vielfach
sind die Sandhiregeln dort nicht befolgt, wo eine Interpunktion zu erwarten wre". ber den Hiat in
anderen buddhistischen Sanskrittexten schreibt EDGERTON (BHSG 4.55): "In seperate words hiatus
is equally common in verses everywhere, and in prose of some texts, especially Mv, but also LY. In the
prose of most texts it is rare, probably owing to Sanskritization in the course of tradition."
2
Die korrekte Schreibung -h\ ( J ** ) findet sich in den Handschriften nur selten.
3
BECHEBT, "ber eine abweichende Regelung des vokalischen Sandhi im Sanskrit, S. 62, stellt auf
Grund publizierter ostturkistanischer Sanskrittexte folgende Regel auf: Auslautendes o aus as vor
anlautendem a- wird hufig zu -a, wobei das anlautende a- erhalten bleibt." Die Schreibung -ah a- dagegen erklrt BECHERT als sekundre Schreibernderung, da sich z. B. in der Handschrift S. 360 (CPS
und MAV) 26mal -a a- gegen nur 5mal -ah a- findet. In unserem Text dagegen liegen die Verhltnisse
ganz anders: -ah a- lt sich 19mal nachweisen, -a a- dagegen berhaupt nicht. Die Zusammenstellung
mit den brigen Fllen von Visarga im Auslaut zeigt deutlich, da die Schreibung -ah die primre ist,
auch in den unten (S. 18f.) angefhrten Fllen der Auslassung des Visargazeichens. Auch fr die
ostturkistanischen Sanskrittexte ergibt sich daher die Forderung, die Textgeschichte jeder einzelnen
Textgruppe gesondert zu untersuchen und zu werten.
2 Schlingloff, Yogalehrbuch

18

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

o 139B4; salakabhyah nkura 121V4; yogcrah tmnam 128V5; manayah (ditya) 128V5;
bhyah dhyatmakas 136R3; kausal(a)h (dhyat)m{a) 137V2; catasrah yatana0 136V1; lokah
asrayas 127V2; mayah srayo 144V5; tatah svasatah 127V3/4; tatah svsa0 127R6; arambhah
svsnam 121V6; dasadisah 147V3; cetasah srayam 124R3; stambhah iva 143V1; mrdunah
udsinasya 153V4; prsthatah upanibandha0 1S5B2; bhagavamtah uparyupari 128B1; kramasah
upeks 158B4; (visaye)bhyah upeksm 158V1; disah urdhvam 136V2, 136B1; parivrtah urdhvam
152B2; cetasah ebhi 153V 5; aupanyikah ehipas(y)i(kah) 165B6; (aka)Ukah aupanyikah
165B6; goghatakah grhlta0 160V1; asrayah candraP 127Bl; (ya)thoktah crnaP 129B1; bhgasah tac 160V2; Qgatah tad 145V1; ^cetasah tatraiva 155B3; lokah tirthyaP 166V1; vrtah tarne
(statt vame) 152V3; gratah tis(thati) 158V1; bhagavamtah tejo0 146V1; pravkah darsanam
165B3; cetasah deva 167B4; <>abhah dauvrikah 161B5; pravhah dvdasaP 134B6; parvatah
nana0 150V2; <>nadyah nna0 130B3; sah nana0 153B1; yoginah nirvid0 130B5; t(a)tah n(i)laf>
133B4; svasatah nllabhah 127V4, 127V4; (sr)otobhyah nila 145B2; srotobhyah huddha0 136B1;
mayah buddha0 131V3; maitreyah bodhi0 152V3; tatah brahmabhih 136V5; adhirudhah brahm
150R6; punah mudita0 153B1; adhirdhah brahma 152V2; bhagavamtah mrdhata 144B1;
punah maitra0 145V3; ksobhah yatha0 16IV4; cetasah yatho0 155B2; bhtah yavad 163B1;
yogah yoga0 128B3; gatah yog 121V5; tatah yoga0 127Bl; digbhyah yoga0 136V3; rdhah
yogina 144V5; mrdhnah ratn(af 127V2; c(e)tasah ratna0 124V1; jatah ratnani 152B2; cyatanebhyah rasa0 136V6; amtah rasi 160B5; manahrpa 134B4; bhagavamtah l(ak)s 165V3;
mrdhatah vajram 121B4; ksobhah vayu0 161V4; apah vayo 136B5; cetasah vaidurya0 167V4,
169B3; bhagavatah hrdaye 162V5.

Auslautendes -ah:
vedanayh adhipati0 158V2; vymisrah adho 125V2; parh apramano 146V5 \ pravistah kasa0
161B6; satvah a(vir) 148V3; yah iva 131V5; cith eva 162V1; pldltah ghat{i)tas 158V4;
satvh candra0 144B5; buddhh tebhya 131V'4; rnh duhkhaya 132B5; parvath drsyamt(e)
130B2; sannah drsyamte 168B3; patth nihsrtya 130V5; (dhir)dhh bhagavamto 150V5;
(ra)try(a)h m(a)dhy(a)m(e) 164B4; srth yavad 170V5; (parisa)ndh yoga0 146V5; buddhh
yoga0 131B3; buddhh ra(t)na 121B3; prasvash vajra0 127B6; (pra)k(a)r(ay)h vedanayah
158V2.

Auslautendes ~ih, ~uh, -eh, -aih:


srtabhih asta0 148V6; rasmibhih in(dr)i 157B2; sphulimgabhih ista0 157V6; salakabhih dipa0
124B5; manih utpadyat(e) 145B2; dharabhih yoga0 123V6; mukhabhih ratna0 12IV3; brahmabhih ratna0 136V5; srtbhih rasmibhih 157B2; tribhih rupaih 146V4; dhatuh caksuh0 128B6;
dhatuh durbala0 160V3; Uhatuh markata0 128B6; uruh vi 116V5; bahuh vayu0 160V3; samadheh dvi 130B4; varsaih gosirsa0 170V6; nimittaih duhkhitam 149B3; manasaih duhkhair
147B6; caryaih yoga0 128B2; nadaih ratna0 153V'6; srtaih ratna0 126V3; varsaih lokam
162V4; padmaih vaidrya0 153V6.

An einigen Stellen sind die Sandhiregeln nicht beachtet, das Visargazeichen ist dabei
aber a u s g e l a s s e n :
amtarebhya yathokta0 133B2; Harn tad 162V1; pandar te 121V5; priti utpadyate 153V6
154B3; salkabhi rdhva0 12IV3; bhi dharabhih 123V6; sakabhi nih 127V5; (ras)m(i)bhi visphulimgabhih 157V6; hri utpadyate 159V2; hri duscaritebhyah 159V2; narakai mukhi 148B5;
nisannai urdhvad 146B1; pattai tad0 158B4; prnai tlryag 169V6; varnai buddha0 164V4.

Da hier das Zeichen einfach vergessen wurde und daher diese Flle nicht anders zu werten
sind als die der vorhergehenden Liste, zeigen die hufigen Auslassungen des Visarga auch an
anderen Stellen:
loka kso 162V6; pursa pra 136V2; nisthita pra 135B5; bhmita sapta0 147B4; tata samudra
131V2; tata sauvarnam 145V5; satva sarva0 151V6; dya sauvarna0 168B2; puna satvh 159V5; tebhya stha0 133B2; prayoga (statt prayogah |) 135B5; sarv karanah 149V3; satv pa(t)r(esu) 152V4;
satv pary0 159V6; mOn puspa0 128V4; samskr punyah 137B4; karan purusa 170B5; yav

Einleitung

A. Zur Textgeschichte

19

prthivi 136R5; Osvas praP 124R1; Oparyamt sanft 144V3; puru? sa 170ES; ^satva samvigns
159V4; nimagna sra 13SR5; rdh svam 162V2; nirgata sthi0 133R4; dev sthi<> 147V2; ^satv
sanft 159V4; *smrti fca 167R3; ^smrti sa<> 128R1; ebhi pra 153V5; varnbhi sni<> 124V4; utpatti (statt utpatti |) 136R4, 136R5; smrti || 167R3; dhatu sarve0 153R6; Uhatu sthi<> 160V2;
(ma)tu kuksi0 164R1; citai pa 146R1; krai sa 159R6; Karsai sa 126V3; ^(se)kai simcya0
145V4; padayo pa 150V1; pdayo pra 152V4, 154R2.
Die dargestellte Schreibweise, bei der die einzelnen Wrter im Satz ohne Beachtung der
Sandhiregeln nebeneinandergestellt werden, ist in unserem Text zwar hufig, aber keineswegs
konsequent durchgefhrt. In sehr vielen Fllen sind die Sandhiregeln korrekt befolgt. Seltsamerweise erweist sich nun die hinsichtlich der Sandhiregeln korrekte Textgestalt als die
sekundre. Diese Regeln sind nmlich teilweise falsch angewandt oder an falscher Stelle
befolgt; sie wurden also von Schreibern durchgefhrt, die den Sinnzusammenhang des Textes
nicht mehr verstanden:
padmebhyo tulym statt padmebhyas- 144V2; padmo ta(dadhir)dhs statt padmh\ ta(d) 146R4;
tejastino (statt vino) sarva0 statt tejasvinah sarva0 163V1; phenarsiva (aus *phenarsih ival) statt
phenarsir iva 128V1; snehah pariprna0 statt snehapariprnP 169R3; (pratipa)ksah samanamtaram statt (pratipa)ksasamanamtaram 132V1; samkalh su statt samkalsu 136V6; kaihayati\ caitat
pramdaphalam iti statt kathayati ca\ etat 169R5; kathayati civam npnasmrtir bhvayitavya
statt kathayati ca\ evam 128V3; yoglamkroktas ca visess statt yoglamkr ukts 147V4; ti$thaty
atha statt tisthati\ atha 150V3.
Wie vllig gedankenlos die Durchfhrung der Sandhiregeln im Text teilweise vorgenommen
wurde, zeigt die Schreibung maitrbhisekas cas tadrasaparipurnah parvatah in 146R5. Hier
hat der Schreiber das Satzzeichen (#t oder | ) in seiner Vorlage fr einen Visarga gehalten
und dem t des folgenden Satzes assimiliert. hnlich scheint (ni)hsrts candramandalasamks
nadl in 151R6 auf (ni)hsrt\ candramandalasamks nadl zurckzugehen.
Zu hnlichen Ergebnissen ber die Behandlung der Sandhiregeln in unserem Text fhrt
die Betrachtung des A n u s v r a . Dieser ist mehrfach, statt des Klassennasals, vor anlautendem Vokal beibehalten:
pannam adhah 146R1; ta(ra)tn (a)n 153R5; anbhogarn anabhi0 125V4; pararn anircft 128R2;
gaganatn abhra0 148V5; stabdharn upa(r)i 118V'4; srayarn utpadyate 153R5; ks{a)narn rdhvam
158R1; g(r)hitarn evam 127R2; asvsanrn\ adhipati0 121V6; mahrn 149V3; dhvajrn ditya0
134R5; vedanyrn upeks 158V6.
Dabei ist der Anusvrapunkt versehentlich ausgelassen:
idni aparo0 152R4.
Die Auslassung des Anusvrazeichens ist auch sonst hufig belegt, sowohl im Wort als
auch am Wortende:
tisthati statt tisthaniti 136V2; rjsy statt rajmsy 129V4; aghanistha statt stharn 146V2; abhisambuddha statt ddharn 139V4; namtara statt rarn 152R5; sraya statt yarn 145R6; rdhva
statt Harn 146R5; kya statt kyarn 123V5; gagana statt gaganarn 128V4; dvdasagam statt
rngam 139R1; bibasra0 statt birnbasra 164R2; kampayati statt yantti 160R3; utpadyate statt
Qpadyainte 159R2; dhatu statt dhtutn 131V3, 131V5; duscarita statt duscaritatn 158R1; tistha
statt tistharn 130V3; mitta statt mittarn 166R5; mrdu statt mrdurn 155V5; padma statt padmani
146R3; samvara statt samvararn 169V2; phala statt phalarn 147V6; sastra statt sastratn 160V2;
sarva statt sarvarn 127V 6; scaka statt scakarn 130R5; prthivi statt prthivim 117V 3, 129R3,
129R5,132V59132R2; anamta statt Harn 130V4; paryamt statt ^paryamtrn 129V1, 128R1; upeksa statt upekarn 158R4; naraka statt narakrn 145R5; asivis statt sivisarn 157V3; pretas
statt pretrns 129R2; manusys statt manusyarns 145R5 ; adhasta statt adhastarn 145R4, 148R2;
samjnya\ statt osamjnayarn\ 126R4; bhvanay\ statt bhvanyant\ 128V6,
2*

20

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

Scheinbar regellos wird der Nasal manchmal durch Anusvra und manchmal durch den
Klassennasal bezeichnet; mehrfach findet sich auch das Anusvrazeichen neben dem Klassennasal :
bhagavrnn utpadyate 159R5; bhmny 127V3; tatnn satvm 141V3; syamnte 162V5; anamtaparyarnnt 146V6.
Dieses Nebeneinander erklrt sich wohl daraus, da der Schreiber die Anusvrazeichen
seiner Vorlage teilweise durch den Klassennasal ersetzt hat. 1 An einigen Stellen hat er bei
dieser Umsetzung Virma eingefhrt:
vmam\ bdhtuh 160V3; ku(sa)lamlam\ bhvayamtam 128R1; sat kmvacarm devn\ rpvacarms ca 145R6; tn\ . . . 151RS; etvat\ maitrbhise(ka) 146E4; (bhru)madhyat\ nn(a) 131V3.
Dabei wurde der Charakter des Nasals miverstanden 2 :
kledayam\ dsayams ca 135R4; satvm

simcyamtinam] 149R3.

Hier besttigt sich erneut, da die Schreiber zwar einige zur Gestaltung des Schriftbildes
erforderliche Regeln beherrschten, dabei aber den Sinnzusammenhang nicht durchschauten.
Schlielich sei noch auf eine vom klassischen Sanskrit abweichende Sandhibildung hingewiesen, die sich als Regel fr die ostturkistanischen Handschriften aufstellen lt: Anl a u t e n d e s cha erscheint am Satzanfang, sowie nach Visarga und Anusvra als ccka3:
|cchatradandam 130V5; \cchatram 150R5; samamtatah cchidram 136V5, 121V2; cetasa (statt sah)
cchidram 151R4; satva (statt tvh) cchdyamte 155R5; mayam cchatram 130V4; mukthram
cchatram 127V6; satvkhyam cchidri 130V1.
Anlautendes sa kann nach Anusvra als ccha erscheinen4:
bhagavm cch(u)d(dh) 152V3; vcayam cchrnvams 166V2.5
Die bisher skizzierten Fehler und Abweichungen von den klassischen Sandhiregeln betreffen das in Ostturkistan entwickelte S c h r i f t b i l d unseres Textes; es ist kaum angngig,
von diesem Schriftbild auf eine vom klassischen Sanskrit abweichende S p r a c h f o r m des
Textes im Munde gelehrter ostturkistanischer Mnche zu schlieen. Ein Blick in die Fehlerlisten der zentralasiatischen Handschriften des Buddhacarita 6 , Saundarananda 7 , Satapanc-

Vgl. HBTBL, Karmavacana, S. 21, 1. u. Anm. 5. Ob hinter der Schreibung mn eine Sprachwirklichkeit steht, wie REGAMBY, Randbemerkungen zur Sprache und Textberlieferung des Krandavyha,
S. 518, Anm. 6, annimmt, ist unsicher. Auffllig ist die Schreibung daksinmd amsd 133V1, die, wie
(ak)sam patati statt (ak)sat0 154R2, auf eine nasale Aussprache des schlieenden Dentals nach
prakritischem Vorbild hinzuweisen scheint.
2
Der Fehler praviliyam yatana0 statt yann in 136V2 ist wohl aus der Umsetzung von *praviliyam
zu erklren.
3
Vgl. etwa WALDSCHMIDT, Mahparinirvnastra, S. 81 (243,5): mah cchatra0; ROSEN", Vinayavibhanga, S. 24 (M112,5;VI): Harn cchandam; S. 34 (M177, Bl 99, R3 u. Bl. 100,V3): ^km cchinna<>;
SCHLINGLOFF, Chandoviciti, S. 20 u. Anm. 6: krtih cchandovicitih.
4
Vgl. etwa WALDSCHMIDT, Mahparinirvnastra, S. 47 (122,2): yusmam cchst; Mahvadnastra, S. 14 (6,6): vm cchkya0; ROSEN", Vinayavibhanga, S. 25 (M 112,5; R4): (bha)gav(m) cchrvastym; S. 36 (Sg255; V3): yusmam cchilavm; WALDSCHMIDT, Upasenastra, S. 44 (Sgl455, R2):
hram cchru0; (R5): yusmam cchriputra (dagegen S. 38,8: yusmam sriputra).
5
dharmn cchrnoti in 45V1 ist wohl eine Sekundrbildung aus *dharmm cchrnoti; vgl. HOEBNLE,
Manuscript Remains, S. 147 (SdhP., Fol. 254 Obv, 2): yusmn cchriputras.
6
WELLER, Zwei zentralasiatische Fragmente des Buddhacarita; ohne Fehlerliste.
7
WELLER, Ein zentralasiatisches Fragment des Saundaranandakvya; Fehlerliste S. 407 ff.

Einleitung

A. Zur Textgeschichte

21

satka1, der Jtakaml 2 oder der Chandoviciti3 zeigt, da auch klassische Sanskritwerke
von unkundigen Schreibern fehlerhaft tradiert wurden. Einige Besonderheiten unseres
Textes jedoch weisen nicht auf das Schriftbild, sondern auf seine sprachliche Stellung. Hierher gehren die Mediae (bzw. -aspiratae) in den Wrtern sphadika^ und aghanistha^ statt
der sonst in den Handschriften blichen Tenues, ferner die auch aus anderen Texten bekannte Unsicherheit gegenber vokalischem r, die sich in den Schreibungen prathivi 129R3,
146R6, apvryate 141R4, 143R6 und drvyni 130V1 uert. 6 Einmal finden wir die berfhrung eines Nomens in die a-Deklination: brahmais 148R2, dagegen brahmabhih 136V5,
141R6. rasmi ist im Plural sowohl als Maskulinum (nihsrtais ca rasmibhir 169R2), wie auch
als Femininum (Qnihsrtbhih rasmibhih 157R2) belegt 7 ; parisanda als Maskulinum (par(i)sandm 146V1) und als Neutrum (sarvaparisandni 146Vl).s caJcra wird, entgegen sonstigem
Gebrauch, wie ein Maskulinum behandelt: (dvdasmgapratltyasamut)pdacak(r)h 159R6,
dvdasmgah pratitya(samutp)d(a)c(a)kr(a)h 139V3/4 (dagegen dvdasmgam pratityasamutpdaeakram 159V6). Hier hat wohl das maskuline Geschlecht von pratityasamutpda
bestimmend gewirkt.9
Die Unsicherheit gegenber dem Genus, die sich in solchen Bildungen bekundet, zeigt sich
am aufflligsten im Nominativ Singular einiger maskuliner Substantive, die teilweise wie
Neutra behandelt werden:
srayam

utpadyate 130V 4, 132R2, 153R5;


= pryate 152R2;
= pryate 131R5, 136V 4;
= a(va)tisthate 130R4;

SH. BAILEY, The Satapancasatka of Matrceta. Die Angaben ber die Lesarten zu den einzelnen
Versen sind nur mit Vorsicht zu verwerten, da sie nicht auf den Handschriften, sondern auf den oft
fehlerhaften und unvollstndigen Abschriften SIEGLINGS beruhen. Vgl. die Wiedergabe der britischen
Handschriften bei HOERNLE, Manuscript Remains, S. 61 u. Anm. 2, 3 usw. (Visargafehler!).
2
WELLEB, Die Fragmente der Jtakaml; Fehler liste S. 10 ff.
3
SCHLINGLOFF, Chandoviciti; Fehlerliste S. 12.
4
Die Schreibung sphadika scheint nur in unserem Text vorzukommen. Die Handschriften des
Mahparinirvnastra bringen die korrekte Form sphatika.
5
Die Form aghanistha kommt auer in unserem Text nur noch in einer Handschrift der
Bodhisattvabhmi (vgl. BHSD) und in Mvy. 3107 als Nebenform von akanistha vor. Der Name der
Gtterklasse ist als akanistha schon im Rigveda (413,6; 414,5) belegt (GBASSMANN: keinen Jngsten
habend, d. h. von denen keiner der Jngste ist, Bein, der Maruts, neben ajyestha"). Ob die Schreibung
aghanistha durch Volksetymologie entstanden ist (BHSD: "surely nothing but a folk-etymological
distortion"), ist unsicher; vielleicht hat die tocharische Aussprache (Toch. A: aghanistha) die Schreibung beeinflut.
6
Zu vergleichen sind Schreibungen wie drksyate statt draksyamte MPS 125,2 (S. 48); dhryata statt
dhriyato WALDSCHMIDT, Zum ersten buddh. Konzil, S. 823 (M 147(2); V4); Qnisrtya statt nisritya
MPS 182,5 (S. 68) u. WALDSCHMIDT, Upasenastra, S. 37 (5) (Hs. nihSrtya); srunotu statt srnotu
HBTEL, Karmavacan 34,2 (S. 33); tr statt tri MPS 201,6 (S. 72) u. fter; vgl. dazu LDEBS, Sriputraprakarana, S. 395 (=Phil. Ind. S. 197): ,,Die falsche Schreibung trbhii fr tribhis 1^,2 beruht
wohl auf lokaler Aussprache und hat zahlreiche Parallelen in den Inschriften."
7
pw: rami m. (ganz ausnahmsweise f.)".
8
Nach BHSD ist parisanda als m. und als f. parisanda belegt.
9
mandala und sana werden im Plural scheinbar als Maskulina verstanden: dityam(an)d(ales)u
(p)r(a)v(isa)t(i) t(e) vajrsanesu te ca (bh)janesu 167R12; (adityama)ndalesu nirudhyamte te vajrsanesu 166R4; aber: (dityama)nd(a)lesu pravisamti(\ tni va)jrsanesu tni bhjanesu tni smrtinimittesu 165R2.

22

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch


= nirvartate 160B4;
= laksyate 146R6;
dagegen
srayo

utpadyate 130R6, 144V5.


= pryate 131V1;
= 'bhisamksiptah 146V 5;

kyarn avastabhyate 161V2.


dhvajam utpadyate 121V1;
dagegen:
dhvaja utpadyate 15SR2.
prsdam utpadyate 126V2;
dagegen:
prsda utpadyate 128V2.
vajrarn nirgacchati 121R4;
dagegen:
vajra utpadyate 150V5.
varsarn patati 148R4, 154R2;
dagegen:
var$ah
patit(a) 169 R2.
samudrarn abhimukhi bhavati 145V3, 158R2/3;
= utpadyate 127 Rl;
= sambhavati 143R6;
dagegen:
samudrah abhimukhi bhavati 153R1;
= utpadyate 123R3.

Die Erklrung solcher Erscheinungen liegt vielleicht darin, da der durch pasyati und
hnliche Verben an vielen Stellen geforderte Akkusativ dieser hufig vorkommenden Wrter
so gelufig war, da er das sichere Gefhl fr ihren maskulinen Charakter hat schwinden
lassen.1 In hnlicher Weise ist auch an zwei Stellen eine gelufige Nominativ Pluralform in
den Akkusativ eingedrungen:
buddhm bhagavamtah tejodhtusampannam 146V1;
lokadhtavah spharitv 127V2;
dagegen:
lokadhtum

spharitv 130V4.

Ob solche Fehler auf einer mndlichen berlieferung des Textes beruhen, oder ob sie bis
in seine Entstehungszeit zurckreichen, wird sich schwerlich bestimmen lassen.
Whrend der Bearbeitung der Birkenrindenhandschrift fanden sich die Reste dreier
P a p i e r h a n d s c h r i f t e n unseres Textes:
1

REGAMEY, Randbemerkungen zur Sprache und Textberlieferung des Krandavyha, S. 524ff., erklrt solche scheinbaren Akkusative in den Handschriften des Krandavyha, besonders in den alten
Gilgithandschriften, in berzeugender Weise aus dem Miverstndnis des mittelindischen anorganischen Einschubkonsonanten -m-. Eine solche Erklrung ist jedoch fr unseren Text kaum mglich, denn
Einschubkonsonanten sind den ostturkistanischen Handschriften fremd; auerdem sprechen die Flle,
in denen in unserer Liste -am vor anlautendem Konsonanten erscheint, gegen die Auffassung des -rn
als ursprnglichen Sandhikonsonant.

Einleitung

A. Zur Textgeschichte

23

1. das 64. Blatt einer Handschrift, die unser Werk als ersten Text enthielt; die beiden Stcke des
Blattes wurden wie die Birkenrindenhandschrift in den Ming-i von Kyzil gefunden1;
2. drei kleine Fragmente von drei verschiedenen Blttern einer anderen Handschrift, die ebenfalls
aus den Ming-i von Kyzil stammen 2 ;
3. ein vollstndiges Blatt mit der Blattzahl [8]5, das in der Handschriftenhhle" von Sorcuq gefunden
wurde.3 In dieser Handschrift mu unserem Werk ein kurzer Text bis etwa zum 34. Blatt vorausgegangen sein.

Der Text dieser Fragmente ist in die Wiedergabe der Birkenrindenhandschrift eingearbeitet 4 ;
zur Untersuchung der Textgeschichte gebe ich hier den handschriftlichen Befund :
458

2.

Vorderseite
151V3-R1
1 tvam=dti karunsthiti punar =abhisekapravha
(t)[]paryamt bhavatil [ta]2 to ratnamayo vrksa udgatah krtsnam
loke sphari[tv]()
[pra]tisthitni [sau](va)3 rnni ksirapariprnni drsyamte vr[ks]()

[v]t yatra bodhi(sa)4 tvah sarvam sarvatra sarvad prayacchanno


[h] kathayatil a5 smim sthne bodhisatva sarvasatvnm
sarvamanora
(kh)[y](a)satvaparivr6 h nirupadhisese nirvnadhtau pravisamt =iti tato =[sya]
,[va]dtava[s](tra)-

568
1 ///(ka)thayatil///
2 ///ratnamayo ///
3 ///(dr)syam(te)///
1

4
5

Rckseite
151R1-R4
prvrtl
sapattasuvarnamlvabaddh
s =ainam [pr]o
s()v =[]tm()n(am pra)namya bodhya pranidhnam karoti
vyutthitasya c =(sya)
[h] sa[rva]satv[o]pari patatil tac=ca drstv samjtapritipr[mo]
[n](ir)g(a)tya krtsnam satvasamudram=upaguhyatisthamti| krame
. . . . kasahasrapa(r)[i]vran =nirupadhi&ese nirvnadhtau pravisatih pa
h karunsa[ya](sya)
bhrvivara upanibaddhacetasa cchidram=utpadyate
syati|
tamnihsrtai-

2A.
Vorderseite
4
5
6

151V3-R1

///purusa(h)///
///(ni)rupadhise(se)///
///ml[va](baddh|)///

Fundnummer T i l l MQ155; Hhe 9 cm, Lnge 34 cm.


Fundnummer T i l l MQ152; die Hhe der Bltter betrug ca. 9 cm, die Lnge lt sich auf etwa
40 cm berechnen.
3
Fundnummer T H I S 19; Hhe 5,8cm, Lnge 24,5cm. Der Fundort ergibt sich aus einer im
Museum fr Vlkerkunde aufbewahrten Fundliste aus Soruq, nach der die Fragmente mit den Fundnummern Sl4 (oder S Nak) aus der Naksatra-Hhle, S 534 aus der Handschriftenhhle und
S 61102 aus der Stadthhle stammen. Leider sind diese Angaben jedoch nicht in allen Fllen zutreffend.
4
Soweit die Fragmente Textteile enthalten, die in der Birkenrindenhandschrift fehlen, stehen diese
wie die Ergnzungen in runden Klammern, aber in Fettdruck,
2

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

24

3 HIHI
4 ///(utpa)dyatel ta[tt]r(a)///
5 ///(sa)mudrm sa///

151R1-152V1
Rckseite
6 ///(na)g(ara)///
7 ///(suvar)n(a)bh[j](ana)///
8 ///adho yva[d=v](yumandalam)///
2B.

568

165R3-R4
Vorderseite
6 ///(c)[ch](i)dren(a p)[](rayati)///
7 ///(kra)[m](e)na y[v](at)///
8 ///h ratnak(tgrai)///

Rckseite
165R5-166V1
1 ///(dhar)[m]()nusmr(tih)///
2 ///aupan[yi](kah)///
3 ///(lo)kab tirth(yasstrni)///

568
1
2
3
4
5
6
7
8

20.
Vorderseite
///(di)[tya]mandal[am] n
///[sphajritv dvitly 2///
///[va] nimittaci///
///y[a sa]rvak[ye]///
///[sya]///
///(s)[pha]ra(ti)///

385
1

Vorderseite
129R1-R3
utpadyatel
tadanamtaram =abhiseken =sraya(m) prinayan=tato| bhrumadhye cittopanibandhah tasmt =pravho nirgatah prthivimandsClam bhitv narakm prets =c =vabhsya kmcanacakram bhitv pmandalam vyumandalam ksadhtum =avabhsya
parivartya nabhym pravisya mrdhn nir[ga]ty =vyucchinnam yvad aghanisth(m) devn vabhsya caturdhynarasam dya mrdhn punali
pravisati | punar =bhrumadhyd =ekah
pravho nirgacchati d[v]i-

Rckseite

1 min

2 mm
3
4
5
6
7
8

///[ve]///
///(spha)[rana]///
11/. . . . pyaru(dhira) s///
///(u)[tpadya]te| ksirapa///
///par(i)prn nirga[tya]///
///(a)[va]dte manda(l). V//

i
Rckseite
129R3-R5
tiyo nbhy misribhtam prathivi spharitv tisthatil
prvam bhrumadhyd=vicchidyate| tato
nbhyh tato nbhiparyamtanimagnam
svam =srayam pasyati
sthitis=ca
vrksapariprn dr^yate tammlanisann bhiksavo dhtuprayogam bhvayamti tamnakhavivaranihsrts ca dhtavah krtsnam lokam spharitv parasparamakaramukhesu tesv==eva nirudhyamte|
evam saddhtumayaih purusaih
prthivi prn[m] pasyati | kadcid =dhtm vyastm pa[s](ya)

1
Eine Einordnung dieses Fragmentes in den Text war nicht mglich. Der Terminus sarvakye in V4
scheint auf die Kategorie c)sarvakyapratisamvedanym des Kapitels II Entfaltung der Atmungsachtsamkeit" zu weisen (s. S. 65). Vielleicht bildet das Fragment also eine Parallele zu den sehr
schlecht erhaltenen Blttern 122, 123 der Birkenrindenhandschrift (S. 74 f.)
2
Erg. a(kasam\)1 Vgl. 126V4: . . . (pr)thivim avastabhya tisthati\ dvitiya ksam], ,,. . . bringt die
Erde zum Erstarren. Ein zweiter den ther".
3
Vgl. 135V6: pyardhirakarnamalapravhh, Strme von Eiter, Blut und Ohrenschmalz".
4
Vgl. 121R1: (a)vadtacandramandalacit(a), ,,mit weien Mondscheiben besetzt".

Einleitung

A. Zur Textgeschichte

25

Ein Vergleich der Fehler und Unregelmigkeiten dieser Handschriften und der entsprechenden Stellen in der Birkenrindenhandschrift ergibt folgendes Bild:
P apier hs.:

(korrekte Schreibung

Birkenrindenhs.:
*

i.

458V1: o pr av hao
V2: loke
V3: (va)rnni
V5: Osatva
V5/6: Oparivrh
V6: pravisamtl0
R5: varan0 *
R5: pravisatih
R6: cetasa
R6: Osrtair
568R8: adho

15IV 3: pravh

(Oh)
(Okam)

V4: varna
V5: satva
V6: parivrah

R4 : o sr tauro

(rnni)
(Otvah)

(vro)
(visati)
(rn)
(tah)
(Osah)

(tairO)

2.
152V1 : adho

fdho)

o.

385V1: tato| bhru


F2: pretax
F3: bhitvo
V3: pmandalarn
V3: ksao
V4: vabhsya
V5: pravisati] ( = h)
Rl: prathivi
R5: prthivi
R5: dhtrn

(|tato bhru0)

129R1
0

R2 : prets
R2 : bhitv o
R2 : pmandalarn
R2 : %kasa
R3 : avabhsya
R3 : pravisati] ( = h)
R3 : prathivi
R5 : prthivi
R5 : dhtum

(Otms 0 )

(bhitva 0 )
(Ob)
(ksa)
(Oava0)

(ti|)

(prthivim)
(Ovim)

(tm)

Die Fehler der ersten Handschrift bestehen in denselben Nachlssigkeiten und Miverstndnissen, die uns aus der Birkenrindenhandschrift gelufig sind; echte Textvarianten sind
nicht zu verzeichnen, lohe statt lokam mag auf einer Verlesung, pravisatih statt pravisatah
auf einer Textkorrektur aus Miverstndnis (im Sinne von pravisati\) beruhen. In (va)rnni
und srtair liegt die richtige Form gegenber den Fehlern der Birkenrindenhandschrift vor,
an anderen Stellen wiederum hat die Birkenrindenhandschrift die richtige Schreibung;
manchmal sind auch beide Texte fehlerhaft. Whrend diese beiden Handschriften aus Kyzil
also eine gleichermaen mit Fehlern durchsetzte, aber voneinander unabhngige Textberlieferung erkennen lassen, bringt Hs. 385 eine berraschung: diese Handschrift aus dem
300 km weiter stlich gelegenen Sorcuq zeigt ganz dasselbe Schriftbild wie die Birkenrindenhandschrift. Die bereinstimmung geht soweit, da sie nicht nur charakteristische Fehler,
sondern auch die Schreibung, Auslassung oder Fehlschreibung der Satzzeichen umfat. Die
Tatsache, da jede Handschrift noch einen zustzlichen Quantittsfehler enthlt, weist vielleicht darauf hin, da nicht eine Handschrift von der anderen, sondern beide von der gleichen
Vorlage abgeschrieben wurden. Wir sehen, wie hier Schreiber am Werk waren, die die Handschriften buchstabengetreu Zeichen fr Zeichen kopierten, ohne den Text zu verbessern,
aber wohl auch ohne ihn zu verstehen.

26

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

B. Zum Inhalt
In den meisten indischen Literaturwerken finden sich am Ende der Kapitel einheitlich
redigierte Kolophone, die den Namen des Kapitels, des Gesamtwerkes und des Verfassers
angeben. Leider fehlen solche Angaben in unserem Text 1 , und da auch das Schlukolophon
nicht erhalten ist, bleibt die Frage nach Namen und Verfasser des Werkes vorlufig ungeklrt.
An Stelle gleichlautender Kolophone stehen aber am Ende und auch am Anfang der einzelnen
Abschnitte kurze Bemerkungen ber ihren Inhalt. Eine Zusammenstellung dieser Angaben
ergibt folgende bersicht ber den Gedankengang des Werkes:
I. (Kein Name erhalten; vgl. aber 166V3: ,,durch die bung der Hlichkeiten usw.
(asubhdiprayogena).t

II. ,,So kann man diese Atmungsachtsamkeit (npnasmrti) samt Vorbereitung und
Besonderheiten als vollendet bezeichnen." 128R1.
III. Unmittelbar darauf soll man die bung der Elemente (dhtuprayoga), wie sie im
Yogalehrbuch dargestellt ist, nachvollziehen." 128R3.
IV. (beginnt die Betrachtung der Gruppen (skandhapariks).)" 132V1; vgl. aber 160R6:
in der bung der Gruppen (skandhaprayoge) dargelegt."
V. beginnt die Betrachtung der Bereiche (yatanaparik$a).il 134R1.
Vollendung der bung der Bereiche (yatanaprayoga)." 136R2.
VI. beginnt die Betrachtung des Entstehens in Abhngigkeit (pratityasamutpadaparikQ,)."

136R3.

VII. Dies ist [die Darstellung des] unermelichen (apramna) Wandels in der Gte
(maitrivihra)." 145V'6, Dies ist eine weitere [Darstellung des] unermelichen Wandels in der Gte." 146V5.
VIII. wird die Beschreibung der bung des Mitleides (karunprayoga) vorgenommen."
147R2.
So ist der Standort des Mitleides (karunasihiti)." 151V3.
Dies ist ein weiterer Standort des Mitleides." 151R3 = 152R3.
So kann man sein Mitleid samt Vorbereitung (und Besonderheiten) als vollendet bezeichnen." 152R4.
IX. Der Erhabene hat gelehrt, da unmittelbar auf das Mitleid die Freudigkeit (mudit)
[folgt]." 152R5.
X. (Der Erhabene) hat gelehrt, da unmittelbar auf die Freudigkeit der Gleichmut
(upek$a) [folgt]." 155V2.
XI. (Was ist Meditation ber den Buddha (buddhnusmrti)!)" 163R6.
Was ist Meditation ber die Lehre (dharmunusmrti) ?" 165R5.
Was ist Meditation ber die Gemeinde (samghunusmrti)!" 166R6.
Was ist Meditation ber die Tugend (silanusmrti)'*" 167R3.
(Was ist Meditation ber die Gottheiten (devatanusmrti)!)" 170V6.
Die hier vorliegende Kapiteleinteilung ist keine originale Gestaltung unseres Textes, sondern folgt einem bekannten Schema. In einer in Yarchoto gefundenen Handschrift2, die
dogmatische Begriffsreihen enthlt, finden wir folgende Kategorien zusammengestellt:

Einmal wird im Text auf ein Yogadastra Bezug genommen: ato 'nantaram dhtuprayogah yogaistropadito 'nusartavyah, Unmittelbar darauf soll man die bung der Elemente, wie sie im Yogalehrbuch dargestellt ist, nachvollziehen". (128R3).
2
Fundnummer TU Y3, Katalognr. Y906. Das Format der Bltter, 13,5 x 10,5 cm, ohne Schnrloch, ist ebenso ungewhnlich wie die Tatsache, da sich die Blattzahlen auf der Rckseite der Bltter
oben ber der ersten Zeile befinden. Zwei Bltter der Handschrift sind verffentlicht bei WALDSCHMIDT, Ein zweites Dasabalastra, S. 382ff. und bei SCHLINGLOFF, Dasottarastra IXX, S. 18,
Anm. 1. Weitere Bltter sind unten, S. 174, Anm. 4, S. 179, Anm. 9 und S. 182, Anm. 1 wiedergegeben.

Einleitung

B. Zum Inhalt

27

[Blatt 27R5] asubh *7iapnasmr[R6]tir dhatuprayogah smrtyupasthnaparik$ah ska[R7]ndhaparik$ah


yatana[pa]rik($)ah pratityasamu[28Vl](tpdapariksah)
Die Hlichkeiten, die Atmungsachtsamkeit, die bung der Elemente, die Betrachtung der Anwendungsbereiche der Achtsamkeit, Betrachtung der Gruppen, Betrachtung der Bereiche, Betrachtung
des Entstehens in Abhngigkeit, . . . ."

Das anschlieende Blatt fehlt leider; soweit die Reihe erhalten ist, stimmt sie, von der Erweiterung um die Betrachtung der Anwendungsbereiche der Achtsamkeit abgesehen, in allen
Einzelheiten mit der Kapiteleinteilung unseres Textes berein. Selbst der sachlich unbedeutende Unterschied in der Bezeichnung des Abschnittes ber die Elemente als ,,bung" (prayoga), ber die Bereiche usw. dagegen als Betrachtung" (pariks) kehrt in dieser Reihe wieder.
Wir haben also hier eine feste berlieferung vor uns, die bekannte Kategorien in einen Zusammenhang stellt, der nicht willkrlich ist, sondern eine wohldurchdachte M e d i t a t i o n s r e i h e
begrndet: Die schockierende Betrachtung der Hlichkeiten (asubh), Leichen in den verschiedenen Zerfallszustnden , nimmt die sinnliche Leidenschaft und weckt das Verlangen
nach religiser Luterung; die beruhigenden Atembungen (npnasmrti) fhren dann zu
der Durchdringung und Beherrschung von Krper und Geist, die die Voraussetzung fr das
Erfassen des Weltzusammenhanges ist. Um das Wesen des Daseins zu erkennen, schreitet
dann die Meditation von der Betrachtung der Elemente (dhtu) als den Seinsgrundlagen ber
die Gruppen (skandha) als den Seinsinhalten und die Bereiche (yatana) als den Seinsbezgen
zu der Erklrung der Herkunft des Seins in der Lehre vom Entstehen in Abhngigkeit (pratityasamutpda). Ist dieses Wissen erreicht, kann die ethische Haltung gegenber den Lebewesen begrndet werden, die ihren Ausdruck in den unermelichen (apramna) Gefhlen der
Gte (maitrl), des Mitleides (karun), der Freudigkeit (mudit) und des Gleichmutes (upeks)
findet. Als letztes werden dann in der Meditation ber den Buddha (buddhnusmrti), seine
Lehre (dharmnusmrti), seine Gemeinde (samghnusmrti), die Tugend (silnusmrti) und die
Gottheiten (devatnusmrti) die erhabenen religisen Wahrheiten erfat.
Dieser Textanordnung liegt eine Meditationspraxis zugrunde, deren Ursprnge bereits in
der ltesten buddhistischen berlieferungsschicht fixiert sind. Der alte Buddhismus hatte
zwei verschiedene Meditationsreihen entwickelt, um seinen Jngern das erlsende Wissen
nahezubringen; beide nehmen, vielfach berarbeitet, eine zentrale Stellung in den kanonischen Schriften ein. Die eine Reihe, die nach der Tradition auf das Erleuchtungserlebnis des
Buddha selbst zurckgeht, beginnt mit der bung der Tugend (sila), die dem Mnch die
Ruhe und ethische Haltung schafft, die zur seelischen Konzentration notwendig ist. Die
Kontemplation (samdhi), in vorgeschriebener Sitzhaltung an einem einsamen Orte durchgefhrt, fhrt ihn anschlieend durch die vier Versenkungsstufen zu immer hherer geistiger
Abstraktion und Klarheit. In einem Zustand schwereloser Geistigkeit, aber gewaltiger
seelischer Spannung berkommt ihn dann die erlsende Erkenntnis (prajn), die ihm den Einblick in eigenes und fremdes Schicksal und in den Weg zur Erlsung vermittelt. 1 Die andere
Meditationsweise, die ihre klassische Darstellung im Satipatthna-Sutta 2 ( = Smrtyupa-

Vgl. vor allem die ausfhrliche Darstellung dieses Erlsungsweges bei FRUWALLNER, Geschichte
der indischen Philosophie, I, S. 162ff. FEAUWLLNER schreibt dazu (S. 162): Ich mchte daher diesen
Abschnitt, der einen festen Bestandteil der ltesten kanonischen Textsammlungen bildet, unbedenklich
einer der ltesten Schichten der buddhistischen berlieferung zuschreiben."
2
Mah-Satipatthna Suttanta, D II, S. 290ff.; Satipatthnasuttam M I, S. 55ff. Vgl. die vorzgliche bersetzung und Bearbeitung des Textes von NYANAPONIKA, Satipatthna.

28

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

sthnastra *) gefunden hat, kennt die Stufenfolge TugendKontemplationErkenntnis


nicht. Hier schreitet der Mnch in reinem, leidenschaftslosem Beobachten von Objekt zu
Objekt, von dem Krper (Jcya) und seinen Empfindungen (vedan) zum Geist (citta) und den
Geistesobjekten (dhamma), als deren hchste er die religisen Wahrheiten erfat.
Auf dieser Satipatthna''-Meditation beruht die Darstellung unseres Textes: Den Hlichkeiten (asubh) entsprechen im Satipatthna-Sutta die auf das Leichenfeld geworfenen
Krper (sariram sivathilcya chadditam), der Atmungsachtsamkeit (npnasmrti) das achtsame Ein- und Ausatmen (sato va assasati, sato passasati), der bung der Elemente (dhtuprayoga) das Anschauen des Krpers nach seinen Elementen (kyam
dhtuso paccavekkhati), der Betrachtung der Gruppen (skandhapariks) die fnf Gruppen des Anhangens
(pancas9 updnakkhandhesu) und der Betrachtung der Bereiche (yatanaparlks) die jeweils
sechs das eigene Selbst bzw. das uere betreffenden Bereiche (chasu ajjhattika-bhiresu
yatanesu).
Unser Text zeigt gegenber dem Satipatthna-Sutta manche Umstellungen und Erweiterungen; vor allem die Einfgung der Meditationsreihe GteMitleidFreudigkeitGleichmut. Seine geistige Grundlage jedoch, das Verstndnis der Meditation als ein fortschreitendes
Betrachten, ist die gleiche. Der Inhalt der Betrachtungen aber erfhrt in unserem Text eine
berraschende Neugestaltung. Als Beispiel untersuchen wir eine Stelle unseres Textes, die in
einem direkten literarischen Abhngigkeitsverhltnis zum Satipatthna-Sutta steht :
Um zu erlutern, in welcher Weise der Meditierende seinen Krper als eine Zusammensetzung der Elemente betrachten soll, gibt das Satipatthna-Sutta ein Gleichnis2:
Gleichwie, ihr Mnche, ein geschickter Rinderschlchter oder Kinderschlchter geselle ein Rind
schlachtet und, es zerlegend, sich auf einem [Markt]platz niederlt, in der gleichen Weise, ihr Mnche,
schaut der Mnch eben diesen Krper in seiner jeweiligen Stellung oder Lage hinsichtlich seiner Elemente an: In diesem Krper ist das Erd-Element, das Wasser-Element, das Glut-Element und das
Wind-Element."

Unser Text hat diese Stelle folgendermaen gestaltet:


,,Hier (entsteht) zum Zwecke seiner den sechs Elementen angemessenen Betrachtung ein Rinder schlchter, der (ein Messer) trgt. (Dieser schlachtet ein Rind) und schaut die sechs Stcke auf dessen
Haut gesondert an. Dann geht von dem Nabel des Yogin ein Messer aus und trennt die Gestalt des Yogin
in sechs gesonderte Teile auf seiner Haut: . . . ." 160V12.

Der Topos des Gleichnisses ist das Zerlegen, das Rinderschlchter und Mnch gleichermaen
befhigt, ihr Objekt nicht als Einheit, sondern als Zusammensetzung einzelner Teile zu sehen.
In unserem Text nun ist dieser Rinderschlchter kein Beispiel, sondern eine wahrnehmbare
Erscheinung; das Zerlegen in die Elemente wird nicht mehr vorgestellt, sondern krperlich
erlebt. Das Gleichnis wird hier zum Sinn-Bild, die Anschauung zur Vision; der Mnch wird
zum Yogin. Mit den Begriffen yogin oder yogcra, yoga oder prayoga ist eine neue Meditationsweise verbunden, die unserem Text ihr Geprge gegeben hat.

Zitate aus der (mahyanistisch berarbeiteten) Sanskrit version des Stras sind berliefert in
iks. S. 21 Off. Ob die unten, S. 64f. (A) wiedergegebenen ostturkistanischen Sanskritfragmente einem
Smrtyupasthnastra zugehren oder einem hnlichen Text, ist unsicher.
2
D II, S. 294: seyyath pi, bhikkhave, dakkho goghtako v goghtakantevsi v gvim vadhitv
ctummahpathe bilaso pativibhajitv nisinno assa, evam eva kho, bhikkhave, bhikkhu imam eva kyam
yaththitam yathpanihitam dhtuso paccavekkhati: atthi imasmim kye pathavidhtu podhtu tejodhtu
vyodht ti. Skt. vgl. Siks. S. 210, 4ff.: tadyathpi nma, subhte, goghtako v goghtakantevsi v gm
hatv tlksnena iastrena catvri phalakni krtv pratyaveksate sthito Hha v nisannah, evam eva, subhte,
bodhisatvah prajnpramitym carann imam eva kyam dhtuso yathbhtam prajnti: asty asmin
kye prthividhtur abdhtur api tejodhtur api vyudhtur apiti.

Einleitung

B. Zum Inhalt

29

Der lteren buddhistischen Meditation sind die Namen Yoga, Anspannung", und Yogin,
der sich Anspannende"', unbekannt. 1 Aus der religisen Umwelt des Buddhismus drangen die
beiden Begriffe in die spteren Texte ein und eroberten sich eine zentrale Stellung2, ohne
jedoch Trger eines bestimmten weltanschaulichen Programmes zu sein. Die Vieldeutigkeit,
die den Yoga noch heute zum Schlagwort sich widersprechender geistiger Strmungen werden
lt, liegt im Wortsinn begrndet: Der Yogin ist ein Mensch, der eine Aktivitt im religisen
Bereich entfaltet, und Yoga ist seine Ttigkeit. 3 In unserem Text knnen wir die Art der
religisen Aktivitt des Yogin sicher bestimmen und damit den Bereich des Terminus Yoga
abgrenzen. Der Begriff prayoga (,,bung"), in Aktion getretener Yoga, ist ohne weiteres mit
pariks, ,,Betrachtung" vertauschbar 4 ; die Betrachtung aber ist die visionre Schau, deren
Entfaltung (bhvan)5 gelehrt und gelernt werden kann:
Darum sollen, wenn sie dies gehrt haben, Yogalehrer (yogcrya) und Yogin (yogcra) in der Unterweisung (upadesa) und in der Entfaltung (bhvan) nicht nachlassen." 128R2.
Der Yoga ist die Methode, visionre Bilder hervorzurufen:
Dabei erscheinen im Innern durch den Yoga Masse"6 (rsiyoga) achtzigtausend Wurmarten." 160R5.

Der Begriff Yoga erscheint im Buddhismus zuerst in seiner profanen und damit fr den Heilsweg
negativen Bedeutung: Die Yogas sind die Ttigkeiten, durch die der Tor verfhrt wird und die der
Weise von sich tut (Uv. XXIX, 39 b : yogaih samuhyate blo, yogn nudati panditah); vgl. PTSD:
"3. (fig.) bond, tie; attachment (to the world and its lusts), or what yokes to rebirth". Zu dem Begriff
Yogin schreibt PTSD: "The word does not occur in the four Nikyas", zu Yogvacara: "The term is
peculiar to the Abhidhamma literature."
2
Die Ttigkeit, die dem Begriff des Yoga inhrent ist, konnte als religise Aktivitt verstanden
werden: caturnm ryasatynm
abhisamayya
yogah Jcaraniyah, zum Erfassen der vier
edlen Wahrheiten soll man Aktivitt entfalten4 (WALDSCHMIDT, Kleine Brhmi-Schriftrolle: Satyastra S. V, S. 415); savnam khayya yogo karaniya, zum Schwinden dei Befleckungen soll man
Aktivitt entfalten" (A. II, S. 93); iraddhym, nanda, yogah karaniyah ,,im Glauben, o nanda,
soll man Aktivitt entfalten" (LV. S. 90,13). Spter wird dann der Begriff Yoga teilweise zum terminus
technicus fr die Meditation berhaupt, wenn etwa im Vinaya der Mlasarvstivdins (DUTT, Gilgit
Manuscripts, III, S. 73) die Pltze genannt werden, an denen man Yoga treiben darf. Der Yogin oder
Yogvacara (NYANATLLOKA: der bungsbeflissene") ist im Visuddhimagga derjenige, der den vorgezeichneten Weg zur Reinheit einschlgt; Mnche und Nonnen, Laienanhnger und -anhngerinnen
werden zu Yogins oder Yogcras (bhiksubhiksunyupsakopsik yogino yogcrh, Sdhp. S. 6,12).
3
FEAUWALLNER, Geschichte der indischen Philosophie, I, S. 133, definiert den Begriff Yoga folgendermaen: Unter Yoga versteht der Inder das Streben, vermittels systematischer Schulung des
Krpers und Geistes auf dem Wege innerer Sammlung durch unmittelbares Schauen und Erleben die
erlsende Erkenntnis oder die Erlsung selbst zu erlangen. Er ist also keine Lehre sondern eine Methode, und kann als solche mit den verschiedensten Lehren in Verbindung treten."
4
yatanapariks, Betrachtung der Bereiche" 135R5, 136V2, steht neben yatanaprayoga, bung
der Bereiche" 136R2; skandhapariks, Betrachtung der Gruppen" (in rpaskandhapariks usw.)
neben skandhaprayoga, bung der Gruppen" 160R6; saddhatupariks, Betrachtung der sechs Elemente" 160V1 neben dhatuprayoga bung der Elemente" 128R3, 129R4.
5
Der Terminus wird auch verbal gebraucht: bhiksavo dhtuprayogam bhvayamti, Mnche entfalten die bung der Elemente" 129R4; npnasmrtir bhvayitavy, man soll die Atmungsachtsamkeit entfalten" 128V 3.
6
rsi Masse", bezeichnet wohl, hnlich wie pindi Hufung" in Divy. S. 162,15, ein einfaches
Bild, das unendlich vervielfltigt ist. Im Yogavidhi findet sich auf einem kleinen Fragment der analoge
Begriff rdimandalayogena, durch den Yoga des Kreises Masse".

30

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

,, . . verharren sie in dem Yoga des wie ein (Pisang)blatt Faltens und Entfaltens (putputayoga)."1
1S2V5.
,,. . . wie eine Leuchte durch den Yoga des Hervorhebens (utkarsanayoga) . . ." 124R5,
,,. . . entsteht diese Schau durch den zuendegefhrten Anschauungsyoga (pratyaveksanayoga)." 169V5.
Die Kenntnis solcher Methoden wird jedoch in unserem Werk vorausgesetzt. Dieses hat die
Aufgabe, die einzelnen Visionen als systematische bungen darzustellen, zu gliedern und
dogmatisch zu untermauern. Daher enthalten die einzelnen Abschnitte zu Anfang und Ende
scholastische Errterungen, die die Vorbereitungen (parikarman)2 und Besonderheiten
(visesa)3, die Hindernisse (pratipaksa) *>und die Ergebnisse (nisyanda)^ der bungen erlutern
sollen. Diese theoretischen Grundlagen unseres Textes beruhen auf dem Lehrgut der Sarvstivdins, wie es aus den kanonischen Texten entwickelt wurde. Auch der praktische Teil ist
keine Neuschpfung, sondern geht auf alte visionre Traditionen zurck, die zum Teil in den
Buddha- und Heiligenlegenden, sowie in der Mythologie ihren Niederschlag gefunden haben.
Wie Maudgalyyana in die Himmels- und Hllen weiten dringt und von dort Kunde bringt 6 ,
sieht auch der Yogin die Hllen vor seinen Augen 7 ; wie Mras Heere gegen den Bodhisatva
Waffen schleudern8, strmen die Wesen auch gegen den Yogin mit Waffen, Feuer und Giften

Der Stamm des Pisangbaumes besteht nur aus einem zusammengefalteten Blatt und dient deshalb
als Symbol der Haltlosigkeit der Gruppe Gestaltungen; durch das Entfalten wird ihre Wesenlosigkeit
offenbar. Vgl. S. 96 u. Anm. 3.
2
Zu den Vorbereitungen gehren Tugendbungen usw. (vgl. siladikrtapari(karmanah), die Vorbereitung, an deren Anfang die Tugend steht" 134R2 = 128R4; vgl. auch 132V1), aber auch einfache,
vorbereitende Visionsbungen (vgl. S. 96ff.). P. parikammaicata entspricht Skt. krtaparikarman; vgl.
krtaparikarmanah avasthitasamdheh, der die Vorbereitung durchgefhrt hat und in Kontemplation
verharrt" 130R4 130V5; vgl. auch LUDERS, Sriputraprakarana, S. 392 ( = Phil.Ind., S. 194) (C4. R2):
yatidharmmena krtaparikarmmanoh, ,,(der beiden Buddhajnger Sriputra und Maudgalyyana), die
durch Selbstzucht die Vorbereitung durchgefhrt haben".
3
Die bungen werden ,,samt Vorbereitung und Besonderheiten" (saparikarm savises 128R2,
152R4) durchgefhrt. Unter den Besonderheiten sind die verschiedenen geistlichen Errungenschaften zu
verstehen; vgl. etwa Divy. S. 271,7ff.: tato bhagavat
tdrsidharmadesan krtym srutv bahubhih
sattvaiatair mahn viieso 'dhigatah kaiicic chrotapattiphalam skstkrtam kaiicit sakrdgmiphalam
kaiicid angmiphalam kaiicit sarvakleiaprahnd arhattvam skstkrtam kaiicid smagatni kuialamlny utpditni kaiicid mrdhnah kaiicid mrdumadhyh ksntayah kaiicic chrvakabodhau cittny
utpditni kaicit pratyekabodhau kaiicid anuttarym samyaksambodhau kaiicic charanagamanni
grhitni kaiicic chikspadni yadbhyas s parsad buddhanimn dharmapravan samghaprgbhr
vyavasthit\ Dann fhrte der Erhabene eine Lehrpredigt von solcher Art durch, da viele hundert
Wesen eine groe B e s o n d e r h e i t erreichten: einige verwirklichten die Frucht des Eintrittes in den
[aufwrtsfhrenden] Strom, einige die Frucht des [nur noch] einmal Wiederkehrens, einige die Frucht
des nicht [mehr] Wiederkehrens, einige verwirklichten, nachdem sie allen Befleckungen entsagt hatten,
die Heiligkeit, einige lieen erhitzte Wurzeln des Heiles entstehen, einige hauptschliche und einige
mige oder mittlere [Formen der] Geduld, einige richteten ihre Gedanken auf die Erleuchtung als
Junger [eines Buddha], einige auf die als Pratyekabuddha und einige auf die unvergleichliche vollkommen Erleuchtung, einige nahmen die [dreifache] Zuflucht an und einige die Gebote; 'darberhinaus wurde die Versammlung dem Buddha ergeben, der Lehre glubig und der Gemeinde zugetan.
4
Vgl. die Zusammenstellung der Hindernisse S. 115 f.
5
Der Terminus wird im Sinne von punyanisyanda, Ergebnis ( = Erfolg) durch [religises] Verdienst" verwendet; etwa in 146V6: vyutthitasypi nisyamdam anuvartate, erwacht [der Yogin], folgt
das Ergebnis*'. Er kann aber auch mit negativen Begriffen verbunden werden: vyapdanisya(nda),
Ergebnis des belwollens" 147R1.
6 Etwa Mv. I, S, 5ff.
7 145R5; 148R5J?.
8
LV. S. 317,15ff.

Einleitung

B. Zum Inhalt

31

an1; wie der Buddha Feuer und Wasser aus seinem Leib entlt 2 , gehen von dem Yogin
leuchtende Strme aus3, und wie der Buddha, wird auch der Yogin von himmlischen Blumenregen berschttet. 4 Die Vorstellungen ber den Weltbau wurden im lteren Buddhismus
ebenfalls von solchen visionren Erlebnissen beeinflut, was vor allem in der engen Verknpfung der Gtterwelten mit den vier dhyna-Stnien zum Ausdruck kommt. Unser Text
hat auch hinsichtlich seines W e l t b i l d e s diese traditionellen Anschauungen bernommen5,
die sich nach seinen Schilderungen folgendermaen zusammenfassen lassen: Den Mittelpunkt
unseres Weltsystems bildet die Erde (prthivi). Unter diesem Begriff wird einerseits die Erdoberflche (prthivlmandala, Erdkreis") verstanden, andererseits aber auch die Rume darber und darunter, soweit sie mit dem Erdelement (prthivldhtu) behaftet sind. So reicht die
Erde nach oben bis zu den Aghanistha[-Gttern] (aghanisthaparyamt prthivi), den hchsten
Gottheiten der vierten Versenkungssphre (caturtha dhyna), nach unten umfat sie die unter
ihrer Oberflche liegenden Wohnsitze der Gespenster (preta) sowie die Hllen, von denen die
acht groen Hllen (mahnaraka) Sanjiva, Klastra, Sanghta, zwei Raurava, Tapana,
Pratpana und Avici mit ihren Qualen (kran) aufgefhrt sind. 6 Jede Hlle hat 16 Nebenkammern (utsada)7, dazu kommen die kalten Hllen (sltanaraka).8 Die untere Begrenzung der
Erde bildet die Goldscheibe (kancanacakra).9 Weiter nach unten folgen sodann der Wasserkreis (abmandala), der Windkreis (vyumandala) und schlielich das Element ther (ksa-

144R2-3; s. unten, S. 125, Anm. 6.


Vgl. etwa Divy. S. 161,8ff : adhah kyam prajvlayaty uparimt kyc chital vridhrh sy andante,
Abwrts lt er seinen Krper brennen, aufwrts flieen aus seinem Krper khle Wasserstrme "
ber dieses berhmte 'Zwillingswunder' (yamakaprtihrya) handelt ausfhrlich LDEBS, Bharhut,
S. 62ff.; vgl. auch WALDSCHMIDT, Wunderttige Mnche in der ostturkistanischen Hinayna-Kunst,
S. 2ff.
3
S. unten, S. 41 f.
4
S. unten, S. 40.
5
Soweit erkennbar, fgt sich das Weltbild unseres Textes ganz in den durch die Dogmatik der Sarvstivdin gesteckten Rahmen. Das dritte Kapitel des Abhidharmakosa kann fr alle dargestellten
Lehren zum Vergleich herangezogen werden. Fr die Stellenbelege zu den enzelnen Begriffen unseres
Textes vgl. das Wrterverzeichnis S. 190ff.).
6
Die Hllen werden in der angegebenen Reihenfolge untereinander liegend vorgestellt. Zu den Angaben ber die Hllenqualen im Vergleich mit anderen Texten vgl. die Anm. zul48B5ff. (S. 13 8f.).
7
Vgl. AbhdhK. III, S. 152: Oh les nomme utsada parce que ce sont des lieux de tourment supplementaire: dans les enfers les damns sont tourmentes; ils le sont par surcroit dans les utsadas." Der
Querschnitt einer Hlle mit ihren Nebenkammern wird folgendermaen dargestellt (BASTIAN, graphische Darstellung des buddhistischen Weltsystems, Tafel IV):
2

Vgl. AbhdhK. III, S. 154: ,,11 y a huit autres enfers, les enfers froids, TArbuda, etc." Die kalten
Hllen werden in unserem Text nur in der Formel astau mahnaraJch sodasotsadaparivrh sahasitanarakaih 145R5 148R5 genannt.
9
Andere Bezeichnungen sind: kncanavajramandala, Golddiamantkreis" (Zitat eines kan. Sarvstivdin-Werkes in Bcvp. S. 168,7; in demselben Zitat in iks. S. 148,15 findet sich dagegen die Lesart
kancanacakra) und kncanamayi bhmi, Boden aus Gold" (AbhdhK. I l l , S. 140).

32

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

dhtu).1 Seitwrts wird die Erde von dem groen Ringwall (mahcakravda) umgeben2,
hinter dem das Meer (samudra) liegt. 3 Die Rume ber der Erdoberflche werden in sieben
Sttten (bhmi) eingeteilt: Die Region der Sinnenwelt (kmadhtu), die bergangsstufe zur
Formenwelt (angamya) und die Formenwelt, die aus den vier Versenkungssphren (catvri
dhynni) und der Versenkungszwischensphre (dhynmtara) (zwischen der ersten und
zweiten Versenkungssphre) besteht. 4
Die Lebewesen (satva) der Erde knnen in fnf Existenzformen (pancagati)5 geboren
werden: als Gespenster (preta) und Hllenwesen (satv nrakh) unter der Erdoberflche6,
als Menschen (manusya) und Tiere (tiryak) auf der Erde, und als Gtter in den Gtterklassen
der Sinnenwelt (kmvacar devah) und der Formenwelt (rpvacar devah)7. Von einzelnen
Gtterklassen werden nur die Paranirmitava&avarti-Gtter8 und die Aghanistha-Gtter 9

Die Kreise (mandala) entsprechen also den Elementen (dhtu); da der Begriff des Kreises nicht
auch auf den ther (ksa) angewendet, sondern durch den des Elementes ersetzt wird, liegt wohl
daran, da die dem Kreis inhrierende Vorstellung der Begrenztheit von dem ther fern gehalten
werden soll. Dies wird schon in einem kanonischen Dialog errtert: 'prthivi, bho gautama, kutra pratisthit?' 'prthivi, brhmana, apmandale pratisthit' 'apmandalam, bho gautama, kva pratisthitam?"
'vyau pratisthitam' 'vyur, bho gautama, kva pratisthiiah?' 'kie pratisthitaK 'kam, bho gautama,
kutra pratisthitam?' 'atisarasi, mahbrhmantisarasi, mahbrhmana. kiam, brhmandpratisthitam
anlambanam' 'Die Erde, Herr Gautama, worin steht sie fest?' 'Die Erde, Brahmane, steht im Wasserkreis fest.' 'Der Wasserkreis, Herr Gautama, wo steht er fest?' 'Im Wind steht er fest.' 'Der Wind,
Herr Gautama, wo steht er fest?' 'Im ther steht er fest.' 'Der ther, Herr Gautama, worin steht er
fest?' 'Du gehst zu weit, groer Brahmane, du gehst zu weit, groer Brahmane; der ther, Brahmane,
steht nirgends fest und ist ohne Sttze.'" (zitiert in AbhdhKVy. S. 15,2732; bers, von BOTJRNOUF,
Introduction, S. 448L). Vgl. 136R5 u. Anm. 10 (S. 112).
2
Vgl. AbhdhK. III, S. 141: Enveloppant le tout, le Cakravda, ainsi nomme parce qu'il encercle
l'univers quatre continents et lui donne ainsi la forme d'une roue." Der Name Mahcakravda, der
sonst meist im Kompositum mit Cakravda erscheint (vgl. BHSD), wird in AbhdhK. nicht genannt
(ebenda, S. 143, Anm. 3).
3
Vgl. den Ausdruck samudraparyamt mahprthivi, ,,die meerbegrenzte groe Erde" 129V1. Das
Wasser bildet also nicht nur die untere, sondern auch die seitliche Fortsetzung der Erde.
4
Zu diesen Sttten kommen noch die in unserem Text nicht genannten drei Bereiche (yatana) der
Welt der Formlosigkeit (rpyvacara): ksa, ther", vijnna Bewutsein" und kincanya Nichtsheit", so da (ohne kmadhtu) neun Sttten der Meditation aufgezhlt werden: angamya-dhynntara-caturdhyn-ka-vijnn-kimcanyyatana-bhmikah, AbhdhKVy. S. 101,29f.; S. 113,28f. u.
fter; AbhdhK. VI, S. 271. Zu den Begriffen dhynntara und angamya, die eine Eigentmlichkeit
der Sarvstivdin-Scholastik zu sein scheinen, vgl. AbhdhK. VIII, S. 181, Anm. 2. Die Pliberlieferung nennt die drei Sttten: bhmibhedato tividham: kmvacaram, rpvacaram, arpvacaram ca,
nach der Einteilung in die Sttten ist sie dreifach: sich auf die Sinnen weit, die Formenwelt und die
Welt der Formlosigkeit beziehend", Vism. S. 386,106.
5
Einige Texte sprechen von sechs Existenzformen, indem sie noch die Asuras (Dmonen) als selbstndige Klasse anfhren.

Diese Existenzformen werden als apya, schlechte Lebensrume", bezeichnet. Der Strom, der
von dem Yogin ausgeht, durchdringt und erleuchtet diese Rume; 146E6, 129R2.
7
Einmal werden in unserem Text auch die Wesen der Gtterklassen der Welt der Formlosigkeit
genannt: kmrprpyavacardevparivrto, umgeben von den [Wesen der] Gtterklassen der Sinnenwelt, der Formenwelt und der Welt der Formlosigkeit" 147V1.
8
In unserem Text ist sowohl die Namensform paranirmitavasavartin (150V2) als auch parinirmitavasavartin (153R4) belegt. Die klassische Erklrung des Namens geht von para- aus: ,,11 y a des etres
dont les objets desirables sont crees par d'autres et qui disposent de ces objets crees par d'autres. Tels
sont les Paranirmitavasavartins". AbhdhK. III, S. 166, nach Sang. III, 34 ( = D. I l l , S. 218). Da aber
die Form parinirmitavasavartin keine bloe Verschreibung, sondern eine echte Nebenform darstellt,

Einleitung

B. Zum Inhalt

33

als obere Begrenzung der Sinnen- bzw. der Formenwelt mehrmals genannt; einmal erscheinen
die Suddhvsa-Gtter, d. h. die vier obersten Gtterklassen der Formenwelt, in Begleitung
des Erhabenen.1 Gott Brahma, auf einem Schwanenwagen stehend 2 oder mit einem Kruge
in der Hand, 3 tritt dem Yogin vor Augen4, und die Wesen seiner Gtterklasse erfllen den
Luftraum.5 Damit sind die Hinweise auf gttliche Wesen in unserem Text erschpft. Wie in
anderen Hmayna-Werken nehmen die Gtter den brigen Wesen gegenber keine Sonderstellung ein, whrend die Buddhas zu Angelpunkten kosmischen Geschehens werden. Wie die
Wesen dem Yogin in seinen Visionen handelnd und leidend gegenbertreten, erscheint auch
der Buddha, hier immer als ,,der Erhabene" (bhagavant) bezeichnet6 oder die Buddhas 7 an
entscheidenden Stellen der bungen, leuchtend, predigend und segenspendend.
Den Weltrumen mit ihren Lebewesen und den Buddhas auf der einen Seite steht als
zweiter Pol des visionren Geschehens die G e s t a l t des Yogin gegenber. Im Gegensatz
zu dem Mystiker, der in hhere Welten entrckt wird, verlt der Yogin niemals seinen
Standort (sthiti)*; durch systematische bung erreicht er, da die Erscheinungen vor seine
Augen treten, oder, wie es oft przisiert wird, da sie aus seinem Inneren heraus geschaffen
werden. Der Gestalt des Yogin (sraya oder yogcrsraya) kommt daher zentrale Bedeutung
zu. Der Begriff sraya (,,Sttze") wird hier, wie im Abhidharmakosa, in der Bedeutung von
kya Krper" verwendet. So ist in einem Gleichnis des Satipatthna-Sutta 9 von dem menschlichen Krper die Rede:
.,Gleichwie, ihr Mnche, ein an beiden Enden zu ffnendes Stuch10 voll von verschiedenerlei Krnern

zeigt die mehrfach belegte Schreibung des Namens in dieser Form im Sangitisutra (HOERNLE, Manuscript Remains, S. 22).
9
Zur Schreibung und Bedeutung des Namens vgl. oben, S. 21, Anm. 5.
1
bhagavm cch(u)d(dhvsadevapariv)r(to daksine padmaka)rnikym nisidati iuddhvsS ca devh
patresu, der Erhabene, von den Suddhvsa(-Gttern umgeben), setzt sich (an der rechten) [Seite]
in die Samenkapsel der Lotosblume nieder und die Suddhvsa-Gtter in die Bltenbltter". 152V3;
152R2.
2
hamsarathadhirdhah brahm 1S2V2, 150R6.
3
brahm, grhitsuvarnabhja(na) 151R6; brahm ca bhrmgram dygratah sthito 150V5.
4
Gott Brahma erscheint regelmig zu dem Gelbde (pranidhna) des Yogin; s. unten, S. 54f.
5
136V 5; 148R2.
6
Die Bezeichnung Buddha" fr den Erhabenen findet sich nur in der Zehnnamensformel 164V1;
sonst wird buddhh, mit oder ohne bhagavantah, nur im Plural verwendet.
7
Namentlich werden nur der Buddha der Zukunft Maitreya und einmal die Reihe der sechs Vorgnger des historischen Buddha genannt.
8
So wird auch das alte Visionsbild des Berhrens von Mond und Sonne (D. I, S. 78 usw.) nicht als
ein Entrcktwerden verstanden: so
svayarn irame paryamkena nisanno candramayidalam ca
sryamandalam ca pnin parmriati, ,,er sitzt selbst in [seiner] Klause im Ruhesitz und berhrt die
Mondscheibe und die Sonnenscheibe mit seiner Hand" Mv. I, S. 284,35.
9
D. II, S. 293: seyyath pi, bhikkhave, ubhatomukh mutoli pr nnvihitassa dhannassa
,
evam eva kho, bhikkhave, bhikkhu imam eva kyam uddham pdatal adho kesamatthak tacapariyantam
pram nnappakrassa asucino paccavekkhati. Skt. vgl. SsP. S. 1430,17ff. = iks. S. 210,8ff.: tadyathpi
nma, subhte, karsakasya mtodi (SsP. flschlich: mrtotrih) prn nndhanynm (sP.: nndhnyajtnm)
, evam eva bodhisatvo mahsatvah prampramitym carann imam eva kyam
rdhvam pdatald adhah kesamastakn nakharomatvakparyantam (Siks. flschlich: kesamastakanakharomatvakromaparyantam) prnam nnprakrasysucer (sp.: nnvidhasyd0) yathbhtam pratyaveksate.
10
Das Wort mutoli ( = Skt. mtodi) ist nur in diesem Textzusammenhang belegt. Als bersetzung
wurde vorgeschlagen 'vesseV (WARREN), 'bag' (BENDALL), 'provision-bag' (PTSD), 'basket, bag or large

3 Schlingloff, Yogalehrbuch

34

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

ist
9 in der gleichen Weise, ihr Mnche, schaut der Mnch eben diesen Krper an, von der
Fusohle aufwrts und der Haarspitze abwrts mit Haut umschlossen, mit verschiedenartigem Unrat
gefllt."
In unserem Text ist in der Bearbeitung dieser Stelle kya durch sraya ersetzt:
Dann sieht [der Yogin seine] eigene Gestalt wie ein Stuch von verschiedenartigem Unrat erfllt."
128R5.
An einigen Stellen wird jedoch der Begriff des Krpers beibehalten 1 :
,,Dann wird sein Krper von Wolkenhaufen aus Bergkristall zum Erstarren gebracht." 161V2.
In einer hnlichen Darstellung wird stattdessen die Gestalt genannt:
. . . sieht [der Yogin] seine eigene Gestalt von Tempeln erstarrt." 125R5.
Die Vorstellung des Erstarrens wird uns an spterer Stelle beschftigen2; in diesem Zusammenhang zeigen die Beispiele, da die Gestalt an den wesentlichen Meditationserlebnissen
teilhat. Sie wird mit Lotosblumen berschttet 3 und von mondhellen Flssen erfllt4; sie
vermag selbst wie die Mondscheibe zu leuchten. 5 Die Gestalt des Yogin (srayo
yogina)
erscheint aus Diamant und auf einem Diamantthron sitzend6, aber sie kann auch kraftlos
werden und verfallen.7 Am Ende einer bung nimmt der Yogin alle Visionen in seine Gestalt
zurck 8 :
Dann wird alles zu Erkennende in der Gestalt des Yogin verborgen." 127 Rl.
Dann tritt, zerschmolzen wie ein Klumpen Butterschmalz, alles zu Erkennende in seine Gestalt ein."
136R1.
Hufig wird jedoch bei dieser Vorstellung konkreter vom N a b e l (nbhi) des Yogin gesprochen 9 :
am Ende wird alles im Nabel des Yogin zum Verschwinden gebracht. So [erfolgt] das Erwachen.**
139R3.

container'' (BHSD). Die tibetische bersetzung ist rjan (iks. S. 210, Anm. 3), das vielleicht mit 'rjah
ma, or rdzan-ma, store-room' (JSCHKE) zusammenhngt. Fr die Bedeutung des Wortes mutoli ergibt
sich aus dem Textzusammenhang, da es in der Landwirtschaft Verwendung findet (karmkasya), mit
Krnern gefllt wird und an zwei Enden zu ffnen oder offen ist (ubhatomukh). Das letztere trifft
weder fr einen Korb noch fr einen Sack zu. In der Landwirtschaft werden aber bis auf den heutigen
Tag zur Aussaat von Mischfutter (Gemenge) Stcher verwendet, die von oben mit Krnern gefllt
und dann zur Aussaat unten geffnet werden. Der Vergleich mit dem oben und unten zu ffnenden
Krper ist naheliegend.
1
Neben raya, Gestalt" und kya, Krper" wird auch einige Male darira, Leib" gebraucht.
2 S. 90f.
3 131R3; R4.
* 152R1/2 152V1 130R4.
5 127R1.
6 144V5.
7 118R5.
8
Vgl. auch die Zusammenstellung unten S. 53 f.
9
Der Nabel als Krpermittelpunkt spielt auch in anderen Meditationsschilderungen als Aus- und
Eintrittsstelle der Visionen eine Rolle. Vgl. POZDNEJEV, Dhyna und Samdhi, S. 26: Nachdem die
Perle den leeren Raum und das Ende des Alls erreicht, kehrt sie zurck und geht mit dem sie begleitenden Licht in den Nabel des Kontemplanten ein."

Einleitung

B. Zum Inhalt

35

Auch wenn die Visionen als von der Gestalt ausgehend geschildert werden, wird oft eine
Krperstelle als Austrittspunkt genannt. Hier erscheint ebenfalls der Nabel1:
Gtter, die aus seinem Nabel hervorkommen" 147V2.
Im Zwischenraum [seines] Nabels entsteht das Antlitz eines Lwen aus Edelsteinen." 130V1/2.

Vom Haupte (murdhan) des Yogin geht ein Milchbaum2, ein Schirm aus Edelsteinen3,
ein Diamant1 oder eine Frau 5 aus. Am hufigsten ist jedoch das Bild des vom Haupte ausgehenden Stromes.6 Der Ausgangspunkt dieses Stromes wird meist genauer festgelegt:
Dann (geht) von [seiner] Stirn (lalta) ein Strom (aus)". 117V6.
(Dann) geht von dem Mittelpunkt zwischen [seinen] (Brauen) (bhrumadhya) ein Buddhastrom aus."
131V3.
von unterhalb des Mittelpunktes [zwischen seinen] Brauen (bhrumadhydhastt) geht ein Strom aus."
134R6.
Dann geht von der vertieften Stelle unter (dem Mittelpunkt [zwischen seinen] Brauen) (bhrumadhy-

dhar nimnapradesa) ein Milchstrom aus." 146R6.

Vom Herzen (hrdaya)1 gehen die Gefhle der Gte, des Mitleides, der Freudigkeit und des
Gleichmutes aus, oder die Frauen, die diese Gefhle jeweils verkrpern8:
Dann geht die Verkrperung des Mitleides vom Herzen aus" 148V5.
In seinem Herzen entsteht eine goldleuchtende, erfreute Frau als Verkrperung der Freudigkeit."

H3R3*.

Objekte, die in groer Zahl entstehen, kommen aus allen Krperffnungen (srotas)
hervor:
Aus allen seinen Krperffnungen kommen thergleiche Seidentcher10 hervor (und umhllen alle
Wesen)." 148R4/5.
Dann [kommen] aus allen [seinen] Krperffnung^n auf Lotosblumen sitzende Buddhas, Pratyekabuddhas und [Buddha]jnger [hervor]." 136R1^.

Die Nennung solcher krperlichen Ausgangspunkte der entstehenden Visionen gestattet


uns einen Einblick in die Technik der Meditation. Das Zustandekommen der Erscheinungen

Vom Nabel geht die zweite Phase des mehrfach ausfhrlieh beschriebenen Stromes (pravha) aus
(s. unten, S. 38f.); auerdem ein Blumenstrom 131V2, ein Strom von Buddhas 133V4 und mondhelle
Flsse 152R1.
2
145V1; vgl. 127V2 (ein Baum aus Edelsteinen).
3
130V4.
4
121R4.
5
148V1.
6
S. unten, S. 38f.
7
Einmal wird ein goldenes Banner (dhvaja) genannt, das im Herzen entsteht (153R2), whrend an
einer anderen Stelle ein glas[farbenes] Banner von der Nasenspitze (nsgra) ausgeht (115V6).
8
Auch das Milchmeer (143R6) oder der Milchteich (147V2), die dem Gefhl der Gte Ausdruck verleihen, entstehen im Herzen des Yogin.
9 hnlich 148R19 151V6, 162V3, 165V6.
10
Zu der bersetzung von patta als Seidentuch" vgl. LDEBS, Textilien im alten Turkestan, S. 24ff.
11
Vgl. POZDNEJEV, Dhyna und Samdhi, S. 28: Bei weiterer Betrachtung treten aus allen Poren
seines Krpers Padmablumen mit Buddhas hervor, erfllen den ganzen Luftraum mit einem endlosen
Rankenwerk und kehren dann smtlich an ihren Ausgangspunkt durch den Nabel zurck." Vgl. auch
SIEG, bersetzungen aus dem Tocharischen, II, S. 30f.: Darauf gingen aus den 80000 Poren des
Buddha
(Strahlen) heraus. Am Ende der Strahlen wurden Teiche
auf den Teichen
Sitze aus
Beryll
(auf den Sitzen)
Lotusse
[und] auf den Staubfden der Lotusse
Buddhagtter sichtbar.*'
3*

36

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

wird dadurch erreicht, da der Yogin seinen Geist (citta) oder sein Denken (cetas) auf die
betreffende Krperstelle k o n z e n t r i e r t {wpanibandh). So beginnt eine der Darstellungen des
Stromes 1 :
[Es erfolgt] dann die Konzentration des Geistes (dttopanibandha) auf den Mittelpunkt zwischen den
Brauen. Von diesem geht ein Strom aus." 129 Rl.
Dieselbe Krperstelle kann jedoch auch ganz andere Erscheinungen hervorrufen:
Hat sich [der Yogin] dem Mitleid zugewandt [und sein] Denken auf den Zwischenraum [zwischen]
den Brauen konzentriert (upanibaddhacetas), entsteht weiterhin ein Hohlraum. Darin sieht er (den
Erhabenen)." 151R4 2.
In den Meditationen ber den Buddha, die Lehre, die Gemeinde, die Tugend und die Gottheiten entsteht durch die Konzentration jeweils eine Frau:
(Konzentriert) [der Yogin] weiterhin [sein] (Denken) unter der Voraussetzung der Meditation ber
die Lehre (auf das Herz (dharmnusmrtiprvam hrdayopanibaddhacetas), entsteht die Frau) aus (Glas
und ihre) l(gefllten) Schalen." 166R2
Hier geht die Frau, wie bei den oben erwhnten Unermelichkeiten Gte, Mitleid, Freudigkeit und Gleichmut, vom Herzen als dem Sitz der Gefhle aus. Aber auch ungewhnlichere
Krperstellen dienen als Konzentrationspunkte:
,,. . . sieht [der Yogin], indem er [seinen] Geist durch das Tor des Mundes auf den rechten Zahn konzentriert (cittopanibandham kr)." 142R4/5.
Ein anderes mal geht die bung von der Konzentration auf eine bestimmte Stellung der
Zehen 4 aus:
(Hat) [der Yogin] ebenso (die Vorbereitung, an deren Anfang) die Tugend (steht, durchgefhrt),
ist die Konzentration des Geistes auf den Spalt zwischen den Ngeln der [beiden] groen Zehen auszufhren. Dann sieht der Spalt zwischen den Ngeln wie das Maul eines Seeungeheuers aus. In dieses
lt [der Yogin seinen] Geist eingehen." 128R4.
Die Vorstellung des Seeungeheuers (makara)5 wird also hier durch die dem geffneten Maul
entsprechende, V-frmige Stellung der Zehen angeregt. Solche einfachen Praktiken sind
jedoch in unserem Text selten; es entspricht seiner weit hher entwickelten Meditationstechnik, wenn in demselben Kapitel an spterer Stelle diese Praxis nicht gebt, sondern selbst
als Vision g e s c h a u t wird:
[Sein] Standort erscheint von Bumen erfllt, an deren Wurzeln Mnche sitzen und die bung der
Elemente entfalten: Aus den Spalten zwischen ihren Zehngeln kommen Elemente hervor, durch-

* S. unten S. 38f.
Vgl. POZDNEJEV, Dhyna und Samdhi, S. 26: Dann richtet er sein Sinnen ausschlielich auf die
Stirn, und bald gehen aus ihr Buddhagestalten
hervor".
3 hnlich 165V2, 167V4, 167R4, 169V5, 169R3, 170R2.
4
Vgl. POZDNEJEV, Dhyna und Samdhi, S. 24 (Beginn der Meditation der Hlichkeiten): Der
Asket richtet seinen Blick und seine ganze Aufmerksamkeit auf die groe Zehe des linken Fues
und stellt sich genau in ihrer Mitte ein kleines weies Geschwr vor."
5
Vgl. VOGEL, Le makara dans la sculpture de l'Inde; WALDSCHMIDT, Buddhistische Kunst in Indien,
S. 58: Unter den zahlreichen dekorativ verwandten Fabeltieren der frhindischen Kunst den geflgelten Lwen, Stieren, Pferden, Einhrnern und Mischwesen ist der Makara das bemerkenswerteste (Abb. Nr. 29 u. 71 unt.). Seine Charakterisierung wechselt; meist besitzt er einen Fischleib,
einen Fischschwanz und zwei Fischflossen, dazu kommen entweder zwei oder vier Beine. Der Vorderkrper gleicht bald mehr dem eines Krokodils, bald mehr dem eines Dickhuters. Immer hat das Tier
einen Kopf mit aufgerissenem, zahnbewehrtem Rachen, dessen Schnauzenende sich rsselartig aufrollt."
2

Einleitung

B. Zum Inhalt

37

dringen die ganze Welt und werden in eben diesen, den jeweiligen Mulern der Seeungeheuer, zum Verschwinden gebracht.
Am Ende wird alles im Nabel zum Verschwinden gebracht." 129R4
bis 6.

In dieser Weise werden oft recht komplizierte Bilder aufgebaut, die unser Text mit allgemeinen Aussagen, wie ,,sie entstehen (utpadyante)", erscheinen (drsyante)", treten in
Erscheinung (prdur bhavanti)", kommen zu gesicht (abhimukhi bhavanti)" werden sichtbar (vir bhavanti)" usw. darstellt, ohne nhere Angaben ber die Praxis ihrer Hervorbringung zu machen. Diese Bilder beruhen jedoch auf wenigen meditativen Vorgngen, die
den jeweiligen dogmatischen Anforderungen entsprechend gedeutet werden.
Als erstes dieser inneren Erlebnisse, aus denen die Visionen aufgebaut werden, betrachten
wir nun das D u r c h d r in g e n (sphar) und E r f l l e n (pr, pr) der Weltrume. Diese Meditation
geht auf eine alte, in ihren Ursprngen wohl nicht buddhistische Praxis zurck, deren Darstellung in den kanonischen Schriften im stereotypen Wortlaut hufig belegt ist 1 :
Man durchdringt mit von Gte erflltem Denken eine Himmelsrichtung; ebenso die zweite, die dritte
und die vierte. So durchdringt man aufwrts, abwrts und seitwrts berall und allweitig die allumfassende Welt mit von Gte erflltem Denken, das weitreichend und grozgig ist, unermelich, frei
von Ha und Bedrckung."
Anschlieend wird mit denselben Worten das Durchdringen der Welt unter den Aspekten der
brigen drei ,,Unermelichkeiten'', des Mitleides, der Freudigkeit und des Gleichmutes
beschrieben. Sptere Bearbeitungen dieser Meditationspraxis sind dann von der urtmlichen 2
Vorstellung, da das Denkorgan (cetas) den Krper verlt und in fernen Welten verweilt
(vihar), abgegangen.3 Auch die einseitige Bindung an die ,,Unermelichkeiten'' wurde fallen
gelassen. So durchdringen dann die Flammen (arcis), die bei dem Lcheln eines Buddha von
seinem Antlitz ausgehen, die Weltrume, lindern abwrts (adhas) gehend die Qualen der
Hllenbewohner und dmpfen aufwrts (rdhatas) gehend die Freude der Himmelsbewohner.4

D. I, S. 250f. usw.: so mettasahagatena cetas ekam disam pharitv viharati, tath dutiyam, tath
tatiyam, tath catuttham. iti uddham adho tiriyam sabbadhi sabbattatya sabbvantam lokam mettasahagatena cetas vipulena mahaggatena appamnena averena avypajjhena pharitv viharati. Skt. vgl.
Mvy. 150809, MPS 34. 156157 (S. 350): sa maitrisahagatena (MPS: maitrsahagatena) cittenvairendsapatnenvybdhena (MPS: vyvadhyena) vipulena mahadgatenpramnendvayena subhvitenaikm
dUam adhimucya spharitvopasampadya viharati, tath dvitiyam (MPS richtig: dvitiyam), tath trtlyam
(MPS: ym), tath caturtham (MPS: thim). ity rdhvam adhas tiryak sarvasah sarvvantam imam lokam
(Forts, nur MPS:) maitrsaha(ga)tena c(i)ttenvairensapatnenvyvadhyena vipulena mahadgatenpra(mnendvayena subhvitenaikm disam adhimucya sphari)tvopasam(pad)ya (v)yahrsit.
2
RUBEN, Schamanismus im alten Indien, vermutet Einflu des Schamanismus, der ,,mit einer
prhistorischen Kulturwelle aus Innerasien nach Indien gekommen sein" mu (S. 204). Nach allerlei
Vorbereitungen verfllt der Schamane in Trance und erlebt es, wie sein Geist sich von der Erde erhebt
und durch die neun Himmelssphren mit ihren Gttern und Geistern hindurchzudringen vermag"
(S. 166). Vgl. zu der Frage schamanistischer Einflsse auf den Yoga auch ELIADB, Schamanismus und
archaische Ekstasetechnik, 1957, und Yoga, 1960; anders HAUER, Der Yoga als Heilsweg, 1960.
3
Dogmatische Bedenken, dem Denkorgan den anderen Organen gegenber eine solche Sonderstellung einzurumen, mgen hierbei bestimmend gewesen sein; vgl. RUBEN, Schamanismus im alten
Indien, S. 171: Ein typisches Element, der Dualismus von Leib und Geist, liegt im Buddhismus nicht
mehr in der primitiven Form des Schamanismus vor.
Also kann auch keine Seele durch den
Himmel wandern."
4
Divy. S. 366, 23ff.: tato bhagavat smitam vidarsitam. dharmat khalu yasmin samaye buddh
bhagavantah smitam vidarsayanti, tasmin samaye nilapUalohitvadtamanjisthasphatikarajatavarn
arciso mukhn niscaranti. kecid rdhato gacchanti, kecid adhastd gacchanti. ye 'dho gacchanti, te samjivam

38

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

In unserem Text ist es ein Strom (pravha), der von dem Yogin ausgeht und die Welt durchdringt. Die in hnlichem Wortlaut1 mehrfach berlieferte Darstellung lautet:
Unmittelbar darauf beglckt [der Yogin seine] Gestalt durch die Besprengung.2 Dann [erfolgt] die
Konzentration des Geistes auf den Mittelpunkt zwischen den Brauen. Von diesem geht ein Strom aus,
durchbricht den Erdkreis, erleuchtet die Hllen und die Gespenster[welten], durchbricht die Goldscheibe, erleuchtet den Wasserkreis, den Windkreis und das Element ther, kehrt zurck, tritt in den
Nabel ein, geht durch das Haupt aus, leuchtet ungeteilt bis zu den Aghanistha-Gttern und tritt mit
der Essenz der vier Versenkungssphren wieder durch sein Haupt ein. Weiterhin geht der eine Strom
vom Mittelpunkt zwischen [seinen] Brauen aus und der zweite vom Nabel: [ihr] Gemisch durchdringt
die Erde." 129R1-3.

In diese Darstellung sind die wesentlichen Elemente der alten Meditation der Unermelichkeiten aufgenommen: Das Durchdringen der Weltrume abwrts, aufwrts und berallhin.
Erweitert wurde der Bericht um die genaue Beschreibung der Weltrume, die sich in hnlicher
Form auch in den erwhnten Berichten ber die Flammen aus dem Haupte des Buddha
findet, und um die schon besprochene Beziehung zu der Gestalt des Yogin. Auerdem vollzieht sich hier das Durchdringen der Welt in zwei Phasen, indem der Strom zuerst abwrts
und aufwrts die Rume durchdringt, zurckkehrt und die Gestalt des Yogin erfllt, um
dann nochmals, gleichsam berflieend, aus Stirn und Nabel hervorzubrechen und den
Raum zu erfllen. Auch in krzeren Berichten ist der Weg des Stromes in dieser Weise dargestellt :
,,. . . [geht] eine Strom abwrts bis zum (Windkreis) und aufwrts bis zur vierten Versenkungssphre
Nachdem er deren Farbe abgetrennt hat3, tritt er wieder durch das Haupt ein und geht vom Zwischen-

klastram samghatam rauravam maharauravam tapanam pratpanam aviciparyante$u gatv, ye 4ita


naraks tessnibhtv nipatanti, ye usnanaraks tesu Mtibhtv nipatantL tena te$m satvnm kranvi&esah pratiprasrabhyante.
ye rdhato gacchanti, te cturmahrjikn devms trayastrim^n
ymms tuitn nirmnaratayah paranirmitavaSavartindh brahmakyikn brahmapurohitn mahbrahmn parittbhn apramnbhn bhsvarn parlttaiubhn apramnaubhn Subhakrtsnan anabhrakn punyaprasavn brhatphaln abrhn atapn sudrn sudariann akanisthaparyantesu devesu gatv,
anityam duhkham Snyam antmety udghosayanti.
atha t arcisas
'ntardhiyante. Dann
zeigte der Erhabene ein Lcheln. Immer wahrlich wenn erhabene Buddhas ein Lcheln zeigen, dann
gehen blaue, gelbe, rote, weie, hellrote, bergkristallne und silberfarbene Flammen von ihrem Antlitz
aus. Die einen gehen aufwrts, die anderen abwrts. Diejenigen, die abwrts gehen, gehen [in die
Hllen] Samjlva, Klastra, Samghta, Raurava, Mahraurava, Tapana, Pratpana bis hin zur
Avici-[Hlle] und fallen in den kalten Hllen hei, in den heien Hllen aber kalt nieder. Dadurch
stillen sie die besonderen Qualen jener Wesen.
Diejenigen, die aufwrts gehen, gehen zu den
Cturmahrjika-Gttern, den Trayastrimsas, Ymas, Tusitas, Nirmnaratis, Paranirmitavasavartins,
Brahmakyikas, Brahmapurohitas, Mahbrahmas, Parlttbhas, Apramnbhas, Abhsvaras, Parlttasubhas, Apramna^ubhas, ubhakrtsnas, Anabhrakas, Punyaprasavas, Brhatphalas, Abrhas, Atapas,
Sudrsas, Sudarsanas bis hin zu den Akanistha-Gttern und lassen das 'Unbestndig, Leidvoll, Leer
und Seelenlos' erschallen.
Nunmehr werden diese Flammen
[im
Krper des Erhabenen] verborgen." hnlicher Wortlaut Divy. S. 67, 16ff., 138,1 ff., 265,15ff., 568,7ff.,
Av. I, S. 4,5ff. usw.
1 Vgl. 133Rlf., 134E6, 135R3, 146R6, 152V1.
2 S. unten S. 41.
3
Statt aufwrts bis zur vierten Versenkungssphre*' steht an anderen Stellen meist, sachlich
gleichbedeutend, aufwrts bis hin zu den Aghanistha[-Gttern]", 129V'4,146R1,169V'6. Das Abtrennen
der Farbe wird durch 129R3 erklrt: tritt mit der Essenz der vier Versenkungssphren wieder durch
sein Haupt ein." Essenz (rasa) (vgl. S. 47) und Farbe (varna) bezeichnen die Leuchtkraft, die der
Strom in den Sphren der Formen weit erhlt.

Einleitung

B. Zum Inhalt

39

rum [zwischen] den Brauen aus, und ein zweiter vom Nabel, und erfllt den Standort."
152V1-2.
Es gibt jedoch auch Darstellungen, die nur die Momente des Durchdringens der Welt
(spharana) und des Zunichtewerdens in der Gestalt des Yogin (nirodha) * nennen :
Von eben diesem Nabel geht ein Strom von thergleichen (Buddhas) aus, durchdringt (die Welt)
und wird ebendort zum Verschwinden gebracht." 133V4.2
In diesem Bild ist das Erlebnis des Stromes mit der Vorstellung von Buddhas kombiniert.
Derartige Kombinationen spielen eine groe Rolle; wir werden sie weiter unten noch eingehend behandeln. 3 In unserem Zusammenhang ist bemerkenswert, da in solchen Bildern
die Vorstellung des Stromes ganz fallengelassen werden kann: Die Buddhas selbst durchdringen die Welt und verschwinden wieder in der Gestalt des Yogin:
Dann [kommen] aus allen [seinen] Krperffnungen auf Lotosblumen sitzende Buddhas, Pratyekabuddhas und [Buddha]jnger [hervor],
[und] durchdringen alle Richtungen und Zwischenrichtungen aufwrts und abwrts. Am Ende treten sie
in seine Gestalt ein." 136B12.
An einer anderen Stelle ist der Strom mit der Vorstellung der leuchtenden 4 und schmerzenstillenden5 Milch verbunden:
Dann geht von der vertieften Stelle unter (dem Mittelpunkt [zwischen seinen] Brauen) ein Milchstrom aus, durchbricht den Erdkreis, verschafft den in schlechte Lebensrume geratenen Wesen das
Erlschen allen Leides, (durchbricht [diese Rume] bis zum Windkreis, kehrt zurck, tritt in den
Nabel ein, geht) durch das Haupt (aus), geht (bis zu) den Aghanistha[-Gttern], kehrt zurck und tritt,
umgeben von den [Wesen der] Gtterklassen der Sinnenwelt, der Formenwelt und der Welt der Formlosigkeit, durch [sein] Haupt ein. Indem [dieser Milchstrom] weiterhin aus eben dieser Stelle und auch
aus [seinem] Nabel hervorkommt, erfllt er den Standort." 146R6147V1.
Statt dieses Milchstromes kann nun auch ein Milchbaum (ksiravricsa)6 die Welt durchdringen:
Ein vom Haupte des im Ruhesitz sitzenden [Yogin] ausgehender Milchbaum durchdringt die unendliche Weltregion." 145V1,
,,. . . erfllt (ein Milchbaum)
. . [seine] Gestalt. Ist [seine] Gestalt [von diesem] erfllt, geht er
wie eine Milchsule von [seinem] Haupt aus, erfllt wie ein Wolkenhaufe den Luftraum und entlt
einen Milchregen, von dem der Standort erfllt wird." 143V1.
So wie hier ein Milchregen aus dem Milchbaum den Standort des Yogin erfllt, ist an anderer
Stelle von einem Edelsteinregen aus einem Edelsteinbaum die Rede:
Dieser Edelsteinbaum durchdringt die unendliche Welt. Dann sieht er
von einem Edelsteinregen aus dem (Edelstein)baum das gesamte Meer der Lebewesen umhllt." 131B6.

Vgl. 129V 2: spharananirodhau, Durchdringen und Zunichte wenden4'.


2 hnlich 132R2, 132R3, 132R5, 132R6, 133V1, 133V2, 133V3, 133V5, 133V6.
3 S. unten S. 45 ff.
4
Die leuchtende Helligkeit der Milch ist etwa in 130R3 ausgedrckt: ksiraghrtanavanitanadyah
nnvarnaratnanaksatracandramandalanadyah, Milch-, Butterschmalz- und Butterflsse und Flsse
aus Edelsteinen in verschiedenen Farben, aus Sternen und Mondscheiben ".Vgl. auch 143V1: m()rdhatah ksirastambhah iva nirgatah abhrakta iva gaganam prya, geht wie eine Milchsule von [seinem]
Haupt aus, erfllt wie ein Wolkenhaufe den Luftraum."
5
Vgl. 148V1: stri ksiradhrbhih sariram a(vasimcati) yvad vedanopasamyati, (bergiet) eine
Frau [seinen] Leib mit Milchgssen bis die Empfindung [sc. der schmerzenden Beule] zum Erlschen
kommt."
6
Wohl ein Baum mit Milchsaft" (pw); es wird kaum an einen bestimmten Baum (pw: Nyagrodha,
Udumbara, As*vattha, Madhka, Ficus glomerata) gedacht sein.

40

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

Der Edelsteinregen erinnert an das weitverbreitete Motiv des Blumenregens1 als Zeichen der
Freude der Gtter 2 :
Dann durchdringen Gtter frohlockend den gesamten Luftraum und entlassen einen Regen aus Blumen
und Edelsteinen." 152V6*
Auch Buddhas entlassen Edelstein- und Blumenregen4; einmal wird dieses Bild mit dem des
Edelsteinbaumes kombiniert:
Dann durchdringt (ein Baum aus) Edelsteinen von [seinem] Haupte aus unendliche Weltregionen. Auf
diesem Baum erscheinen in den dichtblttrigen Zweigen Buddhas5, die die Lehre verknden. Von den
Edelstein-, Blumen- und Lotosregen, die in verschiedenen Farben aus ihrem Munde hervorkommen,
wird die Welt berschttet. Die glsern leuchtenden, im Innern hohlen Wurzeln des Baumes erscheinen mit den Fusohlen des Yogin auf der Goldscheibe feststehend." 127V23.6
Dem Edelsteinbaum entspricht ein Edelsteinschirm (ratnacchatra)7, mit dem die Vorstellung
von Seidentchern verbunden ist, die die Wesen umhllen:
Aus seinem Haupt kommt ein Schirm aus Edelsteinen hervor und durchdringt unendliche Weltregionen. Den Schirmstock sieht er auf der Goldscheibe feststehend. (Aus allen seinen Krperffnungen)
kommen (ther)gleiche Seidentcher hervor und umhllen das gesamte (Meer der Lebewesen)."
130V 4-5*
Dieselbe Funktion hat ein Lotos:
Dann durchdringt ein goldener Lotos die zehn Richtungen (und umhllt alle Wesen)." 145V5.
Alle diese Bilder vom Milch- und Edelsteinbaum, Edelstein- und Blumenregen, von
Schirm und Lotos sollen dem Erlebnis des Durchdringens der Rume Gestalt verleihen; sie
erweitern das dem Bild des Stromes inhrente Erfllen zu einem Umhllen der Wesen. Der
Vergleich wie ein Wolkenhaufe'' (abhrakta)9 kennzeichnet treffend das visionre Grund-

1
Edelstein- und Blumenregen werden hufig zusammen genannt: 126V3, 128V4, 152V6, 154B5,
162V3, 170V6, 170R6.
2
Der Bodhisatva (und der Buddha) wird von Gttershnen (devaputra) mit Blumenregen berschttet; hufig in LV., SdhP. usw.
3 hnlich 128V 4, 150R2.
4 126V3, 154R5. In 162V4 erfllt eine Frau die Welt mit Edelstein- und Blumenregen.
5
In 152R1 kommen aus allen Krperffnungen der Buddhas Edelsteinbume hervor, auf denen
wiederum Buddhas sitzen, die den Yogin mit Flssen aus ihren Nabel erfllen. Meist sitzen die Buddhas, die die Lehre verknden, auf Lotosblumen (144V'2,152R3, 131R4, 136R1,146R4) oder Lwenthronen (simhsana, 126V2, 149R6, 150V5, 154R5, 165V5).
6
Die Vorstellung, da der Baum mit seinen Wurzeln auf der Goldscheibe feststeht, also die gesamte
Erde (vgl. S. 31) durchdringt, ist auch 151V45 belegt.
7
Bildliche Darstellungen solcher Schirme, auf denen Edelsteine sitzen, bei v. LE COQ, Buddhistische
Sptantike, 3, Tafel 21. Durch die Schirme werden auf diesem Bild, wie in unserem Text in 127V'5,
Buddhas beschirmt. In 127V5 besteht der Schirm aus Seidentchern (patta), die im weiteren Verlauf
der bung erst durch Perlenschnre (mukthra), dann durch Sonnenstrahlen (dityarasmi) ersetzt
werden. Dieser Vorstellung entspricht LV. S. 352,8, wovon Edelsteinschirmen (ratnacchatra) Strahlenfden (rasmijl) ausgehen und die Welt erleuchten.
8
Das Umhllen wird in 150R5 nicht von den Seidentchern, sondern von dem Schirm selbst ausgesagt. Ob die Seidentcher in 130V45 von dem Schirm ausgehen, oder direkt von dem Krper des
Yogin wie in 148R5, (wonach unsere Stelle ergnzt ist), ist unsicher. In 158R4 werden die Wesen von
Seidentchern, die aus Sulen hervorkommen, berdeckt.
9
143V1, 144R2. 148V5; vgl. unten, S. 44. abhrakta wird in buddhistischen Texten neben meghakta, Wolkenhaufe" (LV. S. 293,20) gebraucht; etwa LV. S. 66,20: mahato "bhraktd vidyuto nihsrtya,
,,gehen von einem groen Wolkenhaufe Blitze aus". Die CPD und PTSD durch VvA. S. 12 (valhakasikhara) angeregte bersetzung point or summit of a storm-cloud" ist unzutreffend.

Einleitung

B. Zum Inhalt

41

erlebnis in seiner unbestimmten Formbarkeit. Gleichzeitig wird aber durch ihn ein entscheidendes Merkmal der visionren Bilder erfat: ihre Leuchtkraft. Wie die Wolkenhaufen von
strahlendem Licht durchflutet sind1, sind die Visionen von leuchtenden Farben begleitet.
Der Strom erfllt nicht nur, sondern er erleuchtet die Gestalt des Yogin und die Welt:
Dann die Besprengung: (Ein Edelsteinstrom) tritt zerschmelzend durch das Haupt ein und erfllt
und beglckt [seine] (Gestalt). Der Strom (geht) von seinem Herzen (aus, wird geteilt), geht abwrts
und aufwrts, erleuchtet mit den Strahlen der Edelsteine die Welt und
erfllt allmhlich
[seinen] Standort." 154R3-5.2

Von hier aus klrt sich der Begriff der Besprengung (abhiseka), der die Meditation des
Stromes einleitet. Diese Besprengung ist die Weihe des Yogin in einem bestimmten Stadium
der Meditation, das Binden des Seidentuches um seine Stirn3 zeigt, da hier die Vorstellung der Knigsweihe anklingt4 , die Weihe aber ist die Erfllung und Beglckung5
seiner Gestalt mit leuchtenden Farben:
Dann [erfolgt] gleichzeitig die Besprengung in den vier Farben 6 :" 146R3.
,,Besprengungen mit den Essenzen von gold, blau, gelb, rot und wei;" 145V4.7
Dann gehen blaue, gelbe, rote und weie (Strme)
und beglcken die Gestalt [des Yogin].
[Von da] gehen sie allmhlich aus und erfllen [seinen] Standort." 133B4.

Wir sahen oben8, da der von dem Yogin ausgehende Strom in anderen Texten seine Entsprechung in den von einem Buddha ausgehenden Flammen hat. Auch die Besprengung des
Yogin mit leuchtenden Farben steht in engem Zusammenhang mit dem alten Motiv des
Leuchtens der Buddhas:
Besprengung in den vier Farben:
[ihren] Strahlen die Welt." 146R3-4.

erhabene Buddhas in den vier Farben erleuchten mit

Die Buddhas strahlen mit ihren Krpern:


Auf den anderen Diamantthronen erscheinen Buddhas, die nach vorhergehendem Sichtbarwerden
ihrer Usnisa allmhlich zum Vorschein kommen. Durch (das Strahlen ihrer Usnisas) erscheint die ganze
Welt saphirblau leuchtend, durch das Strahlen der rn mondwei, durch das Strahlen [ihrer] Glieder
goldstrahlend und durch das Strahlen der acht Fingerngel rubinrot leuchtend." 144V6R1.

Ihr Leuchten wird durch die Bezeichnungen aus Bergkristall" (sphadikamaya 16IV2, 161R1)
und aus ther" (lcsamaya 161R6, ksanibha 162R2) angedeutet.
2 hnlich 165R2-4.
3 130V4, 169V4. Der Erhabene bindet das Seidentuch um den Kopf des Yogin: 127R4, 128V3,
M0R1.
4
Vgl. Divy. S. 211,14 ff.: te Jcathayanti: 'abhisekam, deva, praticchasvaS sa hathayati: 'mama manusyh pattam bandhiyantiS Sie [die Minister] sprechen: 'Empfange, o Knig, die Weihe.' Dieser
spricht: 'Die Menschen werden mir das Seidentuch umbinden.'"; Divy. S. 280,17ff.: yadjtasatrun
devadattavigrhitena pit dhrmiko dharmarjo jivitd vyaparopitah svayam eva ca pattam baddhv
rjye pratisthitas tad tena jyotisko *bhihitah\ Als Ajtasatru, von Devadatta angestiftet, seinen Vater,
den gerechten Knig der Gerechtigkeit, des Lebens beraubt hatte, und er selbst das Seidentuch umgebunden bekam und in das Knigtum eingesetzt war, da redete er den Jyotiska an". Vgl. auch S. 44
u. Anm. 5.
5
Zuerst wird die Gestalt des Yogin beglckt, dann sein Standort erfllt (133R4, 134R6).
6
Die vier Farben blau, gelb, rot und wei werden als rein" ( = Grundfarben) bezeichnet: parisuddhavannesu nildisu, in den reinen Farben blau usw." Vism. S. 269,120.
7
Vgl. 130R2: (n)nvarnena rasena sraym puraya(ti), er erfllt [seine] Gestalt mit der Essenz
der verschiedenen Farben."
8 S. 37, Anm. 4.

42

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

Auch durch ihre Lehre und Tugend erleuchten die Buddhas die Welt:
Mit den Strahlen, die aus ihrem natrlichen und aus ihrem Leib der Lehre (janmadharmasarira)
hervorkommen, durchdringen [die Buddhas] die Welt." 16SR1.
Die von den Strahlen der Buddhaqualitten (buddhaguna) erleuchtete Welt." 155V1.

So wie die Buddhas, leuchtet auch der Yogin selbst 1 ; die Gestalten und Gegenstnde, die er
schaut, erscheinen weistrahlend oder im goldenen Glnze, mit Edelsteinen, Perlen und
Blumen besetzt. So werden die Visionen zu einem berauschenden Farbenspiel: Vor den Augen
des Yogin erscheinen goldene Grotten 2 , perlenbesetzte Palste 3 mit glsernen Sulen4 und
bergkristallnen Treppen 5 , in Lotosteichen goldene Lotosblumen mit edelsteinbesetzten
Stengeln6, goldleuchtende, weigekleidete Frauen 7 und sternenbesetzteMnner. 8 Poetische
Phantasie und berlieferte Schmuckmittel mischen sich hier mit echten Lichterlebnissen, wie
sie der Yoga schon in seinen ltesten literarischen Zeugnissen berichtet. So heit es in dem
Bericht einer Versenkungsbung in der Svetsvatara-Upanisad 9 :
nihradhmrknilanalnm
khadyotavidyutsphatikasasinm\
etni rpni purahsarni
brahmany abhivyaktikarni yoge ||
,Die Erscheinungsformen von Nebel, Rauch, Sonne, Wind und Feuer, von Leuchtkfer, Blitz, Bergkristall und Mond, die vorausgehen, bewirken im Yoga Offenbarung in bezug auf das Brahman.'*
(Hauschild)

Diese Darstellung ist fr uns deshalb von Interesse, weil schon hier leuchtende Erscheinungen
dem Lichterlebnis Gestalt verleihen. Auch in unserem Text werden Mond- und Sonnenscheiben (candramandala, dityamandala)10, ther (lcsa), Bergkristall (sphadika)11, Glas
(vaidurya)i2 und Perlen (mukt) in Verbindung mit anderen Erscheinungen genannt13, deren
Leuchtkraft sie ausdrcken sollen. Bei der Wahl des Farbmotivs scheint die Freiheit dichterischer Gestaltung durch kein Schema gebunden zu sein. So wird etwa die Frau, die in

Die Buddhas erfllen den Yogin mit Leuchtkraft, indem strahlende Flsse aus ihren Gestalten
auf den Yogin bergehen (152R1/2). Seine Gestalt leuchtet wie die Mondscheibe (127R1), ist [wie] aus
Bergkristall (127V2) oder Diamant (144V5).
2 146V6, 146R1.
3 128V2, 134V4.
126V2, 158R3.
5 121R1; glserne Treppen 166V5.
e 153V5-6.
7 s. unten S. 43.
8 118R3, 125R4.
9

10

HAUSCHILD, Die Svetsvatara-Upanisad, S. 12.

Beide Begriffe werden oft im Plural verwandt.


11
Zur Schreibung sphadika statt sphatika s. oben, S. 21 Anm. 4.
12
Ob in unserem Text noch an den Naturedelstein Beryll oder an das Kunstprodukt Glas gedacht
ist, ist schwer zu entscheiden. Das Kunstprodukt scheint jedenfalls in Indien unter der Bezeichnung
vaidrya bekannt gewesen zu sein; vgl. ERKES, Geschichte Chinas, S. 50: ,,Das Glas scheint schon um
500 v. u. Z. von Indien nach China gelangt zu sein. Sein chinesischer Name po-liu-li, eine Wiedergabe
des Sanskritwortes vaidrya, spricht jedenfalls fr fremde Herkunft."
13
Die Verbindung wird meist durch -dta, besetzt mit", -maya, ,,aus", -bha, leuchtend wie'4,
-nibha, gleich" (nur mit ka-), -samks'a, scheinend wie" (nur mit candramandala-)f -varna, ,,-frben" oder durch ein Kompositum ausgedrckt.

Einleitung

B. Zum Inhalt

43

zahlreichen Visionen erscheint1, beschrieben als therfarben" 2 , weifarben, mit weiem


Gewand"3, goldleuchtend, mit weiem Gewand" 4 , ,,goldfarben, mit weiem Gewand" 5 ,
weifarben, goldleuchtend, mit blauem Gewand" 6 , von der Farbe frischer Butter durchdrungen"7, ,,regenbogenfarben"8, ,,aus Perlen" 9 und ,,aus Glas".10
Sind die Farbbezeichnungen solcher Bilder nichts weiter als allgemeine Glanzattribute,
scheint in anderen bungen eine Meditationsweise anzuklingen, die bestimmte Farbwerte
bestimmten Meditationszustnden zuordnet. So gehrt in der Atembung die blaue Farbe
zum Einatmen, die weie zum Ausatmen:
,,Atmet [der Yogin] dann ein, [entstehen] blauleuchtende Seidentcher;
atmet er aus, weileuchtende Seidentcher;
Atmet weiterhin [der Yogin] ein, [entstehen] auf blauleuchtenden Perlenschnren
atmet er aus, auf weileuchtenden Perlenschnren/4 127V4.11

Das leuchtende Wei des thers oder des Bergkristalls ist zum Ausdrucksmittel des hchsten
in der Meditation erreichbaren Bewutseinszustandes geworden. Hier werden in den Visionen
seelische Erlebnisse gestaltet, die schon in kanonischen Meditationsberichten12 angedeutet
sind: Knig Sudarsana hat einen der Religion dienenden (dhrma) Palast (prsda) bauen
lassen und besteigt (adhiruh) darin vier Tempel (kutgra)13, in denen er ber die vier Unermelichkeiten meditiert: Gte erfllt ihn in einem goldenen, Mitleid in einem silbernen, Freudigkeit in einem glsernen und Gleichmut in einem bergkristallnen Tempel.14 Wie in dem
Gleichnis der vierten, in Gleichmut geluterten Versenkungsstufe der Mnch gleichsam von

1
Vgl. S. 49 f.
2 165V6, 162V3.
3 161V2/3, 162V6, 163R2.
' 148V4.
s 151R6/V1.
6
162V3.
7 155R4, 156V1.
8 147V3.
9 168 V'2.
i 143V6, 165V2, 166R2, 167V 4, 169V1.
" hnlich 121V3-6.
12 MPS 34. 94-97; 156-162 (S. 336; 350-52).
13
Nach der Wortzusammensetzung kann der Ausdruck ktgra, der hauptschlich dem buddhistischen Sprachbereich angehrt, entweder bedeuten: ein Raum (gra) mit einer Spitze (Jcta) ( = Pavillon"), oder aber: ein Raum an der Spitze [eines Gebudes] (pw.: ,,Dachzimmer"). D E VREESE,
Skt. ktgra, S. 323325, gibt der ersten Erklrung den Vorzug; die Vorstellung aber, da hier Sudarsana in dem Palast die ktgras besteigt, scheint die zweite Erklrung nahezulegen, die auch von
dem Lexikographen Purusottamadeva gegeben wird. Man wird an eine Art von Turmtempeln" zu
denken haben; von der Hhe dieser Tempel aus berstrahlt der Knig die Wesen mit seinen unermelichen Gefhlen. Die ktgras dienen im Buddhismus der Meditation oder der Anbetung:
fctgrasya madhye paryankah prajnaptas, ein in des Tempels Mitte gelegter Ruhesitz" LV 63,6; sa
tasmin ktgre paryamkanisanno, der in diesem Tempel [ = im Mutterleib der My] im Ruhesitz
sitzende [Bodhisatva]" LV. S. 66,17; gunamatir nma bodhisattvo bodhisattvasya pjkarmane sarvagunavyham ktgram abhinirmimite sma, der Bodhisatva Gunamati zauberte den Tempel 'Wunderflle aller Tugend' zur Anbetung des Bodhisatva" LV. S. 293,1.
14

Zuerst (MPS 34,9497) versetzt sich der Knig in jedem der Tempel in die erste Versenkungssphre, dann (MPS 34, 156162) fhrt er die Meditation der Unermelichkeiten durch. In der ersten
Darstellung ist vom Betreten (pravid) des Palastes und Besteigen (adhiruh) der Tempel die Rede, in der
zweiten dagegen, wohl durch P. (D. II, S. 186 [2, 4]: sovannamayam ktgram pavisitv) angeregt,
umgekehrt vom Besteigen des Palastes und Betreten der Tempel.

44

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

einem weien Gewand umhllt wird *, umgibt hier den Knig, der Gleichmut ausstrahlt, ein
Tempel aus Bergkristall. Auch der Yogin unseres Textes geht in einen solchen Tempel ein,
wenn er Gleichmut erlangt hat 2 :
Indern er dies sieht, entsteht bei ihm den Gestaltungskrften gegenber Gleichmut.
bald sieht er sich selbst in einen bergkristallnen Tempel eingegangen." 161V12.

Als-

Wie dies zu verstehen ist, zeigt der vorhergehende Satz:


Dann wird sein Krper von Wolkenhaufen aus Bergkristall zum Erstarren gebracht (avastabh)."
Wir begegneten den Wolkenhaufen schon oben als Gleichnis der die Rume durchdringenden
Substanz 3 ; auch dort sollten sie neben dem Durchdringen und Umhllen das Leuchten umschreiben. Hier ist das Erstarren der krperliche Aspekt eines seelischen Erlebnisses, das die
Momente des Durchdringens und Umhllens, Besprengens und Erleuchtens in gesteigerter
Form in sich begreift.4 Der Yogin steht vor dem Ende der bung; er ist durch die Besprengung geweiht und der Erhabene bindet als Vollendung der Weihe ein Seidentuch um
seine Stirn. 5 Nun wird er des hchsten Glckes teilhaftig, whrend sein erstarrter Krper

D. I. S. 76 usw.: seyyatha pi, maharja, puriso odatena vatthena sasisam prupitv nisinno assa,
nssa kind sabbvato kyassa odatena vatthena apphutam assa, evam eva kho, mahrja, bhikkhu imam
eva kyam parisuddhena cetas priyodtena pharitv nisinno hoti, nssa kind sabbvato kyassa parisuddhena cetas priyodtena apphutam hoti. ,, Gleich wie, o Groknig, ein Mensch von einem weien
Gewand vollstndig ( = einschlielich seines Kopfes) umkleidet dasitzt und nicht eine einzige Stelle
seines ganzen Krpers von dem weien Gewand nicht erfllt ist, ebenso, o Groknig, setzt der Mnch
da, der seinen Krper mit gelutertem und lichtem Geiste durchdrungen hat, und nicht eine einzige
Stelle seines ganzen Krpers ist von dem geluterten und lichten Geiste nicht erfllt."
2
Es ist unsicher, ob in unserem Text auch den anderen Unermelichkeiten je ein Tempel in der
durch die Tradition des Mahsudarsanastra festgelegten Farbe entspricht, wie hier dem Gleichmut
ein Tempel aus Bergkristall. In der Meditation der Gte werden an einer Stelle (146V1) goldene Tempel
genannt, in der Meditation der Freudigkeit aber Edelsteintempel (153R6). Auch in der Meditation des
Gleichmutes knnen statt der bergkristallnen thergleiche Tempel erscheinen (159R3,160V1), wie auch
statt der Wolkenhaufen aus Bergkristall solche aus ther (161R6, 162R2). Die Vorstellung der Tempel
ist nicht auf die Unermelichkeiten beschrnkt; sie kann auerdem durch die von Palsten (prsda)
ersetzt werden: ein perlenbesetzter Tempel (134V4) entspricht einem perlenbesetzten Palast (128V2);
Edelsteintempel (153R6) stehen neben Edelsteinpalsten (154R6, 158R4) und mit glsernen Sulen
versehene Tempel (121R4) neben Palsten mit glsernen Sulen (126V2, 158R3).
3
S. oben, S. 40 f.
4
Wenn in 162V2 Buddhas ihren Wirkungsbereich erleuchten (avabhs), so kann dieses Leuchten in
demselben Zusammenhang ohne weiteres durch den Begriff des zum Erstarren Bringens ersetzt werden.
Wie die Tempel die Wesen zum Erstarren bringen, erfllen sie auch die Welten (127R5), umhllen
(153R6) oder berdecken (158R4) die Wesen. Wolkenhaufen erfllen (143V1) und durchdringen (148V5)
den Luftraum, umhllen die Wesen (144R2) und bringen den Krper des Yogin zum Erstarren (161V2).
Der krperliche Zustand des Yogin wird, gleich der hypnotischen Starre, mehr der Totenstarre als dein
Zustand des Schlafes, mit dem er fters verglichen wird (etwa Vism. S. 258,60), hnlich gewesen sein.
Ein anschauliches Bild dieses Zustandes bei einem mongolischen Mnch gibt POZDNEJEV (S.19): ,,Doch
mein Gott, was war das fr eine Gestalt! Ausgemergelt bis zum uersten, das Gesicht so bleich und
abgemagert, da man den Lama eher fr eine Wachsfigur, denn fr einen Menschen halten konnte.
Unbeweglich hockte er da
; die Augen waren vllig geschlossen, das Antlitz sichtlich ruhig,
aber ganz gefhllos.
Fnf Minuten stand ich so da, doch nicht eine seiner Muskeln zuckte
whrend dieser Zeit. Diese leichenhafte Unbeweglichkeit machte auf mich einen furchtbaren, lhmenden Eindruck".
* 127R4, 128V3, 130V4, 150R1, 169V4; vgl. oben, S. 41, Anm. 4.

Einleitung

B. Zum Inhalt

45

gleichsam von lgssen1 oder khlem Wasser2 besprengt wird. In der Vision der bergkristallnen Tempel oder therischen Wolkenhaufen wird das Nirvna-Erlebnis vorweggenommen, das unser Text mit denselben Bildern schildert:
Wenn [der Buddha] so gesprochen hat, tritt er in die Stadt des Verlschens (nirvnanagara) ein und
kommt, an der gleichsam von thergleichen Wolkenhaufen umhllten (Sttte nichts mehr)
begehrend, wie eine Lampe zum Erlschen (upasama)." 162R23.
Indem [die Jnger in die Stadt des Verlschens] eintreten, werden sie gleichsam von therischen
Wolkenhaufen zum E r s t a r r e n gebracht und kommen wie Lampen zum Erlschen." 161B6.
So wie hier der Buddha und seine Jnger zum Erlschen kommen, durchlebt auch der Yogin
das Glck des Erloschenseins (upasamasukha); die Vielfalt der Visionen weicht einer alldurchdringenden, therischen Helle:
Am Ende wird alles zum Verschwinden gebracht, und die Welt wird therisch. Dann empfindet [der
Yogin] das Glck des Erloschenseins." 130R6.
[Der Yogin] sieht die ganze Welt therisch geworden. (Indem er) lange Zeit das Glck des Erloschen seins (empfindet), entsteht [seine] Gestalt (zur Zeit des Erwachens) mit einem [um den Kopf] gebundenen, (edelstein)besetzten Seidentuch." 130V 34
So ist die bung des Yogin mit Erfolg gekrnt und er erwacht {vyutth, vyutthna).
Wie Kunst und Dichtung fr glubige Buddhisten nicht Objekte sthetischen Genusses,
sondern Mittler religiser Erkenntnis sind, sind auch die faszinierenden Visionen nicht Selbstzweck, sondern dienen dem Erfassen abstrakter Wahrheiten. Die von dem Yogin hervorgerufenen Bilder erfahren dadurch ihre Sinngebung, da sie mit dogmatischen und ethischen
Vorstellungen verknpft werden. Unser Text kennt verschiedene Darstellungsweisen solcher
Kombinationen; um den grundlegenden Vorgang zu verstehen, gehen wir wieder von dem
Erlebnis des Stromes aus. Wir zitierten oben (S. 39) eine Vision, bei der der Strom als Milch
die Welt durchdringt und die Schmerzen der Wesen stillt. Das Bild des Stromes kann jedoch
auch mit ganz entgegengesetzten Vorstellungen verbunden werden:
,,(Dann) gehen (von den beiden Augen [des Yogin] Strme von Eiter, Blut und Trnen) aus, von
den beiden Ohren Strme von Eiter, Blut und Ohrenschmalz, von den beiden Nasenlchern (Strme)
von Eiter, (Blut und Nasenschleim, von der Zunge Strme von Eiter, Blut und Speichel, vom Krper
Strme von Eiter, Blut und Schwei, von den Brsten)4 Strme von (Milch), vom Weg des Urins Urin-

i 118V4/5.
128V2. Vgl. auch POZDNEJEV, Dhyna und Samdhi, S. 28: ,,Nach allen diesen Vorgngen wird der
Krper des Dayanci durchsichtig und rein, und ein blendendes Wei legt wie eine Wassermasse seine
Fluten um ihn"; ebenda, S. 29: ,,Dann empfindet der Asket ein Wohlgefhl hnlich jenem, wenn man
in der heien Jahreszeit in khles Wasser taucht' 4 .
3
hnlich 131R5; vgl. auch 128V3: utthnakle muktcitah prsda utpa(dya)
bhagavms
easya sirasi pattam badhnati Zur Zeit des Erwachens entsteht ein perlenbesetzter Palast
Der
Erhabene bindet ein Seidentuch um den Kopf [des Yogin]".
4
Der Gre der Lcke wegen kann die Ergnzung nur den Sinn, nicht den genauen Wortlaut des
Textes wiedergeben, da die Angaben ber die unreinen Ausflsse des menschlichen Krpers nicht
stereotyp festliegen. Man vergleiche etwa die Darstellung in Vism. S. 159, 89: idam sariram
yassa ubhohi akkhihi akkhigthako paggharati, kannabilehi kannagthako, nsputehi singhnika,
mukhato hrapittasamharudhirni, adhodvrehi uccrapassv, navanavutiy lomakpasahassehi asucisedayso paggharati, diesen Leib, von dem aus beiden Augen Augendreck hervorquillt, von dem aus
den Ohrhhlen Ohrendreck, aus den Nasenfalten Nasenschleim, aus dem Mund Speise, Galle, Schleim
und Blut, aus den unteren ffnungen Kot und Urin und aus den neunundneunzigtausend Poren unreine
Schweiabsonderung hervorquillt".
2

46

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

4
strme, von allen Krperffnungen (Strme von) Eiter,
erfllen sie die Gestalt des
Yogin. Er (lt) stets wiederholend aus allen Krperffnungen
(Dann) durchbricht der
Strom mit den (aus dem Yogin) hervorkommenden unreinen Ausflssen
[die Rume] (bis)
zum Windkreis, kehrt (vom ther her) zurck, tritt in den Nabel ein, (geht) durch das Haupt (aus)
und besudelt und beschmutzt mit allen unreinen (Ausflssen die [Wesen der] Gtterklassen der Sinnenweit), die sich in [Luft]-Schlssern und Grten ergtzen und die [Wesen der] Gtterklassen der Formenweit samt [ihren] Schlssern; geht und kommt und tritt durch das Haupt ein, kommt (wieder aus dieser
Stelle) hervor und erfllt [seinen] Standort. Darin eingesunken erscheinen alle Wesen zerflieend/'
135V6-R5.

In dieser ausfhrlichen Darstellung dient also ein Strom dazu, die Vorstellung der Unreinheiten des Krpers auch auf die Gtterwelten auszustrahlen. 2 Der Strom ist an einer anderen
Stelle Trger der meditativen Erkenntnis, da der menschliche Krper keine Wesenseinheit,
sondern ein Konglomerat aus Kopfhaaren, Krperhaaren, Ngeln, Zhnen, Haut, Fleisch
usw. darstellt 3 :
,,Ebenso Strme von Menschen aus Kopfhaaren usw.: Durchdringen und Zunichtewerden." 129V2.4
Der Betrachtung der Gruppen (skandha) ist eine Reihe von berlieferten Vergleichen zugeordnet 5 ; so wird z. B. die Empfindung (vedan) mit Wasserblasen (udakabudbuda) verglichen. In einer vorbereitenden Betrachtung sieht der Yogin diese Blasen :
,,(Dann) entstehen (Blasen): Vorbereitung [betreffs] der Gruppe Empfindung." 132V4
In der bung wird dann die Vorstellung der Blasen mit der Empfindung des Stromes verbunden :
Dann (kommt) aus [seiner] linken Schulter ein Blasenstrom hervor (und durchdringt die Welt)." 132R4
Anschlieend wird dieses Bild noch um die Erscheinung von Buddhas erweitert :
,,(Dann) geht von
[des Yogin] ein Strom von blauleuchtenden, mit Blasen besetzten
Buddhas aus, (durchdringt) die Welt (und wird ebendort) zum Verschwinden gebracht." 132R6133V1.
Hier sind also drei Vorstellungen, StromBlasenBuddhas, kombiniert. Der Ausdruck
b e s e t z t " (-cita), der den Buddhas die Blasen zuordnet, kann in unserem Text seine gewhnliche, profane Bedeutung haben, wenn etwa von perlenbesetzten Palsten, edelsteinbesetzten
Lotosblumen oder Wagen gesprochen wird. 7 Er hat sich von hier aus zum Terminus technicus
fr den Meditationsvorgang entwickelt:
,,Dann entwickelt sich mit Diamanten besetztes Ein- und Ausatmen. Die Welt zerfllt zu Staub."
127R6-128V1.

Grere Lcke, der im Deutschen etwa 20 Wrter entsprechen.


Die Vorstellung erinnert an das Lcheln des Buddha, das in die Gtterwelten dringt und dort Leid
und Unbestndigkeit der Welt verkndet (s. oben, S. 37, Anm. 4), ist aber viel drastischer.
3 Vgl. Satipatthnasutta, D. II, S. 293 Skt. in Siks. S. 210.
4
Wie im Satipatthnasutta auf die Betrachtung der Bestandteile des Krpers die der Elemente
folgt, folgt anschlieend an diesen Strom ein Strom von Menschen aus den verschiedenen Elementen.
5
S. unten, S. 96.
6
In einem spteren Abschnitt (X.4.a): Gleichmut gegenber der Empfindung (vedayitopeks) wird
auf diese bung Bezug genommen: yathoktam vedanskandhaparlksym tatra duhkhsukhym vedanay a udakavarnam budbudam
(utpad)y(a)t(e), ,,Wie [oben] bei der Betrachtung der Gruppe
Empfindung gelehrt, (entsteht) hier fr die leidvolle und glckliche Empfindung eine Blase von der
Farbe des Wassers" 158V3.
7
Vgl. oben, S. 42, Anm. 13.
2

Einleitung

B. Zum. Inhalt

47

Die Diamanten, Zeichen der Hrte und Stokraft1, zertrmmern bei dieser Atembung
gleichsam die Welt. Visionre Erscheinungen knnen auch mit abstrakten Begriffen ,,besetzt"
werden: Berge oder Banner sind mit den Bereichen (yatana) besetzt2; Skelette, die mit den
Bereichen besetzt sind, durchdringen in der Art des Stromes die Welt:
Es entsteht ein Mann aus der Essenz der Bereiche. An dessen [vier] Seiten tritt eine Vierzahl von
geffneten Toren in Erscheinung, und von den Toren gehen vier mit den Bereichen besetzte Skelette
aus
und durchdringen alle Richtungen, aufwrts und abwrts.
Ringsum sieht
[der Yogin] alle Welt ausgehhlt, kraftlos und entwertet." 136V1-5

Der Begriff der Essenz" (rasa), der zu Beginn dieses Bildes die Bereiche mit der Erscheinung des Mannes verbindet, gehht, wie der Terminus besetzt", sowohl dem profanen als
auch dem yogatechnischen Sprachbereich an: Neben der Essenz" ( = Duft, Farbe) der
Blumen (pusparasa)4 wird mehrmals die Essenz der Farben genannt :
Besprengungen mit der Essenz [der Farben] gold, blau, gelb, rot und wei" 145V'4. = ,,Bsprengungen
mit der Essenz der verschiedenen Farben'* 148R3. Berge, die von der Essenz [der Farben] blau, (gelb,
rot und wei) erfllt sind." 130R1-2.5

Schlielich wird der Begriff der Essenz auf die Bereiche angewendet :
Whrend der Mann aus der Essenz der Bereiche zerschmilzt, tritt aus dem Haupt [des Yogin] ein
Teich in Erscheinung, der von der Essenz der Bereiche erfllt ist." 136V23.
,,Dann sieht er in [seinem] Innern ein Meer aus der Essenz der Bereiche." 136V4.

In den bisher behandelten Beispielen wurden abstrakte Begriffe mit konkreten Vorstellungen kombiniert. In unserem Text ist noch eine weitere Meditationstechnik entwickelt, bei der die dogmatischen Begriffe durch Erscheinungen vertreten sind, die als die
Symbole (nimitta)Q oder Verkrperungen (adhipatirupa) dieser Begriffe aufgefat
werden:
,,Weiterhin sieht [der Yogin] die Sechszahl der Elemente im [Embryonal]zustand Kalala. Dabei [erscheinen] Schlangen in der Farbe der (vier) Elemente, inmitten von diesen sieht er eine Muschel als
Symbol des Elementes ther und in diese eingegangen das Antlitz eines jungen Knaben als Symbol
des Elementes Bewutsein, [dies alles] durch den Lebensfaden miteinander verbunden." 129V46.

Der Yogin spaltet mit einem Diamant den Berg der Befleckungen (150V5); Regenbogen mit dem
Aspekt von Diamanten aus dem Munde des Erhabenen zerschlagen die Verkrperungen des Nichtwissens (159R6); die Buddhas oder der Yogin auf Diamantthronen (vajrsana) zeigen ihre Unerschtterlichkeit (144V5-6; 144R1-2).
2
parvat vicitryatanacit 135V2; yatanacitm dhvajm 134R5.
3
In dieser bung hhlen Lampen (pradipa) die Skelette und die Welt aus. Vgl. die hnliche Darstellung bei POZDNEJEV, Dhyna und Samdhi, S. 25 (in der bung der Hlichkeiten): macht er alle
:
Wesen, die das Universum bevlkern, ebenso zu Skeletten.
Pltzlich lodert eine mchtige
Flamme empor und verzehrt die Gebeine."
4
pusparasanadyah 130R3; pusparasadhrbhih 149R2.
5
Vgl. auch niladirasa, ,,Essenz von blau usw." 170V1; tadvarnarasena, von der Essenz ihrer
Farben" 131V1; tadvarnanihsrtnekarasadhrsahasrni, viele Tausende von Essenzgssen, die in derselben Farbe daraus hervorkommen" 145R3; snigdhasuvarnarasam, lige, goldene Essenz" 146V2.
6
Der Begriff nimitta hat im profanen Sprachgebrauch die Bedeutung Merkmal"; er kann in diesem
Sinne im Bereich der buddhistischen Meditation gebraucht werden und bezeichnet dann, vor allem im
Visuddhimagga, eine bestimmte bersinnliche Erscheinung, die sich als unmittelbares Ergebnis der
Meditation einstellt und dem Meditierenden den Erfolg seines bens besttigt." (BECKH, Buddhismus,
II, S. 47). In unserem Text ist das Merkmal" ausschlielich die visionre Erscheinung eines Wesens
oder eines Objektes, das charakteristische Eigenschaften mit dem abstrakten Begriff teilt, an dessen
Stelle es tritt.

48

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

In dieser Vision eines entstehenden Lebewesens sieht der Yogin den Embryo der buddhistischen Lehre entsprechend nicht als Wesenseinheit, sondern als eine Zusammenballung der
sechs Elemente. 1 Die Elemente werden hierbei durch ihre Symbole vertreten: die vier Elemente Erde, Wasser, Wind und Glut durch die vier Schlangen2, das Element ther durch die
Muschel, die die Eigenschaften des Leerseins 3 und des Weileuchtens4 mit diesem teilt, und
das Element Bewutsein (vijnna) durch den jungen Knaben (baladraka).5 Dieser mehrmals
in Erscheinung tretende junge Knabe gehrt zu einer Reihe von symbolischen Darstellungen
des Bewutseins:
das Element ther [wird dargestellt von] Augenhhlen usw.; das Element Bewutsein [von] einem
Affen6, einem jungen Knaben, einer gesprenkelten Gazelle7, einer Fackel8 usw." 128R6.
Alle diese Erscheinungen versinnbildlichen das Unstete, Schweifende des Bewutseins. In
demselben Sinne wird von Flimmern 9 gesprochen:

1 S. unten, S. 85.
Die vier Elemente, auch mahbhta, groe Substanzen" genannt, werden hufig mit Schlangen
{stvisa) verglichen (P. etwa S. IV, S. 172); diese Verbindung ist so eng, da in unserem Text mahbhta
und sivisa ein Kompositum bildet: rnahbhtsivisaparip(rna) 160R5; catvras ca mahbhtswi(sa)
117R3.
3
S. unten, S. 85; vgl. auch AbhdhK. I, S. 49: La cavite ou vide de la porte, de la fenetre, etc.,
c'est Tenement espace (ksadhtu) externe (bhya); la cavite* de la bouche, du nez, etc., c'est Telement
espace interne (dhytmika)." In diesem Sinne wird kasa durch chidra, Hohlraum" erklrt (AbhdhKVy.
S. 99,7).
4
Die weie Farbe der Muschel dient als Vergleich: samkhpamam setam, einer Muschel vergleichbar wei" J. V, S. 396.
5
Das Wort baladraka (nicht in den Wrterbchern) scheint nur dem buddhistischen Sprachbereich
anzugehren: Junge Knaben spenden den Mnchen (Vism. S. 383, 85), spielen mit Lehmstpas (DUTT,
Gilgit Mss. III, 1, S. 1) oder Lehmhusern (Divy. S. 366, 6). In unserem Text ist baladraka das gebruchlichste Symbol des Bewutseins.
6
Wie der Jger einen Affen einfngt, zgelt der Yogin seinen Geist (Vism. S. 202, 6969: makkato
viya cittam, luddo viya yogvacaro, der Affe ist gleich dem Geist, der Jger gleich dem Yogin."); vgl.
auch S. II, S. 94f. Der Affe erscheint noch in der tibetischen Darstellung des Lebensrades" als Symbol
des Bewutseins (dargestellt bei WADDELL, Buddhism of Tibet, S. 108; vgl. auch KIRFEL, Symbolik
des Buddhismus, S. 39; SCHLINGLOFF, Rel. d. Buddh. II, S. 34). In unserem Text scheint dieses Symbol auer in der zitierten Reihe nicht vorzukommen.
7
Das Symbol der gesprenkelten Gazelle (binducita) wird an einer Stelle mit der Erscheinung von
Buddhas verbunden: buddh drsyamte\ parisuddhabinducita(g)atrh tatsadrss ca pravh gat,
Buddhas mit den makellosen Gliedern gesprenkelter Gazellen erscheinen. Ihnen entsprechende Strme
kommen herbei" 131R2.
8
Fackeln (ulka) vertreten den Geist (neben dem jungen Knaben) in der Atembung: ulksahasrni
cmtahsam(u)d(r)e nipatamti naijvalamti kvathamti evam bhyasamu(d)r(e) \ svsaparigrhitah sa bladraka(h amta)hsamudre nimajjati prasvsaparigrhitas ca bahih, tausende von Fackeln fallen in das
Meer in [seinem] Innern, flammen auf und sieden, und ebenso in das uere Meer. Der beim Einatmen
erfate junge Knabe sinkt in das Meer in [seinem] Innern und der beim Ausatmen erfate auen"
127R23. Ein Mann mit einer Fackel in der Hand verkrpert das Bewutwerden (samprajanya)
169V1.
9
Im Zusammenhang mit der bung (des Elementes oder der Gruppe) Bewutsein sieht der Yogin
die Welt flimmern: (tatah krtsnam) tr(aidh)tuk(am)
sksmn vsyyabindn iva spandamnam
pasyati\, (Dann) sieht er die (ganze) Welt
wie feine Reiftropfen flimmern" 131R3; vgl.
2

132V6, 133V1.

Einleitung

B. Zum Inhalt

49

Es entsteht der Schnabel eines Garuda. [Der Yogin] (sieht) das darin eingegangene, wie ein Glhwrmchen flimmernde, brennende Symbol des Bewutseins."1 130V23.

Wie das Bewutsein, vertritt der junge Knabe den Geist (citta):
einen mit Ein- und Ausatmen verbundenen jungen Knaben (als Symbol) des Geistes." 118R2.
,,der beim Einatmen erfate Geist in Form eines jungen Knaben (bladrakarpin)." 127R2.

Der Gedanke (cetna) wird in hnlicher Weise durch einen Funken dargestellt:
einen in Feuerbrnde eingegangenen Feuerfunken als Verkrperung des Gedankens." 137B4.

Der hier gebrauchte Begriff der V e r k r p e r u n g (adhipatirpa) wird noch hufiger als der
des Symbols (nimitta) verwendet, um die bildhafte Darstellung einer abstrakten Idee auszudrcken. Adhipatirpa, wrtlich Herrscherform4', ist eine visionr schaubare Form, die die
beherrrschende Idee einer Meditationsbung sichtbar vertritt. 2 Eine solche Verkrperung
kann ein lebloses Objekt 3 sein:
entsteht die Verkrperung der (dreiartigen) Empfindung:
Empfindung eine Blase von der Farbe des Wassers." 158V23.

fr die leidvolle und glckliche

Hufiger jedoch werden die Begriffe durch Personen verkrpert:


,,(bei einer glcklichen [Empfindung]) erscheinen in den Blasen die Antlitze von Frauen als Verkrperung der Leidenschaft (rga)." 132JR5.

Diese Verbindung von Frauen mit dem Begriff der Leidenschaft steht jedoch in unserem Text
vereinzelt da. Treten sonst Frauen auf, verkrpern sie religis-ethische Ideen femininen
Geschlechtes, whrend Mnner Maskulina und Neutra vertreten:
,,Dann entsteht als Verkrperung (der Scham) (hri) und des Scheuseins (avatrpya) eine mit weiem
Gewand bekleidete Frau und ein Mann. Die Scham schmt sich der Befleckungen und das Scheusein
des schlechten Lebenswandels." 159V12A

In diesem Bild verhalten sich der Mann und die Frau entsprechend der Idee, die sie verkrpern. Die beherrschende Idee kann jedoch auch durch Objekte dargestellt werden, die
den Verkrperungen beigegeben sind:
[als Verkrperung] der [fr Buddhas] charakteristischen (venika) Anwendungsbereiche der Achtsamkeit (smrtyupasthna) erscheinen drei waffentragende (grhityudha) Mnner mit lschalen in der
Hand (tailabhjanahasta)." 165V5-6

Es ist nicht gesagt, wer dieses Symbol darstellt. Falls auch hier der junge Knabe gemeint ist,
knnte man annehmen, da der Schilderung das aus der Kunst bekannte Motiv des kinderraubenden
Garuda zugrunde liegt.
2
In einem kanonischen Text findet sich die Bezeichnung der beherrschenden Idee einer Meditationsbung als adhipati: chandam cpi, bhiksavo, bhiksur adhipatim krtv labhate samdhim: so 'sya bhavati
chandasamdhih. cittam viryam mimmsam cpi, bhiksavo, bhiksur adhipatim krtv labhate samdhim:
so 'sya bhavati mimmssamdhir, ,,Indem, ihr Mnche, ein Mnch den Willen zum Herrscher macht,
erreicht er die Kontemplation: dies ist seine Willenskontemplation. Indem ein Mnch den Geist, die
Energie oder die Reflektion zum Herrscher macht, erreicht er die Kontemplation: dies ist seine Reflektionskontemplation." Strazitat in AbhdhKVy. 601, 31ff.
3
In 147V3 verkrpert ein Stern (naksatra) in einem Milchteich die Gte des Yogin.
4
Das wie hri-avatrpya aus weiblicher und schlicher Komponente bestehende Kompositum smrtisamprajanya, Achtsamkeit und Bewutwerden" wird ebenfalls durch Frau und Mann vertreten
(169V1).
5
Die Stelle entspricht 162 V2/3: (traynm aveniknm smrtyupasth)nanm grhitatailaptryudhs
trayah p(urush)\, ,,[Als Verkrperung] (der drei [fr Buddhas] charakteristischen Anwendungs4 Sehlingloff, Yogalehrbuch

50

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

Eine Frau mit einer Lampe in der Hand (pradlpahasta) als Verkrperung der Erkenntnis (prajn)"
160R4.

Wie die unermelichen Gefhle der Gte, des Mitleides, der Freudigkeit und des Gleichmutes, entstehen auch die Frauen, die diese Gefhle verkrpern, im Herzen des Yogin, um
ihm dann als handelnde Wesen entgegenzutreten:
Indern [der Yogin dies] sieht, hat er Mitleid. Als dessen Verkrperung entsteht in [seinem] Herzen
eine (gold)leuchtende, mit weiem Gewand bekleidete Frau. Entstanden spornt sie den Yogin an:
,
[ist] die Tat; ich will dir bei [deinem] (Handeln) zum Heil aller Fremden den Beistand leisten
der allen angemessen ist'." 148V4 5.1
(Dann entsteht) in [seinem] Herzen die oben erwhnte Verkrperung (des Mitleides. [Diese] fat ihn)
bei den Hnden (und spricht:) ,Wohin wolltest du gehen, die Leidenden im Stiche lassend?'" 162R56.
In seinem Herzen entsteht eine goldleuchtende, erfreute Frau als Verkrperung der Freudigkeit.
Diese lobt ihn: Trefflich, trefflich; vorzglich [hast du] dies begonnen." 153B32,

Grundlegende Begriffe der buddhistischen Lehre werden hufig durch Buddhas dargestellt.
Dabei wird versucht, wenn auch oberflchlich, ihren Erscheinungsformen gewisse Merkmale
des Lehrbegriffes, den sie verkrpern, zu verleihen:
Hierbei [erscheinen als Verkrperung] (der) [zehn] (Krfte) (bala) zehn (mit Sonnenscheiben) besetzte
Elefanten3 und auf ihnen sitzend in derselben Farbe und ebenso mit Sonnenscheiben besetzt die Abbilder von zehn Buddhas, die mit [ihrem] Lichtschein den jeweiligen Wirkungsbereich der ihnen
eigenen Kraft zum Erstarren bringen; [als Verkrperung] der Klugheiten (vaisradya) (die Abbilder

bereiche der Achtsamkeit) [erscheinen] drei (Mnner), die lschalen und Waffen tragen." Von Frauen
getragene lschalen (snehapariprnabhjana) verkrpern die Meditation (anusmrti) in den Meditationen
ber den Buddha usw. (Kapitel XI; vgl. S. 174 (c)). Die Nennung von lschalen- und Waffen tragenden
Mnnern als Verkrperung der Anwendungsbereiche der Achtsamkeit geht wohl auf das kanonische
Gleichnis zurck, das S. V, S. 170 berliefert ist: athapuriso gaccheyya
, tarn enam evam vadeyyum:
'ayan te, ambho purisa, samatittiko telapatto antarena ca mahsamajjam antarena ca janapadakalynim
parihtabbo. puriso ca te ukkhitsiko pitthito pitthito anubandhissati; yattheva nam thokam pi chaddessati,
tatiheva te siro ptessati' ti.
upam kho myyam, bhikkhave, kat atthassa vinnpanya; ayam cevettha
atiho: samatittiko telapatto ti kho, bhikkhave, kyagatya etam satiy adhivacanam. Dann kme ein Mann
, zu diesem sprche man: 'Guter Mann, inmitten einer groen Menschenansammlung um die
Landesschne mut du eine vollgefllte lschale umhertragen. Ein Mann mit gezcktem Schwert
wird dir auf den Fersen sein; wenn auch nur ein einziger Tropfen verschttet wird, wird dir der Kopf
abgeschlagen.'
Dieses Gleichnis habe ich, ihr Mnche, zur Erluterung des Sinnes gegeben; dies
aber ist der Sinn: Die vollgefllte lschale, ihr Mnche, ist ein Gleichnis der auf den Krper gerichteten
Achtsamkeit." Sntideva hat dieses Gleichnis in Bcv. 7, 70 bearbeitet:
tailaptradharo yadvad asihastair adhisthitah \
skhalite maranatrst tatparah syt tath vrati \\
So wie jemand, der eine lschale hlt und von Schwerttrgern gefhrt wird, aus Todesfurcht nur auf
das Ausgleiten achten wird, so [verhalte sich auch] der Asket."
1

hnlich 148R12: tathaiva ca hrdayasth karu(n) protsha(ty u)ddhara snpaya cainm satvn
iti\9 Auch hier spornt [den Yogin] das in [seinem] Herzen befindliche Mitleid an: 'Ziehe diese Wesen
heraus und reinige sie'." Vgl. auch 151V6R1: (ta)t(o) 'sya hrdaye stri samutpadyate
s(ai)n(am)
pr(o)tshay(ati), Dann entsteht im Herzen [des Yogin] eine Frau
Diese spornt ihn an".
2
Fr die Verkrperung des Gleichmutes vgl. 16IV23: (stri)
(a)vadtavarn avadatavastraprvrta
paryamkena nisannnbhogvasthit upeksdhipatirpam sambhavati\, Eine weifarbene, mit weiem
Gewand bekleidete (Frau) tritt im Ruhesitz sitzend und entspannt verharrend als Verkrperung des
Gleichmutes in Erscheinung."
3
In der Paralleldarstellung zu diesem Abschnitt in 165V46 erscheinen als Verkrperung der fnf
Krfte fnf weie Elefanten (sveta gaj). Zu der engen Verbindung, die zwischen der Vorstellung eines
Buddha und eines weien Elefanten besteht, vgl. LDERS, Bharhut, S. 48f. Vgl. auch 125V5: saddam(ta)h sveto gajah ein weier Elefant mit sechs Stozhnen".

Einleitung

B. Zum Inhalt

51

von vier) auf Lwenthronen sitzenden Buddhas1, die mit [ihrem] Lichtschein jeweils ihren eigenen
Wirkungsbereich erleuchten." 162V12.
*,,Hierbei [erscheinen als Verkrperung] der vier (Anwendungsbereiche) der Achtsamkeit (smrtyupasthna) (vier Lwen)
von gelber Farbe und (vier) diesen entsprechende (Buddhas), die
mit ihrem Lwengebrll die ganze Welt erfllen." 166V34.2
(Dann) entstehen die Abbilder von acht (auf Lwenthronen) sitzenden Buddhas als Verkrperung des
edlen achtgliedrigen [Heils]weges. Von den Regenbogen, die aus deren Munde hervorkommen, zerschlagen, wird die Verkrperung des Nichtwissens zum Verschwinden gebracht." 159B12.
Nicht immer ist der Aussagegehalt der Bilder so sicher zu deuten wie in den angefhrten
Beispielen. Vielfach werden die Ideen, die durch die Erscheinungen verkrpert werden, nicht
genannt, sondern als bekannt vorausgesetzt. Kurze Andeutungen bezeichnen Vorgnge, die
zwar dem Yogin gelufig waren, uns aber oft unverstndlich sind 3 . Wir knnen hieraus entnehmen, da der Text auf damals bekannten T r a d i t i o n e n aufbaut. An einigen Stellen lt
sich noch nachweisen, wie sein Verfasser solche bereits literarisch fixierten berlieferungen
verarbeitet hat: Das Kapitel ber die Entfaltung der Atmungsachtsamkeit wird nach 16 Kategorien gegliedert, die die verschiedenen, erst krperlichen, dann geistigen Verhaltungsweisen
beim Atmen charakterisieren sollen.4 Die im Zusammenhang mit diesen Kategorien entstehenden Visionen werden nun in unserem Text viermal beschrieben. Hierbei zeigen die
Namen der Kategorien formale Unterschiede: Den Bildungen mit -anudarsan, ,, Erschauen''
in der ersten Reihe stehen solche mit -anupasyan, Erblicken" in der vierten gegenber.
Beide Reihen lassen sich mit denselben Unterschieden in der kanonischen SarvstivdinLiteratur nachweisen; der Verfasser unseres Textes hat sie also unverndert aus der Tradition bernommen. Darberhinaus zeigt aber die vergleichende Betrachtung der ihnen
zugeordneten Visionen, da wohl auch diese bereits mit den Kategorien zusammen berliefert waren:
l) Gesammeltsein ( = Sammlung) des Geistes:

sieht er
, und darin einen mit Ein- und Ausatmen verbundenen jungen
Knaben (als Symbol) des Geistes (einsinken):
beim Gesammeltsein des Geistes." 118R23.
Innen und auen (sieht er) ein von l erflltes (Meer)
sieht er den beim Einatmen erfaten (jungen)
Knaben im Innern einsinken:
(beim Gesammeltsein des Geistes.)" 125R24.
(In [seinem] Innern) entsteht ein Meer, und ein zweites auen. Atmet [der Yogin] ein, sinkt der beim
Einatmen erfate Geist in Form eines jungen Knaben in das Meer im Innern ein; atmet er aus, der
beim Ausatmen erfate ebenso in das Meer auen:
bei der Sammlung des Geistes." 127R12.
m) Befreitsein des Geistes ( Empfinden der Befreiung):
Dann (entsteht in) [seinem] Herzen (ein Teich)
Er sieht den (darin)

In 165V5 erscheinen als Verkrperung der Klugheiten vier Buddhas auf Lwenthronen, die den
Wesen die Lehre verknden. Wie die Diamantthrone die Unerschtterlichkeit der Buddhas zum Ausdruck bringen sollen (s. oben S. 47, Anm. 1), dienen die Lwenthrone der Lehrverkndigung (dharmsanni simhsanni, ,,Lehrthrone Lwenthrone" Sdhp. 162,15f.).
2
Die Anwendungsbereiche der Achtsamkeit bilden in diesem Zusammenhang die ersten vier der 37
zur Erleuchtung fhrenden (bodhipaksya) [Faktoren], deren Verkrperungen in dieser Darstellung
genannt werden. Erhalten ist nur die Verkrperung der vier Machtstufen (rddhipada) durch vier
glserne Treppen und die der fnf Krfte (bala) durch fnf Elefanten aus Diamant; s. unten, S. 173
Anm. 6.
3
S. auch oben, S. 30.
4
Die Kategorien und ihre Herkunft sind unten, S. 63ff dargestellt.

52

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

eingesunkenen jungen Knaben dem Glck der Versenkung hingegeben. Ein [wie glhende] Kohlen
leuchtender, mit Sternschnuppen (besetzter) Mann ergreift in eben diesem Teich (den jungen Knaben)
und zieht ihn heraus. Dann brennt der Teich:
beim Befreitsein des Geistes." 118R34.
,,
und sieht
(den jungen Knaben) von einem mit Sternschnuppen versehenen Mann herausgezogen werden
sieht er [seine] eigene Gestalt . .
, von Tempeln zum
Erstarren gebracht. [Sein] Geist, nicht hochfahrend . . . .
:
(beim Befreitsein des Geistes). 125R46.
Am Ende sieht er [den jungen Knaben] in das Meer in [seinem] Innern eingesunken dem Glck der
Kontemplation hingegeben. Tausende von Fackeln fallen in das Meer in [seinem] Innern, flammen auf
und sieden, und ebenso in das uere Meer. Der beim Einatmen erfate junge Knabe sinkt in das Meer
in [seinem] Innern ein und der beim Ausatmen erfate auen. Am Ende (sieht er sich selbst) von Tempeln aus Bergkristall (umhllt), perlenbesetzt und mit vielhundertfachem Gefolge. Dann entsteht der
mit Achtsamkeit verbundene Erhabene und bindet ein gelbweies Seidentuch [um den Kopf des Yogin].
Von [seinem] Kopf gehen ringsum Perlenschnre aus; durch das Seidentuch (und) die Perlenschnre . . .
Ebenso erscheinen unendliche Weltregionen von Tempeln aus Bergkristall erfllt, und in diese eingegangen erhabene Buddhas mit vielhundertfachem Gefolge. Ebenso
umhllen sie [jeweils] ihr Gefolge:
beim Empfinden der Befreiung." 127R26.
n) Erschauen (= Erblicken) der Unbestndigkeit:
[Der Yogin] sieht seine eigene Gestalt kraftlos (werden), leiden und verfallen. Ein- (und Aus)atmen . . .
verfllt die Welt:
beim Erschauen der Unbestndigkeit." 118R45.
ft

sieht er die ganze Welt wie in einer Weltvernichtungsperiode


zerfallen:
(beim Erschauen) der Unbestndigkeit." 125R6-126V1.
,,Dann entwickelt sich mit Diamanten besetztes Ein- und Ausatmen. Die Welt zerfllt zu Staub:
beim (Erblicken der Unbestndigkeit)." 127R6-128V1.
o) Erschauen ( = Erblicken) des Entsagens:
,,[Der Yogin] sieht Ein- und Ausatmen brennen. Ebenso (setzt dieses die ganze Welt in Brand):
beim Erschauen des Entsagens.)" 118R56.
Dann (im) dritten
setzen [Ein- und Ausatmen] die ganze Welt in Brand:
beim Erblicken des Entsagens." 128V1.
p) Erschauen ( Erblicken) der Entleidenschaftlichung:
,,
sieht er [seine] eigene Gestalt
von einem Schaumballen durchsetzt; ebenso Ein- und Ausatmen und die ganze Welt:
(beim Erschauen) der Entleidenschaf tlichung." 118R6119V1.
Einen mit Sonnenscheiben bedeckten Lwen mit von Edelsteinen bedeckten
:
(beim Erschauen der Entleidenschaftlichung.)" 126V12.
,,Durch eben diese Brnde bringt er die ganze Welt siedend wie eine Schaummasse in Wallung:
beim Erblicken der Entleidenschaftlichung." 128V12.

In diesen Bildern knnen wir bestimmte Erscheinungen und Vorgnge erkennen, die fest
mit den Kategorien verbunden sind und daher in allen Paralleldarstellungen wiederkehren:
bei der Sammlung des Geistes sinkt der junge Knabe, der den Geist verkrpert, in ein
Meer im Innern des Yogin ein und beim Befreitsein des Geistes gibt sich dieser Knabe
dem Glck der Versenkung hin; die Welt zerfllt beim Erschauen der Unbestndigkeit, brennt beim Entsagen und gleicht bei der Entleidenschaftlichung einer Schaummasse. Neben solchen bereinstimmungen zeigen die Bilder aber auch sachliche Unterschiede,
die sich wohl auf unterschiedliche Tradition zurckfhren lassen. Aus Unterschieden in der

Einleitung

B. Zum Inhalt

53

Ausdrucksweise lt sich dagegen kaum auf berlieferte Formen schlieen. Denn im


Gegensatz zu den Kategorien sind die Darstellungen der Vorgnge nicht wie in kanonischen
Texten stereotyp berliefert, sondern unterliegen dem freien Gestaltungswillen des Verfassers, der sachlich bereinstimmende Vorgnge jeweils mit verschiedenem Wortlaut
schildert. Eine solche Darstellungsweise stellt zwar der Rekonstruktion verlorengegangener
Textpartien oft Schwierigkeiten in den Weg, bedeutet aber fr das Erfassen diffiziler seelischer
Vorgnge eine groe Hilfe. Als Beispiel fr die Variationen in der Darstellung paralleler
Erscheinungen sei der oft wiederkehrende Passus am Ende der bungen angefhrt, der
besagt, da alle geschauten Bilder wieder in den Yogin eingehen:
Am Ende wird alles im Nabel zum Verschwinden gebracht." 129R56, 135V2.
(Am Ende) wirddas zu Erkennende im Nabel zum Verschwinden gebracht. So [erfolgt] das Erwachen.4*
165R5.
Am Ende wird alles zu Erkennende im Nabel zum Verschwinden gebracht. So [erfolgt] das Erwachen."
166R5-6.

[sein] Standort, und am Ende wird alles im Nabel des Yogin zum Verschwinden gebracht.
So [erfolgt] das Erwachen." 139R3.
Die Gte (erfllt) [seinen] Standort, (und dann) wird [alles] zum Verschwinden gebracht. So [erfolgt]
das Erwachen." 147V4.
Am Ende wird alles zu Erkennende im Nabel zum Verschwinden gebracht. Die auf Lotosblumen
sitzenden Buddhas erscheinen in [seinen]Krper eingegangen. So [erfolgt] das Erwachen." 152R3.
Am Ende treten [die Buddhas], das Wort unbestndig, unbestndig' ausstoend, in seine Gestalt
ein: Vollendung der bung der Bereiche." 136R2.
Die Buddhas stoen das Wort ,ruhevoll, ruhevoll* aus und
tritt (am Ende alles) in die Gestalt (des Yogin) ein: Vollendung [der bung des] Ein- und
Ausatmens." 121R56.
Am Ende wird alles zu Erkennende zum Verschwinden gebracht. Die bung ist vollbracht." 135R5.
Am Ende wird alles zum Verschwinden gebracht, und die Welt wird therisch." 130R6.
Dann wird alles zu Erkennende in der Gestalt des Yogin verborgen." 127V6R1.
Dann tritt, zerschmolzen wie ein Klumpen Butterschmalz, alles zu Erkennende in seine Gestalt ein."
136V6-R1.
An (dem Haupte) [des Yogin] entsteht (ein Juwel).
Von den Strahlen, die aus dem Juwel hervorkommen, angezogen, sieht er das zu Erkennende, das sich abwrts und aufwrts befindet, in seine
Gestalt eingegangen." 169R1-2.
Es entspricht dem Charakter eines Meditationstextes, wenn in unserem Werk Bilder und
Vorgnge mehrmals in abgewandelter Form dargestellt und dadurch die Visionen von verschiedenen Seiten beleuchtet werden. Wie wir es bei der Entfaltung der Atmungsachtsamkeit
sahen, werden auch in den anderen Kapiteln kleinere oder grere Abschnitte hnlichen
Inhaltes zusammengestellt. Oft werden diese Abschnitte nur lose aneinandergefgt, manchmal werden sie in der Weise angeordnet, da eine einfache bung die Vorbereitung fr eine
schwierigere bildet.1 Eine weitere Methode der Variation einer bung besteht darin, ein einfaches Bild zu vervielfltigen2:

Dies geschieht in der Betrachtung der Gruppen, S. 96ff.


Das Vervielfltigen von Buddhaerscheinungen wird in anderen Texten hufig berichtet; vgl.
Divy. S. 401, 14:ff:bhagavatsravastymtirthynvijayrthammahaprtiharyam
yvad akanisthabhavanam nirmitam, ,,der Erhabene hat in Srvasti, um die Sektierer zu besiegen, das
Groe Wunder vollfhrt: Er hat einen Kranz von Buddhas bis hin zur Behausung der Akanistha[Gtter] gezaubert." hnlich Divy. S. 162, 9ff: bhagavmi ca padmakarnikaym nisannah paryamkam
bhujya rjum kyam pranidhya pratimukham smrtim upasthpya padmasyopari padmam nirmitam.
tatrpi bhagavm paryamkanisannah. evam agratah prsthatah prsvatah. evam bhagavata buddhapindi
nirmita yvad akanisthabhavanam updya buddh bhagavanto parsannirmatam (? lies: paryamkanisa2

54

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

Dann entsteht
ein blaufarbener, von blauen Sprlingen umgebener Juwel. Ebenso entstehen aus allen [seinen] Krperffnungen blaufarbene, von blauen (Sprlingen umgebene Juwele)."
145B2-3.
(Aus seinem) Haupt tritt ein Lotos in Erscheinung, auf dem der Erhabene sitzt und die Lehre verkndet.
An den Lotosstengeln treten im unendlichen Umkreis Lotosreihen in Erscheinung.
Darauf erscheinen die Wesen in Brahmagestalt sitzend." 144V23.

Solche Vervielfltigungen dienen hier nicht, wie in anderen Texten1, zur Demonstration
der Zaubermacht, sondern sollen den Gesichtskreis des Yogin von einer einzelnen Erscheinung auf die Vielzahl der Wesen erweitern. Von groer Bedeutung ist daher in unserem
Text eine Art der Variation, die dahin geht, da die bungen einmal fr den Yogin selbst,
dann aber auch fr die anderen Wesen die Verwirklichung des Meditationszieles verheien:
[Der Yogin] sieht seine eigene Gestalt von allen Ursachen des Todes umgeben. Indem von seiner
Gestalt Brahma[-Gottheiten] ausgehen, durchschaut er [auch] diese als den Ursachen des Todes [unterworfen]. Dann (sieht er sich selbst von allen) Ursachen (des Todes) befreit.
Ebenso sieht
er fr alle den Ursachen des Todes [unterworfene] Wesen das Entfernen des Todes." 144B35.
,,Bei [dem Yogin] entsteht den Gestaltungskrften gegenber Gleichmut. Dann wird sein Krper von
Wolkenhaufen aus Bergkristall zum Erstarren gebracht. Alsbald sieht er sich selbst in einen bergkristallnen Tempel eingegangen.
berkommt diese [Wesen] ebenfalls Gleichmut. Sie werden
von Wolkenhaufen aus Bergkristall zum Erstarren gebracht. (Er sieht die Wesen) ebenfalls (in Tempel)
aus Bergkristall (eingegangen)." 161V1R1.

Hierbei bertrgt der Yogin selbst das Zeichen seines Erfolges auf die Wesen:
[Der Yogin] sieht die ganze Welt therisch geworden. (Indem er) lange Zeit das Glck des Erloschenseins (empfindet), entsteht [seine] Gestalt (zur Zeit des Erwachens) mit einem [um den Kopf] gebundenen, (edelstem Jbesetzten Seidentuch.
(Aus allen seinen Krper ffnungen) kommen
(ther)gleiche Seidentcher hervor und umhllen das gesamte (Meer der Lebewesen)." 130V35.

So werden die Wesen in seinen Visionen bekehrt und erlst:


,,Alle Wesen treten bestrzt (vor) den Erhabenen und bitten um Aufnahme [in den Orden]. Der Erhabene nimmt sie mit der Komm-als-Mnch-Formel auf. Aufgenommen werden sie frei von den
Befleckungen,
und nehmen Htten an Baumwurzeln ein. Weiterhin
verweilen die Wesen im Ruhesitz sitzend als Gleichmtige.*' 159V46.

Nicht nur das eigene Heil, sondern die Erlsung der leidenden Welt ist also das Ziel der
Meditationen. Daher nehmen die bungen der Gte, des Mitleides, der Freudigkeit und des
Gleichmutes, die die ethischen Beziehungen des Yogin zu seiner Umwelt darstellen, einen
breiten Raum in unserem Text ein. Eingebettet in die bung des Mitleides finden wir dann,
mehrmals geschildert, das Gelbde (pranidhna)2 des Yogin mit der anschlieenden Verheiung zuknftiger Buddhaschaft (vykarana)3:
nnahl) Der Erhabene lt sich in der Lotoskapsel nieder, nimmt den Ruhesitz ein, richtet seinen
Krper auf, konzentriert seine Aufmerksamkeit und zaubert dann ber dem Lotos einen [weiteren]
Lotos. Auch in diesem befindet sich ein Erhabener im Ruhesitz. So auch vorn, hinten und an den Seiten;
und so zaubert der Erhabene eine Buddhahufung: bis einschlielich zu der Behausung der Akanistha[Gtter] erhabene Buddhas im Ruhesitz (?)." Vgl. auch Av. I, S. 87 und die oben, S. 35, Anm. 11 angefhrten Beispiele.
1

Die Fhigkeit der Vervielfltigung gehrt zu dem Bereich der bernatrlichen Macht eines Buddha ,
vgl. Mvy. 215217: anekavidham rddhivisayam pratyanubhavati: eko bhtv bahudha bhavati, bahudh
bhtvaiko bhavati. ,,Er verwirklicht den vielfachen Bereich der bernatrlichen Macht: Wenn er einer
ist, vervielfltigt er sich, wenn er sich vervielfltigt hat, wird er einer."
2
bodhya pranidhnam karoti 151R1; bodhau ca pranidhnam karoti 150V6. Die Form pranidhi
ist in unserem Text nicht belegt. Zur Bedeutung dieser Begriffe vgl. BECHERT, Bruchstcke buddhistischer Verssammlungen I, S. 35ff. u. S. 20, Anm. 1; dort auch die Zusammenstellung der wichtigsten
Literatur.
3
Der Begriff ist in unserem Text nicht belegt.

Einleitung

B. Zum Inhalt

55

(Dann1 entsteht) unter den Fen des [Yogin], der (in Mitleid) wandelt und von Vertrauen
durchdrungen ist, ein Lotos. [Der Yogin] verneigt sich zu Fen des Erhabenen und spricht:
,0 Erhabener, ich mchte in einer zuknftigen Epoche [der] Fhrer (aller Wesen) sein; ein Tilger der
Gebrechen aller Wesen, ein vllig Erleuchteter.' Dann berhrt der Erhabene sein Haupt (mit der Hand)
und spricht: ,Mein Sohn, du wirst in einer zuknftigen Epoche ein Tilger (der Gebrechen aller Wesen
sein), ein vllig Erleuchteter.4 Dann durchdringen Gtter frohlockend den gesamten Luftraum und entlassen einen Regen aus Blumen und Edelsteinen." 152V46.
Brahma, der mit einem Kruge im Vordergrund steht, spricht zu dem Bodhisatva: ,
' Dieser besiegt
, und legt das Gelbde zur Erleuchtung ab.
(Der
Erhabene) bindet ein Band (an den Kopf) [des Yogin] und spricht: Verehrung [sei dir], dem in einer
zuknftigen Epoche erstehenden Steuermann2 der Welt.' Gtter erfllen den gesamten Luftraum"
150V5-R2
In der buddhistischen Literatur finden sich hnliche Schilderungen an zahllosen Stellen in
den Berichten ber die frheren Existenzen der Buddhas. Was aber dort Erzhlung aus vergangener Zeit ist, wird hier aktuelle Gegenwart: Der Yogin wird zum B o d h i s a t v a . 4
Aus der Versenkung heraus nimmt er sein Gelbde zum Heile der Wesen mit in den Alltag:
,,Wenn [der Yogin] erwacht, entsteht bei ihm die feste Hinwendung zur Erleuchtung." 150R34.
In einer solchen Ethik hat der teilnahmslose, kalte Gleichmut keinen Platz. 5 In der bung
des Gleichmutes selbst wird in dramatischer Auseinandersetzung dem alten Ideal des Verlschens im Nirvna das neue Ideal des Groen Mitleids, der ttigen Menschenliebe, entgegengesetzt :
Wenn [der Erhabene] so gesprochen hat, tritt er in die Stadt des Verlschens ein und kommt, an der
gleichsam von thergleichen Wolkenhaufen umhllten (Sttte nichts mehr) begehrend, wie eine Lampe
zum Erlschen. Auch die Jnger (des Erhabenen) treten anschlieend, (in der Zeit) [ihres] vlligen
Verlschens, in (die Stadt des Verlschens) ein und (kommen ebenso) zum Erlschen. (Der ihnen nachfolgende Yogin aber) wird von dem Torwchter zurckgehalten: ,Wenn du
, dann
wirst auch du hier eintreten.' Das gesamte (Meer der Lebewesen) erscheint
Auch die in
schlechten Existenzformen Lebenden, die von Fesseln Gebundenen und die von verschiedenem Leid
Gepeinigten. [Diese]
und sprechen: ,Errette uns, o Mitleidsvoller; nicht ziemt es sich
fr dich, (zur Stadt des vlligen Verlschens zu gehen.' Dann entsteht) in [seinem] Herzen die oben
erwhnte Verkrperung (des Mitleides. [Diese] fat ihn) bei den Hnden (und spricht:) ,Wohin wolltest
du gehen, die Leidenden im Stiche lassend?' Der Gleichmut weicht von ihm; Mitleid berkommt ihn.
Mit [seinen] beiden Armen umschlingt er (das gesamte Meer der Lebewesen) und
" 162R2
bis 163V1.
Hier wird eine neue Ethik verkndet: Weltdurchdringung steht gegen Weltberwindung.
Beide Krfte waren freilich schon dem Urbuddhismus inhrent, denn eine Gruppe von

Vorhergegangen war die Schilderung des Erscheinens des Gottes Brahma, des Buddha und des
Bodhisatva Maitreya.
2
Im Sriputraprakarana des Asvaghosa wird Sriputra von dem Buddha als Steuermann und Heerfhrer der Lehre angesprochen (LUDERS, Sriputraprakarana, S. 390 ( = Phil. Ind. S. 193), C 1. V 4.
3
Das Gelbde des Yogin ist in der bung des Mitleides an zwei weiteren Stellen dargestellt: In
150R6151V3 ist wenig mehr als die Namen Brahma, Buddha und Maitreya erhalten; in 151V6Rl
treten nicht diese Personen auf, sondern nur die Frau als Verkrperung seines Mitleides, die ihn zu
dem Gelbde anspornt. Daher fehlt an dieser Stelle auch die Verheiung (vyJcarana) des Buddha.
4
In der zuletzt zitierten Pranidhischilderung (150V5) wird der Yogin ausdrcklich als Bodhisatva
bezeichnet.
5
Es wird betont (16IV5), da der Gleichmut nur von der Gte her, keinesfalls aber als Hartherzigkeit (nairghrnya) verstanden werden drfe

56

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

Schwrmern, die in weltentrckter Einsamkeit allein der Arhatschaft nachstrebte, htte


schwerlich vermocht, eine weltweite Mission zu entfalten. In unserem Text wird nun, auf
dem Boden des Hinayna, dem Ideal des Arhat ein neuer Menschentyp entgegengesetzt, der
die Bekehrung der Wesen ber die eigene Erlsung stellt. Indem der Yogin in der Versenkung
seine Weihe zum Bodhisatva erfhrt, wird das Mitleid zum Leitstern seines Handelns. Der
Mnch in seiner Klosterzelle, kein berweltliches, anbetungheischendes Wesen, wird hier
zum Helfer der Menschheit.

TEXT UND BERSETZUNG

VORBEMERKUNGEN ZUM TEXT


Die Umschrift gibt in Fettdruck den handschriftlichen Befund der Birkenrindenhandschrift buchstabengetreu wieder; kursive Zahlen im Text [118V1] und die entsprechenden Marginalien bezeichnen
Blatt- und Zeilenzahl. In eckigen Klammern [] stehen teilweise zerstrte Aksaras, und zwar ebenfalls in
Fettdruck, wenn die Lesung trotz der Zerstrung sicher ist. In Normaldruck stehen unsichere Lesungen
in eckigen und Ergnzungen in runden Klammern (). Da die Aksaras in der Handschrift sehr sauber
und gleichmig geschrieben sind, war fr die Wahl des ergnzten Wortlautes oft die genaue Gre
der Lcke entscheidend. Hypothetische Ergnzungen stehen in den Anmerkungen; ihre bersetzung
im bersetzungstext in Kursivdruck. Ergnzungen, deren Wortlaut durch eine der Parallelhandschriften
gesichert ist, stehen in runden Klammern () in Fettdruck. Fehlende Aksaras sind durch Punktpaare
bezeichnet; bei umfangreicheren Lcken kann die Zahl der tatschlich fehlenden Aksaras im geringen
Umfang (bis etwa zu 4 Aks.) von der Zahl der Punktpaare abweichen. In der Handschrift kann der
einfache Punkt ( ) wie auch der Doppelpunkt ( %) sowohl als Zeichen fr den Visarga als auch fr das
Satzende Verwendung finden; in der Umschrift ist das jeweils Sinngeme (h oder |) eingesetzt. Satztrennungen und Kapitelgliederungen sind zur Erleichterung der bersicht eingefgt.
In der bersetzung stehen Ergnzungen in runden (), erklrende Zustze in eckigen Klammern [ ].
In den Textlcken entsprechen dem Punktpaar fr ein fehlendes Aksara drei Einzelpunkte.
In den Anmerkungen wird durch Lies:" auf die korrekte Sanskritschreibung hingewiesen, unabhngig davon, ob die Abweichung auf einem Schreibversehen, einer Schreibeigentmlichkeit oder einer
sprachlichen Besonderheit beruht. (Die Schreibung des Nasals teils als Klassennasal, teils als Anusvra,
ist nicht besonders vermerkt.) Vgl.": weist auf hnliche Textstellen hin, die zur Ergnzung des Wortlautes oder zum Verstndnis des Sinnes beitragen; Erg.:" bezeichnet Ergnzungen, deren Wortlaut
so unsicher ist, da er nicht in den Text aufgenommen wurde.

I. bung der Hlichkeiten (asubhaprayoga)


Vorbemerkung
Der Name dieses ersten Kapitels, von dem nur einige kleine Fragmente erhalten sind, ist aus
der Bemerkung (asu)bhdiprayogena, ,,durch die bung, die mit den Hlichkeiten beginnt"
in 166V2/3 erschlossen.1 Die bung beruht auf den Leichenbetrachtungen des SatipatthnaSutta2, in denen der Mnch seinen eigenen Krper mit einem Leichnam gleichsetzt. Dieser Leichnam wird in verschiedenen Dekompositionszustnden vorgestellt: aufgedunsen" (vydhmtaka,
p. uddhumtaka), blauverfrbt'' (vinilaka), faulig" (vipyaka, viptika, p. vipubbaka),
zerfressen" (khdyamna,^. khajjamna) wraZafeKnoehengerippecc (asthisamkalik, -samkalik, p. atthikasankhalika) 3 , das allmhlich zerfllt und sich in Staub auflst. Diese Begriffe
wurden spter in den Listen der neun Leichenfeldbetrachtungen" (nava sivathik) oder der

In der Liste der Hs. 906 (s. oben S. 27) ist der Name der ersten Kategorie asubhh, Die Hlichkeiten".
2
D. II, S. 295: puna ca param, bhikkhave, bhikkhu seyyath pi passeya sariram sivathikya chadditam
ekhamatam v dvihamatam v tihamatam v, uddhumtakam vinilakam vipubbakajtam, so imam eva
kyam upasamharati: ayam pi kho kyo evamdhammo evambhvl evamanatlto ti. Weiterhin, ihr Mnche,
als she der Mnch einen auf ein Leichenfeld geworfenen Leib, der einen, zwei oder drei Tage tot ist,
der aufgedunsen, blauverfrbt und faulig geworden ist, ebenso stellt er sich diesen [seinen] Krper vor:
Auch dieser Krper ist von solcher Art, ist in solchem Zustand und ist solchem unentrinnbar." Anschlieend wird die Vorstellung auf die weiteren Zerfallszustnde der Leiche ausgedehnt. Ein wesentlicher Unterschied der Sanskritparallele (Siks. S. 21 Of.) besteht darin, da in dieser an eine wirkliche
Betrachtung der Leichen gedacht ist: punar aparam, subhte, bodhisatvah smasnagatah pasyati
nandrpni mrtasarirni smasne ''paviddhdni, Weiterhin, Subhti, sieht der zur Leichensttte gegangene Bodhisatva auf die Leichensttte geworfene tote Leiber in verschiedenen Formen" usw.
Auch andere Bearbeitungen der Stelle (etwa Vism. S. 145ff.) denken an eine tatschliche Betrachtung.
Man vergleiche auch den AbhdhKVy. S. 526, 19ff. zitierten Sanskritvers:
yo bhaven navako bhiksuh saikso 'sampraptamanasah \
gacched asau sivipathikm hamtum rgam yadicchati \\
tato vinilakam pasyet tatah pasyed vipyakam \
lato vydhmtakam pasyed asthisamkalikm apiti |l
,,Wer als Mnch neu ist, ein Schler, noch ohne geistige Reife,
der gehe zum Leichenfeld, wenn er die Leidenschaft abtten will.
Dann sehe er sich eine blau verfrbte [Leiche] an und eine faulige;
dann eine aufgedunsene und auch ein Knochengerippe."
Diese beiden Verse werden auch auf einem Handschriftenblatt aus den Turfanhandschriften zitiert
und erklrt (vorl. Nr. 446).
3
In unserem Text ist die Form samkala belegt (136V1, V2, V3, V6); zu den anderen Schreibungen
vgl. BHSD.

60

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(neun oder zehn) Hlichkeiten" (a&ubha, p. asubha) 1 um einige weitere Vorstellungen vermehrt', verwurmt" (vipadumaka, vipatumaka, vipatmaka, cf. p. puluvaka), verstreut",
(viksiptaka, p. vikhittaka), verbrannt" (vidagdhaka) und rotverfrbt" (vilohitaka, cf. p.
lohitaka). Die Vergleiche sollen dazu dienen, die Leidenschaft (rga) zu zerstren.2 Da sie auch
der bung unseres Textes zugrunde liegen, zeigt der Begriff vipitaka, gelb verfrbt" in 116V5,
der, wie viohitaka rotverfrbt" in der Liste, eine Erweiterung von vinilaka blauverfrbt",
darstellt. Die bung selbst besteht in einer ausfhrlich dargestellten Vision einer Leichensttte
(masna 115V4), wie aus erhaltenen Textworten hervorgeht: herausgeschlagene Weichteile"
115R4, Schenkel gelb verfrbt" 116V 5, wie von einer Getreideschwinge ausgehhlt" (sc.
das Skelett) 116R3, und zu Staub verwandelt, Asche. . . ." 116R4. Anschlieend {Blatt 117)
durchdringen verschiedene Strme (pravha) die Weltrume.
115V1 [1]
.[u]vana ev
V2
[2]
. . .[y].mne krtsnam ja(gat)
V3
'. . [3]
drsyamte paritth
V4 . . . . [4]
pasyati| t[]
V5 [5]
ypacayau3 bahuso gatv [ni]
V6
[6]
[n]sgrc csya vaidryadhvajo (n)i[r](gatah)4
115R1
'. . [1]
R2

t
(s)m(a)snam iva
(samca)-

[2]

(dus)[ca]ritacrinm [p]5
R3
[3] . . . ' . . '
vymisra6 drsyamte|
R4
[4]. . .'
. (u)d[dha]tni ca marmn[y]
R5
[5]
.. .
jivite csya pa
R6
[6]
kaprthagja[n](a)

1
Aufzhlung und Stellenbelege bei WALDSCHMIDT, Ein zweites Dasabalastra S. 282f. Hingewiesen
sei noch auf die Aufzhlung der neun Leichenzustnde als Kontemplationsmerkmale (samadhinimitta)
in der fnften Kategorie der ,,fnf Sttten der Befreiung" (panca vimuktyyatanni), im Strazitat
(aus dem Sangltistra?) AbhdhKVy. S. 54,34.
2
adubhabhvan rgasya pratipaksah, die Entfaltung der Hlichkeiten ist das Gegenmittel gegen
die Leidenschaft" Siks. S. 209,6f.
3
Vermehrung und Verminderung" (des Karman? Vgl. BHSD zu samcaya).
4
Vgl. 153R2: hrdayc csya sauvarno dhvaja utpadyate.
5
Erg. zu p(rva)t Vgl. 156B1: dusc(a)r(i)t(a)crinam atitangatm.
6
Lies: vymisra.

I. bung der Hsslichkeiten (aSubhaprayoga)

61

(Lcke von 116V1 bis V3; ca. 150 ks.)

116V1-3
yvat sainudraparyamt(m mahprthivim) 1
[4].. .'...'
'....'..
(samu)[d]raparyamtym sarvasa[t](v)m
' . . ..[5]
'
uruh2 vipitakam)
dvitly[v].
'. . . ..[6]
|
yathtm[na]m . .

. . (sa)r[v]a[sa](tv)
[1]
kair iva citam sphutitad[]
[2].'
'.
. . . . satvnm ca prthivym tannimagnm
. ' . . . . ' . . . . [3]
\
ripava)navac3 chidrikrtam|4 svam (srayam)
M '
'
y crnlkrtam5 bhasma
'-[5].'
[la] . . .e .1
(Lche von 116R6 bis 117V3; ca. 220 ks.)
avabhsya)7
gatv)
r[p]
laltt prav[h](o nirgatya)10

ba-

(pa-

. . . . (pr)thivl6 bhitvstau mah[n](arakn


. .
[4]
mrdhn niskrmya yva(d aghanisthm
[5]
[ga]tam vinivartyam9 nsti hi
[6]
yati ca|
tato
[1]. .
(sthitim pra)[ya]ti|11

Vgl. 129V1: samudraparyamta mahprthivim.


Lies: rur.
3
Vgl. 136V3: pradip nirgatya sarvny yatanni sarvs ca samkalh paripavanavac chidrl kurvamti\.
4
Satzzeichen wohl zu streichen. Erg. zu: chidrikrtam svam (srayam pasyati\)*! Vgl. etwa 118R5:
jirnam svam srayam pasyati.
5
Vgl. 129V3/4: sarvam vislrnam crnibhtam
pasyati\.
6
Lies: (pr)thivim.
7
Vgl. 129Rl2: pravho nirgatah prthivimandalam bhitv narakm prets cvabhsya (Einl. S. 37f.).
8
Zweite Phase des Stromes; vgl. 147V1: mrdh(n) (n)i(rgatya yvad a)ghanisthm gatv; 133R1:
mrdhn nirgatya\ yvad aghanisthn ava(bhsya); 129R2: mrdhn nirgatyvyucchinnam yvad aghanisthm devn avabhsya.
9
Lies: vinivartya.
10 Einl. S. 35.
11
Vgl. pravho ni(rgatya)
k(r)amena sthitim pray(ati) 154R5 u. .
12
,,Vier Schlangen, [die die vier] groen Substanzen [darstellen]"; vgl. 160R5: mahbhtsivisaparip(rna) (Einl. S. 48 Anm. 2).
2

V5
V6

U6B1
R2

tatah paripkn nbhym .i


. . .'. [2]
. . . . I catvras ca mahbhtsi[v]i(s)12

V4

R3
B4
R5
R6-117V3
V4
V5
V6
117R1

R2

62

117R3

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

. . [3]
amgrasalksadr[^](a)1

R4 . . . . [4]
rodhayit[v]
R56
{Lcke von R5 bis R6; ca. 100 Ales.)

Lies: 4alkaQt!

tarn samni-

II. Entfaltung der Atmungsachtsamkeit (anapanasmrtibhavana)

Vorbemerkung
Die bung gliedert sich in drei Teile: Entfaltung der Atmungsachtsamkeit fr die Gegenwart' ' (pratyutpamnnpnasmrtibhvan), Entfaltung fr die Zukunft'' (angatabhvan)
und Entfaltung fr die Vergangenheit" (atitabhvan). Whrend die beiden letzteren nur aus
je einer kurz geschilderten Vision des zuknftigen bzw. der sechs vergangenen Buddhas bestehen
(128V4-Rl), nimmt die bung in der Gegenwart einen breiten Raum ein (117R6128V4). Dies
ist darauf zurckzufhren, da die Reihe der sechzehn Kategorien, unter denen hier das Ein- und
Ausatmen durchgefhrt wird, vier mal mit unterschiedlichem Begleittext wiedergegeben ist. Die
Reihe selbst geht auf die vier krperlichen Verhaltensweisen in der Atembung des SatipatthnaSutta zurck1, die in anderen kanonischen Texten um weitere zwlf, mehr auf geistige und seelische
Zustnde gerichtete Verhaltensweisen vermehrt ist.2 Im Sanskrit der Turfantexte ist diese Reihe
auf drei Fragmenten 3 erhalten, von denen die beiden ersten zu demselben Text, aber verschiedenen
Handschriften gehren, wahrend die auf dem dritten Fragment berlieferte Textform eine abweichende Gestalt hat. Im Vergleich mit dem Pali (p) lassen sich die beiden Textformen (A und B)
folgendermaen rekonstruieren:
(p): aniecnupassl assasissmiti sikkhati,
aniccnupassi passasissmiti sikkhati;
(^4): anitynupa^yi &vasam anitynupa&yi svasmiti siksati,
anitynupa^yi pra^vasam anitynupasyi prasvasmiti Siksati;
(B): anitynudarsi svsisymiti siksati,
anitynudari pra^vsisymiti siksati.
In unserem Zusammenhang ist vor allem der Unterschied zwischen den Bildungen mit -anudarsin in (B) und denen mit der lteren Sanskritisierung -anupa&yin in (A) von Interesse. Denn in
derselben Weise stehen sich in unserem Text -anupa^yan in der ersten und -anudarsan in der
vierten Reihe gegenber. Der Verfasser hat also die aus verschiedenen berlieferungen stammenden
Reihen nebeneinander gestellt, ohne die Textform zu verndern. Zur bersicht gebe ich nun zuerst
den Textbefund der Fragmente, dann die Zusammenstellung der 16 Kategorien in den verschiedenen Versionen:

D. II, S. 291.
Pali: M.I, S. 425, III, S. 83f., usw.; ausfhrliche Erklrung Vism. S. 224ff. Sanskrit: Mvy.
11731188 (nur bis zur 9. Kategorie); fr weitere Parallelen, vor allem aus chinesischen Quellen, vgl.
DEMi^viLiiE, La Yogcrabhmi de Sahgharaksa, S. 415, Anm. 1.
3
Katalog-Nr. 724, 715 a und Vorl. Nr. 1331.
2

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

64

Textform {A)
Blatt 204'i

724

1
2
3
4
5

Vorderseite
dhy vasati arany ni2///
timukhm3 smrtim=u[pa](sthpya)///
stmamiddham =au(ddhatya)4///
odhayati*///
//////

Rckseite
1
2
3
4
5

IIUli
svasam prasra(bhya)///
svasam prasrabh(ya)///
vedi6 abhipramoday(am)///
sm=iti Siksati | ani(tynupasyi)///

1331

Vorderseite7
1 ///pran(i)dhya pratimu[kh](am ca
sm)r(ti)8
2 U/., stmamiddham ^auddha 9

Rckseite
a ///(cit)t(a)m =^vasmiti siksati vi
b ///(nir)[o]dhnupasyi10 svasam niro[dh](nupa)

Textform
715 au

(B)

Blatt 10[9]
Vorderseite

1
2
3
4

lillll
HIHI
HIHI
[di 3v](si)sy(m =iti Siksati sukhapratisamvedi prasvsisym =iti sik)[s](atil)
[c](i)[t]t(a)kyasa(m)sk(rapratisamvedi)

5 svsisyam =iti si (ksati citta) [k] (yasa mskrapratisamvedi pra)[sv]sisym =[!]ti Siksati | prasra[mbhati] (cittasamskrm sv)6 sisym=iti siksati prasrambhati cittasamskr[m] pra^v(sisym =iti) [si]ksati|
cittapratisamvedp ](&vsisymiti
siksati)

Linkes Eckstck.
Erg. etwa zu: (a)dhy vasati arany ni (v vrksamlni v Sunygrni v pary ankam, bhujya rjum
kyam pranidhya pra)timuJchm smrtim upa(sthpya). Vgl. CPS. 24a.9.
* CPS I, Hs. S 360, Bl. 84 Rl (S. 11,2) liest ebenfalls mukhm.
4
Erg. etwa zu: (kmacchandam vypdah) stinamiddham au(ddhatyakaukrtyam vidkits). Es handelt
sich hier um die Reihe der fnf Hindernisse" (panca nivaranni); Skt. Daso. V, 4 (S. 66) usw.
5
Erg. zu: (cittam pari)sodhayati.
6
Abgekrzte Textform (statt (cittapratisam)vedi vasam cittapratisamvedl svasmiti siksati usw.).
7
Rechtes Eckstck, Zeilenzahl unsicher.
8
S. oben, Anm. 2.
9
S. oben, Anm. 4.
10
anitynupadyi und virgnupa&yi knnen in dem Zwischenraum (vor b) nur in der abgekrzten
Textform gestanden haben.
11
In dieser Handschrift werden anschlieend an die auf Bl. 109 behandelte Atmungsachtsamkeit
(npnastnrti) auf Bl. HO die Kategorien der Meditationen ber den Buddha, die Lehre und die
Gemeinde (buddhnusmrti, dharmnusmrti, samghnusmrti) wiedergegeben.
2

II. Entfaltung der Atmungsachtsamkeit (anapanasmrtibhavana)

65

Rckseite
cittapratisamvedl prav[si]sym =iti 3iksati| abhipramo(dayam citta)m svsisym=i[ti siksati]
(abhipramodayam
cittam pra^v)sisym=iti siksati sa(mdhatt)e [o]i[t](t)a (svsisym =iti siksati sa)[m]dhatte citta 1 pra&vsi[sym =iti siksa](til )

Die Kategorie

3 ()[v]sisym==i(ti &iksati) . . . . . .
. . . . (prasvsisym =iti iksati| an)[ity]nu[da]r()i (svsisym =iti si)4 (ksati an)[i](ty)[](nudarsi)///
5 //////
6 //////

n der

Atembung

a) ,,Langsein [des Atems]" 2


(p) digham v assasanto digham assasmiti pajnti;
digham v passasanto digham passasmiti pajnti.
118V1 (dirgha)ty(m)
b) ,,Kurzsein [des Atems]"
(p) rassam v assasanto rassam assasmiti pajnti;
rassam v passasanto rassam passasmiti pajnti.
118V1 hrasvatym
c) ,,Empfinden des ganzen Krpers"
(p) sabbakyapatisamvedi assasissmiti sikkhati;
sabbakyapatisamvedi passasissmiti sikkhati.
118V3 sarvak(yapratisamvedanym)
122R4 (sarvak)yapratisam(vedanym)
d) Gestilltsein der Gestaltungskrfte des Krpers"
(p) passambhayam kyasamkhram assasissmiti sikkhati;
passambhayam kyasamkhram passasissmiti sikkhati.
118V5 prasrabdhakysamskr(atym)
123V2 (p)r(a)srabdhakyasamsk(ratym)
e) Empfinden von Beglckung"
(p) pitipatisamvedi assasissmiti sikkhati;
pitipatisamvedi passasissmiti sikkhati.
118V5 pritisamvedanym 3
123V3 (pritisam)vedan(ym)

1
2
3

Lies: citte.
Mvy. 1173 beginnt mit hrasvam.
Mvy. 1182 (wie Pli): pritipratisamvedi.

5 Schlingloff, Yogalehrbuch

66

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

/ ) Empfinden von Glck"


(p) sukhapatisamvedi assasissmiti sikkhati;
sukhapatisamvedi passasissmiti sikkhati.
(\ (sukhapratisamve)[7'15aF4]di &v(si)sy(miti &iksati
sukhapratisamvedi praivsisymiti &ik)s(ati|)
118V6 (sukhaprat)isamvedanym
123V4 (sukhaprati)s(am)v(e)danym
g) Empfinden der Gestaltungskrfte des Geistes"
(p) cittasamkhrapatisamvedi assasissmiti sikkhati;
cittasamkhrapatisamvedi passasissmiti sikkhati.
(J5) c(i)tt(a)kyasa(m)sk(rapratisamvedi)1[7i5aF5] asvsisymiti si(ksati
citta)k(yasamskrapratisamvedi pra)svsisymiti iksatij
118V6 (cittasamskrapra)tisamvedanym
125V3 (cittasam)sk()rapratisamvedany()m
h) Gestilltsein der Gestaltungskrfte des Geistes"
(p) passambhayam cittasamkhram assasissmiti sikkhati;
passambhayam cittasamkhram passasissmiti sikkhati.
(A) (prasrabhya cittasamskrm2 )[724i?2]svasam prasra(bhya cittasamskrm svasmSti ^iksati)
(prasrabhya cittasamskrm pra)[72R3]6vasam prasrabh(ya cittasamskrm
pra&vasmiti ^iksati)
(B) prasrambhati (cittasamskrm 6v)[715aF6)sisymiti ^iksati
prasrambhati cittasamskrm pra^v(sisymiti) ^iksati
118R1 (p)r(asrabdhacittasamskratym) 3
i) Empfinden des Geistes"
(p) cittapatisamvedi assasissmiti sikkhati;
cittapatisamvedi passasissmiti sikkhati|.
(A) (cittapratisam)[724R4]vedi
(J5) cittapratisamvedi (^vsisymiti ^iksati)
[7I5aJ?i]cittapratisamvedi pra^vsisymiti ^iksati
118R1 cittapratisamvedanym

1
2
3

Mvy. 1184 (wie Pali)r cittasamskrapratisamvedi.


Erg. nach Mvy. 1186: prasrabhya cittasamskrn.
Erg. analog d): prasrabdhakyasamskrfatym).

II. Entfaltung der Atmungsachtsamkeit (anpnasmrtibhvana)

67

k) Erfreuen des Geistes**


(p) abhippamodayam cittam assasissmiti sikkhati;
abhippamodayam cittam passasissmiti sikkhati.
(^4) [724]abhipramoday(am cittam)
(JS) abhipramo(dayam citta)m &vsisymiti iksati
(abhipramodayam cittam prav)[725ai?2]sisymiti &iksati
125R2 (ci)ttbhipramodany(m)
127R1 cittbhipramodan(y)m
l) Gesammeltsein ( = Sammlung) des Geistes**
(p) samdaham cittam assasissmiti sikkhati;
samdaham cittam passasissmiti sikkhati.
(B) sa(mdhatt)e cit(t)a (vsisymiti ^iksati.
sa)mdhatte citta pravsisymiti &iksa(ti|)
118R3 c(i)tt(a)samdhnaty(m)
127R2 eittasamdnym
m) Befreitsein des Geistes ( = Empfinden der Befreiung)**
(p) vimocayam cittam assasissmiti sikkhati;
vimocayam cittam passasissmiti sikkhati.
(A) (vimucya cittam vasam vimucya [133IRa] cit)t(a)m ^vasmiti iksati
vi(mucya cittam prasvasam vimucya cittam prava[724J?5]smiti ^iksati)
118R4 cittavimocanatym
127R6 yimuktipratisamvedanym
n) Erschauen ( = Erblicken) der Unbestndigkeit**
(p) aniccnupassl assasissmiti sikkhati;
aniccnupassi passasissmiti sikkhati.
(A) [724i?5]ani(tynupayi svasam anitynupasyi svasmiti siksati
anitynupayi prasvasam anitynupasyi pra^vasmiti siksati)
(B) (an)itynudar()I (^vsisymiti i[7i5ai?4]ksati
an)i(ty)(nudarsi pravsisymiti siksati|)
118R5 anitynudarsanyni
128V1 (anitynupaya)nym
o) Erschauen ( = Erblicken) des Entsagens**
(p. vgl.) patinissaggnupassi1 assasissmiti sikkhati;
patinissaggnupassi passasissmiti sikkhati.
128V1 prahnnupasyanym

Die Sanskritform pratinihsarganudarMn ist im Samyuktagama belegt


fizierung einer Handschrift des Nidnasamyukta, S. 386, 390).

(WALDSCHMIDT,

Identi-

68

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

p) ,,Erschauen ( = Erblicken) der Entleidenschaf tlichung"


(p) virgnupassi assasissmiti sikkhati;
virgnupassl passasissmiti sikkhati.
118B6 virg(nudaranym)
128V2 (vi)rgnupasyan(ym)
q) ,,Erschauen ( = Erblicken) des Zunichtewerdens"
(p) nirodhnupassi assasissmiti sikkhati;
nirodhnupassi passasissmiti sikkhati.
(.4) [1332j&](nir)odhnupayi vasam nirodh(nupayi &vasmiti
nirodhnupasyi pra^vasam nirodhnupasyi prasvasmiti ^iksati)
128V2 nirodhnupasyanym
Wir sehen, da die Unterschiede der Reihen unseres Textes von den Pali- und Sanskritparallelen
im Wesentlichen in der Wortbildung, selten in sachlichen Verschiedenheiten liegen.1 Um so
aufflliger ist, da die vierte Wiedergabe der Reihe in unserem Text erst mit der zehnten Kategorie
(k) Erfreuen des Geistes'' einsetzt. Vorher geht, von 126V3 bis 127V1, die Erklrung einer
anderen Reihe, von der sich folgende Glieder erkennen lassen:
das Reinigen der eigenen Windbahn" 126R5;
das zur-Ruhe-Kommen von Nachdenken und Erwgen" 126R6;
die Erlangung der Kontemplation" 126R6/127V1;
das Herbeifhren erwnschter Verhaltensweisen" 127V1.
Hier liegt also eine Meditationsreihe vor, in der der Yogin von der Atembung zu den verschiedenen Versenkungsstufen2 gefhrt wird. Leider ist von Blatt 126 so wenig erhalten, da sich
Einzelheiten und Zusammenhnge nicht bestimmen lassen.
Die bungen des Kapitels werden in der Weise durchgefhrt, da der Yogin zu den einzelnen
Kategorien Symbole und Vorgnge schaut, die die Begriffe veranschaulichen sollen.

Auffllig ist nur der Einschub von prahnnupaSyanym zwischen anitya- und virganupaiyanayrn in 128V1 (118R6 ist unsicher).
2
Das zur-Ruhe-Kommen von Nachdenken und Erwgen (vitarkavicroparama) ist ein Merkmal
der zweiten Versenkungsstufe.

II. Entfaltung der Atmungsachtsamkeit (anapanasmrtibhvana)

69

(ti)[2]sthat[i]|

118V1

hrasva[t](ym|)
(dlrgha)ty(m))
tathaiva parivrttam amtar[ga]tam ea kye|
hrasvatym
tiryan mahcakrav(da) 2 . . . . [2]
dlrghatym
tathaiva parivrttam k(ye 'ntargatam|
hrasvatym |)
c)
tivat prnam srayam vyubhih pasyatij sarvasrotobhir vyun3pravisato
[3]
[s]i [sa]rvam [v] si.. . .
(taila)hradanimagnam4 ctmnam
sarvasrotobhis tailena pra5
visat iti
sarvak[](yaprati[4]samvedanym| ||)

l.)-b)
steht
beim Kurzsein [des Atems].
beim (Lang)sein [des Atems].
Ebenso [ist der Atem] umgekehrt und in den Krper [des Yogin] eingegangen:
beim Kurzsein.
Horizontal [ist der Atem] bis zum Groen Ringwall [um die Erde] {gegangen):
beim Langsein.
Ebenso [ist der Atem] umgekehrt und (in den Krper [des Yogin] eingegangen:
beim Kurzsein.)
c)
sieht [der Yogin seinen] Krper wie
. . . von den Winden erfllt. Indem [der Atem] durch alle Krperffnungen in die Winde
eintritt,
alles
und sich selbst in den (l)teich eingesunken, indem [der Atem] durch alle
Krperffnungen mit dem l eintritt:
(beim Empfinden) des ganzen Krpers.

Die beiden ersten Kategorien Langsein" und Kurzsein" des Atems scheinen zusammen behandelt zu sein, und zwar in der Weise, da der Atem beim Langsein die Rume durchdringt und beim
Kurzsein zurckkehrt.
2
Erg. zu mahcakrav(adagataml Zu mahcahravda vgl. Einl. S. 32.
3
Lies: vyn.
4
Vgl. 118V4: tailahradanimagnam
tailadhr(bhih sim)cyamnam.
5

Lies: praviata.

V2

V3

V4

70

118V5

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

d)
. ..
(prava)[rta]mnam
pasyati|
tailahradanimagnam cakasvastabdham1 u[pa](r)i2 [t]ailadhr(bhih sim)[5]cyamnam3
prasrabdhakysamskr (atym |4 ||)
e)
prltisamyedanym ||

dh nirgat

/) candramandalareei[ta]
m
V6 [6](sukhaprat)i[sa]m[v]edanym| (||)
g)

(cittasamskrapra)tisamvedanyip 11
118R1

h) ci[t]tapatutvam attra cit(ta)[sa]m


tyarasmay(ab
p)[r](asrabdhacittasamskratym| ||)
i)
eittapratisamyedanyip ||

[2]

[t](a) [ev]d[i]-

[]n avastabhya tisthati

d)

sieht [der Yogin]


sich entwickeln, in den lteich eingesunken, vom ther erstarrt und darber
mit lgssen besprengt werden:
beim Gestilltsein der Gestaltungskrfte des Krpers.
e)
. . . ausgegangen:
beim Empfinden von Beglckung.
/ ) Mondscheibenfgleich] entlassen
beim Empfinden (von Glck).

90

beim Empfinden (der Gestaltungskrfte des Geistes).


h) Geistesschrfe [und] hierbei GeistesSonnenstrahlen:
(beim Gestilltsein der Gestaltungskrfte des Geistes)
i)
beim Empfinden des Geistes.

bringt

zum Erstarren:

Lies: cdkasavastabdham. Vgl. 159E6/160V1: cksanibhaih ktgrair ava$thabhya(m)te\; 161R6:


kSamayair ivdbhraktair avastabdhh; (Einl. S. 44).
2
Vgl. 160R3: ksc ca tailadhrah patith.
3
Vgl. 149R3: puparasadhrbhih simcyamnam; 145V4: simcyamno; 128V2: sitalajalapariiktam
iva; (Einl. S. 45).
4
Lies: okya (123V2 richtig).

II. Entfaltung der Atmungsachtsamkeit (anapanasmrtibhavana)

71

k) hr(daye nilapitalohi^tvadtam 1 rasmiklpanirga[t](am)2


(cittbhipramodanym| ||)
l)
[pa]syati|
5
nimit)t(am)4
[3]
[c](i)[t]t(a)samdhna[t][y](m |) 11
6
m) tato hr(daye)
kam samdhisukhasaktam pasyati
()m (e)va [pu]skir[i]ny[](m)
cittavimocanatym| ||

118R2

asvsaprasvsahlyam3 ctra bladrakam ci[t](taR3

ang[r]()bhatraka
grhy[o]ddharati|7

t(am)nimagnam bladra[4](pu)rusas ca tasytatah puskirinT jvalati|

n) durba[li](bhtam dub)[5][kh]i(ta)m jirnam svam srayam pasyati|


. .8
(lo)[ka]h sciryate9
anitynudarsanym

sv(sa) . . . .

k) (In) [seinem] Herzen (entsteht) ein (blaues, gelbes, rotes) und weies, von Strahlenbndeln ausgehendes
:
(beim Erfreuen des Geistes).
l)
sieht er
, und darin einen mit Ein- und Ausatmen verbundenen jungen Knaben (als Symbol) des Geistes (einsinken):
beim Gesammeltsein des Geistes.
m) Dann (entsteht in) [seinem] Herzen (ein Teich)
Er sieht
den (darin) eingesunkenen jungen Knaben dem Glck der Versenkung hingegeben. Ein [wie
glhende] Kohlen leuchtender, mit Sternschnuppen (besetzter) Mann ergreift in eben diesem
Teich (den jungen Knaben) und zieht ihn heraus. Dann brennt der Teich:
beim Befreitsein des Geistes.
n) [Der Yogin] sieht seine eigene Gestalt kraftlos (werden), leiden und verfallen. Ein(und Aus)dtmen
verfllt die Welt:
beim Erschauen der Unbestndigkeit.

nilapitalohitavadata: 133R4, 145V'4, usw. (Einl. S. 41 Anm. 6.)


Lies: kalpa; vgl. 157R3: (ra)smikalpam grhitv smrtini(mittam). Der Vorstellung entspricht
vielleicht der letzte Vorgang (tadvad dityarasmibhih 127V6) in der Paralleldarstellung k) in 127V1Rl.
3
Lies: asvsaprasvasasahiyam'l Vielleicht ist My am aber nur eine Verstmmelung von grhitam;
vgl. 127R3: svsaparigrhitah sa bladraka(h)
prasvsaparigrhitas ca.
4
Vgl. 127R1: asvsaparigrhitam cittam bladrakarpi; (Einl. S. 48).
5
Erg. nimajjamnam] ? Vgl. 125R3: (blad)rakm svsaparigrhitam amtarnimajamnam pasyat(i)\.
6
Erg. pukirini1 In der Paralleldarstellung 127R26 sinkt der junge Knabe in ein Meer {samudra)
im Innern des Yogin ein (Einl. S. 52).
7
Der Satz ist vielleicht folgendermaen zu ergnzen: angr()bhatraka(citah pu)rusas ca tasy()m
(e)va puskiriny(m bladrakam) grhyoddharati]. Vgl. 125R4: (bladrakam) trakoparacitena ca purusenodriyamnam pasyati] (Einl. S. 52). In der anderen Paralleldarstellung 127R26 fehlt die Vorstellung
des mit Sternschnuppen besetzten Mannes.
8
Erg. zu: v(sapra6vsh).
9
Lies: siryate. Vgl. 125R6: (sam)vartanym iva krtsnam lokam visiryamtam pasyati\; 128V1: (lo)kam
crnam visiryate] (Einl. S. 52). Vgl. auch 132R1: satvsatvkhyni siryamnni pasyati.
2

R5

72

118B6

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

o) svsaprasvsm jvalitm pasyati|


(prahnnudarsanym | ||)

tathaiva ca

[6]

p)
[la ph](e)[na]pindkulam svam
2
srayam [pa]syati|
tadvad svsaprasvsm krtsnam ca lokam
119V1 vir[g](nudarsa[2]nymj ||)
q)

(nirodhnudarsanym | ||)
V2

r)

[2]

rt[]n[i]3 mukti[p]4

2. a)
V3 . . . . [3]sya hrdayt klesopaklesa
V4-119R2

{Lcke von 119V4 bis R2; ca. 330 AJcs.)

R3 [3][n].s.[l].t.[n](i)[m](it)t(a)m| .
[4]ns, hastena vaidryaguh5 ra

B4

R5-120V2
(Lcke von 119R5 bis 120V2; ca. 270 Aks.)
V3 [3] n(i)hsrth krtsnam prthivim s[pha](ritv tisthamtij)
V4
6
li(u)[r]e(su n)ilbhni pa

[4] an-

o) [Der Yogin] sieht Ein- und Ausatmen brennen. Ebenso (setzt dieses die ganze Welt in
Brand):
(beim Erschauen des Entsagens).
p)
sieht er [seine
eigene Gestalt von einem Schaumballen durchsetzt; ebenso Ein- und Ausatmen und die ganze
Welt:
(beim Erschauen) der Entleidenschaftlichung.
q)
(beim Erschauen des Zunichtewerdens).
r) (nicht bersetzt)
2. a) (nicht bersetzt)
1

Erg. krtsnam lokam jvlayamti. Vgl. 128V1: (kr)tsna(m) lokam jvalayamti (Einl. S. 52).
Vgl. 128V2: jagat krtsnam phenarsiva d(a)vati (Einl. S. 52). Vgl. auch 132R2: (sva)m srayam
phenapindamayam utpadyat(e)\.
3
Erg. zu: (nihs)rtni1
4
Lies: muktp(uspni) ? Vgl. 126V3: (ni)hsrtaih ratnapuspavarsai sa samgho vyavakiryate; 128V4:
devas ca
pusparatnavarsam utsrjanti.
5
Vgl. 146R1: sauvarn guha.
6
Erg. zu: pa(ttacchatrni). Vgl. 121R5: n(i)labh(an)i (pa)ttacchatrani mahmti. Sprlinge (ankura)
werden als blau (nila) vorgestellt; vgl. 145R2: nilamkuraparivro manih; 121R3: nilbhair amkuraih.
2

II. Entfaltung der Atmungsachtsamkeit (anapanasmrtibhavana)

73

(Lcke von 120V5 bis R2; ca. 270 Aks.)


[3]sm upari pndarny [e]va

V5-120R2
R3

[4]vati| kye csya par pra[s]r(abdhi)1


R4
(Lcke von 120R5 bis 121V1; ca. 170 Aks.)
R5-121V1
ndradhvajam2 utpadyate | nisthnim(i)tta(m)
[2]
121V2
[smr]tinimittni idam aparam nisthnimittam
sama(m)ta3cch(id)r(a)
[3]
V3
(mu)khbhih sudvikasalkbhi4 rdhvamukhbhih5 ratnaci(tbhih)
(rp)y(asa)lkbhyo nllava(r)n() . . . . [4]
V4
(3a)[l]kbhih pndarh patt nihsrth krtsnam
(r)(p)yaslkbhyah nkura6 ni[b](srth) [5]
V5
(ni)lbhh patth7 ye ekse pndar8 te
[dh].t[e]|
tadamtargatah yo[g]. V . . . . . [m] . . . . [6]
V6
(adhipajtirprambhahio sysnm|adhipatirpam|^
pnm| amdarmu[kha]i2
[2]
121R1
(spha)[d](i)kamayam sop()n(am)13 . .
(a)[va]dtacandramandalacit(a)
[2] . . . .
R2
6)punar svsaprasvsa[s]th()n()[n]t(a)r(am) c[i](t)[t](a)
t(a)tr(a)sth(am)
14
c(i)ttam snt(am) drdham ci
sth.. . [s]. . . [3]
nirgatais ca nllbhair amkuraih krtsn prthivi cl(yate| va)[j](r)[](sanns

b) (Richtet) [der Yogin] weiterhin [seinen] (Geist) auf den Inhalt [der bung des] Ein- und
Ausatmens, (bleibt) [sein] Geist feststehend, ruhevoll, fest und lange Zeit
(Atmet er ein), wird die ganze Erde mit blauleuchtenden
Sprlingen bedeckt, die von [seinem]
ausgehen. (Diamantthrone) kommen zum

1
Der Ausdruck lt an einen Zusammenhang mit der Kategorie d) prasrabdhahyasatnskrat
denken.
2
Lies: dhvaja (Einl. S. 22). Erg. zu (i)ndradhvaja.
3
Lies: samamtatahl Vgl. 136V5: samamtatah cchidram
sarvajagat pasyati].
4
Der Text ist verderbt. Lies: suvarnasalakbhirt Vgl. 117RB: amgrasalk0; 124V1: ratnasalk iva
5
Lies: mukhbhi.
6
Lies: salkbhyo ^nkur, oder: 'nkurni. Nach pw. ist ankura Maskulinum; vgl. aber 168V5: tani
cdmkurni.
7
In 127V4 gehren blaue Seidentcher zum Einatmen, weie zum Ausatmen (Einl. S. 43); hnliche
Vorstellungen scheinen hier dem mehrfachen Wechsel zwischen blau (Seidentcher, Sprlinge) und
gelb wei (Seidentcher) zugrunde zu liegen.
8
Lies: pndars.
9
Lies: gato.
10
Lies: rambha.
11
Lies: ivsnm adhi0.
12
Lies: amtarmukha.
13
Vgl. 166V: vaidryasopa(nani).
14
Erg. zu: ci(rakalam)? Vgl. 135R6: tatrastham ciraklam snt . . .iratam ca cittam tithati\.

R3

74

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

121R4 c)odgacchamti|1 tesu nisann buddhh2 ra(t)na[m](ay) [4]


.. .. stambhopara(ci)[t]h3ktgr yvattrtiyamdhynamevam sphutam4pasyati(j
tato
3
R5 sya) mrdhatah5 vajram6 nirgacchati|
tattra nisanno bhaga[v]()m7 . . [5] . . . .
n(i)lbh(n)[i] (pa)[tta]cchatrni mahmti
sarva8
9
caitad indranllabhtirekbh[i] . . . .te
b(u)d[dh]s ca sabdam u[dirayan](t)i
[sajntam10
R6 snta[m] i(t)i"
[6]
(yog)[c]rasray(e
p)[r](a)visatip
sv[sap]ras[v]sanispattir eva []svsapra(svsa)^
122V1
[1]
3. a), 6), c)
V2

[2]

V3

[c]ch

[3]

V4 . . . . . . (pra)visati| prasv(asatas ta)[t]r(a ti)[stha]ti| (e)[v](am) ponahpu[4](nyena|)14


V5
(sarvasrot)[o](bh)[ya]s ca tadvarn buddh[sr](a)y15
[e] . . . .[5]

Vorschein, auf denen Buddhas (aus) Edelsteinen sitzen und


. . . . mit (glsernen) Sulen versehene Tempel; bis zur dritten Versenkungssphre sieht er
[die Welt] voll [davon]. (Dann) geht von (seinem) Haupt ein Diamant aus, auf dem der Erhabene sitzt und
,
blauleuchtende, groe Seidenschirme. All dieses (bertrifft) das intensive saphirblaue Leuchten. Die Buddhas stoen das Wort aus: ,,ruhevoll, ruhevoll" und
...
tritt (am Ende alles) in die Gestalt (des Yogin) ein:
Vollendung [der bung des] Ein- und Ausatmens; Ein- und Ausatmen
3. (nicht bersetzt)

Vgl. 144V6: vajra,8anesu buddha


kramenodgacchamto drsyamte.
Lies: buddh.
3
Erg. zu: (vaidrya)8tambho. Vgl. 126V2: prsadam
vaidryastambhadharitam; 158R3-.
vaidryastambh(a)m(a)h(ap)r(sda).
4
Vgl. 132V3: (kt)(g)raih 8(phu)ta(m) prthivim pasyati.
5
Lies: mrdhato.
e 150V5 als Maskulinum belegt (Einl. S. 22).
7
Vgl. 149V4: bhagavam vajrasanadhi(rdhah) (Einl. S. 47, Anm. i).
8
Lies: sarvam?
9
Lies: indranbh0! Die bersetzung ist unsicher; es scheint von dem Leuchten des Buddha die
Rede zu sein, das auch sonst als atireka bezeichnet wird (buddham
sryasahasrtirekaprabham,
Av. S. 99,6). Die Buddhas leuchten saphirblau durch ihre Usnlsa: buddh (tesm usnisapra)bhy
krtsnam jagad indranilbham drsyate 144V6.
10
Lies: Sntam.
11
Vgl. 136R1: amte ca tadsraye anitya(m a)nityam iti sabdam udiray(am)tah pravisamti.
12
Erg. etwa zu: (amte sarvam yog)crs'ray(e p)r(a)vUati\ (Einl. S. 53).
13
Lies: evdSvsa0.
14
Lies mit 127V5: paunahpunyena.
15
Vgl. etwa 136-JR1: sarvasrotobhyah buddhapratyekabuddhasrvakh (Einl. S. 35).
2

II. Entfaltung der Atmungsachtsamkeit (anapnasmrtibhvana)

75

(Lcke von 122V6 bis R3; ca. 250 Aks.)


ry(am)[t](a)

V6-122E3
(p)(r)[n](a)h samudra ut[p]a(dya)te| (tat)[p](a)'
m svsak(n)m

[4]

(sarvak)yapratisam [5](vedanym | 11)

R4
B5

d)
{Lcke von 122R6 bis 123V1; ca. 150 Aks.)
yam sa[m]ksipya sray[](t)1 pr(a)[v]([2]ho nilisrtab)
[5]
(P)[r](a)srabdhakyasamsk[3](ratym| ||)

R6-123V1
V2

V3

e)
(pritisam)[v]edan[^](ym| ||)

V4

f)
(sukhaprati)s(am)v(e)danym | [5]

V5

g), h), i), k), l), m), n), o), p), q)


. . . . .h kya2 padmacitam [6]

..

V6

bh[i] dh[]rbhih3 yogcrsra[2](yam)^


nam utpadyatej

123R1
[2]

R2

(m)[u]ktpuspa5[3]

R3

bhir abhra[4](ktaih)
(nirodhnudarsan)y [am] |6
4. a), b), c), d), e) punar svsapra[5](svasa)
[d].n(i)[m](itta)m samudracan(d)[r]a(m)7 [6]

Lies: samkipyraya(t).
Lies: lcyam. Vgl. 131R4: (loham) padmacitam.
3
Lies: bhir dhrbhir.
4
Vgl. 124V4: suvarnavarnbhi snigdhbhir dhrbhir asray . . . .
5
Perlen und Blumen"; vgl. S. 109, Anm. 12.
6
Ergnzung unsicher, abhrakta entspricht prsda (Einl. S. 44) in 126R2 und 128V2 und lt
auf das Ende der bung schlieen; auch die vorher erwhnten Perlen und Blumen werden in den
Paralleldarstellungen (119V2; 126V3; 128V2 u. 4) in der abschlieenden Vision (r) genannt.
7
,,Mond[spiegelung] im Meer"; vgl. udakacandra in Mvy. 2814, unter den Beispielen fr die Irrealitt (mydayah).
2

R4

76

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

124V1

(u)[p]arimam upaciyate

[1]

(va)[h](i)t(a)c(e)tasahi ratnasalk2 iva ratnacitdity(a)m(a)nd(a)[l]([2]ni) . .

V2

V3 yati|
V4 [4]
V5

svityamandaloparacith3
evam krtsnam lokam sphuta(m) pas[3]
'
.'...'.....'.....'..'
(suvar)[n](a)bhjanaparyamtesu4 ca ratnacitdityamandalni . . .[r]. . . . .
'.'
(nihs)rtbhih suvarnavarnbhi5 snigdhbhir dhrbhir6 sray
[5] ..

V6 .

[nam] bhajane 7 ca pryamne bhjanaparya(m)t[a] . . . .


.'
|
sukhapratisamyedi
svst sukha[1]

[6]

124R1 pra[ti](samved.)

(svsapra)s[v]s pravarta(m)te
[2]

B2 yogcrsrayah pra

tadvad

(pritisamvedanym |
/ ) sbhogam sbhisamskram ca tasmim sama)ye cittam bhavati8 tesm ca ratnn[m]
[lo]kah s
[3]
'...,'. . '
9
(sukhaprat)isamvedanvahitacetasa[b] srayam anamtaparyamt(a)

.....

[lasujryamandalni10 nimagnni drsyamte)

[6]

'

'. ..

hrdaye pl

salkbhih11 dipavaty12 utkarsanayogena13 pradi. .


V

(sukhapratisamvedan) [y ][m
125V1

g) sjbhogam sbhisams[k]ram ca tasmim samaye ci(ttam bhavati |)14 [1]

Lies: c(e)taso. Erg. zu: (sarvakyapratisamvedanava)h(i)t(a)c(e)tasot Vgl. 124R3: (8ukhaprat)isam~


vedanvahitacetasah.
2
Vgl. 121V3: salkbhi
ratnaci{tbhih).
3 Lies: ditya.
* Vgl. 151R6: suvarnabhja(na).
5
Lies: varnbhih.
6
Vgl. 146V2: snigdhasuvarnarasam.
7
Lies: bhjane.
8
Vgl. 124E6: sbhogam sbhisamskaram ca tasmim samaye ci(ttam bhavati); = 125V3.
9
Lies: cetasa.
10
Lies: 08rya0? (sonst immer dityamandala0).
11
Lies: Salakbhir.
12
Lies: dipavad oder dipavad vyutkaPi
13
Vgl. Einl. S. 29 f.
" Vgl. 124R2, 125V3/4.

II. Entfaltung der Atmungsachtsamkeit (anapanasmrtibhavana)

[|]

etny adhipatirpni

77

punar svsaprasvs n. [v]. . . [2] 125V2

(ma)[n]dalaih sragdmabhir iva vymisrh1 adho yvad vyuma'...."


'

nda[l](am) [3]

V3

(cittasam)sk()rapratisamvedan[y]()[m]( |)
h) sbhogam ca sbhisamskram t(asmim [4] samaye cittam bhavati |)2

V4

(prasrabdhacittasamskratym |)
i) [ajnbhogam3 anabhisamskra(m) sntam tasmim samaye [c]i(tta)[mj (bhavati)

[5]

V5

[ca] bladrakam Saddam(ta)h sveto ga[ja]h4 ag(ra)[ha]


.. [6]

.'.'..'..'...I

"

V6

(cittapratisamvedanym |)
h)

(pa)syati
[i]
[2]

bhramamtam5

tamnivistadrst(i)m ca pramudi[t].

ts ca bladrakah prasvasatah6 ra[tna]


'
'

125R1
R2

(ci)ttbhipramodany (am |)
/) smtarba[hi]s ca t[ai]la(p)[](rnam)
tarn amtarnimajamnam9 pasyat(i)[|]io
(cittasa[4]mdhnatym |)

[3]

7
(blad)[rak]m8 svsaparigrhi-

R4

m)

[t]rakoparacitena ca [puru]senodriyamnam12 pasyati[|]13

ii

[5]

1
Lies: vyamiSra.
2 Vgl. 124R2, R6.
3
Lies: anbhogam. Zu anbhoga, entspannt*', vgl. 16IV3: (stri)
paryamkena niannnabhogvasthit upeksdhipatirpam.
4
Lies: gajo ^(ra)0.
5
Vgl. 159R1: pratitya8amutpdacakram
bhramamtam.
6
Lies: pravasato.
7
Erg. zu: taila(p)(rnam samudrampasyati); vgl. 127R1: (amtah8a)mudram utpadyat(e)\ (dvi)tiyam
bahih (Einl. S. 51).
8
Lies: (blad)rakam.
9
Lies: nimajjamnam.
10
Vgl. 127R1/2: svasaparigrhitam cittam bladrakarpi amtahsamudre nimajjati asvasatah.
11
Erg. bladrakam.
12
Lies: oddriyamnam.
13
Vg\.118R3/4: angar()bhataraka(citah pu)rusas ca tasy()m {e)va puskiriny(m bladrakam)
grhyoddharati] (Einl. S. 52).

R5

78

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

[la](m) ktgrvastabdham svam srayam pasyati1

cittam cnuddha[ta]..

125R6 . . [6]
(cittavimocanatym |)
n)
. . (sam)[va]r[ta]nym2 iva krtsnam lokam visiryamtam pasyati|3
126V1 ani(tynu[l]daranym|)
o)

(prahnnudara) [n] () [y] ()m |


p) simham dityamandalopacitam ratnopacit[ai]r [a]. . [2]
V2 (virgnudaranym |)

V3
V4
V5
V6
126R1

q)

(nirodhnudarsanym |)
5
r)
(anam)[t]paryamtam6 prsdam7 utpadyate| vaidryastambhadhri8
tam| tatra si(m)[3](h)
9
.
(ni)hsrtaih10 ratnapuspavarsai11 sa samgho vyavakiryate ||
5. [ a)-i) ] puna
[4]
(pr)thivim avastabhya tisthati|
dvitifya] ksarnj
catvra
[5]
[p](ai)r adityamandalam|12
pratibaddh drsyamte| [b]
[6]
'.
.'.
r[i]tam avikampyam tmnam pasyati | nbhym
[1]
. . ' .

'

R2 [s]gre dvicchidro bhavati


E3

(n)-

tbhym svsapra(^vsa)

tato bhagaym yathoktasm[r](tinimittni)13.

[2]
[3] . . . .

1 Einl. S. 34.
samvartani, Weltvernichtungsperiode**; vgl. 161V4: evam udakasamksobhah agnisamksobhah
vyusamksobhah yathsamvartanisu.
3
Vgl. 128V1: (lo)kam crnam visiryate (Einl. S. 52).
* Einl. S. 52.
5
Erg. utthnakale*! Vgl. 128V2: utihnakale muktcith prsda utpa(dya).
6
Lies: (anam)taparyamtam. In Handschriften und Drucken (LV, Sukh.) erscheint hufig die Schreibung anamtparyamta, unendlich-grenzenlos". In unserem Text steht fast immer anamtaparyamta;
einmal (145V3) auch dnamtam paryamtam. Auch das Tibetische versteht den Begriff als unendlicher
Umkreis" Mvy. 6480: mihalyyas mu med (-pa).
7
Statt prsda (Einl. S. 22).
8
Vgl. 158R3: vaidryastambh(a)m(a)h(ap)r(sada).
9
Erg. zu: tatra 8i(mhsandhirdho bhagavm prdur bhavati. Vgl. 149R6: bhagavm 8imhQsa(ndhirdha). In der Paralleldarstellung 128V3 bindet der Erhabene ein Seidentuch um den Kopf des
Yogin; der Blumenregen geht von Gttern aus.
10
Lies: srtai. Erg. zu: (tammukhanfyhsrtai. Vgl. 127V2: buddh
tammukhanihsrtai ratnapuspapadmavarsair loko (vyava)k(i)ry(a)te.
11
Lies: varsaih.
12
Lies: ditya0.
13
Vgl. 127V4: yaihokta8mrtinimittani.
2

II. Entfaltung der Atmungsachtsamkeit (npanasmrtihhavana)

(b)[la]draka iva . . .r
.... [4]

79

(n)[t](ar)g(a)t(a)[] c(it)[t](a)[n](i)[m](i)[t]t(am)idr(yate|)
126R4

(sukhasa)m[j]nym|

jvalamti duhkhasamjiiy| 2

nenjnep

antahsusira[h] . . . . [5]

adhytmavyupathaparisodhant| 4

R5

sthitak-

[y]o [6] (bhavati)

R6
5

[k](r)ta vitarkavicroparamtj
sthitacitto bhavati [sa][2]mdhiprati[l]()bht| rjubh()[v](a)
127 VI
.. t
ksuprahmanam6 bhavati abhipretakryvhakatvt|7 ||
hf punar svsaprasvst9 vhayatah sphadikamayo [2] [l]okah10 [sraya]s ca drsyamte)
V2
11
13
[ta]t[o] mrdhnfa]!! [rat]n(amayo vrksajh^anamt lokadhtavah spharitv tisthati) tasmim
vr[k](s)e ghanapa[t](r)askhsu buddh dkyamte 14
dharmam desayamtah
tammukhanihsrtai [ra[3]t]na[p]u[s]papadmavarsair [n|][n]()varnair loko (vyava)[k](i)ry(a)te|15 vrksaV3
mlni ca vaidrybhmny16 antahsusirni . . . ,17 y(o)gerapdatalaih kmcanacakre pratisthit18 drsyante|19

k) Lt sich weiterhin [der Yogin] von Ein- und Ausatmen leiten, erscheinen die Welt
und [seine] Gestalt aus Bergkristall. Dann durchdringt (ein Baum aus) Edelsteinen von
[seinem] Haupte aus unendliche Weltregionen. Auf diesem Baum erscheinen in den dichtblttrigen Zweigen Buddhas, die die Lehre verknden. Von den Edelstein-, Blumen- und
Lotosregen, die in verschiedenen Farben aus ihrem Munde hervorkommen, wird die Welt
berschttet. Die glsern leuchtenden, im Innern hohlen Wurzeln des Baumes erscheinen
mit den Fusohlen des Yogin auf der Goldscheibe feststehend.

Vgl. 118R2: baladarakam cit(tanimit)t(am).


Lies: Qsamjnym\.
3
Lies: enjane.
4
Vgl. S. 68.
5
Lies: &(r)*?
6
Lies und erg. zu: (samya)ksuprahinnrn1
7 Vgl. S. 68.
8
Die Paralleldarstellungen (Je) in 118R12 und 125V6-R2 sind sehr viel krzer. In 125R1 tritt ebenfalls der junge Knabe (baladaraka) auf; andere bereinstimmungen sind nicht festzustellen.
9
Lies: praSvsd.
10
Lies: loka.
11
Lies: mrdhno,
12
Lies: (vrkso) 'namtm. Vgl. 15IV4: ratnamayo vrksa udgatah krtsnam lok(am) spharitv( ti$thati\);
~ 1S1R5 (Einl. S. 40).
13
Lies: lokadhatm (Einl. S. 22). Vgl. 130V4: anamta lokadhatm spharitva; 14V15: 'namtam lokadhtum spharitva.
14
Vgl. 152R1: (ratnavrk)s(a)h
tada(dhir)dhah samyaksamb(uddh)s. Die Vorstellung, da die
Buddhas nicht auf Lwenthronen oder Lotosblumen, sondern auf Bumen sitzen, ist ungewhnlich.
15
Vgl. 126V3: ratnapuspavarsai sa samgho vyavakiryate.
16
Lies: bhny.
17
Erg. cat
18
Lies: pratisthitni.
19
Vgl. 151V4: (vrksamlani ca kmcanacakre pra)tisthitni sauvarnni ksirapariprnni drsyamte\.
2

80

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

127V4 (1) tatahi [^] svasatah2 n[i]lbhh patth tadadhirdhni yathokta[sm]r[ti]nimittni|3 bladrakas ca vaidryam[l]()dibhih kmcanacakram avatarati prasvasatah4 avadtbhh
V5 pa[5]tth tadadhirdhni|5 smrtinimittni b[ladraka] (c)a sarvaskhbhi6 nih7 sarvabuddhnm upari pattacchatram krtv tisthati( | e)vam paunahpunyena|
V6 (2) punar svasatah8 nilbhmukthrdhir[6]dhh9
eta evvataramti|
prasva(satah)10
avadtamukt()[h]rdhirdhh
sarvaskhsu sarvabuddhnm mukthram cchatram11
[k](rtv)[] (t)i[stha]ti
(3) tadvad dityarasmibhih^
127Rl tatah sarva13 jneyam yogcrasra14 [1] 'ntardh[I]yat(e)15
cittbhipramoda[n] (y)m |

(1) Atmet [der Yogin] dann ein, [entstehen] blauleuchtende Seidentcher; auf diesen
sitzen die oben erwhnten Symbole der Achtsamkeit: Der junge Knabe steigt zu der Goldscheibe mit den glsernen Wurzeln usw. hinab. Atmet [der Yogin] aus, [entstehen] weileuchtende Seidentcher; auf diesen sitzen die Symbole der Achtsamkeit: Der junge Knabe
[kommt] mit allen Zweigen hervor und macht ber alle Buddhas einen Seidenschirm. So
[geschieht es] zu wiederholten Malen.
(2) Atmet weiterhin [der Yogin] ein, [entstehen] auf blauleuchtenden Perlenschnren
sitzende [Symbole]; auch diese steigen hinab. Atmet [der Yogin] aus, [entstehen] auf weileuchtenden Perlenschnren sitzende [Symbole]: In allen Zweigen macht er [ber] alle
Buddhas einen Perlenschnurschirin.
(3) In derselben Weise [geschieht es] mit Sonnenstrahlen.
Dann wird alles zu Erkennende in der Gestalt des Yogin verborgen:
beim Erfreuen des Geistes.

Lies: tata.
Lies: ivasato.
3
Einl. S. 43.
4
Lies: vasato 'vadt0.
5
Satzzeichen zu streichen.
6
Lies: Hkhbhir.
7
Lies: nihsrtah?
8
Lies: vasato.
9
Lies: nilbha0.
10
Lies: prava(sato) 'vadta0.
u Lies: chatram (Einl. S. 20).
12
Die bung wird also in der dritten Form dahingehend abgewandelt, da an die Stelle der Seidentcher (patta) oder der Perlenschnre (mukthra) Sonnenstrahlen (dityaraimi) treten.
13
Lies: sarvam.
14
Lies: yogcriraye. Die Auslassung des ye ist ein wohl durch das Blattende bedingtes Schreiberversehen.
15
Einl, S. 53.
2

II. Entfaltung der Atmungsachtsamkeit (anapnasmrtibhavana)

81

4
l) tatah 1 yog(c)rsrayah2 candramandalasamksafh]3
(sa)mudram5
6
utpadyat(e)| (dvi)tlyam bahih svsaparigrhitam cittam bladrakarpi amtah[2]samudre 127R2
nimajjati? svasatah prasvsapari[g](r)[h]I[ta]m8 evam bahihsamudre prasvasatah
cittasamdnym|9 ||

m) amte cm(tali)[sa]mudre nimagnam samdhisukhasaktm10 pasyati| ulksahasrni11


cmtah[3]sam(u)d(r)e nipa[t]am[t]i [n]aijvalamti12 kvathamti 13 evam bhyasa[mu](d)r(e)|
Svsaparigrhitah sa bladraka(li14 amta)hsamudre nimajjati prasvsaparigrhitas ca bahih
amte ca spha[4](di)[kama]y(ai)h ktg()[r](ai)[hp
m
I\M anekasataparivram17 muktcitam tatah smrtisa[h]i(yo bha)[ga]vn utpadya pattam badhnti pndaram18

l) Dann (erscheint) die Gestalt des Yogin scheinend wie die Mondscheibe. (In [seinem]
Innern) entsteht ein Meer, und ein zweites auen. Atmet [der Yogin] ein, sinkt der beim
Einatmen erfate Geist in Form eines jungen Knaben in das Meer im Innern ein; atmet er
aus, der beim Ausatmen erfate ebenso in das Meer auen:
bei der Sammlung des Geistes.
m) Am Ende sieht er [den jungen Knaben] in das Meer in [seinem] Innern eingesunken
dem Glck der Kontemplation hingegeben. Tausende von Fackeln fallen in das Meer in
[seinem] Innern, flammen auf und sieden, und ebenso in das uere Meer. Der beim Einatmen erfate junge Knabe sinkt in das Meer in [seinem] Innern ein und der beim Ausatmen
erfate auen. Am Ende (sieht) [der Yogin] (sich selbst) von Tempeln aus Bergkristall (umhllt), perlenbesetzt und mit vielhundertfachem Gefolge. Dann entsteht der mit Achtsamkeit
verbundene Erhabene und bindet ein gelb weies Seidentuch [um den Kopf des Yogin].

Lies: tato.
Lies: (
3
Vgl. 144R5: c(and)r(a)samksm cdt{mna)m.
4
Erg. zu: (drSyate\ amtahsa)mudram.
5
Lies: (sa)mudra (Einl. S. 22).
6
Lies: rpy.
7
Lies: nimajjaty.
8
Lies: g(r)hitam.
9
Zusammenstellung der Paralleldarstellungen (118B2-3, 125R2-4) Einl. S. 51. Zur Verkrperung
des Geistes durch einen jungen Knaben vgl. Einl. S. 48f.
10
Lies: osaktam. Vgl. 118R3: bladrakam samdhisukhasaktm. Zusammenstellung der Paralleldarstellungen Einl. S. 51 f.
11
ulka, Fackel" ist ebenso wie bladraka junger Knabe", ein Symbol des Geistes (cta); vgl.
Einl. S. 48f.
12
Lies: ujjvalamti, samjvalamti o. .?
13
Vgl. 128V1: jvalitaih kvathamnam jagat.
14
Lies: bladrako Cmta)h.
15
Vgl. 127R5: evam anamta lokadhtavah sphadikamayaih ktgraih pariprn drsyamte.
16
Zu ergnzender Wortlaut unsicher. Vgl. 161V2: sphadikaktgrnmtargatam atmnam pasyati;
125R5: ktagrvastabdham svam srayam pasyati; 153R6: ratnaktgrair ivopagudhm pasyati; usw.
(Einl. S. 44f).
17
Der Ausdruck scheint sich hier auf den Yogin zu beziehen, obwohl die Bezeichnung anekasata
(oder ~sahasra)parivra sonst nur den Buddhas (und dem Bodhisatva Maitreya (128V)) zukommt.
18
Vgl. 128V3: bhagavms casya sirasi pattam badhnti (Einl. S. 41).
2

6 Schlingloff, Yogalehrbuch

^3
R*

82

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

127R5 samamtatas ca siraso mukt[5][h]()r() n(i)rgacchamti


pattena mukth[r](ai ca). . . .
[ti]| evam anamta 1 lokadhtayah sphadikamayaih ktgraih pari[p]rn
R6 drsyamte| tadantargats ca buddh bhagavamtah 2 anekasa[6]tapariv(r)h 3 ta[th]ai(va). .
parivram upaguhya tisthamtij
vimuktipratisam [v]e[d]anym |
128V1

n) tatah 4 sysaprasvsh5 vajracith pravartante| 6


(anitynupasya)[n]ym| ||
o) tatas trti[y]
prahnnu[pa]syanym| ||

V2

[I] (lo)kam crnam [v]isir[y]a[t]e|7

(kr)tsna(m) lokam jvlayamtis

p) [t]air eva jvalitaih kvathamnam jagat krtsnam phenarsiva9 d(a)vati10 [2]


(vi)rgnupasya[n](ym| ||)
q)
[ y]o[g][c][r](raya)m
r(a)[m](a)[n]t(am) pasyati

sitalajalapansiktarn11 iva12 upa-

Von [seinem] Kopf gehen ringsum Perlenschnre aus; durch das Seidentuch (und) die Perlenschnre
Ebenso erscheinen unendliche Weltregionen von
Tempeln aus Bergkristall erfllt, und in diese eingegangen erhabene Buddhas mit vielhundertfachem Gefolge. Ebenso . .
umhllen sie [jeweils] ihr Gefolge:
beim Empfinden der Befreiung.
n) Dann entwickelt sich mit Diamanten besetztes Ein- und Ausatmen. Die Welt zerfllt
zu Staub:
beim (Erblicken der Unbestndigkeit.)
o) Dann (im) dritten
setzen [Ein- und Ausatmen] die ganze Welt in Brand:
beim Erblicken des Entsagens.
p) Durch eben diese Brnde bringt er die ganze Welt siedend wie eine Schaummasse in
Wallung:
beim Erblicken der Entleidenschaftlichung.
q) . .
(die Gestalt) des Yogin
sieht er wie mit khlem
Wasser besprengt zur Ruhe kommen :

Lies: anamta.
Lies: bhagavamto 9neka.
3
Vgl. 154R6: (kta)grmtargata buddh; 146VIx ktagraparivaritani tadarntargatms ca
buddhm bhagavamtah tejodhtusampannm (Einl. S. 45).
4
Lies: tato.
5
Lies: pravs.
6 Einl. S. 47.
7 Zusammenstellung der Paralleldarstellungen (118R4-5, 125R6-126V1) Einl. S. 52.
8 Paralleldarstellung (118R5-6) Einl. S. 52.
9
Lies: phenarsir iva. Vgl. die Paralleldarstellung 118R6: ph(e)napindakulam svam (Xsrayam pasyati
(Einl. S. 52).
2

10

Lies: d()vayatil
" Lies: iitala*.
12
Lies: ivopa0*

II. Entfaltung der Atmungsachtsamkeit (anapnasmrtibhavan)

83

nirodhnupasyanym| |
r) utthnakle1 muktcith2 prsda utpa[3](dya) [tjatrmtah3 muk[t]
* . . 128V3
bhagavms casya5 sirasi pattam badhnti|6 kathayati caivam7 npnasmrtir bhvayitavy
evam cais hhvit supariprn bhavati [4] devs ca krtsna[m] gagana8 pryamn9 pusV4
10
paratnavarsam utsrjanti
iyam pratyutpamnpnasmrtibhyanl11
6. angatabhvanym|
75
nimnam pradesam pasyati mukteitam tadupa[5]ri12 urupramn bhsur manayah13
(ditya)[man]d(a)[l](o)[p]ari sthh tadadhirdho yogcrah14 tmnam pasyatij15 abhisambuddhm16 cryamaitreyam anekasryakasahasraparivram17
te ca bhiksavah keci[6]d
V6
dirghatsampann drsyamte kecid yva[n n](irodhnupa^ya)nm18sampann d[r]syainte19
beim Erblicken des Zunichte Werdens.
r) Zur Zeit des Erwachens entsteht ein perlenbesetzter Palast und dort im Innern, (ebenso)
])erlen(besetzt), ([seine] eigene Gestalt). Der Erhabene bindet ein Seitentuch um seinen Kopf
und spricht: In dieser Weise soll man die Atmungsachtsamkeit entfalten. Ist sie in dieser
Weise entfaltet, ist sie gut ausgefhrt." Gtter erfllen den gesamten Luftraum und entlassen
einen Blumen- und Edelsteinregen.
Dies [war] die Entfaltung der Atmungsachtsamkeit fr die Gegenwart.
6. Bei der Entfaltung fr die Zukunft:
[Der Yogin] sieht eine flache Gegend, die mit Perlen besetzt ist; ber dieser [erscheinen]
in weiter Ausdehnung leuchtende Juwelen, die ber Sonnenscheiben stehen. Auf diesen sieht
[der Yogin sich] selbst und den vllig erleuchteten edlen Maitreya mit einem vieltausendfachen Gefolge von Jngern sitzen. Von diesen Mnchen erscheinen einige in das Langsein
[des Atems] eingedrungen, bis hin zu solchen, die in (das Erblicken des Zunichtewerdens)
eingedrungen [sind].
1

Sonst immer: vyutthna.


2 Lies: citah.
3
Lies: mto.
4
Erg. zu: mukta(cita evsrayah). Vgl. 134V4: tato niruddhe sarvasmim jneye mu(k)t(acita)ktgre
'ntargatam mukteitam e(va) . . . .
5
Lies: csya.
6
Vgl. 150R1: {bhagavms csya sirasi pa)tta(m) badhnti kathayati ca namo 'ngate 'dhvani bhavisya
jagatkarnadharya (Einl. S. 41).
7
Lies: kathayati ca\ evam.
8
Lies: gaganam.
9
Lies: pryamnah.
10 Einl. S. 40.
11
Lies: pratyutpamnnpnaP.
12
Lies: upary.
13
Lies: manaya.
14
Lies: yogera.
15 Vgl. 144R45: candramandaldhirdham
ct(mna)m.
16
Lie : buddham.
17 Vgl. 152V3: ryamaitreyah bodhisatvaganaparivrtah; 151V1: ryamaitreyas ca tatparivaras ca.
18
Lies: n(irodhnupas'ya)nym. dirghat ist die erste (a), nirodhnupa&yan die letzte (q) der Kategorien der Atembung.
19
Vgl. 129B4 (Ende der bung der Elemente): bhiksavo dhtuprayogam bhvayamti; vgl. auch
159V4-6 (Einl. S. 54).

84

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

iyat a(n)[ga]tal)hvanym|1 yatr[n]e[na] (bh)vayitavy me tatkusalamlam bhavisyati|


128R1
7. atltabhvany|2 [1]
pratilomam3 kSyapdivipayiparyamt4 [b](uddhm) sapa(riv)rm pasyati
tatra ctmnam iva ku(sa)lamlam|5 bhvayamtam pasyati |
[t](e) ca bhagavamtah 6 uparyupari
drsyamte j |
R2
8. evam iyam npnasmrti 7 [2] saparikarm| 8 savises nispamn ya[k](tavy| 9 ta)[s]m[]d e(ta)c chrtv10 yogcryaih^yogcrais ca upadese12bhvanymca nayisdah kartaR3 [vya]iti| 13 atah param14 anirkrtadhyyinm smrtyupasthnni[3]rvedhabhgiyas(r)manyaphalni15 sasambhrlamkr[](ny16 u)tpadyamte ||

Soweit [die Atmungsachtsamkeit] bei der Entfaltung fr die Zukunft, wobei sie von ihm
entfaltet werden soll [in der Erkenntnis]: Mir wird daraus die Wurzel des Heils [zuteil]
werden.
7. Bei der Entfaltung fr die Vergangenheit:
[Der Yogin] sieht rcklufig die [Reihe der] (Buddhas) mit K&yapa am Anfang und Vipayin am Ende samt ihrem Gefolge. Dort sieht er gleichsam [sich] selbst die Wurzel des Heils
entfalten. Die Erhabenen erscheinen jeweils ber [ihm].
8. So kann man diese Atmungsachtsamkeit samt Vorbereitung und Besonderheiten als
vollendet bezeichnen. Darum sollen, wenn sie dies gehrt haben, Yogalehrer und Yogin in
der Unterweisung und in der Entfaltung nicht nachlassen. Versenkt man sich unablssig,
entstehen darber hinaus die Anwendungsbereiche der Achtsamkeit, die zur Durchdringung
fhrenden [Eigenschaften] und die Frchte des Asketentums samt Zurstung und Fertigkeiten.

Lies: iyat(na)gata.
Lies: bhvanym\.
3
Vipas*yin ist der lteste, Ks*yapa der Jngste der sechs Vorlufer des historischen Buddha. Der
Yogin schaut diese Reihe rcklufig", d. h. den ihm zeitlich am nchsten stehenden Ksyapa zuerst.
4
Lies: paryamtm.
5
Lies: mlam bh.
6
Lies: bhagavamta.
7
Lies: 8mrtih.
8
Satzzeichen zu streichen.
9
Vgl. 152R4: saparika(rm savises ka)run nispam(n va)ktavyd.
10
Lies: chrutv.
11
Lies: yogcryair.
12
Lies: copadeie.
13 Einl. S. 29.
14
Lies: param a.
15
Lies: smrtyupasihnaP.
16
Unter sambhra sind die Mittel zu verstehen, die die Erleuchtung (vgl. bodhisambhra) vorbereiten,
wie Freigebigkeit usw. (apariprnadndisambhratvt AbhdhKVy. S. 3,7). alamkra wird hier kaum
in dem Sinne von ,,Schmuckmittel", sondern in dem ursprnglichen Sinne des Wortes ("making fit,
suitable"), den GONDA, Remarks on Similes, S. Iff., herausgearbeitet hat, zu verstehen sein.
2

III. bung der Elemente (dhatuprayoga)

Vorbemerkung
Die bung beruht auf der Betrachtung des Krpers nach den Elementen im SatipatthnaSuttaA Es werden dort vier Elemente genannt, aus denen der menschliche Krper besteht: Erde"

(prthividhtu), Wasser" (abdhtu), Wind" (vyudhtu) und Glut" (tejodhtu). Andere


Texte fgen diesen vier groen Substanzen" (mahbhta) 2 noch die Elemente ther" (k^adhtu) und Bewutsein" (vijiina) hinzu? Die anatomischen Bestandteile des Krpers,
die im Satipatthna-Sutta vor den Elementen betrachtet werden, werden dann den einzelnen
Elementen zugeordnet: Haare, Ngel, Zhne, Haut, Fleisch, Sehnen, Knochen usw. gehren dem
Element Erde an, Galle, Schleim, Eiter, Blut usw. dem Element Wasser, die Krperwinde dem
Element Wind, die Krperwrme und Verdauung dem Element Glut, die Krperhhlungen
dem Element ther und die geistigen Bestandteile dem Element Bewutsein.** Die Auenwelt
(bhya)5 kann ebenfalls in die Elemente zerlegt werden, und zwar besteht alles Belebte (satvkhya)
aus den sechs, alles Unbelebte (asatvkhya) nur aus den fnf Elementen ohne Bewutsein.^
In der bung vermitteln Strme und Symbole dem Yogin die Erkenntnis, da der Krper
keine Wesenseinheit, sondern ein Konglomerat aus den sechs Elementen darstellt, und daher
vergnglich und wesenlos ist. Auch die Wesen erlangen die Fhigkeit, in den Objekten die Elemente zu erkennen.

D. II, S. 294: Puna ca param, bhikkhave, bhikkhu imam eva kyam yaththitam yathpanihitam
dhtuso paccavekkhati: atthi imasmim kye pathavidhtu podhtu tejodhtu vyodht ti. ,,Weiterhin,
ihr Mnche, schaut der Mnch eben diesen Krper in seiner jeweiligen Stellung oder Lage hinsichtlich
seiner Elemente an: In diesem Krper ist das Erd-Element, das Wasser-Element, das Glut-Element
und das Wind-Element."
2
Erklrung des Namens (nach Samghabhadra) AbhdhK. I, S. 21, Anm. 1. In unserem Text ist der
Terminus mahbhta nur im Kompositum mit ivisa, Schlangen", belegt (vgl. oben, S. 48, Anm. 2).
3
Pli D. III, S. 247 usw.; Skt. Sang. VI, 15; Siks. S. 244,13f.; Dhs. LVIII; weitere Parallelen
AbhdhK. I, S. 49, Anm. 2.
PliM. III, S. 240ff. - Skt. &ks. S. 245,1 ff.
5
Vgl. oben, S. 48, Anm. 3.
6
Vgl. 160V5: (saddh)atuvibhgena krtsnam satvasamudram
asatvakhyam ca pamcadhtuvibhgena durch Zerlegen in die (sechs) Elemente das gesamte Meer der Lebewesen, und das Unbelebte
durch Zerlegen in die fnf Elemente". Zu den Begriffen satvkhya und asatvkhya vgl. AbhdhK. I,
S. 17, Anm. 2.

86

128R4
R5
R6
129V1

V2

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

ato 'nantaram dhtuprayogah i yogasstropadisto 'nusartavyah


iha tu prayogamtram
darsayisymah2
l.a) ta[4]thaiva [s]i(ldikrtaparikarmanah3 p )[]dn(gus)[tha](na)khavivare cittopanibaddhah kryah tato nakhavivaram makaramukham iva laksyate tena cittam pravesayati|4
yad [5] m(r)dh()nm5 (r)[dh](va)
(ava)[sth]payati| tadupari cittopanibandham karoti| tato mto[d]ivat pariprnam nnprakrair
7
asucibhih svam srayam pa[6]syati|6
tatra
8
9
[ram] pasyati| ksadhtuh caksuhsausirydinm| vijnnadhtuh lo markatabladrakabinducitolk[d]Imii . . . . [2] .i|
6) [ta]d[vat] sarva[satv]()[s]r(a)y(e)su12 as(at)[y](kh)[y](esuoa13 kr)tsna(m) lo[k](am)..
(nakhavi)varamaka(ram
ta)d[ai]kasmim kesapra(vh nirga)[ccha](m)ti| samudraparyamt14 mahprthivim prya dvi[2]tiyapdngus(th)e nakhavivaramakarm. ..

Unmittelbar darauf soll man die bung der Elemente, wie sie im Yogalehrbuch dargestellt ist, nachvollziehen. Hier aber wollen wir nur die bung beschreiben:
l.a) (Hat) [der Yogin] ebenso (die Vorbereitung, an deren Anfang) die Tugend (steht,
durchgefhrt), ist die Konzentration des Geistes auf den Spalt zwischen den Ngeln der
[beiden] groen Zehen auszufhren. Dann sieht der Spalt zwischen den Ngeln wie das Maul
eines Seeungeheuers aus. In dieses lt [der Yogin seinen] Geist eingehen. Wenn er [sein]
Haupt aufwrts
, trennt er
,
ber
diese(s) konzentriert er [seinen] Geist. Dann sieht er [seine] eigene Gestalt wie ein Stuch
von verschiedenartigem Unrat erfllt. Hierbei sieht er (die vier Elemente)
. ..
; das Element ther [wird dargestellt von] Augenhhlen
usw.; das Element Bewutsein [von] einem Affen, einem jungen Knaben, einer gesprenkelten Gazelle, einer Fackel usw
b) Entsprechend [verhlt es sich] bei den Gestalten aller Wesen (und bei dem Unbelebten).
Die ganze Welt
das Seeungeheuer in dem Spalt zwischen [seinen]
(Zehngeln). Dann gehen bei dem einen [Zeh] (Strme) von Kopfhaaren aus. Sie erfllen die
meerbegrenzte groe Erde und werden bei dem zweiten groen Zeh (im Maul) des Seeungeheuers im Spalt zwischen den Zehngeln (zum Verschwinden gebracht),

Lies: yogo yoga0.


Statt der theoretischen Einleitung, die den anderen Kapiteln vorangestellt ist, wird hier auf das
Yogalehrbuch verwiesen.
3
Vgl. 134'Rli sildikrtapari(karmanah).
* Einl. S. 36.
5
Lies: m{r)dh{a)naml
6 Einl. S. 34.
7
Erg. (catvri mahbhtni) ? Wie im Satipatthnasutta folgt auf die Betrachtung der krperlichen
Unreinheit die der Elemente des Krpers, die hier durch Verkrperungen dargestellt werden.
8 Lies: UhtuS.
9
Vgl. 160V4: madhyamam gandam ksadhtuh susirataratvt] (Einl. S. 48).
10 Lies: dhatur.
11
Lies: ^dinmt Zu den Verkrperungen vgl. Einl. S. 48.
12
Lies: y(e)$v a.
13
Vgl. 160R2: satvkhyms csatvkhyms ca tulayati; 160V5: satvasamudram
asatvkhyam ca.
Der Yogin bertrgt hier die beim eigenen Krper gewonnene Erkenntnis auf die Auenwelt.
14
Lies: paryamtm.
2

III. bung der Elemente (dhatuprayoga)

87

. . . . . . . . .* .i .i
[r]
(prav)[h](a)spharanan[i]r(o)dh(au)| [e](vam) kesdipuru[sa](pra)vahh s[ph](a)rananirodhau ca) 2 tadvan nndhtupurusapra[3]vh [ra]n 129V3
. . . . . . [h][s](ra)yam3 [sama]m(tam c)[ch](i)[d]r(am) prandik[yo]4 . .sunyam 5 pasyaty 6 evam
sarva[satvsa]tvkhyam|7
tadva . . . . . . bhinnam rajahsam
[pas]yati|
tatari
V4
sarvam vislrnam c[4]rnibhtam8 vyumandalaparyamtam adhah (co)r(dh)[v]am yvad
aghanisthaparyamtam10 pasyati | tni ca rjsy 11 amtahsunyni 12 pa[s](yati)
[sujnyatnuklatvd13 asya manasikrasya
2. a)14 punah kalal[5]vastham dhtusatkam pasyati tatra ca|15 sivi(s)
dhtuvarnh
tammadhye samkham kasadhtunimittam|16 tadam[ta](rgatam ca) bladrakamukham pasyati vij[n]nadhtunimi[t](t)a[m]
jl[v]i[ta][6]tantunnubad[dha]m
tac
ca mtuh kuksv arbu(dap)e(sighanapra)skhnukramena|17 [vajrdhamnam pa[sya]ti

. . . . . . : (der Strme) Durchdringen und Zunichtewerden. Ebenso Strme von Menschen aus
Kopfhaaren usw.: Durchdringen und Zunichtewerden. In derselben Weise Strme von Menschen aus den verschiedenen Elementen: (Durchdringen und Zunichtewerden, Hier) sieht
[der Yogin seine eigene] Gestalt vollstndig hohl, von Kanlen
und leer, und ebenso
alles Belebte und Unbelebte. In derselben Weise sieht er
zerbrochen, zu Staub
Dann sieht er bis zum Windkreis abwrts und aufwrts bis zu den Aghanistha-[Gttern] alles zerfallen und zu Staub geworden. Auch diese Stubchen sieht er im
Innern leer durch das der Leere Angemessensein [seines] Beherzigens.
2.a) Weiterhin sieht [der Yogin] die Sechszahl der Elemente im [Embryonal]zustand
Kalala. Dabei [erscheinen] Schlangen in der Farbe der (vier) Elemente, inmitten von diesen
sieht er eine Muschel als Symbol des Elements ther und in diese eingegangen das Antlitz
eines jungen Knaben als Symbol des Elementes Bewutsein, [dies alles] durch den Lebensfaden miteinander verbunden. Dies sieht er im Mutterleib der Reihe nach zu [den Embryonalzustnden] Arbuda, (Pesi, Ghana) und Praskha wachsen, geboren werden, [die Lebens-

Lies u. erg.: makaram(ukhe nirudhyamte)*!


2 Einl. S. 46.
3
Lies u. erg. zu: pravhh spharana(nirodhau\ i)h6(ra)yamt Der Beginn eines Satzes mit iha
ist jedoch ungewhnlich.
4
Lies: prandik0.
5
Lies: Snyam.
6
Lies: pasyati] evam.
7
Vgl. 130V1: krtsnam lokam satvsatvkhyam.
8
Vgl. 129V3: (lo)kam crnam visiryate\.
9
Vgl. 125V2: adho yvad vyumandal(am).
10
Vgl. 146R1: rdhvd aghanisthaparyantam; 169V6: cordhvam yv(ad aghani)stha.
11
Lies: rajmsi.
12
Lies: Hnyni.
13
Lies: snyat0. Vgl. 136V5: esd sunyatnukl pariks.
u Einl S. 47 f.
15
Satzzeichen zu streichen. Lies: c6ivi(s).
16 Lies: ktaP.
17
Satzzeichen zu streichen. Zu den fnf Embryonalzustnden kalala, arbuda, pzi, ghana und
pradkha vgl. AbhdhK. II, S. 58, Anm. 1; dort weitere Stellenbelege.

88

jyamnam

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

blakaumrayau[va](madhyavrddh) 1 . . . . cirya2 vydhitam [ma](hallakam)


3

129R1

b)[l] tadvat sarvasatvnm yathsambhava4 esa eva [v]. .[r]. . . (ya)th[o]ktah5 crnapurusaka [385V1]^ utpadyate]

3. a) 7 tadanamtaram abhisekensra(yam8 prinayan)


[t](a)t[o]|9bhrumadhye cittopanibaR2 [385V2]nh&h tasm(t pravho nirgata^ 0 [2] prthivimandalam bhitv narakm prets 11
cva[bh](sya12 km[35F3]eana)[ca]k[r]am bhitv pmandalam13 vyumandalam kasadhtum14 avabhsya (pa)ri[355F4]vartya nbhym pravisya mrdhn nirgatyvyucchinnam
E3 yvad aghanisthm de[3]vn avabh[]sya ca[t](u)[355F5]r(dh)[y]narasamd[ya]15 mrdhn
punah pravisa[t]i|
b) punar bhrumadhyd ekah pravho nirgacchati &vi[385Rl]tiyo (n)[bh]y() misribhR4 tarn16 prathi[v]i17 spharitv tisthati| prvam bhrumadhyd vicchidya[4]te| tato [385R2]
nbhyh
Stadien] Kindheit, Jugend, Jnglings-, Mannes- und Greisenalter (durchlaufen), verfallen,
krank und gebrechlich werden, (sterben und zu Staub werden).
b) In derselben Weise entsteht von allen Wesen ihrer Entstehung gem dieser
eben erwhnte Staubmensch.
3.) Unmittelbar darauf beglckt [der Yogin seine] Gestalt durch die Besprengung. Dann
[erfolgt] die Konzentration des Geistes auf den Mittelpunkt zwischen den Brauen. Von
diesem geht ein Strom aus, durchbricht den Erdkreis, erleuchtet die Hllen und die Gespenster [weiten], durchbricht die Goldscheibe, erleuchtet den Wasserkreis, den Windkreis
und das Element ther, kehrt zurck, tritt in den Nabel ein, geht durch das Haupt aus,
leuchtet ungeteilt bis zu den Aghanistha-Gttern und tritt mit der Essenz der vier Versenkungssphren wieder durch das Haupt ein.
b) Weiterhin geht der eine Strom vom Mittelpunkt zwischen [seinen] Brauen aus und der
zweite vom Nabel; [ihr] Gemisch durchdringt die Erde. Zuerst wird es vom Mittelpunkt
zwischen den Brauen aus geteilt, dann vom Nabel aus.
1
Vgl. AbhdhKVy. 198,32f.: pamca garbhvasthh kalalrbudapeighanapradkhvasthh pamca
jtvasthh blakumrayuvamadhyavrddhvasth ity. Nach Vgbhata (KIRFEL, S. 187) whrt die Jugend
bis zum 16. und das Mannesalter bis zum 70. Lebensjahr.
2
Lies: jirnami Vgl. Mvy. 409597 ( = 7^65657):. jirnah vrddhah mahallaJcah.
3
Erg. (mriyamnam crnibhtam) ?
4
Vgl. 138V6: (sarvasa)tvnm yathsambhavatah pasyati\.
5
Lies: 0okta3. Vgl. 129R1; (ya)thoktah crnapurusalca.
6
Beginn der Parallelhandschrift 3.; Textwiedergabe S. 24 f.
7 129R1-R4: Einl. S. 38f.
8
Zum Begriff abhiseka vgl. Einl. S. 41.
9
Satzzeichen zu streichen,
to Einl. S. 36.
11
Lies: pretmi.
12
Vgl. 146R6: ksirapravho nirgatya prathivimandalam bhitv apyagatnm satvnm sarvaduhkhopasamam krtv.
13
Lies: bhitvdbmandalani.
14
Lies: ksa0.
15
Vgl. 152V1: pravhah
rdhva(m) yvac caturtham dhynam iti tadvarnam evvasthpya.
16 Vgl. 165R4: murdhna
ratnapravhah
sahanbhini(h)s(rt)e(na prav)hena misri bhtah
(sth)itim prayati.
17
Lies: prthivim.

III. bung der Elemente (dhatuprayoga)

89

c) (tato) nbhiparyamta[n](imagnam svam) [](sra)yam pasyati 1 sthi)[t]is ca v[r]ksaparipflrn r&y&[385B3]te tammlanisann bhi[k](s)[av]o dhtuprayogam bh[va]y(am)t(i) 2
tamnakhavivaranih[35i?<]srts ca dhta[5]vah krts[na]m [l]o[k]am spharitv parasparama- 129R5
[ka](ramukhesu tesv eva nirudhyam[355J?5]te|3
evam saddhtumayai)[h p]u(r)u[s]aih
pr[th]i(v)i* (pflrn)m (pa)syati| kad[c](i)d [dh]tum5 vyastm pasyati kadcit samasttp
d) ante sarvam nbhym [6] nirudhyate| 7
-B6
4,a)
[manas]ik(ra)

(utpa)[dya]te
mrdhata e . . . . urdhvamukhas 8 tistha[t](i|)
. . .r
lakacit
trak
pravesaniskramam karoti cchi[2](dra)
[s]a v lo[t.k.]
130V1
tah sarvhy 9 asucidrvyni10 saddhtumandalni 11 ca pasyati |*
b) tadvat kr[tsna]m lokam satvsatvkhyam cchidri12 kriyamnam pasyati13 nbhisth[2]V2
n(m)tar[e] ca ratnamayam simhamukham utpadyat(e)14
[l]o(ka)[h]15 sab(d)am
k[u]rvno niru(dh)yate| yogcrsrayas ca

c) Dann sieht [der Yogin] seine eigene Gestalt bis zum Nabel eingesunken. [Sein] Standort
erscheint von Bumen erfllt, an deren Wurzeln Mnche sitzen und die bung der Elemente
entfalten: Aus den Spalten zwischen ihren Zehngeln kommen Elemente hervor, durchdringen die ganze Welt und werden in eben diesen, den jeweiligen Mulern der Seeungeheuer,
zum Verschwinden gebracht. Ebenso sieht [der Yogin] die Erde von Menschen aus den sechs
Elementen erfllt. Zeitweise sieht er [dabei] die Elemente gesondert und zeitweise vereinigt.
d) Am Ende wird alles im Nabel zum Verschwinden gebracht.
4.a) (nicht bersetzt)
b) In derselben Weise sieht [der Yogin] die gesamte belebte und unbelebte Welt ausgehhlt
werden. Im Zwischenraum [seines] Nabels entsteht das Antlitz eines Lwen aus Edelsteinen.
Dieser gibt das Wort von sich: ,,Die Welt [ist]
", und wird zum Verschwinden
gebracht, wie auch die Gestalt des Yogin.
1

Vgl. 147V2: adau galak(d vicchidya)t(e)\ t(ato nabh)y(ah\ n)bhiparyamtanimagnam cdtm(a)nam


pasyati.
2 Einl. S. 36 f; auch S. 54.
3
Die Mnche fhren die oben, 128R4ff., dargestellte bung durch.
4
Lies: prthi(v)im.
5
Lies: dhtm.
6
Lies: samastn] ?
7 Einl. S. 53.
8
Lies: rdhva0.
9
Lies: sarvny.
10
Lies: dravyni. Vgl. 130R4: asuddravy(n)i.
11
Vgl. 160R2/3: (saddhtu)mandalaih lokam prnam pasyati.
12 Lies: chidri (Einl. S. 20).
13
Vgl. 136V4: pradips ca krtsnam lokam
cchidri krtv.
14
Einl. S. 35. Vgl. 162V5: bhagavatah hrdaye ratnamayah sim(ha) . . . Der Lwe verkndet die
buddhistische Lehre (simhandal). In ostturkistanisehen Wandgemlden ist das Predigen der
Mnche dadurch bildlich dargestellt, da ein Lwe von ihrem Mund ausgeht (in GKNWEDEL, Idikutschari, S. 124, 127, 129).
15
Ergnzung unsicher. Vgl. 121R5: b(u)ddhs ca sabdam udirayan(t)i santam sntam i(t)i; 136R2:
buddhapratyekabuddhasravakah
anitya{m a)nityam iti sabdam udiray(am)tah.

90

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

c) tasmim niruddhe garudamukham utpadyate|


tadamtargatam khadyotakrimim iva
130V3 spandamnam [3] jvalitam vijnnanimi(tta)[m] (pas)y(at)!1
[r]
. garuda*
mukham pari(v)[r]ya tistha2
tato gurudamukhc3 ehabdo (nirgaccha)ti
layanam ca
d)5 ksibhtam ca krtsnam lokam pa[4]syati|6
ciraklam upasamasukham a(nubhya
vyutthnak)[l](e ratna)[ci]tam pattabaddham srayam utpadyate)7
mrdhata[ c](a ni)V5 hsrtam ratnamayam cchatram8 anamt9 lokadhtm spharitv tistha[5]ti|10 echatradandam11
ca kmcanacakre pratisthitam pa(s)y(ati|12 sarvasrotobhya csyk)sanibhh patth13nihsrV6 tya14 krtsnam [s](atvasamu)dram upaguhya tisthamti|15

V4

5. a) punah parik(r)takarmano16 'vasthi[6]tasamdheh17 sasastrah puru(sa utpadyat)e 18 . .

c) Ist dies zum Verschwinden gebracht, entsteht der Schnabel eines Garuda. [Der Yogin]
(sieht) das darin eingegangene, wie ein Glhwrmchen flimmernde, brennende Symbol des
Bewutseins
umgibt er den Schnabel des Garuda, (geht) dann von
dem Schnabel des Garuda das Wort (aus) und die Sttte zerfllt.
d) [Der Yogin] sieht die ganze Welt therisch geworden. (Indem er) lange Zeit das Glck
des Erloschenseins (empfindet), entsteht [seine] Gestalt (zur Zeit des Erwachens) mit einem
[um den Kopf] gebundenen, (edelstein)besetzten Seidentuch. Aus [seinem] Haupt kommt
ein Schirm aus Edelsteinen hervor und durchdringt unendliche Weltregionen. Den Schirmstock sieht er auf der Goldscheibe feststehend. (Aus allen seinen Krperffnungen) kommen
(ther)gleiche Seidentcher hervor und umhllen das gesamte (Meer der Lebewesen).
5.a) Hat [der Yogin] die Vorbereitung durchgefhrt und verharrt er in der Kontemplation, (entsteht) ein Mann mit einem Messer

Einl. S. 48 f. Vgl. auch 137R4: agn(i)jvlmtargatam agnitilakm cetandy adhip(atir)pam\.


Lies: tistham.
3
Lies: garuda0.
4
Lies: (v)isiryate\. Vgl. 128V1: (lo)kam crnam visiryate] ; 125R6: krtsnam lokam visiryamtam;
129V3: sarvam visirnam crnibhtam.
5 130V3-4: Einl.' S.' 54.
6
Vgl. 130B6: amte sarvam nirudhyate ksi bhavati ca lokah tata upasamasukham anubhavati.
7
Einl. S. 45. Vgl. 131R5: tata upasamasukham anubhya vyutthnakle ratnacitam ratnavrksddhar
nisanam cdtmnam pasyati].
8 Lies: chatram (Einl. S. 20).
9
Lies: anamtam. Vgl. aber 145V1: 'namtam lokadhatum.
10
Einl. S. 40. Vgl. 160R5: cchatram ca anam(tam lokam) spharitv sarvasatvn upaguhya tistha(ti).
11
Lies: chatraQ (Einl. S. 20).
12
Vgl. 127 V3i vrksamlni ca
kmcanacakre pratisthit.
13
Lies: patt.
14
Ergnzt nach 148R4/5: sarvasrotobhyas csyksanibhh patta nihs(r)tah. Es ist jedoch mglich,
da die Seidentcher nicht von dem Yogin selbst, sondern von dem Schirm ausgehen, der als Seidenschirm (pattacchatra 120V4, 121R5, 121V5) gedacht ist.
15
Vgl. 151R2: krtsnam satvasamudram upaguhya tistham(ti).
16
Verschreibung fr krtaparikarmano.
17
Vgl. 130R4: krtaparikarmanah avasthitasamadheh.
18
Durch das Messer wird die Welt in ihre Elemente zerlegt; vgl. 160V14: Zerlegung der Gestalt des
Yogin; anschlieend 160V5-Rlx Zerlegung der Welt.
2

III. bung der Elemente (dJiatuprayoga)

91

.. . .
. .m . . . .m1 . . .y samskraga(tam) . . . .
.. cchidram sunyam2 t[m]t(m)Iyavirahi(tam3 pas)y(a)ti| sarvasamsk[l]ragatam vi()Irya- 130R1
nt[am] nirudhya[m]()[n](am) [ca pas]y(a)ti(|)4
b) [s]
. . .[y]. . . .[r]
. . nirmaie5
[na]
(u)pari easya nl[l](apitalohitvad)tarasapariprn()[2]t6 parvath 7 drsyR2
amt(e)
darse ca parvatapratibim(ba)
(n)nvarnena rasena8 sraym9 puraya(ti|)10 ratnbhjanam" iva nirmalar(asa)pariprnam srayam pasya[3]ti| sthit[y]m [ca sa]rvarasapariprnam pa(rvatam)
.. [t](i)sthati|
RS
tasmt pusparasanadyah ksiraghrtanayamtanadyah12 nnvarnaratnanaksatracandramandalanadyah pra[4]viKn y(o)gcr(^rayam prayamtil 13
R4
6. a) punab)
[mu]ktasya krtapari[ka]rmanah14 avasthitasamdheh15dvidhsrayam
16
atisthate|
tatra kaksy[]puta iva nnsucidravy[5](n)[i](|)17 [a]tha ks(u)
(sieht er die ganze Welt) von Gestaltungskrften bewegt,
, hohl, leer, ohne Seele und Seelisches. Er sieht die von allen Gestaltungskrften
bewegte [Welt] zerfallen und zum Verschwinden gebracht werden.
b)
mit reiner (Essenz). ber ihm erscheinen Berge, die von der Essenz [der Farben] blau, (gelb,
rot und wei) erfllt sind. Das Gegenbild der Berge im Spiegel
erfllt [seine] Gestalt mit der Essenz der verschiedenen Farben. Er
sieht [seine] Gestalt wie eine Edelsteinschale von reiner (Essenz) erfllt. An [seinem] Standort
einen von allen Essenzen erfllten (Berg). Aus diesem [kommen]
Blumenessenzflsse, Milch-, Butterschmalz- und Butterflsse und Flsse aus Edelsteinen
in verschiedenen Farben, aus Sternen und Mondscheiben [hervor und] (erfllen) zerschmelzend (die Gestalt) des Yogin.
6M) Hat [sich der Yogin] von
befreit, die Vorbereitung durchgefhrt und verharrt er in der Kontemplation, verharrt [er in] zweifacher Gestalt. Darin [befinden sich]
wie in einer Grteltasche verschiedene unreine Substanzen. Sodann
1

Erg. zu: (krtsn)m (Ioka)m1


Lies: dnyam.
3
Vgl. 160R1: atmtmiyavirahitah.
4
Vgl. 161V1: sa evam vic(i)trsmskragatm hetupratyaydhinam tmtmiyavirahitam
pasyati.
5
Erg. rasenal Vgl. 130R2: nirmalar(asa)pariprnam (Xsrayam.
6
Lies: prn()h^
7
Lies: parvat. Vgl. Einl. S. 47. Vgl. auch 146B5: tadrasapariprnaKparvatah; 135V2: sthityupari
ca parvat vicitryatanacit.
8
Lies: rasend0. Vgl. 148R3: nnvarnarasasekaih.
9
Lies: irayam.
10
Lies: praya(ti).
11
Lies: ratnabhajanam. Vgl. 147V3: amrtarasam
nirmalena bhajanena grhitva.
12
Lies: nadyo.
13 Vgl. 152R1I2: candramandalasamkdsbhir nadibhir yogcrs(r)ayam pryate\ ; 1S1R6/152V1:
candramandalasamksa nadi (srayam p)r(ayati).
14
Lies: samdher. Vgl. 130V5/6: punah parik(r)takarmano 'vasthitasamdheh.
15
Lies: karmano 'va.
16
Lies: avatisthate. Es ist sowohl avatisthati (144R2, 132V5) als auch avatisthate (146V5) belegt.
17
Vgl. 128R5: mtodivat pariprnam nnprakrair asueibhih svam asrayam pasyati\.
2

R5

92

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(ca)[tur]su ca prsv(e)su1 samudracatustayam sarvsucipari130R6 prnam pasyati| ta(dda)rSanasamvignasya ca yoginah2 nirvidabhiscaka3 jvali[6](tam) . .
va
b) amte sarvam nirudhyatej4 fcsi bhavati ca lokah tata upasamasukham anubhavati5
srayo laksannuvyamjanavirjita utpadyate|6
7
7. a) [1] catursu ca prsve[su]
(nilapitalo)hitvadtm pasyatij
8
tesu kramasah pravistasyaj tadvarnarasensra[ya]h pryate| padmni cpanlyamte|
V2
b) ml[dya]bhis9 ca sv[]sra[2]yaprabhbhih krt[s](n)am (lokam prayati| 10 caturbhya)[s ca sajmudrebhya ut[t]arati| [njbhys csya (pu)spapravho nihsrtah11 caturdh [gaccha]ti|
V3 samudresu catursu patatij tata12 samudra13 rasaih p[3]ryamte| pa[d](m)nicopa(niyamte|14

131V1

An [seinen] vier Seiten sieht er eine Vierzahl von Meeren,


die von allem Unrat erfllt sind. Ist der Yogin durch diese Schau bestrzt, (entsteht) ein
[seinen] Abscheu ausdrckendes, brennendes
b) Am Ende wird alles zum Verschwinden gebracht, und die Welt wird therisch. Dann
empfindet [der Yogin] das Glck des Erloschenseins. [Seine] Gestalt entsteht mit den
[Buddha]malen und Nebenmerkmalen prangend.
7M) An [seinen] vier Seiten sieht [der Yogin]
[in den
Farben] (blau, gelb), rot und wei. Indem er schrittweise in diese eintritt, wird [seine] Gestalt von der Essenz ihrer Farben erfllt, und die Lotosblumen werden entfernt.
b) [Der Yogin] (erfllt) die ganze (Welt) mit den blauen usw. Strahlen [seiner] eigenen
Gestalt und steigt aus den (vier) Meeren heraus. Aus seinem Nabel kommt ein Blumenstrom
hervor, geht in vierfacher [Richtung] und fllt in die vier Meere. Dann werden die Meere von
[dessen] Essenzen erfllt und die Lotosblumen werden herbei(gebracht).

Vgl. 136V1: purusa


tasya prsvebhyo dvaracatu$tayam.
Lies: yogino.
3
Lies: scakam.
* Einl. S. 53.
5
Vgl. 130V314: dkasihhtam ca krtsnam lokam pasyati]
cirakalam upasamasukham a(nubhya
vyutthnaka)l(e ratna)citam pattabaddham srayam utpadyate] ; 131R5: tata upasamasukham anubhya
vyutihnakale ratnacitam ratnavrksdhar nisanam ctmnam pasyati\ .
6
Die Gestalt des Yogin wird der eines Buddha gleich; vgl. etwa Divy. S. 268: bhagavn
dvtrimsatd mahpurusalaksanaih samalamkrto 'sity cnuvyanjanair virdjitagtro. Vgl. 150R3, 163V2,
140V6.
7
Ergnzung unbestimmt. Nach dem Textzusammenhang mssen an dieser Stelle vier Meere (s.
unten 131V2: samudrebhya uttarati) sowie auch Lotosblumen (s. unten: padmni cpaniyamte) genannt
sein.
8
Satzzeichen zu streichen.
9
Lies: nildibhis'.
10
Vgl. 162V3: lokam prayati; 166V'4: krtsnam lokam pr(ayamt)i; u. a.
11
Lies: nihsrta.
12
Lies: tatah.
13
Lies: samudr.
14
Vgl. 131V1: padmni cpaniyamte\. Die Lotosblumen mssen wieder erscheinen, weil sie fr die
folgende bung wichtig sind.
2

III. bung der Elemente (dhatuprayoga)

93

c) tato bhrujmadhytl1 n[n](ratna)[ma]yah2 buddhapravho nirgatah padmesu nisanno


drsyate|3
(1) prthividhtu4 sampadyamnah5
tatas ca ghanah pravh[4]

131V4
7
[r].m .i
krtsna ekaghano8 dryate| nitmtalohitavarnah
(2) t a t o ' b d h t u m s a m p a d y a t e
t a evabuddhh9 tebhya udakaprav[5](hebhyah) . . . .
V5
10
yh iva c a loko
laksyate|
(3) tatas tejodhtu11 sampadyate| tebhyo nnvarnny arclm[s]i nihsrtya12 ta[6]
V6
(4) (tato vyudhtum sam)(padya)m(t)e13

(t)[e](bhy)[o] (n)[n](varn)[]14 (v)yukalp

c) (Dann) geht von dem Mittelpunkt zwischen [seinen] (Brauen) ein Buddhastrom aus verschiedenen (Edelsteinen) aus und erscheint in den Lotosblumen sitzend,
(1) indem er in das Element E r d e eindringt: Dann (kommt) eine feste Masse (aus) dem
Strom (hervor),
erscheint die gesamte (Erde) als eine [einzige] feste Masse von durchdringend roter Farbe.
(2) Dann dringt er in das Element Wasser ein: [Indem] eben diese Buddhas aus diesen
Wasserstrmen
sieht die ganze Welt wie
aus.
(3) Dann dringt er in das Element Glut ein: Aus diesen [Strmen] kommen verschiedenfarbige Flammen hervor: (von blauer, gelber, roter, weier, krapproter und bergkristallner
Farbe).
(4) (Dann dringt er in das Element Wind ein: Aus diesen) [Strmen] kommen (ver-

Satzzeichen zu streichen. Lies: madhyan na. Vgl. Einl. S. 35.


Lies: ^mayo. Vgl. 121B3: buddhh ra(t)nam(ay).
3
Vgl. 152R3: buddhs ca padmdhirdhah u. a.
4
Lies: Hhtum.
5
Durch sampad wird die meditative Teilhabe an dem Wesen einer Sache bezeichnet. Vgl. 131R4:
buddhn
$addhtusampannt\. Die Darstellung unseres Textes ist wohl durch den sehr alten
Begriff tejodhatusampanna angeregt (146V1: buddhm
tejodhtusampannm; 146JR2: satv
tej(o)dhatusampanna buddhavapurdharino). Wie in das Element Glut, dringen die Buddhas auch in die
anderen Elemente ein und erfllen die Welt mit dem Wesensmerkmal des jeweiligen Elementes.
6
Erg. zu: pravhn nihsrtahl
7
Erg. lokah.
8
Der Terminus ekaghano wird bei der Beschreibung der die Erde umgebenden Ringwlle verwendet; s. iks. S. 246,2 (aus Pitrputrasamgama): cakravdamahcakravdh samtisthante drdhh
8r ekaghan vajramays, ,,Es bestehen Ringwlle und groe Ringwlle, fest und massiv, aus einer
[einzigen] festen Masse, aus Diamant".
9
Lies: buddhs.
10 Lies: y.
11
Lies: dhtum.
12
Vgl. Divy. 161,4ff.: tejodhtum api sampadyate \ tejodhtusampannasya buddhasya bhagavato
vividhny arcimsi kyn niScaranti tadyaih nilapitni lohitny avadtni mnjisthni sphatikavarnni \.
Dementsprechend ist vielleicht der Rest des Satzes zu ergnzen: ta(dyath nilapitalohitvadtamnjiVthasphadikavarnni \).
13
Lies: (sam){padyat)ee>
14
Vgl. 131V5: tebhyo nnvarnny.
2

94

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

131R1 nihsrtya yo[g](crgrayam cchidri) kurvantil1 himbhra 2 [2]. . . .3 krtsnam lokam (payati|
(5) tata ksadhtum sampadyate|)
r
(c)[ch]. [k]()[s](adhtuva)[rn]h pra(v)h[] gacchamti
yog[c](rsrayam) . . . . . . . . . .4 hi jlR2 [2](rnam krt)[s](nam) lokam|
(6)5 vai[d](rya)
buddh drsyamte) parisuddhabinducita(g)[tr]h6
tatsadrss ca pravh gat yogc(rsrayam) [kr]tsnam ca
R3 traidh([3]tukam spharitv) [t]is(th)am(t)[i](|7 tatah krtsnam) [t]r(aidh)tuk(am buddhsray)[]s8 ca sksmn avsy[ya]bindn9 iva spandamnam10 pa[s]yat[i]|
R4

8. a) punah samksipte11 grhitapadm buddhh12 yogcrsrayam padmair vya[^]vakiramti


aghanistha[pa](ryamtam lokam)13 padmaeitam [ta](dadhir)[dh](m)s ca buddhn14 pasyati
yugapatj15 saddhtusampanntj16 tannihsrtaih pravhai[h pajdmaprayhas cneka-

schiedenfarbige) Windbndel hervor und (hhlen die Gestalt) des Yogin (aus. Er sieht) die
ganze Welt (wie) Schneewolken.
(5) (Dann dringt er in das Element t h e r ein):
. . . . . . . kommen Strme (von der Farbe des Elementes) ther herbei und (lassen die Gestalt)
des Yogin (verfallen. Ebenso) [sieht er] die (ganze) Welt (verfallen).
(6) [Element B e w u t s e i n ] : Es erscheinen Glas- . . . .
Buddhas, mit den makellosen Gliedern gesprenkelter Gazellen. Ihnen
entsprechende Strme kommen herbei und (durchdringen die Gestalt) des Yogin und die
ganze Welt. (Dann) sieht er die (ganze) Welt und (die Gestalten der Buddhas) wie feine
Reiftropfen flimmern.
8.a) Zusammenfassend berschtten weiterhin lotostragende Buddhas die Gestalt des
Yogin mit Lotosblumen. Dieser sieht (die Welt bis hin zu) den Aghanistha-[Gttern] mit
Lotosblumen besetzt und auf ihnen Buddhas sitzen, die in die sechs Elemente gleichzeitig
1

Vgl. 130V1: krtsnam lokam


cchidri kriyamnam pasyati; ^ 136V45.
pw: *himbhra m. Kampfer. In unserem Falle drfte diese Bedeutung wohl kaum zutreffen; der
Begriff wird einen hnlichen Bedeutungsgehalt wie abhrakta (Einl. S. 40f.) haben.
3
Erg. ival
4
Ergnzung unbestimmt. Vgl. 118B5: jirnam svam srayam.
5
Die berschrift tato vijnnadhtum sampadyate \ ist, wohl durch ein Versehen des Schreibers
ausgefallen.
6
binducita ist Symbol des Bewutseins; vgl. 128R6: vijnnadhtuh markatabladrakabinducitolkdlm (Einl. S. 48).
7
Vgl. 133V2: buddhanm pravaho nirgatah traidhatukam spharitv tistha(ti) u. a.
8
Vgl. 121V4: buddhasr(a)ya u. a.
9
Lies: avayya0. avadyyabindu wird Mvy. 2827 unter den Beispielen fr die Irrealitt (mydayah)
genannt.
10
Lies: spandamdnam. Das Flimmern ist ein Merkmal des Bewutseins; vgl. 130V2: khadyotakrimim,
iva spandamnam vijnnanimi(tta)m; 132V61 spandamnm prthivim (Einl. S. 48).
11
Fr samksiptenal (Vgl. PTSD zu sankhitta).
12
Lies: buddh.
13
Vgl. 132R2: aghanisthaparyamtm krtsnam prthivi u. a.
14
Vgl. 152R3: buddhs ca padmdhirdhh u. a.
15
Satzzeichen zu streichen.
16
Lies: sampannn\. Zu sampad s. oben, S. 93, Anm. 5.
2

III. bung der Elemente (dhatuprayoga)

95

varsadhrbhi[5](r) [i](va) syam srayam prya . A


131R5
[te}|
h) tata upasamasukham anubhya vyutthnakle ratnacitam ratnavrksdhar nisanam 2
ctmnam pasyatip sa ca ratnavrksah 4 anamtam lokam [6]spharitv tisthati 5 tatah . . . .
R6
[vr]ksd 6 ratnavarsena krtsnam satvasamudram (u)pagdham pasyati|7 tatah samu(c)[c]()labhedms 8 ca sausirydlm 9 pasyati|
dhtusabdas ca sarvatra
bu[l]
132V1

eingedrungen sind. Von Strmen, die aus diesen hervorkommen und von Lotosstrmen
(wird)' [seine] eigene Gestalt wie von vielen Regengssen erfllt
b) Dann empfindet [der Yogin] das Glck des Erloschenseins und sieht [sich] selbst zur
Zeit des Erwachens mit Edelsteinen besetzt unter einem Edelsteinbaum sitzen. Dieser Edelsteinbaum durchdringt die unendliche Welt. Dann sieht er
von einem Edelsteinregen aus dem (Edelstein)ba,um das gesamte Meer der Lebewesen umhllt. Dann sieht er die Einteilungen in die Hervorbringungen (?) Hhle" u g W e D a s Wort
,,Element" [ist] berall

Erg. zu: prya(te\) oder prya(mnam pasyati\). Vgl. 136V3: varsadharbhir iva
yogcarsrayam pryate.
2
Lies: nisannam.
3
Vgl. 130V3/4: ksibhtam ca krtsnam lokam pasyati]
ciraklam upasamasukham a(nubhyavyutthana&Q)l(e ratna)dtam pattabaddham srayam utpadyate\ mrdhatas c(a ni)hsrtam ratnamayam
cchatram anamt lokadhtm spharitv tisthati\.
4
Lies: vrkso ^namtam.
5
Vgl. 127V2: tato mrdhnah ratn(amayo vrksa)h anamt lokadhatavah spharitva tisthati\ ; 151V4:
(ta)to ratnamayo vrksa udgatah krtsnam lok(am) spharitv( tisthati\).
6
Erg. zu: (ratna)vrksd.
7
Einl. S. 39. Vgl. 130V5: patth nihsrtya krtsnam s(atvasamu)dram upaguhya tisthamti\.
8
Die Bedeutung von samuccla ist unsicher. Das Wort erscheint mehrfach im Yogavidhi( Vgl. Einl.
S. 12 Anm. 3): 1R5: pravhh samucclah darsanasa///; 3V5: samjnsamskrasamucclah; andere Fragmente: ///samucclasmrtyupasthanapra///; ///bdh[i] cdbhinne samucc///.
9
sausirya ist das erste der Symbole des Elementes ther; vgl. 128R6: aksadhtuh caksuhsausirydlnm (EinL S. 48).

96

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

IV. Betrachtung der Gruppen (skandhapariksa)


Vorbemerkung
In einer den sechs Elementen hnlichen Reihe nennt die buddhistische Dogmatik fnf Gruppen i,
aus denen sich die Persnlichkeit zusammensetzt: die Gruppen Form" (rpaskandha), Empfindung" (vedanskandha), Wahrnehmung" (samjnskandha), Gestaltungen" (samskraskandha) und Bewutsein" (vijnnaskandha).2 Zur Verdeutlichung ihrer Wesenlosigkeit
werden den Gruppen fnf Vergleichsobjekte zugeordnet3: Die Form ist wie ein Schaumballen
(phenapinda), die Empfindung wie eine Wasserblase (udakabudbuda), die Wahrnehmung wie
eine Luftspiegelung (marici), die Gestaltungen wie ein Pisangblatt (kadalipatra) 4 und das
Bewutsein wie Blendwerk (my).5 Als Gesamtheit knnen die Gruppen nach ihren acht Aspekten
betrachtet werden, nmlich als Krankheit" (rogatah), Beule" (gandatah), Stachel" (salyatah), bel" (aghatab), unbestndig" (anityatah), Leid" (duhkhatah), leer" (sunyatah)
und Nichtselbst" (antmatah). 6
Die bung beginnt nach einer kurzen theoretischen Einleitung (i.) damit, da dem Yogin als
Vorbereitung (parikarman) die jeweiligen Vergleichsobjekte der einzelnen Gruppen vor Augen
treten (2. und 3.). Anschlieend (4.) durchdringen fr jede einzelne Gruppe zuerst die VergleichsObjekte, dann entsprechende Buddhas die Welt. Die acht Aspekte werden durch Bilder erlutert (6.).

Im Satipatthnasutta (D. II, S. 301 f.) stehen diese als die fnf Gruppen des Ergreifens" (pancpdnakkhandha) innerhalb der Betrachtung der Denkobjekte.
2 Skt.: Daso. V, 3 (S. 66); Sang. V, 2; Mvy. 1832-36; Dhs. XXII; usw.
3 S. 3, S. 142:
phenapindpamam rpam
vedan bubbulupam\
maricikpam sann
sankhr kadalpam]
mypaman ca vinnnam
dipitdiccabandhuna \
Vgl. auch Vism. S. 406, 224. Im Skt. vgl. AbhdhS. S. 15,14f.: yath buddhena bhsitam\ rpam budbudopamam vedan phenopam samjn maricilcopam samskr parnopam (Anm.: Bho kadaliskandho0)
vijnnam myopamam iti\
Vgl. oben, S. 30, Anm. 1.
5
In unserem Text nicht belegt.
6
Vgl. das Strazitat in AbhdhKVy. 273, 13ff.: api tu yat tatropalabhate rpagatam v vedangatam
v samjngatam v samskragatam v vijnnagatam v9 sa tm dharmn rogato manasikaroti, gandatah
Salyato 'ghato 'nityato duhkhatah nyato 'ntmato manasikaroti. Was man aber dabei [als Erfolg der
ersten Versenkungsstufe] an [Dingen] erlangt, die die Form, die Empfindung, die Wahrnehmung, die
Gestaltungen oder das Bewutsein betreffen, diese Dinge beherzigt man als Krankheit, Beule, Stachel,
bel, unbestndig, Leid, leer und Nichtselbst." Die Reihe mit acht Gliedern findet sich auch im Nidnasamyukta (TRIPATHI, S. 126); "gato statt "ghato ist hier wohl nur ein Schreiberversehen. Im Slistambhastra (S. 88) ist die Reihe um asatyatas tucchata rktato 'srato auf 12 Glieder vermehrt; im
Pli (M. I, S. 435; usw.) finden sich 11 Glieder (zustzlich bdhato parato palokato). Spter wurde diese
Liste auf 37 Begriffe erweitert (Mil. S. 418,29ff.), die Vism. S. 524,18ff. ausfhrlich erklrt sind.

IV. Betrachtung der Gruppen (skandhaparlksa)

1
(pratipa)ksahsamanamtaram1
ndhapariksrabhyate | )3

tmadrsti(pratipaksrtham 2

97

ska-

2. t(a)tparikarmdau|4 sdhranam maitrsaydi(m) prvoktam| ayam [2]


132V2
. . .5 [s](a)syariprnm 6 pasyati | t a t h n [ ] . . . .
(b)[]hyam p a r i k a r m a
3. dhytmikam t u parikarma
a) sariram pamcavibh[3](ga)
ni c s u . . . . (kt)(g)[r]ai[h s](phu)t(m) prthivlm pasyat[i]7 pasyatas csya [phe](na)p(i)ndam8 utpadyatej
etad rupaskandhaparikarma|9
b) ksudrair asucidra[4](vyaihi prthivlm citm payatil*1 tato budbu)d12 utpadya(m)te|
yedanaskandhaparikarma13

1. Unmittelbar nach dem Hindernis


, (um des Hindernisses willen), das
in der [falschen] Ansieht [besteht, es gbe] ein Selbst, (beginnt die Betrachtung der Gruppen).
2. Am Anfang ihrer Vorbereitung [steht] das oben erwhnte Gemeingut, [d. h.] die Zuwendung zur Gte usw. Dies
sieht
[der Yogin] (die Erde) von einer Getreidemasse erfllt. So
die das uere [betreffende] Vorbereitung.
3. Vorbereitung [betreffs] des eigenen Selbstes:
a) [Seinen] Leib (durch) Zerlegen in fnf [Elemente]
sieht er die Erde voller (Tempel). Sieht er dies, entsteht ein
Schaumballen:
Dies ist die Vorbereitung [betreffs] der Gruppe Form.
b) (Er sieht die Erde mit) winzigen unreinen Substanzen (besetzt. Dann) entstehen
(Blasen):
Vorbereitung [betreffs] der Gruppe E m p f i n d u n g .

Lies: (pratipa)ksasam. Das hier genannte, nicht mehr erhaltene Hindernis bezieht sich auf die
vorhergehende bung dhtuprayoga.
2 S. unten, S. 115f.
3
Vgl. 134R1: cyatanapariksrabhyate\ ; 136B2/3: bhavabhogatrsnprati(paks)nmtaram\ mohapratipaksrtham pratityasamutpdapariksrabhyate\.
4
Satzzeichen zu streichen.
5
Erg. prthivlm.
6
Zur Definition der Gruppen als r&i, ,,Masse", vgl. AbhdhK. I, S. 37 f.
7
Vgl. 121R4: ktgr yvat trtiyam dhynam evam sphutam pasyati; 124V2: evam krtsnam lokam
sphuta(m) pasyati.
8
Vgl. 132R2: (sva)m asrayam phenapindamayam utpadyat(e)\ ta(to bhrumadhyat phenapinda)pravho nirgacchati\ ; 118R6: ph(e)napindkulam svam srayam pasyati\ ; 128V1: jagat krtsnam phenarsiva.
9
Lies: rpa.
10 Ygi# 230V1: asucidrvyni; 130R4/5: nnasucidravy(n)i.
11
Vgl. unten: karanthaih prthivlm citm payati \.
12
Vgl. 132R4: vmad ams budbudapravaho nih(srtah); 158V3: yathoktam vedanaskandhaparlksaym
tatra duhkhsukhyam vedany udakavarnam budbudam (Einl. S. 46).
13
Lies: vedan0.
7 Schlingloff, Yogalehrbuch

V3

V4

98

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

c) ta(tab)
[ry](ai)s ca karanthaih 1 prthivim citm pasyati [ pasyats2
3
132V5 csya maricikalp [5] (utpadyamte|
samjnskandhaparikarma |)
d)
nirhrtair anyakosthgai4 ca p(r)[th]i(v)I5 prnm pa()y(ati|)
....
(kada)llpatravat putputayogenvatisthamti|6
V6 samskraskandhaparikarma [6]
e). ..
[ma]yas[k](r)totpadyamte| te(na) sparndamnm prthivim7 pa(syati |
vijiinaskan) [dha]parikarma
rpaskandhasya mlasthnmtarni|
132R1 kadamam laltam mrdh[2]
. .
4. a) (i)s
(a)dhy()R2 tmalbhyni9 satvsatvkhyni siryamnni10 pasyati)11 ^Irne ca sa[2]
(sva)m srayam phenapindamayam utpadyat(e)|
ta(to
c) Dann sieht er die Erde mit
Karanthas(?) besetzt. Sieht er
dies, (entstehen) Bndel von Luftspiegelungen:
(Vorbereitung [betreffs] der Gruppe W a h r n e h m u n g . )
d)
sieht er die Erde von
herausgenommenen anderen Vorratshusern
erfllt
verharren sie in dem Yoga des wie ein (Pisang)blatt Faltens und
Entf altens:
Vorbereitung [betreffs] der Gruppe G e s t a l t u n g e n .
e)
entstehen.
Dadurch (sieht er) die Erde flimmern:
Vorbereitung [betreffs] (der Gruppe B e w u t s e i n ) .
Ursprungsinhalte der Gruppe Form :
Ein Schreibstift, der Stirn und Haupt
4,a) [Betrachtung der Gruppe F o r m ] : (1)
sieht [der Yogin] bei [sich] selbst und im ueren Belebtes und Unbelebtes verfallen. Ist
verfallen,
entsteht
[seine] (eigene) Gestalt aus einem Schaumballen [bestehend]. Dann geht (von dem Mittel1

Die Bedeutung des Wortes harantha ist unbekannt. Vielleicht handelt es sich, wie in a) (ktagra)
und d) (kosthgra), um ein bestimmtes Gebude.
2
Lies: payatad.
3
Vgl. 133V1: tato dak$inmd amsd asya maricipravho nirga(cchati).
4
Lies: kosthgraiS.
5
Lies: p(r)thi(v)im.
6
Vgl. 133V3: kadalipatraputputnirbhjanayogena (Einl. S. 30).
7
Vgl. 131R3: tr(aidh)tuk(am)
spandarnanam pasyati; zum Flimmern als Merkmal des Bewutseins vgl. Einl. S. 48.
8
Da die Abschnitte 4.a)~e) (1) und (2) nach dem gleichen Schema aufgebaut sind, ist der fehlende
Wortlaut den erhaltenen Stellen entsprechend ergnzt. Zum Vergleich ist auch fr jeden Abschnitt
seine Vorbereitung (3.a)~e)) heranzuziehen.
9
Die ostturkistanischen Handschriften lesen hufig dhyatma (Daso. immer); in unserem Text ist
sowohl adhyatma0 (126R5) als auch a(dhyt)m(a) (137V2) belegt.
10
Vgl. 136R3: satvsatvkhyas ca bahyo (sc. pratttyasamutpada).
11
Vgl. 118R5: (lo)kah sciryate anityanudarsanyam.

IV. Betrachtung der Gruppen (skandhapariksa)

99

bhrumadhyt phenapinda)[pra]vho nirgacchati| aghanisthaparyamtm krtsnm prthivi1


spharati ta[3](to nbhym nirudhyate|
132R3
(2)tatab)
khanibhnm2 bud(dh)nrp p[r]avha [u]tpad[y]ate| (aghanisthaparyamtm krtsnm) [pr]thivim spharati | punas ca tatraiva nirudhyate
b) yedanskaiidhapariksdhi[^](muktih|
R4
(jf)svam srayam udakabudbu)d(a)c(i)t(m)3 pasyati
kyik[a]
evam sarvasatvnm tato vmd ams4 budbudapravho nih[5](srtab) . .
R5
5
r[n]h duhkhy? jvalit
8
(bu)dbudesustrlmukhnidrsyamte| rgasydhipatirupamp jvali[t]e[6]
m[t]eva praR6
dese [t](at)[r](aiva nirudhyate|
(2) tatati)
(nl)[l]bhnm budbudacittnm10 buddhnm pravho
11
nirgacchatil
traidh[i](tukam spharitv tisthatil
tatraiva ca nirudhyatel
133V1

punkt [zwischen seinen] Brauen ein Schaumballen)strom aus und durchdringt die ganze
Erde bis hin zu den Aghanistha-[Gttern]. Dann (wird er im Nabel zum Verschwinden gebracht).
(2) (Dann) entsteht ein Strom von
gleichen Buddhas und durchdringt die
(ganze) Erde (bis hin zu den Aghanistha-[Gttern]). Wieder wird er ebendort zum Verschwinden gebracht.
b) (Eifer) in der Betrachtung der Gruppe E m p f i n d u n g :
(1) [Der Yogin] sieht [seine] (eigene Gestalt) mit (Wasserblasen) besetzt. Krperlich . .
; ebenso von allen Wesen. Dann (kommt)
aus [seiner] linken Schulter ein Blasenstrom hervor (und durchdringt die Welt)
[sind] (Blasen von der Farbe des Wassers, [die] bei einer leidvollen [Empfindung] brennend
; (bei einer glcklichen [Empfindung]) erscheinen in den
Blasen die Antlitze von Frauen als Verkrperung der Leidenschaft. Bei den brennenden . . .
in dieser
Gegend, (und wird eben)dort (zum Verschwinden gebracht).
(2) (Dann) geht von
[des Yogin] ein Strom von blauleuchtenden,
mit Blasen besetzten Buddhas aus, (durchdringt) die Welt (und wird ebendort zum Verschwinden gebracht).

Lies: prthivim.
Ergnzung unbestimmt, -nibha ist sonst immer nur im Kompositum mit ksa- belegt; vgl. 133V4:
aksanibhanam bu(ddhnam) pravho.
3
Lies: c(i)ta(m)? Vgl. 132B2: (sva)m srayam phenapindamayam utpadyat(e)\.
4
Lies: amsd. Vgl. 133V1: daksinmd amsd asya maricipravho nirga(cchati).
5
Erg. (traidhtukam spharitv tisthati\). Vgl. Einl. S. 46.
6
Lies: rn. Erg. zu: (budbud udakava)rna. Vgl. 158V3: duhkhasukhym vedanya udakavarnam
budbudam
(utpad)y(a)t(e).
7 Lies: duhkhyml
8
Erg. sukhym.
9
Lies: rpam\. Vgl. 158V6: (sukhym vedanaym sukhitasya rga ut)padyate (Einl. S. 49).
10
Lies: citnm.
11 Einl. S. 46.
2

7*

100

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

c) samj)[n]()skandhapariks(dhimuktih|)
(1)
svandamnam1
tato daksinmd2 amsd asya
3
4
133V2 marieipravho nirga[2](cchati|)
(suvarna5
v)[]lukcitam iva pasya(ti)| tatraiva ca nirudhyat(e|
(2) tatah)
(s)[u]varnbhnm buddhnm pravho nirgatah traidhtukam
V3 spharitv tistha[3](ti| tatraiva ca nirudhyatel
d)6 (1) tato) . . . . (ga)[nd]()d v(i)citraputputacitah purusapravho nirgatah traidh(tuV4 kam spharitv) kadalipatraputputuirbhjanayogena7 ca vicitram samskragatam8 [4] . .

..'".

'.. EU 9

(2) tasy eva nbhy []ksanibhnm bu(ddhnm) pravho ni(r)[ga](tah|


traidh)[u]kam spharitv tisthatij tatraiva nirudhyate10
V5 e) vijnaskandhapariksdhimu[5](ktih|)11
(i)
[la]pravr(ttisth)[](n)[mtar]nm
. . [ry.t]
[m] . . [s]
nm iv12 pravho nirgatah
traidhtukam
t

c) (Eifer) in der Betrachtung der Gruppe ( W a h r n e h m u n g ) :


(1)
flimmernd. Dann geht von seiner rechten Schulter ein Luftspiegelungsstrom aus (und durchdringt die ganze Erde. Dann) sieht [der
Yogin] (die Erde) wie mit (Gold)sand besetzt. [Der Strom] wird ebendort zum Verschwinden
gebracht.
(2) (Dann) geht von
[des Yogin] ein Strom von goldleuchtenden Buddhas
aus, durchdringt die Welt (und wird ebendort zum Verschwinden gebracht).
d) [Gruppe Gestaltungen]:
(1) (Dann) geht von der
Wange [des Yogin] ein mit mannigfachem Falten und
Entfalten besetzter Menschenstrom aus, (durchdringt) die Welt und, durch den Yoga des
Umbiegens beim Falten und Entfalten des Pisangblattes die von mannigfachen Gestaltungskrften bewegte (Welt)
, (wird er im Nabel zum Verschwinden gebracht).
(2) Von eben diesem Nabel geht ein Strom von thergleichen (Buddhas) aus, durchdringt
(die Welt) und wird ebendort zum Verschwinden gebracht.
e) Eifer in der Betrachtung der Gruppe B e w u t s e i n :
(1)
der Inhalte
des Entwickeins
geht ein Strom gleichsam
1

Lies: spandamnam. Vgl. 132V6: spandamnm prthivim.


Lies: daksind. Vgl. 132R4: vmd ams budbudapravho nih(8rtah).
3 Vgl. 132V4: maricikalapa.
4
Erg.: (krtsnm prthivim spharati\ tatah prthivim).
5
Vgl. 153V5: (pad)mini
suvarnavlukstl(rna).
6
Selbst wenn man annimmt, da der letzte Satz des vorhergehenden Abschnittes (tatraiva ca nirudhyate\) ausgefallen ist, reicht der vorhandene Raum nicht fr die Ergnzung der berschrift samskraskandhaparikdhimuktih aus. Es ist also anzunehmen, da diese berschrift durch ein Schreiberversehen ausgelassen wurde.
7
Lies: putputanirbhjana. Vgl. 132V5: (kada)lipatravat putaputayogenvatisthamti.
8
Vgl. 161V1: vic(i)trasamskragatm hetupratyaydhinam tmtmiyavirahitam;
130V6: samskaraga(tam) . . . . cchidram sunyam tmt(m)iyavirahi(tam). Erg. (lokam).
9
Erg. zu: (nbhym nirudhya)t(e)\.
10 Einl. S. 39.
11
Lies: parik$.
12
Lies: iva.
2

IV. Betrachtung der Gruppen (skandhaparik$)

spharitv tisthati|

101

tadamtarga[6](t)

(2) . . . .2
tukam spharitv tisthati)

133V6

(buddh) [n](m) pravho nirgatah


tatraiva ca nirudhyate|

traidh-

5.a)[l]
133B1
3
.
(kst) parivrtya nbhym punah pravisya mrdhn nir5
gatya|4 yvad aghanisthn ava[2](bhsya)
R2
6
[ti]| tesu vyucchinnesu
10
tebhya7 sthnmtarebhya8 yathoktalaksan buddh9 [3]
R3
-.
.[dh]
[t]
'. '.
(niru)[dh]y(a)te|
6) tato nisthnimittam

ditya(ma)ndaladvayo11 'ntargatam pamcaramga[^]

M. (I)
c) t(a)tahi2 [n](i)Iapitalohitva[d](th)

gat srayam prina-

von

aus und durchdringt die Welt. Darin eingegangen


(wird er im Nabel zum Verschwinden gebracht).
(2) (Dann) geht von
[des Yogin] ein Strom von
(Buddhas) aus, durchdringt die Welt und wird ebendort zum Verschwinden gebracht.

5.a) (Unmittelbar darauf beglckt [der Yogin seine] Gestalt durch die Besprengung. Dann
geht von unterhalb des Mittelpunktes [zwischen] seinen Brauen ein Strom aus, durchbricht [die
Rume] bis zum Windkreis), kehrt (vom ther her) zurck, tritt wieder in den Nabel ein,
geht durch das Haupt aus, (leuchtet) bis zu den Aghanistha[-Gttern] (und tritt wieder durch
das Haupt ein.)
Sind diese [Strme] geteilt, (kommen) aus den Zwischenrumen
Buddhas mit den oben erwhnten [Buddha]malen (hervor),
wird zum Verschwinden
gebracht.
b) Dann das Vollbringungssymbol: In eine Zweizahl von Sonnenscheiben eingegangen als
fnffache Schaubhne
c) Dann gehen blaue, gelbe, rote und weie (Strme)
und be1
Erg. (nbhym nirudhyate).
2 Erg. (tatah).
3 Erg. etwa (nach 129R1, 135V1; vgl. 135R3, 146R6, 152V1, 154R4, 165R2; Einl. S. 35): (tadanamtaram abhi$ekensrayam prinayan tato bhrumadhydhastt pravho nirgatya yvad vyumandalam
bhitv).
4
Satzzeichen zu streichen.
5
Erg. etwa (nach 129R2 usw.): mrdhn punah pravisati].
6
Vgl. 129R3/4: pravho
prvam bhrumadhyd vicchidyate] tato nbhyh.
7
Lies: tebhyah.
8
Lies: mtarebhyo.
9
Lies: buddh.
10
Erg. nihsrtht
11
Lies: dvaye.
12 Lies: tato.
13 Erg. pravhh.

R4

102

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

133B5 yanti 1 kramenaiva ca nirgat 2 sthitim purayam[5](ti|) 3


madhye cbhyunnate pr(a)[d](ese)4
B6
nirmalojvalasastracitam5 pratyaveksannimittam utpadyate|
[n]ni skandhanimittni|
6
134V1 (1) tatra rogatah parmrsa[I](n|)

sa[6]. . . .

[tr]| astabhir kraih parmrsati|

(2) (ga)ndatah parmrsan srava[ta]


(P&s)[y](ati|)
V2 (3) s(a)lyatah parmrsan| rpaskandham jardibhih salyair viddham [2] (pasyatil
(4) aghatah parmrsan |
rpaskandham)
[r]g[&i]7 upaha8
9
10
nyamnam pasyati snsikstha iva cchidyamna | arupinah jskandhml11 parasparoV3 paghtaih12 upahanya[3](mnm pasyati |

glcken die Gestalt [des Yogin]. [Von da] gehen sie allmhlich aus und erfllen [seinen]
Standort
an der in der Mitte
erhhten Stelle
entsteht ein mit einem reinen,
brennenden Messer besetztes Anschauungssymbol.
die Symbole der Gruppen.
#
6
denkt [der Yogin ber die Gruppen]
hinsichtlich [ihrer] acht Aspekte nach:
(1) Denkt er hierbei [ber sie] als K r a n k h e i t nach, .
(2) Denkt er [ber sie] als B e u l e nach, (sieht er) Ausflu
(3) Denkt er [ber sie] als S t a c h e l nach, (sieht er) die Gruppe Form von den Stacheln
,,Alter" usw. durchbohrt.
(4) (Denkt er [ber sie] als bel nach), sieht er (die Gruppe Form)
erschlagen und wie auf einer Schlachtbank zerhackt werden. Die [brigen
vier] Gruppen ohne Form (sieht er) durch [ihre] jeweilige Zerstrung erschlagen werden.

Vgl. 154R4: ra(tnapravhah)


{sra)yam prayali prinayati ca (Einl. S. 41).
Lies: nirgath.
3
Lies: prayam(ti\). Vgl. 154R5: pravho ni(rgaty)
k(r)amena sthitim pray(ati);
^ 165R4 u. a.
4
Es scheint sich hier, wie bei nbhipradese 167V5, bhupradese 16SV4, um eine Krpergegend zu
handeln.
5
Lies: nirmalam oder nirmalojjvaWt Vgl. 167V6: jvalanirmal(a)sa(8tra)ci(ta). Vgl. auch 150R5:
kas(avar)na(m) sastram.
6
Satzzeichen zu streichen. Lies: (ta)trdstabhir?
7
Lies: orgairt
8
In anderen Texten ist nur die Form asisna belegt; vgl. M. I, S. 130: km
asisnpam;
Divy. S. 10, 25: asisndhastt suvarnasya kalaiah.
9
Lies: cchidyamnam\.
10
Lies: arupinah.
11
Satzzeichen zu streichen. Zur Bezeichnung der Gruppen Empfindung, Wahrnehmung, Gestaltungen und Bewutsein als arupinah skandh vgl.l.S. 82,9: catvro 'rpinah skandh yac ca rpam.
12
Lies: Hair.
2

IV. Betrachtung der Gruppen (skandhaparik$a)

103

(5) anityatah parmrsan|)


|
(6) duhkhatah parmrsatj 1 jvalinn 2 yaspindasam[n]ibhm3 pasyati |
(7) sunyatah* parmrsat|5
[4]
(8) (antmatah parmran|)
svatamtrms ca pas[y]a[t]i|

134V4

7. tato niruddhe sarvasmim jrieye [mu](k)[t](cita)ktgre 'ntargatam 6 muktcitam e[5]

7 . . . ;

ca medi[ny]m [bud](dhm padma)panktim8 ivvasthitm9 pasyati


nbhisu cdityamanda[6](lni)
8
su[i]

sarvabuddhnm

(6) Denkt er [ber sie] als Leid nach, sieht er sie brennenden Eisenklumpen gleichen.
(7) Denkt er [ber sie] als leer nach. . ,
(8) (Denkt er [ber sie] a l s N i c h t s e l b s t nach,) sieht er [sie]
und unabhngig
7. Wird dann alles zu Erkennende zum Verschwinden gebracht, (sieht er sich selbst) in
einen perlenbesetzten Tempel eingegangen und auch mit Perlen besetzt
sieht er auf dem Erdboden (Buddhas) wie eine Reihe (von Lotosblumen) verharren. Sonnenscheiben in den Nabeln aller Buddhas
8
, Zustandekommen des Unwandelbaren, Erlangen der Frucht, Entleidensohaftlichung, Schwinden der Befleckungen, (Heil) im gegenwrtigen Zustand,

Lies: parmrdan\.
Lies: jvalitn.
3
Lies: ayaspind^a0.
4
Lies: dnyatah.
5
Lies: parmr4an\.
6
Vgl. 128V2/3: utthnakle muktcitah prsda utpa(dya) tatrmtah mukta(cita asraya); 161V2:
sphadikaktgrnmtargatam tmanam pasyati (Einl. S. 44).
7
Vgl. (tmnam payati\)1
8
Vgl. 144V2131 padmapamktayo.
9
Vgl. 166R1: (dha)rmarajika ivvasthitah.
2

V6

m.yaniymyakrmtiphalaprptiyairgysrayaksayadrstadharma-

(5) (Denkt er [ber sie] als u n b e s t n d i g nach),

V5

'

134R1

V. Betrachtung der Bereiche (ayatanapariksa)


Vorbemerkung
Unter den Bereichen versteht die Dogmatik die sechs Sinnesorgane, denen als ihre Objekte sechs
uere Bereiche (bhyyatanni) entsprechen: zu dem Bereich Auge" (caksus) gehrt der
Bereich Form" (rpa), zum Ohr" (srotra) der Ton" (&abda), zur Nase" (ghrna) der
Geruch" (gandha), zur Zunge" (jihv) der Geschmack" (rasa), zum Krper" (kya) das
Berhrbare" (sprstavya) und zu dem Verstand" (manas) das Denkobjekt" (dharma).1
Wie die Elemente und Gruppen, sind auch die Bereiche nichtig und wesenlos.
In der bung untersucht der Yogin zuerst die Bereiche bei sich selbst (2.), und festigt dann die
Erkenntnis ihrer Wertlosigkeit durch Strme von unreinen Substanzen (4.) und Skeletten (5.),
die die Welt durchdringen.
1
rabhyatej 3

m.n(r)tha(m) cyatanaparlks-

2. a) tathaita 4 sildikrtapari[2](karmanali)5
.
|
t(a)t(a) y(atanasth)[n]mtarny yatanni
R& ca| 6 klinnaj[v]alitasunyani7 pasyatij ta[3]
(bhi)s citam kyam pa(ya)t(i)|

134R2

1. {Unmittelbar nach dem Hindernis)


ginnt die Betrachtung der Bereiche.

, um

willen, be-

2.a) Hat [der Yogin] ebenso (die Vorbereitung), an deren Anfang die Tugend steht durchgefhrt,
Dann sieht er die Inhalte der Bereiche und die Bereiche verwest, brennend und leer
sieht er [seinen] Krper mit
besetzt.

Pali D. II, S. 302f. (Satipatthnasutta; innerhalb der Betrachtung der Denkobjekte) usw.; Skt.
Sang. VI,l-2; Dhs. XXIV; Mvy. 2028-2039; &ks. S. 244,i5ff.; usw.
2
Erg. (nach 132V1: tmadrsti(pratipaksrtham)) atmadrstipratipaksasamanamtaramt Vgl. S. 115f.
3
Vgl. 136R2/3: mohapratipaksriham prattiyasamutpadaparik$rabhyate\.
4
Lies: taihaiva.
5
Vgl. 128B4: taihaiva si(ladikrtaparikarmanah).
6
Satzzeichen zu streichen.
7
Lies: Hnyni.

V. Betrachtung der Bereiche (ayatanapariksa)

15

b) tadvat krtsnam lokam pamcaga[t]i.ai . . [bhijs1 citam pa[s](ya)t(i)[

nrake 2 cak(u)[4] 134B4


sarvam jiietadvac chrotraghrnajihvk()fya]ma[na]hrpasabdagandharasasprsta(vya[5]R5

yam grasati|
dharm)3
c)
(dityamanda)larasmibhir bhinnm pasyati|
evam yatanacitm
dhvajm4 dityamandalvyatimisrd5 dityamandalarasmibhi(r) bh(i)nn(m)[6]
.
[ni] drsyamte|

R6

3. a) tato 'bhisekah7
[l]e
kah8 prlnitsrayasya bhrumadhydhastt9
pravhahw dvdasya[i](tana)
l[ai]va nirgata11 yvad vy(uman)d(a)l(am)|12 bhitv- 135V1
13
kst parivrtya nbhy[m] pravisya mrdli14 nirgacchatya]15 y(vad aghanisthm devm)| 16
gatv punar mrdhn pravisya bhrumadhydhastd eva nirgaty17 nbhys ca [2]
V2

b) In derselben Weise sieht er die ganze Welt mit


der fnf Existenzformen
besetzt: In der Hlle [der Bereich] Auge
verschlingt alles zu Erkennende. In derselben Weise
[die Bereiche] Ohr, Nase, Zunge, Krper, Verstand, Form, Ton, Geruch, Geschmack, Berhrbares (und Denkobjekt)
c)
sieht er von den Strahlen (der Sonnenscheibe) durchbrochen.
Ebenso (sieht er) mit den Bereichen besetzte Banner unvermischt mit der Sonnenscheibe
von den Strahlen der Sonnenscheibe durchbrochen. (Dann) erscheinen
3M) Dann die Besprengung:
Ist die Gestalt [des
Yogin] beglckt, geht von unterhalb des Mittelpunktes [zwischen seinen] Brauen ein Strom
aus, der die zwlf Bereiche
, durchbricht [die Rume] bis zum Windkreis,
kehrt vom ther her zurck, tritt in den Nabel ein, geht durch das Haupt aus, geht (bis zu
den Aghanistha-Gttern), tritt wieder durch das Haupt ein und geht von unterhalb des
Mittelpunktes [zwischen] den Brauen und vom Nabel aus.
1

Ergnzung unbestimmt. Vgl. pamcagatika 150V2.


Lie: naraket
3
Lies: mcmo.
4
Lies: dhvajn.
5
Lies: ^miSrni
6
Erg. paiyati\ tatah.
7 Einl. S. 41.
8
Ergnzung unbestimmt. Vgl. 154R3/4: tato 'bhisekah ra(tnapravhah pra)viliya mrdhn pravi(sysra)yam prayati prinayati ca; 133R4: t(a)tah n(i)lapitalohitvad(th pravhh) . . . . gat srayam
prinayanti; 129R1: tadanamtaram abhisekensrayam
prinayan.
9 Einl. S. 35.
10
Lies: pravho. Zum Weg des Stromes vgl. Einl. S. 38f.
11
Lies: nirgaty oder nirgato.
12
Satzzeichen zu streichen. Vgl. 135R3: (yva)d vyumandalam bhitvd; 163R1, 170V5.
is 135R3, 129R2: (pa)rivartya.
14
Lies: mrdhn.
15
Satzzeichen zu streichen. Lies: nirgaty.
16
Satzzeichen zu streichen. Vgl. 129R2: ndbhym pravisya mrdhn nirgatyvyucchinnam yvad
aghanisthm devn avabhsya; 147V1: mrdh(n) (n)i(rgatya yvad a)ghanisthm gatv.
17
Lies: nirgaty.
2

106

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

b) (tatah sthitir 1 anam)[tapa]ryamt 2 yata(na)[p](a)riprna3 drsyate


parvat 4 vicitryatanacit drsyamtej5
c) am(te ca sarvam) nbhym nirudhyate]6

sthityupari ca

4. a) punar yatanapariksvahitacetasah pa[3]


te| 7 siras ca
8
mahpram[n]am . . . .tarn yatanni ca jvalit[gn]i
ni drsyamte| tadvat sarvaV4 satvh
tatra bhyyatanni pravisamti| [4]
. . . .ai
e [p](r)[th]i(v)l [pa]r[v]a(ta)[mah]9 . . .
jni tisthamti| ante
V5 ca [vi]
ram ca tasmim samaye nirvi[5]
(caksuh rotram ghr)V6 nam jihv kynm yathsvavisayam nipatamti manas tu pradipa [6]

135V3

10

11

6) (tatas caksurbhym)
135R1 pyardhirakarnamalapravhh13

12

(pravh) [n](i)rgacchamti|
ghrnbhym p[_Z](ya)

srotrbhyam

b) (Dann) erscheint [sein] (Standort) im unendlichen Umkreis von Bereichen erfllt, und
ber [seinem] Standort erscheinen mit mannigfachen Bereichen besetzte Berge.
c) Am Ende wird (alles) im Nabel zum Verschwinden gebracht.
4,a) Hat [der Yogin] sein Denken weiterhin auf die Betrachtung der Bereiche gerichtet,
(erscheinen)
[Sein] Kopf erscheint in groer Ausdehnung . .
, und die Bereiche in brennendes Feuer (eingesunken). In derselben Weise [erscheinen]
alle Wesen. Hierbei treten sie in die ueren Bereiche ein.
(die Erde). Berg
stehen. Am Ende
zu dieser Zeit
(Auge, Ohr, Nase) und Zunge fallen auf das [ihnen] jeweils eigene Objekt der Krper nieder;
der Verstand aber (kommt wie) eine Lampe (zum Erlschen)
b) (Dann) gehen (von [seinen] beiden Augen Strme von Eiter, Blut und Trnen)
aus, von den beiden Ohren Strme von Eiter, Blut und Ohrenschmalz, von den beiden
Nasenlchern (Strme) von Eiter, (Blut und Nasenschleim, von der Zunge Strme von Eiter,

Vgl. etwa 130R3: sthitym ca sarvarasapariprnam.


Lies: paryamtdyata(na)1
3
Lies: prn.
4
Vgl. 130B1/2: (u)pari csya
parvath.
5 Einl. S. 47.
e Einl. S. 53.
7
Erg. zu: (dr&yam)te\?
8
Erg. zu: jvalitgni(nimagna)nil Vgl. 134R2: ayatanni
9
Lesung unsicher.
10
Erg. ivopasamam gacchatit Vgl. 162R13-. bhagavm
161R6: te ca
pradipa iva smyamte.
11 135V6-R5: Einl. S. 45 ff.
12
Erg. (pyarudhirru0) ?
13
Lies: rudhira.
2

klinnajvalitasunyani.
pradipa ivopasamam gaccha(ti\);

V. Betrachtung der Bereiche (ayatanaparik$a)

vahh1

prasrvamrgt prasrvavapravhh

. .
sarvasrotobhyah pya[2]

107

rpra-

(yo)[g]crasrayam2 prayamti| sa ca satatasamitam sarvasrotobhyah pa[3]. . . .


3 [n](i)[hs]r[t]()[bh](ir au)[c](i)dh()rbh(i)h4' pravh(a)h
[s]
(yva)d vyumandalam bhitv 5 (kst pa)[ri]vartya nbhym pravisya mrdhn ni[4](rgatya6 kmvacarm devm) y(i)mnodynopabhogm7 rp(avaca)[r]ms ca 8
savimnm sarvsuci[dh](rbhir) . .kledayamj9 dsayams ca gacchaty gacchati ca inrdhn ca pravisya [5] (punas tata eva sthnm) n(i)hsrtahi0 sthiti(m) [](p)[]rayanti| il tasym
sarvasatva12 nimagn 13 sravamto drsyamte|
c) amte ca sarvam jiie(yam niru)dhyate|14 nisthita15 prayoga16 ||

Blut und Speichel, vom Krper Strme von Eiter, Blut und Schwei, von den Brsten)
Strme von (Milch), vom Weg des Urins Urinstrme, von allen Krperffnungen
(Strme von) Eiter,
erfllen sie die Gestalt des Yogin.
Er (lt) stets wiederholend aus allen Krperffnungen
(Dann) durchbricht der Strom mit den (aus dem Yogin) hervorkommenden unreinen Ausflssen
[die Rume] (bis) zum Windkreis, kehrt (vom ther her) zurck, tritt
in den Nabel ein, (geht) durch das Haupt (aus) und besudelt und beschmutzt mit allen unreinen (Ausflssen) die [Wesen der] (Gtterklassen der Sinnenwelt,) die sich in [Luft]Schlssern und Grten ergtzen, und die [Wesen der] Gtterklassen der Formenwelt samt
[ihren] Schlssern; geht und kommt und tritt durch das Haupt ein, kommt (wieder aus
dieser Stelle) hervor und erfllt [seinen] Standort. Darin eingesunken erscheinen alle Wesen
zerflieend.
c) Am Ende wird alles zu Erkennende zum Verschwinden gebracht. Die bung ist vollbracht.

Lies: pravhh. Erg. etwa: ghrnbhym p(yarttdhira^imgh^imkapravahah jihvayah pyarttdhiralasikpravhh kyt pyarudhirasvedapravhh stanbhym k$i)rapravhh. Zu dieser Ergnzung vgl.
Einl. S. 45, Anm. 4.
2
Lies: drayam.
3
Erg. tato yogcraPi
4
Vgl. 135R4: 3arvsucidha(rabhir).
5
Lies: bhitvd(ksat). Vgl. 135V1: yvad vy(uman)d(a)l(am)\ bhitvkst parivrtya.
6
Vgl. 129R2: nbhyam pravisya mrdhna nirgatyvyucchinnam yvad aghani$tham devn avabhsya.
7
Vgl. 169R4: divyrmodyanavimanany.
8
Vgl. 145E6: sat kmvacaram devn] rpvacarms ca caturdhynopapannm.
9
Satzzeichen zu streichen. Lies und erg. zu (vi)kledayan,
10
Vgl. 147V1: punas tata eva sthnm nihsrto n(bh)y(s) c(a) 8th(i)tim aprayati\.
11
Lies: (p)rayati1
12 Lies: satv.
13
Lies: nimagnh.
u Einl. S. 53.
15
Lies: nisthitah.
16
Lies: prayogah.

135B2
R3

R4
R5

108

135R6

136V1
V2

V3
V4

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

5. a) yatanaparlksbhiratasya mrdhni [6] . . . . . . . . . . tatrastham ciraklam sn[t]. . .i[ra]tam ca cittam 1 tis[th]ati|


6) tatah sadyatananimittam utpadya(t)[e]
(yata)nni yugapad utpamnny
dhryamnni praviliyamte| tebhya[i]s cyatanarasapurusa utpadyate[ [ta]sya prsvebhyo2
dvracatustayam3 apvrtam sambhavati | 4 dvrebhyas catasrahs yatanacith sa(m)kalh6
pradipatamtukalpobhayahast nirga[ccha]m(ti|)
[2] [tajmtukalpais ckrsth samkal
[ya]tacitni7 nirgacchamti| disodisah8 urdhvam 9 cdhs10 ca spharitv tisthati]11
c) sa cyatanarasapursa12 praviHyam13 yatanarasapariprn puskirini14 m(r)dhn(ah)
[3] sambhavati]15 [tajsys co[ta]k[]ks[d]16 ivapradip17 nirgatya sarvny yatanni sarvs
ca samkalh paripavanvac18 chidri kurvamti| tais ca c(ch)id[r]air varsadhrbhir iva19 dasabhyo digbhyah20 [4] yogcrsrayam pryate|

5.a) Am Haupte des an der Betrachtung der Bereiche interessierten [Yogin]


. . .; [sein] Geist bleibt feststehend und sich lange Zeit ruhevoller . . . . . erfreuend.
b) Dann entsteht das Symbol der sechs Bereiche:
. die Bereiche entstehen, werden
behalten und zerschmelzen gleichzeitig. Daraus entsteht ein aus der Essenz der Bereiche
[bestehender] Mann. An dessen [vier] Seiten tritt eine Vierzahl von geffneten Toren in
Erscheinung, und von den Toren gehen vier mit den Bereichen besetzte Skelette aus, die
Lampen und Fadenbndel in beiden Hnden [halten]. Von den Fadenbndeln angezogen gehen
[diese] mit den Bereichen besetzte Skelette heraus und durchdringen alle Richtungen aufwrts und abwrts.
c) Indem der aus der Essenz der Bereiche [bestehende] Mann zerschmilzt, tritt aus dem
Haupt [des Yogin] ein Teich in Erscheinung, der von der Essenz der Bereiche erfllt ist.
Von diesem gehen wie von einem Gewandgrtel (?) Lampen aus und hhlen wie eine Getreideschwinge alle Bereiche und alle Skelette aus. Die Gestalt des Yogin wird von diesen, wenn sie
ausgehhlt sind, wie von Regengssen aus den zehn Richtungen erfllt.
1

Vgl. 121R2: t(a)tr(a)sth(am) ca c(i)ttam snt(am) drdham ci(raklam).


Vgl. 136V1: (ca)tursu ca prsv(e)su samudracatustayam.
3
Vgl. 143R6: sarvasrotobhyas csya dvarany apvryamte\.
4 136V1-5: Einl. S. 47.
5
Lies: catasra.
6
Vgl. oben, S. 59 u. Anm. 3.
7
Lies: yatanac.
8
Lies: disodisa. Vgl. dasadisah 145V5; sarvadigvidisah 136R1.
9
Lies: rdhvam.
10
Lies: cddhas. Vgl. 136R2: sarvadigvidisah urdhvam adhas ca spharitv tisthamti.
11
Lies: tisthamti.
12
Lies: purusah.
13
Lies: praviliyann.
14
Lies: puskirini. Zur Schreibung (statt puskarini) vgl. BHSD.
is Einl. S. 47.
16
cota, BHSD: some kind of garment, or textile goods**; lies cotakaksdt Der Sinn ist jedoch unklar.
17
Lies: pradip.
18
Lies: pavanavac.
19 Vgl. 131R4: padmapravhais cnekavarsadhrbhi(r) i(va) svam srayam prya(te).
20
Lies: digbhyo. Die zehn Richtungen bestehen aus den vier Haupthimmelsrichtungen (diS), den
vier Zwischenrichtungen (vidis"), oben (rdhvam) und unten (adhas).
2

V. Betrachtung der Bereiche (ayatanapariksa)

109

d) tata yatanarasasamudram amtah pasyatil 1 pradips ca krtsnam lokam paripavatac 2


chidri krtv 3 yog(crsra)ye patits
tadva tai 4 cchidri 5 ku[5](r)v(am)ti|6 samamtatah 7 136V5
8
cchidram durbalam srutsram ca saryajagat pasyati|
es sunyatnukl 9 pariksj
e) tatah 10 brahmabhih11 r[a](tna)puspamuktanaksatryatanacitalh 12 krtsnam gaganam prnam13 pasya[6](t)i| tebhyas cyatanebhyah14 rasadhr patith 15 sarvam samkalhsu16 tadV6
sraye ca nipatith yathoktasubhanimit[t]ya(tana)citam jagad ayasthpayamti| 17 tato ghrtapindavat pravilinam j[ii]e(ya)m [1] saryam tadsraye pravisatij18
136R1
es19 upasamnuklvasth

d) Dann sieht er in [seinem] Innern ein Meer aus der Essenz der Bereiche. Die Lampen
hhlen wie eine Getreideschwinge die ganze Welt aus, fallen auf die Gestalt des Yogin und
hhlen in derselben Weise [auch] diese aus. Ringsum sieht er alle Welt ausgehhlt, kraftlos
und entwertet.
Dies ist die der Leere angemessene Betrachtung.
e) Dann sieht [der Yogin] den gesamten Luftraum von Brahma[-Gttern] erfllt, die mit
den Bereichen [in Form von] Edelsteinen, Blumen, Perlen und Sternen besetzt sind. Aus
diesen Bereichen fallen Essenzgsse, fallen auf alle Skelette und auf seine Gestalt nieder und
trennen die mit den Bereichen [in Form der] erwhnten Symbole des Schnen besetzte Welt.
Dann tritt, zerschmolzen wie ein Klumpen Butterschmalz, alles zu Erkennende in seine
Gestalt ein.
Dies ist der dem Erlschen angemessene Zustand.

1 Einl. S. 47.
2
Lies: paripavanavac.
3
Vgl. 130V1: krtsnam lokam
cchidri kriyamnam.
4
Lies: tadvat tarnt
5
Lies: chidri.
6
Vgl. 131V6: (v)yukalp
yoga(crsrayam cchidri) kurvanti.
7 Lies: tataS chidram (Einl. S. 20).
8
Lies: srutasram.
9
Lies: snyata0. Vgl. 129V4: sarvam visirnam crnibhtam
pasyati\
sunyatnuklatvd
asya manasikrasya.
10 Lies: tato.
11
Lies: brahmabhi.
12
Lies: puspamukt. Diese Stelle besttigt die Auffassung von (m)uktpuspa 123R2 als Perlen
und Blumen; derselbe Sinn liegt in dem Vers (und der folgenden Prosa) Divy. S. 78,18 vor:
yo buddhacaityesu prasannacitta
ropayen muktsupuspars'im;
die Textausgabe liest, gegen das Metrum, mukta0. In Karmav. LXXIV (S. 100) lesen die Handschriften
(und die tib. bers.) muktapuspa0, Schnittblume" (Lvi: simple fleur").
13
Vgl. 148R2: brahmais ca gaganam prnam.
14
Lies: cyatanebhyo.
15
Lies: rasadhrh patith ?
16
Lies: sarvaSamkalsu ?
17
Vgl. 160V5: sastrani
(saddh)atuvibhgena krtsnam satvasamudram avasthpayanti.
i Einl. S. 34, S. 53."
19
Lies: esopa0.

110

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

/)*tatah sarvasrotobhyah 2 buddhapratyekabuddhasr[]yakh padmdhirudh3 yathokta136R2 laksanyatanacith sarvadigyidisah4 urdhvam 5 a[dhas] ca 6 [2] spharitv tisthamtij 7
amte
ca tadaraye8 ani[tya](m a)[n]ityam iti sabdam udlra[y](am)tah
yatanaprayoganispattih10 ||

/ ) Dann [kommen] aus allen [seinen] Krperffnungen auf Lotosblumen sitzende Buddhas,
Pratyekabuddhas und [Buddha]jnger [hervor], die mit den oben erwhnten [Buddha]malen
und Bereichen besetzt sind [und] durchdringen alle Richtungen und Zwischenrichtungen,
aufwrts und abwrts. Am Ende treten sie, das Wort unbestndig, unbestndig" ausstoend,
in seine Gestalt ein.
Vollendung der bung der Bereiche.

1 136R1-2: Einl. S. 39.


2 Lies: srotobhyo. Einl. S. 35.
3
Lies: rdh. Vgl. 152R3: buddhs ca padmdhirdhah.
'* Lies: vidiSa.
5
Lies: rdhvam.
6 S. oben 108, Anm. 20.
7
Vgl. 136V2: disodisah urdhvam cddhs ca spharitv tithati.
8
Lies: o4raya.
9
Vgl. 152R3: ante ca sarvam nabhym jneyarn nirudhyate\ buddhs ca padmdhirdhh kaye 'ntargat
drsyamta iti vyutthnam\ ; 121R56: b(u)ddhs ca sabdam udirayan(t)i santam sntam i(t)i
(amte sarvam yog)acrasray(e p)r{a)visati\ (Einl. S. 53).
10
Vgl. 121R6: asv8aprasv8anispaUir.

VI. Betrachtung des Entstehens in Abhngigkeit (pratUyasamutpadapariksa)


Vorbemerkung
Wie die Elemente, Gruppen und Bereiche, betrifft auch das Entstehen in Abhngigkeit sowohl
das eigene Selbst (dhytmaka), als auch die Auenwelt (bhya) (1. b). In der theoretischen
Einleitung dieses Kapitels werden weiterhin (l.cd) die Formen der Abhngigkeit zusammengestellt und durch eine Beispielreihe erlutert. In der bung betrachtet der Yogin als Vorbereitung
(2.) Abhngigkeitsverhltnisse in der Auenwelt (a) und bei sich selbst (6); sodann erschaut er
die einzelnen Glieder des Entstehens in Abhngigkeit in ihren Verkrperungen (3.) und sieht
schlielich (4.), wie der Buddha bei seiner Erleuchtung das Entstehen in Abhngigkeit durchschaut und den Wesen dieselbe Erkenntnis zuteil werden lt.
l.a) bhayabhogatrsnprati(paks)nmtaram|1
mohapratipaksrtham 2
pratitya[3]sa- 136R3
3
mutpdaparlksra1bhyate|
b) s[a] (ca dvivi)dhah bhyah 4 dhytmaka^ ca 5
c) satvsatvkhyas ca bhyo dvividhah pratisthitotpatti6 kramabhedt|
d) []
[t]tr.dhnu[sarta]vyah7 tatr^ hi sa[<|(<) . . . . .[o] (ni)sray[o] (d)[e]B4
sitah

l.a) Unmittelbar nach den Hindernissen Werden, Genu, und Durst und um des Hindernisses Verblendung willen beginnt die Betrachtung des Entstehens in Abhngigkeit.
b) Dieses ist (zwei)fach: das uere und das eigene Selbst betreffend.
c) Das uere [Entstehen in Abhngigkeit], das [sowohl] Belebtes [als auch] Unbelebtes
umfat, ist zweifach: Feststehen und Entstehung nach der Einteilung des Verlaufes.
d)
soll man
nachvollziehen. Denn hierbei wird eine [aus] sechs . , .
[bestehende] Abhngigkeit gelehrt:

Lies: ()namtaram\. Die genannten Hindernisse beziehen sich auf die vorhergehende bung. Vgl.
unten, S. 115f.
2
In 139R4 wird die Unkenntnis (ajfiana) als ein Hindernis der Betrachtung des Entstehens in Abhngigkeit genannt.
3
Vgl. 134R1: cyatanapariksrabhyatel.
4
Lies: bahya.
5
Vgl. l. S. 65: so *pi dvividho dra$tavyah\ bhyai cdhytmikaS ca.
6 Lies, wie 136R4, pratisthotpattih? Nur die unten dargestellten Abhngigkeitsverhltnisse (3) und
(4) betreffen auch das Unbelebte (asatvkhya), alle anderen ((1), (2), (5) und (6)) das Belebte (satvakhya).
7 Ergnzung unbestimmt. Vgl. 128R3: dhatuprayogah yogasastropadisto 'nusartavyah.
8
Lies: tatra.

112

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(7) dh[]rakah (2) [s](am)dh()[ra](ka)[h] (3)utpatti* (4) pratisth


(6) sprhanisrayas ca
(1) tatrdhrako nisrayah brhmanak mamtrh 2 pudgalam nih[s]rth
136R5 (2) samdhraka[5](h pudgal vri)[hi]ya(vm)3 [njihsrth
(3) utpatti* hriyav* prthivie nih(srt)h
(4) pratisth| prthivy psu7 pratisthitj pah 8 vyo 9 vyur kse10
R6 (j) prajnaptih loke saty ksam prajnyate prajnapti[n]ih[6]srayah1i
(6) sprha(n)i(rayah)
[ry]h caturmahrji[k]e12 . . . . [yo va]
[m]itam iti|

137V1

tatpariks
2. parikarmaj
a) pdmgupte13 gomayapindam tadamtargatni [1]
(pa)dm(a)jam

(5) prajnaptih

ity (e)va kukutyndavad14

(i) Halter, (2) Trger, (3) Entstehen, (4) Feststehen, (5) Bestimmung und (6) Abhngigkeit
des Verlangens:
(1) Hierbei [bedeutet] Halter [als] Abhngigkeit: Brahmanische Rezitationen sind abhngig von [der Existenz eines] Individuums;
(2) Trger [bedeutet]: (die Individuen) sind abhngig von Reis und Gerste;
(3) Entstehen: Reis und Gerste sind abhngig von der Erde;
(4) Feststehen: die Erde ist in den Wassern feststehend, die Wasser im Wind, der Wind im
ther;
(5) Bestimmung: Wenn ein Lichtschein ist, erkennt man den ther. [Dies ist die] Abhngigkeit der Bestimmung.
(6) Abhngigkeit des Verlangens:
auf die vier Groknige bezglich
Dessen Betrachtung:
(nicht bersetzt)
1

Lies: utpattih.
Unter brhmanak mamtrh verstehen die Buddhisten die gesamte liturgische Ttigkeit der Brahmanen; vgl. etwa Divy. S. 487,2: brhmanakn mantrn vcayati (BHSD zu brhmanak). In unserem
Text dienen die mantrh als Beispiel fr die menschliche Rede.
3
Reis und Gerste dienen als Beispiel fr die Nahrung (hra).
4
Lies: utpattih.
5
Lies: vrihiyavh.
6
Lies: prthivim.
7
Lies: apsu.
8
Lies: po.
9
Lies: vyau.
10
Vgl. MPS 17,4 (S. 212): (i)yam mahpr(thivy) apsu pratisth\ po v(yau) pratisthit v(y)u{r kse
pratisthitah\). Vgl. Einl S. 32 u. Anm. 1.
11
Sonst in unserem Text immer ni&raya; in ostturkistanischen Handschriften sind jedoch sowohl
Formen von ni-ri als auch von nih-iri belegt (CPS 45,2 [S. 28]: niMritya; vgl. BHSD zu niritya).
12
Lies: ^ cturmahrjikaih?
13
Lies: pdmgusthe.
14
Lies: kukkuty0. Das Ei aus der Henne dient als Beispiel fr die Abhngigkeit des Entstehens (3)
2

VI. Betrachtung des Entstehens in Abhngigkeit (pratyasamutpdaparik)

ndi[p]ri

113

[2]

b) sa evam bhye pratityasamutpde krtakausal(a)h 2 (dhyt)[m](ap)r(a)[t](i)[t]y(a)sa[m]utp()d(e) 'v(a)t(a)r(a)t(i)[|]3


.'. . . [3] . .'
(prat)[i]sthitam
yvac chirsakplam 4 grlvsthipratisthi(tam) pasyatip
3. evam sarvarpnm satvnm tatra [k]rtak(au)[4](alah)
(kra)mena yvaj jarmarana
o . . .i [5]
.'
.'
rah pratyekabuddha[jii]
[6]
."
[ya]m atitam avidys
[1]
[pto]pdnni klesva[sth]
[2]
[sphajritv tistha(t)[i]

[3] . .
samskrk.c.t k(ar)[m](a) karoti|
[ag]n(i)jvlm -

137V2

V3

V4
V5
V6
137Rl
R2
R3

dhipatirpam| puru[s](a)
[4]
R4
6
7
targatam agnitilakm cetany adhi[p](atir)[pa]m|
punas trividhh samskr8 punyh [ap](u[5]nyh ninjyh) 9
R5
h tridhynopags ca punynm samsk[r]nm|io
ja
i
m .. r
[6]
R6
(nilava)rnmk(u)racitah11 [pa]rvatah tadamtargat
[2] . . . . 138V1
{Lcke von 138V2 bis V5; ca. 260 Aks.)
rmukh vijn[n]()vasth() j()t(i)h n()[m](a)rfl(pa) . . [6]

Lies: anadi0.
2 Lies: kaudalo '(dhyt)m(a)0
3
Ergnzung unsicher. Man sollte osamutpadam avatarati erwarten; vgl. 154E3: s{atvh)
ssanam
avataramti.
4
Lies: kaplam.
5
Schlielich sieht er die Schdelschale auf dem Nackenknochen feststehen"; als Beispiel fr
die statische Abhngigkeit (4) im eigenen Selbst.
6
Lies: Hilalcam.
7 Einl. S. 49.
8
Lies: samskrh.
9
Vgl. D. I l l , S. 217: tayo samkhr. punnbhisamkhro, apunnbhisamkhro, nenjbhisamkhro
Sanskritparallelen, s. BHSD zu aninjya.
10
ninjya gehrt der vierten Versenkungssphre an; vgl. MPS 42.17 (S. 396): (caturtham dhynam
sampya cakusmanta ninjyam intim sampann).
11
Vgl. 145R2: nilmkuraparivro manih; 121R3: nbhair amkuraih.
8 Schlingloff, Yogalehrbuch

V2-5
V6

114

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(sarvasa)tvnm yathsambhavatah pasyatij1


'
'
'.
[p]r(a)tityasamutpda-

138R1 t(a)[t](ah) [2]


R2 sttram vistarena prak[2](sitam)2

icakre
R3 ni[p].[p].nti|3

e (va)m

i .[] . . [3]

R4-139V2

(Lcke von 138R4 bis 139V 2 \ ca. 290 ks.)


parivram 4 nirjitya prat[i]
V3
y. [d].[ty]
[3]
[l] nihs[r]th
avidydhi(pa)[t](i)r[p](ni p)(ra)yamti
V4 bhavati ca dvdasmgah pratitya(samutp)[4]d(a)c(a)kr(a)h5

vicakri

4. t(a)t(o) m
[lo](ka)m avabhsya bodhisatvamrdh(a)[n]i [par]isantam6 pasyaty abhisambuddha7 bodhe8
V5 .. .. [5] mahkarunven(i)k(asm)[r](tyupasthna)9
go bhavisyati
V6
[6]tamnm pasyati mahkaruna
(samsk)[i]rasmtnikam dvdasgam^pratl^yasamutpdacakram)11.
.. [2]dr^yamte| tesm [vi]
]k(ra)ment.[nj
(bhaR3 ga)[3]vatah g(r)vakapa(r)[i](vra)12
sth(i)tir
amte ca sarvam yo(gc)[r](a)sy(a) n()bhy[](m)13 n(i)rudhyata i(ti) vyutth14
nam|

139R1
R2

R4

5
[4]
(p)[un]y(e)na v[i]cray(a)t(a)h15 a.i.e . . r

(bha)vatiti16 j |

Vgl. 129Rl: tadvat sarvasatvnm yathsambhava.


2 Vgl. praksayati 160R6; 166R4: praksya.
3
Lies: nip(a)t(a)nti1 Vgl. 146V21 kmcanacakre nipatita.
4
Erg. zu: (mra)parivramt!
5
Lies: dvdasmgam
c(a)kr(a)m (Einl. S. 21). Vgl. 159R6: tato bhagavmmukhnihsrtair indryudhair vajrkrai sarvvidydhipatirupni par hatni niritdhyamte\ vicakri bhavanti\ sarvasatvnam
(dvdasmgapratityasamut)pdacak(r)h; s 159R2.
6
Lies: paridntam.
7
Lies: buddham.
8
Lies: bodhimi Vgl. 151V6: abhisam(bu)ddh(o) bodhim.
9
Aufzhlung der Eigenschaften eines Buddha; vgl. 162V1: balavaisradyvenikasmrtyupasthanamahakarundhi(patir)pani; ^ 164V46 (S. 173, Anm. 6).
10
Lies: dvdadmgam.
11
Vgl. 159R1: pratityasamutpdacakram (8amska)rasmtnikam.
12
Vgl. 166R6: bhagavatah srvakasamgha.
13 Einl. S. 34.
14
Vgl. 147V4: maitri sthiti(m prayati tato) tirudhyata iti vyutthnam\ (Einl. S. 53).
15
Lies: Ho.
i Vgl. 152R4-5.

VIIX. Die Unermelichkeiten (apramna)


Vorbemerkung
Die Meditationsreihe Gte" (maitri, maitr) Mitleid" (karun) Freudigkeit"
(mudit) Gleichmut" (upeks), die auch im Yogastra des Patanjali berliefert ist1, wird
in unserem Text als unermelich" (apramna) bezeichnet; der andere Name brahmavihra,
Wandel in [der Welt] Brahmas" ist in unserem Text, wie im Abhidharmakosa, nicht belegt.
Das Unermelichsein (apramnat) der vier Verhaltensweisen wird hnlich wie im Abhidharmakosa2 begrndet:
(1) wegen des Unermelichseins der Gestalt" (^raypramnatay),
(2) wegen des Unermelichseins der Objekte" (lambanpramnatay),
(3) wegen des Unermelichseins
....",
(4) wegen des Unermelichseins der Erzeugung von [religisem] Verdienst" (punyaprasavpramnatay). 3
Den bungen der vier Unermelichkeiten sind Einleitungen vorangestellt, die im gleichen
Schema ihre theoretischen Grundlagen errtern: Zuerst werden die Hindernisse (pratipaksa)
und die bei der bung zu beherzigenden (manasikra) Dinge genannt. Um den logischen Zusammenhang der Kapitel deutlich zu machen, wird dabei jedesmal ein Hindernis der unmittelbar
(anamtara) vorhergehenden bung neben den Hindernissen der bung selbst nochmals angefhrt. Die Reihe der Hindernisse, die neben den Unermelichkeiten auch die vorhergehenden
bungen mit umfat, lt sich also in folgendem Schema den bungen gegenberstellen:
1

YS. 1,33: maitrikarunrnuditopeksnm sukhaduhkhapunypunyavisaynm bhvantai cittaprasdanam, Abgeklrtheit des Geistes [entsteht] durch die Entfaltung von Gte, Mitleid, Freudigkeit und Gleichmut gegenber glcklichen, leidenden, frommen und unfrommen [Meditations]objekten.*'
Nach dem Kommentar soll man Gte und nicht Neid gegen Glckliche walten lassen, Erbarmen und
nicht Teilnahmslosigkeit gegen Leidende, Freude und nicht Ha gegen Fromme und Gleichgltigkeit,
d. h. weder Mitfreude noch Ha, gegen Unfrmme.
2
AbhdhK. VIII, S. 196: On les nomme Apramnas parce qu'ils
s'appliquent un nombre d'etres immesurable, tirent leur suite un mrite immesurable
(,,fruit d'coulement") produisent des fruits [de retribution] immesurables.
In Vism. S. 267,110 hat die erste dieser Erklrungen eine Entsprechung: yasm pana sabb p^et appamne gocare pavattanti, appamn hi satt etsam gocarabht, weil aber alle diese [Unermelichkeiten]
in einem unermelichen Wirkungsbereich vonstatten gehen, denn unermelich [viele] Wesen fallen
in ihren Wirkungsbereich*'.
3
145V6R1 ** 146V56. Die beiden Stellen ergnzen sich gegenseitig; da sie aber beide nur fragmentarisch berliefert sind und im Wortlaut geringe Abweichungen zu enthalten scheinen, seien sie hier
zur Kontrolle ohne Ergnzungen nebeneinandergestellt:
145V6-R1
ity es apramno maitriviharah

146V5-6
ity eso 'parh apramno maitrivihrah

(1)
(2)
(3)
(4)

asray . . r

[a]
alamba[n] . . [r]

[ya ap]r[am]an

. . . [y] . prasavapramnataydpramneti

pramnatay
punyaprasav[p] . . . . [n]ataypramneti

116

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

bung:

Hindernisse:

Gruppen" (skandha)

die Ansicht, [es gbe] ein Selbst" (tmadrsti)


132V1;

Bereiche" (yatana)

? 134R1;

Entstehen in Abhngigkeit" (pratityasamutpda)

Werden, Genu und Durst" (bhavabhogatrsn) 136R2;


Verblendung" (moha) 136R2;

Gte" (maitri)

Unkenntnis" (ajfina) 139R4;


Zorn" (krodha) 139R4;

,,Mitleid" (karun)

belwollen" (vypda) 147R1;


das Veranlassen, das Glck und Heil Fremder zu entfernen" (parasukhahitpanayanakrana) 147Rl;
das Veranlassen,
" 147R2;

Freudigkeit" (mudit)

Grausamkeit" (vihims) 152R6;


Beglckung ber fremdes Leid" (paradubkhapriti) 152R6/153V1;
Neid und Unlust" (Irsyrati) 152R6;
Nichtbeglcktsein ber fremdes Glck" (parasukhpriti) 153V1;

Gleichmut" (upeks)

Neid und Unlust" (irsyrati) 155V3;


Sinnliche Leidenschaft und
(kmargavypda) 155V3.

belwollen"

Aus der Gegenberstellung wird deutlich, da die Liste der Hindernisse in unserem Text eine
Erweiterung der kanonischen Aufzhlung der Meditationshindernisse in den sechs Elementen,
die zum Entrinnen fhren" (sad nihsaraniy dhtavah) 1 darstellt: Die Gte fhrt zum Entrinnen aus dem belwollen (vypda), das Mitleid aus der Grausamkeit (vihims), die Freudigkeit aus der Unlust (rati) und der Gleichmut aus sinnlicher Leidenschaft und belwollen (kmargavypda).2
Anschlieend werden die bei den bungen zu beherzigenden (manasikra) Dinge genannt,
die sich mit den Merkmalen (lakkhana) der Unermelichkeiten im Visuddhimagga3 vergleichen
lassen:

Skt. Daso. S. 77ff.; Sang. VI,16; Mvy. 1596-1602.


Die vier Eigenschaften werden auch AbhdhK. VIII, S. 196 als Hindernisse der Unermelichkeiten
angefhrt.
3
Vism. S. 263, 93f.
2

VIIX. Die Unermelichkeiten (apramana)

117
Vism.

Gte:
?* 139R5;

Bettigung des Aspekts des Heils" (hitkrappavatti)


Mitleid:

Zuwendung zum Entfernen [des Leides]


Bettigung des Aspekts des Entfernens des
der Leidenden" (duhkhitpanayansaya)
Leides" (duhkhpanayankrappavatti) 2
153V1;
Aspekt des Kummers" (nirvidkra) 153V1;
Freudigkeit:
Aspekt der Freude" (prmodykra)
153V1;
Zuwendung zur Mitfreude bei Heil und
Glck" (hitasukhnumodansaya) 153V2;

Freude" (pamoda)

Gleichmut:
? 155V4.

Bettigung des Aspekts der Neutralitt"


(maj j hatthkrappa vatti)

Als nchstes wird das Wesen (svabhva) einer jeden Unermelichkeit definiert; erhalten ist
jedoch nur die Bestimmung der Freudigkeit als Frohsinn" (saumanasya).3 Die anschlieenden
Angaben sind in den vier Einleitungen mit fast gleichem Wortlaut berliefert*; sie betreffen
den Wirkungsbereich der Meditationen.5 Damit sind die theoretischen Einleitungen ab-

Vielleicht ist nach 140V3 (sarvasatvah)itasukhdhysaya, Hinwendung zum Heil und Glck aller
Wesen" zu ergnzen.
2
Entspricht AbhdhK. VIII, S. 196, Anm. 3 ( = AbhdhKVy): duhkhpanayankratvc, durch den
Aspekt des Entfernens des Leides".
3
153V2. In AbhdhK. VIII, S. 197 wird das Wesen (svabhva) der Unermelichkeiten in folgender
Weise bestimmt: ,,Que sont, de leur nature, les Apramnas ? Non-haine, la bienveillance et aussi la
pitie; satisfaction, la joie; non-desir, Vindifference."
4
140V1 == 147R34 = 155R1. Lediglich die Freudigkeit weicht dahingehend ab, da sie sich nicht,
wie die anderen drei Unermelichkeiten, auf die sieben Sttten (bhmi; s. oben, S. 32, Anm. 4), sondern
nur auf die drei unteren Sttten bezieht, da sie ihrem Wesen nach aus dem Frohsinn besteht, der den
hheren Versenkungssphren fremd ist (153V4). Vgl. AbhdhK. VIII, S. 199: ,,Sur quelles terres prend
point d'appui l'ascete quand il produit les Apramnas? La joie dans deux dhynas; les autres dans six
terres ou, d'apres quelques-uns, dans cinq. On cultive la joie (mudit) dans les deux premiers dhynas
seulement, car la joie est satisfaction (saumanasya) et la satisfaction manque dans les autres dhynas."
(In dieser Darstellung wird kmadhtu nicht, wie in unserem Text, zu den bhmi gezhlt; Vasubandhu
erwhnt dann noch mehrere hnliche Zhlungen).
5
Die hier vertretene Anschauung, da die Meditationen, wenn sie der Sinnenwelt angehren, aus
vier Gruppen bestehen, wenn sie aber der Formenwelt angehren, aus fnf (kmvacar catuhskandhasvabhv\ rpvacar pamcaskandhasvabhv), wird durch AbhdhKVy. S. 634,19ff. erklrt: kmvacaram anuparivartakarpbhavc catuhskamdhasvabhvam. vedansamjnsamskravijnnaskamdhasvabhvam ity arthah. rdhvabhmikni tu pamcasvabhvni dhynasamvaralaksanarpaskandhasvabhvt. Gehrt sie der Sinnenwelt an, besteht sie wegen des Nichtseins der sich anschlieenden[ Gruppe]
Form ihrem Wesen nach aus den vier Gruppen; d. h., sie besteht ihrem Wesen nach aus Empfindung,
Wahrnehmung, Gestaltungen und Bewutsein. Die aber, die den hheren Sttten angehren, bestehen
ihrem Wesen nach aus den fnf Gruppen, weil die Gruppe Form mit dem Merkmal der Zucht in der
Versenkung zu ihrem Wesen gehrt."

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

118

geschlossen und es folgen die bungen (prayoga), an deren Beginn jedesmal das vom
Freund zum Feind fortschreitende Verwirklichen der in der Unermelichkeit geforderten Gesinnung steht.\

VII. Gte (maitri)


Vorbemerkung
In der bung strmt der Yogin auf mannigfache Weise seine Oute ber die Wesen aus: Er
berschttet sie mit einem Milchregen (4.a), lt sie in ein Milchmeer (5. a) oder Milchteiche (5.b)
eingehen, besprengt sie mit Farbstrmen (8.a) und umhllt sie mit einem Lotos (8.b). Darberhinaus erlebt der Yogin die Segnung (nusamsa), da dem in der Gte Wandelnden (maitrvihrin) keine Gewalttat etwas anzuhaben vermag: Sein Krper wird diamanthart und auf ihn
geschleuderte Messer fallen als Blumen nieder (6.a); anstrmende Feinde und wilde Tiere verneigen sich vor ihm, wenn er sie mit Gte berstrahlt (6.c). Dieser Erfolg gehrt zu einer Reihe
von elf Segnungen, die am Ende der bung (12.) genannt werden. Die Reihe lautet, im Vergleich
mit dem Pli2:
147V5-6:

()
(3)

{4)
(5)

(6)

er schlft glcklich" (sukham svapiti)


er wacht glcklich auf" (sukham pratibudhyate)
wenn er schlft, schtzen ihn Gottheiten" (suptam enam devat raksamti)
er hat keine bsen Traumgesichte''
(na ca p(pakam svapnam pasyati))
(vgl. weder Gift noch Messer dringt in
seinen Krper" (kramati na visam na
sastram kye) (144V4)

Pli:
(1) er schlft glcklich'* (sukham supati)
(2) ,,er wacht glcklich auf" (sukham patibujjhati)
(6) Gottheiten schtzen ihn" (devat
rakkhanti)
(3) er hat keine bsen Traumgesichte"
(na ppakam supinam passati)
(7) weder Feuer noch Gift noch Messer
dringt in ihn" (nssa aggi v visam v
sattham v kamati)
(8) alsbald sammelt sich der Geist" (tuvatam cittam samdhiyati)
(9) der Gesichtsausdruck verklrt sich"
(mukhavanno vippasidati)

Vgl. AbhdhK. VIII, S. 201 f.: doit done diviser les etres en trois categories, amis, indiffrents,
ennemies. La premiere catgorie se divise aussi en trois: grands amis, amis moyens, petits amis; de
meme la troisieme; tandis que la categorie des indifferents ne comporta pas de subdivisions; soit, dans
Tensemble, sept groupes. Cette division etant acquise,l'ascete forme d'abord le voeu de bonheur l'egard
des grands amis; ensuite l'egard des amies moyens et des petits amis. L'ascete en arrive ne plus
distinguer les trois categories d'amis; il forme alrs le meme voeu l'gard des indifferents et des ennemis. Par la force de l'entrainement, il produit, Fegard des plus grands ennemis, le meme voeu de bonheur qu' regard des plus chers amis."
2
A. V, S. 342 usw.; erklrt Vism. S. 255ff.

VII. Gte (maitri)

(7/8) er wird von Gttern und Menschen


geliebt" (priyo devamanusynm)

(9) er wird von Brahma gerhmt''


(brahman ca pra&amsitah)
(10) er erlangt die Frucht des Nichtwiederkehrenden" (angmiphalam
prpnoti)
(11) wenn er aber nicht zu Hherem
durchdringt, geht er in den Wesenszustand der Brahmawelt ein" (uttare
cpratividh(ya brahmalokasya svabhvatym upagacchati))

1. a) ajnnapratipaksnamtaram1

119

(4) er,wird von Menschen geliebt" (manussnam piyo hoti)


(5) ,,er wird von Nichtmenschen geliebt"
(amanussnam piyo hoti)

(20)

er stirbt unverwirrt"
klam karoti)

(asammlho

(22)

wenn er nicht zu Hherem durchdringt, geht er in die Brahmawelt ein"


(uttarim appativijjhanto brahmalokpago hoti)

krodhapra(tipaks[5]rtham)
m . . [sa]m[v](r)tyanukm . . . . .[i] . . . . [6] . . . .

[ra]

139R5
R6

. . . . . [ ! ] . . 140V1
(sraye kmadhtvsray|
lambane kmadhtv)l(am)ban bhmibhedena saptabhaum kmadhtur angamyas catvri [dh](ynni dhynm)[t](a)r(am) ca hitasukh[o]pa[2](samhra)3
V2
2

2. (tatprayogah)
a)

(a)dMmtrdhimtre mitre mrduni 4 evam udsme] 5

6) tath 6 amitre m(rduni madhya) adhimtre 7 ya[d] yad(r)sam a[3]


(sarvasatvah)[it]asukhdh[y][sayap](ra)[v](r)[t](t)8
[ta]d
satvnm hitat
[4]

Das Hindernis ajnana bezieht sich auf die vorhergehende bung pratityasamutpdaparikpa.
Nach den Paralleldarstellungen in den einleitenden Abschnitten zu den anderen Unermelichkeiten (karun: 147R14; mudit: 162R5153V4; upeks: 15SV2R1) ist etwa zu ergnzen:
b) atha kimsvabhv maitri tad ucyate] adve$eti s svabhv\ s tu sapratipak$a sanuparivart sasamprayog parigrhyamn\ kmvacar catuh8kandhasvabhav\ rpvacar pamcaskandhasvabhav\.
3
Vgl. hitasukhopasamhra 141V1, 141V'2. Vgl. Vism. S. 263,93: metta hpasamhrarasa.
4
Lies: mrduny.
5
Vgl. 147R5: tatprayogah
adhima(tradhimt)r(amm)it(r)am
krpanam
drtva param
krunyam utpadyate evam ma(dhyam mrdum) tadvad itdsinam; 153V4: tatprayogah adhimtrdhimtrasya mitrasya sukhena prlto bhavati evam madhyasya mrdunah udsinasya.
6
Lies: tathmitre.
7
Vgl. 147RS: mrdumadhydhimtram cmitram kramasah
duhkhair pahatam drstva ka(runyam
utpa)dyate; 153V5: e(vam adhi)mtrasymitrasya sukhena prlto bhavati. Siehe oben, S. 118, Anm. 1.
8
Vgl. 145V6: sarvasatvhitadhyasayapravrttah.
2

V3
V4

120

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

140V5

[ma]m ivtmnam ma[h]. . . . [5]

V6

[jkram vidh(i)manta(m) pa[sy](ati)

140R1

o .[y]o

[6]

.. .

sat(v)nm laksannuvyamjanavi[r]()jit buddh()

[2] . . .

d. c(a) y(a)thlt)hilasita utpadyate


R2 [2]
R3

[h](r)dayam
.'.

[3]

R4

ta[tra] cit[t]o[p](anibandham)1

....

[4]

[n].va kram(e)na s(ar)v(a)satvn mftrp. . .


[5] . .'
'
..
punah sarvath visamcayatah
nbht sa 3
[v].sa[6]
[o]pasaipliarati ayam dvitiya avadra
(sa)[tv]nm a[I]

R5
R6
U1V1

rni
V2 khopas(am)h()r(a)h [s]th()n(m)taram|
V3 [s]. .o . . [hjansthnmtaram ca
V4

samhrtni

V5

[yam]ti ca

hitasukh[2]

hitasu.

hitasukhopasamhrasth[<3]

sa tmn 4 satvm pasyati

drstv c[4](sya)

ksirasamudre ca nimagnh [5]

V6

.. .

m .[i n.la .e]panmaya[tf]

141R]

(se)[n]p(a)t(ir) bh(a)v(a)ti|

R2

um[2](patih)6

[v]. .[y]. .t. [s](at)y()n. [2]

Vgl. hrdayopanibaddhacetasah 166R2 u. a.; Einl.-S. 36.


Vgl. 143R5: sa(r)vasatvh
mtrbhts cdmtahkuksigat().
3
Der erhaltene Text von 140R4 und R5 allmhlich alle Wesen [zur] Mutter
. . .; indem er
weiterhin berall untersucht: Nicht war
" scheint mit der in Vism. S. 253 (36) dargestellten Meditation im Zusammenhang zu stehen, die auf S. II, S. 189 zurckgeht: na so, bhikkhave, satto sulabharpo,
yo na mt bhtapubbo
yo na pita bhtapubbo etc., Nicht leicht ist ein Wesen zu finden, ihr Mnche,
das nicht frher einmal [euere] Mutter war,
[euer] Vater war, . . . " usw.
4
Lies: tan.
5
Vgl. 143R6: maitrsayasya hr(day)advram apvryate tatrmtah ksirasamudram sambhavati.
6
senpati ist ein Beiname Skandas, umpati Sivas.
2

VII. Gte (maitri)


[tjv1 cimtayatij 2 dirghartram 3

(eittopaniba)[n]dham

l desh sasatv dagdhh

121
[3]

141R3

tamma[4]

R4
sya 4 satve-

su hrdaydvram5 apvryate | 6

[5]

R5
sarvasatvn(m)

duhkhny usamayamti 7

te ca ta eva nadyo 'nu[6]

R6
h amta-

rsrayapravis(t)h

[r][jabh]i[r] e[va] brahmabhih saddantai[l] . . . . 8

142V1

[2] hrdaye suva(rn) . . .

V2

[3]
(u)padesasthn[](m)t(a)r(am) [j](i)(citt)opanibandham krtv dhyti dirghartram 9
[4]
priyahitasus a t v n a n u g [ r ] h n l y m | 1 0 t a s y a i v a m citta[s] . . . . . . . . [5] . . . .

V3

ym ucitnucity[](m) y

[h]v()[g]r(a)
khopa[d]e(s)e

(Lcke von 142V6 bis R2; ca. 185 Aks.)

(at)[i

Pa[s]y(e)[y]R3
[t]. (pa)[sy]-

k h a d ( v ) r e d a k s i n a i p 1 2 d a m s t r y m c i t t o p a ( n i b a n d h a m ) [5] k r t v pasyati | 13

[6]

Lies: krtva.
Satzzeichen zu streichen.
3
Vgl. 142V3: (citt)opanibandham krtv dhyti dirghartram.
4
Erg. zu: (maitrsaya)sya. Vgl. 143R6: tasyaivam maitrsayasya hr(day)dvram apvryate.
5
Lies: hrdaydvram.
6
Lies: apvriyate\.
7
Lies: upasamayamti. Vgl. 146R6: apyagatnm satvnm sarvaduhkhopasamam krtv.
8
Erg. zu: saddantai(r gajaih)! Vgl. 125V5: saddam(ta)h sveto gajah. Vgl. Einl. S. 50, Anm. 3.
9
Vgl. 141R2: cimtayati\ dirghartram; 142R4: m(u)khad(v)re dakinam damstrym cittopa(nibandham) krtv pasyati (Einl. S. 36).
10
Vgl. 1S3R4: satv
sukhen()nugr(hith).
11
Erg. zu: candramandalasa(mksbhir nadi)bh(i)h1 Vgl. 152R12: samyaksamb(uddh)s
tarru
n(bhinih)srtbhis candramandalasamksbhir nadibhir yogcrs(r)ayam pryate].
12
Lies: daksinym.
!3 Vgl. 142V3:j(i)hv()gr(a)
(citt)opanibandham krtv dhyti dirghartram (Einl. S. 36).
14
Vgl. 146R3: esa eva kramah.
2

V5

142V6-R2

(mai)trsayasa[ha]
|
t(a)sy(ai)vam
[3]
(nih)srth
amjalibhih satv(m) pi
ev]am [c]andramandalasa
[flbh^Jh 11 e t

(maitr)[sa]yasya kaly[n]
kramah14

V4

R4
R5
R6

122

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

4. a) tasyaivam l)ha[va](ti|)1
2

143V1

[i]lam srayam prayati


prn(e) csraye m()[r]dhatah
kslrastambhah iva nirgatah 4 abhrakta iva gaganam prya 5 ksiravarsam muncati yena
(sthiti)r pryate6
V2
b) tatra
(prajmn? utpadyamte [2] tadamtargat[n]()m [sa]rvasatvnm
sapta
dm 8 u[pasa]m[h]a[rat]i
(2) [j](fi)[dh]i[pa]tyasam[pa](d ya)th cakravartinmj
(2) raksadhipatya(sa)m(pad9 ya)th caturnm [ma]hrj()nm|10
V3 (3) v(i)[sa]yaparibhogdhi[3](patya)[sa]m(pad yath trayastrimsatml
(4) kmdhipatyasampad yath mrnml) 11
(5)
(dh)i[pa]tyasampad yath brahma[n](m
(6) sva)[ya]mavabodhdhipatyasampad yath pratyekajinnm|
V4 (7) [4]
.'
12
3

4.a) [Dem Yogin] kommt die Erkenntnis:


erfllt (ein Milchbaum)
[seine] Gestalt. Ist [seine] Gestalt [von diesem] erfllt, geht er wie eine Milchsule von [seinem]
Haupt aus, erfllt wie ein Wolkenhaufe den Luftraum und entlt einen Milchregen, von
dem [sein] Standort erfllt wird.
6) Hierbei entstehen (weitf)ausgedehnte (Palste). [Der Yogin] schafft fr alle Wesen, wenn
sie in diese eingegangen sind, [bezglich] (des Zustandekommens fr die) sieben (Klassen:)
(1) Das Zustandekommen der Befehlsmacht wie von Weltherrschern;
(2) das Zustandekommen der Schutzmacht wie von den vier Groknigen;
(3) (das Zustandekommen der Macht) des Genieens der Sinnesobjekte (wie von den
[Wesen der Gtterklasse der] Dreiunddreiig);
(4) (das Zustandekommen der Macht ber die Sinnenwelt wie von den Mra-[Wesen]);
(5) das Zustandekommen der Macht
wie von Brahma[-Gttern];
(6) das Zustandekommen der Macht der Selbsterleuchtung wie von Pratyekabuddhas;
(7) (das Zustandekommen der Macht des In-Bewegungsetzens des Bades der Lehre wie von
vllig Erleuchteten).
1

Vgl. 143R5: (5.a) puna(s ta)s(y)ai(vam bhavat)i.


Erg. lc?iravrkso ? Vgl. 145V1: ksiravrko mrdhanirgato 'namtam lokadhatum spharitv ti?thati\
(sat)v() nihsrtbhih ksiradhrbhih siktamtr
-maitrvihrinam pranamanti.
3
Lies: ostambha.
4
Lies: nirgato 'bhra0.
5
Vgl. 148V5: (kr)tsn(am) gaganam abhrak(ta iva spha)r(i)tv
vr$tim municati; 144R23:
abhraktavam nirgatya sarvam gaganam aprya; (Einl. S. 40 f. u. S. 45).
6
Einl. S. 39.
7
Erg. zu: (prsd urupra)mn. Vgl. urupramn 128V5.
8
Erg. zu: (parisatsampa)dmtt Das Verstndnis ist schwierig; man sollte (sampa)da erwarten. Ob
die Aufzhlung mit den acht parisat (ksatriyap0, brhmanap0, grhapatip0, ramanap0, caturmahrjikap0,
trayastrimSatp0, mrap0, brahmap0; etwa AbhdhKVy. S. 135,28ff.) im Zusammenhang steht, ist ungewi; sie umfat jedenfalls die gnstigsten Existenzmglichkeiten der Sinnen weit (kmvacara).
9
rakdhipatyaP.
10
Die vier Groknige sind die Beschtzer der vier Weltgegenden.
11
Ergnzung unsicher. Vgl. etwa LV. S. 130,8: mr ah kmdhipatih.
12
Erg. etwa: dharmacakrapravartandhipatyasampad yath samyaksambuddhnml?
2

c)
syati

VII. Gte (maitri)

123

(kra)mena varnasamsthno

[bhjvopetn sarvasatvm pa-

sarvadamte. . [<5]

143V5

[d].[d]h sambh[a](vamti|)
pas)[y](ati|) [ta]ta loka. .m . . . . [6]
.' . ;
ryamayll 1 stri sampraja[ny](a)2
[2]

tadamtargatms ca sa(tvm
V6
,.

(vai)[d](). U3R1

gunenanag[t](e3 'dh)[v](ani) . .
. . [2]

R2

(man)[d](a)[l](e)nt(i)kr(a)
[3]
ksena iti 4 yatraiv
[]. . . .[ra]kssthnmtaram ity ucyat(e|)
[4] s(a)[t]v(o)dv(a)h(a)[na]
.r
[v]. [m](ai)trsayasya ratnamayah . . .[] . . (^i)[ra]sy (u)tpadyate|
anamtaparyamtam svsvirnaparyamkas5 ta[5]dadhirdhn sa(tv)n udvahati|
i. .[y].(p)r(a)t[ip](ak)se

R3
R4
R5

5. a) puna(s ta)[s](y)ai(vam bhavat)i


[m](a)y() [sa](r)vasatvh bhr(ai)
(pi)dit mtrbhts cmtahkuksigat() 8 . . [n]. . . .[]ra[m] pidith [katha]m
e . . (satv)n udvaheyam iti ta[6]syaivam maitrsayasya hr(day)[]dvram9 apvryate10 ta[tr]B6
[m]tah ksirasamudram sambhavati | u sarvasrotobhyasc[a]syadvrany12 apvryamte|13 .e . .
(ni)m(a)gns14 tadanusrenai[2]vsrayam pravi- 144V1
15
samtij
c) (nicht bersetzt)
5.a) Weiterhin (kommt [dem Yogin] die Erkenntnis):,,Durch mich wurden alle Wesen (mit)
Brden
gepeinigt, wurden mir zur Mutter und gingen in [meinen] Mutterleib
ein, wurden
gepeinigt. Wie kann ich (die Wesen)
empor
fhren?"
Hat er sich so der Gte zugewandt, ffnet sich [sein] Herzenstor. Dabei tritt in [seinem]
Innern ein Milchmeer in Erscheinung. Es ffnen sich die Tore aller seiner Krper ffnungen.
(Von diesen gehen Milchstrme (ms, in die alle Wesen) einsinken und diesen folgend in die
Gestalt [des Yogin] eintreten.
1

Satzzeichen zu streichen.
Vgl. 169V1: smrtisamprajanyasampaddvayam pratilabhate] tadadhipatirupam] vaidryamay(i)
stri
smrtyh 8amprajany(a)sy(a ca puru$ah).
3
Lies: gunenngat(e).
4
Lies: kseneti.
5
Lies: svstirna0.
6
Vgl. 142B6: tasyaivam bhava(ti\).
7
Lies: satv.
s Vgl. S. 120, Anm. 3.
9
Lies: hr(day)advram.
10
Lies: apavriyate. Vgl. 141R4: (maitrsaya)sya satvesu hrdaydvram apvryate].
11
Vgl. 141V4: kirasamudre ca nimagnh.
12
Lies: dvrny.
13
Lies: apvriyamte\.
14
Erg. zu: (t)e(bhyah k$irapravaha nirgatah\ te$u sarvasatva ni)m{a)gnasti Vgl. 146R6: ksirapravaho
nirgatya.
15 Vgl. 144R6: yoginah ,sraye sarvaeatvsrayh.
2

124

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

b) [t]. . . .[r]. . A . . . .tasu 2 vaidryadamdpadmni| 3 tatkarniksu ca kslrapuskirinyah4


padmadandnusrendhiruhya [s](ar)[v](asatv ca ksirapus)[k](i)[r](i)[ni]su nimagnh sm144V2 kucitapa[2][t](tr)[o](dhir)dh5 drsyamte|
c) [m](rdh)n(as csya) [pa]dmam sambhavati6 tannisanno bhagavm dharmam desayati|
tac chrutv vikasitebhyah padmebhyo7 tulym priti[m] (anubhavamti sar)[v](a)satvhs
V3
d) tesu ca padmandesu padmapamkta[3]yo '[na]m(ta)paryamt 9 sambhavamti|
tadadhij3
rudh10 brahmarupinah u satv drsyamte)12 evam suvarnesu mlalohitvadta
V4 [sajrvasatvm sarvagtraih samudvaham ** parm pri[^](tim) samanubhavati|
camkra15
16
manisadybhym sarv(e)rypathesu codvahato 'sya satvm pari prltir tpadyate|
6. punar maitriprayu[k](ta)

(kra)[ma]ti na yisam na sastram kye| 17

b) {Dann) [erscheinen] {in der Gestalt) [des Yogin] in


Lotosblumen mit glsernen
Stengeln, und in deren Samenkapseln Milchteiche. Den Lotosstengeln folgend steigen (alle
Wesen) hoch und erscheinen, eingesunken in die (Milch)teiche, in den geschlossenen Bltenblttern sitzend.
c) (Aus seinem) Haupt tritt ein Lotos in Erscheinung, auf dem der Erhabene sitzt und die
Lehre verkndet. Indem sie diese vernehmen, (werden alle) Wesen einer Beglckung (teilhaftig), die den aufblhenden Lotosblumen gleicht.
d) An den Lotosstengeln treten in unendlichem Umkreis Lotosreihen in Erscheinung.
Darauf erscheinen die Wesen in Brahmagestalt sitzend. Ebenso an goldenen und an blau-,
rot- und wei{farbenen) [Lotosstengeln].
Indem [der Yogin] mit all [seinen] Gliedern alle Wesen emporfhrt, wird er hchster Beglckung teilhaftig. Fhrt er die Wesen aus Umherwandeln und Niedersitzen und in allen
Krperhaltungen empor, entsteht [bei ihm] hchste Beglckung.
6. Weiterhin [gilt fr den Yogin, der im] ben der Gte
: ,,Weder Gift noch
Messer dringt in seinen Krper":
1

Erg. zu: t(adS)r{aye)?


Lies: otsu1
3
Lies: damda oder damdni. Vgl. 153V61 padmaih vaidryandaih.
4
Vgl. 147V23: ksirapuskirini
t(amni)magnam naksatram maitrsayaparigrhitasya (adhi)patirpam\.
5
Lies: ^pat(tr)(dhir)dht
6
Vgl. etwa 136V2: puskirini m(r)dhn(ah) sambhavati.
7
Lies: padmebhyas.
8
Vgl. 144V3/4: parm pri(tim) samanubhavati],
9
Lies: Qparyamth.
10
Lies: rdh.
11
Lies: rpinah.
12
Einl. S. 54.
13
Erg. zu: nilalohitvadta(varnesu ca)1 Vgl. unten S. 131, Anm. 9.
14
Vgl. 143R5: satvn udvahati.
15
Vgl. Divy. S. 161,3: caturvidham irypatham kalpayati tadyath camkramyate tisthati nxsldati
ayym kalpayati, ,,er nimmt vier verschiedene Krperhaltungen ein: er wandelt umher, steht, sitzt
nieder und liegt.4'
16
Lies: utpadyate\.
17
Es handelt sich hier um die 7. der 11 Segnungen der Gte (s. oben, S. 118f.): nssa aggi v visam
v sattham v kamati, ,,weder Feuer noch Gift noch Messer dringt in ihn".
2

VII. Gte (maitri)

125

a)1 vaiduryama[5][yl](m)2 prthivlm vaiduryama[yava]jrsanaracitm2 tanmadhye vajr- 144V5


mayah3 srayo vajrsandhirdhah4 yogina utpadyate|
tadupari sarvasatv(h sarvaprahara)[n]ni ksipamti 5 tni puspabhtni tatra [6] n(i)patanti| 6 tad eva vajrsanam tesm
V6
avisayi bha[vat]i
b) tesu cnyesu vajrasanesu7 buddh usnisaprvadarsant kramenodgacchamto drsyam[t]e(|8 tasm usnisapra)[bh][y]9 [kjrtsnam jagad indranilbham dr[l][sya]te|
rnpra- 144R1
bhy10 candryadtam gtraprabhy()!11 kanakaprabham|
'stanakhaprabhbhih12 padmargbham13 te bhagavamtah14 mrdhata ekaikam
(yog)c[]r[s]r(a)yam
vestayamti|
vajracla[2]k[tapr]khyo15 'vatisthati|
R2
c) punar api [ca] sarvasatvh sarvapraharangnivisdims cdya simhavyghrdayas ca
16
tarn abhidravyamte tasya maitrsa(yasya)
maybhraktavam nirgatya17

a) [Er sieht] die Erde aus Glas und mit Diamantthronen aus Glas versehen. In deren Mitte
entsteht die Gestalt des Yogin aus Diamant und auf einem Diamantthron sitzend. ber ihn
schleudern alle Wesen (alle Waffen); [doch] fallen diese, in Blumen verwandelt, dort nieder;
denn jener Diamantthron ist fr sie unzugnglich.
b) Auf den anderen Diamantthronen erscheinen Buddhas, die nach vorhergehendem Sichtbarwerden ihrer Usnisas allmhlich zum Vorschein kommen. Durch (das Strahlen ihrer
Usnisas) erscheint die ganze Welt saphirblau leuchtend, durch das Strahlen der Urn mondwei,
durch das Strahlen [ihrer] Glieder goldstrahlend und durch das Strahlen der acht Fingerngel
rubinrot leuchtend. Die Erhabenen umkleiden einzeln die Gestalt (des Yogin) mit
. . . aus [ihrem] Haupt.
[Dieser] verharrt einem diamantenen Berggipfel hnlich.
c) Weiterhin strmen alle Wesen mit allen Waffen, Feuern, Giften usw., und auch Lwen,
Tiger usw. gegen ihn an. (Vom Haupte) des der Gte zugewandten [Yogin] geht (ein Flu)
1

144V5-6: Einl. S. 30 f.
Lies vaidrya0.
3
Lies: vajramaya.
4
Lies: dhirdho.
5
Vgl. 144R2: sarvasatvh sarvapraharangnivisdims cdya
tarn abhidravyamte.
6
Die Darstellung erinnert an den Angriff der Heere des Mra gegen den Bodhisatva; vgl. LV.
S. 317,15 ff.: mr ah
saparivro vividhni praharanni bodhisattvasyopari utsrjati sma sumerumtrms" ca parvvatn\ te ca bodhisattvasyopari ksipth puspavitnni vimnni samtisthante sma.
7
Lies: vajrasanesu.
8
Vgl. 121R3: (va)j(r)(sann)i (c)odgacchamti\ tesu nisann buddhh.
9
Lies: (pra)bhay.
10
Lies: prabhay.
11
Lies: prabhay(). Satzzeichen zu streichen.
12
Lies: astanakha0.
13
Vgl. 146R4: caturvarn buddh bhagavantah prabhbhir lokam avabhsya tisthamtiti. (Einl. S. 41).
14
Lies: bhagavamto.
15
Lies: vajrcalaktaprakhyo. Vgl. 155R3: . . .[m]. ktaprakhy buddhavapurdhrina.
16
Erg. (mrdhn nadi ksira0)? Die in 142R6 naheliegende Ergnzung kslravrksa ist hier nicht mglich, da ein Feminin vorliegen mu. Vgl. etwa 130R3: ksiraghrtanavanitanadyah.
17
Vgl. 143V1: m()rdhatah kslrastambhah iva nirgatah abhrakta iva gaganam prya kslravarsam
muncati yena sthitir pryate; 148V5: tat(ah karu)ndhipatirpam hrdayn nirgatah
(kr)tsn(am)
gaganam abhrak(ta iva spha)r(i)tv
(sa)r(v)opakaranavrstim mumcati; (Einl. S. 40 f.).
2

126

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

144B3 sarvam gaga[3][na]m prya prakravat 1 sarvasatvn upaguhya tistliatij


ktasamrambhapraharans tarn eva pranamamtitij 2

te ca satv mu-

7. puna(r mait)[r](&ayas)[y](ai)vyam any[o] visesa utpadyate


R4

a) svam [sr]a[4]yam sa(rvama)ranapratyayaih parivrtam pasyati|


srayc csya brahmno nirgatya tarn maranapratyayn udviksate ta[ta](b. sarvamarana)pratyayanirmuktam
R5 candramandaldhirdham [5] [c](and)[r](a)[sam]k[s]am c[t](mna)m (payati|) 3
b) tadvat sarvasatvnm maranapratyay[](m)4 paranpanayanam 5 pasyatij te ca satvhe
candramandalarasmy.[] . . 7
()[](ra)yam pravisamti] sa ca cakravarty^rayam
R6 [6] sa ca brahmsra(yam sa ca buddhra)yam 8 buddhsraye brahmsrayo drsyate yvad
yoginah9 sraye sarvasatvsrayh
c) tatra bhagavm su
m prthivym camkramati
niksi10
145V1 pte[i]
(ni)r[g]atah tadrasaprnam simcati utsipte paryamkena
nisannasya ksiravrkso mrdhanirgato 11J namtamlokadhtum 12 spharitvtisthati| 13

aus (Milch) wie ein Wolkenhaufe aus, erfllt den gesamten Luftraum und umhllt wie ein
Schutzwall alle Wesen. Zorn und Waffen ablegend verneigen sich vor ihm die Wesen.
7. Weiterhin entsteht (fr den der Gte zugewandten) [Yogin] folgende andere Besonderheit:
a) Er sieht seine eigene Gestalt von allen Ursachen des Todes umgeben. Indem von seiner
Gestalt Brahma[-Gtter] ausgehen, durchschaut er [auch] diese als den Ursachen des Todes
[unterworfen]. Dann (sieht) er (sich selbst von allen) Ursachen (des Todes) befreit und (wie
der Mond) scheinend auf der Mondscheibe sitzen.
b) Ebenso sieht er fr alle den Ursachen des Todes [unterworfene] Wesen das Entfernen des
Todes. Die Wesen treten, auf einem Strahl der Mondscheibe (aii/wrte)[steigend], in die Gestalt eines
ein, dieser in die Gestalt eines Weltherrschers, dieser in die Gestalt
Brahmas (und dieser in die Gestalt des Buddha). Die Gestalt Brahmas erscheint in der Gestalt
des Buddha, und schlielich in der Gestalt des Yogin die Gestalten aller Wesen.
c) Hierbei wandelt der Erhabene
auf der Erde umher.
Werden
niedergelegt, geht von
aus und besprengt ihn, der von
dessen Essenz erfllt ist. Ist [die Essenz] ausgegossen, durchdringt ein vom Haupte des im
Ruhesitz sitzenden [Yogin] ausgehender Milchbaum die unendliche Weltregion
1

Lies: prakaravat.
Vgl. 145V2: (sat)v(a) nihsrtbhih ksiradhrbhih siktamtr eva muktasamrambhapraharan maitrvihrinam pranamanti\.
3
Vgl. 128V5: manayah (ditya)mand(a)l(o)pari sthah tadadhirdho yogcrah atmnam pakyati\ ;
127Rl: yog(c)rsrayah candramandalasamksah.
4
Lies: pratyaynml
5
Lies: maran0.
6
Lies: 8atv&.
7
Erg. zu: {rdhvam)1
8
Die Wesen gehen in Gestalten von immer hherer Rangstufe ein.
9
Lies: yogina.
10
Lies: Ogatas,
11
Vgl. 127V2 \ mrdhnah >ratn(amayo vrk$a)h anamt lokadhtavah spharitv tisthati\.
12
Vgl. 130V4: anamt lokadhtm spharitv; 150R1: anamtesu lokadhtusu.
13
Einl. S. 39.
2

VII. Gte (mari)

127

[2]
(sat)[v]() nihsrtbhih ksira- 145V2
dhrbhih1 siktamtr eva muktasamrambhapraharan maitrvihrinam pranamanti| 2
evam mait[r]sa[ya](sya)
[3]
V3
[kujta eva bhagavato buddhasyeti ||
8. a) punah 3 maitrsayasynamtam paryamtam satvasamudram abhimu(khi bhavati|)* . .
[4]
. . . . (abhise)kai5 simcyamno drsyate]
evam suvarnanIlapitaloMtvadtarasbhise[k]aih6
(sad)[rs](a)h7 [d]r()[y](ate|) . . .
[5]
. .. ..
(ni)hsrtbhir
dhrbhih siktah 8 satvh 9 tatsadrs eva drsyantej
b) tata10saxivarnam padmam dasadisahspharitv(sarvasatvnupagu)hyatisthati| li samam
ca ta[to] . . . . [6]
. . . (sa)t[v]nm visesam pasyatij
12
sarvasatvhitadhy^ayapravrttah
c)13 ity es apramno14 maitrivihrah
verneigen sich die Wesen,
nur eben von den [aus dem Milchbaum] hervorkommenden Milchgssen besprengt, Zorn und
Waffen ablegend, vor dem in der Gte wandelnden [Yogin]. So ist fr den der Gte zugewandten [Yogin]
; wieviel mehr noch fr den erhabenen Buddha.
8.a) Weiterhin (kommt) dem der Gte zugewandten [Yogin] in unendlichem Umkreis das
Meer der Lebewesen zu gesicht
\ erscheint er durch (Besprengungen)
besprengt werdend, und ebenso
durch Besprengungen mit der Essenz [der Farben] gold, blau, gelb, rot und wei;
. . . erscheint er [diesen] entsprechend
erscheinen auch die durch die [daraus] hervorkommenden Gsse besprengten
Wesen diesen entsprechend.
b) Dann durchdringt ein goldener Lotos die zehn Richtungen (und umhllt alle Wesen).
Zusammen
sieht er die Besonderheit der
Wesen:
Entwickelt zur Hinwendung zum Heil aller Wesen.
c) Dies ist [die Darstellung] des unermelichen Wandels in der Gte. [Die Gte heit]
1

Vgl. 148V1: stri ksiradhdrhhih sariram a(vasimcati).


Vgl. 144R3: te ca satv muktasamrambhapraharans tarn eva pranamamtiti\.
3
Lies: punar,
4
Vgl. 158R2: satvasamudram abhimulchi bhav(a)ti; 153R1: satvasamudrah ahhi{muhh% bhava)ti\.
5
Lies: kaih.
6 Vgl. 146R3: caturvarnabhisekah; 148R3: nnavarnarasasekaih (Einl. S. 41 u. S. 47).
7 Lies: (d)r{o).
8
Lies: sikth.
9
Lies: satvs.
i Lies: tatah.
u Vgl. 150R5: cchatram ca anam(tam lokam) spharitv sarvasatvn upaguhya tistha(ti); 130V5:
patth
krtsnam s(atvasamu)dram upaguhya tisthamti (Einl. S. 40).
12 Lies: satvahitdhyasayapravrttah. Vgl. 145R2: (sar)v(asat)v(a)h{i)tdhyasayapravrttam ctam;
140V3: (sarvasatvah)itasukhadhyasayap(ra)v(r)t(t)a.
13 Vgl. 146V5-6; siehe oben, S. 115, Anm. 2 u. 3.
14
Lies: eso 'pramno.
2

V4
V5

V6

128

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

145R1 [](raypramnata)[y apjrfamjn1 alamba[n](p)[r](amna[2]tay)2


(pramnatay pun)[y](a)prasavpramnataypramneti krtaparikarmano 3 maitrsayasya apramnapradnasthnm[ta](ra)4
(u)[p](a)n(i)baddh(a)c(e)tasas eiraklam s(n2 tarn) 5 [2]
(sar)[v](asat)v(a)[h](i)tdhysayapravrttam6 cittam anuvartate
9. a) tad dhranc ca cchatrapradese nllavarno nilmkuraparivro manih 7 utpadyat(e)
R3 tadvatsar(vasr)otobhyahs nllavar(n)(n)[ll](mkura[3]parivr mana)[y](a) utpadyamte9
tadvarnanihsrtnekarasadhrsahasrni satvesu nipatamti|10 satvs ca pibamto drsyamte
R4 ta[t]o manayo >[bh]iv(r)[d](dham)[ai](trsayasya)11
[4]
(a)[dha]st12 nirgata13 satvh parigrhya priyaikaputrakava14 stanesu slesayanti
R5
b) tato 'bhivrddhamaitrsaya(sya)
[5] . . . .
tisthati|

unermelich wegen (des Unermelichseins der Gestalt, wegen des Unermelichseins) der
Objekte, (wegen des Unermelichseins)
und wegen des Unermelichseins der
Erzeugung von [religisem] Verdienst. Hat [der Yogin] die Vorbereitung durchgefhrt, sich
der Gte zugewandt und sein Denken auf den Inhalt des unermelichen Hinschenkens
konzentriert, gibt sich [sein] zur Hinwendung zum Heil (aller Wesen) entwickelter
Geist lange Zeit ruhevoller
hin.
9.a) Dann entsteht durch das Aufrechterhalten [der Hinwendung zur Gte] in der Umgegend eines Schirmes ein blaufarbenes, von blauen Sprlingen umgebenes Juwel. Ebenso entstehen aus allen [seinen] Krperffnungen blaufarbene, von blauen (Sprlingen umgebene
Juwelen). Viele Tausende von Essenzgssen, die in derselben Farbe hervorkommen, fallen auf
die Wesen nieder. Die Wesen erscheinen trinkend. Hat sich [der Yogin] gesteigerter Gte zugewandt, [werden] dann die Juwelen
erfassen [ihn] die von unterhalb
ausgehenden Wesen und umschlingen wie ein geliebter einziger Sohn [seine] Brust.
b) Hat sich [der Yogin] dann gesteigerter Gte zugewandt,
und durchdringt (die ganze Welt),

Lies: ypramana.
Lies: lamba0.
3
Vgl. 130R4: krtaparikarmanah avasthitasamdheh; 134R2/3: siladikrtapari(karmanah).
4
Lies: maitrayasypramna0.
5
Vgl. 121R2: t(a)tr(a)sth(am) ca c(i)ttam snt(am) drdham; 135R6: tatrastham eiraklam sant. . ratarn ca cittam tisthati\.
Vgl. 145V6.
7
Lies: manir. Vgl. 121R3: nilbhair amkuraih.
8
Lies: ($r)otobhyo.
9 Einl. S. 54.
10
Vgl. 149R2: satvm
pusparasadhrbhih simeyamnam].
11
Vgl. 145R4: tato 'bhivrddhamaitrasaya(sya).
12
Lies: stn.
13
Lies: nirgathl
14
Lies: putrakavat.
15
Erg. zu: (krtsnam lokam spha)r(i)tv.
2

VII. Gte (maitri)

129

c) tato 'stau mahnarak 1 sodasotsadamahparivrm sahasltanarakais 2 tiryakpretamanusys3 ca apanitas 4


[6]
145R6
.()sraya5 parisanddhirdhm 6 pasyati| tadupari sat kmvacarm devn 17 rpvacarms
ca caturdhynopapa[nn]m sthnmtarapa[ri] 8
[2]ti|
146V1
sarvaparisandni9 (sauva)r[n]aktgraparivritni10 tadamtargatms ca buddhm bhagavamtah11 tejodhtusampannm12 pasyati urimms13 ca par(i)sandm snigdh
[2] [sa]rva[t]r[a] .[] .[I]
(p)[u]rayitv14kmcanacakre
V2
15
nipatit yvad aghanistha sthnmtaram prya tisthamti snigdhasuvarnarasam16 samudra[n]i[m]a[g](na)17
[3]ya parisand(m) [ku]
V3
. .tair buddhavapurdhribhih18 asamksipte19 csmim nilalohitvadtam sampadyabMnirhara
(ti|)20

c) Dann sieht [der Yogin] die acht groen Hllen mit ihrem groen Gefolge von [jeweils]
sechzehn Nebenkammern samt den kalten Hllen; [sieht] die Tiere, Gespenster und Menschen
mit entfernten
und [sieht]
die Gestalten (von Yogins) auf den Rundstufen [um den Berg Meru] sitzen; ber diesen die
[Wesen] der sechs Gtterklassen der Sinnenwelt und die [Wesen] der Gtterklassen der
Formenwelt, die in den vier Versenkungssphren wiedererstanden sind, [sowie die Wesen,
die] Zwischenrume
Alle Rundstufen sind
von (goldenen) Tempeln umgeben. In diese sieht er erhabene Buddhas eingegangen, die in
das Element Glut eingedrungen sind, und darber die Rundstufen mit liger
,
berall
erfllt habend, fallen sie
auf die Goldscheibe nieder und erfllen den Zwischenraum bis hin zu den Aghanistha[-Gttern]. Die in das Meer eingesunkene, lige, goldene Essenz
die Rundstufen
mit [Wesen], die das Aussehen von Buddhas haben. Ist er [damit] zusammengeworfen, dringt er in blaue, rote und
weie [Essenz] ein und wird ihrer teilhaftig.

Lies: Qnarakan.
Vgl. 148R5: astau mahnarakh sodaso(tsadapar)ivrh sahasitanarakai (Einl. S. 31).
3
Lies: manusyms. Vgl. 149R23: satvm narakm
evam tirym p(r)et(m manusyms ca\).
/i
Lies: cpanita0.
5
Lies: {)6raym. Erg. (yogcr)raym!
c
Vgl. Divy. S. 344,12: kecid bhiksavah sumeruparisandym gatv dhyyanti; Av. S. 127,9: sumeruparisandyrn ropya; aber Divy. S. 212,8: sumeruparikhandam.
7
Satzzeichen zu streichen.
8
Zu der hier gegebenen Darstellung des Weltgebudes und seiner Bewohner vgl. Einl. S. 31 ff.
9
parisanda ist sonst in unserem Text Maskulinum; in Divy. auch Femininum (vgl. Einl. S. 21 f).
10 Einl. S. 44 f.
11
Lies: bhagavatas.
12
Vgl. 146R2: padmesu satv nisannm tej(o)dhtusampann buddhavapurdhrino.
13
Lies: uparimmki
14
Lies: (p)rayitv.
15
Lies: aghanisthm Vgl. 129R2: pravho
yvad aghanisthm devan avabhasya; usw.
16
Vgl. 124V4: suvarnbhi snigdhbhir dhrbhir.
17
Vgl. 13IV2: (pu)spapravho
samudresu catursu patati\ tata samudra rasaih pryamte\.
18
Vgl. 146R2: satv
tej(o)dhtusantpann buddhavapurdhrino.
19
Lies: abhisamksipte. Vgl. 'bhisamksiptah 146V5; abhisamksipyamte 160R3.
20
Lies: Qpadybhi0. Vgl. 170V1: nildiras{a)n(i)magna(m); 133R4: n(i)lapitalohitvad(tah pravhah)
asrayam prinayanti; 131V5: tatas tejodhtu sampadyate\
tebhyo nnvarnany arcimsi nihsrtya
ta{dyath nilapUalohitvadtamnjisthasphadikavar?ini\).
2

9 Schlingloff, Yogalehrbuch

130

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

1
d) . . '
[4] tribhih2 rupai(b) 3 pravartate
4
adhipativibhganisyandarpaih
avitargnm ekena
adhipatirpenaiva
V5
e) tatah ktg[r]a
(parisa)[5]ndh5 yogc6
rsrayesu yog[c]rsrayo 'bhisamksiptah
yathpaurno 'vatisthate 7
/ ) 8 ity eso 'parh apramno 9 maitrivihrah
V6 sray(p)r(amnataylambanpramnatay)
()[6]pramnatay punyaprasav[p](ram)[n]ataypramneti

146V4

10. vyutthitasypi nisyamdam anuvartate srayam anaipiitaparyanit l0 sauvarnaguhm . .


146R1
[IJpannam adhah 11 kmcanacakre pra12
13
t(i)[sth](itam) nnratna[c]i[t]ai padmair nisannai14 rdhvd aghanisthaparyantain15 tiryakto16 'nantaparyantah sauvarn guh pari

d)
entwickelt sich (fr diejenigen, die von
Leidenschaft frei sind,) in drei Formen, [und zwar] in den Formen Verkrperung, Zerlegen
und Ergebnis; fr diejenigen, die nicht von Leidenschaft frei sind, nur in der einen Form, nmlich der Verkrperung.
e) Dann [werden] die Tempel
.
die
Rundstufen, und mit den Gestalten der Yogins wird die Gestalt des Yogin zusammengeworfen.
[Der Yogin] verharrt wie frher.
/ ) Dies ist eine weitere [Darstellung des] unermelichen Wandels in der Gte.
[Die Gte heit] unermelich (wegen des Unermelichseins) der Gestalt, (wegen des Unermelichseins der Objekte), wegen des Unermelichseins
, und wegen des Unermelichseins der Erzeugung von [religisem] Verdienst.
10. Erwacht [der Yogin], folgt das Ergebnis: [Seine] Gestalt eine goldene Grotte unendlichen Umkreises
abwrts
auf der Goldscheibe feststehend mit [darauf] sitzenden, mit verschiedenen Edelsteinen
besetzten Lotosblumen, aufwrts bis hin zu den Aghanistha[-Gttern] und horizontal in
unendlichem Umkreis. Die goldene Grotte
1

Erg. (vitargnm).
Lies: tribhi.
3
Lies: rpai(h).
4
Vgl. 154V1: .. .dynnubhavadarsanam vitargnm adhipa(tivibhgani$yam)darupair vedit(av)y~
<*)m\.
5 Lies: nd.
6
Vgl. 144R6: buddhsraye brahmsrayo drsyate yvad yoginah sraye sarvasatvsrayh.
7
D.h. sarvasatvahitdhysayapravrtta; vgl. 145V6.
8 Vgl. 145V6-B1; s. oben S. 115, Anm. 2 u. 3.
9
Lies: 'paro Apramno.
10
Lies: paryamtm.
11
Lies: pannam adhah.
12
Vgl. 127V3: vrksamlni
y(o)gcrapdatalaih kmcanacakre pratisthit drsyante.
13
Lies: citaih. Vgl. 153V6: (suvarna)padmaih vaidryandaih ratnacitaih.
14
Lies: nisannair.
15
Vgl. 129V4: (co)r(dh)vam yvad aghanisthaparyamtam usw.
16
Lies: tiryakto. Vgl. 169V6: tiryag anamtam.
2

VII. Gte (maitri)

131

. . [2] padmesu satv nisannm 1 te[j](o)dhtu[s]ampann2buddhavapurdharino3drsyamte


146R2
madhye cnamtabhsuram nnratnacitam sahasrracakam tadvat sa
. . .[3]m indranilapadmargasphadikayarne4 sarva 5 esaeva
R3
kramah
11. a) tato yugavac6 caturvarnbhisekah7 caturvarnapadma 8 gu . .
[4\i caturvarnapadmo
[ta](dadhir)dhs caturvarn buddh
10
bhagavantah prabhbhir lokam avabhsya tisthamtity
etvati 1 ! maitrbhi[se](ka)
[5]rya| rdhva ca12 suva[rna]. . . . (ca)[tu]varnamaitr14
15
bhisekas ca s

erscheinen auf den Lotosblumen sitzende Wesen, die, in das


Element Glut eingedrungen, das Aussehen von Buddhas haben. In [ihrer] Mitte [erscheint]
ein unendlich [weit] leuchtendes, mit verschiedenen Edelsteinen besetztes tausendspeichiges
Rad. Ebenso
alle in
den Farben saphirblau, rubinrot und [der Farbe von] Bergkristall. So ist der Verlauf.
11.a) Dann [erfolgt] gleichzeitig die Besprengung in den vier Farben: Lotosblumen in vier
Farben
die Lotosblumen in
den vier Farben. Auf diesen sitzen erhabene Buddhas in den vier Farben und erleuchten mit
[ihren] Strahlen die Welt. Soweit die Gtebesprengungs(abwrts
und) aufwrts (die Welt erfllend): Die Gtebesprengung in Gold(farbe) und (in den vier)
Farben.
1

Lies: nisannas.
Vgl. 146V1: sarvaparisandni (8auva)rnaktagraparivritani tadamtargatms ca buddham
tejodhatusampannm pasyati.
3
Lies: dhrino.
4
Vgl. 144R1: buddha
(tesm usnisapra)bhy krtsnam jagad indramlabham drsyate]
'stanakhaprabhabhih padmargbham.
5
Lies: sarvhl
6
Lies: yugapac.
7 Einl. S. 41.
8
Lies: padm^
9
Lies: padmh\. Vgl. etwa Sukh. S. 30,8ff.: padmni
-nilni
pltni
lohitni-dtrni;
im Pli 5 Farben; vgl. PTSD zu paduma: pancavannapaduma (the 5 colours however are nowhere
specified)". Vgl. auch 144V3: evam 8uvarne?u nilalohitvadta . . . Zu den Farben bemerkt RAIT, Lotusblumen, S. 512: Nelubiumbliiten aus Gold finden sich natrlich nur in der Phantasie der kavis; von
einem gelbblhenden Nelubium, das man zur Erklrung anfhren knnte, wei ich nichts." HAU zitiert
Anm. 4 GBEENE, Indian Antiquary, vol. LIX, 1930, p. 131: "The white, pink, and cream-coloured ones
are the most common, but there is also a blue variety". An unserer Stelle ist unter den vier Farben
natrlich, entsprechend caturvarnbhiseka, die schematische Farbreihe nilapitalohitvadta zu verstehen.
10 Einl. S. 41.
11
Lies: etvan maitr0.
12 Satzzeichen zu streichen. Lies: ryordhvam ca. Erg. zu: (adhas ca lokam p)ryordhvarn ca. Vgl. etwa
150R6: adhs cordhvamca g(atv).
13 Erg. zu: suvarna(varna)?
14
Lies: (ca)turvarna. Vgl. 145V4: (abhise)kai simcyamano drsyate\ evamsuvarnanilapitalohitvadatarasabhisekaih.
*5 Lies: ca\. Vgl. zu dieser Verschreibung Einl. S. 19.
2

R4
R5

132

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

b) tadrasapariprnah parvatah 1 tasmc eatvra 2 pravhh kcapribhih s sariram pra146JR6 yamti suva(rna)
(sva)[6]m srayam Iaksyate|
4
5
c) ta[t]o (bhrumadhy)dhar nimnapradest
ksirapravho nirgatya prathivimandalam 6
bhitv7 apyagatnm satvnm sarvaduhkho[pasa]mam krtv 8 y(vad vyumandalam bhitv
147V1 parivartya nbhym [1] pravisya) mrdh(n) (n)i(rgatya yvad a)ghanisthm gatv parivartya 9 kmrprpyvacardevparivrto10 mrdhn pravisati|
V2
d)11 punas tata eva sthnm nihsrto n(bh)[y](s) c(a) sth(i)tim prayatij dau galak[2](d vicchidya)[t](e)|
t(ato nbh)y(ti|
e) n)bhiparyamtanimagnam ctm()nam pasyati n()bhinihsrts ca dev12 sthitim prya
tisthamti

b) [Es entsteht] ein Berg, der von der Essenz dieser [Farben] erfllt ist. Vier Strme aus
diesem erfllen seinen Leib mit Glasgefen (?). Wie gold. . . sieht [seine] (eigene) Gestalt aus.
c) Dann geht von der vertieften Stelle unter (dem Mittelpunkt [zwischen seinen] Brauen)
ein Milchstrom aus, durchbricht den Erdkreis, verschafft den in schlechte Lebensrume
geratenen Wesen das Erlschen allen Leides, (durchbricht [diese Rume] bis zum Windkreis,
kehrt zurck, tritt in den Nabel ein, geht) durch das Haupt (aus), geht (bis zu) den Aghanistha-[Gttern], kehrt zurck und tritt, umgeben von den [Wesen der] Gtterklassen der
Sinnenwelt, der Formenwelt und der Welt der Formlosigkeit, durch [sein] Haupt ein.
d) Weiterhin kommt [der Milchstrom] aus eben dieser Stelle und auch aus dem Nabel
hervor und erfllt [seinen] Standort. Anfangs wird er von [seiner] Kehle aus geteilt, (dann
vom Nabel).
e) [Der Yogin] sieht sich selbst bis zum Nabel eingesunken. Gtter, die aus dem Nabel
hervorkommen, erfllen [seinen] Standort.

Vgl. 130R12: (u)pari cdsya nU(apitalohitvada)tarasapariprn(a)t parvatah drsyamt(e).


Lies: catvrah.
3
Die Vorstellung ist ungewhnlich. Vielleicht ist das Wort verderbt aus ksiradhrbhih; vgl. 145V2:
(sat)v{)
Jc$iradhrbhih siktarntr; 148V1: stri ksiradhrbhih sariram a(vasimcati). Das Fllen
seines Leibes mit Milchgssen wrde auch den Milchstrom aus seinem Haupte im folgenden Abschnitt
(146R6) erklren. Da die Strme aus dem Berge kommen, knnte man auch an eine Verschreibung fr
rasadhrbhih denken; vgl. etwa 130B12: ml(apitalohitvad)tarasapariprn(a)t parvatah
(na)navarnena rasena asrayam puraya(ti\).
* 146R6-147V1: Einl. S. 39.
5 Einl. S. 35.
6
Lies: prthivi0.
7
Lies: bhitvpya0.
8
Vgl. 129R2: prthivimandalam bhitv narakam prets cvabhasya.
9
Vgl. 135R34: (yva)d vyumandalam bhitv a(kasat pa)rivartya nObhyam pravitya mrdhna
ni(rgatya).
10
Lies: kamarparpyavacaradevaparivrto. Vgl. 129R3: yvad aghanistham devan avabhasya cat(u)r(dh)ynarasam adaya mrdhna punah pravisati].
11
d) und e) vgl. 129R34:punar bhrumadhyad ekah pravaho nirgacchati dvitlyo nabhya misrlbhtam
prathivl spharitva tisthati] prvam bhrumadhyad vicchidyate] tato nabhyah tato nabhiparyamtanimagnam svam asrayam pasyati.
12
Lies: devh. Einl. S. 35.
2

VII. Gte (maitri)

133

/) hrdaye caj 1 ksirapuskirini 2


[t](amni)magnam naksatram maitrsayaparigrhitasya3
4
[3] (adhi)patirpam| tamnirjtam amrta[rasa]m ivendryudhavarn stri nirmalena blija- 147 V3
7
nena5 grhitv dasadisahe
sarvn satvm parena sukh[e]na samyojaya[^]ti|
V4
g) maitri sthi[t]i(m prayati tato) tirudhyata 8 iti vyutthnam| 9 ||
22. yogavitysa yoglamkroktas10 ca visess11 ta e[v]a [s]
ai
nir12
13
[k](aran)[iyo] . . . .[5]rvavypd
(nu)samss cotpadyamte| yad uta (l)sukham
V5
svapiti (2)sukham pratibudhyate (3)suptam enam devat raksamti| (4)na ca p(pakam
svapnam pasyati)
(5)
.14[6] . . (6)
V6
.. . .
[h] (7/)priyo [d]e[v]amanusynm (9)brahman ca prasamsitah15 (20)angmiphala16 prp(n)o[ty (22)u]ttare caprativi[dh](ya17 brahmalokasya svabMvatym upagacchati18 ||)
/) In [seinem] Herzen [entsteht] ein Milchteich, und (darin) eingesunken ein Stern als Verkrperung des von der Zuwendung zur Gte erfaten [Yogin]. Eine regenbogenfarbene Frau
fngt die gleichsam daraus entstandene Ambrosiaessenz in einer reinen Schale auf, (versprht) sie in die zehn Richtungen und lt [so] allen Wesen hchstes Glck zuteil werden.
g) Die Gte (erfllt) [seinen] Standort, (und dann) wird [alles] zum Verschwinden gebracht.
So [erfolgt] das Erwachen.
12. Die Yogaordnungen samt den Yogafertigkeiten und die gelehrten Besonderheiten,
eben diese
abzulegen (alles) belwollen
und es entstehen die Segnungen, nmlich: (1) er schlft glcklich (2) und wacht glcklich auf;
(3) wenn er schlft, schtzen ihn Gottheiten, (4) und er hat keine (bsen Traumgesichte);
(5) (weder Gift noch Messer dringt in seinen Krper), (6)
; (7/8) er wird von Gttern und Menschen geliebt, (9) und von Brahma
gerhmt; (10) er erlangt die Frucht des Nichtwiederkehrenden, (11) wenn er aber nicht zu
Hherem durchdringt, (geht er in den Wesenszustand der Brahmawelt ein).
1

Satzzeichen zu streichen.
Vgl. 144V1: vaidryadamdpadmni\ tatkarniksu ca ksirapusicirinyah.
3
Lies: grhitasy(dhi).
4
Einl. S. 49, Anm. 3.
5
Vgl. 130R2: ratnbhjanam iva nirmalar(asa)pariprnam srayam.
6
Lies: dasadia.
7
Erg. zu: a(k?ipya ca)1 Vgl. 150V6R1: tac codakam vyun ksiptam anamtesu lokadhtusu satvn
simca(ti\).
8
Lies: nirudhyata.
9 Einl. S. 53.
10
Lies: yogavinys yoglamkr ukt&i Zu alamkra vgl. Sv 84, Anm. 16.
11
144B3: (mait)r(sayas)y(ai)vyam anyo visesa utpadyate.
12
Erg. zu: {sa)rva0<!
13 S. oben, S. 118f.
14
Erg. nach 144V4: kramati na visam na sastram kye.
15
Die Stze (7/8) und (9) bilden zusammen einen Halbsloka:
priyo devamanusynm
brahman ca prasamsitah \ \
2

Da der gesamte Abschnitt wohl ein Zitat aus einem dem Pli parallelen Stratext darstellt, wird es
sich hier um ein Stck rhythmischer Prosa" handeln, wie sie in kanonischen Texten vorkommt; vgl.
WALDSCHMIDT, Mahvadnastra II, S. 60.
m
Lies: phalam.
17
Lies: cprati0.
18
Vgl. MPS 34.164: (caturo brahmavihrn bhvayit)v()
upagatah].

(bra)hmal(o)kasya svabhvaty()m

VIII. Mitleid (Icaruna)


Vorbemerkung
In dieser bung dienen die Milchstrme, Regengsse, Farbstrme und Seidentcher dazu, dem
Mitleid des Yogin Gestalt zu verleihen. Er befreit die Wesen von ihren Leiden (3.b) und Krankheiten (4.a) und erlst die Hllenbewohner (5. und 6.). Dann wird in vier verschiedenen Darstellungen (811) das Gelbde (pranidhna) des Yogin beschrieben, das er vor dem Buddha und vor
Gott Brahma zur eigenen Erleuchtung und zum Heile der Wesen ablegt A
1- o) (1) (krodhapra[i]tipaksnamtaram | 2
parasukha)h[i]tpa[naya]nakranviskara3
nrtham| (2)yypdapratipaksnamtaram vypdanisya(nda)
(3) . .
4
R2
[2]pratipaks()
dakranapratipaksviskaranrtham| karunprayoganirdesah kriyatej
R3
b) atha kims[v]a(bhv karun tad ucyate|) 5
[3]spratipakse(ti(6 s tu snupari)varta[7 sasamprayoga| 8 parigrhyamana| d kmvacara| 10 catu[ska]R4 (ndhasvabhvl 11 pvacar pamca)[s]kandhas[vabh]va|12
sray(e[4] kmsra)ya| 13

147Rl

l.a) {1) (Um unmittelbar nach dem Hindernis Zorn) [das Hindernis] deutlich zu machen,
das [in dem] Veranlassen [besteht], (das Glck und) Heil (Fremder) zu entfernen; [oder]
(2) um unmittelbar nach dem Hindernis belwollen (als) Ergebnis des belwollens (die
Grausamkeit deutlich zu machen;) [oder] (3) (um unmittelbar nach dem) Hindernis
das Hindernis deutlich zu machen, das [in dem] Veranlassen [besteht],
, wird die Beschreibung der bung des Mitleides vorgenommen.
b) Was ist nun (das Mitleid seinem Wesen nach? Darber lehrt man:)
ist es mit Hindernissen versehen. (Es) mu (aber zusammen mit) [seinen]
Folgerungen und Verbindungen erfat werden. Gehrt es der Sinnenwelt an, (besteht es
seinem Wesen nach aus) den vier Gruppen; (gehrt es der Formenwelt an,) besteht es seinem
Wesen nach aus (den fnf) Gruppen. (Hinsichtlich der) Gestalt (entspricht es den Gestalten

* Vgl. oben, S. 54 f.
2
Vgl. 139B4: ajnnapratipaksnamtaram krodhapra(tipaksrtham).
3
Erg. (vihimsvi$karanrtham\). Vgl. oben, S. 115f.
4
Erg. zu: pratipaks(namtaram).
5
Vgl. 153V2: atha kimsvabhv rnudit tad ucyate\ 8auma(na)8(y)e(t)i sa svabhv. Siehe oben,
S. 117.
6
Lies: saprati0.
7
Lies: vart. Satzzeichen zu streichen.
8
Lies: yog. Satzzeichen zu streichen.
9
Lies: parigrhyamn\.
10
Lies: kmvacar. Satzzeichen zu streichen.
11
Lies: catuhska(ndha)0.
12
Lies: svabhv\ .Vgl. 153 V 3: (kmvacar catuh)skandhasvabhv\ rupvacara pamcaskandhasvabhv\. Siehe oben, S. 117 u. Anna. 5.
13 Lies: (ra)y\.

VIII. Mitleid (karun)

lambane [k]()madhtyl(am)bana| 1 bhmita 2 saptabhaumaj 3


catursu [dh]y(nesu dhynmtare ca| 4 )
(it)[y]()di ||

135

kmadhtau

angamye

tatprayogah
2. a) adhim[5](trdhimt)[r](am m)[it](r)am 5
(asu)bhamalinavasanam kr pan am 147R5
krsnam anuprptam
vivrtaviniguhyadesabhayasokavisdratimtsary[e]rsy[]pa 6 . . .t.[h]
csya drstv param krunyam utpa[6]dyate
R
b) evam ma(dhyam mrdum) [tajdvad udsinam 7
c) mrdumadhydhimtram cmitram 8 kramasah 9 tad a[n]e[ka]sariramnasaih 10 duhkhair
pahatam 11 drstv [k](runyam utpa)[dya]te|
3.a) tato 'sya karunrta[2]sya bhruvor madhye krsnataptam pitaka(m utpadyate|)
. . 148V1
mrdhno nihsrt strl ksiradhrbhih sarlram a(vasimcati) [y]vad vedanopasmyati

der Sinnenwelt), hinsichtlich des Objektes hat es die Region der Sinnenwelt zum Objekt.
Hinsichtlich der Sttte bezieht es sich auf sieben Sttten: auf die Region der Sinnenwelt,
auf die bergangsstufe, (auf die) vier Versenkungssphren (und auf die Versenkungszwischensphre;)
usw.
Dessen bung:
2.a) Indem [der Yogin] einen im berma (bermig) [guten] (Freund)
mit
einem hlichen, befleckten Gewand und in eine elende, finstere [Lage] geraten [sieht],
und dessen zu verheimlichenden Ha (?), Furcht, Kummer, Verzagtheit, Unlust, Migunst,
Neid und
aufgedeckt sieht, entsteht [bei ihm] hchstes Mitleid.
6) Ebenso einen (mittelmigen und migen) [Freund] und auch einen Gleichgltigen.
c) Indem er dann schrittweise einen migen, mittelmigen und bermigen Feind mit
vielen leiblichen und geistigen Leiden geschlagen sieht, (entsteht [bei ihm] Mitleid),
3.a) Ist [der Yogin] dann durch das Mitleid niedergeschlagen, (entsteht) in dem Mittelpunkt [zwischen] seinen Brauen eine schwarze schmelzende Beule
(bergiet) eine aus [seinem] Haupte hervorkommende Frau
[seinen] Leib mit Milchgssen, bis die Empfindung zum Erlschen kommt.

Lies: l(am)ban\.
Lies: bhmitdh,
3
Lies: saptabhaum],
4
Vgl. 140V1: bhmibhedena saptabhaum kmadhtur angamyas catvri dh(ynni dhynm)t(a)r(am) ca. Vgl. Einl. S. 31 f.
5
Lies: (m)it(r)am. Vgl. 153V4: tatprayogah adhimtrdhimtrasya mitrasya sukhena prito bhavati;
140V2; s. oben S. 118, Anm. 1.
6
Lies: vivrtaviniguhyadvesa1
7
Vgl. 153V4: evam madhyasya mrdunah udsinasya; 140V2: (a)dhimtradhimatre mitre mrduni
evam udsine\.
8 Vgl. 153V5: e(vam adhi)mtrasymitrasya sukhena prito bhavati', 155V5: mrdu madhyam adhimtrm c(mitram); 140V2: ttha amitre m(rduni madhya) adhimtre.
9
Lies: kramaSas.
10
Lies: sariramnasair. Vgl. 148V2: s()riramanasaduhkhm.
11
Lies: pahatam.
2

136

148V2
V3
V4
V5

V6
148R1

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

b) tasmc char(i)[2][r]t ksiradhrbhih sarvasatvsamudrah 1 plvyatej2


(sarvasat)[v]()[n](m) [s]()r[I]ramnasaduhkhm pasyati|

4. a) punas tathaiva karun


rvahitacetasah4 sariramnasai 5 [3] rogair upahath
6
sarvasatvh (vir bha)vanti| srirais caturuttarais catur(bh)i(h)7 [r]ogasataih 8 mnasais
cstottaraih fs)[t]e(bh)[i](h9 r)[oga]sataih
drstv csya karun bhavati| ta[4]dadhipatirpamj hrdaye stri su(varn)[bh]() av(a)d()tastraprvrta utpadyate)10 utpamn yoginam
prots[ha](yati|) li
kryah aham te sarvaparahitaka[5](ran)[e] sarvnuklam
shyyam karisymiti12 tat(ah karu)ndhipatirpam hrdayn nirgatah 13 a(ghan)i(sth)mj/i
(kr)[tsn](am) gaganam15 abhrak(ta iva spha)[r](i)tv16 sarvasarlraduhkhapratipaksa[bha][6]. . (sa)r(v)o[pa]karanavrstim mu[m]cati17
mnasnm
rog(nm)
[g]m viskambhaya(ti| u)[bh](a)yah(a)[st](figu)iinihsrtbhih18 astmgopet[i](bhiti sa)l(i)ladhrbhir19 avasesam mnasam duhkham
a[h]. . . ' /
'.
b) Mit den von seinem Leib [herkommenden] Milchgssen wird das Meer aller Lebewesen
berschwemmt. (Dann) sieht er die leiblichen und geistigen Leiden (aller Wesen zunichte
werden).
4.a) Hat [der Yogin] sein Denken auf
des Mitleides gerichtet, werden
ihm weiterhin in derselben Weise alle Wesen, geschlagen mit leiblichen und geistigen Krankheiten (sichtbar); mit vierhundert und vier leiblichen Krankheiten und mit achthundert
und acht geistigen Krankheiten. Indem er [dies] sieht, hat er Mitleid. Als dessen Verkrperung entsteht in [seinem] Herzen eine (gold)leuchtende, mit weiem Gewand bekleidete
Frau. Entstanden spornt sie den Yogin an: ,,
[ist] die Tat; ich will dir bei
[deinem] (Handeln) zum Heil aller Fremden den Beistand leisten, der allen angemessen ist."
Dann geht die Verkrperung des Mitleides vom Herzen aus, (durchdringt wie ein) Wolkenhaufe (den gesamten) Luftraum [bis hin zu] (den Aghanistha)-[Gttern] und entlt einen
Regen aus (allen) Lebensmitteln [als]
Hindernis fr alle leiblichen Leiden. Fr die
geistigen Krankheiten
befestigt . . .
Von Gssen kostbaren Wassers, die aus den Fingern [seiner] beiden
Hnde hervorkommen, wird das restliche geistige Leid
1

Lies: ^satvasamudrah.
Vgl. 145V2 \ (sat)v() nihsrtbhih ksiradhrbhih siktamtr.
3
Erg. tato nasyamnmt Vgl. nasyamn 160R4.
4
Vgl. etwa 135V2: yatanaparik$tivahitacetasah; aber 148R5: (karu)nvarjitacetasah.
5
Lies: srira0.
6
Lies: satv.
7
Lies: catur(bh)i.
8
Vgl. 160R5: caturottaram rogasatam.
9 Lies: rair a(s)t{bh)it
j0
Lies: su{varn)bhv(a)d()tavastraprvrtotpadyate\. Vgl. Einl. S. 43.
i! Vgl. 148R12: tathaiva ca hrdayastha karu(na) protsaha(ty u)ddhara snpaya cainam satvn iti\ ;
151V6R1: (ta)t(o) 'sya hrdaye stri samutpadyate
s(ai)n{am) pr(o)tshay(ati).
12 Einl. S. 50.
13
Einl. S. 35. Lies: nirgato.
14
Man sollte yvad aghanisthni gatv oder aghanisthaparyamtatn erwarten.
15
Lies: gaganam abhra0.
16
Vgl. 143V1: abhrakta iva gaganam prya; 144R2: abhraktavam nirgatya sarvam gaganam prya.
17
Vgl. 153R2: sa ca mrdhn nirgatah krtsnam lokam spharitv sarvo(pakara)navarsam amte ca ratnavarsam muncati\.
18
Lies: nihsrtbhir. Vgl. 148R3: brahmahastmgulibhyas ca varsam patati.
19
Vgl. 149V3: astamgopetam pniyam niscarati.
2

VIII. Mitleid (karun)

137

b) .
c
[r]. . . medhya s g. r
m.mu[kli].
. . ti| tathaiva ca hrdayasthkaru[2](n) protsha^y 1 u)d[dh]ara sn[pa]ya cainm satvn 148R2
iti| (sa tarn sa)[t]vn uddharati snpayati ca
v(a)sy(dha)st 2 nirgatya satvm [s]
c) brahmais ca gaganam prnam 3 karakaha[3]staih 4 nnvarnarasasekai[h 5 sajtvm
(simcya)[m]naih6 pasyati| sa ca tm snpayati( | de)[v]nm ca padmaih prthivi prya[t](e| 7
tadadhir)dh(m) satvm pasyati| 8 brahmaliastmgulibhya[4]s ca varsam patatij
tatas
te satvh pr(modyapr)pino 9 bhavamti
d) tasyaivam bha[v](a)t(i) [m](a)yaite mahvyasanapamkd u(d)[dh]r[t] ity adhimlram| 10 tesu karunm avakrmatij 11 sarva[5]srotobhyas csyksanibhhpattnih[s](r)[t]h
[sa]r(vasatvn upaguhya tisthamti | 12

b)
Auch hier spornt [den Yogin] das in [seinem] Herzen befindliche Mitleid an: Ziehe diese Wesen heraus und reinige sie," (Er) zieht (diese) Wesen heraus
und reinigt sie
geht von unterhalb
aus und
die
Wesen.
c) [Der Yogin] sieht den Luftraum von Brahma-[Gttern] mit Krgen in den Hnden
erfllt [und] die Wesen von Besprengungen mit der Essenz der verschiedenen Farben (besprengt werden). Er reinigt auch diese [Wesen]. Die Erde wird von Lotosblumen der (Gtter)
erfllt. Er sieht die Wesen (auf diesen) sitzen. Aus den Fingern der Brahma-[Gtter] fllt
ein Regen. Dann erlangen die Wesen Freude.
d) [Dem Yogin] kommt die Erkenntnis: Von mir sind diese [Wesen] aus dem Sumpf des
groen Elends herausgezogen worden." So berkommt ihn ein bermiges Mitleid mit
ihnen. Aus allen seinen Krperffnungen kommen thergleiche Seidentcher hervor (und
umhllen alle Wesen).

Lies: protsahaya(ty). Vgl. 148V4: stri


yoginam protsha(yati\); 151R1: 8(ai)n(am) pr(o)tshay(ati).
2
Lies: stn.
3
Vgl. 136V5: brahmabhih
krtsnam gaganam purnam.
4
Vgl. 151R6: brahm grhitQsuvarnabhja(na); 150V5/6: brahm ca bhrmgram dy0.
5
Vgl. 145V4: suvarnanilapitalohitavadatarasbhisekaih (Einl. S. 47).
0
Lies: (simcya)mnm1 Vgl. 145V4: (abhise)kai simcyamno drsyate\ ; 149R3: satvmpuparasadhrbhih simcyamnam; 118V4/5: tailadhr(bhih sim)cyamnam.
7
Vgl. etwa 152V6: dev
pusparatnavarsm utsrjamti.
8
Vgl. 146R2: padmesu satv nisannm
buddhavapurdhrino.
9
Vgl. 150R2: pritiprmodyasamjtasya; 151R2:
10
Satzzeichen zu streichen. Vgl. 150R4: tad asya drstv adhimdtram krunyam utpadyate\.
11
In buddhistischen Texten wechselt mahkarunam avakrmati mit krmayati; vgl. BHSD zu
avakramati. Vgl. auch 162R6: (ka)runvakramati; 149R6: daurgandhyam kayam avakrmati.
12
Vgl. 130V5: (k)sanibhah pattah nihsrtya krtsnam s(atvasamu)dram upaguhya tisthamti\ ; pattair
anamtaparyamtaih satva cchdyamte (Einl. S. 35).

^
R4

R5

438

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

5.a) punah karu)nvarjitacetasah * astau mahnarakh sodaso(tsadapar)[i]vrh sahasl148R6 tanarakai 2 mukhl bha[6]vanti| 3 tatkrans cemh*
5
(2) saktyasipa
(samjlve)
(2)
[s] (c)[]rastrakrakacacchidn6 klastre tu|
149V1 (3) a[s](ma)7
[y](a)[m]tryoghanagajadvadryyodro[2]ny(a)h8 s(am)[gh]()t(e)

5.a) Hat [der Yogin] sein Denken (dem Mitleid) zugewandt, kommen ihm (weiterhin) die
acht groen Hllen mit ihrem Gefolge von [jeweils] 16 (Nebenkammern) samt den kalten
Hllen zu gesicht. Als deren Qualen erscheinen:
1) Speere, Schlachtmesser,
in der Sa njiva-[Hlle];
(2)
, Eisendrhte und Zerstckeln mit Sgen in der K l a s t r a [Hlle];
(3) Felsen,
, Zangen, Hammer, Elefanten und nicht aufzubrechende
eiserne Srge in der Sang h a t a-[Hlle];
1

Lies: cetaso ''stau.


Lies: narakair.
3
Vgl. 145R5: 'stau mahnarak sodasotsadamahparivrm sahasitanarakais (Einl. S. 31).
4
Die Beschreibungen der Hllenqualen weichen in den verschiedenen Berichten vielfach voneinander ab; es lt sich jedoch fr jede Hlle ein bestimmter Grundstock von Qualen herausschlen,
der in fast allen Schilderungen wiederkehrt und zum Teil auf Erklrungsversuchen der berlieferten
Hllennamen beruht. Der Beschreibung unseres Textes steht der Sarvstivdin-Bericht am nchsten,
den BEAL, A Catena of Buddhist Scriptures from the Chinese (S. 60ff.), bersetzt hat; hnlich
WADDELL, Buddhism of Tibet, S. 93f. Einen sehr altertmlichen Eindruck macht die Darstellung der
Mahvastu-Gths (Mv. I, S. 10ff.), in der jede der acht Hllen in fnf gleichgebauten Strophen (teilweise ist die ursprngliche Fnf zahl durch Einschbe zerstrt) geschildert ist. Zum Vergleich kann noch
der tibetisch berlieferte Kommentar zu Ngrjunas Suhrllekha (bers. WENZEL) herangezogen werden und, mit gewissen Einschrnkungen, auch die Malereien der Teufelshhle (bei L E COQ, Buddhistische Sptantike IV, Tafel 9 u.Beschr.). InAbhdhKVy. S. 254,19ff. und in den Sadgatikriks (Mus,
S. 220ff.) wird von jeder Hlle eine kurze Beschreibung als erweiterte Namenserklrung gegeben.
Unser Text zeigt allen diesen Berichten gegenber manche Besonderheiten, deren Quelle ich nicht
nachzuweisen vermag.
5
Erg. zu asipa(daJiast) ? Die anderen Berichte besagen, da sich die Wesen in Samjiva gegenseitig
mit eisernen Klauen (Mv.: nakhehi tiksnehi yasehi; BEAL: with iron claws) zerfleischen und mit
Schlachtmessern verwunden (Mv.: asino
yehi cchindanti anyo "nyam; BEAL: seizing with their
hands knives and swords, they cut and hack each other to bits).
6
Die Sgen werden auch in den anderen Berichten genannt (BEAL: their limbs hacked with iron
hatchets, theit bones slowly sawn asunder with iron saws; WENZEL : mit glhenden scharf gezhnten Sgen
und glhenden xten; S: kakacehi jalantehi; Mv.: vsihi parashi ca). Unter dem schwarzen Strick, der
den Namen der Hlle erklren soll, scheint, wie F. W. K. MLLER (Ethnologisches Notizblatt 1, H. 3,
S. 22f.) gezeigt hat, eine geschwrzte Zimmermannsschnur zu verstehen sein, zwischen die der Snder
gelegt wird. In der von MLLER herangezogenen japanischen Quelle heit es: Die Hllenschergen
packen die Snder und schleudern sie auf den Boden von glhendem Eisen hin. Dann ziehen sie mit glhendem Eisenfaden in der Lnge und Breite geschwrzte Richtlinien und spalten mit Beilen von glhendem
Eisen lngs der geschwrzten Richtschnur die Snder auseinander." An einen hnlichen Vorgang scheint
in S (klasuttnusrena phlyante dru v yato\ kakacehi jalantehi klasuttam tato matam) und AbhdhKVy.
(klastr yatra klastrni ptayitv sattvs taksyamte) gedacht zu sein. Die anderen Quellen, auch
unser Text, scheinen an ein einfaches Umwickeln der Wesen zu denken, wie es auch in der Teufelshhle
dargestellt ist (Mv.: strayitvna tesng; BEAL: lashed with burning iron wires).
7
Die Lesung ist unsicher. Die Vorstellung, da die Wesen in Samghta zwischen Felsen zerquetscht
werden, findet sich in allen Schilderungen (BEAL: crushed by mountains; Mv.: te pi iail samgamya

pidayanti bahu prnm; Wenzel: zwischen Berge von verschiedener Gestalt


zusammengepret).
In der Malerei der Teufelshhle bezieht sich das letzte Bild auf die Samghta-Hlle, das von L E COQ
folgendermaen beschrieben wird: Im letzten Felde finden wir eine Darstellung, die vielleicht auf antike
2

VIII. Mitleid (karun)

139

(4-5) [.n].nasastrau l grh(ita):


(rauravayofr|)
(6)
(tapane|
(7) pratpa)[n]e narake| 2 bhrstodbharjanapitarapravesafm]3
(8) (avicau) narake tu satsparsyatangniprafSjvarsanarathngakllasamkvacall4 drsyamte 149V2
b)
(kra)[n]panayanayaivam5 citta6
[sya] y esm (sat)vnm krans t aham praticcheyam i[3]ti tasyaivpramnsayasya
V3
(45) mit
-Messern
(in den beiden R a u r a v a [Hllen]);
(6)
(in der Tapana-[Hlle]);
(7) in der (Pratpana)-Hlle Eingehen in Tpfe zum Braten und Rsten;
(8) (in der Avici)-Hlle aber [Wesen], die in dem Feuerregen an ihren sechs Berhrungsbereichen wie der Pflocknagel eines Wagenrades unbeweglich sind.
b)
[seines in
dem Gedanken]: die Qualen dieser Wesen, die will ich bedecken*' auf das Entfernen der
Erinnerungen zurckgeht; nmlich auf die Geschichte von dem Symplegaden. Im roten Felde sind zwei
Felsen abgebildet, der eine grn, der andere blau, beide mit Flammen bedeckt. Durch den Zwischenraum
zwischen ihnen mssen die Verdammten hindurch und whrend sie die enge und mit zornigen Flammen
brennende Schlucht betreten, krachen pltzlich die feurigen Berge zermalmend zusammen. Die den Bergen
aufgesetzten Widderkpfe sollen ohne Zweifel die Heftigkeit und die hufige Wiederholung des Zusammenpralls andeuten." Diese Widder werden auch AbhdhKVy. S. 254,20 genannt: samghto yatra meskrtayah
parvatdaya ubhayata patantah sattvn pidayanli; hnlich WADDELL S. 94: animal-headed mountains.
8
Der Text ist verderbt; lies: gajnavadry0^ Elefanten werden nur bei BEAL erwhnt {iron
elephants stamp them to pieces), whrend eiserne Srge in allen Bearbeitungen vorkommen (BEAL: they
are brayed in iron motars; Mv.: yassu ca dronisu; WENZEL: Ebenso werden sie in eine groe eiserne
Presse gebracht, wo von oben ein groer Prestein auf eine eiserne Platte drckt).
1

Lies: 4astrairl Den Schilderungen der Qualen in den Hllen Raurava und Mahraurava ist nur
gemeinsam, da die Wesen durch die erlittenen Qualen Schreie ausstoen. Die Messer werden nur in der
Beschreibung der Mahraurava-Hlle bei BEAL erwhnt (the victims are placed under iron hatchets and
knives).
2
Satzzeichen zu streichen.
3
pw: pithara. In Tapana werden die Wesen gerstet (BEAL : Here the victims are
placed in an iron
dungeon
Here the flesh is burned; WADDELL: enclosed in a red-hot fiery chamber; Mv.: taptaloho
tatra ppasamcr pacyanti; WENZEL: In Tapana werden sie
in Pfannen gelegt und gerstet ; AbhdhKVy.: tapano yatrgnydibhis tapyante sattvh); in Pratpana gekocht (BEAL : Here the
guilty are thrown into a great lake of fire; WENZEL : Ferner werden sie in glhende Kessel mit siedendem
Salzwasser kopfber gestrzt) oder gespiet (WADDELL: A three-spiked burning spear is thrust into
the wretch's body which is then rolled up within red-hot iron plates; Mv.: tiksna&l; BEAL : pierced through
with iron spikes; WENZEL: von drei
Speerspitzen getroffen). Im zweiten Bild der Teufelshhle sind
zwei Tpfe dargestellt, in denen die Wesen gekocht oder gebraten werden; im vierten zwei eberkpfige Hllenwchter, die zwei Wesen mit Speeren stoen. In unserem Text bezieht sich vielleicht
bhrstodbharjana auf Tapana, pitarapraveia auf Pratpana.
4
In Avici erfat das Feuer die Wesen an allen Seiten (BEAL : on every side; Mv.: hest upari prsvato;
WENZEL: von allen vier Seiten, von oben und unten). Das Folgende in unserem Text scheint ein Erklrungsversuch des Namens avid (,,ohne Welle" = unbeweglich", acala) zu sein. Andere Texte
leiten die Erklrung des Namens von der Bedeutung vici* = avakia her (BEAL: there is no cessation
of their misery for a moment, and so it is called "no intermission"; WENZEL: Und weil die Lebewesen
keine Unterbrechung finden in dem Feuer und der Qual, deswegen wird diese Hlle Mthsams-med (Grnzenlos)" genannt), oder von vlci * = sukha (S.: yato na vlci sukhassa tenvlciti sammato; AbhdhKVy.:
avicir yatrtimtrgnijvllimgitnm sattvnm sukhavicir antaram nsti); AbhdhK. I l l , S. 149 stellt
beide Erklrungen zur Wahl.
5
Lies: nayanyaivam.
6 Lies: praticchadeyam.

140

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

mahm [^srayali) 1
o
sahasrair
149V4 astmgopetam pniyam niscarati 2 tena sarv 3 kranh [4] smyamte| 4
c) tato bhagavm vajrsandhi(rdhah) . . .
V5
dhiragambhirodrena ca svarena dharmam desa[5]yati|
tac chrutv()
m[] 5 cyut()h sugatvy6 upapa[dyam](te|)
6.")
V6 sarpa mrispasarpa parvatam ptay[6]miti
149Rl

R2
R3
R4

R5

(a)[paj. . . sataym apasarpa[t]i[|] .e


(su)khasamspar[s]o mahms csrayo mahnarakn sa[i]rvn avasta[bh](ya)
kraiis ca vinasyamti(l)7
(sa)rvaduhkhavinirmukth sukham tisthamti|
b) [2] punah sa puru(sa)
[t]. mrdhany utsrjati
sa tasya karun()
[sa]rvms ca satvm
narakips pasyati| pusparasadh[3]rbhih simcyamnam|9
evam ti[ry]m [p](r)et[](m
manusym^ ca|) 10
c)
[trojpanimittm^pamcacacyavannimittaih^duh^jkhitm
pasyati
cchym svsrayasya [p](a)sya(ti|)
[d], v. g()tr[e] tisthati| [e]kavisaylambanasamartham csya cittam
bha[5]vati na bhyah13 altacakravat|14 sarvavi[sa](y). .hi[da]
na c

Qualen [gerichteten] Geistes. Gro (wird die Gestalt) des der Unermelichkeit zugewandten
[Yogin]
fliet
mit tausenden von
ein kostbares Getrnk heraus. Durch dieses kommen alle Qualen zum
Erlschen.
c) Dann (erscheint) der Erhabene auf einem Diamantthron (sitzend)
und verkndet mit weisen, tiefen und erlesenen Worten die Lehre. (Die Wesen) vernehmen diese und
erstehen, (aus der Hllenexistenz) herausgefallen, in einer guten Existenzform wieder.
6. (nicht bersetzt)
1

Lies: mahn . Vgl. 149V6: (su)khasamsparso mahms csrayo.


Vgl. 148V6Rl: (u)bh(a)yah(a)st(angu)linihsrtbhih astmgopet(bhih sa)l(i)ladhrabhir avasesam
mnasam duhkham a[h]. . . .
3
Lies: sarvh.
4
Vgl. 149R1: karanas ca vinasyamti.
5
Erg. zu: (satvs tas)m(c)t
6
Lies: sugatv upa.
7
Vgl. 149V3: tasyaivpramnasayasya mahm (srayah)
astmgopetam pniyam niscarati
tena sarv kranh smyamte\.
8
Lies: nrakm.
9
Lies: simcyamnn]. Vgl. 148R3: nnvarnarasasekaih satvm (simcya)mnaih; 145V2: (sat)v()
ksiradhrbhih siktamtr; 130R3: pusparasanadyah.
10
Vgl. 145R5: mahnarak
tiryakpretamanusys ca.
11
Lies: onimittam1
12
Lies: ^nimittairt
13
Lies: bhyo 'lta0.
14
Der Feuerwirbel, den man flschlich fr ein Rad hlt, dient im Buddhismus (wie auch im Vednta; vgl. LA VALLEE POUSSIN, Vednata and Buddhism, JRAS 1910, S. 135f.; GLASENAPP, Das
Gleichnis in der Vednta-Philosophie, Festschrift Kirfel, S. 92) als Beispiel fr eine falsche Vorstellung:
Lank. S. 95: acakram altacakram blais cakrabhvena parikalpyate, ,,Toren bilden sich bei einem
2

VIII. Mitleid (karun)

141

(ni)m(i)ttni pamcarajo gjhnanti vsm


i[va] sraja 1 gtrasvedo jyate
daurgandhyam kya[6]m ayakrmati
s(v)e sane devoddhatim n[la]
149R6
d)
[y].nodyatabhvasya bhagavm simhsa(ndhirdha utpad)[y](a)te
dharmam ca desayati te ca samvignh[2]
v. ta iti sabdam niScrayamti bha[ga]- 150V1
2
3
(vata)h pdayo patamti| [t]
.
t[[ t]
devespapadyamte|
evam yvat parani[2](rmi)[t](a)vasavartino devm paV2
syatij
7. a) punah ka[run]saya evam pamcagatikam c(akram) . . . . . . [bhra]myamnam pa(syat)i4 (drst)[v] csya krunyam u(tpadyate|) 5 []trsanrtham klesaparvatah 6 nnvarnai [3] rgadvesamoliamnavicikitsdr(sti)7
gacchatij sa csambh[r]m[t]as tisthaty 8
b) atha sa purusas tarn samsracakram [4]dya tasmim klesaparvate]9 pravisa(ti|) . . . .
[v]esakan[ta](km) . . . . mnm pasyati drstv csyadhikataram10 samj^takarunyasya 11 haste vajrautpadyate 12 tenatam
klesapa(rvatam)
7M) Weiterhin sieht der so dem Mitleid zugewandte [Yogin] das die fnf Existenzformen
umfassende (Rad) [des Werdens]
sich drehen. (Indem er dies sieht, entsteht)
bei ihm Mitleid. Um [ihn] zu erschrecken, {entsteht) der Berg der Befleckungen mit verschiedenfarbigen, Leidenschaft, Ha, Verblendung, Hochmut, Zweifelsucht und [falsche]
Ansicht [darstellenden]
geht
Er aber steht unerschttert.
b) Nun tritt dieser Mann mit dem Rad des Geburtenkreislaufes in der Berg den Befleckungen ein
sieht [der Yogin]
Dornen. Indem er dies sieht [und] in noch hherem
Mae von Mitleid durchdrungen [ist], entsteht in seiner Hand ein Diamant. Mit diesem
(spaltet) er den (Berg) der Befleckungen
Feuerrad, das kein Rad ist, das Vorhandensein eines [wirklichen] Rades ein"; AbhdhKVy. S. 341,28f.:
altacakravat. yathdlte ighrasamcrt tatratatrotpadyamne altacakrabuddhir bhavati, 'wie ein Feuerwirber [bedeutet], wenn ein Feuerschein durch die schnelle Schwingung hier und dort erscheint, entsteht der Eindruck eines Feuerkreises".
1

Lies: srajo.
Lies: pdayoh.
3
Vgl. 154R2: te (ca) satv bhagavantam drtv samamtatah pradhv(amti
bhaga)v(a)tah pdayo
pranamya
nam bhagavm dharmam des(a)y(a)t(i); 159V45: sarvasatv samvigns ca bhaga(vato
'ntike) gacchanti pravrajym api ycante\ bhagavms caihibhiksukay pravrjayati.
4
Vgl. 159R1: pratityasamutpdacakram (8amsk)rasmtnikam traidhtukam karmaklesavabaddham
bhramamtam abhimukhi bhav(a)t(i).
5
Vgl. 1S0R4: tad asya drstv adhimatram krunyam utpadyate\.
6
Lies: parvato.
7
Die aufgezhlten Eigenschaften gehren zu den kleias, deren Zahl und Reihenfolge in den Texten
verschieden angegeben wird.
8
Lies: tisthati\.
9
Satzzeichen zu streichen.
10
Lies: csyadhikataram.
11
Lies: krunyasya.
12
Vgl. 150R45: tad asya drstv adhimatram krunyam utpadyate\ sam(jtak)runyasya ca daksine
haste tiksnam kas{avar)na{m) sastram utpadya(te\).
2

V3
y4
75

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

150V6
150R1

R2

R3
R4

8. a)1
(si)m(h)(sandhir)[dh]h2 bhagavamto
dharmam desayanti3 brahm ca bhrm[6]gram^dygratahsthitobodhisatvam kathayati
[nya]
jayati| bodhau ca pranidhnam s karoti| tac codakam [1] vyun ksiptam anamtesu lokadhtusu satvn sim[ca](ti|)
b)
[mjrdhn praticch(am)n(a)
(bhagavm csya sirasi pa)tta(m) badhnti 6 kathayati ca namo 'ngate 'dhvani bhavi[]syajagatkarnadhrya 7
c) devs ca krtsnam gaganam prya [n]
bhtv nipata(nti|)
[v]
(u)[t]srjanti8
9
d) tasya prltiprmodyasamjtasya kra[3]mena laksannuvyamjanavirji(ta)
..
10
. . yati candramandalasamkso
[sat]v(m)s ca vina[ya](ti|
e) vy)[u]tth[i]tasya csya bodhya drdham adhysaya[^](m ut)[pa]dyate|11 s csya samtistha(te)
[k](ar)[m](a)[k]l(e)[s]()i2*.'

8M)
verknden (auf Lwenthronen)
sitzende Erhabene die Lehre, und [Gott] Brahma, der mit einem Kruge im Vordergrund
steht, spricht zu dem Bodhisatva:
" Dieser besiegt
, und legt das Gelbde zur
Erleuchtung ab. Das Wasser, vom Winde versprht, besprengt in unendlichen Weltregionen
die Wesen.
h)
mit dem Haupt bedeckt
(Der Erhabene)
bindet ein Seidentuch (um den Kopf) [des Yogin] und spricht: Verehrung [sei dir], dem in
einer zuknftigen Epoche erstehenden Steuermann der Welt."
c) Gtter erfllen den gesamten Luftraum und
[Diese] fallen, zu
geworden, nieder
entlassen sie
d) Ist [der Yogin] von Beglckung und Freude durchdrungen, (erscheint [seine] Gestalt)
allmhlich mit den [Buddha]malen und Nebenmerkmalen prangend; wie die Mondscheibe
scheinend
und erzieht die Wesen.
e) Indem [der Yogin] erwacht, entsteht bei ihm die feste Hinwendung zur Erleuchtung,
und es berkommt ihn der Wunsch: ,,(Von den Tat)befleckungen
"
1

Beginn der Pranidhischilderungen; vgl. Einl. S. 54 f.


Lies: (r)dh bhagavamto.
3
Vgl. 165V5: simhsandhirudha buddhh satvebhyo dharmam desayanti,
4
Vgl. WALDSCHMIDT, Buddhistische Kunst, S. 97 f.: Die Kanne fr die feierliche Wasserausgieung
bei der Spende (die bhrngra) ist ein rundbauchiges Gef mit langer Tlle und einem Tragbgel ber
dem Deckel, hnlich modernen Teekesseln." Vgl. 148R2: brahmais
karakahastaih; 151R6: brahma
grhitasuvarnabhja(na).
5
Vgl. 151R1: bodhya pranidhnam karoti.
6
Vgl. 128V3: bhagavms easya sirasi pattam badhnti\ kathayati caivam npnasmrtir bhvayitavya
(Einl. S. 41).
7
Lies: bhavisyajjagatP. Zu karnadhara vgl. Einl. S. 55, Anm. 3. Eine andere Form des Vykarana
findet sich in 152V6.
8
Vgl. 128V4: devs ca krtsnam gagana pryaman pusparatnavarsam utsrjanti u. a.
9
Erg. sraya. Vgl. 130R6: tata upasamasukham anubhavati
srayo laksannuvyamjanavirjita
utpadyate\.
10
Vgl. 127R1: yog(c)rsryah candramandalasamksah.
11
Einl. S. 55.
12
Vgl. karmaklesvabaddham 159R1.
2

VIII. Mitleid (karun)

143

9. a) . . . . (ban)dh(ana) . . . A
(a)[bh]imukhi bhavati
[ta]d asya drstv 2 adhi3
mtram krunyam utpadyate|
sam[5](jtak)[ru]nyasya ca daksine haste tiksnam []- 150R5
k[s](avar)[na](m) sastram utpadya(te|) 4 . . . .5
(cche)[d](a)yatip
b) cchatram ca 7 a[n]am(tam lokam) [spha]ritv sarvasatvn upaguhya tistha[6](ti|)s
B6
c) (tata) [i]ndranilavarno 'bhisekah^ [p]()r(vava)[t|]
' . . . . ! . . ' . . . . [s]
d) tato hamsarathdhirudhahii brahm 12 ta[i]

. -.
[3](satu)
[458V1]^ (tvam
iti karunasthitih|)17

adhs10 cordhvam ca [g](atv) . .


.'....

bhagavms c[s](ya) . . . .
[]ryamaitreyas ca tatparivrs 13 ca bodhi[2](satv)
[gat]e
(an)[u]modayati| brahm kathayaty 14 sva[568V1]M (kathayati)

9.a) (Weiterhin) kommt [dem Yogin] (die mit Fesseln gebundene)


zu gesicht.
Indem er dies sieht, entsteht bei ihm bermiges Mitleid. [Ist er] von Mitleid durchdrungen,
entsteht in [seiner] rechten Hand ein scharfes ther(farbenes) Messer. (Mit diesem) durchschneidet er (die Fesseln)
b) Ein Schirm durchdringt die unendliche (Welt) und umhllt alle Wesen.
(c (Dann) [erfolgt] die Besprengung, in saphirblauer Farbe (wie oben). [Der Strom] (geht)
abwrts und aufwrts,
d) (nicht bersetzt)

Erg. zu: (punar ban)dh(anabaddham)? Vgl. bandhanabad(dh) 162R5.


Lies: drstvdhi0.
3
Vgl. 148R4: adhimtram\ tesu Jcarunm avakrmati\.
4
Vgl. 150V4/5: samjatakarunyasya haste vajra utpadyate tena tarn klesapa(rvatam). . .
5
Erg. (tena)
6
Erg. zu: (bandhanm cche)d(a)yati\tt
7
Lies: cnam(tam).
8
Vgl. 130V4: mrdhatas c(a ni)h8rtam ratnamayam cchatram anamta lokadhtm spharitv tisthati.
9 Vgl. Einl. S. 41.
10
Lies: adhas. Vgl. 136V2: urdhvam cdhs ca spharitv; 154R4: (a)dh(a)s c(or)dhv(am) c(a) gatv.
11
Lies: adhirdho.
12
Wie unten in der Pranidhidarstellung 152V26 erscheinen hier vor dem Yogin Gott Brahma, der
Erhabene sowie der Bodhisatva Maitreya.
13
Vgl. 152V3: ryamaitreyah bodhisatvaganaparivrtah; 128V5: ryamaitreyam anekasrvakasahasraparivram.
14
Vgl. 150V56: brahm ca bhrmgram dygratah sthito bodhisatvam kathayati.
15
Beginn der Parallelhandschrift 2 A; Textwiedergabe S. 23f.
16
Beginn der Parallelhandschrift 1; Text wiedergbe S. 23.
17
Vgl. 151R5: iyam apara karunasthitih\\ ; 153R3: (iyam apar karu)nsthitih.
2

151V1
V2

V3

144

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

151V4

10. a) [pu]nar abhisekapravhnamtaram| sthitih kuttimasau[4], . . . (anamtparyamt


bhavati| t&[458V2]to) [568V2] ratnam(a)[y](o v)r(k)[s](a udgatah krtsnamlokami spharitv
tisthati| vrksamlni ca kmcanacakre pra)tisthitni sauva[455F3]rna2 ksirapariprnni
V [568V3] drsyam[5]te|3 vrksdha[s](tt)
yajnavt yatra
hoAhisa[458V4](t\h sar)v(am) sarvatra sarvad praya(cchan no)
V6 . . . . [568V4] purusah kathayati|
a[45SF5]smim sthne bodhisa[6]tva4 sarvasatv(nm
sarvamanoratha)
k(r)tv[bh]i[sa]m(bu)[ddh](o) bodhim5 asamkhyasatvaparivra[458V6]h [568V5] [n]i(rupadhisese nirvnadhtau pravisamtiti 6
151R1
b) ta)t(o) 'sya hrdaye stri samutpadyate suvarnavarn[2](vadtavastra[45<SJ?2]prvrt|
sapattasuvarna[56SF6]m)lv(a)b(a)[d]dh()
[s](ai)n(am) pr(o)tsha[y](ati|) 7
tv(a)[m]
(a)pi tv(at) . .[r]
s (Sv tmnam pra[45Si?2]namya bo)[dh]ya pranidhnam
karoti9
R2
c) vyutthitasya csya10prani[2](dhna)
(h) [sa]rvasatvopa[4553]ri patati| tac ca d(rstv)[ sjamjtapritiprmodya11
(ni)rgatya

10. a) Weiterhin ist der Standort [des Yogin] unmittelbar nach den Besprengungsstrmen
in (unendlichem) Umkreis EstrichDann kommt ein Baum aus Edelsteinen zum
Vorschein und durchdringt die ganze Welt. (Die auf der Goldscheibe) feststehenden, goldenen
und mit Milch angefllten (Wurzeln des Baumes) erscheinen. Unterhalb des Baumes [sind]
die Opfersttten, wo der Bodhisatva, alles berall und
allezeit hingebend,
spricht der Mann: An
dieser Stelle tritt der Bodhisatva, nachdem er alle Wnsche aller Wesen (zur Erfllung) gebracht hat und zur Erleuchtung gelangt ist, mit einem Gefolge von unzhligen Wesen in die
erlste Region des Verlschens ein."
b) Dann entsteht im Herzen [des Yogin] eine Frau von goldener Farbe und mit einem
weien Gewand bekleidet, die umwunden ist von einem Goldkranz mit Seidentchern. Diese
spornt ihn an: ,,Auch du
" (Dann) verneigt er sich selbst und legt das
Gelbde zur Erleuchtung ab.
c) Indem [der Yogin] erwacht, [bleibt sein] Gelbde
/. .
fllt ber alle Wesen. Indem er dies sieht, gehen von (ihm), der von Beglckung und
Freude durchdrungen ist,
aus und umhllen das gesamte Meer der
i 458V2: liest: lohe.
~ Lies: var?ini (so richtig Parallelhs. 1, V3).
3
Vgl. 127V23: tato mrdhnah ratn(amayo vrksa)h anamt lokadhatavah spharitv tisthati\
vrksamlni ca
kmcanacakre pratisthit drsyante\.
4
Lies: satvah.
5
Vgl. 139V4: abhisambuddha bodhe.
6
Lies: pravisatiti. Vgl. 151R3: buddhn anekasahasraparivran nirupadhisese nirvnadhatau pravisatih.
7
Vgl. 148V35: drstv csya karun bhavati\ tadadhipatirpam\ hrdaye stri su(varn)bh() av(a)d()ta8traprvrta utpadyate] utpamn yoginam protsha{yati\)
kryah aham te sarvaparahitaka(ran)e
sarvnuklam shyyam karisymiti; 148R12: tathaiva ca hrdayasth karu(n) protsha(ty u)ddhara
snpaya cainm satvn iti.
8
Erg. tataht
9
Vgl. 150V6: bodhau ca pranidhnam karoti; 152V4: sa bhagavatpdayo pranamya kathayati\. Das
in 150R1 und 152V5 auf das pranidhna folgende vykarana des Erhabenen fehlt hier.
10
Vgl. 150R3: (vy)utthitasya csya bodhya drdham adhysaya(m ut)padyate (Einl. S. 55).
11
Vgl. 150R2: pritiprmodyasamjtasya.

VIII. Mitleid (karun)

145

krtsnam sa[45&R4]tvasamudram upaguhya tistham[3](ti| 1 kramena)


151R3
. . . . buddhn a[ne](kasahasrapari[45&5]vran2 nirupadhisese nirvnadhtau pravisatih 3
iyam apara 5 karunsthitih 6 ||
11. a) punah [4] (karunsayasya [458R6] bhrvivara upanibaddhacetasa7 cchidram [568B4]
R4
9
utpadyate|8
tattra)
(pa)[s]yati| tamnihsrtaur 10 lokair
lokam avabhsitam p a s y a ^ t i l ) 1 1
[568R5] (samudrm sa) ..
R5
k(m)c(a)n(a)c(ak)r(e)
. [568R6] nagarabhavanodynni pasyati tn| 12 [6]
R6
[brajhm grhit[56&7]suvarnabhja(na)13
(ni)hsrts14 candramandalasamks nadi15 [1] [](sra- 152V1
16
yam p)[r](ayati|)

Lebewesen. Allmhlich sieht er


fachem Gefolge in die erlste Region des Verlschens eintreten.

Buddhas mit vieltausend-

Dies ist ein weiterer Standort des Mitleides.


ll.a) Hat sich [der Yogin] dem Mitleid zugewandt [und sein] Denken auf den Zwischenraum [zwischen] den Brauen konzentriert, entsteht weiterhin ein Hohlraum. Darin sieht er
(den Erhabenen)
Durch den Lichtschein, der aus diesem hervorkommt, sieht er die Welt erleuchtet
Meere
auf der Goldscheibe
sieht er Stdte, Huser und Grten. Diese
[Gott] Brahma, der eine goldene Schale trgt
. . . (erfllt) ein [daraus] hervorkommender, wie die Mondscheibe scheinender Flu [seine]
(Gestalt).

Vgl. 130V5: patth


krtsnam s(atvasamu)dram upaguhya tisthamti; 131R6: ratnavarsena
krtsnam satvasamudram (u)pagdham; 153R6: ratnaktgrair ivopagudhm.
2
Lies: vrn.
3
Lies: pravis'atah.
4
Vgl. 151V5\ asamkhyasatvaparivrah nirupadhisese nirvnadhtau pravisamti.
5
Lies: apar.
6
Vgl. 15IV3: iti karunsthitih,
7
Lies: cetasa chi; vgl. Einl. S. 20.
8
Einl. S. 36.
9
Erg. (bhagavantam).
10
Lies: nihsrtair (so richtig Hs. i, R6).
11
Vgl. 159V4: (ta)to bhagavan utpadyate tamnihsrtais cdlokai(h sat)v(a) av(a)bh(si)t(a).
12
Virma wohl durch das Zeilenende bedingt. Lies: tm.
13
Lies: grhita0. Vgl. 150V56: brahm ca bhrmgram dygratah sthito.
14
Lies: srt.
15
Lies: nady.
*6 Vgl. 152R1-2: samyaksamb{uddh)s
tamn(abhinih)srtbhis candramandalasamksabhir nadibhir yogcrs(r)ayam pryate].
10 Schlingloff, Yogalehrbuch

146

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

b)i
eva pravhah 2 [568R8] adho y(vad vyumandalam) 3 []rdhva(m)
yvac caturtham dhynam iti tadvarnam evvasthpya punar mrdhn pravisya4 bhruvi152V2 varm nirgato dvitiyas ca [2] nbhyahs sthitim p(rayati|)
racitais ca buddhsryaih6 sthi[t]i(h prn dr[sya]te| 7
c) tato hamsarathdhirdhah 8 brahm prdur bhavati| 9 daksine [c][s](ya) prve sauV3 varnena padmam vme nil[3](bham|)
[ta]to bhagavm10 cch(u)[d](dhvsadevaparin
v)[r](to daksine padmaka)rnikym nisidati suddhvss ca devh patresu ryamaitreyah12
V4 bodhisatvaganaparivrtah13 tarne14 p[4]rsvepadma(kar)[n](i)ky(m nisidati bo)dhisatv15pa(t)r(esu|
d)16 tatah karunvi)hrinah samjtaprasdasya17 pdamle padmam (utpa)[dya]te|18

sa

b)
[geht] ein Strom abwrts bis zum (Windkreis) und aufwrts bis zur vierten Versenkungssphre. Nachdem er deren Farbe abgetrennt hat, tritt er
wieder durch das Haupt ein und geht vom Zwischenraum [zwischen] den Brauen aus, und
ein zweiter vom Nabel, und erfllt den Standort. (Dann) erscheint [sein] Standort von
Buddhagestalten, die mit
besetzt sind, (erfllt).
c) Dann tritt [Gott] Brahma auf einem Schwanenwagen in Erscheinung, sowie an seiner
rechten Seite ein Lotos mit goldenem [Glanz] und an [seiner] linken ein blau (leuchtender)
[Lotos]. Dann setzt sich der Erhabene, von den Suddhvsa-(Gttern umgeben, an der rechten) [Seite] in die Samenkapsel der Lotosblume nieder und die Suddhvsa-Gtter in die
Bltenbltter. Der edle Maitreya, von der Bodhisatvaschar umgeben, (setzt sich) an der
linken Seite in die Samenkapsel der Lotosblume (nieder) und die Bodhisatvas (in die) Bltenbltter.
d) (Dann entsteht) unter den Fen des [Yogin], der (in Mitleid) wandelt und von Ver-

1 152V1-2: Einl. S. 38 f.
2
Lies: pravho 'dho.
3
Lies: (mandala)m rdhva(m). Vgl. 125V2: adho yvad vyumandal(am).
4
Vgl. 129R3: pravho
yvad aghanisthm devn avabhsya caturdhynarasam dyamrdhn punah pravisati\.
5 Lies: nbhyh. Vgl. 129E3: punar bhrumadhyd ekah pravho nirgacchati dvitiyo nbhy
misri
bhtam prathivi spharitv tisthati \.
6 Vgl. buddhsr(a)y 122V4 164V4.
7
Vgl. 135V2: (sthitir)
p(a)riprna drsyate.
8
Lies: rdho.
9
Vgl. 150R6: hamsarathdhirudhah brahm; 169V3: sauvarnaratnacitarathdhir(dham brah)m()n(am) pasyati\.
10 Lies: bhagavn ch(u). Vgl. Einl. S. 20.
11
Suddhvsa ist der Name der vier obersten Gtterklassen der Formenwelt; vgl. Einl. S. 33.
12 Lies: maitreyo.
13 Lies: vrto.
14
Lies: vme.
15
Lies: satvh.
16 152V4-6: Einl. S. 55.
17 Vgl. prasdajtah 152R2.
18
Vgl. LV. S. 84,19: yatrayatra ca bodhisattvah padam utksipati sma tatra tatra padmni prdurbhavanti sma.

VIII. Mitleid (karun)

147

bhagavatpdayo1 pranamya 2 kathaya[5]ti|


bhaga[v](am) [sy]Sm aham anga(te 'dhvani 152V5
sarvasatva)parinyake|3
[s](ar)[v](a)s(a)tv(a)vy()[dh](m)m apahart samyaksambuddha
iti tato ssya bha[g](avm pni)[n]() mrdhnam parmrsatij kathayati ca pu[6]traka
V6
(bhavi)syasi tvam a[n]gate 'dhva(ni sarvasatvavydhmm apa)hart samyaksambuddha iti| 4
e) tato dev hrsth krtsnam gaganam spharitv
pusparatnavarsm 5 utsrjamti| 6
7
sthityupari (ni)[i]sannnm ca buddhnm sarvasroto(bhyo ratnavrk)s()h 8 nirgacchamti|
152R1
ta[da](dhir)[]dhh samyaksamb(uddh)s9 candramandacit10 yvad aghanisth dev11 iti12
tam[n](bhinih)srtbhis candramandalasamksbhir nadibhi[2]r yogcr[s](r)ayam pryaR2
tOp3
/) ta(t)[o] (bhagavm) cch(u)d[dh]vsdevaparivrta14 []r[y]amaitre[y](o) bodhisatvaganaparivrtah15 rdhvam yathgat abhiruhamti sa ca prasdajtah^ ratnni puspni ca ksi[3]R3
(ptni devaih) [pa]riga[v](esat)[e](|

trauen durchdrungen ist, ein Lotos. [Der Yogin] verneigt sich zu Fen des Erhabenen und
spricht: ,,O Erhabener, ich mchte in einer zuknftigen Epoche der Fhrer (aller Wesen)
sein; ein Tilger der Gebrechen aller Wesen, ein vllig Erleuchteter/' Dann berhrt der Erhabene sein Haupt (mit der Hand) und spricht: ,,Mein Sohn, du wirst in einer zuknftigen
Epoche ein Tilger (der Gebrechen aller Wesen sein), ein vllig Erleuchteter."
e) Dann durchdringen Gtter frohlockend den gesamten Luftraum und entlassen einen
Regen aus Blumen und Edelsteinen
Von allen Krperffnungen der ber
[seinem] Standort sitzenden Buddhas gehen (Edelsteinbume) aus. Auf diesen sitzen bis hin
zu den Aghanistha-Gttern vllig Erleuchtete, mit Mondscheiben besetzt. Von Flssen, die
wie die Mondscheibe scheinend aus deren Nabel hervorkommen, wird die Gestalt des Yogin
erfllt.
/) Dann steigen (der Erhabene), von den Suddhvsa-Gttern umgeben, und der edle
Maitreya, von der Bodhisatvaschar umgeben, so wie sie gekommen waren, aufwrts. Von
Vertrauen durchdrungen sammelt [der Yogin] die (von den Gttern) verstreuten Edelsteine
und Blumen.
1

Lies: pdayoh.
Vgl. 154R2: (bhaga)v(a)tah pdayo pranamya; 151R1: s()v tm()n(am pra)namya bodhya
pranidhanam karoti.
3
pw. und BHSD: parinyaka.
4
In 150R12 lautet das Vykarana: (bhagavms csya sirasi pa)tta(m) badhnti kathayati ca namo
'ngate 'dhvani bhavisyajagatkarnadhraya.
5
Lies: varsam.
6
Vgl. 128V4: devs ca krtsnam gagana pryamna pusparatnavarsam utsrjanti (Einl. S. 40).
7
Vgl. 135V2: sthityupari ca parvatdrsyamte\.
8
Lies: (vrk)s(). Vgl. ratnavrksah 131R5; ratnamayo vrksah 127V2. Auch in 151V4 ist die Erscheinung eines Edelstembaumes die unmittelbare Folge des Gelbdes des Yogin.
9
Vgl. 127V2: mrdhnah ratn(amayo vrksa)h anamta lokadhtavah spharitv tisthti\ tasmim vrkse
buddh drsyamte.
10
Lies: oma7idalacit.
11
Lies: aghanistham devn. Vgl. yvad aghanisthm devn avabhsya 129R2 u. a.
12
Vgl. 131R4: aghanisthapa(ryamtam lokam) padmacitam ta(dadhir)dh(m)s ca buddhn pasyati
tannihsrtaih pravhaih
svam srayam prya(te) (Einl. S. 53 f).
13
Vgl. 151R6152V1: candramandalasamks nadl (sraya?n p)r{ayati). Vgl. auch das Ende der
ersten Pranidhischilderung 150R2R3: tasya pritiprmodyasamjtasya kramena laksannuvyamjanavirji(ta sraya) . . . . yati candramandalasamkso
satv(m)s ca vinaya(ti\).
14
15
16
Lies: vsadeva.
Lies: vrta.
Lies: jta.
2

IQ

148

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

iyam apar karu)nsthitih 1


g) ante ca sarvam nbhym jneyam nirudhyate|
gat drsyamta 2 iti vyutthnamj

buddhs ca padmdhirdhh kye 'ntar-

12. e[4]vam asya saparika(rm savises ka)run nispam(n va)ktavy| 3 atah param idni4
aparopatpibhavah ksmtisauratyamrjavamrdutve5 parakryavyasanitvam
sauhrdam amR5 g[5]ni karunyh
e[bh]i
(gr)hita6 karunh 7 punahpu(nar )rabhyasyamn8
mahkarunvhika 9 bhavatiti ||

152R4

(Dies ist ein weiterer) Standort des (Mitleides).


g) Am Ende wird alles zu Erkennende im Nabel zum Verschwinden gebracht. Die auf
Lotosblumen sitzenden Buddhas erscheinen in [seinen] Krper eingegangen. So [erfolgt] das
Erwachen.
12. So kann man sein Mitleid samt Vorbereitung (und Besonderheiten) als vollendet bezeichnen. Darber hinaus sind nun als Glieder des Mitleides [zu nennen]: Das Empfinden des
Schmerzes anderer; in Geduld, Milde, Sanftmut und Zartheit die Anteilnahme an fremden
Taten; Freundschaft. Wird das Mitleid mit diesen
ergriffen und immer wieder
begonnen, fhrt es das Groe Mitleid herbei.

Vgl. 151V3: iti karunsthitih; 161R3: iyam apara karunsthitih ||.


-Vgl. 136B12: buddhapratyekabuddhasrvakh
amte ca tadsraye
S. 53).
3
Vgl. 128R2: npanasmrti saparikarm\ savises nispamn vak(tavy).
4
Lies: idnim.
5
Lies: mrdava0^
6
Lies: (gr)hit.
7
Lies: karun.
8
Lies: ()rabhyamn'!
9
Lies: vhik.
2

-pravisamti] (Einl.

IX. Freudigkeit (mudita)


Vorbemerkung
Wie das Mitleid sich den leidenden und gequlten Wesen zuwendet, erfat die Freudigkeit die
Regionen der Seligen. Der Yogin freut sich ber ihr Glck und bertrgt seine Freude auf die
Wesen (3.-5.). Das hchste Glck jedoch, das den Irdischen zuteil werden kann, ist die Jngerschaft des Erhabenen (6.).
karunnamtara 1 mudi[t]( n)[i]rdist bhagavatp
1. a) atas tatsma[6](rthya)m . . .e
kimartham punah 152R6
ka(runnamtaram) m[u]ditnirdesas 3 tad ucyate (1) vihimspratipaksnamtaram4 Irsyratipratipaksviskaranrtham|5 (2) pa[ra][2][d]u[hkh](a)pritipratipaksnamtaram v
pa- 153V1
rasukhpri(ti)pratipaksviskaranrtham| (3) nirvidkramanasikrnamtaram v
prmody[k](r)nuklamanasikaro6 dyotanrtham| (4) duhkhltpan[2]yansayamanasikrV2
8
namtaram ? v hitasu[kh]()numodansayamanasi[k]ro dyot(a)[n]rtham|

Der Erhabene hat gelehrt, da unmittelbar auf das Mitleid die Freudigkeit [folgt].
l.a) Nun deren Funktionen
Aus welchem
Grunde aber ([folgt] unmittelbar auf das Mitleid) die Beschreibung der Freudigkeit? Darber lehrt man:
(1) Um unmittelbar nach dem Hindernis Grausamkeit die Hindernisse Neid und Unlust
deutlich zu machen; oder (2) um unmittelbar nach dem Hindernis 'Beglcktsein ber fremdes Leid5 das Hindernis 'Nichtbeglektsein ber fremdes Glck' deutlich zu machen; oder (3) um
unmittelbar nach dem Beherzigen des Aspektes des Kummers das dem Aspekt der Freudigkeit angemessene Beherzigen zu erhellen; oder (4) um unmittelbar nach dem Beherzigen
der Zuwendung zum Entfernen [des Leides] der Leidenden das Beherzigen der Zuwendung
zur Mitfreude an [fremdem] Heil und Glck zu erhellen.

Lies: namtaram.
Vgl. 155V2: muditsamanamtaram upeks nirdis(t) (bhagavat\).
3
Vgl. 147R2: karunprayoganirdesah.
4
Zusammenstellung der Hindernisse (pratipaksa) und der zu beherzigenden (manasikra) Dinge
s. oben, S. 116f.
5
Liies: irsyrati0. Vgl. 155V3: irsyratipratipaksnamtaram.
6 Lies: kra.
7
Lies: duhkhitpanayan0
8 Lies: kra
2

150

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

b)1 atha kimsvabhv mudit tad ucyate | sauma(na)[s](y)e(t)i [sa] 2 svabhv3 s tu snu153V3 parivart sa[3]samprayog parigr(h)ya(mn| kmvacar catuh)skandhas[va]bhv| rupvacara4 pamcaskandhasvabhv| sraye kmadhtvsray| lambane kmadhtvlamV4 bana 5
bhmi[4](tah kmadhtau dh)[y]()nadvaye ca tatra sau(manasyam) [dv](a)y(a)sadbh[v](am||)6

V5

[ta]tprayogah
2. a)7 adhimtrdhimtrasya mitrasya sukhena prlto bhavati
b) evam madhyasya mrdunah 8 udsmasya
c) e[5](vam adhi)[m]trasymitrasya sukhena prlto bhavati

3. a)
(opa)[n](i)bandhacetasah9 ebhi10 prakraih satvn adhimucyamnasya
V6 hr(daye padjmpjnl11 prdur bhavati| suvarnavluksti[6](rn12suvarna)padmaih13vaidryandaih14 ratnacitaih15 prn()
tadadhirdh(m)|16 sa[tv]n17 sarvlamkravibhsitm|18
b) Was ist nun die Freudigkeit ihrem Wesen nach ? Darber lehrt man: Sie ist ihrem Wesen
nach aus Frohsinn bestehend. Sie mu zusammen mit [ihren] Folgerungen und Verbindungen
erfat werden. (Gehrt sie der Sinnenwelt an), besteht sie ihrem Wesen nach aus (den vier)
Gruppen; gehrt sie der Formenwelt an, besteht sie [ihrem] Wesen nach aus den fnf Gruppen. Hinsichtlich der Gestalt entspricht sie den Gestalten der Sinnenwelt, hinsichtlich des
Objektes hat sie die Region der Sinnenwelt zum Objekt. (Hinsichtlich der) Sttte (bezieht
sie sich auf die Region der Sinnen weit) und auf die Zweizahl der [unteren] Versenkungssphren. Hierbei [bedingt] (der Frohsinn) das Vorhandensein der Zweizahl.
Deren bung:
2.a) [Der Yogin] ist ber das Glck eines im berma bermig [guten] Freundes beglckt;
b) ebenso ber das eines mittelmigen und migen [Freundes] und eines Gleichgltigen;
c) ebenso ist er ber das Glck eines bermig [groen] Feindes beglckt.
3. a) Konzentriert [der Yogin] {dann) [sein] Denken auf {die Freudigkeit) und ereifert sich
durch diese Mittel um die Wesen, tritt in [seinem] (Herzen ein Lotosteich) in Erscheinung,
[dessen Uf er]mit Goldsand bestreut ist und der von (goldenen) Lotosblumen mit glsernen, edelsteinbesetzten Stengeln erfllt ist. Auf diesen sieht er mit allem Zierat geschmckte erfreute
1 153V2-4: Vgl. 139B6-140V1; 147R2-E4; 155V6-R1; s. oben, S. 117.
2
Lies: s
3
S. oben, S. 117 Anm. 3.
4
Lies: rpvacar.
5
Lies: lamban\.
6
Ergnzung unsicher. Zum Inhalt s. oben, S. 117, Anm. 4.
7 1S3V4-5: Vgl. 139V2; U7R4-5; 155V5; s. oben S. 118 und Anm. 1.
8
Lies: mrduna.
9
Lies: %addhacetasa. Erg. zu: (tato muditopa)n(i)baddhaceta^a.
i Lies: ebhih.
11 Lies: (pad)mini. Vgl. 147V2: hrdaye ca\ ksirapuskirini.
12
Vgl. 133V2 \ (survarnav)lukcam iva; vgl. auch Sukh. S. 39,4: mahnadyo
suvarnavluksamkirnh; LV. S. 274,1: suvarnavliksamstrt (sc. puskirinl).
13
Lies: padmair.
14
Lies: ndai. Vg.. 144V1: vaidryadamdpadmni.
15
Vgl. 146R1: nnratnacitai padmair.
16
Satzzeichen zu streichen.
17
Vgl. 146JR2: padmesu satv nisannm
buddhavapurdhrino. 18 Satzzeichen zu streichen.

IX. Freudigkeit (mudita)

pramuditra pasyati|
tadvat krtsn(ym pr)[th](i)[v]y(m)
padyate|
b) anumoda[l](nkra ca modamtu bata satv iti|) 3

151

drst(v) casya1 pritis ut-

4. a) [pu]nah4 mudita
sah 5 nnsukhasamarpitah 6 satvasamudrah?
abhi(mukhi bhava)ti| cakravartisadrsbhir vibhsitbhih [2]
(drs)[y](am)t(e) hr
8
dayc csya sauyarno dhvaja utpadyate
n sa ca mrdhn nirgatab krtsnam lokam spharity sarvo(pakara)[na]varsam amte ca ratnavarsam muncati] 9
tena ca [3] (sat)y( b)[u]ddhadharmasamghesu kram kurvanti
b) (hr)day i0 'syas (uva)rrtbhstripramuditotpadyatel11 muditdhipatirpam12 sainam
(sam)[u]tkarsayati13 sdhu sdhu sobhanam idam rabdham|[4] eyam iya satv ihaloke
paraloke [s]ukhe[n](a)[n]ugr(hith|14
c
) y)[]vatparinirmitayasavartideym15 sukhenasukhitm[d](r)[s][tv) p(r)itir utpadyate[ 16
d) anumodankras ca [5] modamtu bata satv iti| 17
Wesen sitzen, und ebenso auf der ganzen Erde. Indem er dies sieht, entsteht bei ihm Beglckung.
b) [Seine] Mitfreude (hat den Aspekt: Freuen frwahr sollen sich die Wesen).
4M) Hat [der Yogin] {sein Denken auf die bung) der Freudigkeit {gerichtet), (kommt ihm)
weiterhin das mit mannigfachem Glck durchsetzte Meer der Lebewesen (zu gesicht). Mit
Weltherrschern entsprechenden, geschmckten
erscheinen sie. Aus dem Herzen
[des Yogin] entsteht ein goldenes Banner
Dieses geht
durch [sein] Haupt aus, durchdringt die ganze Welt und entlt einen Regen aus allen
Lebensmitteln und am Ende einen Edelsteinregen, womit (die Wesen) vor Buddha, der Lehre
und der Gemeinde Spenden darbringen.
b) In seinem Herzen entsteht eine goldleuchtende, erfreute Frau als Verkrperung der
Freudigkeit. Diese lobt ihn: Trefflich, trefflich; vorzglich [hast du] dies begonnen. So sind
gleichsam die Wesen in der diesseitigen und in der jenseitigen Welt vom Glck begnstigt.
c) Indem [der Yogin die Wesen] bis hin zu den Paranirmitavasavarti-Gttern vom Glck
beglckt sieht, entsteht [bei ihm] Beglckung.
d) [Seine] Mitfreude hat den Aspekt: Freuen frwahr sollen sich die Wesen.
1

Lies: csya.
Lies: pritir.
3
Vgl. 153B4 = 154R3: anumodanakras ca modamtu bata satv iti. Vgl. AbhdhK. VIII, S. 198:
,,Les &tres rejouis {mudita) sont l'objet de la joie. A leur endroit l'ascete pense: 'Rejouis les etres!' et,
par l, entre dans la 'meditation de joie', muditabhvana."
4
Lies: punar.
5
Lies: so. Erg. zu: mudit(prayogvahitaceta)so; vgl. etwa 135V2: yatanapariksvahitacetasah.
6
Vgl. LV. S. 85,5: te suhhasamarpit bhavisyanti.
7 Lies: samudro *bhi. Vgl. aber 145V3, 158R2/3: samudram abhimukhi bhavati (Einl. S. 22).
8
Vgl. 115V6: ndsagrac csya vaidryadhvajo (n)ir(gatah) (Einl. S. 35, Anm. 7).
9
Vgl. 148V'56: tat(ah karu)ndhipatirpam hrdayn nirgatah
(kr)tsn(am) gaganam
(spha)r(i)tv
(sa)r(v)opakaranavrstim mumcati. Vgl. auch 170R5: hastesu grhitaratnopakaran purus.
10
Lies: (hr)daye.
11 Einl. S. 35; vgl. auch S. 43.
12
Lies: mudita0.
3
1 Vgl. 148V4: karun
tadadhipatirpam\ hrdaye stri
utpadyate] utpamn yoginam protsha(yati\) 151R1 (Einl. S. 50).
16
14 Vgl. 142V4: satvn anugrhniym.
Vgl. 154R3: drstv priti u(tpadyate).
i7
15 Lies (mit 150V1): para*. Vgl. Einl. S. 32, Anm. 8.
S. oben, Anm. 3.
2

153R1
R2

R3
R4

R5

152

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

5. ) tatsmanamta^a)!]! 1 (a)nagatena 2 sukhena sukhita(m)| 3 satvm (pajsyatip* tato


'sya brahmasadrsam srayam 5 utpadyatej6 sarvasr[oto]bhys7 ca suvarnabhni 8 candrama153R6 nda[6]lni nnacitni 9 nirgacchamti tatrdhirudhm10 (satvm) tatsadrsavarnn ratnaktgrair 11 ivopagudhm12 pasyati)
b) tadvad anam[ta]m [l]o(ka)m (dv)[i]tiye dhynej13 evam eva nilavarno dhtu14 sarve154V1 [s]m| ta[c] ca [1]
(u)[t]padyat(e)|
6. a) anu
[dy]nnubhavadarsanam vitargnm adhipa(tivibhganisyam)darupair15 vedit(av)[y](a)[m|]
V2
b)
[2]
nubhvena eva16 naya . .
17
(mana)sikraprayuktasyaikasmim bhge manusya(lokam de)v(m)s ca paV3 syati
dvitlye bh(ge)
[3]
sam

5.a) Unmittelbar darauf sieht [der Yogin] vom zuknftigen Glck beglckte Wesen.
Dann entsteht seine Gestalt Brahma entsprechend, und von allen [seinen] Krperffnungenen
gehen goldleuchtende, mit verschiedenen [Edelsteinen] besetzte Mondscheiben aus. Auf
diesen sieht er Wesen von entsprechender Farbe sitzen, die gleichsam von Edelsteintempeln
umhllt werden.
b) Ebenso [sieht er] die unendliche Welt in der zweiten Versenkungssphre; [sie ist] in
gleicher Weise eine blaufarbene Region fr alle [Wesen]. Dann entsteht
6M)
soll man wissen, da die Schau der Empfindung des
fr diejenigen, die von Leidenschaft frei sind, in den Formen Verkrperung, (Zerlegen und Ergebnis) [erfolgt].
b)
durch die
Macht
des Gebten, [das Zerlegen] zu beherzigen, sieht [der
Yogin] auf der einen Seite die Menschen(welt) und die Gtter, und auf der anderen (Seite
den Buddha), der
, der
1
2

Lies: osamanamta(ra)m a.

Lies: (a)ngatena.
Lies: sukhit(m). Satzzeichen zu streichen.
4
Vgl. 128V46: angatabhvanym\
manayah
tadadhirdho yogcrah tmnam
pasyati \.
5
Lies: irayam ut.
6
Vgl. brahmsrayo 144R6; brdhmarupinah satv 144V3.
7
Lies: srotobhyas.
8
Lies: suvarnabhni.
9
Lies: nn0. ratna ist wohl versehentlich ausgelassen; vgl. 124V1: ratnacitdity(a)m(a)nd(a)l(ani);
130R3: nnvarnaratnanaksatracandramandalanadyah; nnratnacita auch 146R1, 146R2.
10
Lies: rdhm. Vgl. 144R4: candramandaldhirdham
ct(rnna)m.
11
Vgl. 165R4: . . . ratnaktsrai . . .; 158R4: satv
vaidryastambhanihsrtaih pattai
tadv(arnais ca ktg)rair avacchdit drsyamte.
12 Lies: gdhm.
13
Die Meditation der Freudigkeit reicht nur bis zur zweiten Versenkungssphre; s. oben, S. 117,
Anm. 4.
14
Lies: dhtuh.
15
Lies: rpair. Vgl. 146V4: (vitargnm) tribhih rupai(h) pravartate adhipativibhganisyandarpaih avitargnm ekena adhipatirpenaiva.
16
Lies: bhvenaiva.
17
Lies: yuktasya\ ekasmim?
3

IX. Freudigkeit (mudita)

153

paramena cittada(mopa)samena samanygatam candrdityasambhsam


agnir 1 vidyu[t] .
[ya pa]
[b]uddh(a)[t](e)[jo] visisyate
srvakaganam [4] . . . . 154V4
[pa]riprnasamt()nambh(agava)[ta]scadharmasariram 2 tasyavistarenabuddhnusmrtau 3 vi[v]
c)
(pa)ksadvayam drstv
(1) ime 'trapacayah su[5]
(ami)
[v]ah
(2) [i](me s)[mr]tyupapattide[v]() ami visuddhideva4
(3) ime abhyudayikena5 sukhena sukh(i)n(a)h ami n[i]sr(a)ya[s.i] . . 6
(4) (i)me mahrhaprsdavimndhir[dh] [6] (ami)
(5) (i)me mahrhlamk()[r]lamkrt ami sramanlamkrlam(krth)
(6) im[e]7 isvarajana[g]
(ami)
(?) (ime)
[./]
(ami)

vom uersten Zhmen und Erloschensein des Geistes durchdrungen ist und der wie Mond
und Sonne leuchtet. Die Glut eines Buddha ist vorzglicher als Feuer-, Blitz-, .
[Dazu sieht er dessen] Jngerschar, die
seine Nachfolge verwirklicht, und [er sieht] des Erhabenen Leib der Lehre (in der)
ausfhrlich in der Meditation ber den Buddha (dargelegten Weise).
c) Indem er die Doppelseitigkeit

sieht:

(1) Diese [sind als solche, fr die die Frchte der in frheren Existenzen vollbrachten
guten Werke] jetzt reifen, (in eine) gute (Existenzform gelangt),
(jene) [sind]
. .;
(2) diese [sind] durch Achtsamkeit als Gtter erstanden,
jene [sind] Gtter durch [ihre] Lauterkeit;
(3) diese [sind] durch das vom Erfolg herrhrende Glck glcklich,
jene [sind] durch die Untersttzungen [des mnchischen Lebens]
;
(4) diese sitzen in groartigen Palsten und Schlssern,
(jene)
;
(5) diese [sind] mit groartigem Zierat geziert,
jene [sind] mit dem Zierat der Asketen geziert;
(6) diese [sind mit] Herrenmenschen,
(jene)
;
(7) (diese)
,
(jene)
;
1

Lies: agnil
Vgl. 165R1: (b)u(d)dh()srayesu dharmasariram drsyate]
bhbhir lokam spharitv t(isthamti).
2

tajjanmadharmasariranihsrtbhih pra-

3 S. unten, 165V3-R1.
4
Lies: devh\. Zu der Unterscheidung vgl. PTSD zu deva: "visuddhi0 (beings divine by purity, i. e.
of great religious merit or attainment like Arahants and Buddhas), and upapatti0 (being born divine,
i. e. in a heavenly state as one of the gatis, like bhumma-dev etc.)."
5
Lies: 'bhyudayikena.
6
Ergnzung unsicher. Die Untersttzungen bestehen im Tragen von Lumpengewndern, Essen von
Bettelspeise, Wohnen unter Bumen (vgl. 129R4, 159V5) und Einnehmen von Urin als einziger Arznei;
vgl. etwa HRTEL, Karmavcan, S. 87 f.
7
Lies: ima.

V5

V6

154R1

154

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(8) (i)me mahbht(a)[sa]matayopeth1 ami cittasamat(a)[y](ope)[t]2


154RZ
d) tato bhagavatah sarirt pra(vho nirgatah)
[2] . .
(rat)n(a)pusp(a)[v](arsam3 k)[]sm4 patatij te (ca) satv bhagavantam drsfcv samamtatah pradh[v](amti bhaga)v(a)tah pdayo 5 pranamya 6
nm
E3 bhagavm dharmam des(a)y(a)t(i)7
t(e) c(a) s(a[3]tvah)
(p)[r](a)[m]rth(i)kam ssanmj 8 sm[k]e(tikam)9 [c]vataramti srvakagunopetms ca drstv priti10
u(tpadyate |
e) anumodankras ca modamtu) bata satv iti| u
7.a)12 tato 'bhisekah
ra[4](tnapravhah pra)viliya mrdhn pravi(syra)yam prayati
13
prinayati ca hrdayc csya pravho ni(rgatya)
(a)[dh](a)s c(or)dhv(am) c(a)
14
15
R5 gatv ratnaprabhbhir lokam avabhsyam [5]
[k](r)amena sthitim praR4

{8) diese haben sich auf die gleiche Ebene mit den [vier materiellen] Elementen begeben,
jene haben sich auf die gleiche Ebene mit dem Geist begeben
d) Dann (geht) von dem Leib des Erhabenen (ein Strom aus),
fllt aus dem ther (ein Edelstein- und)
Blumen (regen). Die Wesen sehen den Erhabenen und laufen von ringsum herbei. Sie verneigen sich zu Fen des Erhabenen und
verkndet der Erhabene die Lehre.
Die (Wesen)
begreifen die der hchsten Wirklichkeit entsprechende und
die konventionelle Unterweisung. Indem [der Yogin] sieht, da sie die Qualitten von Jngern erlangt haben, (entsteht) [bei ihm] Beglckung.
e) [Seine] (Mitfreude hat den Aspekt: Freuen) frwahr sollen sich die Wesen.
7M) Dann die Besprengung: (Ein Edelsteinstrom) tritt zerschmelzend durch [sein] Haupt
ein und erfllt und beglckt [seine] (Gestalt). Der Strom (geht) von seinem Herzen (aus,
wird geteilt), geht abwrts und aufwrts, erleuchtet mit den Strahlen der Edelsteine die Welt
und
erfllt allmhlich [seinen] Standort.
1

mahbhtasamat wird Mvy. 1501 unter den sampatti genannt.


2 Lies: (ope)th\3
Vgl. pusparatnavarpam 128V4 usw.
4
Lies: (k)st (Einl. S. 20, Anm. 1). Vgl. 160R3: aksac ca tailadhrah patith.
5
Lies: pdayoh.
6
Vgl. 152V4: bhagavatpdayo pranamya.
7
Vgl. 149R6150V1: bhagavm
dharmam ca desayati te ca samvignh
bhaga(vata)h
pdayo patamti; 159V5: sarvasatv samvigns ca bhaga(vato 'ntike) gacchanti pravrajym api ycante\ bhagavms caihibhikukay pravrjayati.
8
Lies: sanam. Satzzeichen zu streichen.
9
Vgl. 166B2: smketikapramrthi(kam ssanam); 166V2: smketikena (ssan)e(na)
tadanamtaram p(ra)mrthika8ad(dh)arma . . .
10
Lies: pritir.
11 Vgl. 153R4 = 153R1; S. 151, Anm. 3.
12 154R3-5: Einl. S. 41.
13
Erg. vicchidyatei Vgl. 129R3/4: pravho
vicchidyate.
14 Vgl. 150R6: adhs cordhvam ca g(atv).
15
Lies avabhsy0.
16
Vgl. 165R24:abhi$ekakle . . . . (pravhah) . . . . (spharitv tistha)ti sa ca pravilinah tadsr(ayam)
murdhna cchidrena prayati
tata eva ca nihsrtai ratnapravhah darsanam datv
(kra)mena
yvat sahanabhini(h)s(rt)e(naprav)hena misri bhtah s(th)itim prayati. Anschlieend erscheinen auch
dort, ehe das Erwachen erfolgt (165R5), Buddhas und Tempel. Vgl. Einl. S. 45.

IX. Freudigkeit (mudit)

155

b) tatah simhsanjfdhijrudhh 1 anamtaparyamt bhagavamto buddhh prdu[r] (bhavamti) srvakaganaparivrt(b tamnili)srtais ca ratnapus(p)a(va)r(s)ai(fr)
[6] 154R6
2
. . .(angu)libhis (t)ebhya e[va]
(kt)grmtargata3 buddh
drsyamte| satvs ca ratna[pr](sdmtargat)[]h4 tadubhayesu [vai]
[i]
155V1
[ljokais ca buddhagunaprabhbhis cvabhsito loko5 buddh(s)[r](aye)
[2]
V2
6
c) (amte sarvam jneyam nbhym nirudh)[y](a)ta iti vyutthnain| ||

6) (Dann treten) in unendlichem Umkreis (auf Lwenthronen) sitzende erhabene Buddhas


in Erscheinung, umgeben von ihren Jngerscharen. Von den Edelstein- und Blumenregen,
die (aus diesen) hervorkommen, (wird die Welt berschttet)
mit den Fingern aus
diesen
erscheinen die Buddhas in (Edelstein)tempel eingegangen, und die
Wesen in Edelstein(palste eingegangen). In beiden
. . . und mit den Welten. Die von den Strahlen der Buddhaqualitten erleuchtete Welt (wird
in der Gestalt) des Buddha
c) (Am Ende wird alles zu Erkennende im Nabel zum Verschwinden gebracht). So [erfolgt] das Erwachen.
1

Lies: rdh. Vgl. 165V5: simhsandhirudh buddhh satvebhyo dharmam desayanti.


Erg. loko vyavakiryate. Vgl. 127V21 buddh drsyamte dharmam desayamtah tammukhanihsrtai
ratnapu$papadmavar$air
loko (vyava)k(i)ry(a)te; 131R3: grhitapadm buddhh yogcrsrayam
padmair vyavakiramti.
3
Lies: gata. Vgl. 127R5: lokadhtavah
ktgaraih pariprn drsyamte\ tadantargats ca buddh
bhagavamtah anekasatapariv(r)h.
4
Vgl. 158R4: ratnaprsadmtargatam.
5
Vgl. 146R4: buddh bhagavantah prabhbhir lokam avabhsya tithamtiti;
165R1: tajjanmadharmasariranih8rtbhih prabhbhir (Einl. S. 42).
6 Vgl. Einl. S. 53f. '
2

X. Gleichmut (upeksa)
Vorbemerkung
Der Begriff des Gleichmutes wird im Buddhismus nicht nur in der Reihe der Unermelichkeiten, sondern auch in der alten dhyna-Formel und in anderen Zusammenhngen verwendet;
dementsprechend hat die sptere Systematik mehrere Arten des Gleichmutes, im Pali zehn Formen*, zusammengestellt. Die Sarvstivdin-berlieferung2 nennt drei Formen des Gleichmutes:
1. Gleichmut gegenber der Empfindung" (vedanopeks)
2. ,,Gleichmut gegenber den Gestaltungskrften" (samskropeks)
3. ,,Gleichmut als Unermelichkeit" (apramnopeks). 3
Auch unser Text fhrt die bung nicht nur an Hand des zu erwartenden Gleichmutes als Unermelichkeit durch, sondern behandelt auch die anderen Arten des Gleichmutes mit. Statt der
drei sind in den Kolophonen sechs Formen angegeben:
1. Gleichmut gegenber den Sinnesobjekten" (visayopeks) 156V158V2;
2. Gleichmut gegenber der Empfindung" (vedayitopeks) 158V2-R5;
3. ,,Gleichmut gegenber der Lust am kindischen Lebenswandel" (blacaritaratyupeks)
158R5-159V6;
4. ,,Gleichmut gegenber den Gliedern des Werdens" (bhavmgopeks) 159V6-160V1;
5. Gleichmut gegenber der Einbildung einer Seele" (tmaparikalpopeks) 160V1161R1;
6. (Gleichmut als Unermelichkeit" (apramnopeks)) 161R1-163R.
In dieser Reihe, die eine wohldurchdachte Entwicklung vom Konkreten zum Abstrakten darstellt, entspricht das 2., 5. und 6. Glied den obigen drei Formen. Die Liste zeigt, da ein Verstndnis des Gleichmutes im Sinne einer Gleichgltigkeit gegenber dem Schicksal der Wesen
ausgeschlossen werden soll; eine solche Auffassung wird als Hartherzigkeit (nairghrnya) ausdrcklich verworfen.4 Dementsprechend werden die bungen in der Weise durchgefhrt, da der
Yogin jede Form des Gleichmutes zuerst fr sich selbst verwirklicht, um dann auch den Wesen,

Vism. S. 129, 156: (1) chalangupekkh, Gleichmut gegenber den sechs Gliedern [der das eigene
Selbst betreffenden Bereiche]'4; (2) brahmavihrupekkha, Gleichmut als Wandel in [der Welt] Brahmas"; (3) bojjhangupekkh, Gleichmut als Erleuchtungsglied"; (4) viriyupekkha, Gleichmut als
Energie"; (5) sankhrupekkh, Gleichmut gegenber den Gestaltungskrften"; (6) vedanupekkh,
Gleichmut gegenber der Empfindung"; (7) vipassanupekkha, Gleichmut als Durchschauen";
(8) tatramajjhattupekkha, Gleichmut als gegenwrtige Neutralitt"; (9) jhnupekkh, Gleichmut der
[dritten] Versenkungssphre"; (10) prisuddhiupekkh Gleichmut als Gelutertsein [in der vierten
Versenkungssphre]''.
2 AbhdhKVy. S. 129,23.
3
1. entspricht Pli (), 2. entspricht (5) und 3. Pli (2).
4
161V5.

X. Gleichmut (upeksa)

157

meist durch das Medium des Buddha, diesen Gleichmut zukommen zu lassen.1 In dem letzten Abschnitt (8.) wird das ttige Mitleid als Verpflichtung des Yogin ber den Gleichmut gestellt.2
muditsamanamtaram upeksa nird[is](t)[] (bhagavat|)3
La)

m. [v]
[3]
t tad ucyate (1) Irsyratipratipaksnamtaram4
kmar[ga](vypdapratipaksviskaranrtha)m[| (2) v.bh.g].manasi[k]()rnamta(ram) . .[4]
(3) . . . .[ya]vidhuraudbilynuklamanasikrnamta[ra]m5
(d)[y](o)tanrtham| tatprayoga dita evo . . [5]
ca mitrapaksam
mrdu 6 madhyam adhimtrm 7 c(mitram)8
sty ajatvt| yadsya taci. .m [samam] . . . . [6]
(u)peks nispann bhavati)
b)9 atha kimsva(bhv upeksa tad ucyate | alobhasvabhv s tu snupariva)r[t]
[sa](samprayog parigrhyam[i]n|)
(sraye kmadhtvsray) lambane kmadhtvlamban bhmi[t](ah saptabhaum| kmadhtau angamye catursu dhynesu dhynmtare ca|)
2
[2]
tah^upanibandhacetasah^yathokte
vati| tatra padmop(a)g(a).
[3]
14
ddhacetasah tatraiva dvram prdur bhavati15

p[r]stha[pr]dur bha (upani)[ba]-

V4
V5
V6

155R1

R2

12

tatr(a)

(Der Erhabene) hat gelehrt, da unmittelbar auf die Freudigkeit der Gleichmut [folgt].
1.3. (nicht bersetzt)

155V3

Der zweite Abschnitt der bungen, der fr die visionr geschauten Wesen die Erfllung des Meditationszieles bringt, wird ungefhr gleichbleibend mit folgender Formel eingeleitet: tato 'sya
satva8amudram abhimukhi bhavati\ sa tesm
upeksm upasamharati\ tadapeksadosanya tato bhagavn
utpadyate] Dann kommt [dem Yogin] das
Meer der Lebewesen zu gesicht. Er schafft diesen
Gleichmut gegenber
, um im Hinblick auf sie die Schuld zu tilgen: Es entsteht sodann der Erhabene
". In der bung des Gleichmutes gegenber der Empfindung entsteht an Stelle des Erhabenen ein Palast, in den die Wesen eingehen (158R2R5); in der des Gleichmutes gegenber den
Sinnesobjekten eine Frau (157R6-158V2).
2 Vgl. Einl. S. 55 f.
3
Vgl. 152R5: karunnamtara mudit(a n)irdist bhagavata.
4
Zusammenstellung der Hindernisse (pratipaksa) und der zu beherzigenden (manasikra) Dinge
s. oben, S. U6f.
5
Vgl. iks. S. 183,4ff. (Aksayamatistra): tatra katam mudit\
cittasya prmodyam kyasyaudbilyam buddheh sampraharsanam manasa utplavah\.
6
Lies: tnrdum.
7
Lies: adhimtrm.
8 Vgl. 147R6: mrdumadhyadhimtrm cmitram; 140V2 153V4; s. oben, S. 118 u. Anm. 1.
9 155V6-R1: Vgl. 139R6-140V1; 147R2-R4; 153V2-4; s. oben, S. 117.
10
Lies: prsthata.
11
Lies: upanibaddhacetaso.
12
Erg. (dvram).
13
Erg. puratat
14
Lies: cetasas tatraiva.
15
Vgl. 136V7: prsvebhyo dvaracatustayam apvrtam sambhavati\.

B3

18

155R4
B5
R6
156V1
V2

V3
V4
V5

V6

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

[mj.ktaprakhy1 buddhavapurdhrina2
[4]
t ctra nayamtayarnasamspars stri 3 utpadya[t](e|)
(u)pa[gu]hya tistha(ti|)
[5]
pattair anamtaparyamtaih satv 4 cchdyamte 5 patta
;
;. /
[6]
su satvm parasparopeksakim6 snigdharasa[p]. 7
"
' . . . ' . . . [2]
[]mnms
tannihsrtais ca navanltavarna(a)8
'
V
[2] . . . .
B
.
|
karunyfa dujhkhhi(ta)
(mu)[d]itys tadubhaynumodanena9 yuktah pu
. . [3]
(t)[y]gi|
tarn parebhyas tadupeksdosansya|i ato vi
[4] . .
(v)[isa]yopek(s|)
vedayitopeks|
blacaritaratyupe[k](s|
bhavmgopeks| tmaparikalpopeks|) u
[5]
(apram)[n](o)peksym yatho(k)t(a)sthnmtaresv anyatarnyatara upaniba(ddha)

3.a)
(u)t[padyat]e|

[6]
,
yain
[d](u)(ca)ritacrisv abahumtt 13 pratighah14
[2]
y.ti c(e)t(a)h du^c(a)r(i)t(a)crinm atltngatm pasya[t](i|)
!
1
[2]
[sa]tvm pasyati e[va]m (su)varnadurvarnnm| sadhann adhan(n|) . .
"
.....,!......
[3]
(vita)rgn| b(l)[]n ayitargn| sakkle^m niskle^n| a[c]

156B1
R2
R3

. . . . . . sami
R5
R6

h sarvasatv niskles drsyante| ktgrfs ca]


. [5]
[] utpadyamte|
tatra ca pravistn sarvasatvm . . . .
[6]
[te]| visayopekstriprakr 15 [k]i . . .[]

Vgl. 144R1/2: vajractilaktaprkhyo 'vati$thati\.


Vgl. 146R2: satv
tej(o)dhtusampann buddhavapurdhrino.
3
Lies: stry0. Vgl. 156V1 navanitavarnas . . .
4
Lies: satv ch.
5
Vgl. 158R4: satv
vaidryastamhhanihsrtaih pattai
-avacchdit drsyamte\.
6
Lies: ^opehsahamt Vgl. 159V6: satv
upeks(a)k8.
7
Vgl. 146V2: snigdhasuvarnarasam.
8
Vgl. 155R4: navanitavarna,8am8parsa stri.
9
Vgl. die Aspekte der Unermelichkeiten (oben, S. 117).
i Lies: tadapeksadosansya; vgl. 158V1, 158R3, 159V3, 159R5, 161V6; s. oben, S. 157, Anm. 1.
11
Zusammenstellung der sechs verschiedenen Formen des Gleichmutes; s. oben, S. 156.
12
Erg. zu: upaniba(ddhacetasah).
13
Lies: abahumnt.
14
Vgl. 158V6-, pratighas ca dri bhavati\.
15
Der Gleichmut gegenber den Objekten ist dreiartig, je nachdem, ob er sich auf erwnschte
(istavisaya 157 V59 V6), unerwnschte (anista 157R6) oder neutrale (madhyastha 157V1) Objekte bezieht.
2

X. Gleichmut (upeks)

st[a] utpadyate
) mo
[2]
prn candramandalahas(t)o3
pratikllambanbh4[3]
pasyatij tata

159

madhysthm i visay[m] d. [y].


(pratighas ca) [d]rl bhavati 2

ksiraparit[i]|
^ivis5nirdhvyamnm
i[s]. . . .
[4]
[y]. rpanadyah snehamirh pravi
[5]
he dh(ar)m[]nmmanodvraih
tni ca na-

157V1

V2
V3
V4
V5

ksatrn(i7 i)st(a)vis(a)[y]
.8
. . . . [6]
(ra)m(i)bhi9 visphulimgbhihioistV6
yisayn11 upahamti
caksurdvre[na]
[J] (rotradvrena)
(ghrnadvrena)
[j]ihvdv- 157R1
rena ksurnm| kyadvrena ^aktinmj12 nadya
[2]
B2
. . [p]i . . utpadyate tannihsrtbhih*3 ra^mi[bh]i[h^in](dr)i(y)[](n)[i]
[3]
(ra)B3
[smi]kalpam15 grhitv smrtini(mittam)
"....'
. ' . . . . [4]
[y](a)[bhi]muR4
khi bhavamti
yatandvrn[y]16 a
[a]nunaya^ ca dur(I)17 bh(a)v(a)t(i|)18

Lies: madhyasthm.
Vgl. 157B4: anunayas ca dur(i) bh(a)v(a)t(i\); 158V6: pratighas ca dri bhavati\.
3
Vgl. 159R5: bhagavmn
grMtacandramandaiah.
4
Lies: lamban.
5
Lies: iivism. Schlangen verkrpern die vier Elemente; vgl. Einl. S. 48, Anm. 2.
6
Erg. {rpnm caksurdvrena abdnm rotradvrena gandhnm ghrnadvrena rasnm
jihvdvrena sprstavynm kyadvrai)h. Zu den 12 Bereichen vgl. oben, S. 104.
7 Lies: nakatrn{i)st(af.
8
Erg. zu: (i)$t(a)vi$(a)y(adhipatirpni)? Vgl. 136V5-6: brahmabhih ra(tna)puspamuktanaksatrayatanacitaih
yathoktasubhanimittaya(tana)citam jagad;
147V2: naksatram maitrasayaparigrhitasya (adhi)patirpam.
9
Lies: (rai)m(i)bhir:
10
Lies: visphulimgbhir.
11
Lies: i$tavi?ayn.
12
Lies: aktinm\.
13 Lies: srtbhi.
*4 Lies: rasmibhir. Vgl. 169R2: maninihsrtais ca rasmibhir.
is Vgl. 118R2: rasmikalapa0.
16
Lies: yatana0.
17
Lies: dr(i).
is Vgl. 158V6: pratighas ca dri bhavati, Vgl. Vism. S. 264,96: patighnunayavpasamo tassa (sc.
2

upekkha8sa) sampatti, ,Die Vollendung [des Gleichmutes] besteht im Erlschen von Feindschaft und
Freundschaft''.

160

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

157B5

c) [5]
masya triprakrasya visayespe[k](s)i
[bha]vati| tato 'sya
R6 visayas[6]
nm anistesu dvisyamnm
tadubhaya.i
(visa)yopeksm
2
3
158V1 upa(samhara[i]ti tadapeksadosanya
ta)[t](ah) str(i) anamtapa(r)yamtm 4 darsam
grhitvaikaikasya satvasygratah 5 ti[s](thati|)
(visaye)V2 bhyah 6 upeksm pratilabhantef ya[2](th s)[up]arivritam caikaikam satvam paryamkena
nisannam pasyati| 7
iti visayopeksj
4. vedayi[t](o)[p](e)[ks]() [k](atar|)8
a)
(tripra)[k]()[r](y)[]h9 vedanyh1 adhipatirpam utpa[3](dya)te|
yathoktam vedanskandhapariksymA1 tatra duhkhsukhym^ vedany13 udakavarnam
budbudam u
(utpad)[y](a)t(e)i4 pasyatas csya^ upeks samtisthate
V4
b) duh[4]khym pldyamnasya dvesam utpadyate
tatrsytlt janmaparamparbhim(u)khii6bhava[t]i
[e] . .17
(duh)[khai]h pidithis ght(i)ts ca angat
V5 ca janmapa[5]ramparbhimukhi bhayatij dvesasamudcradosadarsant ksiptsivisdisu19

V3

4. (Was ist Gleichmut) gegenber der Empfindung?


a)
entsteht die Verkrperung der (dreiartigen) Empfindung: Wie
oben bei der Betrachtung der Gruppe Empfindung erwhnt, (entsteht) hier fr die leidvolle
und die glckliche Empfindung eine Blase von der Farbe des Wassers
Sieht [der Yogin] diese, berkommt ihn Gleichmut.
b) Wird [der Yogin] von einer leidvollen [Empfindung] gepeinigt, entsteht [bei ihm] Ha.
Dabei kommt ihm die Aufeinanderfolge seiner vergangenen Existenzen zu gesicht. (Damals)
[wurden] (Wesen auf seine Veranlassung) von Leiden gepeinigt und erschlagen. Auch die
Aufeinanderfolge seiner zuknftigen Existenzen kommt ihm zu gesicht; durch die Schau der
1

Vgl. 156R6: visayopeks tripraJcr.


2 Vgl. 158R3, 159V3, 159R4, 161V6; s. oben, S. 157, Anm. 1.
3
Lies: stry0.
'* Lies: pa(r)yamtam.
5
Lies: dgratas.
0
Lies: (visaye)bhya.
7
Vgl. 159V6: satv pary(am)k(e)n(a) n(i)s(a)nn upeks(a)ks tisthamti\ blacaritaradhy(u)pek(s)a ||.
8
Vgl. etwa 160V1: tmaparikalpopeksa katam\ ; 159V6: bhavmgopeksa katar\.
Lies: r(y).
10
Lies: vedany. Wie die Objekte, ist auch die Empfindung dreiartig, leidvoll (duhkha), glcklich
(sukha) oder neutral (madhyastha). Nach einer vorbereitenden Vision (a) wendet sich die Betrachtung
zuerst der leidvollen (6), dann der glcklichen Empfindung (c) zu.
11 S. oben, 132V3-4; 132R4-6 (S. 00).
12
Lies: duhkhasukhym.
13
Lies: vedanym.
Einl. S. 49.
15
Lies: cdsyopeks.
16
Vgl. 158V6\ tatrdtitm (janmaparampar)m abhimukhi karoti; 159V1: anamtaparyamtm janmaparamparm.
17
Erg. zu: (tatrn)e(na), vgl. 158R1: tatrnena
duscarita samutthapitam.
18
Lies: pida. Vgl. 162R5: (n)nduhkhapidh.
19
Lies: sivis0. Vgl. 159V1: evam anamtaparyamtm janmaparamparm apyesv ksipt(m) pasyati.

X. Gleichmut (upeks)

161

drstv [c](sya)
(jparddhahiafnjgata.t].
[a]m [d]osah i[t](i) duh[6]khym vedanym 2 upeks samtisthate pratighasca drl bha- 158V6
vati| 3 tatkrtas ca doso vy[va]r(tat)[e]
c) (sukhym vedanym sukhitasya rga ut)padyate| 4 tatrtitm (janmaparampar)m
abhimukhl [1] karoti 5 tatrnena sukhvedansvdavas6 duscarita7 samutthpitam apyesu 158R1
duh[kh](am anubhtam | ) 8
(prava)rtamnm 9 c.
d. . . [ks](a)nam lo rdlivam a[2]navasthyinim pasyati drstv csya sukhym vedanym
R2
upeks samtisthati 11 nispari[d]
d) . .
[y], satvasamudram abhimukhi12 bha[v](a)[3]ti sa tesm vedayitopeksm upasamharati| 13 tadapeksadosansya tato vaidryastambh(a)m(a)h(p)[r](sda14utpadyate) yatra te satv triprakrasya15vedayitdhyava[4](s)-

Schuld [seines] ha [erfllten] Benehmens zu Schlangen usw. gestoen. Indem er dies sieht,
berkommt ihn bei dem Gedanken '
(eigene)
Verfehlung [ist] die Schuld zuknftiger
' der leidvollen Empfindung gegenber Gleichmut. Die Feindschaft weicht, und die aus ihr resultierende Schuld wendet sich ab.
c) (Wird [der Yogin] von einer glcklichen Empfindung beglckt), entsteht [bei ihm]
(Leidenschaft). Dabei stellt er sich (die Aufeinanderfolge) [seiner] vergangenen (Existenzen)
vor Augen. Damals hatte er infolge des Genusses glcklicher Empfindungen schlechten
Lebenswandel aufkommen lassen und hat [demzufolge] in schlechten Lebensrumen Leid
(empfunden)
sieht er die
sich entwickeln
[und]
aufwrts [als] unbestndig. Indem er dies sieht, berkommt ihn der
glcklichen Empfindung gegenber Gleichmut
,
d)
kommt [dem Yogin] das Meer
der Lebewesen zu gesicht. Er schafft diesen Gleichmut der Empfindung gegenber, um im
Hinblick auf sie die Schuld zu tilgen: (Es entsteht) sodann ein groer (Palast) mit glsernen
Sulen, in welchem die Wesen die Misere des sich Entscheidens fr die dreiartige Empfindung

Lies: raddho 'nagata0.


Lies: vedanym u.
3 Vgl. S. 159, Anm. 18.
4
Vgl. 158V34: duhkhaym pidyamnasya dvesam utpadyate; 132R6: (sukhym bu)dbudesu strimukhni drsyamte rgasydhipatirupam\. Vgl. auch YS. II, 78: sukhnusayi rgah duhkhnusayi
dvesah.
5
Vgl. 158V4: tatrsytit janmaparamparbhim(u)khi bhavati.
6
Lies: sukhavedansvdavad.
7
Lies: du&caritam.
8
Vgl. 159V1: duscaritam samutthpitam apyesu ca duhkham anubhtam.
9
Vgl. 160R6: pravartamnam pasyati.
10
Lies: nam rdhvam.
11
Vgl. 158V6: duhkhaym vedanym upeks samtisthate.
12
Lies: abhimukhi.
13 Vgl. 156V3, 158V1, 159V3, 161V6; s. oben, S. 157, Anm. 1.
14
Vgl. 126V2: prsdam utpadyate\ vai$ryastambhadhritam\ ; 154R6: satvs ca ratnapr(sdamtargat)h.
is S. oben, S. 160, Anm. 10.
2

11

Schlingloff, Yogalehrbuch

E3
R4

162

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

[jnasydinavm * drstv kramasah 2 upeks 3 pratilabhante tata eva ca vaidryastambhanihsrtaih pattai 4 ta[d]v(arnai ca ktg)[r]air avacchdit drsyamte| 5 ratnaprsdmtargatam 6
158R5 [5] (veda)[yi]tam triprakram pariksamnm 7 drsyamte
iti vedayitopeks| ]|

E6
159V1
V2
V3

5. blacariratyupeksa8 kata(r) |
a)
(abhimu)khi 9 bhavati| iliajnmikam anyajtmikam10
1X
[6]
(ihajanman)[i] maithuuayuddhakarananiriksanbhiratah anyajanmani ca
[I], . . [na] vais[v]bhtena12 rgadvesa[2]mohavasd duscaritam samutthpitam apyesu ca duhkham anubhtam 13 evam anamtaparyamtm janmaparamparm apyesv ksipt(m) pasyati
tato
(hriava)trpyadhipatirpam14 utpadyate a[2](vad)tvastraprvrt stri purusas ca15 hri 16
klesebhyo lajjati
avatrpyam duscaritebhyah
hri 1 dus[car]i[t]e[bhyah
ava](trpya)m
(du)[s](c)[ar]i[tapha]l(t)I d(r)st(v) csya par hri 17 utpadyatef blacaritara[3]tibhya^ copeks samtisthatej
sehen und schrittweise Gleichmut erlangen. Dann erscheinen sie von Seidentchern, die aus
den glsernen Sulen hervorkommen und von (Tempeln in derselben Farbe) berdeckt. Sie
erscheinen, in den Edelsteinpalast eingegangen, die dreiartige Empfindung betrachtend.
Soweit der Gleichmut gegenber der Empfindung.
5. Was ist Gleichmut gegenber der Lust am kindischen Lebenswandel?
a) {Hier) kommt [dem Yogin] {die Aufeinanderfolge seiner vergangenen Existenzen) zu
gesicht. {Er sieht [seinen] Lebenswandel) hinsichtlich [seiner] jetzigen und [seinen] anderen
Existenzen: (in der jetzigen Existenz) Lust am Geschlechtsgenu und am Beobachten von
Kampfhandlungen; in einer anderen Existenz
hatte er mit
infolge von Leidenschaft, Ha
und Verblendung schlechten Lebenswandel aufkommen lassen und hat [demzufolge] in
schlechten Lebensrumen Leid empfunden. So sieht er in unendlichem Umkreis die Aufeinanderfolge seiner Existenzen in schlechte Lebensrume gestoen. Dann entsteht als Verkrperung (der Scham) und des Scheuseins eine mit weiem Gewand bekleidete Frau und
ein Mann. Die Scham schmt sich der Befleckungen und das Scheusein des schlechten Lebenswandels; die Scham des schlechten Lebenswandels und (das Scheusein) der Frucht des
schlechten Lebenswandels. Indem er dies sieht, entsteht bei ihm grte Scham, und gegenber der Lust am kindischen Lebenswandel berkommt ihn Gleichmut.
1
2

Lies: dinavam.

Lies: kramaia.
Lies: upeksm.
4
Lies: pattais. Vgl. 155R5: pattair
satva cchadyamte.
5
Vgl. 153R6: (satvm)
ratnaktgrair ivopagudhm pasyati.
6
Lies: gat ?
7
Lies: pariksamn ?
8
Lies: blacaritaratyupeks.
9
Erg. zu: (tatrsytitajanmaparampardbhimu)khi; vgl. 158V4.
10
Lies: jnmikam.
11
Erg. (ca caritam pa4yati\)1
12
Der Sinn ist mir unverstndlich.
13 Yg\. 158R1: tatrdnena sukhvedansvdavasa duscarita samutthpitam apyesu duhkh(am anubhtam\).
14
Lies: (hryava)trpydhipatirpam.
15
17
Einl. S. 49.
16 Lies: hrih.
Lies: hrir.
3

X. Gleichmut (upeksa)

6) tato 'sya blacaritakrida . . . . (satvasamudramabhimukhibhavati|


sa tesm blaca1
ritarat)yupeksm upasamharati tadapeksdosan[^](sya
ta)[t]o bhagavans utpadyate
159V4
tamnihsrtais clok[ai](h sat)[v]() av(a)[bh](si)[t]()[ti]3 .r.[v]-4
(upe)ksm pratilabhamte sarvasatv 5 samvigns ca bhaga[5](vato 'ntike) [gacchjantie praV5
vrajym api ycante| bhagavms caihibhiksukay pravrjayati7 te pravrajit niskless
vrksamlesu 9 kutikmiopith^ [t]fi*2 [pun]a13 [6] satv14pary(am)k(e)V6
n(a) n(i)[s](a)[n]n[ u]p[e]ks(a)ks tisthamti| 15
blacaritaradhy(u)pek(s)16 ||
6. [bh]avmgo[p]ek[s]a17
a) pratit[y](asamutpdam

katarj
18

pariksa)[m]ansya19 dvdasmgam pratityasamutpdacakram

b) Dann (kommt) [dem Yogin] (das in) der Verspieltheit des kindischen Lebenswandels
(befangene Meer der Lebewesen zu gesicht. Er) schafft (diesen) Gleichmut (gegenber der
Lust am kindischen Lebenswandel, um) im Hinblick auf sie die Schuld zu tilgen: Es entsteht
sodann der Erhabene. (Die Wesen, erleuchtet) durch den Lichtschein, der aus diesem hervorkommt,
erlangen Gleichmut. Alle Wesen treten
bestrzt (vor) den Erhabenen und bitten um Aufnahme [in den Orden]. Der Erhabene
nimmt sie mit der Komm-als-Mnch-Formel auf. Aufgenommen werden sie frei von den
Befleckungen,
und nehmen Htten an Baumwurzeln ein.
Weiterhin verweilen die Wesen im Ruhesitz sitzend als Gleichmtige.
Soweit der Gleichmut gegenber der Lust am kindischen Lebenswandel.
6. Was ist Gleichmut gegenber den Gliedern des Werdens ?
a) (Betrachtet) [der Yogin] (das Entstehen) in Abhngigkeit, kommt ihm das zwlf1 Lies: <>ape1c?aQ. Vgl. 158V2, 158R3, 159R4, 16IV6; s. oben, S. 157, Anm. 1.
2
Lies: bhagavn.
3
Vgl. 151R4: (bhagavantam)
(pa)syati\ tamnihsrtair lokair lokam avabhsitam pasya(ti).
4
Lesung unsicher.
5
Lies: satvh.
6
Vgl. 149R6/150V1: te ca samvignh
bhaga(vata)h pdayo patamti\ ; 154R2: te (ca) satv
bhagavantam drstv samamtatah pradhv(amti bhaga)v(a)tah pdayo pranamya.
7
Diese lteste Ordinationsweise, die nur der Erhabene persnlich durchfhren kann, wird ausfhrlich etwa folgendermaen beschrieben: tato yena bhagavms tenmjalim pranamya bhagavantam idam
avocan: 'labhema vayam, bhadanta, svkhyte dharmavinaye pravrajym upasampadam bhiksubhvam;
carema vayam bhagavato 'ntike brahmacaryam.' tatas te bhagavat ehibhiksukay
bhsith: 'eta
bhiksava, car ata brahmacaryam1 iti. bhagavato vcvasne mundh samvrtth samghtiprvrth usw.
(Divy. S. 48,15ff.). Vgl. auch HRTEL, Karmavcan, S. 58.
8
Vgl. 156R4: sarvasatv niskles drsyante.
9 Vgl. 129R4: sthitis ca vrksapariprn drsyate
tammlanisann bhiksavo dhtuprayogam bhvayamti.
10
Lies: kutikn.
Einl. S. 54.
12 Lies: te.
13
Lies: punah.
14
Lies: satvh.
15 Vgl. 161V3: (stri) paryamkena nisann upeksdhipatirpam.
i Lies: raty(u)pek(s).
17
Lies: opeks.
18
Lies: pratity(a).
19
Lies: mnasya.
11*

164

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

159R1 [i] (samsk)rasmtnikam traidhtukam karmaklesvabaddham bhramamtam abhimukhl


bhav(a)t(i)1
drstv csya [v]ai[mukhya](m) [u](tpadyate|
tatah simhsandhi)rudh2
3
jl2 astau buddhapratimh rystmga[s]ya (m[2]rgasydhipati)[r]pam utpadyate| 4
tammukh(a)n(i)hsrt(ai)r5 (i)ndryudh(ai)[r av]i[dy]dhipatirpam abhyha(tam) [n]irudhyate6
R3 [v]i(cak)ri (bhavati ca dvda)s(m)ga(m) pratityasamutpda[cak]r(am7
)[k]([3]sanibhaih) [kjtgrai 'vastabhyamte 8 yogcrsraya upa[r]
I . . .e
harn csya tasmim samaye)9 cittam bhavati10
j$4
b) tato [4] fsya dv)[d]asmgap(r)atityasamutpdacakrakrtam parasparak(armaklesvabaddham 11 satvasamudram abhimukhl bhavati| 12 sa tesm) [bh](a)[v]mgopeksam13 upaR5 samharati tadape[5](ksa)[dosan]sya[14 tato bhagavmn 15 utpadyate| grhltacandramandalah tatraik(ai)k(a)[s](a)h satvnm [e]sa eva16 par(i)ks() kr(a)[m](a)[s](ah)
.
ji
[e].[]m utpadyate| tato bhagavmmukh[6]nihsrtair17 indryudhair vajrkrai48
gliedrige Rad des Entstehens in Abhngigkeit zu gesicht; eine ununterbrochene Fortsetzung
(der Gestaltungskrfte) verursachend, weltlich, umwunden von der Tatbefleckung sich
drehend. Indem er dies sieht, (entsteht) bei ihm Widerwille. (Dann) entstehen die Abbilder
von acht (auf Lwenthronen) sitzenden Buddhas als Verkrperung des edlen achtgliedrigen
[Heilsjweges. Von den Regenbogen, die aus deren Munde hervorkommen, zerschlagen, wird
die Verkrperung des Nichtwissens zum Verschwinden gebracht und das zwlfgliedrige
Rad des Entstehens in Abhngigkeit verliert seinen Radcharakter. Die Gestalt des Yogin
wird von (thergleichen) Tempeln zum Erstarren gebracht
ist sein Geist zu dieser Zeit.
6) Dann (kommt) [dem Yogin] das aus dem zwlf gliedrige n Rad des Entstehens in Abhngigkeit resultierende, von der jeweiligen (Tatbefleckung umwundene Meer der Lebewesen zu gesicht. Er) schafft (diesen) Gleichmut gegenber den Gliedern des Werdens, um
im Hinblick auf sie die Schuld zu tilgen: Es entsteht sodann der Erhabene, eine Mondscheibe
tragend. Hierbei entsteht im einzelnen eben diese Betrachtung fr die Wesen schrittweise
Von den Regenbogen mit dem Aspekt von Diamanten,
die aus dem Munde des Erhabenen hervorkommen, weggeschlagen, werden dann alle Ver1

Vgl. 139R1: (samska)rasamtanikam dvdasgam prati(tyasamutpdacakram).


Lies: rdh. Vgl. 162V2\ cat(vro buddhapratimh) s(i)mhasandhirdha; 165V5: simhsandhirudh buddhh.
3
Lies: pratim.
4
Lies: utpadyamte.
5
Vgl. 127V2-, buddh
tammukhanihsrtai ratnapuspapadmavarsair
loko (vyava)k(i)ry(a)te\.
6 Einl. S. 51.
7
Vgl. unten, R6,u. 139V3/4: avidydhi(pa)t(i)rp(ni p)(ra)yamti vicakri bhavati ca dvdasamgah
pratitya(samutp)d(a)c(a)kr(a)h.
8
Lies: ktgrair avastabhyate.
9
Satzzeichen zu streichen.
10 Vgl. 125V4: sntam tasmim samaye ci(tta)m (bhavati).
11
Vgl. 159R1: pratityasamutpdacakram
karmaklesvabaddham.
12
Geringe Spuren der ergnzten Aksaras sind als Abdruck auf dem folgenden Blatt (160V) lesbar.
13
Lies: opeksm.
14
Vgl. 156V3, 158V1, 158R3, 16IV6; s. oben, S. 157, Anm. 1.
15
Lies: bhagavn.
16
Lies: esaiva.
17
Lies: bhagavammukha0.
18
Lies: kraih. Vgl. Einl. S. 47, Anm. 1.
2

X. Gleichmut (upeksa)

165

sarvvidydhipatirupni1 parhatni nirudhyamte| vicakri bhavantij sarvasatvnam 2 (dvdasmgapratityasamut)[p]dacak(r)h 3


tathaiva cksani[l]bhaih ktgrair avastabhya- 160V1
(m)te|*
iti bhagavmgopeks|5
7. tmaparikalpopeksa6 katamj
a)1 ihsya saddhtupariksnuklrtham goghtakah 8 grhita[sa](stra utpadyate| sa gm
vadhayi)[2]tv9 taccarmani sad bilm10 bhgasah pratyaveksate| tato yogino nbhymn
sastra i2 nirgacchati| yoginas csrayam sad bilm13 bhgasah14 taccarmany avasth(payati |)
(1)
is
prthividhtuie [3] sthirataratvt)
(2) vmam| bdhtuh17 durbalataratvt|
(3) daksino bhuh18 vyudhtuh sthirataratvt|
(4) vmas tejodhtuh
(t)[j
t]e[4]naiva ca kranena
vmaprsvasyinm19 slghrataram jiryate
krperungen des Nichtwissens zum Verschwinden gebracht und fr alle Wesen verlieren
(die zwlfgliedrigen) Rder des Entstehens (in Abhngigkeit) ihren Radcharakter. [Die
Wesen] werden ebenfalls von thergleichen Tempeln zum Erstarren gebracht.
Soweit der Gleichmut gegenber den Gliedern des Werdens.
7. Was ist Gleichmut gegenber der Einbildung einer Seele?
a) Hier (entsteht) zum Zwecke seiner den sechs Elementen angemessenen Betrachtung
ein Rinderschlchter, der (ein Messer) trgt. (Dieser schlachtet ein Rind) und schaut die
sechs Stcke auf dessen Haut gesondert an. Dann geht von dem Nabel des Yogin ein Messer
aus und trennt die Gestalt des Yogin in sechs gesonderte Teile auf seiner Haut:
(1) (Das rechte)
[stellt] durch sein Pestersein das Element Erde [dar],
(2) und das linke durch sein Schwchersein das Element Wasser;
(3) der rechte Arm [stellt] durch sein Festersein das Element Wind [dar],
(4) und der linke durch sein
das Element
Glut; durch eben diese Veranlassung verfllt [dieser] bei den auf der linken Seite Liegenden
schneller;
1

Lies: rpni.
Lies: satvnm.
3 Zu 159R6 vgl. 159R1-3; 139V3-4. Zu %ak(r)ah statt ^cakrni s. Einl. S. 21.
4 Einl. S. 45.
5
ga ist nachtrglich durchgestrichen. Vgl. Einl. S. 15, Anm. 1.
6
Lies: opeks.
7 160V1-2: Einl. S. 28.
8
Lies: goghtako.
9
Vgl. D. II, S. 294: goghtako
gvim vadhitv; Siks. S. 210: gm hatv.
10 Lies: bilm. Vgl. aber 160R1: %ilni. D. II, S. 294: bilaso pativibhajitv.
11
Lies: nbhyh.
12
Lies: astrarn.
13
Lies: bilm
14
Lies: bhgasas.
15
Erg. daksinam.
1(3
Lies: dhtuh.
17
Lies: vmam abdhtur.
is Lies: bahur. Vgl. 165V'36, wo ebenfalls Erscheinungen auf bestimmte Krperteile lokalisiert
werden: (daksi)ne bhupradese
cibuke,
19
Lies: sayinm.
2

V2
V3

V4

166

160V5

V6
160R1
R2

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(5) madhyamam gandam ksadhtuh susirataratvtl1


(6) sakalam mukham vijn[]n(a)dh()t(o)h
[5]yapravrtteh
b) tato yogcrsrayanihsrtni sastrni tadvad e(va saddh)[tu]vibhgena krtsnam satvasamudram avasthpayanti
asatvkhyam ca pam[cadh]tuvibhgena2
(hast)[]3
(bhym ekai)[6]kasas tm dhtus tulayati| 4 te samam tulyamte
tatah kathaya(ti | ayam
a)pi prthividhtur ayam api prthividhtuh ayam apy bdhtur 5 evam [y](vad vijfinadhtuh| ayam apy [l]tm)[]tmiyavirahitah 6 ayam apy tmtmiyavirahitah tat[o]
ya saddhtu dbilni? nirvidgnin jvalamti tadanye ca satv
(sa[2]rvasatv)[sa]tvkhyni saddhtumandalny avasisyamte
tato bhaga(so8 ha)[s]t()[bh]y[m] satvkhyms csatvkhyms ca tulayati| 9 ayam api prthiv(i)dh()tur (i)ty [e]vamdi prvavat|

c) [tata](h saddhtu)[3]mandalaihi0 lokam prnam pasyati ksc ca tailadhrah1A patith


sarvni mandalni kampayati12 abhisamksipyamte ca
tni [y]
i
R4
[4]yamukt nasyamn drsyamte|
R3

(5) der mittlere [Teil der] Wange [stellt] durch sein Ausgehhltersein das Element ther
[dar],
(6) und der ganze Mund durch sein sich Entwickeln
des Elementes Bewutsein.
b) Ebenso trennen dann Messer, die aus der Gestalt des Yogin hervorkommen, das gesamte Meer der Lebewesen durch Zerlegen in die (sechs) Elemente, und das Unbelebte durch
Zerlegen in die fnf Elemente. (Mit beiden Hnden) prft er die Elemente im einzelnen,
[und dann] werden diese zusammen geprft. Dann spricht er: ,,(Dies) ist das Element Erde,
und auch dies ist das Element Erde; dies ist das Element Wasser", und so weiter (bis zu
dem Element Bewutsein: ,,Dies) ist ohne (Seele) und Seelisches, und auch dies ist ohne
Seele und Seelisches." Dann
brennen die (sechs) Stcke, [die die] sechs Elemente [darstellen], im Feuer [seines] Abscheues. Die anderen Wesen
bleiben [nur] die (alles Belebte und Un)belebte [umfassenden] Kreise der sechs Elemente brig. Dann prft er gesondert mit beiden Hnden Belebtes
und Unbelebtes: ,,Dies ist das Element Erde", usw., wie oben.
c) Dann sieht er die Welt von den Kreisen (der sechs Elemente) erfllt. Aus dem ther
fallen lgsse; alle Kreise erbeben und werden zusammengeworfen. Diese
erscheinen sie von
frei und zunichte werdend.
1

Vgl. 128R6: aksadhatuh caksuhsausirydinm; Einl. S. 48, Anm. 3.


Vgl. 160R2: satvkhyms csatvkhyms ca; s. oben, S. 85.
3
Lies: dhtm.
4
Vgl. 160R2: bhaga(so ha)st()bhym
tulayati.
5
Lies: bdhtur.
G
Lies: virahito 'yam.
7
Lies: sa#; vgl. 160V2: sad bilm.
8
Lies: bhga(so).
9
Vgl. 160V5/6: (hast)(bhym ekai)kasas tm dhtus tulayati\.
10
Lies: mandalair.
11
Lies: dhrh. Vgl. 118V4: tailadhr(bhih sim)cyamnam.
12
Lies: kampayamty.
2

X. Gleichmut (upeksa)

167

d) tato Mndubhyah saddhtumayam srayam nirvartate pradlpahast ca strl prajndhipatirupam1 pr(an)[s](i)t(a)m ()sray(am) suny(am2 tmtmiyavirahi)[<5]tam3 dhtumtra- 160R5
kam idam iti praksayatij tatra camtah 4 rsiyogensiti krimikulasahasrni drsyamte| 5 evam caturottaram 6 rogasatam mahbhtsivisaparip(rna)7
[6]rnm 8 dvre
R
9
dvre ca skandhapamcakam pravartamnam pasyati
tadadhipatirupni skandhaprayoge
vibhaktni10 evam sarvasatvm praksayati
e) tatah sarvasatvsa[t]v(khya) . . . A1
[ijktam12 pasyati[ sa evam vic(i)- 161V1
13
14
trasamskragatm hetupratyaydhmam tmtmiyaviraMtam gatipamcake bhramantam 15
susiksitanatam iva vicitrm vesavisesm kurvantam pasyati drstv csya samsk[2]resV2
peks16 utpadyate tato 'sya sphadikamayairabhraktaihkyamavastabhyate| 17 muhrtc
19
ca sphadikaktgrnmtargatam18 tmnam pasya[ti]
(a)vadtavarn2o
d) Dann entwickelt sich aus Tropfen eine Gestalt aus den sechs Elementen. Eine Frau mit
einer Lampe in der Hand als Verkrperung der Erkenntnis offenbart: ,,Vernichtet ist die
Gestalt, leer, (ohne Seele und Seelisches), lediglich aus Elementen bestehend/' Dabei erscheinen im Innern durch den Yoga ,,Masse" achtzigtausend Wurmarten. Ebenso sieht er
die hundert und vier Krankheiten, und, angefllt mit den Schlangen, [die die vier] groen
Substanzen [darstellen], die
, und [sieht, wie] sich an jedem Tor
die Fnfzahl der Gruppen entwickelt. Deren Verkrperungen sind in der bung der Gruppen
dargelegt. Ebenso offenbart [die Frau] alle Wesen.
e) Dann sieht [der Yogin] die alles Belebte und Unbelebte [umfassende] (Welt frei von)
Er sieht sie durch mannigfache Gestaltungskrfte bewegt, von Grund und
Ursache abhngig, ohne Seele und Seelisches, sich in den fnf Existenzformen drehend, wie
ein gebter Tnzer mannigfache besondere Kleidungen anlegend. Indem er dies sieht, entsteht bei ihm den Gestaltungskrften gegenber Gleichmut. Dann wird sein Krper von
Wolkenhaufen aus Bergkristall zum Erstarren gebracht. Alsbald sieht er sich selbst in einen
bergkristallnen Tempel eingegangen. (Dann) tritt (in [seinem] Herzen) eine weifarbene, mit
1

Lies: ^rpam. Einl. S. 50.


Lies: dny(am).
3
Vgl. 130V6: sunyam tm(Xt(m)%yavirahi(tam).
4
Lies: cmt.
5
Einl. S. 29.
6
Lies: caturuttaram. Vgl. 148V3: srirais caturuttarais catur(bh)i(h) rogasataih.
7 Vgl. Einl. S. 48, Anm. 2.
8
Lies: ornam1
9
Lies: rpni10 Oben, 132V2-133V6.
11
Erg. zu: satv(khyam lokam). Vgl. 130V1: krtsnam lokam satvsatvkhyam.
12
Erg. zu: (mu)ktaml
13
Lies: gatam. Vgl. 133V3: vicitrm samskragatam.
14
tu unter der Zeile eingefgt.
15
Vgl. 150V2: pamcagatikam
bhramyamnam; 159R1: pratityasamutpdacakram
traidhtukam karmaklesavabaddham bhramamtam.
16
Lies: peksotpadyate.
*7 Einl. S. 34, S. 44, S. 54.
18
Lies: ktgrmtargatam.
19 Erg. (tato hrdaye strl); vgl. 148V4: hrdaye strl su(varna)bh(a) av(a)d(a)tastrapravrta utpadyate] ;
153R3: (hr)day 'sya s(uva)rnbha strl pramuditotpadyate] ; 162V3: a(ksava)r(na) h(r)daye strl s(u)varnbh nilavas(trapr,vrt).
20
Lies: varnvadta.
2

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

16IV3 ava[S]dtavastraprvrt paryamkena nisannnbhogvasthit1 upeksdhipatirpam2 sambhavati|


V4 /) tato 'synbhogvasthitasya
[I] . . [4] evam udakasamksobhah3 agnisamksobhah4 vyusamksobhah4 yathsamvartanisu 5 evam s[v]a[jan]V5 (m)a[v]i[n]sam6 am(t)e
[5]m.
7
8
9
[m](ai)tr[]nusrena| upeks samtisthato| n nairghrnyadost|
10
g) evam csyopeksakasya viharatah s
(sa
11
V6 tesm tmaparikalpopeksm upa)[6]samharati| tadapeksadosansyaj
tadupasamhrahetos ca bhagavn utpadyasvasariranih(srtaih)12
161B1 . . . .
(te)[2]s(m) t(a)th(ai)vopeks samtisthate
sphadikamayais ca13
abhraktair avast(abh)[y](amte|) tathaiva sphadikamaya(k)(tgr)

weiem Gewand bekleidete (Frau) im Ruhesitz sitzend und entspannt verharrend als Verkrperung des Gleichmutes in Erscheinung.
/) Verharrt [der Yogin] dann entspannt,
; ebenso das Erschttern [der Erde] durch das Wasser, dessen Erschttern durch
das Feuer und dessen Erschttern durch den Wind in den jeweiligen Weltvernichtungsperioden; ebenso das Zunichtewerden seiner eigenen Existenz [und] am Ende
berkommt ihn, der
Gte folgend, Gleichmut; nicht [aber] von der Hartherzigkeit her, [die eine] Schuld [ist].
g) Wandelt so [der Yogin] gleichmtig, (kommt ihm das . . . .
Meer der Lebewesen zu gesicht. Er) schafft (diesen Gleichmut gegenber der Einbildung einer Seele), um
im Hinblick auf sie die Schuld zu tilgen. Um dessen Schaffung willen entsteht der Erhabene
und mit den aus seinem eigenen Leib hervorkommenden
berkommt [die Wesen] ebenfalls
Gleichmut. Sie werden von Wolkenhaufen aus Bergkristall zum Erstarren gebracht. (Er
sieht die Wesen) ebenfalls (in Tempel) aus Bergkristall (eingegangen).
1
2

Lies: sthitopeks.

Einl. S. 50, Anm. 2.


Lies: Jcsobho *gni.
4
Lies: ksobho.
5
Vgl. 125R6: (sam)vartanym iva krtsnam lokam visiryamtam pasyati. Vgl. Siks. S. 246,7ff. (Pitrputrasamgama): bhavati, rttahrja, sa samayo yadyam lokah samvartate. tadeyam rnahprthivi agnin v
dahyate, 'dbhir v klidyate vyun v vikiryate; Es gibt, o Groknig, eine Zeit, in der die Welt vernichtet wird. Dann verbrennt diese groe Erde im Feuer oder verfault im Wasser oder verweht im
Wind." Vgl. auch Mvy. 82858287: tejahsamvartani, apsamvartani, vyusamvartani, Vernichtung im
Feuer, im Wasser, im Wind."
6
Lesung unsicher.
7
Satzzeichen zu streichen. Lies: sre?iopeks.
8
Lies: na.
9 S. oben, S. 156.
10
Erg. (satvasamudram abhimukhi bhavati).
11 Vgl. 156V3, 158V7, 159V3, 158R3; s. oben, S. 157, Anm. 1.
12
Vgl. 154R1: tato bhagavatah sarirt pra(vho nirgatah).
13 Lies: cbhra^.
14 Erg. zu: (k)(tgrmtargatm satvm pasyati]). Vgl. 161V12: drstv csya samskrespeks utpadyate tato 'sya sphadikamayair abhraktaih kyam avastabhyate\ muhrtc ca sphadikaktgrnmtargatam tmnam pasyati (Einl. S. 54).
3

X. Gleichmut (upeksa)

169

a)
[2].ai . .m
[bhajgavatparinirvnam abhimukhi bhavati 161R2
vajrasailam i[va va]na[ka]mpane dharmnusri
(nirvnapu)[3]rastham ca bha(gavantam dhrm)y[](m) ganB3
dikm 2 kotayamtam pasyati sa sabdah anamta 3 lokadhtun 4 ()pflr(a)[y](a)t(i) s. . . . .
'...'.
[4]m iti ghosa[y](a)[t](i
sr)R4
5
[va]knm nirvnapurapravesaklam scayati|
tato yvas tasya bhagavatah parivrah
tbhyah 6 t
(di)[5]so7 'namtaparyamtah pusparaR5
tnamayah prdur bhavati yatrdhirdh drsyamtej tato nirvnapuram pravisat vaidrybhahs dauvrikah puruso [v]
[kajthayatiha9 na[ga][6]re yah pravisto
E6
10
na bhyo nirgac^hatiti) te ca pravisth ksamayair ivbhraktair avastabdhh pradlp iva
smyamte11 si
6) (tata) [](s)[r](a)ye balavaisradyveni[i]kasmrtyupasthnamahk^run[dh]i(patir)- 162V1
[p]ni12 drsyamte
8. (Was ist Gleichmut als Unermelichkeit?)
a)
kommt [dem Yogin] das vllige Verlschen des Erhabenen zu gesicht: Wie ein Diamantfels beim Erbeben des Waldes, der
Lehre folgend
sieht er den (in der Stadt des Verlschens) stehenden (Erhabenen) den Gong
(der Lehre) anschlagen. Der Ton erfllt unendliche Weltregionen und lt fr alle Wesen
ertnen:
. . .", und kndigt fr die Jnger die Zeit des Eintretens in die Stadt des Verlschens an.
Dann tritt, soweit das Gefolge des Erhabenen [reicht], von
(nach den zehn Richtungen) in unendlichem Umkreis aus Blumen und Edelsteinen in Erscheinung, worauf sitzend [die Jnger] erscheinen. Dann [wird] von dem in die
Stadt des Verlschens Eintretenden ein glsern leuchtender, das Tor bewachender Mann
spricht [dieser]: ,,Wer hier in [diese] Stadt eingetreten ist,
geht nie mehr heraus/' Indem [die Jnger] eintreten, werden sie gleichsam von therischen
Wolkenhaufen zum Erstarren gebracht und kommen wie Lampen zum Erlschen
b) (Dann) erscheinen in [seiner] Gestalt die Verkrperungen (1) der Krfte, (2) der Klugheiten, (3) der [fr Buddhas] charakteristischen Anwendungsbereiche der Achtsamkeit und
(4) des Groen Mitleids:
1

Erg. (apramnopeks katar). Vgl. (apram)n(o)pek$ym 156V5; s. oben, S. 156.


"The gandi
is a long, symmetrically shaped, piece of wood, whence sounds are produced by
striking it with a short club, also of wood" (F. W. Thomas: A new Poem of Asvaghosa, JBAS 1914,
S. 753).
3
Lies: idbdo 'namtm.
4
Lies: dhtn.
5
Lies: yvat.
6
Lies: vras tbhyas.
7
Erg. zu: (daadi)So1
8 Lies: bho.
9
Lies: kathayati\ iha.
10
Lies: pravist.
11
Vgl. 162R3: pradipa ivopasamam gaccha(ti\) (Einl. S. 45).
12
Diese Verkrperungen der Eigenschaften eines Buddha werden in hnlichem Wortlaut auch in der
Meditation ber den Buddha, unten 165V4-V6, beschrieben; vgl. S. 173, Anm. 6.
2

170

162V2

V3

V4
V5

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(l) 1 t(at)r(a balnm raviman)[dala]cit dasa hastinah


tadvarn 2 tadadhirdh ravima3
ndalacith eva dasa buddhapratimh yath[2]svabalagocaram lokinvastabhya4 t(i)sth(am)t[i]
(2) Yaisradynm ca[t](vro buddhapratimb) [s](i)[m]hsandliir[]dh5 svam svam gocaram lokenvabhsya [ti](sthamti|
(3) traynm aveniknm smrtyupasth)[3]nanm6 grhltatailaptryudhs trayah [p](urush | 7
(4) mahkar)[u](ny)[h8 ](ksava)[r](n) [h](r)daye strl s(u)varnbh nllava[s](traprvrt) 9
(ratna)[4]puspavarsaih10 lokam prayati
c) ta(to mahkarujfn]11 gun anamtaparyamt[] bh(a)[g](avads)[r](aye12d)r[s]y(am)t(e)|
sr()vakn ()[d](i)ty(a)mandaldh(i)r[](dhm)i3 f]
[5]p(u)rus
amtargat trsyamntej14
asaiksadharmdhi[p](a)t(i)[r](pam)
[g] u ?15
nm adhipatirpam asu(bh)dlnm drsyamte|
(2) Hierbei [erscheinen als Verkrperung] (der) [zehn] (Krfte) zehn (mit Sonnenscheiben) besetzte Elefanten und auf ihnen sitzend in derselben Farbe und ebenso mit
Sonnenscheiben besetzt die Abbilder von zehn Buddhas, die mit [ihrem] Lichtschein den
jeweiligen Wirkungsbereich der ihnen eigenen Kraft zum Erstarren bringen;
(2) [als Verkrperung] der [vier] K l u g h e i t e n (die Abbilder von vier) auf Lwenthronen
sitzenden Buddhas, die mit [ihrem] Lichtschein jeweils ihren eigenen Wirkungsbereich erleuchten ;
(3) [als Verkrperung] (der drei [fr Buddhas] charakteristischen Anwendungsbereiche der Achtsamkeit) drei (Mnner), die lschalen und Waffen tragen;
(4) [als Verkrperung] (des Groen Mitleides) [erscheint] in [seinem] Herzen eine goldleuchtende Frau (von therischer Farbe) und mit einem blauen Gewand (bekleidet),
und die die Welt mit Regen aus Blumen und Edelsteinen
erfllt.
c) Dann erscheinen in unendlichem Umkreis die Qualitten (des Groen Mitleides in der
Gestalt des Erhabenen). [Seine] auf Sonnenscheiben sitzenden Jnger
erscheinen [darin] eingegangene Mnner als Verkrperung der Eigenschaften
eines Vollendeten
erscheinen als Verkrperung der Qualitten
. . . [der bung] der Hlichkeiten usw.
1 (i) und (2): Einl. S. 50 f.
2
Lies: varns.
3
Lies: cit.
4
Lies: aloken0.
5
Lies: dhirdhh.
6
Lies: 0(sth)n7iam.
7 Vgl. Einl. S. 49.
8
L i e s : (nya) . V g l . 165V6: mahakarunay
ksavarna strl hrdaye . . . .
9
Sonst i m m e r : avadatavastraprvrt.
V g l . E i n l . S. 4 3 .
10
Lies: var$air.
11
Ergnzung unsicher.
12
Ergnzung unsicher. Vgl. 162R1: bhagavadsraye.
13
Zwischen den Aksaras n() und [cf](*) ist eine Lcke von etwa iy 2 Aksaras, deren Ergnzung mir
unerklrlich ist. Vielleicht war dieser Raum einer Unebenheit der Rinde wegen unbeschrieben geblieben.
14
Lies: drsyante.
15
Vgl. 166V3: asubhadiprayogena.

X. Gleichmut (upek$a)
2
d) tato bhagavatah1 hrdaye ratnamayah sim(ha)
[6] . . . . [najyena sacar- 162V6
3
caro loka kso(bhyam)(nah)
rasmayo nihsrth satvm vicayam krtv
tatraiva ca pravisamti
e) avadtavarn ca stri 4 avad[ta](vastr mahka[2]ru)[n]()dh(i)patirupam|5 bhagavad- 162R1
sra[y]e (d)r(syate|)
ddh 6 kryam nistirn pratijn| parisampt vaineyh
santam nirvnam iti
/) 7 tato bhagavm g(thm bhsate|
anity) [2] bata samskr utpdavyayadharminah
B2
[u](tpadya hi nirudhyamte tesm) [v]yupasamah sukham| 8
ity uktv ni(rv)nanagare pravisyksanibhair abhrakter 9 ivopagdh[y]()m
[3]lsi10 pradipa ivopasamam gaccha^il^bhagavata)^ ca] srvakh pasct pari(n)ir(v)(na)
R3
.
ram 12 pravi[s](t) . . . . [opasama]m13 [ga](ccha)m(ti|)14

d) Dann (entsteht) im Herzen des Erhabenen ein Lwe aus Edelsteinen,


wird die Welt samt Beweglichem und Unbeweglichem erschttert und
kommen Strahlen hervor, die die Sichtung der Wesen vornehmen und dann ebendort
eintreten.
e) Eine weifarbene Frau mit einem weien (Gewand erscheint) als Verkrperung des
(Groen Mitleides) in der Gestalt des Erhabenen, (und spricht: Vollbracht ist) die Tat, erfllt ist das Versprechen; erfat sind die Bekehrungsfhigen, ruhevoll ist das Verlschen."
/) Dann (spricht) der Erhabene die Strophe:
(Unbestndig) frwahr sind die Gestaltungskrfte,
dem Gesetz des Entstehens und Vergehens unterworfen:
(sie entstehen und werden zum Verschwinden gebracht;
[nur] ihr) Erlschen ist Glck."
Wenn er so gesprochen hat, tritt er in die Stadt des Verlschens ein und kommt, an der gleichsam von thergleichen Wolkenhaufen umhllten (Sttte nichts mehr) begehrend, wie eine
Lampe zum Erlschen. Auch die Jnger (des Erhabenen) treten anschlieend, (in der Zeit)
[ihres] vlligen Verlschens, in (die Stadt des Verlschens) ein und (kommen ebenso) zum Erlschen.
1

Lies: bhagavato.
Erg. (utpadyate). Vgl. 130V2: nbhisthn(m)tare ca ratnamayam simhamukham utpadyat(e).
3
Lies: lokah.
4
Lies: stry0.
5
Lies: rpam. Satzzeichen zu streichen. Vgl. 165V6: mahdkaruntiy ksavarn slri hfdaye;
162V3: (mahkar)u(nya)h (kasava)r(n) h(r)daye strl s(u)varnabha nilavas(trapravrta).
6
Lies: ddham ? Erg. zu: (kathayati ca\ si)ddham ?
7 162R2-163V1: Einl. S. 55.
8
In MPS 44, 5 (S. 398) wird diese Strophe bei dem Parinirvna des Erhabenen von Gott Sakra
gesprochen.
9
Lies: Qktair.
IO Erg. zu: sihitym anabhi)l(Xsl.
" Einl. S. 45.
12
Erg. zu: pari(n)ir(v)(nakle nirvnapu)rarn.
13
Erg. zu: pravi$(t)(s tathaiv)opasamam.
14
Vgl. 161R6: te (sc. srvakh) ca pravistah aksamayair ivbhraktair avastabdhh pradipa iva
smyamte.
2

j[72

162R4
R5
R6

163V1
V2
V3-6
163R1

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(dau^jvrikena 1 pratisidhyate| yad tv(am)


2
(ta)d tvam apy atra praveksyasiti[ krtsnam
3
(dr)[5]syate|
evam apyasthnm bandhanaba[d](dh) (n)[n]duhkhapidith4
kathayanti ca paritryasva kruniksmm nrhasi [p](arinirvnanaga)[r](am5 gantum|
mahkar)[u](ndhipa)[6]tirupam6 csya yathoktam
7
hrdaya [u](tpadyate|) [hjastbhym ca ta
(u)[ts](r)jya duhkhi8
tm kva gamtum icchasiti] tasyopeks dribhavati| (ka)runvakramati| 9 sa bhubhym
[1] (krtsnam satvasam)[ud]r(am) sv(a)ja(m)n a[m]
[du]hkhs tejastino10 s a r [ v a ] . . . .
[2] . . (laksa)nnuvyamjanavirjit(a)11
g)

(Lcke von V3 bis V6; ca. 250 Aks.)


(misri)[i]bhtahi2yvadvyuma[n]da(lam)13[bh](i)tv()[dh](as) c(ordhvam ca gatv)

14

R2

[2] brahmahrda-

yesu cvadtavarn . . . ,15


R3-6
(Lcke von R3 bis R6\ ca. 210 Aks.)
manasik(r)o
g) (Der ihnen nachfolgende Yogin aber) wird von dem Torwchter zurckgehalten: Wenn
du
; dann wirst auch du hier eintreten.4'
Das gesamte (Meer der Lebewesen) erscheint
Auch die in
schlechten Existenzformen Lebenden, die von Fesseln Gebundenen und die von verschiedenem
Leid Gepeinigten. [Diese]
und sprechen: Errette uns, o Mitleidsvoller; nicht ziemt es sich fr dich, (zur Stadt des vlligen Verlschens zu gehen)/' In
[seinem] Herzen (entsteht) die oben erwhnte Verkrperung (des Groen Mitleides. [Diese]
fat ihn) bei den Hnden (und spricht): Wohin wolltest du gehen, die Leidenden im Stiche
lassend?" Der Gleichmut weicht von ihm; Mitleid berkommt ihn. Mit [seinen] beiden Armen
umschlingt er (das gesamte Meer der Lebewesen) und
(Ende nicht bersetzt)
1

Vgl. 161R5: nirvnapuram


vaidrybhah dauvrikah puruso.
Erg. satvasamudram.
3
Lies: Qsthna1
4
Vgl. 158V4: (duh)khaih pidith ght(i)ts ca.
5
Vgl. ni(rv)nanagare 162R3.
6
Lies: rpam. Vgl. 162V6R1: avadtavarn ca stri avadta(vastr mahkaru)n(a)dh(i)patirupa?n\
bhagavadsraye (d)r(syate\).
7
Erg. zu :ta(m anugrhya kathayati\). Vgl. 165V: mahkaruny ksavarn stri hrdaye
(anugra)henai(va)
8
Einl. S. 50.
9
Vgl. 148R4: tesu karunm avakrmati.
10
Lies: tejasvinah,
11
Vgl. 130R6: amte sarvam nirudhyate akasi bhavati ca lokah tata upasamasukhatn anubhavati asrayo
lak$annuvyamjanavirjita utpadyate].
12
Lies: bhto. Vgl. 129R3: punar bhrumadhyd ekah pravho nirgacchati dvitiyo nabhy misribhtarn prathivi spharitva tisthati; 165R34: pravahah
sahanabhini(h)s(rt)e(na prav)hena misribhtah s(th)itim prayati.
13
Vgl. 135R3: (yva)d vyumandalam bhitv u. a.
14
Vgl. 150R6: adhs cordhvam ca g(atv).
15
Erg. strlt avadtavarn ist nur in Verbindung mit etn belegt.
2

XI. Meditationen ber den Buddha, die Lehre, die Gemeinde, die Tugend
und die Gottheiten (buddha-, dharma-, sarngha-, sila-, devatnusmrti)
Vorbemerkung
In den kanonischen Texten wird eine aus sechs Gliedern bestehende Meditationsreihe berliefert: Meditation ber den Buddha (buddhnusmrti), ber die Lehre (dharmnusmrti), die
Gemeinde (samghnusmrti), die Tugend (silnusmrti), die Entsagung (tygnusmrti) und ber
die Gottheiten (devatnusmrti).1 Spter wurde diese Reihe noch um die vier Meditationen ber
den Tod, den Krper, die Atmung und das Erlschen erweitert.2 Die Meditation ber die Entsagung steht in einigen Texten vor3, in anderen nach der Meditation ber die Tugend1*; in unserem
Text scheint sie entweder ganz zu fehlen, oder sie wird erst nach der Meditation ber die Gottheiten behandelt.
Die bungen werden nach einem gleichen Schema durchgefhrt, das entsprechend der jeweiligen
Meditation inhaltlich variiert wird. Jede der fnf bungen vollzieht sich in vier Stufen:
a) Der Yogin meditiert zuerst ber die Aspekte seines Objektes, deren berlieferte Reihen^
vollstndig oder auszugsweise zitiert werden.
b) Dann tritt das Meditationsobjekt selbst durch Bilder und Verkrperungen vor Augen des
Yogin: der Buddha wird in seinem Lebensweg vergegenwrtigt, die Lehre wird den Irrlehren der
Sekten gegenber als alleinseligmachend erlebt und, wie die Gemeinde und die Tugend, in Verkrperungen6 geschaut.

1 Pli D. I l l , S. 250; usw./ Skt. Sang. VI, 21; usw.


2 Pli A. I, 30; usw.; erklart Vism. 189ff.; Skt. SsP. S. 1443,6ff.
3 LV. S. 31,18ff.; Dhs. LIV.
4 Im Pli und Skt. Sang. VI, 21; Mvy. 1149-54.
s Pli D. II, S. 93f.; usw.; Skt. Sahgitipryya zu Sang. VI, 21. In Vism. S. 162ff. bilden die Aspekte,
die ausfhrlich erklrt werden, den eigentlichen Inhalt der Meditationen.
6
Eine Gegenberstellung der Kategorien und ihrer Verkrperungen in der Meditation ber den
Buddha und ber die Lehre ergibt folgendes Bild :
buddhnusmrti (165V4-V6; vgl. 162V1-V4):
Fnf Krfte (bala)
Vier Klugheiten (vaisradya)
Drei charakteristische Anwendungsbereiche
der Achtsamkeit (avenikni smrtyupasthnni)
Das Groe Mitleid (mahkarun)

fnf Buddhas auf weien Elefanten.


vier predigende Buddhas auf Lwenthronen.
drei waffentragende Mnner mit lschalen.
eine Frau von therischer Farbe.

dharmnusmrti (166V3-B1):
>ie zur Erleuchtung fhrenden Faktoren (bodhipaksya):
Vier Anwendungsbereiche der Achtsamvier Buddhas, die das Lwengebrll ertnen
keit (smrtyupasthna)
lassen.
Vier rechte Anstrengungen (sarnyakprahna)
?

174

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

c) Der Meditationsvorgang wird sodann durch eine Emanationsreihe versinnbildlicht: Eine


glserne Frau trgt lschalen1, in diesen sind Diamantthrone, darauf Sonnenscheiben, darauf
Buddhas und die Verkrperungen des Meditationsobjektes. Wie diese Erscheinungen vom
Krper des Yogin ausgegangen waren, treten sie wieder in diesen ein.
d) Als Zeichen des Erfolges2 gehen leuchtende Strme von dem Yogin aus und erfllen seinen
Standort. Dann wird alles zum Verschwinden gebracht und der Yogin erwacht.
1. (buddhnusmrtih katar 13
a) i)[h]ryasrvakas tathg(atam kratah samanusmarati | 4
[1] iti hi sa bha)gavms
tathgato 5[r]h(am) sa(myaksambuddho vidycaranasampannab sugato lokavid anu)[tt](a)rah purusa(damyasrathih sst devamanusynm b)[u]ddho bhagaynj
V2
b) tasyaiv(am) t(a[2]thgatam kratak) [samanusmarajtah

164V1

V3 . .

[3]

1. (Was ist Meditation ber den Buddha?)


a) Hier (meditiert) der edle Jnger ber den Tathgata (nach dessen Aspekten: Der)
Erhabene [ist] der Tathgata, der Heilige, (vllig Erleuchtete, in Weisheit und Wandel
Vollkommene, der Wohlgegangene, der Weltenkenner, der unvergleichliche Lenker der zu
erziehenden) Mnner, (Lehrer von Gttern und Menschen), Buddha der Erhabene/'
b) Indem er so (ber den Tathgata nach dessen Aspekten) meditiert,

Vier Machtstufen (rddhipda)


Fnf Fhigkeiten (indriya)
Fnf Krfte (bala)
Sieben Erleuchtungsglieder (bodhyamga)

vier glserne Treppen.


?
fnf Elefanten aus Diamant.
sieben Buddhas, auf ihren Huptern sieben
Sonnenscheiben, auf diesen sieben
Der achtgliedrige Weg (astmgo margah)
?
Als Kategorien der Meditation ber die Gemeinde werden verschiedene Arten des Zustandekommens
(sampad) aufgezhlt, die aber, ebenso wie ihre Verkrperungen, nicht erhalten sind.
1

Das l symbolisiert die Achtsamkeit (smrti); die Frau verkrpert also die Meditation. Vgl. oben,
S. 49, Anm. 5.
2
Die Strme vermitteln die Besprengung; vgl. abhisekalle 165R2; abhisekapravh(h) 166R5; zu
dem Begriff abhiseka vgl. Einl. S. 41 f.
3
Vgl. 165R5: dharmanu(sm)r(tih kata)rd; 166R6: samghnusmrtih katar;
167RS: sildnusmrti
katar.
4
Die an zahllosen Stellen wiedergegebene Zehnnamensreihe" des Buddha (vgl. LUDERS, Dasanmaka, ZDMG 92, S. 15-27) wird hufig als Meditationsgrundlage angefhrt; vgl. Divy. S. 196,22ff.:
athnyatamo bhiksuh syhnasamaye keSanakhastpe sarvngaih pranipatya taihgatam kratah samanusmaramS cittam abhiprasdayati: ity api sa bhagavms tathgato Whan usw.; WALDSCHMIDT, Bruchstcke buddhistischer Stras, S. 49 (Dhvajgrastra): mm yyam tasmim samaya kratah samanusmarata\ iti hi sa bhagavm yvad buddho bhagavm]; Hs. 906 (s. Einl. S. 26, Anm. 2), Blatt 40: [V7] katham
buddham krata sa(manusmara)[Rl]ti\ iti hi sa bhagavms tath(gatah samya)[H2]ksambuddho vidycaranasampannah (s)ugat(o) l(oka)[J&3]vid anuttara purusadamyasrathe sst (d)e(va)[H4:]manusynm
buddho bhagavm\ evam buddham kra[R5]ta samanusmarati\.

XI. Meditation ber den Buddha (buddhanusmrti)

175

[4]

t(a)h suva(r)nar[p]y(a)vaidrya- 164V4


[ta]dvarnai2 buddhasra[y](ai)3
[5]
(prthi)vlm prayaV5
nti| vajrsanam ca tata e[va]
bhagavn yvad aghanisthm . .
".
[6]
'. . .
V6
. . bodhisatvm4 dau bodhipranidhnam
(anut)[ta]ram dnasilaTiryapra[jii]5
[1]
164R1
6
7
v(a)t[i]
yvat tusitabhavan cyava[m]
(m)[t]u kuksisamprajnaniskramanam s [d]uskaracarya9
[2] . . . .
R2
[spha]dikam

Gold, Silber, Glas, Bergkristall,


mit Buddhagestalten in diesen Farben
erfllen sie (die Erde). Ein Diamantthron
der Erhabene bis hin zu den Aghanistha-[Gttern]
(sieht) [der
Yogin] den Bodhisatva am Anfang [seiner Laufbahn] das Gelbde zur Erleuchtung [abiegen],
[sieht seine] unvergleichliche Freigebigkeit, Tugend,
Energie und Erkenntnis [in seinen Existenzen als Bodhisatva],
(Saphir und Smaragd)

, bis zu [seinem] Herausfallen aus der Behausung der Tusita-[Gtter],


. . . [sein] bewutes Heraustreten aus dem Mutterleib, [sein] asketisches Leben,

Erg. zu: sphadikam(v^ragalvsmagarbha). Die Reihe ist in buddhistischen Texten hufig belegt;
Stellenbelege vgl. BHSD.
2
Lies: Harnair,
3
Lies: buddhsray(ai).
4
Lies: satvam.
5
Lies: virya. Die vier Eigenschaften gehren der Reihe der sechs Pramits (dna, sila, ksnti,
virya, dhyna, prajn) an.
6
Lies: bhavanc. Vgl. Mv. II, S. 1,1: tuitabhavanto cyavanaklasamaye; M. I l l , S. 120: sato
sampajno bodhisatto tusit ky cavitv mtu kucchim okkami; weitere Parallelen bei LUDERS, Bharhut
S. 45f.
7
Lies: (ma)tuh.
8
Vgl. Mv. II, S. 20,10: bodhiatvo smrto sarnprajno mtaram abdhayamno daksinaprsvena prdur
bhavati.
9 Lies: ^car^m*! <>carya ist belegt Mvy. 6679, LV. S. 36. Vgl. Mv. II, S. 237,17: atha bodhisatvam dni uruvilvayam tapovane nady nairamjanys tire duskaracrikm carantam.

176

164R3

E4
R5
R6
165V1

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

[kj.vinayanam1 bibasravinayanam2 u[pa](tisyakolitavina)yanam pitrvinayanam mahpratihryam 4 ma[h]


[3] . .
[t]i| yva[t] 5 (par)i[n]irvnakle6 sthavi[r](am7 )nam[d]am mamtraya[t]i( |
p)r(aj)[n](pa)[y]nam[da ya](ma)kaslayo(r8 amtarenottarsirsam
10
mamca[4]m
adya tathgatasya r)try()h 9 m(a)dhy(a)m(e yme)
(niru)padhise u ni(r)v()na(dhtau pari)nirvnam (bhavisyatiti|)
[5]
[pa]rivrtam
yvan mall()
(ayodr)[on](y)[a]h12 citm [bh]
[6]
(ra)tnamayaih k(u)m(bh)aihi3
[d]evaga(n)
(de)[v]s tej[o]
[1]
3

, die Bekehrung
(der Gruppe der fnf Mnche), die Bekehrung des Bimbasra, die Bekehrung des Upatisya
und des Kolita, die Bekehrung [seines] Vaters, das Groe Wunder, das groe
, bis dahin, wo er in
der Zeit seines vlligen Verlschens den ltesten nanda anredet: ,,Bereite mir, nanda,
(zwischen) den Slabaumpaaren (eine Lagerstatt mit dem Haupte nach Norden; heute wird
in der) mittleren (Wache) der Nacht,
, (das vllige) Verlschen
(des Tathgata) in der erlsten (Region) des Verlschens (stattfinden)",
umgeben, bis dahin, wo die
Mallas
. die [beiden] (eisernen) Sarg[hlften]
den Scheiterhaufen
mit Urnen aus Edelsteinen. Die Gtterscharen
die Gtter Glut
1
Erg. zu: (pamcakabhi)k(su)vinayanamti Der Bekehrung des Bimbasra geht die Bekehrung des
Urubilvaksyapa voraus; die Ergnzung (kasya)p(a) ist jedoch nicht mglich; das zerstrte Aksara
kann nur k, n oder t sein.
2
Lies: bimbasra.
3
Zu diesen Bekehrungen vgl. vor allem CPS, 2728.
4
Lies: prtihryam. Vgl. LDERS, Bharhut, S. 62ff.; s. auch Einl. S. 31, Anm. 2.
5
164R3-R4 ist ein wrtliches Zitat aus MPS 32.5-6 (S. 294) (zitiert auch Av. II, S. 197,6) u. BAILEY,
Khotanese Texts V 251.
6
MPS (erg. nach dem Tib.): (klasamaya); ebenso Av. u. Khot.
7
MPS: (yusmantam). Im Mahparinirvnastra wird nanda immer als yusmn angeredet; in
einem Vers (30.20) aber auch als sthavira bezeichnet.
8
MPS: (tath)gatasyntarena yamakaslayor uttar0. Zur Schreibung sla (statt sla) vgl. WALDSCHMIDT, Mahparinirvnastra I, S. 30, Anm. 5 (zu Hs. 360): ,,Lies: dlavane\. sla ist die bliche
Schreibung der Handschrift. Auf eine stndige Verbesserung ist im Folgenden verzichtet."
9
Lies: (ra)try().
10
Die Lcke ist mir unerklrlich. Vielleicht war der Raum einer Unebenheit des Materiales wegen
unbeschrieben belassen.
11
Lies: (niru)padhisese. Ergnzt nach 151V6 und 151R3: nirupadhisese nirvnadhtau. MPS (nach
17.21, 22.12, 23.2): ('nupadhisese); Av.: nirupadhisese.
12
Lies: (dr)on(y)as. Vgl. MPS 49.1 (S. 424): (atha kausingar mall bhagavatah sariram
tailapariprnym ayodronym praksipynyayyodrony pracchdya sarvaga)ndhaksthais citm citv prajvlayitukm.
13
Vgl. MPS 49.26: atha kausingar malls tny asthini sauvarne kumbhe praksipya.

XI. Meditation ber den Buddha (buddhanusmrti)

r[d]isa pryamte|

(ma)[n]usynm yogcrasya ca h[]n(r)th(a)


v. . . .y. . . suvarnasarsa(pa)
,
[gh]ais ca prthivl prneti|

177

(catu)[2]

c) punar buddhnusmrtiprvam mrdhn(opanibaddha)[c]i[t](t)a[s](y)a1[v]ai(dryamay)[i]


stri snehaparip[]rnavaid[r](yabhjanacitotpadyate|)
[<3]bh()[j](a)n(e)su vajrsana 2
vajrsanesv dityamandalni| tesu buddh bhagavamtah 3 [l](ak)[s]
yh 4 dha
(1) (daksi)[4]ne bhupradese5 pamca sveta6 gaj dityamandalacitasrayh7
tadadhirudhh8 pamca (buddh)
(balnm adhipatirpam(|)9[5]

fr die Menschen, und fr den


Yogin zum Aufgeben
werden die (vier) Richtungen erfllt
goldene Senfkrner
und von
ist die Erde erfllt.
c) (Konzentriert) [der Yogin] weiterhin [seinen] Geist unter der Voraussetzung der Meditation ber den Buddha auf das Haupt, (entsteht) eine Frau (aus Glas, die) mit lgefllten
glsernen (Schalen besetzt ist); in den Schalen [entstehen] Diamantthrone, auf den Diamantthronen Sonnenscheiben und auf diesen erhabene Buddhas, (deren Gestalten mit den [Buddha]malen und Nebenmerkmalen prangen)
:
(1) In der Umgegend [seines] (rechten) Armes [erscheinen] fnf weie Elefanten, deren Gestalten mit Sonnenscheiben besetzt sind und auf diesen sitzend fnf (Buddhas in derselben
Farbe und ebenso mit Sonnenscheiben besetzt als Verkrperung der fnf K r f t e ) ;

Lesung und Ergnzung sind unsicher. In den Paralleldarstellungen dient das Herz als Konzentrationspunkt; vgl. 169R3: (si)lnu(smrti)prvam hrdayopanibaddhacetasah vaiduryamayi stri snehahpariprnvaidryabhjanacittotpadyate. In unserer Darstellung geht die Emanationsreihe aber auch
nicht, wie in den Paralleldarstellungen, am Ende der bung in den Nabel, sondern in das Haupt des
Yogin (yogcramrdhani 165R2) ein.
2
Lies: vajrsanni.
3
Lies: bhagavamto.
4
Erg. zu: l(ak)s(annuvyamjanavirjitsra)yh.Ygl. 140V6: laksannuvyamjanavir()jit buddh(a);
140R6: srayo laksannuvyamjanavirjita.
5
Der rechte Arm wird als der krftigere vorgestellt; vgl. 160V3: daksino bhuh vyudhatuh sthirataratvt.
6
Lies: svet. Vgl. 125Vo: saddam(ta)h sveto gajah.
7
Lies: citsrayh.
8 Lies: Qrdhah.
9
Erg. zu: pamca (buddhs tadvarn dityamandalacit eva pamcnni balnm adhipatirpam\).
Vgl. 162V1: (balnm raviman)dalacit dasa hastinah tadvarn tadadhirdh ravimandalacith eva dasa
buddhapratimh. Die Nennung von nur fnf Krften statt der als Eigenschaften eines Buddha sonst
immer genannten zehn ist ein aufflliger Fehler, der wohl durch die fnf Krfte bei den bodhipaksy
(vgl. 166V5/6: (pamcnm balnm) pamca vajramay hastin(ah)) verursacht wurde, die freilich ihrem
Inhalt nach eine ganz andere Bedeutung haben.
12 Schlingloff, Yogalehrbuch

165V2

V3

V4
V5

178

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(2) cibuke caj1 catvri ratnamandalni|


tadamtargath simhsandhirudh2 buddhh
satvebhyo dharmam desayanti (vais)[]radynm adhi(patirpam | 3
165V6 (3) a)v(e)n(i)kn()m [s](m)[r]tyupasth()nn(m) tr(a)y(a) [6] tr(a)yah* purus grhltyudhs tailabhjanahasta5 drsya(nt)[e]|6
(4) mahkaruny ksavarn stri7 hrday[e]
(anu165R1 gra)henai
[2] . .
. . . . (b)[u](d)dh()srayesu dharmasariram8 drsyate|
tajjanmadharma[sa]riranihsrtbhih
prabhbhir9 lokam spharitv t(isthamti| 10
R2
tato buddh bhagavamta dityama)nd(a)lesu pravisamti( | tni va)[2]jrsanesu
tni
bhjanesu tni smrtinimittesu smrtinimittam yogcramrdhani)u
12
d) abhisekakle [te]
[t]i13 sa ca pravilinah
14
R3 tad[sr](ayam) [3] murdhna [568V6]^ c[ch]idrena prayati tata eva canihsrtai ratnapravhah*6 darsanam datv lal(t)[]
[568V7] (kra)(2) an [seinem] Kinn [erscheinen] vier Edelsteinkreise und darin eingegangen auf Lwenthronen sitzende Buddhas, die den Wesen die Lehre verknden, als Verkrperung der Klugheiten;
(3) [als Verkrperung] der [fr Buddhas] charakteristischen Anwendungsbereiche
der Achtsamkeit erscheinen drei waffentragende Mnner mit lschalen in der Hand;
(4) [als Verkrperung] des Groen Mitleides [erscheint] in [seinem] Herzen eine Frau
von therischer Farbe
durch Gunstbezeigung
(Dann) erscheint in den Gestalten der Buddhas der Leib der Lehre. Mit den Strahlen, die
aus ihrem natrlichen und aus ihrem Leib der Lehre hervorkommen, durchdringen [die
Buddhas] die Welt.
(Dann) treten (die erhabenen Buddhas) in die (Sonnen)scheiben ein, (diese in die Diamantthrone, diese in die Schalen, diese in die Achtsamkeitssymbole und das Achtsamkeitssymbol
in das Haupt des Yogin.
d) Zur Zeit der Besprengung (durchdringt ein Strom)
Dieser zerschmilzt und erfllt dann durch die ffnung des Hauptes [seine] Gestalt. Mit den [Strmen],
die aus dieser hervorkommen, stellt sich ein Edelsteinstrom zur Schau (und aus) der Stirn . . .
1

Satzzeichen zu streichen.
2 Lies: rdh.
3
Vgl. 162V2: vaisradynm cat(vro buddhapratimh) s(i)mhsandhirdh svam svam gocaram
lokenvabhsya ti{sthamti).
4
trayah versehentlich doppelt geschrieben.
5
Lies: hast.
6
Vgl. 162V2/3: (traynm aveniknm smrtyupasth)nanam grhitatailaptryudh strayah p(urush)
(Einl. S. 49).
7
Vgl. 162V3:^{mahkar)u(nay)h (ksava)r(n) h(r)daye stri s(u)varnbh nilavas(traprvrt).
8
Vgl. 154V4: bh(agava)tas ca dharmasariram.
9
Vgl. 155V1: buddhagunaprabhabhis cvabhsito loko.
io Einl. S. 42.
u Vgl. oben, S. 174 u. S. 177, Anm. 1.
12
Erg. (pravhah).
13
Erg. zu: (spharitv tistha)ti.
14
Lies: mrdhn.
j5
Beginn der Parallelhandschrift 2 B (Textwiedergabe Einl. S. 24).
16
Lies: vho.

XI. Meditation ber die Lehre (dharmnusmrti)

179

mena yvat sahan)}hi[ni](h)[4][s](rt)[e](na prav)hena misribhtah [s](th)itim prayati 1


165R4
ratnamayi ca sthitir drsyate
bud(dh)
[568V8] (h ratnak)[]t[]sr[ai]2
'
[5]
.'
'. . .
m
3
(ante n)bhym nirudhyate jiieyam iti vyutthnam| ||
2. [568R1] dharmanu(sm)r(tihL^ kata)[r]|
a) ih()[rya](srvako) dharmam kratah samanu[s](marati| svkhyto bhagava[6]to
dharmah smdrstiko nirjvara 5 k)llkah 6 [568R2] aupanyikah 7 ehi[pas](y)i(kahi8 pratytma)[ve]daniyo vijnaih9
b) tasyai[va](m dharmam )[k]ratah samanusmaratah
krtsno [568R3] lokah^ tirthyasstrni pathams ta
12
v(a)cannu
(ya)d[bh]yaspyespapady(am)t(e)|

t^jsah 266V1
t.|" (ta)[d]ta(to bhagavn utpadya

allmhlich, bis er mit dem gleichzeitig aus


dem Nabel hervorkommenden Strom vermischt [seinen] Standort erfllt. Es erscheint [sein]
Standort aus Edelsteinen. Die Buddhas
von Edelsteintempeln
(Am Ende) wird das zu Erkennende im Nabel zum Verschwinden gebracht. So [erfolgt] das Erwachen.
2. Was ist Meditation ber die Lehre?
a) Hier meditiert der edle (Jnger) ber die Lehre nach ihren Aspekten: ,,(Wohlverkndet
ist die Lehre des Erhabenen, sie ist aktuell, nicht hitzig), zeitlos, richtungsweisend, einladend,
(fr jeden) Einsichtigen erfabar."
b) Indem er so (ber die Lehre) nach ihren Aspekten meditiert, {erscheint)
die ganze Welt die Lehrbcher der Sekten vortragend {und ebenso lesend
und hrend. Als Folge) von deren Doktrinen erstehen {die Wesen) zumeist in schlechten

Zu der hier gegebenen Darstellung des abhiseka vgl. 154R3jf.: tato 'bhisekah ra(tnapravhah
pra)viliya mrdhnpravi{sysra)yam prayatiprinayati ca hrdayc csyapravho ni(rgatya)
(a)dh(a)s c(or)dhv(am) c(a) gatv ratnaprabhbhir lokam avabhsyam
k(r)amena
sthitim pray(ati)
(ratnakt)grmtargata buddha drsyamte\ satvs ca ratnapr(sadmtargat)ah
(amte sarvam jneyam nbhym nirudh)y(a)te iti vyutthnam] \\
2
Lies: O(k)tgrai.
3
Einl. S. 53.
4
Lies: dharmnu(sm)r(tih).
5
Dieser Begriff fehlt in der Pli-Version der Liste (D. II, S. 217; usw.).
6
Lies: (k)iika.
7
Lies: nyika.
8
Mvy. 1296: aihipasyikah.
9
Ergnzt nach Hs. 906, Bl. 40-41: [R5] katham ca dharmm akrata (sa)ma{nus)marati\ svkhyto
bhagavato dha[R6](rmah sam)drst(i)ko nirjvarah aklika aupan[4:lVl]yika ehipasyaka pratytmavedaniyai vi\Y2]jnaih
evam dharmam, krata samanusmarati\. Vgl. auch Mvy. 129197; Divy. S. 426;
Mv. Ill, S. 200,10.
10
Lies: lokas.
11
Erg. zu: ta(dvad vacayam cchrnvams ca drsya)t(e). Vgl. 166V2: stravinayabhidhar(ma)m patham
vcayam cchrnvams ca.
12
Erg. (satv).
12*

180

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

166V2 dharmam) [2] desayati1 tato lokah smketike[na] (ssan)e(na)2


stravinay[bh]i[dhar](ma)m patham vcaya[m] cchrnvams3 ca tadanamtaram [p](ra)mrthikasadV3 (dh)ar[m]a
(asu)[3]bhdhiprayogena4 pravistasya sm(rtyupasthn)[]5
dinm bodhipaksynm darsanam utpadyatej
V4 (1) tatra caturnm smrtyu(pasthnnm)
6
[4]na
pit(a)v(a)rns tatsadr[s](s catvro buddhh) [s]imhandena krtsnam lokam p[r](ayamt)i|
V5 {2) caturnm samyakprahn[](nm)
[5] tadadhirdhh catvrah
(3) (caturnm rddhipd)[n](m) catvri vaidryaso[p](nni)
[n]i|
(4) pamcnm indri[y](nm pamca)
V6 (5) (pamcnm balnm) [6] pamca vajramay hasti[n](ah7
(6) saptnm bodhyamgnm sapta)
buddhh
tammrdhasu sapt()166R1 d(it)[y](a)mandalni|
saptdityamanda[l](dhirdh)
[l]ni|

Lebensrumen wieder. Dann (entsteht der Erhabene und) verkndet (die Lehre). Dann die
Welt durch die konventionelle (Unterweisung)
, Lehrreden, Ordenszucht
und Scholastik vortragend, lesend und hrend. Unmittelbar darauf die der hchsten Wirklichkeit entsprechende wahre Lehre . . . r
Dringt [der Yogin] durch die
bung der Hlichkeiten usw. [in diese] ein, entsteht [bei ihm] die Schau der zur Erleuchtung
fhrenden [Faktoren, d. h.] der (Anwendungsbereiche der Achtsamkeit) usw.:
(1) Hierbei [erscheinen als Verkrperung] der vier (Anwendungsbereiche) der Achtsamkeit (vier Lwen)
von gelber Farbe und (vier) diesen entsprechende (Buddhas), die mit ihrem Lwengebrll die ganze Welt erfllen;
(2) [als Verkrperung] der vier r e c h t e n Anstrengungen (vier)
und darauf sitzend vier
;
(3) [als Verkrperung] (der vier Machtstufen) vier glserne Treppen, die
(4) [als Verkrperung] der fnf F h i g k e i t e n fnf
;
(5) [als Verkrperung] (der fnf Krfte) fnf Elefanten aus Diamant;
(6) [als Verkrperung] (der sieben Erleuchtungsglieder sieben)
Buddhas, auf ihren Huptern sieben Sonnenscheiben, und auf den sieben Sonnenscheiben
(sitzend sieben)
;
1

Vgl. bhagavm dharmam desayati 144V2; usw.


Vgl. 154R3: (p)r(a)mrth(i)Jcam ssanm\ smke(tikam) ca; 166R2: samketikapramrthi(kam
sanam).
3 Zur Schreibung vgl. Einl. S. 20.
4
Vgl. 162V5: gunanam
asu(bha)dinm.
r
V
Detaillierte Aufzhlung der 37 bodhipaksy [dharms] etwa Mvy. 952ff.; Dhs. XVIIIff.; AbhdhKVy.
S. 599,21 ff.; vgl. auch BHSD zu bodhipaksika. Die in unserem Text geschilderten Verkrperungen
beziehen sich recht oberflchlich auf die Namen der einzelnen Gruppen, ohne ber deren Inhalte etwas
auszusagen. So werden die 5 Krfte (bala), die inhaltlich eine ganz andere Bedeutung haben als die
zehn Krfte eines Buddha, wie diese einfach durch Elefanten verkrpert.
6
Erg. catvrah simhh.
7
Vgl. 162V1: (balnm raviman)dalacit dasa hastinah tadvarn tadadhirdh
dasa buddhapratimh; 165V4: pamca sveta gaj
tadadhirudhh pamca (buddh). D e r Unterschied besteht
lediglich darin, da bei den Krften eines Buddha auf den Elefanten noch Buddhas (oder Buddhabilder)
sitzen.
2

XI. Meditation ber die Lehre (dharmnusmrti)

181

(7) astmgasya mrgasya 1


[t], cdharottarvibh[g](ena2 dha)rmarjika ivvasthith loka . . .
[2]tah smketikapramrthi(kam ^sanam) 3 . .
166R2
4
(yadbh)yas sugatim nirv(na)
[y].ta|
c) punar dharmnusmrtip(r)[v](am hrdayopanibaddhacetaso vaidrya)[3]mayi (st)[r](i
R3
ta)[d](bh)jana5 snehapa(riprns cotpadyamte|)6 tesu vajrsanni [t]e[s]u? dityamandalni tes(u) b(u)d(dh)[](rayh)8
.
[4] krtsnam samR4
sram praksya nirvna
(dityama)ndalesu nirudhyamte te 9 vajrsanesu
vajrsa[n](ni bhjanesu bhjanh smrtinimittesu smrtini)[5]mitta10 nbhyml11
B5
d) abhisekapravh(h s)th(iti)[m] (prayamti | i 2 dharmm cdit)y(a)mandalacitam13
samskrtsamsk(r)tm14 avabhsya tistha(m)ti amte ca sarva(m) jne[ya](m n)[bh]ym nirudhya[t](e i)[6]ti vyutthnam|15 ||
R

(7) [als Verkrperung] des achtgliedrigen Weges


unter Zerlegen in oberes und unteres verharren sie wie ein Monument. Die Welt
(begreifen die Wesen) die
konventionelle und die der hchsten Wirklichkeit entsprechende (Unterweisung) und
(erstehen) zumeist in einer guten Existenzform (wieder), die (zum) Verlschen . . .
c) (Konzentriert) [der Yogin] weiterhin [sein] (Denken) unter der Voraussetzung der Meditation ber die Lehre (auf das Herz, entsteht die Frau) aus (Glas und ihre) l(gefllten)
Schalen; in diesen [entstehen] Diamantthrone, auf diesen Sonnenscheiben und auf diesen
(die Gestalten) von Buddhas
offenbaren diese
den gesamten Geburtenkreislauf und
das Verlschen. (Dann) werden sie in den
(Sonnen)scheiben zum Verschwinden gebracht, diese in den Diamantthronen, die Diamantthrone (in den Schalen, die Schalen in den Achtsamkeitssymbolen und das Achtsamkeits)symbol im Nabel.
d) Besprengungsstrme (erfllen [seinen] Standort). Sie erleuchten die mit (Sonnen)scheiben besetzten erschaffenen und unerschaffenen Gegebenheiten. Am Ende wird alles zu
Erkennende im Nabel zum Verschwinden gebracht. So [erfolgt] das Erwachen.
1

Vgl. 159R1: (simhsandhi)rudh atau buddhapratimh rystmgasya (mrgasyddhipati)rpam.


2 Lies: %ttaraP.
3
Vgl. 154R3: (pa)r(a)mrth(i)kam sasanm\ samke(tikam) cd0; 166V2: smketikena (ssan)e(na)
p(ra)mrthikcfl'.
4
Vgl. 166V1: (ya)dbhyaspaye$papady(am)t(e).
5
Lies: (bh)janh.
6
Einl. S. 36. Der in den Paralleldarstellungen belegte Wortlaut ist abweichend; vgl. etwa 169E3:
(punah si)lanu(smrti)prvam hrdayopanibaddhacetasah vaiduryamayi stri snehahpariprnvaidryabhjanacittotpadyate.
7
Lies: tesv.
8
Vgl. 165V3: bh(a)j(a)n(e)u vajrsana vajrsanesv adityamaridalni\ tesu buddh bhagavamtah.
9 Lies: tni (s. Einl. S. 21, Anm. 9).
10
Lies: (ni)mittam.
11
Vgl. 165R2: (tato buddh bhagavamta dityama)nd(a)lesu pravisamti(\ tni va)jr8anesu tni
bhjanesu tni smrtinimittesu smrtinimittam yogcramrdhani\.
12 Vgl. 154R3-4: tato 'bhisekah
(pravhah)
k(r)amena sthitim pray{ati\).
13
Lies: citml
u Lies: k(r)tn^
is Einl. S. 53.

182

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

3. samghnusmrtih katar|
a) i(hryasrvakah samgham kratah) [sa](ma)nusma(rati|
srvakasamgha i(t)i*
167V1 b)
[i]
. . . .hr vai[rdi]
V2
(ap)[2]yespapadyamte(|)2
V3

(di)[3]tyamanda(la)
k)[s]u

supratipa)nno bhagavatah

[s]t. bh(i'

V4

[<|te|
c) pu(nah hrdayopanibaddha)cetasah3 vaidryamayl (stri snehapariprnavaidryabhV5 jana)c(i)t4 utpadyat(e) sn(e)h(abhjanesu vajrsanni tesv dityamandal)[5]ni te[s](u)
[e]
tni r(a)[t]nmtargatni cd(ar)[s]
. . . . [s](am)pannimittam|
nbhipradese ratnamayni
V6
[6]
ksp] jvalanirma[l](a)sa(stra)[c]i(ta)5. .
[g](r)Iv mu[kt](c)i(ta)m
[e] (sam)pannimitta(m|)
167R1
[2]

3. Was ist Meditation ber die Gemeinde ?


a) Hier meditiert (der edle Jnger ber die Gemeinde nach ihren Aspekten:,,Wohlgerstet)
ist die Jngergemeinde des Erhabenen'i
b) (nicht bersetzt)
c) (Konzentriert) [der Yogin] weiterhin [sein] Denken (auf das Herz), entsteht (die Frau)
aus Glas, (die mit den lgefllten glsernen Schalen) besetzt ist; (in den) l(schalen) [entstehen]
(Diamantthrone, auf diesen Sonnenscheiben) und auf diesen
. und diese, in die Edelsteine eingegangen, (im) Spiegel
als Symbol
des Zustandekommens von
In der Umgegend [seines] Nabels [erscheinen]
. . . aus Edelsteinen
mit einem flammenden reinen Messer besetzt
mit Perlen besetzt als Symbol des Zustandekommens von

Vgl. die Wiedergabe des vollen Wortlautes in Hs. 906, Bl. 4142: [41V3] Jcatham samgham akrata
samanusmarati]
su[Y4:]pratipanno bhagavata srvakasamgha nyyapra[V5]tipanno\ rjupratipanna
smicipratipannah [V6]anudharmacari\ samti samghe srotpattipha\yi^las(Xsikriyyai pratipannaka\
samti sam(gh)e [Rl] srotpanna] samti samghe sakrdgmi[pha](las)[R2~\ksikriyyai pratipannaka]
samti samghe 8akrd[H3~\gmina\ samti samghe angmiphalasksikri[K^\yiyai pratipannaka\ samti
samghe angmi[R6]na\ samti samghe arhatvaphalasksikriyyai [R6] pratipannakh\ samti samghe
arhanta\ ity e[R7]te astau purusapudgala catvri purusayu[Vl]g,ni\ esa bhagavata sr(a)v(a)ka(samgha)[h] s[i]lasam[V2]panna\ samdhisampanna] prajnsampanna\ vimukti[Y3]sampanna\ vimuktijnnadarsanasampanna] ahva[V4:]yaniya prhvayaniya] amjalikarani[V5]ya samlcikaraniyam anuttaram
punyaksetram\ [V6] daksiniyo lokasya evam samgham krata [V7] samanusmarati].
2
Vgl. 166V1: (ya)dbhyaspyespapady(am)t(e)\.
3
Lies: cetaso. Das nach den Parallelen (165V2-3; 166B2-3; 169R2-3; 170R2) zu erwartende
samghanusmrtiprvam ist hier ausgefallen.
4
Lies: c(i)totpadyat(e).
5
Vgl. 133B5: nirmalojvalasastracitam pratyaveksannimittam.

XI. Meditation ber die Gemeinde {samghnusmrti)

183

tirthyagann (a)bhibhyvabhsya lokam ptri krtvditya[m](an)[d](ales)[u] (p)r(a)[v](i^a)t(i)i t(e)2 vajrsanesu te2 ca (bh)[i]jane[su] " . .
167R2
d) sthitis ca yath dharmnusmrti* ayam tu visesah hrdayt prav(hah) sthitis cryasamghkirna5 drsyate [a](mte nbhym) [3] sarvam [jiie](yam nirudhyate iti vyutthnam|)
samghnusmrti6 ||

R3

4. silnusmrti6 katar
a) ihryasrvaka[b] (s)i[l](am kratah. sama)[nu]smarati
acchidr(ny asabalni7

itim(ni sil)[^]ny akhandny

b) (2) iti silnusmr)[ti]prvam hrdayopanibaddhacetasah 8 [d]e[v] . [ ! ] . . .[i]


. (a)[5]bhimu(kh)I (bha)[va](nt)i(|)

[tat]o . .

berwltigt (der Buddha) die Sektenscharen, leuchtet, macht


sich die Welt zum Gef und tritt in die Sonnenscheiben ein, diese in die Diamantthrone,
diese in die Schalen, (diese in die Achtsamkeitssymbole und das Achtsamkeitssymbol in den
Nabel)
d) [Sein] Standort ist so wie in der Meditation ber die Lehre, nur ist folgende Besonderheit:
Der Strom kommt aus [seinem] Herzen und der Standort erscheint von der edlen Gemeinde
erfllt. (Am Ende wird im Nabel) alles (zu Erkennende zum Verschwinden gebracht. So
[erfolgt] das Erwachen).
[Ende der] Meditation ber die Gemeinde.
4, Was ist Meditation ber die Tugend?
a) Hier meditiert der edle Jnger ber die Tugend (nach ihren Aspekten): ,,Diese (Tugen
den) sind ungebrochen, nicht hohl, (nicht fleckig").
b) (1) Konzentriert [der Yogin] (so) [sein] Denken unter der Voraussetzung der Meditation
(ber die Tugend) auf das Herz, (kommen) ihm Gtter
zu gesicht. Dann
, durch-

Vgl. 170V3: (duscarita)carinah sarvn abhibhya adityamandal(e)su pr(avisamti\).


Lies: tni (Einl. S. 21, Anm. 9).
3
Erg. (tcbni smrtinimittegu smrtinimittam nbhyam]).
^ Lies: smrtih. Der Verweis bezieht sich auf 166R5: abhisekapravh(h s)th(iti)m (prayamti] dharmm cdit)y(a)mandalacitam samskrtsamsk(r)tin avabhsya tistha(m)ti amte ca sarva(m) jneya(m n)~
bhym nirudhyat(e i)ti vyutth,nam\ ||.
5
Lies: Mrn.
6
Lies: smrtih.
7
Wie in der Meditation ber die Gemeinde ist auch hier der Wortlaut der Formel nur abgekrzt
wiedergegeben. Fr den vollen Wortlaut vgl. MPS 2.34 (S. 132) und Daso. VI.l (5) (S.75): yni tni
sllany akhandny acchidrany asabalny akalmsani bhujisyny aparmrstani susamptni eusamdattni
vijnaprasa8tny agarhitni vijnai,
8
Lies: cetaso.
2

R4

B5

134

Dieter.Schlingloff, Ein buddhistisches Yogalehrbuch

t[i](m) bhitvbhyudgatah sa
tasym vely[](m) g(thm bhsate| *
bahavah saranam ynti)
[pajrvatni2 [va](n)n(i) ca|
167R6
r[6](ma)m (vrksacaityms ca 3
manusy bhayatarjitk 14
na) [hy e]tac charanam sres(th)am 5
nai(tac charanam uttamam
naita)[c cha]ranam gamya
sarvadu(hkht pramucyate |
yas tu buddham ca dharmam) [ca]
168V1
samgham [ca] (saranam gatah [1]
catvri cryasatyni
prajnay pasyati yad| 6

b r i c h t . . . . . . . steigt herauf und


bei dieser Gelegenheit (die Strophen:
Viele nehmen ihre Zuflucht)
zu Bergen und Wldern,
zu Hainen, (Bumen und Grabmalen,
Menschen, von Gefahren bedroht).
Doch
nicht
wenn
(wird

(bhagavm)s

(Der Erhabene spricht)

(nicht) dies ist die beste Zuflucht,


(dies ist die hchste Zuflucht);
man da seine Zuflucht nimmt,
man nicht von) allem (Leid erlst.

Wer aber zum Buddha und zur Lehre)


und zur Gemeinde (seine Zuflucht nimmt,
wenn ein solcher die vier edlen Wahrheiten
mit Erkenntnis sieht:
1

Vgl. 162R1: tato bhagavm ga(thm bhsate). Die Verse entstammen Udnavarga 27, 3438 ( = Pli
Dh. 188192 u. fter); sie finden sich auch Divy. S. 164,7ff. Dort werden sie ebenfalls mit den Worten
eingeleitet: aiha bhagavms tasym velym gthm bhsate\.
2
Uv. und Divy. lesen: parvatmd ca; Pli: pabbatni. Wie das Pli hat hier unser Text die alte stliche Form bewahrt. Vgl. zu diesen Bildungen LDERS, Epigraphische Beitrge III. Das vierte SulenEdikt des Asoka, S. 1006 ( = Phil. Ind., S. 289).
3
Erg. nach Uv.; Divy.: armms caityavrksams ca.
4
Erg. nach Uv.; Divy.: bhayavarjith].
5
Unser Text entspricht Divy.; Uv.: naitad dhi saranam ksemam.
6
Erg. nach Uv.; Divy.: ryasatyni catvri paiyati prajnay yad\* Uv. und Divy. schieben anschlieend einen Vers ein, der sich auch im Vidysthnopamastra (WALDSCHMIDT, Kleine BrhmiSchriftrolle, S. 6) findet:
duhkham duhhhasamutpannam
nirodham samatikramam\
ryam cstngikam mrgam
ksemam nirvnagminam \\
(Wiedergegeben nach Divy.; die Fassungen weichen in Einzelheiten voneinander ab).

XI. Meditation ber die Tugend (silnusmrti)

185

etad dhi ^aranam srestham 1


etac charanam uttamam|
etac charana)m gamya
s(a)rv(a)duhkh()t pra[2](mucyate|)
(2)

168V2

.. . . '
(a)dhipatirpam|
muktmayi strl . .
....'....-

[3]
(ti)sthamti|

s ca strl ratnapuspm

(k)[s](i)rapariprnam utpadya[t]e
m|

. [4] . . . .
[5]

tni cmkurni
e

V3
V4
V5

[6]

V6

[e]

[1]

168R1
:

(u)tpadyate|

[2]

dasmku[r](a)......
.

ndya 2
rnaratnaci(t)

[3]

R3
,

upasam[pa]

nihsrth

(ni)sannh3 drsyamte|

[4]

R4
[lajltesu nilbhni candrama'.
p(u)spakalp

nda(la) . . [5]

R2

sauva-

pr(a)v([6]hb) ,

R5
R6

(ti)sthati|
(3) [ta](d)[] smrtisampra[i]janyasampaddvayam pratilabhate] tadadhipatirupam|4 [v]ai- 169V1
d[]ryamay(i) strl s(a)rv(a)satvsatvkhy(a)
[v]
[n]. smrtyh
samprajany(a)-

Dies ist wahrlich die beste Zuflucht,


dies ist die hchste Zuflucht);
wenn man (da seine Zuflucht) nimmt,
(wird man) von allem Leid (erlst)".
(2 nicht bersetzt)
(3) Dann erlangt [der Yogin] ein zweifaches Zustandekommen: das der Achtsamkeit und das
des Bewutwerdens. Als deren Verkrperung [erscheint] fr die Achtsamkeit eine Frau aus
Glas, die alles Belebte und Unbelebte
und fr das Bewutwerden (ein

1
2
3
4

Erg. nach Divy.; Uv.: saranam k$emam.


Lies: nadyah.
Lies: $ann.
Lies: rpam\.

186

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

i
169V2 sy(a)
[o]lkahastah 2 hrdaye c[2]sydityamandalam|
tadavbhasitam 3 satvsatvkhy(a)m (e)va sarvam vastu yato 'sau samvara 4 pratilabhate satvasatvkhyeV3 bhyas 5 ca gandharatnapu[s](pa).
.y.h samtne 'sya sarverypathe[3]su6 sarva[k][l]am pravartate|
(4) prtimoksasamvarvijnaptipunyasrotasah7 adhipatirpamj sauvarnaratnaeitarathdhirV4 (dham brah)m()[n](am) 8 pasyati| ratnacchatrena .[I] . . . . (ni)[4]lbha9 (cand)r(ama)ndalacitam10 ca pattam sirasi baddham" pasyati| etac crhatvavisesabijam| sarvopasampannV5 nm evam
sya ca prvapratilabdh(n)m
[5] krtmtapratyaveksanyogenaitad12 darsanam utpadyate prvapratilab(dh)amanasikrnm tu syd ekakrameneti|
V6 (5) punah sl(lnusmrti)prvam hrdayopani[ba](ddhacetasab13 a)[6]dhastd yvad vyuma15
ndalamadharottaravibhgena1/*nilbh()
(pa)r[i]prnai16tiryag17anam-

Mann)
mit einer Fackel in der Hand. Im Herzen [des Yogin entsteht] eine
Sonnenscheibe. Dadurch wird jeder belebte und unbelebte Gegenstand erleuchtet, wodurch
[der Yogin] Zucht erlangt. Aus Belebtem und Unbelebtem entwickelt sich in seiner Nachfolge Duft-, Edelstein-, Blumenallezeit in allen Krperhaltungen.
(4) Als Verkrperung des Flieens von [religisem] Verdienst aus dem Gelbnis der Zucht gem der Ordenssatzung sieht [der Yogin] (Brahma) auf einem goldenen, mit Edelsteinen besetzten Wagen mit einem Edelsteinschirm
Er sieht ein blau leuchtendes und mit
(Mond)scheiben besetztes Seidentuch um [seinen] Kopf gebunden. Dies ist der Same der in der
Heiligkeit [liegenden] Besonderheit. Fr alle Ordinierten, die frher
erlangt haben,
entsteht diese Schau durch den zuendegefhrten Anschauungsyoga; fr diejenigen aber, die frher das Beherzigen erlangt haben, mag sie auf einmal
erfolgen.
(5) Konzentriert [der Yogin] weiterhin [sein] (Denken) unter der Voraussetzung (der Meditation) ber die Tugend auf das Herz, [gehen] blauleuchtende (Strme) unter Zerlegen in
oberes und unteres abwrts bis zum Windkreis; [gehen] mit erfllten
hori-

Erg. (ca purusah). Vgl. 159V12: (hriava)trpyadhipatirpam


a(vad)atavastraprvrta stri purusas ca (Vgl. Einl. S. 49 u. Anm. 4).
2
Lies: 0oUchastah. Fackeln dienen als Verkrperung des Geistes (127R23) oder des Bewutseins
(128R6); vgl. Einl. S. 48 u. Anm. 8.
3
Lies: avabhsitam.
4
Lies: samvaram.
5
Lies: satvsatvkhyebhyas.
6
Vgl. 144V4: camkramaniadybhyam sarv(e)rypathesu ca.
7
Lies: samvaravijnaptipunyasrotaso *dhi.
8
Vgl. 150R6, 152V2: hamsarathdhirdhah brahm.
9 Lies: (ni)labha(m). Vgl,'nilabhh patth 127V4, 121V5.
10
V g l . 168R4: laltesu nilbhni
candramanda(la)
....
11
Vgl. 128V3: bhagavams casya sirasi pattam badhnti\ (Einl. S. 41 u. Anm. 4).
12
Einl. S. 30.
13
Lies: (cetaso *)dhastd.
14 \TgL 166R1: cdharottarvibhg(ena dha)rmarajika ivvasthith.
15
Erg. (pravahah)1
16
Lies: prnais.
17
Lies: tiryag. Vgl. 146R1: tiryakto 'nantaparyantah.

XI. Meditation ber die Tugend (Snusmrti)

187

tarn hrda[y]()c cordhvam y[v](ad aghani)s[th]tyi adharottaravi[bh](gena)


. . . . [i]laih skandhadhtvyatanapratltyasamutpdryasatydini. . . .2
169R1
. .ryataih pariprnam pasyatij (m)(rdha)[n]i cs(ya mani)[r u]tpadyat[e]| [t](a)[t]r(a) . . . .
[2] pasyati maninihsrtais ca rasmibhir 3 adha urdhvas[th]am jiieyam R2
6
krst(am) svsray(m)targatam pasyati'* maniratnc ca ratnavarsah amta* patit(a)
. . mandalmtargatany 7 ()[p](rayati|
c) punab si)[3]lnu(smrti)prvam hrdayopanibaddhacetasah vaiduryamayi9 stri snehahR3
pariprnvaidflryabhjanacittotpadya[t]e( |10 bhjan)e(su) vajrsanni tesv (dityamandal)[flni tadamtargat() bladrakh^ tesm divyrmodynavimnnyi2 apsaroganakalilny
R4
abhimukhi bhavamti| tatpra
nti tad ratnama
. [5] ratnajlvrR5
tarn sarvmgapratymgabaddham13 tmnani pasyati| purusascaispym14 darsayati) ka-

zontal unendlich, und aus dem Herzen aufwrts bis zu den Aghanistha-[Gttern] unter Zerlegen in oberes und unteres
sieht er
erfllt von (den Symbolen) der Gruppen, der Elemente, der Bereiche, des Entstehens
in Abhngigkeit, der edlen Wahrheiten usw. An seinem (Haupte) entsteht (ein Juwel). Hierbei sieht er
Angezogen von den Strahlen, die aus dem Juwel
hervorkommen, sieht er das zu Erkennende, das sich abwrts und aufwrts befindet, in seine
Gestalt eingegangen. Aus dem Juweledelstein fllt am Ende ein Edelsteinregen und (erfllt)
die in die Kreise eingegangenen
c) Konzentriert [der Yogin] (weiterhin) [sein] Denken unter der Voraussetzung (der Meditation) ber die Tugend auf das Herz, entsteht die Frau aus Glas, die mit den lgefllten
glsernen Schalen besetzt ist; (in den Schalen) [entstehen] Diamantthrone, auf diesen
(Sonnenscheiben) und darin eingegangen junge Knaben. Diesen kommen himmlische Haine,
Grten und Schlsser, die mit Scharen von Himmelsmdchen bevlkert sind, zu gesicht.
Deren
Dann sieht [der Yogin sich] selbst mit Edelsteinund von einem Edelsteinnetz umwickelt an allen Gliedern und Nebengliedern
gebunden. Ein Mann zeigt die diesen [zukommenden] schlechten Lebensrume und spricht:

Lies: (aghani)sthan cddharo0^. Vgl. 129V4: (co)r(dh)vam ydvad aghanithaparyamtamy 146B1:


rdhvd aghanisthaparyantam; 133B1: yvad aghani$thn; usw.
2
Erg. zu: dini(mittaih)?
3
Vgl. 157R2: tannihsrtbhih rasmibhih.
< Einl. S. 53.
5
Lies: varso 'mte.
6
Vgl. 153R2: amte ca ratnavarsam muncati\.
7
Lies: gatany.
8
Lies: cetaso.
9
Lies: vaidrya0.
10
Lies: snehapariprnavaidryabhjanacitotpadyate(\).
11
In der Meditation ber den Buddha und die Gemeinde entstanden in den Darstellungen, die
unserem' Absatz entsprechen (165V23; 166R23), auf den Diamantthronen Buddhas; hier dagegen
bilden die jungen Knaben, die das Bewutsein oder den Geist verkrpern (s.Einl. S. 48 f.), den Inhalt
der Meditation.
12 Vgl. 135R4: (kmvacarm devm) v(i)mnodynopabhogm.
13
Lies: pratyamga.
14
Lies: caism apdyamt

188

169R6
170V1
V2
Y3
Y4
V5

V6

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

thayati| caitat1 pramdaphalam iti| tatas te vi[sa](yebhyo vimu)khi bhavamti| ratnarasa . .


. . . []ca nimagndrsyamte| dhynasamvarasya nbhyupari nllapitalohityadt cand(r)abla(draka)
[vat]i
man(d)a[la]
[1]

(vimu)khi bhts ca muktm pasyamti|
nlldi| tad
ras(a)n(i)magna(m) hrday(e)
adhirdhh2 b(la[2]drakb)
(ta)d muktcitair
jvlair3 baddham tmnm* pasyati|
vimukhi bht()
[e]vam sarvaromak(p)e . . .e ca buddh[3]
(duscarita)crinah sarvn
abhibhyas dityamandal(e)su [p]r(avisamti|)
6
[4]
romakpadarsanvidhih
buddhadharmasamgh(nusmr)[t]i7
.. / .
[5] . .
8
d)
(ni)hsrth 9 yvad vyumandalam (bh)[i]~
(t)[v](a)io
[6] . .
[ta]m ratnapuspavarsaih u gosirsa[ca](ndana)
5. (devatnusmrtib katar|)

170R1

a)
6)
R2 . . . . '

[2] . . " . . . .
[ujpanibaddhacetasah sat kmvacar de(v)42
V . '.
ddh. manusysrayam pasyati]
13
c) punar deva(tnusm)r(tiprvam)

[2]

,,Dies ist die Frucht der Verblendung." Dann wenden diese sich von den Sinnesobjekten ab.
Sie erscheinen in Edelsteinessenz
eingesunken.
(Ende nicht bersetzt)
5. (Was ist Meditation ber die Gottheiten?)
(nicht bersetzt)

Lies: kathayati ca\ etat.


Lies: rdha.
3
Lies: jlair. Vgl. 169R5: ratnajlvrtatn sarvmgapratymgabaddham tmnam.
4
Lies: tmnam.
5
Lies: bhyditya. Vgl. 167Rl: tirihyagann (a)bhibhyvabhsya lokam ptri
krtvddityam(an)d(ale$)u (p)r(a)v(isa)t(i).
6
Erg. nach den Paralleldarstellungen (165R1-2; 166R4-5; 167Rl2): (tni vajrsanesu
tani
bhajane?u tani smrtinimitteu smrtinimittam nbhym]).
7
Vgl. 167R2: sthitis ca yatha dharmnusmrti.
8
Erg. (abhisekapravahah)t
9
Lies: srta.
10
Vgl. etwa 135R34: pravah(a)h
(yva)d vyumandalam bhitv a(kasat pa)rivartya nbhyam
pravisya mrdhn ni(rgatya).
11
Lies: var$air.
12
Vgl. 145R6: sat kmvacarm devn\ rpvacarms ca caturdhynopapannm.
13
Erg. (hrdayopanibaddhacetasah).
2

XI. Meditation ber die Gottheiten (devatnusmrti)

189

[3]
[h]h pravi(st>b sm)[r]tinimittam| snehapari- 170R3
prnavaid[rya](bhjanacit stri) 1
..
[4]
(dr)sya[m]te|
tesm adharimo bhgahs darsamaR4
3
ndalacitah
[5]
[n](i)m(i)ttam| hastesu
R5
grhitaratnopakaran purus 4 sa
[6]
sv evamjtiyam darsanam
R6
bhavati|
d) an(t)e (ca) devh p(u)spa[r](atnavarsam utsrjamti|) 5
'
[1]
171V1

Vgl. 165V21 vai{dryamay)i stri snehapariprnavaidr(yabhajanacitotpadyate\); ^ 166R3, 167V4,


169R3.
2
Lies: bhaga.
3
Zur Bedeutung von darsamandala, Rundspiegel", vgl. LV. S. 72,10: suparisuddha adarsamandale mukhamandalam drsyate, das Gesichtsrund erscheint in einem klaren Rundspiegel".
4
Lies: karanh purush. Vgl. 153B2: 8arvo{pakara)navarsam amte ca ratnavarsam muncati; 148V6:
(sa)r(v)opakaranavr$tim mumcati.
5
Vgl. etwa 128V41 devs ca krtsnam gagana pryamna pusparatnavarsam utsrjanti iyam pratyutpamnpnasmrtibhvan\.

WRTERVERZEICHNIS
Vorbemerkung
Die Stellenangaben beziehen sich auf Blatt- und Zeilenzahl der Birkenrindenhandschrift.
Seitenangaben in Klammern weisen auf die Seiten der Publikation hin, auf denen das betreffende Wort besprochen ist. Wrter, die Zustze oder zustzliche Stellenbelege zu EDGEBTONS Buddhist Hybrid Sanskrit Dictionary darstellen, sind durch * gekennzeichnet. In den
Belegstellen sind Textlcken durch Punkte (....)> verkrzte Zitierungen durch Striche
(buddh
-drsyamte) bezeichnet; (sie) weist auf auffllige Verschreibungen hin; = bedeutet gleicher, =* hnlicher Wortlaut.
amsa Schulter"
vmd ams(sic) budbudapravho nih(srtah) 132R4; daksinmd(sic) amsd asya marlcipravho nirga(cchati) 133V1.
akhanda ungebrochen"
(sil)ny akhandny 167R4.
agni Feuer"
135V 3; 137R4; 144R2; 149V1; 154V3; 160R1;
161V4.
agra Spitze"
j(i)hv()gr(a) 142V3; s. nsgra.
agratah (1) im Vordergrund", (2) vor"
(l):150V6) (2):158V1.
agha bel"
(aghatah parmrsan|) 134V2.
*aghanisthh Aghanistha-[Gtter]"
pravho
mrdhn nirgatya
yvad aghanisthm devn avabhsya 129R2
o*133Rl; =gatv 147V1 ^ 135V1 ^ 117V4)
^aghanisthaparyamtm krtsnm prthivim
spharati 132R2 ^ 132R3; rdhvd aghanisthaparyantam tiryakto 'nantaparyantah
146R1; aghanisthapa(ryamtam lokam)
131R4; (co)r(dh)vam yvad aghanisthaparyamtam 129V4; yvad aghanisthm 164V5
^169V6 ^146V2 ~ 152R1 ^ 148V5 (S.21,
Anm. 5u. S. 31flF.).
ankura Sprling"
nilmkuraparivro paanih 145R2; nilbhair
amkuraih 121R3; ank(u)re(su n)ilbhni pa...
120V4; 121V4; 137R6; 168V5; 168R1.

anga Glied"
amgni karunyh 152R4/5; sarvmgapratymgabaddham tmnam 169R5; s. atnga,
rathnga.
an gr a [glhende] Kohle"
117R3; 118R3.
anguli Finger"
brahmahastmgulibhyas ca varsam patati
148R3;148V6.
angustha groe Zehe"
s. pdmgustha.
aeara unbeweglich"
sacarcaro loka 162V6.
acala (1) unbeweglich", (2) Berg"
(1):149V2; (2): vajraclakta(^c) 144R1.
ajatva Ungeborensein"
155V5.
ajnna Unkenntnis"
ajnnapratipaksnamtaram 139R4.
anjali zusammengelegte Hnde"
142R3.
anda Ei"
kukutyndavad 137V1.
atah param darber hinaus"
128R2; 152R4.
atireka intensiv"
121R5.
atita (1) vergangen", (2) Vergangenheit"
(1): 137V6,156R1; 158V4; 158V6; (2): 128V6.
*atrapaci [Einer, fr den die Frchte der
in frheren Existenzen vollbrachten guten

Wrterverzeichnis
Werke] jetzt reifen"
ime 'trapacayah su. . . 154V4.
adhana besitzlos"
156R2.
*adharima unterst"
adharimo bhgah 170R4.
*adharottaravibhga Zerlegen in oberes
und unteres"
(a)dhastd yvad vyumandalam adharottaravibhgena 169V 6 \ cordhvam yv(ad aghani)sthty(sic) adharottaravibh(gena)
169V 6 \ cdharottarvibhg(ena dha)rmarjika ivvasthith 166R1.
adhas (1) abwrts", (2) unter"
(1): urdhvam adhas ca spharitv 136V2 ^
136R1; adh cordhvam ca g(atv) 150R6 =
154R4; adho yvad vyumandal(am) 125V2
= 152V1 = 163R1; vyumandalaparyamtam adhah 129V4; adhah kmeanacakre
prat(i)sth(itam) 146R1; adha urdhvastham
jiieyam 169R2; (2): (bhrumadhy)dhar
146R6; ratnavrksdhar 131R5.
adhastt (1) abwrts", (2) unterhalb"
(1): (a)dhastd yvad vyumandalam 169V6;
(2): bhrumadydhastt 134R6 = 135V1;
148R2; vrksdhas(tt) 151V5.
adhikatara in noch hherem Mae"
150V4.
*adhipatirpa Verkrperung"
. . . tribhih rupai(h) pravartate
adhipativibhganisyandarpaih avltargnm ekena
adhipatirpenaiva 146V4; . . , dynnubhavadarsanam vltargnm adhipa(tivibhganisyam)darupair vedit(av)y(a)m
154V1; pradipahast ca stri prajndhipatirupam 160R4; karun
tadadhipatirpamj
stri su(varn)bh() av(a)d()tastraprvrta(5ic) 148V4; 148V5; s(uva)rnbh stri pramudita
muditdhipatirpam 153R3; (stri) . . . (a)vadtavarn avadtavastraprvrt paryamkena nisannnbhogvasthit upeksdhipatirpam 161V3;
avadtavarn ca stri avadta(vastr mahkaru)n()dh(i)patirupam 162R1; 162R6;
(hriava)trpyadhipatirpama(vad)tavastraprvrt stri purusas ca 159V 2 \
smrtisamprajanyasampaddvayam
tadadhipatirupam | vaidryamay (I) stri-

191

smrtyhL
samprajany(a)sy(a ca purusah)
169V1;
prtimoksasamvarvijiiaptipunyasrotasah adhipatirpam |
sauvarnaratnacitarathdhir(dham brah)m()n(am) 169V3;
balavai&radyvenikasmrtyupasthnamahkarundhi(patir)pni
drsyamte t(at)r(a
balnm raviman)dalacit dasa
hastinab tadvarn tadadhirdh ravimandalacith eva da^a buddhapratimh etc. 162V1 ^
165V4; (simhsandhi)rudh atau buddhapratimh ry^tmgasya (mrgasyadhipati)rpam 159R2; vedanyh adhipatirpam
udakavarnam budbudam 158V 2;
(bu)dbudeu strimukhni
rgasydhipatirupam 132R5; ksirapuskirini
t(amni)magnam naksatram maitrsayaparigrhltasya (adhi)patirpam 147V3; agn(i)jvlmtargatam agnitilakm cetany adhip(atir)pam 137R4;
avidydhipatirpam
159R2 c* 159R6 ^ 139 V3; samskrdhipatirupam 137R3; svsnm|(sic) adhipatirpam
121V6; skandhapamcakam
tadadhipatirupni 160R6; asaiksadharmdhip(a)t(i)r(pam)
gunnm adhipatirpam asu(bh)dmm 162V5 \ 168V2; 125V1 (S.49ff.).
adhimtra bermig, berma"
adhimtrdhimtrasya mitrasya 153V4 ^*
140V2 ^ 147R5; (adhi)mtrasymitrasya
153V4 o* 140V2 ^ 147R6 ** 155V5; adhimtram krunyam 150R4 ^ 148R4.
*adhimukti Eifer"
(rp-)(= vedana-, = [samj]n()-, = vijnana-)
skandhapariksdhimu(ktih) 132R1 == 132R3
= 133V1 = 133V4.
*adhimuc sich ereifern"
satvn adhimucyamnasya 153V5.
adhiruh hochsteigen"
144V1.
adhirdha sitzend {stehend) auf"
127V 4; 127V 5 \ 127V 6 \ 128V 5; 131R4; 136R1;
143R5; 144V3; 144V5; 144R4; 145R6; 146R4;
148R3; 149V 4; 150R6; 152V2; 152R1; 152R3;
153V6; 153R6; 154V5; 154R5; 159R1; 161R5;
162V1; 162V 2; 162V 4; 165 V4; 165V5; 166V5;
169V 3; 170V1.
adhlna abhngig"
hetupratyaydhmam 161V1.

192

Dieter Schlingloff,. Ein buddhistisches Yogalehrbuch

*adhyvasna das sich-Entscheiden"


triprakrasya vedayitdhyava(s)nasydmavm 158R3/4.
adhytma (2) selbst", (2) eigen"
(2): (a)dhy()tmabhyni satvs&tvkhyni
132R1; (dhyt)m(ap)r(a)t(I)ty(a)samutp()d(e) 137V 2 \ (2): adhytmavyupathaparisodhant 126R5 (S. 98, Anm. 8).
*adhysaya Hinwendung"
sarvasatvhitadhy^ayapravrttah 145V6 ^
140V3; bodhya drdham adhyaya(m)
150R3.
*adhvan Epoche"
angate 'dhva(ni) 152V5 =* 152V6 = 143R1.
ananta unendlich"
127V 2; 127R5\ 130V 4; 131R5; 145V1; 146R2;
150R1; 150R5; 161R3; 169V6.
*anantaparyanta unendlichen Umkreis [besitzend]"
anamtaparyamtm janmaparamparm
159V1; pattair anamtaparyamtaih 155R5;
padmapamktayo 'nam(ta)paryamt 144V3;
(anam)tparyamtam prsdam 126V2; anamtaparyamnt sauvarnaguhm 146V6;
anamtapa(r)yamtm dar^am 158V1; sthitih
(anamt)paryamt
151V3/4 c*>
135V2 \ namtam paryamtam satvasamudram 145V3; anamtaparyamt bhagavamto
buddhii 154R5; gun anamtaparyamt
162V 4; rdhvd aghanisthaparyantam tiryakto 'nantaparyantah 146R1; anamtaparyamtm svsvirnaparyamkas 143R4; 124R3;
161R5 (S. 78, Anm. 6).
anantaram unmittelbar"
128R3; 129R1; 136R2; 139R4; 147Rl; 151V 3;
152R5; 152R6; 153V1; 153V2; 155V3 \ 155V4 \
166V2.
*anabhisamskra gestaltungslos"
anbhogam anabhisamskra(m) sntam tasmim samaye ci(tta)m 125V4.
anayasthyin unbestndig"
158R2,
angata (2) zuknftig", (2) Zukunft"
(1): 150R1; 152V5 \ 152V 6 \ 153R5; 156R1;
158V4; 158V5; (2): 128V4; 128V6.
*angamya ,, bergangsstufe"
bhmibhedena saptabhaum|kmadhtur angamya^ catvri dh(ynni dhynm)t(a)-

r(am) ca 140V1 ** 147R4 ^ 155R1 (S. 32,


Anm. 4).
*angmiphala die Frucht des Nichtwiederkehrenden"
147V6.
antman Nichtselbst"
(antmatah parmrsan) 134V4.
^anbhoga entspannt"
anbhogam anabhisamskra(m) Sntam tasmim samaye ci(tta)m 125V4; (strl)
paryamkena niannnbhogvasthit upeksdhipatirpam sambhavati| tato 'synbhogvasthitasya. . . 161V3.
anitya (2) unbestndig", (2) Unbestndigkeit"
(2): anitya(m a)nityam iti gabdam udiray(am)tahi 136R2; (anityatah parmrsan)
134V3; (anity) bata samskr 162R2;
(2): anitynudaranym 118R5 = 125R6;
(anitynupasya)nym 128V1.
*anirkrtadhyyin sich unablssig versenkend"
anirkrtadhyyinm smrtyupasthnnirvedhabhgiyas(r)manyaphalni sasambhrlamkr(ny u)tpadyamte 128R2.
anista unerwnscht"
157R6.
anukla angemessen"
136V5 \ 136R1;148V5; 153V 1,155V 4,160V L
anuklatva Angemessensein"
sunyatnuklatvd 129V4.
anukrama Reihe"
129V6.
anugrh begnstigen"
satvn anugrhniym 142V4; satv
sukhen()nugr(hith) 153R4.
anugraha Gunstbezeigung"
165V6.
anucita unpassend"
142V2.
anuttara unvergleichlich"
164V1; 164V6.
*anudarsan Erschauen"
anitya- (=prahna-, ^virga-, =nirodha-)
anudarsanym 118R5 = 118R6 = 118R6/
119V1 = 119V1; = 125R6/126V1 - 126V1
= 126V2.

Wrterverzeichnis

*anuddhata nicht hochfahrend"


cittam cnuddhata. . . 125R5
*anunaya Freundschaft"
anunayas ca dur(i) bh(a)v(a)t(i) 157R4.
*anuparivarta Folgerung"
mudit
s tu snuparivart sasamprayog parigr(h)ya(mn|) 153V2 ex 139R6
~ 147R3 ^ 155V6.
*anupasyan Erblichen"
anitya-( =prahna-, = [vijrga-, = nirodha-)
anupayanym 128V1 = 128V2.
anuprpta geraten in"
147R5.
anubaddha miteinander verbunden"
129V6.
anubhava Empfindung"
154V1.
anubhava Macht"
154V2.
anubh empfinden"
upasamasukham anubhavati 130R6; = a nubhya 130V4 = 131R5; pritim (anubhavamti) 144V2 \ duhkham anubhtam 159V1
= 158R1.
anumud erfreuen"
151V2.
anumodana Mitfreude"
tadubhaynumodanena yuktah 156V 2 \ hitasukh()numodanayamanasikro 153V 2 \ anumodankras ca modamtu bata satv iti
153R4 = 153V6 = 154R3.
anuvrt (2) folgen", (2) sich hingeben"
(1): 146V6; (2): 145R1.
*anuvyanjana Nebenmerkmal"
laksannuvyamjanavirjita 130R6 = 140V6
- 150R3 = 163V2.
anusrena folgend"
143R6; 144V1; 161V6.
anusrin folgend"
161R2.
anusr nachvollziehen"
dhtuprayogah yogasstropadisto 'nusartavyah 128R3; 136R3.
*anusmrti Meditation"
s. buddha-, dharma-, sangha-, sila-, devatnusmrti.
aneka viele"
127R4; 128V 5; 131R4; 145R3\ 151R3.
13 Schlingloff, Yogalehrbuch

193

anta Ende"
amte ca sarva(m) jnya(m n)bhym nirudhyat(e i)ti vyutthnam || 166R5 ex 129R5
ex 130R6 ~ 135V2 ^ 135R5 ~ 139R3 ~
152R3 o* 155V2 =* 165R5 ^ 167R2; amte
ca tadsraye
pravisamti 136R2; amte
ca ratnavarsam muiicati 153R2; ratnavarsah
amta(sic) patit(a) . . . 169R2; an(t)e (ca) devh p(u)spar(atnavarsam utsrjamti|) 170R6;
127R2; 127R3; 135V4 (S. 53).
*antahkuksigata in den Mutterleib eingegangen"
sa(r)vasatvh
mtrbhts cmtahkuksigat() . . . 143R5.
antar im Innern"
125R3; 126R4; 127V3 \ 127R1;127R2; 127R3;
128V3; 129V4; 136V4; 143R6; 160R5.
antargata eingegangen"
118V7; 118V2; 121V5; 126R3; 127R5;
129V 5; 130V 2; 133V 5; 133R3; 134V 4;
136R6; 137R4; 137R6; 143V 2; 143V 5;
146V1; 152R3; 154R6; 157V 5; 158R4;
161V 2; 162V 5; 165V 5; 169R2; 169R4.
antardh verbergen"
sarva jfieyam yogcrasra(sic) 'ntardhiyat(e) 127R1.
*antarmukha zugewandt"
121V6.
antike vor"
bhaga(vato Jntike) 159V5.
*anyatarnyatara der eine und der andere"
156V5.
anyajanman andere Existenz"
158R6.
*anyajnmika hinsichtlich einer anderen
Existenz"
ihajnmikam anyajtmikam(5ic) 158R5.
ap Wasser"
prthivy psu pratisthit| pah vyo vyur
k^e 136R5; s. abmandala, abdhtu.
*apacaya ,, Verminderung''
(samca)ypacayau bahuso gatv 115V5.
apanayana Entfernen"
144R5; 147R1; 149V 2; 153V1/2.
apanita entfernt"
145R5.
apara (2) ein weiterer", (2) ein anderer"
(2): 146V5; 151R3 = 152R3; (2): 152R4.

194

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

aparddha ,, Verfehlung''
158V5.
apasrp zurckweichen'6
(a)pasarpa mrispasarpa parvatam ptaymiti n a
apasarpati 149V5/6.
apahartr Tilger"
s(ar)v(a)s(a)tv(a)vy()dh(m)m apahart samyaksambuddha 152V 5 = 152V6.
*apya schlechter Lebensraum"
(ya)dbhyaspyespapady(am)t(e) 166V1
167V 2 \ apyesu ca duhkham anubhtam
159V1 = 158R1; anamtaparyamtm janmaparamparm apyesv ksipt(m) 159V1;
kirapravho nirgatya prathivi(sic)mandalam bhitv apyagatnm satvnm sarvaduhkhopasamam krtv 146R6; 162R5;
169R5 (S. 32, Anm. 6).
apvr ffnen"
maitr^ayasya hr(day)dvram apvryate
143R6 ^ 141R4; sarvasrotobhyas csya
dvrany apvryamte 143R6; prsvebhyo
dvracatustayam apvrtam
sambhavati
136V1.
*apunya ohne [religises] Verdienst"
trividhh samskr puny ah ap(unyh ninjyh) 137R5/6.
apeksa im Hinblick auf"
tadapeksadosansya 156V3 = 158V1 =
158R3 = 159V3 = 159R5 = 161V6.
*apramna (2) unermelich", (2) Unermelichkeit"
(1): apramno maitrivihrah 145V6 = 146V5 \
apramnapradnasthnmta(ra) . . . 145R1;
(sraypramnata)y
apramna
145V 6;
(pun)y(a)prasavpramnataypramneti
145R1 = 146V6 \ (2): tasyaivpramn^ayasya 149V3 (S. 27f., 37, llff.)*apramnat Unermelichsein"
sray(p)r(amnataylambanpramnatay)
()pramnataypunyaprasavp(ram)nataypramneti 146V 5/6 = 145V 6 l.
*apramnopeks Oleichmut als Unermelichkeit"
(aprani)n(o)peksym 156V5; (apramnopeks katar) 161R1.
apriti Nichtbeglcktsein"
parasukhprl(ti)pratipaksviskaranrtham
153V1.

apsaras Himmelsmdchen"
divyrmodynavimnny apsaroganakalilny 169R4.
abahumna Miachtung"
156V6.
*abdhtu Element Wasser"
131V4; 160V3-, 160V 6.
*abmandala ,, Wasserkreis"
pravho
prthivimandalam bhitv
pmandalam vyumandalam ksadhtum avabhsya 129R2 (S. 31).
abhidru anstrmen gegen"
sarvasatvti
simhavyghrdayas ca tarn
abhidravyamte 144R2.
*abhidharma Scholastik"
stravinaybhidhar(ma)m 166V2.
*abhinirhr teilhaftig werden"
nilalohitvadtam sampadyabhinirhara(ti)
146V3,
*abhipramodan Erfreuen"
cittbhipramodanym 118R2 = 125R2 =
127R1.
abhipreta erwnscht"
abhipretakryvhakatvt | 127V1 (vgl.
S. 68)
abhibh berwltigen"
tirthyagann (a)bhibhya 167R1; (ducarita)crinah sarvn abhibhya 170V3.
abhimukhi bh zu gesicht kommen"
145V 3; 150R4; 153R1; 157R4; 158V 4;
158R2/3; 158R5; 159R1; 159R4; 161R2;
167R5;169R4;170Vl.
abhirata (1) Interesse", (2) Lust"
(1): 135R5; (2): 158R6.
abhiruh steigen"
rdhvam yathgat abhiruhamti 152R2.
abhilasita begehrt"
140R1.
abhilsin begehrend"
162R3.
abhivrddha gesteigert"
'bhivrddhamaitrsayas(ya) 145R4 = 145R3.
*abhiseka Besprengung"
tadanamtaram abhisekenasrayam prinayan
tato| bhrumadhye cittopanibandhab tasmt
pravho nirgatah 129Rl; tato 'bhisekah.....
prinit^rayasya bhrumadhydhastt pravhah
nirgata 134R6; tato 'bhisekah ra.

Wrterverzeichnis
(tnapravhah pra)viliya
(^ra)yam prayati prmayati ca hrdayc csya pravho
ni(rgatya) 154R3; abhiekakle. . .(pravhah). . . sa ca pravilmah
nihsrtai ratnapravhah 165R2; abhisekapravh(h s)th(iti)m (prayamti) 166R5; abhisekapravhnamtaram 15IV3; .. .(abhise)kai simcyamno dryatel evam suvarnamlapitalohitvadtarasbhisekaih 145V4; tato
caturvarnbhisekah
caturvarn buddh
bhagavantah prabhbhir lokam avabhsya tisthamtity etvatl maitrbhise(ka)
146R4; (ca)tuvarnamaitrbhiseka^ 146B5;
indranilavarno 'bhisekah 150R6 (S. 41).
*abhisamskra Gestaltung"
s. anabh, sbh.
^abhisamksip zusammenwerfen66
sarvni mandalni kampayati abhisamksipyamte ca 160R3; asamkipte(5ic) csmim
146V3; yogcrsrayesu yogcr^rayo 'bhisamksiptah 146V5.
*abhiscaka ausdrckend"
nirvidabhiscaka 130R5.
*abhisambuddha vllig erleuchtet"
abhisambuddhm(sie) cryamaitreyam
128V5; abhisambuddha bodhe(sic) 139V4;
abhisam(bu)ddh(o) bodhim 151V6.
abhyhata zerschlagen"
(i)ndryudh(ai)r avidydhipatirpam abhyha(tam) 159R2.
*abhyudayika vom Erfolg herrhrend"
ime abhyudayikena sukhena sukh(i)n(a)h
154V5.
abhyudgam heraufsteigen"
167R5.
abhyunnata erhht"
133R5.
*abhrakta ,, Wolkenhaufe"
samskrespeks utpadyate tato 'sya sphadikamayair abhraktaih kyam avastabhyate 161V2 ^ 161R1; te ca pravith (sc.
nirvnanagare) k^amayair ivbhraktair
avastabdhh pradip iva ^myamte 161R6 ^
162R2; (karu)ndhipatirpam hrdayn nirgatah
(kr)tsn(am) gaganam abhrak(ta iva spha)r(i)tv 148V5 \ abhraktavam
nirgatya sarvam gaganam prya prakravat sarvasatvn upaguhya 144R2; abhra13*

195

kta* iva gaganam prya 143V1 (S. 40,


Anm. 9;S. 44 f.).
amitra Feind"
mrdumadhydhimtram cmitram 147R6 ck
140V2 ^ 153V5 ^ 155V5.
amrta Ambrosia"
naksatram maitrgayaparigrhitasya (adhi)patirpaml tamnirjtam amrtarasam iva
147V3.
a\ aspin da Eisenklumpen"
jvalinn yaspindasamnibhm(sic) 134V3.
ayoghana Hammer"
148R6.
*ayodroni eiserne Sarg[hlfte\"
(ayodr)on(y)ah citm (sc. bhagavatah) 164R$;
ayodrony(a)h s(am)gh()t(e) 148R6/149V1.
ara Speiche"
sahasrracakram 146R2.
*arpin ohne Form"
arupinah skandhm 134V2 (S. 102, Anm. 11).
arcis Flamme"
nnvarnny arcimsi nihsrtya 131V5.
-artham um . . . zu",

um . . . .

willen"

s. viskaranrtham, dyotanrtham, pratipaksrtham.


*arbuda ,,[Embryonalzustand]
Arbuda''
mtuh kuksv arbu(dap)e(sighanapra)skhnukramenal vardhamnam 129V6.
arh sich ziemen"
162R5.
arhant Heiliger"
tathgato 'rh(am) sa(myaksambuddho)
164V1.
*arhatva Heiligkeit"
pattam irasi baddham pasyatil etac carhatvavisesabijaml 169V 4.
*alamkra (1) Fertigkeit", (2) Zierat"
(1): smrtyupasthnnirvedhabhagiyas(r)manyaphalni sasambhrlamkr(ny) 128R3;
yogavitysa(5ic) yoglamkarokta^(5ic) ca vises 147V4; (2): satvn sarvlamkravibhsitm 153V 6; ime mahrhlamk()rlamkrt ami sramanlamkrlam(krth) 154V6
(S. 84, Anm. 16).
alamkrta geziert"
154V6.
*altaeakra Feuerwirbel"
ekavisaylambanasamartham c sya cittam

196

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

bhavati na bhyah altacakravatl sarvavisa(y) . . . 149R5 (S. 140, Anm. 14).


*avakram berkommen"
tesu karunm avakrmati 148R4; (ka)runvakramati 162R6; daurgandhyam kyam
avakrmati 149R6 (S. 137, Anm. 11).
*avakrnti Zustandekommen"
niymvakrmti 134V6.
avacchad berdecken"
satv
avacchdit drsyamte 158R4.
*avatr (1) hinabsteigen" (2) begreifen"
(1): bldrakas
kmcanacakram avatarati 127V4; 127V 6 \ (2): s(atvh)
ssanam
avataramti 154R3; (dhyt)m(ap)r(a)t(i)ty(a)samutp()d(e)
V(a)t(a)r(a)t(i) 137V2.
*avatrpya das Scheusein"
tato (hriava)trpyadhipatirpam utpadyate|
a(vad)tavastraprvrt stri purusas ca hri
klesebhyo lajjati avatrpyam duscaritebhyah
hri duscaritebhyah ava(trpya)m (du)s(c)aritaphal(t) 159V1/2.
avadta wei"
candrvadtam 144R1;
(a)vadtacandramandalacit(a) 121R1; avadtbhh pattb
127V 4; stri
suvarnavarnvadtavastraprvrt 151R1 ^ 148V4; =(a)vadtavarn
avadtavastraprvrt 161V2/3 ^ 162V6 ^
163R2; a(vad)tavastraprvrt stri 159V1/2;
nilapitalohitvadta s. nila.
ayadra ffnung"
140R6.
avadr aufbrechen"
148R6(1).
avabaddha umwunden"
stri
sapattasuvarnamlvabaddh
151R1; pratityasamutpdacakram
karmaklesvabaddham 159R1 ^ 159R4.
avabodha Erleuchtung"
(sva)yamavabodhdhipatyasampad
yath
pratyekajinnm 143V3.
avabhs erleuchten"
pravho
narakm prets(5ic) cvabhsya
pmandalam vyumandalam ka,^adhtum avabhsya
yvad aghanisthm devn avabhsya 129R2 ^ 133R1;
astau mahn(arakn avabhsya) 117V3 \
pravho
ratnaprabhbhir lokam ava-

bhsya 154R4; buddh


prabhbhir lokam avabhsya 146R4; buddhagunaprabhbhis cvabhsito loko 155V1; (buddhapratimh)
svam svam gocaram lokenvabhsya 162V2; lokair lokam avabhsitam 151R4 ^ 159V4; tirthyagann (a)bhibhyvabhsya 167Rl; samskrtsamsk(r)tm avabhsya 166R5; lo(ka)m avabhsya
139V4; avbhasitam satvsatvkhy(a)m
169V2.
avasis brig bleiben"
saddhtumandalny ava^isyamte 160R2.
*avasesa restlich"
avasesam mnasam duhkham 148Rl.
*avasyyabindu Reiftropfen"
(krtsnam) tr(aidh)tuk(am buddhsray)(m)s
ca sksmn av^yyabindn iva spandamnam 131R3.
avastabh zum Erstarren bringen"
sphadikamayair abhraktaih kyam avastabhyate 161V2 \ te ca pravisth (sc. nirvnanagare) ksamayair ivbhraktair avastabdhh pradip iva smyamte i62i?6; ktgrvastabdham svam srayam payati
125R5; ()k(^anibhaih) ktgrai 'vastabhyamte(^c) 159R3 ^ 160V1; buddhapratimh yathsvabalagocaram lokinvastabhya
162V2 \ (pr)thivim avastabhya 126V4; mahnarakn sarvn avastabh(ya) 149R1; akasvastabdham(^c) 118V4; 118R1 (S. 44f.).
avasic bergieen"
stri ksiradhrbhih ariram a(vasimcati)
148V1.
avasth Zustand"
s. kalalvasth, upasamnuklvasth, vijnnvasth.
avasth verharren"
avatisthati 144R2; avatisthamti 132V5; avatisthate 146V5 \ atisthate(5ic) 130R4; avasthita 134V 5, 166R1; s. avasthitasamdhi,
anbhogvasthita.
avasth (caus.) trennen"
pravhah
rdhva(m) yvac caturtham
dhynam iti
tadvarnam evvasthpya
152V1; astra
yoginas csrayam sad
bilm bhgasah taccarmany avasth(payati) 160V2 \ sastrni
(addh)tuvibhgena krtsnam satvasamudram avasthpa-

Wrterverzeichnis
yanti 160V 5 \ rasadhr-jagad avasthpayamti 136V6; 128R5.
*avasthitasamdhi in Kontemplation verharrend"
krtaparikarmanah avasthitasamdheh 130R4
~ 130V5.
*avahitacetas der sein Denken gerichtet
hat auf. . ."
yatanapariksvahitacetasah 135V 2; 124V1;
124R3\ 148V2.
*avikampya unerschttert"
avikampyam tmnam pasyati 126V6.
avidy Nichtwissen"
astau buddhapratimhtammukh(a)n(i)hsrt(ai)r (i)ndryudh(ai)r avidydhipatirpam abhy aha (tarn), nirudhyate vi(cak)ri
(bhavati) 159R2 ^' 159R6 c* 139V3; 137V6.
*avisayi bh unzugnglich sein"
vajrsanam tesm avisayi bhavati 144V6.
*avici Avici-[Hlle]"
(avicau) narake tu satsparsyatangnipravarsanarathngakilasamkvacal 149V1 (S. 139,
Anm. 4).
avitarga nicht frei von Leidenschaft"
146V4; 156R3; s. vitarga.
avyatimisra unvermischt"
134R5.
avyucchinna ungeteilt"
pravho
avyucchinnam yvad aghanisthm devn avabhsya 129R2.
*asabala nicht fleckig"
(sil)ny akhandny acchidr(ny asabalni)
167R4.
asiti achtzig"
a&lti krimikulasahasrni 160R5.
*asuci (1) Unrat", (2) unrein"
(1): mtodivat pariprnam nnprakrair
asucibhih svam srayam pasyati 128R5;
samudracatustayam
sarvsucipariprnam
130R5] (2): kaksyputa iva nnsucidravy(n)i 130R4; sarvhy(5ic) asucidrvyni(5ic)
130V1; ksudrair asucidra(vyaih) 132V3; sarvsucidh(rbhir) 135R4, 135R3.
*asubha (2) Hlichkeit", (2) hlich"
(1): gunnm
asu(bh)dmm 162V5;
(asu)bhdiprayogena 166V2/3; (2): (m)it(r)am
(asu)bhamalinavasanam 147R5 (S.
59ff.).

197

*asaiksa vollendet"
asaiksadharmdhip(a)t(i)r(pam) 162V 5.
astan acht"
astabhir krai^ parmr^ati 133R6; astau
mahnarakh 148R5 = 145R5 = 117V3 \
astau buddhapratimh rystmgasya (mrgasydhipati)rpam 159R1; 148V 3,
*astnga achtgliedrig"
rystmgasya (mrgasya) 159R1 ^ 166R1.
*astngopeta kostbar"
(u)bh(a)yah(a)st(ngu)linihsrtbhi]i
astmgopet(bhih sa)l(i)ladhrbhir 148V6/R1; astmgopetam pniyam niscarati 149V3.
*asamskrta unerschaffen"
abhiekapravh(h)
(dharmm)
samskrtsamsk(r)tm(5ic) avabhsya
166R5.
asamkhya unzhlig"
bodhisatva
asamkhyasatvaparivrah
151V6.
*asatvkhya unbelebt"
satvkhym& csatvkhym^ ca tulayati
160R2; (saddh)tuvibhgena krtsnam satvasamudram avasthpayanti asatvkhyam
ca pamcadhtuvibhgena 160V5 \ 129V1; s.
satvsatvkhya (S. 85, Anm. 6).
asambhrnta unerschttert"
150V3.
asi Schlachtmesser"
148R5.
asthi Knochen"
gnvsthi 137V3.
aham ich"
148V4;149V2)152V5.
kra Aspekt"
astabhir kraih parmrsati 133R6; ryasrvakas tathg(atam)(=dharmam, = (samgham), = (s)il(am)) (kratab samanusmarati) 163R6 - 165R5 = 166R6 = 167R3;
s. anumodankra, prmodykra, nirvidkra, vajrkra (S. 173, Am 5).
*klika zeitlos"
(dharmah)
(k)likah(<sic) 165R6.
ksa ther"
prthivy psu pratisthit| pah v>yo(sic)
vyur kse 136R5; pravho
pmandalam vyumandalam kasadhtum ava-

198

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

bhsya parivartya 129R2; = (yva)d vyumandalam bhitv (kst pa)rivartya


135R3 = 135V1 = 133R1; kse ca tailadhrah patitli 160R3; (rat)n(a)pusp(a)v(arsam k)sm(sic) patati 154R2; ye ckse
pndar (sc, pattk) 121V5; (pr)thivim avastabhya tisthati| dvitiya ksaml 126V4;
loke saty ksm prajnyate 136R5; ksadhtuli caksuhsausirydinm 128R6; madhyamam gandam ksadhtuh suirataratvt| 160 V4; samkham kasadhtunimittaml
129V5\ (tata ksadhtum sampadyate)
k()s(adhtuva)rnh pra(v)h gacchmti 131R1; tiksnam ks(avar)na(m)
sastram 150R5; ksavarn stri 165V6 =
162V3; ksanibhh patt 148R5 = 130V5;
ksanibhnm bu(ddhnm) 133V4\ ksamayair ivbhraktair ayastabdhafc 161R6;
ksanibhair abhrakter(^c) 162R2; ()k(sanibhaih)
ktgrai 'vastabhyamte(sic)
159R2/3 = 159R6; akavastabdham(sic)
118V4 (S. 42, 48).
*ksi bh therisch werden"
amte sarvam nirudhyate ksi bhavati ca
lokah 130R6 ^ 130V3.
kirna erfllt"
167R2,
*kut anschlagen"
bha(gavantam dhrm)y(m) gandikm kotayaiiitam 161R3.
kula durchsetzt"
ph(e)napindkulamsrayam 118R6.
krsta angezogen"
rasmibhir
jfieyam krst(am) 169R2; tamtukalpais ckrsth samkal 136V2.
ksip stoen"
janmaparamparm apyesv ksipt(m)
159V1.
gam herbeikommen"
131R1; 131R2; 135R4; 152R2.
crya Lehrer"
s. yogcrya.
jfi Befehl"
j (ii)dhipatyasampa(d ya)th cakravartinm 143V2.
tman selbst"
yogcrah tmnam pasyati 128V5 = 118V3

~ 128R1 o* 131R5 ^ 144R5 c* 147V2 s*


161V2 =* 169R5 c* 170V2; 116V6; 140V4.
*tmadrsti die [falsche] Ansicht, [es gbe]
ein Selbst"
tmadrti (pratipaksrtham
skandhaparikrabhyate) 132V1.
*tmaparikalpa Einbildung einer Seele"
tmaparikalpopeks 156V4 = 160V1 ==
161V5.
*tmtmiyavirahita ohne Seele und Seelisches"
(lokam)
tmtmiyavirahitam 130V 6 =*
161V1; dhtuh
tmtmiyavirahitab
160V6/R1.
^trsana Erschrecken"
trsanrtham kle^aparvatah
(utpadyate) 150V2.
darsa Spiegel"
130R2; 158V1; 167V 5.
^darsamandala Rundspiegel"
170R4(S. 189, Anm. 3).
dya mit"
129R3; 144R2; 150V 4; 150V6.
ditya Sonne"
dityaramay(ak) 118R1 ^ 127V6 \ 154V 3.
dityamandala Sonnenscheibe"
dityamandalara^mibhir 134R5; simham dityamandalopacitam 126V1; pamca sveta
gaj dityamandalacita&rayti 165V4; (sap t a ) . . . buddhh tammrdhasu sapt()d(it)y(a)mandalni 166V6 \ sarvabuddhnm nbhiu cdityamanda(lni) 134V5j6'; hrdaye
csydityamandalaml 169V2 \ stri snehapariprnavaidr(yabhjanacitotpadyate|) bh()j(a)n(e)su vajrsana(^c) vajrsanesv dityamandalnil tesu buddh bhagavamtafe
(tato buddh bhagavamta dityama)nd(a)lesu pravisamti(| tni va)jrsanesu tni bhjanesu tni smrtinimittesu
smrtinimittam yogeramrdhani 165V3-R1
~ 166R3-R4 c* 167V4-R1 c* 169R4/5
-170V3; 124V1; 124V 3 \ 126V5 \ 128V 5 \
133R3; 162V4; 166R5; 167V3 (S. 42).
*dinava Misere"
triprakrasya vedayitdhyava(s)nasydmavm 158R4.
dau anfangs"
147VL

Wrterverzeichnis

*dhraka Halter"
tatrdhrako nisrayah brhmanak mamtrh pudgalam nihsrth 136B4.
*dhipatyasampad Zustandekommen der
Macht"
(1) j(n)dhipatyasampa(d ya)th cakravartinml (2) raksadhipatya(sa)m(pad ya)th caturnm mahrj()nm| (3) v(i)sayaparibhogdhi(patya)sam(pad
yath
trayastrimsatml (4) kmdhipatyasampad yath mrnml) (5)
(dh)ipatyasampad yath brahman(m (6) sva)yamavabodhdhipatyasampad yath pratyekajinnm |
(7)
. .143V2-3.
dhr behalten"
(yata)nni yugapad utpamnny dhryamnni praviliyamte 135R6.
*dhytmaka das eigene Selbst betreffend'6
sa (sc. pratityasamutpda) (ca dvivi)dhah
bh yah dhytmaka^ ca 136R3.
*dhytmika das eigene Selbst betreffend"
(b)hyam parikarma dhytmikam tu parikarma 132V2.
*nanda nanda"
sthavir(am )namdam mamtrayati 164R3.
*npnasmrti ,,Atmungsachtsamkeit"
npnasmrtir bhvayitavy 128V3 \ pratyutpamnpnasmrtibhvan(5ic) 128V4\ npnasmrti saparikarml savises nispamn
vak(tavy|) 128R1 (S. 27f., 51ff 63ff.).
*ninjya indifferent"
trividhh samskr punyh ap(unyt ninjyh) 137R6.
*nusamsa Segnung"
(rm)samss cotpadyamte: (111) 147V5.
(S. 118f.).
p (caus.) einnehmen"
kutikm pith 159V5.
*puta Entfalten"
s. pu^puta.
pr erfllen"
pravhali (hh)
sthitim prayati
(yamti) 117R1 = 133R4 = 135R5 = 147V1
= 154R5 = 165R4 = 166R5 - 152V2 \ =
mahprthivim prya 129V1; dev sthitim
prya 147V2; devs ca krtsnam gaganam
prya 150R2; brahmais ca gaganam p-

199

rnam 148R2; (buddhfc.) simhandena krtsnam lokam pr(ayamt)i 166V4; sa sabdab


anamtalokadhtun ()pr(a)y(a)t(i) 161R3;
svsrayaprabhbhih krts(n)am (lokam prayati) 131V2 \ (ratna)puspavarsaih lokam
prayati 162V4; nadibhir yogcr(r)ayam
pryate 152R2; (nadi)
sarvam gaganam
prya 144R3; maitri sthiti(m prayati)
147V4; (catu)rdisa pryamte 165V1; yvad
aghanistha sthnmtaram prya 146V2;
164V5 (S. 37).
blia leuchtend"
s. nilbha, avadtbha, vaidrybha, indranilbha, padmargbha, suvarnbha.
-bhsa leuchtend"
candrdityasambhsam 154V3.
*bhoga Spannung"
s. anbhoga, sbhoga.
mantray anreden"
164R3.
*ainukhi bh zu gesicht kommen"
148R5.
*yatana Bereich"
skandhadhtvyatanapratityasamutpdryasatydi 169R1; bhyyatanni 135V3; (yata)nni yugapad utpamnny dhryamnni praviliyamte 135R6; adyatananimittam 135R6; yatanarasasamudram 136V4;
yatanarasapurusa 136V1, V2; yatanarasapariprn puskirini 136V2; yatanacith
sa(m)kalh 136V1, V2\ yatanacitm dhvajm 134R5; (sthitir)
yata(na)p(a)riprna drsyate sthityupari ca parvat vicitryatanacit 135V2 \ brahmabhih ra(tna)pupamuktanaksatryatanacitaih
tebhya^
cyatanebhyah rasadhr patit
yathoktasubhanimittya(tana)citam jagad avasthpayamti 136V5-6 \ buddhapratyekabuddha^rvakh
yathoktalak^anyatanacitht 136R1; 134R6/135V1; 134R2;
135V3; 136V3; 157R4 (S. 27f., 47, 104ff.).
*yatanapariks Betrachtung der Bereiche"
cyatanapariksrabhyate 134R1; yatanapariksvahitacetasah 135V2; yatanapariksbhiratasya 135R5.
*yatanaprayoga bung der Bereiche"
yatanaprayoganispattih 136R2,

200

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

yudha Waffe"
grhitatailaptryudhs trayah p(urush)
162V3 ^ 165V6.
*rastra Eisendraht"
crastrakraechidn klstre 148R6.
raksa Schutz"
raksadhipatya(sa)m(pad) 143V2.
*rati Unlust"
Irsyratipratipaksa 152R6 = Irsyratipratipaksa 155V3; vivrtaviniguhyadesabhayasokavisdratimtsaryersypa. . . 147R5.
rabh beginnen"
cyatanapariksrabhyate 134R1; pratityasamutpdapariksrabhyate 136R3; (skandhapariksrabhyate)
132V1;
()rabhyasyamn(sic) 152R5; rabdham 153R3.
rambha Beginn"
(atipa)tirprambhali 121V6.
rma Hain"
divyrmodynavimnny 169R4.
*rpyvacara sich auf die Welt der Formlosigkeit beziehend"
ksirapravho
kmarprpyvacardevparivrto 147V1.
rta niederschlagen"
karunrtasya 147R6/148V1.
*ryamaitreya der edle Maitreya"
s, maitreya.
*ryasrvaka der edle Jnger"
s. srvaka.
*ryasangha die edle Gemeinde"
s. sangha.
*ryasatya die edle Wahrheit"
s. satya.
*rystnga mrga der edle achtgliedrige
[Heils]weg"
s. mrga.
*lambana Objekt"
lambane kmadhtvlamban (sc. maitri,
karun, mudit, upeks) 140V1 = 147R4 =
153V3 = 155R1; alamban(p)r(amnatay)
apramna (sc. maitri) 145V6 146V5 \
ekavisaylambanasamartham
cittam
149R4; 157V'2.
loka Lichtschein"
loke saty ksam prajnyate 136R5; bhagavan
tamnihsrtai^ clokai(h sat)v(m) av(a)bh(si)t(m) 159V4 =* 151R4; (buddha-

pratimh)
svam svam gocaram lokenvabhsya 162V 2; yathsvabalagocaram
lokinvastabhya (sic) 162V 2 \ ratnnm
lokah 124R2; 143V 5.
varjita zugewandt"
(karu)nvarjitacetasah 148R5,
*vhakatva Herbeifhren"
abhipretakryvhakatvt 127V1.
*vhika herbeifhrend"
mahkarunvhika (sc. karun) 152R5.
vir bh sichtbar werden"
148V3.
viskarana Deutlichmachen"
-viskaranrtham 147R2, 152R6, 153V1,
155V3.
vrta umwickelt"
ratnajlvrtam 169R4.
*venika [fr Buddhas] charakteristisch"
s. smrtyupasthna.
*saya Zuwendung"
s. maitrsaya, karunsaya, apramnsaya,
duhkhitpanayansaya, hitasukhnumodansaya; vgl. adhysaya.
s Wunsch"
150R4.
sivisa Schlange"
mahbht^ivisa 160R5 = 117R2; 129V 5 \
157V3 \ 158V5 (S. 48, Anm. 2).
*sraya Gestalt"
pravh
yogc(rsrayam)
(spharitv) 131R2; = prayamti 135R2;
pravhais
svam
srayam
prya(te)
131R5; srayam prayati 143V1 ^ 165R2;
(pravhh)
srayam prinayanti 133R4;
abhisekensrayam prmayan 129R1; prinitsrayasya 134R6; varsadhrbhir iva
yogcrsrayam pryate 136V4 ^ 123V6 =*
124V4; nadibhir yogcrs(r)ayam pryate
152R2 c* 152V1 ^ 130R4; rasena srayam
puraya(ti) 130R2 ^ 131V1; nirmalar(asa)pariprnam srayam 130R2; prnam svam
srayam vyubhih 118V2; pariprnam nnprakrair asueibhih svam srayam 128R5;
jne(ya)m sarvam tad^raye pravisati 136R1
c* 121R6 ** 144R5-6 c* 136R2 ^144V1; =
'ntardhiyate 127V6; yog(crsra)ye patits
136V 4 ^ 136V 6 \ amtarsrayapravis(t)h
141R6; svsray(m)targatam 169R2; yog-

Wrterverzeichnis
crsrayesu yogcrsrayo 'bhisamksiptah
146V5; buddhh yogcrsrayam padmair
vyavakiramti 131R3; buddh
(yoga )crsr(a)yam vestayamti 144R1; ktgrvastabdham svam srayam 125R5; yoga (c)rsrayah
candramandalasamksah
127Rl; sphadikamayo
srayas 127V 2;
vajrmayah srayo 144V5; srayo laksannuvyamjanavirjita 130R6 ^ 150R3 ^
163V2; mahms csrayo 149V6 ^ 149V3;
pattabaddham srayam 130V4; (sva)m srayam phenapindamayam 132R2 z~118R6;
jirnam svam srayam 118R5; (v)yukalpyog(crsrayam
cchidri)
kurvanti
131V6 \ cchym sv^rayasya 149R4; yogcrsrayanihsrtni sastrni 160V5 \ sastra
yoginas
csrayam
avasth(payati) 160V2; svam srayam sa(rvama)ranapratyayaih
parivrtam
srayc csya
brahmno nirgatya 144R4; svsrayaprabhbhih 131V2 \ saddhtumayam srayam
160R4; buddhsraya 122V4, 131R3, 144R6,
152V2, 155V1, 164V% 165R1; bhagavadsraye 162R1; brahmsraya 144R6; brahmasadrsam srayam 153R5; cakravartysrayam 144R5\ gaj dityamandalacitasrayh
165V4; sraye kmadhtvsray (sc. maitri,
karun, mudit, upeks) 140V1 147R3/4
= 153V3 = 155R1; (sraypramnata)y
apramn (sc. maitri) 145V6 = 146V5 \
123V1; 124R1; 124R3; 128V 2; 129V1;
129V 3; 129R4; 130V 2; 130R4; 131R1;
145R6; 146V 6 \ 146R6; 159R3; 160R4;
161V6; 170R2 (S. 21,33 f).
svas einatmen'6
svasatah 127V% 127V 5, 127R2.
*svsa Einatmen"
svsaparigrhitam cittam 127Rl; svsaparigrhitah sa bladraka(h) 127R3 ^
125R3; svsnm|(5ic) adhipatirpam
121V 6 \ 124V 6 \ 122R4.
*svsaprasvsa Ein- und Ausatmen"
118R2; 118R5; 118R6) 121R2; 121R6;
123R4; 124R1; 125V1; 126R1; 127V1;
127R6
sana Thron"
149R6; s. vajrsana, simhsana. (S. 21,
Anm. 9).

201

stirna bestreut"
suvarnavluksti(rn) 153V 5.
srava Befleckung"
sravaksaya 134V6.
svda Genu"
sukhvedansvdavas(sic) duscarita(sic) samutthpitam 158R1.
hra Schnur"
s. mukthra.
*iiijana Bewegung"
126R5.
indranila saphirblau"
buddh
(tesm usnisapra)bhy krtsnam
jagad indranilbham drsyate 144V6; indranila varno 'bhisekah 150R6; indranilapadmargasphadikavarne 146R3; 121R5.
indryudha Regenbogen"
bhagavmmukhnihsrtair indryudhair vajrkrai sarvvidydhipatirupni par hatni
nirudhyamte 159R6 ^ 159R2; indryudhavarn stri 147V3.
*indriya Fhigkeit"
157R2; 166V5.
is wollen"
kva gantum icchasiti 162R6.
ista erwnscht"
istavisaya 157V5, 157V6.
*ihajanma die jetzige Existenz"
(ihajanman)i
anyajanmani ca 158R5.
*ihajnmika hinsichtlich der jetzigen Existenz"
ihajnmikam anyajtmikam(sic) 158R5.
ihaloka diesseitige Welt"
ihaloke paraloke 153R4.
*Irypatha Krperhaltung"
sarverypathesu 169V2 = 144V4 (S. 124,
Anm. 15).
Irsy Neid"
irsyratipratipaksa 155V3 = 152R6; vivrtaviniguhyadesabhayasokavisdratimtsaryersypa. . . 147R5.
Isvara Herr"
I^varajanag . . . 154V6.
ucita passend"
142V2.

202

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

*utkarsana hervorheben"
utkarsanayogena 124R5.
utksipta ausgegossen"
145V1.
uttara hheres"
147V6 \ s. adharottaravibhga
*uttarslrsa mit dem Haupte nach Norden"
(wttarsirsam mamcam) 164R3.
uttr heraussteigen"
samudrebhya uttarati 131V2.
utthna Erwachen"
128V2 \ s. vyutthna.
utpatti Entstehen"
bhyo (sc. pratityasamutpda) dvividhati
pratisthitotpatti kramabhedt 136R3; utpatti hriyav(sic) prthivi nit(srt)h 136R4-R5.
utpad entstehen"
utpadyate, -yamte 121V1; 123R1; 126V2 \
127R1; 128V 2; 128R3; 129R1; 129R6;
130V 2; 130V3; 130V 4; 130V 6 \ 130R6;
132V 3 \ 132V 4 \ 132V6 \ 132R2; 132R3;
133R5; 135R6; 136V1; 141R1; 143V1;
143R4; 144V 5; 144R3; 145R3; 147V5 \
147R5/6; 148V1; 148V 4; 150V2; 150V5;
150R4; 151R4; 152V 4; 153V6 \ 153R2;
153R3; 153R4; 154V1; 154R3; 155R4;
156V 6 \ 156R5; 157V1; 157R2; 158V 2/3;
158V 3; 158V 4; 159V1; 159V2; 159V 4 \
159R2; 159R5; 159R6; 160V1; 161V 2 \
166V4; 167V4; 168V 4 \ 168R1; 169V5;
169R1; 169R3; utpadya 127R4; 161V6\
utpanna 135R6; 148V4.
*utsada Nebenkammer [einer Hlle]"
astau mahnarak sodaotsadamahparivrm 145R5 c* 148R5 (S. 31, Anm. 7).
utsrj (1) entlassen", (2) im Stiche lassen"
(1): dev
pusparatnavaram utsrjanti
128V4 ^ 150R2 ^ 152V6 ~ 170R6; 149R2;
(2): (u)ts(r)jya dubkhitm 162R6.
udaka Wasser"
udakasamksobhah agnisamk^obhah vyusamksobhah yathsamvartanisu 161V4 \ wdakam vyun kiptam
satvn simca(ti)
150V'6; udakaprav(hebhyah) 131V4; udakavarnam budbudam 158V3 ^ 132R4.
udra erlesen"
bhagavn
dhiragambhirodrena ca
svarena dharmam desayati 149V4.

udsina gleichgltig"
(a)dhimtrdhimtre mitre mrduni evam
udsine 140V2 ^ 147R6
153V4.
udir ausstoen"
buddh$ ca sabdam udirayan(t)i 121R5 ^
136R2.
udgam zum Vorschein kommen"
ttdgacchamti 121R3; wdgacchamto 144V6;
udgatahi 151V4.
uddhata herausgeschlagen"
(u)ddhatni ca marmny 115R4.
uddhr herausziehen"
(sa)tvan uddharati 148R2; 118R4; 125R4;
mahvyasanapamkd u(d)dhrt 148R4.
*udbharjana Rsten"
(pratpa)ne narakel bhrstodbharjanapitaraprave^am 149V1,
udyata bereit"
149R6.
udyna Garten"
135R4; 151R5; 169R4.
udvah emporfhren"
satvn udvahati 143R5; = udvaheyam
143R5; - wlvahato 144V4.
udvahana Emporfhren"
s(a)tv(o)dv(a)h(a)na 143R4.
udviks durchschauen"
brahmno
tarn maranapratyayn udvikate 144R4.
*upakarana Lebensmittel"
(sa)r(v)opakaranavrstim mumcati 148V6 ^
sarvo(pakara)navarsam amte ca ratnavaram muncati 153R2; grhitaratnopakaran
puru 170R5.
*upaklesa zustzliche Befleckung"
kleopaklesa 119V3.
upagam eingehen"
(upagacchati) 147V6.
upaguh Umhllen"
cchatrm ca anam(tam lokam) spharitv
sarvasatvn upaguhya titha(ti) 150R5] patth
^krtsnam s(atvasamu)dram upaguhya
tithamti 130V5 \ padmam
(sarvasatvn
upagu)hya 145V5; ratnavarsena krtsnam
satvasamudram (u)pagdham 131R6; ratnaktgrair ivopagudhm 153R6; k^anibhair abhrakter (sie) ivopagdhy()m . . .
162R2; 127R6; 144R3; 151R2;
155R4.

Wrterverzeichnis

upaghta Zerstrung"
parasparopaghtaib. upahanya(mnm)
134V2.
upaci bedecken"
upaciyate 123R6; wpacitam 126V1.
*upatpibhava Empfinden des Schmerzes"
aparopatpibhavab.
amgni
karunyh 152R4.
*upatisya Upatisya"
upa(tisyakolitavina)yanam 164R2.
upadista dargestellt"
dhtuprayogab. yogasstropadisto 128R3.
upadesa ,, Unterweisung6 c
npnasmrti
upadee bhvanym
c&128R2)141V3;142V4.
*upanibaddhacetas [der Yogin], der sein
Denken konzentriert auf. . "
karunsayasya bhrvivara upanibaddhacetasa 151R4; buddhnusmrtiprvam mrdhn(opanibaddha)cit(t)as(y)a 165V2; ^ dharmnusmrtip(r)v(am hrdayopanibaddhacetaso) 166R2; ^ (hrdayopanibaddha)cetasali
167V4 \ z* (silnusmr)tiprvam hrdayopanibaddhacetasah 167R4 = 169V5 = 169R3;
^ deva(tnusm)r(tiprvam hrdayopanibaddhacetasab)i70J?2;(muditopa)n(i)bandhacetasah(5ic) 153V5; maitr^ayasya apramnapradnasthnmta(ra)
(u)p(a)n(i)baddh(a)c(e)tasas 145R1; (apram)n(o)pek^ym yatho(k)t(a)sthnmtaresv anyatarnyatara upaniba(ddhacetasali)
156V 5;
prsthatah upanibandhacetasah(sic) 155R2;
155R3 (S. 36).
*upanibandha Konzentration"
s. cittopanibandha.
up am herheibringen"
131V3.
upapad wiedererstehen"
sugatvy(sic) upapadyam(te) 149V5; devespapadyamte 150V1; apyespapady(am)t(e) 166V1 = 167V2 \ rpvacarm^ ca
caturdhynopapannm 145R6.
upabhoga Ergtzen"
135R4.
uparaeita versehen mit"
stambhopara(ci)tti ktgr 121R4; trakoparacitena ca purusena 125R4; vityamandaloparacith(5ic) 124V2.

203

uparam zur Ruhe kommen"


upar(a)m(a)nt(am) 128V2.
uparama das zur Ruhe Kommen"
vitarkavicroparamt 126R6.
upari ber"
118V4; 120R3; 123R6; 127V5; 128V 5 \
128R5; 130R1; 135V 2] 144V 5; 145R6;
146V1; 151R2; 152V6; 169R6.
uparyupari jeweils ber"
128R1.
upasam zum Erlschen bringen"
duhkhny uamayamti(sic) 141R5; vedanopasmyati 148V1.
upasama Erlschen"
upa^amnuklvastha 136R1; sarvaduhkhopasamam krtv 146R6; pradipa ivopasamam gaccha(ti) 162R3 ^ 135V6 \ cittada(mopa)^amena samanvgatam 154V3.
upasamasukha Glck des Erloschenseins"
upa&amasukham anubhavati 130R6
^
130V 4 =* 131R5.
*upasampanna ordiniert"
sarvopasampannnm
etad darsanam utpadyate 169V5,
^upasamhra Schaffen"
hitasukhopasamhara 140V1/2, 141V1, 141V2
(sa tesm tmaparikalpopeksm upa)samharati| tadapeksadoan^aya| tadupasamhrahetos ca bhagavn utpadya 161V6.
*upasamhr schaffen"
satvasamudram abhimukhi bhavatil sa tesm viaya-(:= vedayita- = (blcaritaraty-),
= bhavmga-, = (tmaparikalpa)-)^peksm
upasamharatil tadapek^adosansya 157R6
= 158R3 - 159V3 = 159R4 = 161V6 \
140V 6 \ 143V 2,
upahan erschlagen"
upahamti 157V6 \ upahanyamnam 134V2.
upahata geschlagen"
duhkhair pahatam(5ic) 147R6\ rogair upahath 148V3.
*updna Ergreifen"
137R1.
*upeksaka gleichmtig"
satv
upeks(a)ks 159V6; i^peksakasya
viharatah 161V 5; 155R6.
*upeks Gleichmut"
muditsamanamtaram
upeks nirdis(t)

204

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(bhagavat) t a d ucyate-(u)peks nispann bhavatil atha kimsva(bhv upeks tad ucyate|) 155V26; (stri) . . .
(a)vadtavarn avadtavastraprvrt paryamkena niannnbhogvasthit upeksdhipatirpam 161V3; upeks samtisthate 158V3
= 161R1; duhkhym vedanym upeks
samtisthate 158V 6 \ sukhym vedanym
upeks samtisthati 158R2; satv
upeks(sic) pratilabhante 158R4 ^159V4; tasyopeks dri bhavati 162R6; (visaye)bhyah
upeksm pratilabhante 158V1, s. visayopeks; s. vedayitopeks; blacaritaratibhyas
copeks 159V3, s. blacaritaratyupeks;
samskrespeks 161V2 \ 161V5 \ s. tmaparikalpopeks, apramnopeks (S. 27, 43f.,
55, 156 ff.).
upeta (2) begeben", (2) erlangt",
(1): (i)me mahbht(a)samatayopetb ami
cittasamat(a)y(ope)t 154R1; (2) srvakagunopetms 154R3.
ubhaya beide"
136V1; 148V 6; 154R6; 156V 2; 157R6.
umpati iva"
141V6/R1.
urupramna in weiter Ausdehnung"
urupramn bhsur manayah 128V5.
ulk Fackel"
vijnnadhtuh markatabladrakabinducitolkdim 128R6; ulksahasrni cmtahsam(u)d(r)e nipatamti 127R2; samprajany(a)sy(a) (sc. adhipatirpam) (purusah)
^lkahastah 169V1 (S. 48, Anm. 8).
*usnisa Usnisa"
buddh usnisaprvadarsant kramenodgacchamto drsyamte(| tesm usniapra)bhy
krtsnam jagad indranilbham drsyate 144V6.

^ rdhva(m) yvac caturtham dhynam


iti 152V1; adha urdhvastham jfieyam 169R2;
rdhvam yathgat abhiruhamti 152R2\
rdhvam anavasthyinim 158R2; 128R5.
rdhvamukha aufgerichtet"
urdhvamukhas tisthat(i) 129R6; sudvikasalkbhi(sic) rdhvamukhbhih 121V3.
*rjubhva Geradheit"
127V1.
*rddhipda Machtstufe"
(caturnm rddhipd)n(m) catvri vaidryasop(nni) 166V 5.
eka ein"
ekasmim bhge 154V2 \ ekakramena 169V5 \
ekaghano 131V4 (S. 93, Anm. 8); ekavisaylambanasamartham
cittam 149R4.
ekaika einzeln"
ekaikasya satvasya 158V1 ^ 158V2 \ 144R1.
ekaikasas im einzelnen"
159R5; 160V 6.
evamjtiya derartig"
evamjtiyam darsanam 170R6.
*ehipasyika einladend"
(dharmah)
ehipas(y)i(kab) 165R6.
*ehibhiksuk die Komm-als-Mnch-Formel"
bhaga vms caihibhiksukay pravr j ayati
159V5 (S. 163, Anm. 7).
*audbilya Entzcken"
. . .vidhuraudbilynuklamanasikrnamtaram 155V 4.
*aupanyika richtungsweisend"
(dharmah)
aupanyikah 165R6.

*kaksyputa Grteltasche"
tatra kaksyputa iva nnsucidravy(n)i
ru Schenkel"
130R4.
uruh vipitakam 116V5.
*kadama Schreibstift"
*rn Drn"
(tesm) (sc. buddhnm)
urnpra- 132V6.
kantaka Dorn"
bhy candrvadtam (sc. jagat) 144R1.
150V
4.
rdhva aufwrts"
kataina was"
urdhvam adhas ca spharitv 136V2 ^
136R1; adhs cordhvam ca g(atv) 150R6 =. 160V1.
katara was"
154R4; 146R5; (^)r(dh)vam yvad agha158R5;
159R6; 165R5; 166R6; 167R3.
nithaparyamtam 129V4 ^ 169V6 ^ 146R1;

Wrterverzeichnis

kathay sprechen"
bhagavm
kathayati 128V 3 = 150R1 =
152V 5 \ brahm
kathayati 150V 6 =
151V 2 \ purusah
kathayati 161R5 =
169R5 = 151V5 \ sa(sc. yogcrah)
kathayati 152V4 ^ 160V6 \ (satvh)
kathayanti 162R5.
kadalipatra Pisangblatt"
(kada)lipatravat putputayogena 132V5; ^
kadalipatraputnirbh j anayogena 133V3
(S. 30, Anm. 1).
kadcit zeitweise"
129R5.
kanakaprabha goldstrahlend"
(tesm)(sc. buddhnm)
gtraprabhy()|(sic) kanakaprabham (sc. jagat)
144R1.
kapla Schale"
s. ^Irsakapla.
kamp erbeben"
160R3.
kampana Erbeben"
vanakampane 161R2.
karaka Krug"
brahmais
karakahastaih 148R2.
karana (1) Handeln", (2) Handlung"
(1): sarvaparahitaka(ran)e 148V4/5; (2): s.
yuddhakarana.
*karantha Karantha (?)"
karanthaih prthivim citm pasyati 132V4
(S. 98, Anm. 1).
karun Mitleid"
karunprayoganirde^ah kriyatel atha kimsva(bhv karun tad ucyate) 147R2\ evam
asya saparika(rm savises ka)run nispam(n va)ktavy| atah param idni aparopatpibha vah ksmtisauraty am r j avamrdut ve
parakryavyasanitvam sauhrdam amgni karunyh ebhi
(gr)hita karunh punahpu(nar )rabhyasyamn(ic) mahkarunvhika bhavatiti || karunnamtara mudit( n)irdist bhagavatl 152R45; drstv csya karun bhavatil tadadhipatirpaml hrdaye stri su(varn)bh() av(a)d()tastraprvrt&(sic) utpad^atel utpamn yoginam protsha(yati |)
tat(ah
karu)ndhipatirpam hrdayn nirgatah 148V45; tathaiva ca
hrdayasth karu(n) protsha(ty) 148R1/2;

205

(kar)u(ndhipa)tirupam csya yathoktam


-tasyopeks dri
hrdaya u(tpadyate)bhavatil (ka)runvakramati 162R5-6; tesu
karunm avakrmati 148R4; 148R5; 148V2 \
149R2; 156V2; 8. mahkarun (S. 134ff.)karunrta durch Mitleid niedergeschlagen"
tato 'sya karunrtasya bhruvor madhye
krsnataptam pitaka(m utpadyate) 147R6.
karunvarjitacetas der sein Denken dem
Mitleid zugewandt hat"
(punah karu)nvarjitacetasah astau mahnarakh
mukhi bhavanti 148R5,
karunvihrin im Mitleid wandelnd"
(tatah karunvi)hrinah
pdamle padmam (utpa)dyate 152V4,
karunsaya dem Mitleid zugewandt"
punah karunsaya(sya)
cchidram utpadyate 151R4; punah karunsaya evam pamcagatikam c(akram)
pa(syat)i 150V2.
karunsthiti Standort des Mitleids"
iti karunsthitihl 151V3 \ iyam apara karunsthitili 151R3 = 152R3.
karnadhra Steuermann"
(bhagavms)
kathayati ca namo 'ngate
'dhvani bhavisyajagatkarnadhrya 150R2.
karnamala Ohrenschmalz"
srotrbhym pyardhirakarnamalapravhh 135V6.
karnik Samenkapsel"
s. padmakarnik.
karma Tat"
137R3.
*karmaklea Tatbefleckung"
pratityasamutpdacakram
karmaklesvabaddham 159R1; 150R4; 159R4.
*kalala [Embryonalzustand] Kalala"
kalalvastham dhtusatkam 129V4 (S. 87,
Anm. 17).
kalpa Bndel"
s. tantukalpa, pu$pakalpa, maricikalpa,
rasmikalpa, vyukalpa.
kalila bevlkert"
divyrmodynavimnny apsaroganakalilny 169R4.
kalyna schn"
142R5.

206

Bieter Schiin gloff, Ein buddhistisches Yogalehrbuch

*kcapri (?) Glasgef"


pravhh kcapribhib. sariram prayamti
146R6.
*kiicanacakra Goldscheibe"
pravho nirgatah prthivimandalam bhitv
narakm prets cvabhsya kmcanacakram
bhitv pmandalam vyumandalam kasadhtum avabhsya parivartya 129R2; vrksamlni
kmcanacakre pratisthit
127V3 ^ 151V4; cehatradandam ca kmcanacakre pratisthitam 130V5; adhati kmcanacakre prat(i)sth(itam) 146R1; kmcanacakre nipatit 146V2; bladrakas
kmcanacakram avatarati 127V4; 151R5
(S. 31,Anm. 9).
*kmadhtu Region der Sinnenwelt"
sraye kmadhtvsrayl lambane kmadhtvlamban (sc. maitri, karun, mudit,
upeks) 140V1 ^ 147R4 = 153V3 = 155R1;
bhmibhedena saptabhaum (sc. maitri, karun, upeks) kmadhtur angamya^ catvri dhynni dhynmtaram ca 140V1 ^
147R4 ^ 155R1; bhmi(tah kmadhtau
dh)y()nadvaye ca (sc. mudit) 153V4 (S. 32).
*kmarga sinnliche Leidenschaft"
155V'3.
*kmvacara der Sinnenwelt angehrend"
(kmvacar catuli)skandhasvabhv (sc.
mudit, = krun) 153V 3 = 147R3.
*kmvacar devh [Wesen] der GtterMassen der Sinnenwelt"
sat kmvacarm devn| rpvacarm^ ca
caturdhynopapannm 145R6; (kmvacarm devm) v(i)mnodynopabhogm rp(vaca)rms ca savimnm 135R4; ksirapravho
kmrprpyvacardevparivrto mrdhn pravisati 147V1', sat kmvacar de(v) 170R1 (S. 32).
*kya Krper"
daurgandhyam kyam avakrmati 149R5;
(kra)mati na visam na sastram kye 144V4;
amtargatam ca kye 118V1 ^ 118V2 ^
152R3; tato 'sya sphadikamayair abhraktaih kyam avastabhyate 161V 2; chrotraghrnajihvk()yamanah 134R4 ^ 135V5 \ kyadvrena 157R1; sthitakyo 126R5; sarvakyapratisamvedanym 118V 3 122R4
= 124V1; prasrabdhakysamskr(atym)

118V5 123V2 \ kye csya par prasr(abdhih) 120R4; 123V5; 134R3 (S. 33f.).
*kyika krperlich"
132R4.
*kram kr Spenden darbringen"
(sat) v ( b )uddhadharmasamghesu kram
kurvanti 153R3.
krana (1) Veranlassen", (2) Veranlassung"
(1): kranviskaranrtham 147Rl ^ 147R2;
(2): tenaiva ca kranena 160V4.
*kran Qual"
mahnarakh
tatkrans cemh
148R6; y esm (sat)vnm krans t
aham praticcheyam iti 149V2; astmgopetam pnlyam nicarati tena sarv kranh
smyamte 149V3; krans ca vinasyamti
149R1.
krunika mitleidsvoll"
paritryasva kruniksmm 162R5.
krunya Mitleid"
krunyam utpadyate 150R4 = 147R6
150V2 \ samjtakarunyasya 150V5 = 150R5.
krya (1) auszufhren", (2) Tat",
(3) Verhaltensweise"
(1): cittopanibaddhah kryah 128R4; (2):
148V4;
162R1;
parakryavyasanitvam
152R4; (3): abhipretakryvhakatvt 127V1.
kla Zeit"
sarvaklam 169V3 \ s. vyutthnakla, pravesakla.
*klastra Klastra-[Hlle]"
. . .(c)rastrakrakacacchidn klstre tu|
148R6 (S. 138, Anm. 5).
*ksyapa Ksyapa"
kasyapdivipa^yiparyamt b (uddhm)
128R1.
kstha Bank"
s. snsikstha 134V2.
kirn artham aus welchem Grunde?"
152R6.
kila Pflock"
149V2.
kukkuti Henne"
kukutyndavad 137V1 (S. 112, Anm. 14).
kuksi Mutterleib"
amtahkuksigat() 143R5; mtuh kuksi
129V6, 164R1.

Wrterverzeichnis

*kutik Htte"
te (sc. satvh) pravrajit-vrksamlesu kutikm pith 159V5.
kuttima Estrich"
151V3.
kumbha Urne"
164R6.
kula Art"
s. krimikula.
*kusalamla Wurzel des Heils"
yatrnena (bh)vayitavy me tatkualamlam bhavisyati 128V6; tmnam iva ku(sa)lamlam|(sic) bhvayamtam pasyati 128Rlt
kta (1) Gipfel", (2) Haufe"
(1): s. vajraclaktaprkhya; (2): s. abhrakta.
*ktgra Tempel"
anamta lokadhtavah sphadikamayaib. ktgraih pariprn drsyamte 127R5 ^ 127R4;
(kt)(g)raih s(phu)t(m) prthivim pasyati
132V3; stambhopara(ci)tli ktgr yvat
trtiyam dhynam evam sphutam pasyati
121R4; sarvaparisandni (sauva)rnaktgraparivritni 146V1; sphadikaktgrnmtargatam(5ic) tmnam pasyati 161V2 ^
161R1; mu(k)t(cita)ktgre 'ntargatam
134V4; (satvm)
ratnaktgrair ivopagudhm pasyati 153R6 ^ 165R4; satv
vaidryastambhanihsrtaih pattai tadv(arnai^ ca ktg)rair avacchdit drsyamte
158R4; tathahaiva ck^anibhaib ktgrair
avastabhya(m)te 160V1 =* 159R3; ktgrvastabdham svam srayam pasyati 125R5;
146V4; 156R4 (S. 43, Anm. 13; S. 44).
kr (machen" usw.)
karoti 128R5, 129R6, 150V6, 151R1, 158R1;
kurvanti 153R3; karisymi 148V5; krlyate
147R2; kartavya 128R2; krtv 127V 6,
141R2, 142V3, 142R5, 146R6, 151V6; krta
118R4, 158V6, 159R4, 137V2, 137V39134R1;
kurvno 130V2; kurvantam 161V1; kriyamnam 130V1.
*krtaparikarman der die Vorbereitung
durchgefhrt hat"
s. parikarman.
krtnta zuendegefhrt"
krtmtapratyaveksanyogena 169V5.

207

krtsna (1) ganz", (2) gesamt"


(1): krtsnam lokam 119R6, 121V4, 124V2,
125R6, 128V1, 129Vh 130V1, 130V3, 131V 2,
131R1, 131R2, 134R3, 136V4,151V4, 153R2,
166V4, c* 166V1; krtsnm prthivim 120V3,
132R2,132R3 ^ 153V6; krtsnam traidhtukam 131R2, 131R3; krtsnam jagat HSV2,
144V6, ^ 128V1; (2): krtsnam gaganam
128V4, 136V5, 152V6, 150R2; krtsnam satvasamudram 130V5, 131R6, 151R2, 160V 5,
162R4; krtsnam samsram 166R4.
krpana elend"
147R5.
krmi Wurm"
s. krimi.
krsna (1) finster, (2) schwarz"
(1): 147R5; (2): krsnataptam pitaka(m)
148V1.
kesa Kopfhaar"
ke^apra(vh) 129V1; ke&dipurusa(pra)vhah 129V2.
*kolita Kolita"
upa(tiyakolitavina)yanam 164R2.
kosthgra ,, Vorratshaus' *
anyakothgais(sic) ca p(r)thi(v)i prnm
132V5.
kaumra Jugend"
129V6.
kausala Gewandtheit"
krtakau^alah 137V 2, 137V 3/4.
krakaca Sge"
148R6.
kram eindringen"
(kra)mati na viam na ^astram kye 144V4.
krama Verlauf"
146R3; 142R6; kramabhedt 136R3; ekakramena 169V 5.
kramasas schrittweise"
131V1; 147R6; 158R4; 159R5.
kramena allmhlich"
133R4; 137V4; 139R2; 140R4; 143V4;
144V6 \ 150R2; 151R3; 154R5; 165R3.
krimi Wurm"
r&iyogensiti krimikulasahasrni dryamte
160R5; s. khadyotakrimi.
krida Verspieltheit"
blacaritakrida. . . . 159V3.

208

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

krodha Zorn"
krodhapra(tipaksrtham) (sc. maitri) 139R4
~ 147V6.
klid besudeln"
kledayam|(sic) dsayams ca 135R4.
klinna verwest"
yatanni ca| klinnajvalita^unyani 134R2.
*klesa Befleckung"
sakklesm nisklesnl 156B3; sarvasatv niskles 156B4; pravrajit niskles 159V5 \
pratityasamutpdacakram
karmaklesvabaddham 159R1 = 159B4; 150B4; klesopaklesa 119V3; hri klesebhyo lajjati 159V2 \
klesaparvata 150V2, 150V4, 150V5.
kvath sieden"
ulksahasrni
kvathamti 127B3; j valitaih kvathamnam jagat 128V1.
ksaya Schwinden"
sravaksaya 134V6.
ksnti Geduld"
152R4.
ksip schleudern"
sarvasatv(b sarvaprahara)nni ksipamti |
144V5.
ksipta (2) gestoen", (2) verstreut",
(3) versprht"
(1): ksiptsivisdi^u 158V5; (2): ratnni puspni ca ksi(ptni) 152B2/3; (3): t^dakam
vyun ksiptam 150R1.
ksira Milch"
ksiraghrtanavanitanadyah 130R3; maitr^ayasya hr(day)dvram apvryate tatrmtah
ksirasamudram sambhavati 143R6; ksirasamudre ca nimagnh 141V4; hrdaye ca| ksirapuskirini t(amni)magnam naksatram maitrsayaparigrhitasya (adhi)patirpam |
147V2; padmni| tatkarniksu ca ksirapuskirinyahi
s(ar)v(asatv ca ksirapu)k(i)r(i)nisu nimagnh 144V1; m()rdhatah
ksirastambhah iva nirgatah
^ksiravarsam muiicati 143V1; (bhrumadhy)dhar nimnapradest ksirapravho nirgatya 146B6;
stri ksiradhrbhih sariram a(vasimcati)
148V1; tasmc char(i)rt ksiradhrbhih
sarvasatvsamudrah plvyate 148V2; kslravrkso mrdhanirgato 'namtam lokadhtum spharitv tisthatil
(sat)v() nihsrtbhih ksiradhrbhih siktamtr
mai-

trvihrinam pranamanti 145V12; (vrksamlni)


kslrapariprnni 151V 4; ksirapariprna 157V2, 168V4 (S. 39, Anm. 4, 5).
ksudra winzig"
ksudrair asucidra(vyaih) 132V3.
ksubh erschttern"
loka kso(bhyam)(nah) 162V6.
ksura Messer"
157B1.
khadyotakrimi Glhwrmchen"
khadyotakrimim iva spandamnam jvalitam
vijnnamimi(tta)m 130V2.
gagana Luftraum"
devs ca krtsnam gaganam prya 150B2 ^
128V4; = spharitv 152V6; brahmais ca
gaganam prnam 148B2 ^ 136V5 \ abhrakta iva gaganam prya 143V1; = spharitv 148V5; abhraktavam nirgatya sarvam
gaganam prya 144B2/3.
gaja Elefant"
saddam(ta)h s>eto gajah 125V5 ^ 141B6;
pamca sveta gaj dityamandalacitasrayh
(balnm adhipatirpam) 165V4 \
148B6.
gana Schar"
s. apsarogana, tirthyagana, bodhisatvagana,
srvakagana.
ganda Wange"
(ga)ndd
purusapravho nirgatah 133V3;
madhyamam gandam k^adhtuh susirataratvt 160V 4.
*ganda Beule"
rogatah
(ga)ndatali
s(a)lyatah
134V1.
*gandik Gong"
bha(gavantam dhrm)y(m) gandikm kotayamtam 161B3 (S. 169, Anm. 2).
*gatipaiicaka die fnf
Existenzformen"
gatipamcake bhramantam 161V1; s. pancagatika.
gandha (1) Geruch", (2) Duft"
(1): 134B4; (2): 169V2.
gam gehen"
gacchati 131V 2, 135B4, 150V 3, 162B3;
gacchanti 159V5; gantum 162B6; gatv

Wrterverzeichnis

209

115V 5, 117V4, 135V1, 147V1, 150R6, 154R4.


gras verschlingen"
gambhlra tief"
sarvam jiieyam grasati 134R4.
griv Nachen"
bhagavn
dhiragambhirodrena ca svarena dharmam desayati 149V4.
chirsakplam grivsthipratisthi(tam)
137V3.
garuda Garuda"
garudamukham utpadyate| tadamtargatam
ghana (1) dicht", (2) feste Masse"
vijnnanimi(tta)m (pas)y(at)i . . . .ga(1):
ghanapat(r)askhsu 127V2 \ (2): 131V'S;
rudamukham pari(v)rya tistha(sic) tato
gurudamukhc(<9^c) chabdo (nirgaccha)ti ekaghano 131V4; 148R6.
*ghana [Embryonalzustand] Ghana"
130V2-3.
mtuh
kuksv arbu(dap)e(sighanapra)&galaka Kehle"
khnukramenal
vardhamnam 129V6.
ksirapravho
dau galak(d vicchighus
ertnen"
dya)t(e)| t(ato nbh)y(h) 147V1.
ghosay(a)t(i) 161R4.
gtra Glied"
ghrta Butterschmalz"
(tesm) (sc. buddhnm)
gtraprakiraghrtanavanitanadyah
130R3; ghrtapibhy()| (sie) kanakaprabham (sc. jagat)
ndavat
pravilinam
jne(ya)m
136V6.
144R1; buddh
pari^uddhabinducitaghrna
Nase"
(g)trh 131R2; gtrasvedo 149R5; sarvachrotraghrnajihvk()yamanah 134R4 ^
gtraih 144V 3 \ 149R4.
135V
5; (ghrnadvrena) 157Rl; ghrngth Strophe"
bhym
(pravhh) (sc. nirgacchanti)
tato bhagavm g(thm bhate) 162R1 ^
135V6.
167R5.
guna Qualitt"
cakra (1) Rad", (2) Scheibe"
buddhagunaprabhbhis cvabhsito loko
(1): anamtabhsuram nnratnacitam saha155V1; s(atvh)
srvakagunopetms
srraeakram 146R2; pameagatikam c(a154R3; 162V4; 162V 5 \ 143R1.
kram). . . . bhramyamnam 150V2; s. saipguh Grotte"
sraeakra, pratityasamutpdaeakra; (2): s.
sauvarn guh 146R1 ^ 146V6; vaidrya- kneanaeakra (S. 21).
cakravartin Weltherrscher"
grh (i) ergreifen", (2) auffangen"
j (ii)dhipatyasampa(d ya)th cakravarti(i): grhnanti 149R5; grhita 118R2, 152R5; nm 143V2; cakravartisadrsbhir vibhsigrhitv 157R3, 158V1, (2): 147V3.
tbhih 153R1; cakravartysrayam 144R5.
grhita- tragend"
*cakravda Ringwall [um die Erde]"
131B3; 149V1; 151R6; 159R5; 160V1; s. mahcakravda (S. 32, Anm. 2).
162V 3; 165V 6 \ 170R5.
caksus Auge"
*goghtaka Rinderschlchter"
(cksub srotram ghr)nam jihv kynm
goghtakh grhitasa(stra
gm vadhayi)- 135V5; 134R3; caksurdvrena 157V6; (catv taccarmani sad bilm bhga^ah pratya- k^urbhy ampra vh) n (i )rgaccham t i
veksate 160V1 (S. 28).
135V6; ksadhtuh caksuhsausirydmm
*gocara Wirkungsbereich"
128R6.
(buddhapratimh)
svam svam goca*cankram umherwandeln"
ram lokenvobhsya 162V2 \ s. yathsva- prthivym camkramati 144R6.
balagocara.
*cankrama ,, Umherwandeln"
gomayapinda Kuhfladen"
camkramanisadybhym sarv(e)rypathesu
pdmgupte(sic) gomayapindam 136R6.
ca 144V 4.
*gos!rsacandana Sandelholz"
catur vier"
vaisradynm
cat(vro buddhapratimii)
170V6. '
14 Schlingloff, Yogalehrbuch

210

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

162V2 =* 165V 5 \ eaturnm smrtyu(pasthcaturnnm) (catvro buddhh)


nm samyakprahn(nm)
catvrah
(caturnm rddhipd)n(m) catvri vaidryasop(nni) 166V45; catvras ca mahbhtsivi(s) 117R2; catasrah yatanacith
sa(m)kalh 136V1; (kmvacar catuh)skandhasvabhv (sc. mudit = karun)
153V3 = 147R3) catvri dhy(nni) 140V1
c- 147R4; rpvacarm^ ca caturdhynopapannm 145R6; caturdhynarasam 129R3;
caturvarnbhiekah 146R3 ^ 146R5; caturvarnapadma 146R3, 146R4; caturvarn buddh 146R4; catvra pravhh 146R5; caturnm mahrj()nm 143V2 \ caturmahrjike 136R6; (catu)rdisa 165V1; catursu ca
pr^veu 131V1 = 130R5; samudresu catursu 13IV2; caturottaram rogasatam 160R5
~ 148V 3; 126V4.
caturtha vierte"
caturtham dhynam 152V1.
caturdh in vierfacher [Richtung]"
(pu)papravho
caturdh gacehati 131V 2.
catustaya Vierzahl"
samudracatutayam 130R5; dvracatus^ayam 136V1.
candra Mond"
candrvadtam 144R1; candrdityasambhsam 154V3; samudracan(d)ra(m) 123R5.
candramandala Mondscheibe"
sarvasrtobhys ca suvarnabhni candramandalni nnacitni nirgacchamti 153R5; bhagavmn
grhltacandramandalah
159R5;
candramandalahas(t)o 157V 2; candramandaldhirdham
ct(mna)m 144R4; candramandalara^my 144R5; nnvarnaratnanaksatracandramandalanadyah
130R3;
candramandalasamks nadi 151R6
^
142R3 152R1; yog(c)r&rayah eandramandalasamksah 127Rl =* 150R3 ^144R5;
samyaksamb (uddh)s candramandacit(sic)
152R1; (cand)r(ama)ndalacitam ca pattam
169V4; (a)vadtacandramandalacit(a) 121R1;
118V5 \ 168R4; 169R6 (S. 42).
carman Haut"
ad bilm bhga^ah taccarmany avasth(pay ati) 160V 2 \ = pratyaveksate 160V 2.

crin fhrend"
s. duscaritacrin.
ci bedechen"
prthivi ci(yate) 121R3.
cita besetzt"
ratnacitaratha 169V3 \ nnratnacitai padmair 146R1 ^ 153V6; nnratnacitam sahasrracakram 146R2; candramandalni nnacitni(sic) 153R6; ratnacitdityamandalni
124V3 \ ratnasalk iva ratnacitdity(a)m(a)nd(a)l(ni) 124V1; salkbhi
ratnaci(tbhih) 121V3 \ muktcith prsda 128V2 \
pradesam
muktcitam 128V 4; parivram muktcitam 127R4; mu(k)t(cita)ktgre 134V4; 167V6; muktcitair jvlair(5ic)
170V2; (lokam) padmacitam 131R4; 123V5;
amk(u)racitah parvatah 137R6; samyaksam(buddh)s candramandacit(sic)
152R1;
(cand)r(ama)ndalacitam ca pattam 169V4;
(a)vadtacandramandalacit(a) 121R1; gaj
dityamandalacita^rayli 165V4; (dharmm
cdit)y (a)mandalacitam 166R5;
(raviman)dalacit dasa hastinah; = buddhapratimh
162V1; darsamandalacitahi 170R4; asucidra(vyaih prthivim citm); = karanthaih
132R4; (svam ^rayam udakabudbu)d(a)c(i)t(m) 132R4; budbudacittnm(5ic) buddhnm 132R6; (stri snehapariprnavaidryabhjana)c(i)t 167V4 ~ 165V2 'c* 169R3;
^vsaprasvsh vajracitl^ 127R6; nirmalojvala^astracitam pratyaveksannimittam
133R5 ^ 167V6 \ v(i)citraputputacitali purusapravho 133V3; yatanacitm dhvajm
134R5; parvat vicitryatanacit 135V2;
yatanacith sa(m)kalh 136V1 = 136V2 \
brahmabhih ra(tna)puspamuktanaksatryatanacitaih 136V5 \ yathokta^ubhanimittya(tana)citam jagad 136V6; buddhapratyekabuddhasrvakh
yathoktalaksanyatanacith 136R1; 116R1; 129R6; 133V2; 134R3;
168R2 (S.46f.).
cit Scheiterhaufen"
164R6.
citta Oeist"
t(a)tr(a)sth(am) ca c(i)ttam ^nt(am) drdham
121R2 z*> 135R6; sbhogam sbhisamskram
ca tasmim samaye ci(ttam bhavati) 124R6 =
124R2 = 125V4; anbhogam anabhisam-

Wrterverzeichnis

skra(m) bantam tasmim samaye ci(tta)m


(bhavati) 125V 4; ekavigaylambanasamartham csya cittam bhavati 149R4; (sar)v(asat)v(a)h(i)tdhysayapravrttam cittam
145R2; cittam cnuddhata. . ,125R5\ sthitacitto bhavati 126R6; vsaparigrhitam cittam bldrakarpi 127Rl s* 118R2; 126R3;
nakhavivaramtena cittam praveayati
128R4;142V4; 149V2 \ 159R3;s. prasrabdhacittasamskrat.
*cittadamopasama Zhmen und Erloschensein des Geistes"
paramena cittada(mopa)amena samanvgatam (sc. buddham) 154V3.
*cittapatutva Geistesschrfe"
118V6.
*cittapratisamvedan Empfinden des Geistes"
118R1;125V6.
*cittavimocanat Befreitsein des Geistes"
118R4; 125R6.
*cittasamat gleiche Ebene mit dem Geist"
(i)me mahbht(a)samatayopetahL ami cittasamat(a)y(ope)t 154R1.
*eittasamdn Sammlung des Geistes"
127R2.
*cittasamdhnat Gesammeltsein des Geistes"
118R3; 125R3/4.
*cittasamskrapratisamvedan, ,Empfinden
der Gestaltungskrfte des Geistes"
118V 6 \ 125V 3.
*cittbMpramodan Erfreuen des Geistes"
118R2; 125R2; 127R1.
*cittopanibandha Konzentration des Geibhrumadhye cittopanibandhabt tasmt pravho nirgatah 129R1; (p)dn(gu)tha(na)khavivare cittopanibaddhah kryah tato
nakhavivaram makaramukham iva lakyate
128R4; m(u)khad(v)re daksinam(sic) damstrym cittopa(nibandham) krtv pa&yati
142R4;. . . . (citt)opanibandham krtv dhyti dirghartram 142V3; ^ cimtayatil dirghartram 141R2\ 128R5; 140R2 (S. 36).
eint sinnen'1
cimtayatil dirghartram 141R2.

211

eibuka Kinn"
eibuke cajcatvri ratnamandalnil tadamtargath
buddhb 165V 5.
cirakla lange Zeit"
ciraklam ^(ntam)
cittam 145R1 =*
135R6 ^ 121R2; ciraklam upa^amasukham
a(nubhya) 130V 4.
crna Staub"
(lo)kam crnam visiryate| (anitynupasya)nyml 128V1; crnapurusaka utpadyate
129R1.
crnl kr in Staub verwandeln"
116R4.
crnl bh zu Staub werden"
sarvam visirnam crnibhtam 129V3/4.
cetan Gedanke"
agn(i)jvlmtargatam agnitilakm cetany
adhip(atir)pam 137R4.
cetas Denken"
s. avahitacetas, varjitacetas, upanibaddhacetas.
*cotakksa Gewandgrtel (?)tc
tasy& cotakkd iva pradip nirgatya 136V3.
*cyavan das Herausfallen [aus einer
Existenzform]"
cyavannimittaih dubkhitm pa^yati 149R3.
*cyu herausfallen"
. . .cyut()h sugatvy upapadyam(te) 149V5 \
164R1.
chatra Schirm"
mrdhata^ c(a ni)hsrtam ratnamayam cchatram anamt lokadhtm spharitv tisthati
cchatradandam a kmeanaeakre pratithitam pa(s)y(ati)
(k)^anibhli patth nihsrtya krtsnam s(atvasamu)dram upaguhya tithamti 130V45; cchatram ca
anam(tam lokam) spharitv sarvasatvn
upaguhya tistha(ti) 150R5; bladraka
sarvabuddhnm upari pattacchatram krtv
tithati 127V5 \ = mukthram cchatram
127V6 \ ratnacchatrena 169V3 \ cchatrapradesemanih utpadyat(e) 145R2 (S. 40,
Anm. 7).
chad bedecken"
pattairsatv cchdyamte 155R5.

212

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

chy Schatten"
cchym svsrayasya 149R4.
chid (2) durchschneiden", (2) zerhacken"
(2): 150R5; (2): 134V2.
chid Zerstckeln"
krakacacchidn klastre 148R6.
chidra (2) hohl", (2) ausgehhlt", (3)
Hohlraum". (4) ffnung"
(2): cchidram
sarvajagat 136V5 ^130V6;
129V 3 \ 129R6/130V1; (2): c(ch)idrair {sc.
yatanaih) 136V 3 \ (3): cchidram utpadyate
151R4; (4): sr(ayam) murdhna cchidrena
prayati 165R3; 121V 2.
*chidrl kr aushhlen"
pradip
sarvny ytanni sarvs ca
samkalk
chidri kurvamti 136V 3; =
krtsnam lokam 136V4; = (yogcrsrayam)
136V4/5; krtsnam lokam
cchidri kriyamnam 130V1; (v)yukalp
yog(cr^rayam cchidri) kurvanti 131V6; 116B3.
jagat Welt"
115V 2; 128V1; 136V 5; 136V 6 \ 144V6.
*jagatkarnadhra Steuermann der Welt"
150R2.
jan (2) entstehen", (2) geboren werden"
(2): jyate 149R5; (2): jyamnam 129V6.
janman Existenz"
(ihajanman)i
anyajanmani ca 158R6;
atit janmaparampar 158V4, 158V6 \ angat ca janmaparampar 158V4; anamtaparyamtm janmaparamparm 159V1;
161V4; s. svajanman.
*janmasarira natrlicher Leib"
ta j (sc. buddha) j anmadharmasariranihsrtbhih prabhbhir 165R1.
jar Alter"
rpaskandham jardibhih salyair viddham
134V1; jarmarana 137V4.
jala Wasser"
&italajalaparisiktam 128V2.
jti Geburt"
138V5.
*jnmika hinsichtlich der Existenz"
ihajnmikam anyajtmikam(5ic) 158R5.
jla Netz"
ratnaj lvrtam sarvmgapratymgabaddham

tmnam 169R5; muktcitair jvlair(sic)


baddham tmnam 170V2.
jihv Zunge"
chrotraghrnajihvk()yamanah 134R4 ^
135V5\ jihvdvrena ksurnm 157R1; j(i)hv()gr(a)
(citt)opanibandham
krtv
dhyti dirghartram 142V3.
jivita Leben"
dhtusatkam
jivitatantunnubaddham 129V5.
jr verfallen"
jiryate 160V4; jirnam svam srayam 118R5;
ji(rnam krt)s(nam) lokam 131R1/2.
jneya das zu Erkennende"
amte ca sarva(m) jneya(m n)bhym nirudhyat(e i)ti vyutthnam 166R5 ^ 167R3 ^
165R5 ^ 152R3 ^ 135R5 =* 127V6 =*
136V6 c* 134V4 ^ 169R2; sarvam jnneyam
grasati 134R4.
jval brennen"
puskirini jvalati 118R4; saddhtu dbilni
nirvidgnin jvalamti 160R1.
jvalita (2) brennend, (2) Brand"
(2): svsaprasvsm jvalitm 118R5; jvalitam vijnnanimi(tta)m 130V3; ytanni
klinnajvalitasunyni 134R2 ^ 135V3;
130R5; 132R5; 134V3; (2): jvalitaih kvathamnam jagat 128V1.
jvala brennend"
nirmalojvalasastracitam (sie) pratyaveksannimittam 133R5 c* 167V6.
jvla Brand"
agn(i)jvlmtargatam agnitilakm 137R4.
*tatrastha feststehend"
tatrastham
cittam 135R6 ^ 121R2.
*tathgata Tathgata"
163R6; 164V1; 164R4.
tantu Faden"
dhtusatkam
jlvitatantunnubaddham
129V 6; tamtukalpais ckrsth amkal
136V2 \ ^a(m)kalh pradipatamtukalpobhayahast 136V1.
*tapana ,,Tapana-[Hlle]"
149V1 (S. 139, Anm. 9).
tapta schmerzend"
148V1.

Wrterverzeichnis

tala Sohle"
s. pdatala 127V3.
traka Sternschnuppe"
trakoparacitena ca purusena 125R4 ^
118R3) 129R6.
tiryak horizontal"
tiryakto 'nantaparyantah 146R1; tiryag
anamtam 169V 6 \ tiryan mahcakrav(da). . .
118V1.
tiryak Tier"
tiryakpretamanusys 145R5 =* 149R3.
tilaka Funke"
agn(i)jvlmtargatam agnitilakm eetany
adhip(atir)pam 137R4.
tlksna scharf"
tiksnam
sastram 150R5.
*tlrthya Sekte"
krtsno lokah tirthyasstrni pathams 166V1;
tirthyagann (a)bhibhya 167Rl;
tul prfen"
(ekai)kasas tarn dhtus(sic) tulayatil te samam tulyamte 160V6 \ satvkhyms csatvkhyms ca tulayati 160R2.
tulya gleichend"
144V2.
*tusitabhavana Behausung der Tusita[Gtter]"
bodhisatvm
tusitabhavan cyavam.
. . 164R1 (S. 175, Anm. 6).
trtiya dritte"
trtiyam dhynam 121R4; 128V1.
trsn Durst"
bhavabhogatrsnprati(paks)nmtaram
136R2.
tejas Glut"
buddh(a)t(e)jo visisyate 154V3 \ 164R6.
tejasvin glhend"
163V1.
*tejodhtu Element Glut"
buddhapravhopadmesu nisanno
tejodhtu sampadyate 13IV5; padmesu satv nisannm tej(o)dhtusampann
buddhavapurdhrino 146R2; sarvaparisandni (sauva)rnaktgraparivritni tadamtargatms ca buddhm bhagavamtah tejodhtusampannm pasyati 146V1; 160V3.
taila l"
(traynm aveniknm smrtyupasth)nanm

213

(sc. adhipatirpam) grhitatailaptryudhs


trayab p(urusb) 162V3 ^ 165V6 \ ksc
ca tailadhrah patith 160R3; tailahradanimagnam 118V4; 118V3 \ 125R2.
tygin entsagend"
156V3.
*trayastrimsat [Wesen der Gtterklasse
der] Dreiunddreiig"
v(i)sayaparibhogdhi(patya)sam(pad yath
trayastrim^atm) 143V3.
tri drei"
tribhih rupai(h) 146V4; (traynm aveniknm smrtyupasth)nanm
trayah p(urush) 162V3 ^ 165V6 \ tridhynopag^ ca
137R5.
*triprakra dreiartig"
visayopeks triprakr 146V4 ^ 157R5\
(veda)yitam triprakram 158R5 ^ 158V2 ^
158R3.
trividha dreifach"
trividhh samskr 137R4.
*traidhtuka (l)"Welt", (2) weltlich"
(1): pravho
traidhtukam spharitv
133V 2 = 133V1 = 133V 3 = 133V 4 = 131R2/
3 = 132R6; (2): pratityasamutpdacakram
traidhtukam 159Rl.
damstr Zahn"
m(u)khad(v)re daksinam(^c) damstrym
cittopa(nibandham) krtv pasyati 142R4.
daksina rechte"
daksine
prsve 152V23; daksinmd amsd 133V1; daksine haste 150R5; daksino
bhub 160V3; (daksi)ne bhuprade^e 165V4;
daksinam(sic) damstrym 142R4.
danda (1) Stock", (2) Stengel"
(1) chatradanda 130V5 \ (2) padmadanda
144V1.
dama Zhmen"
s. cittadamopasama.
darsana (1) Schau", (2) Sichtbarwerden"
(asu)bhdiprayogena pravistasya sm(rtyupasthn)dinm bodhipaksynm darsanam
utpadyate 166V3; krtmtapratyaveksanyogenaitad darsanam utpadyate 169V5; samudracatustayam sarv^ucipariprnam pasyati | ta(dda)rsanasamvignasya ca yoginaji
130R5; janmaparampar
dvesasamud-

214

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

svam cradoadarsant ksiptsivisdisu 158V5 \ 162R6; 149R4; (dub)khi(ta)m


154V1; 165R3; 170R6; (2): buddh unisa- srayam patyati 118R5] 153V1.
durbala kraftlos"
prvadarsantwdgacchamto 144V6.
durbalam
sarvajagat 136V5.
*darsan Schau"
*durbalataratva das Schwchersein"
romakpadarsanvidih 170V 4.
vmaml bdhtuh durbalataratvt 160V3.
dasa zehn"
durbali bh kraftlos werden"
daa hastinah
dasa buddhapratimh
svam srayam pasya162V1; da^mkura 168R1; da^adisah 145V5 durbali (bhtam)
ti 118R5.
= 147V 3 \ dasabhyo digbhyah 136V3.
durvarna von niederer Herkunft"
dah verbrennen"
(su)varnadurvarnnm 156R2.
desb sasatv dagdhh 141R3.
duscarita schlechter Lebenswandel"
dna Freigiebigkeit"
duscaritam samutthpitam apyesu ca duhdnasilaviryaprajn 164V 6.
kham anubhtam 159V1 = 158R1; hrl kledivya himmlisch"
^ebhyo lajjati avatrpyam duscaritebhyah
divyrmodynavimnny 169R4.
159V2.
dis verknden"
*duscaritacrin , .schlechten Lebenswandel
bhagavm dharmam desayati 144V2 =
149V4 = 149R6=154R2; buddhh
dha- fhrend"
rmam de^ayanti 165V5 ex 150V5 ^ 127V2. d(u)(ca)ritacrisv abahumtt(5ic) pratighah 156V6; 115R2; 156R1; 170V 3.
dis Richtung"
dus beschmutzen"
sarvadigvidisah 136R1, diodisah 136V2 =
161R4/5; dasadiah 145V5 = 147V3; dasa- pravh(a)b
(devm)
d^ayams
bhyo digbhyab 136V3 (S. 108, Anm. 20).
135R4.
dipavat wie eine Leuchte"
*duskaracary asketisches Leben"
drpavaty(sic) utkarsanayogena 124R5.
164R1 (S. 175, Anm 9).
*dirghat Langsein [des Atems]"
dri bh weichen"
dirghatym 118V2; bhikavah
dirgha- 157V1; 157R4; 162R6.
tsampann 128V6.
drdha fest"
*dirghartra lange Zeit"
c(i)ttam snt(am) drdham 121R2; drdham
dhyti dirghartram 142V3 \ cimtayatil di- adhysaya(m) 150R3/4.
rghartram 141R2.
drs sehen"
duhkha (1) leidvoll" (2) Leid"
pasyati 115V4, HSV2, 118V4, 118R2,118R3,
(1): duhkhym vedanym 158V5/6 ^ 118R5, 118R6, 121R4, 124V2, 125V6, 125R3,
158V3j4 c* 132R5 ex 158V3 \ (2): sariradub- 125R4, 125R5, 125R6, 126V6, 127R2, 127R4,
kha 148V 5; mnasam dubkham 148R1; 128V2, 128V4, 128V5, 128R1, 128R59 129V3,
s()rlramnasadubkhm 148V 2 ex 147R6; 129V4, 129V 5, 129V6, 129R4, 129R5, 130V1,
apyesu ca duhkham anubhtam 159V1 = 130V3, 130V4, 130V6, 130R1, 130R2/3,
158R1; apyasthnm
(n)nduhkhapl- 131V19 131R1, 131R5, 131R6, 132V2, 132V3,
dith 162R5; apyagatnm satvnm sa- 132V 4, 132V5, 132V6, 132Rly 132R4, 133V2,
rvadubkhopasamam krtv 146R6; sarvasa- 134V1, 134V2, 134V3, 134V5, 134R2, 134R3,
tvn(m) duhkhny usamayamti(^c) 141R5; 134R5, 134R6, 136V 4, 136V5, 137V 3, 138V 6,
(sa)rvaduhkhavinirmukth 149R1; duhkha- 139V5, 139V6, 141V3, 142R3, 142R5, 143V4,
tah parmrsat 134V3; 153V1; 156V2; 163V1. 143V 5, 144R4, 144R5, 145R6, 146V1, 147V2,
147V 5, 148R3, 149R2, 149R4, 150V2, 150V4,
*duhkhasamjn Leidwahrnehmung"
151R3, 151R4, 153R5, 154V6, 154V2, 156R1,
(sukhasa)mjnyml
duhkhasamjny|
156R2, 157V3, 158R29 159V1, 159V2, 160R3,
126R4.
160R6, 161V1, 161V2, 161R3, 169V3, 169V4,
duhkhita leidend"
(u)ts(r)jya dubkhitm kva gamtum icchatiti 169R1, 169R2, 169R5, 170R2; payamti

W rter Verzeichnis

170V1; pasy(e)y()m 142B2; pa3yata3 132V3,


132V'4, 158V3) drtyate 129B4, 131V3, 131V4,
144V6, 144R6, 145V 4, 152V2, 162V 4, 162R5,
165R1, 165R4, 167R2\ dryamte 115V 2,
115R3, 124R4, 126V5, 127V 2, 127V3, 127R5,
128V6, 128R1, 130R2, 131R2, 132R5, 134R6,
135V2, 135V3, 139R2, 144V2, 144V3, 144V6,
145R3, 146R2, 149V2, 151V4/5, 152R3,
154R6, 156R4, 160R4, 160R5, 161R5, 162V1,
162V5, 168R3, 169R6, 170R4; drstv 141V3,
147R5, 147R6, 148V 3, 150V4, 150R4, 151R2,
153V6, 153R4, 154V4, 154R2, 158V5, 158R2,
158R4, 159V2, 159R1.
drs (caus.) (1) zeigen", (2) beschreiben"
(1): darsayati 169R5; (2): darsayisymali
128R3.
*drstadharma gegenwrtiger Zustand"
134V6.
*drsti [falsche] Ansicht"
150V3; s. tmadrsti.
deva Gott"
dev hrstli krtsnam gaganam spharitv. .
. /.pusparatnavarsm utsrjamti 152V6 ^
128V4 ^ 150R2; (de)vnm ca padmaih
prthivi pryat(e) 148R3; n()bhinihsrts ca
dev sthitim prya tisthamti 147V2 \ ratnni pu^pni ca ksi(ptni devaih) 152R3;
147V6\ 150V1; 154V2\ 164V6; 170R6; s.
aghanithh, kmvacar devh, rpvacar
devh, paranirmitavasavartidevli, suddhvs devJti, smrtyupapattideva, vi&uddhideva.
devat Gottheit"
suptam enam devat raksamti 147V'5.
*devatnusmrti Meditation ber die Gottheiten"
(devatnusmrtili katarl) 170V6; punar deva(tnusm)r(tiprvam hrdayopanibaddhacetasah) 170R2 (S. 188f.).
*devoddhati Gtterhochmut {?)"
149R6.
desa Gegend"
141R3; 147R5.
desita gelehrt"
136R4.
dosa Schuld"
nairghrnyadostl#2F5; tadapeksadosansya
156V3 = 158V1 = 158R3 = 159V3 ==

215

159R5 = 161V6; dveasamudcradosadarsant 158V5 \ doo vyvar(tat)e 158V6.


daurgandhya bler Geruch"
daurgandhyam kyam avakrmati 149R5.
dauvrika (1) das Tor bewachend",
(2) Torwchter"
(2): nirvnapuram
vaidrybhab dauvrikah puruso 161R5; (2): 162R3/4.
dyotana Erhellen"
-dyotanrtham 153V1; 153V2; 155V 4.
dravya Substanz"
asucidravy(n)i 130R4 = 130V1 132V3.
*drom Sarg[hlfte]"
ayodronyah 148R6/149V1, 164R6.
dvaya (2) Zweizahl"", (2) zweifach",
(3) Paar"
(1): s. dhynadvaya 153V4, dityamandaladvaya 133R3, (2): s. smrtisamprajanyasampaddvaya 169V1; (3): s. paksadvaya 154V4.
dvdasa zwlf"
dvdasya(tana) . . . 134R6; dvdasmgah
pratitya(samutp)d(a)c(a)kr(a)h 139V 3
^
139R1 =* 159R2 ** 159R6.
dvra Tor"
hrdaydvram apvryate 141R4 = 143R6;
sarvasrotobhyas easya dvrany apvryamte
143R6; pr^vebhyo dvracatustayam apvrtam sambhavati| dvrebhya^ catasrat yatanacith sa(m)kalb.
nirgaccham(ti)
136V1; yatandvrny 157R4; m(u)khad(v)re 142R4; manodvraih 157V 5; cakurdvrena
(srotradvrena)^
(ghrnadvrena)
-jihvdvrenakyadvrena
157V6-R1, 155R3, 160R6.
*dvicehidra zwei Lcher besitzend"
(n)sgre dvicchidro bhavati 126R1.
dvitiya zweite"
(dv)itiye dhyne 153R6; 116V5; 126V'4;
127R1; 129V 2 \ 129R3; 140R6; 152V1;
154V2.
dvidh zweifach"
130R4.
dvividha zweifach"
136R3.
dvis hassen"
dvisyamnm 157R6.
dvesa Ha"
duhkhym (sc. vedanym) pldyamnasya

216

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

dvesam utpadyate 158V4; rgadvesamoha


150V3, 158R6; dvesasamudcrado^a 158V5.
dhana Besitz"
sadhann adhan(n) 156R2.
*dharma (1) Lehre", (2) Denkobjekt",
(3) Eigenschaft", (4) Zustand", (5) Gegebenheit"
(1): bhagavm dharmam desayati 144V2 =
149V4 = 149R6 = 154R2 ~ 165V5 =*
150V 5 ^ 127V 2; ih()rya(srvako) dharmam kratah samanus(marati| svkhyto
bhagavato dharmah smdrstiko nirjvara
k)likah aupanyikah ehipas(y)i(kah) pratytma)vedaniyo vijnaih 165R56; buddhadharmasamghesu 153R3; (2): manah
(dharm) 134R5; dh(ar)mnm manodvraih 157V 5 \ (3): asaiksadharmdhip(a)t(i)r(pam) 162V5; (4): drstadharma 134V6;
(5): (dharmm)
samskrtsamsk(r)tm
166R5.
*dharmarjika Monument"
adharottarvibhg(ena dha)rmarjika ivvasthith 166R1.
*dharmasarira Leib der Lehre"
bh(agava)tas ca dharmasariram 154V4; (b)u(d)dh()srayesu dharmasariram drsyate| tajjanmadharmasariranihsrtbhih
prabhbhir
lokam spharitv t(isthamti) 165R1.
*dharmnusmrti Meditation ber die Lehre"
dharmanu(sm)r(tih kata)r| 165R5; punar
dharmnusmrtip(r)v(amhrdayopanibaddhacetaso) 166R2; sthitis ca yath dharmnusmrti 167R2; buddhadharmasamgh(nusmr)ti
170V4{S. 179ff.).
*dhtu (1) Element", (2) Region"
(1): skandhadhtvyatanapratityasamutpdryasaty 169R1; dhtuprayoga 128R3;
129R4 J29V2; 129R4/5; 129R5; 131R6J60 V6;
dhtumtrakam (sc. srayam) 160R5; dhtusatkam 129V5; s. saddhtu, pancadhtu,
prthividhtu, abdhtu, vyudhtu, tejodhtu, ksadhtu, vijnnadhtu; (2): nilavarno dhtu 153R6; s. lokadhtu, kmadhtu, nirvnadhtu (S. 27f.; 32, Anm. 1,
48; 85ff.).
dhrana Aufrechterhalten"
U5R2,

dhr (1) Gu", (2) Ausflu"


(1): suvarnavarnbhi snigdhbhir dhrbhir
124V4; astmgopet(bhih sa)l(i)ladhrbhir
148R1; varsadhrbhir iva 136V3; ksiradhrbhih 145V2 = 148V1 = 148V2; taadhrh 160R3 =* 118V4; rasadhr 136V6;
anekarasadhrsahasrni 145R3; pusparasadhrbhih 149R2/3; (2): (asu)c(i)dh()rbh(i)h 135R3 - 135R4.
*dhrmy gandik Gong der Lehre"
bha(gavantam dhrm)y(m) gandikm kotayamtam 161R3 (S. 169, Anm. 2).
dhlra weise"
bhagavn
dhiragambhirodrena ca
svarena dharmam desayati 149V4,
dhy sich versenken"
dhyti dirghartram 142V3,
*dhyna Versenkungssphre"
catvri dhy(nni) 140V1 ^* 147R4; rpvacarms ca caturdhynopapannm 145R6;
pravho
yvad aghanisthm devn avabhsya cat(u)r(dh)ynarasam dya mrdhnpunah pravisati| 129R3; pravhah*
rdhva(m) yvac caturtham dhynam iti
152V1; yvat trtiyam dhynam evam sphutam pasyati 121R4; tridhynopags 137R5;
(kmadhtau dh)y()nadvaye ca 153V 4;
(dv)itiye dhyne 153R6; dhynasamvarasya
169R6 (S. 31 f.).
*dhynmtara ,, VersenkungszwischenSphre"
bhmibhedena saptabhaum (sc. maitri, karun, upeks) kmadhtur angamyas catvri dhynni dhynmtaram ca 140V1 =*
147R4 c* 155R1 (S. 32, Anm. 4).
dhyyin sich versenkend"
anirkrtadhyyinm smrtyupasthnnirvedhabhgiyas(r)manyaphalni
(u)tpadyamte 128R2.
dhvaja Banner"
nsgrc csya vaidryadhvajo (n)ir(gatah)
115V6 \ hrdayc csya sauvarno dhvaja utpadyate 153R2; dhvajam utpadyate 121V1;
yatanacitm dhvajm 134R5 (S. 22).
naksatra Stern"
nnvarnaratnanaksatracandramandalanadyah 130R3; brahmabhih ra(tna)pupamu-

217

Wrterverzeichnis

ktanakatryatanacitaih 136V5 \ hrdaye ca|


ksirapuskirinl t(amni)magnam naksatram
maitrsayaparigrhitasya (adhi )patirpam
147V 2 \ 157V 5,
nakha Nagel"

(p)dn(gus)tha(na)khavivare cittopanibaddhah kryah tato nakhavivaram makaramukham iva laksyate tena cittam pravesayati 128R4; 129V1] 129V2; bhiksavo
~tamnakhavivaranihsrts ca dhtavah 129R4;
(tesm)(sc. buddhnm)
'stanakhaprabhbhih padmargbham (sc. jagat) 144R1.
nagara Stadt"
ni(rv)nanagare 162R2 =* 161R5/6; 151R5.
nata Tnzer"
susiksitanatam iva vicitrm vesavisesm
kurvantam (sc. lokam) 161V1.
nadl Flu"
samyaksamb(uddh)s
tamn(bhinih)srtbhis candramandalasamksbhir nadibhir
yogcrs(r)ayam pryate 152R1 ^ 151R6;
pusparasanadyat ksiraghrtanavanitanadyah
nanvarnaratnanaksatracandramandalanadyah pravilin y(o)gcr(srayam prayamti) 130R3; 141R5; 157V4; 157Rl; 168R2.
namas Verehrung"
150R1.
naraka Hlle"
'stau mahnarak sodasotsadamahparivrm sahasitanarakais 145R5; ^ astau mahnarakh sodaso(tsadapar)ivrh sahasitanarakai mukhi bhavantil tatkran^
(samjive)
^klastre
s(am)gh()t(e)
(rauravayoh)
(tapanel pratpa)ne narake
(avicau) narake 148R5149V1; pravho
prthivimandalam bhitv narakm
prets cvabhsya 129R2; ^ (pr)thivi bhitvstau mahn(arakn avabhsya) 117V3;
mahnarakn sarvn avastabh(ya) 149R1;
134R3 (S. 31; 138, Anm. 3).
navanlta Butter"
ksiraghrtanavanltanadyah 130R3; navanitavarnasamspars stri 155R4 = 156V1.
nas (pass.) zunichte werden"
nasyamn 160R4.
nda Stengel"
padmandeu 144V2 ^ 153V6.

nn verschieden"
nnratna 131V 3, 146R1, 146R2, 153R6;
nnvarna 127V3, 130R2, 130R3, 131V5,
131V6, 148R3, 150V2) nnprakrair asucibhih 128R5; nn^ucidravy(n)i 130R4; nnsukha 153R1; (n)nduhkha 162R5.
nbhi Nabel"

pravho
parivartya nbhym pravisya
dvitiyo (sc. pravho) nbhy (sc. nirgacchati)
nbhyh (sc. vicchidyate)
129R2-4 ^ 133R1 ^ 135V1 =* 135R3 ^
146R6-147V1 ^ 152V2 ^ 165R3; nbhyh
csya (pu)spapravho nitisrtah 131V2; nbhy ksanibhnm bu(ddhnm) pravho
ni(r)ga(tah) 133V4; n()bhinihsrts ca dev
147V 2;
samyaksamb (uddh)s
tamn(bhinih)srtbhis candramandalasamksbhir
nadibhir 152R1; (n)bhiparyamtanimagnam
ctm()nam 147V 2 ^129R4; yogino nbhym
sastra nirgacchati 160V2 \ nbhisthn(m)tare ca ratnamayam simhamukham utpadyat(e) 130V1; nbhipradese r a t n a m a y n i . . . .
167V5; nbhyupari 169R6; sarvabuddhnm
nbhisu 134V5; amte ca sarva(m) jneya(m
n)bhym nirudhyat(e i)ti vyutthnaml ||
166R5 ^ 129R5 ** 135V2 ^ 139R3 ^
152R3 ^ 155V2 ^ 165R5 ^ 167R2\ 132R3;
117Rl; (smrtini)mitta nbhym (sc.nirudhyate) 166R5 (S. 34f.).
*nmarpa Name und Form"
138V5.
naraka hllisch"
sarvms ca satvm narakm(5ic) pasyati
149R2.
nsa Tilgen"
tadapek^adosansya 156V3 = 158V1
158R3 = 159V3 - 159R5 - 161V6.
nsgra Nasenspitze"
nsgrc csya vaidryadhvajo (n)ir(gatah)
115V6; (n)sgre dvicchidro bhavati tbhym
svsapra(svsa). . J26R1.
niksip niederlegen"

niksipte 144R6.
nitnta

durchdringend"

nitmtalohitavarnab 131V 4.
nipat

niederfallen"

nipatamti 127R3, 135V5, 144V6; nipatit


146V 2.

218

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

-nibha gleich"
kanibha 130V5, 133V4, 148R5, 159R3,
159R6, 162R2; 132R3.
nimajj einsinken"
nimajjatii27i?2;nimajamnam (sic) 125R3;
nimagna 116R2,118V 3,118V4J18R3,124R4,
127R2, 129R4, 135R5, 141V4, 144V1, 146V2,
147V2, 169R6, 170V1.
*nimitta Symbol"
bladrakam cit(tanimit)t(am) 118R2 ^
126R3 bladrakamukham pa&yati vijnnadhtunimit(t)am 129V5; amkham kaadhtunimittam 129V 5 \ spandamnam jvalitam vijnnanimi(tta)m 130V 3 \ nirmalojvalasastracitam pratyaveksannimittam 133R5;
skandhanimittni 133R6; adyatananimittam 135R6; yathoktaubhanimittya(tana)citam jagad 136V 6 \ (ra)mikalpam
smrtini(mittam) 157R3\ (sm)rtinimittaml snehapariprnavaidrya(bhjanacit strl) 170R3;
^
smrtinimitteu (sc. pravisamti)
smrtinimittam yogeramrdhani 165R2; =
nbhym 166R4/5; ni^thnimittam 121V1,
121V 2, 133R3) 119R3; 123R5; 126R2;
149R3; 149R5; 167V5; 167V6; 170R5
(S. 47, Anm. 6; 48f.).
nimna (1) flach", (2) vertieft"
(2): nimnam pradesam pasyati muktcitam
128V4) (2): (bhrmadhy)dhar nimnapradest 149R6.
*niymvakrnti , ^Zustandekommen des
Unwandelbaren''
134V6.
nirkr ablegen"
nirk(aran)Iyo 147V4.
ninksana Beobachten"
158R6.
nirudh zum Verschwinden bringen"
amte ca sarva(m) jneya(m n)bhym nirudhyat(e i)ti vyutthnam \\166R5 ^129R6 ^
130R6 ^ 135V2 ^ 135R5 ^ 139R3 ^
147V4 ^ 152R3 ^ 155V2 ^ 165R5 ^
167R3; niruddhe sarvasmim jiieye 134V4 \
(dityama)ndaleu nirudhyamte (sc. buddhh) te vajrsane^u vajrsan( bhajanesu
bhjanlj smrtinimittesu smrtini)mitta nbhym 166R4; pravha utpadyate
prthivim spharatinirudhyate 132R3 ^

132R6 ^ 133V1 ^ 133V2 ^ 133V3 ^


133V4 ^ 133V6 \ dhtavh
lokam spharitv
nirudhyamte 129R5; avidydhipatirpam abhyha(tam) nirudhyate 159R2
^ 159R6; simhamukham utpadyat(e)
niru(dh)yate 130V2; vi()iryantam nirudhyam()n(am) (sc. lokam) 130R1.
*nirupadhisesa erlst"
nirupadhisee nirvnadhtau 151V6, 151R3,
164R4 (S. 176, Anm. 11).
nirodha Zunichtewerden"
(nirodhnudarsanym) 119V1, 126V2 \ nirodhnupasyanym 128V 2; (prav)h(a)spharananir(o)dh(au) 129V2.
nirgam ausgehen"
nirgacchati 121R4, 130V3, 132R2, 132R6,
145R4, 154R4, 160V2, 161R6; nirgacchamti
127R5, 129V1, 136Vr2, 136V 2, 152R1, 153R6;
nirgatya 129R2, 135V1, 135R3/4, 136V3,
144R2,144R4,146R6,148R2,151R2,154R4;
nirgata 115V6, 118V5, 118R2, 121R3, 129R1,
131V3, 133V29 133V3, 133V49 133V5, 133V6,
133R4, 135V1, 143V1, 145V1, 145R4, 148V5,
152V1, 153R2.
nirjta entstanden"
147V3.
nirji besiegen"
nirjitya 139V2.
*nirjvara nicht hitzig"
(dharmah)
(nirjvara) 165R6.
nirdista gelehrt"

karunnamtara mudit( n)irdist bhagavat


152R5 ^ 155V2.
nirdesa Beschreibung"
karunprayoganirde&ati 147R2; muditnirde s 152R6.
nirdhv hervorstrmen"
nirdhvyamnm 157V3.
*nirbhjanayoga bung des Umbiegens"
kadalipatraputputnirbhjanayogena
133V3.
nirmala rein"
130R1, 130R2, 133R5, 147V3, 167V6.
nirmukta befreit"
(sarvamarana)pratyayanirmuktam
t(mna)m 144R4.

Wrterverzeichnis
*nirvna Verlschen"
parisampt vaineyli sntam nirvnam iti
162R1; 166R2; 166R4.
*nirvnadhtu Region des Verlschens"
nirupadhisese nirvnadhtau 151V6, 151R3,
164R4.
*nirvnanagara Stadt des Verlschens"
bhagavm
ni (rv)nanagare praviya
pradipa ivopasamam gaccha(ti) 162R3.
*nirvnapura Stadt des Verlschens"
(nirvnapu)rastham ca bha(gavantam dhrm)y(m) gandikm kotayamtam pa&yati sa abdafc
(sr) vaknm nirvnapurapravesaklam scayatil
tato nirvnapuram praviat vaidrybhab dauvrikah
puruso
kathayatiha nagare yati pravito
na bhyo nirgacchatiti| te ca pravisth. ksamayair ivbhraktair avastabdhh pradip iva ^myamte 161R26.
nirvid Kummer"
nirvidkramanasikrnamtaram 153V1.
*nirvid Abscheu"
saddhtu dbilni(sic) nirvidgnin jvalamti
160R1; 130R5.
nirvrt sich entwickeln"
nirvartate 160R4.
*nirvedhabhgiya zur Durchdringung fhrend"
smrtyupasthnnirvedhabhgiyas(r)manyaphalni 128R2/3.
nirhrta herausgenommen"
132V5.
nivista eingedrungen"
125V6.
niscar (1) herausflieen" (2) (caus.) von
sich geben"
(1): pniyam ni^carati 149V3 \ (2): abdam
ni^crayamti 150V1.
*nisraya (1) Abhngigkeit", (2) Untersttzung"
(1): (ni)srayo (d)esitah
tatrdhrako
nisrayali
-samdhraka(li)
utpatti
prati^th
^prajnaptiti
prajnaptinitsrayahi sprha(n)i(srayab) 136R4-6; (2): 154V5
(S. 112, Anm. 11; S. 153, Anm. 6).
*nihsrta abhngig"
brhmanak mamtrfr pudgalam nitisrth

219

(pudgal vri)hiya(vm) nihsrtli


hriyav(sic) prthivl nih(srt)h 136R4-5.
nisad sich niedersetzen"
nisidati 152V3, 152V 4.
nisanna sitzend"
121R3, 121R4, 129R4, 131V3, 131R5, 144V2,
145V1, 146R1, 146R2, 152R1, 158V2, 159V6,
161V3, 168R3.
*nisady Niedersitzen"
camkramanisadybhym 144V4.
niskram heraustreten"
mrdhn niskrmya 117V4.
niskrama Heraustreten"
129R6.
niskramana Heraustreten"
(m)tu kukisamprajnaniskramanam
164R1.
*nisklesa frei von Befleckungen"
sakklesm nikle^n 156R3; sarvasatv nikle^ drsyante 156R4; sarvasatv
pravrajit niskles 159V 5.
*nisthnimitta ,, VollbringungssymboV'
121VU 121V2; 133R3.
nisthita vollbracht"
nisthita prayoga 11 135R5.
nispatti Vollendung"
svsaprasvsanispattir eva 121R6; yatanaprayoganispattihL || 136R2.
nispaima vollendet"
evam iyam npnasmrti saparikarml savises nispamn vak(tavyj) 128R2; evam
asya saparika(rm savises ka)run nipam(n va)ktavy| 152R4; (u)pek nipann
bhavatil 155V 6.
*nisyanda Ergebnis"
tribhih rupai(h) pravartate adhipativibhganisyandarpai 146V4 ^ 154V1; vyutthitasypi nisyamdam anuvartate 146V6 \ vypdanisya(nda) 147R1 (S. 30, Anm. 5).
nistirna erfllt"
nistirn pratijn 162R1.
nihsr hervorkommen"
nitsrtya 130V 5,131V 5,131V 6; nisrta 120V 3,
121V 4, 123V2, 126V3, 127V2, 129R4, 130V%
131V2, 131R4, 132R4/5, 135R3, 135R5,
136R5, 139V 3, 141R3, 145V 2, 145V 5, 145R3,
147V1, 147V2, 148V1, 148V6} 148R5, 151R4,
151R6, 152R1,154R5, 156V1, 157R2, 158R4,

220

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

159V4, 159R2, 159R6, 160V 5, 161V6, 162V6,


165R1, 165R3, 168R5, 169R2, 170V5.
nila blau"
nilbhh patth 127V4 = 12IV5; (ni)lbh
(cand)r(ama)ndalacitam ca pattam 169V4;
n(I)lbh(n)i (pa)ttacchatrni 121R5 =
120V4] nil(bham) (sc. padmam) 152V2;
nilbhair amkuraih 121R3; nilavarno nllmkuraparivro manih 145R2; (nilava)rnmk(u)racitah parvatah 137R6; (ni)lbhnm budbudacittnm buddhnm pravho
132R6\ nilavarno dhtu 153R6; stri s(u)varnbh nilavas(traprvrt) 162V3; nll(apitalohitvad)tarasapariprn ()t
parvatah
130R1; nildiras(a)n(i)magna(m) 170V1;
nilalohitvadtam (sc. rasam) sampadya
'bhinirhara(ti) 146V3; suvarnanilapitalohitvadtarasbhisekaHi 145V4; n(i)lapitalohitvad(th pravhh) 133R4; 118R1; 131V1;
144V 3 \ 169R6; 121V 3 \ 127V5 \ 131V1;
168R4; s. indranila.
nairghrnya

Hartherzigkeit"

m(ai)trnusrena| upeks samtisthatel n


nairghrnyadostl 161V 5.

patutva Schrfe"
cittapatutvam 118V6.
patta Seidentuch"
bhagavm^ casya sirasi pattam badhnti
128V3 - 150R1 ^ 127R4; (ni)lbha (cand)r(ama)ndalacitam ca pattam sirasi baddham
pasyati 169V4; stri
sapattasuvarnamlvabaddh 151R1; (vyutthnak)l(e)
pattabaddham srayam utpadyate 130V4; svasatah. nilbhh patth
prasvasatab avadtbhh patth 127V4; pndarh patt
nihsrth
(ni)lbhh patth 121V45 \
sarvasrotobhyas csykasanibhh patt nihs(r)tk sar(vasatvn upaguhya ti^thamti)
148R45 ^ 130V5; pattair
satv cchdyamte 155R5; satv
vaidryastambhanihsrtaili pattai
avacchdit dr^yamte 158R4; bladraka^
sarvabuddhnm upari pattacchatram krtv tisthati
127V5 \ n(i)lbh(n)i (pa)ttacchatrni mahmti 121R5 ^ 120V4; (S. 35, Anm. 10;
S. 41, Anm. 4).
path vortragen"

patham vcayam cchrnvams ca 166V2 ^


166VL
pat fallen"
paksa Seite"
patati 148R4, 151R2, 154R2; ptaymi
mitrapaksam 155V5; (pa)ksadvayam 154V4.
149V5; patita 131V2; 136V4, 136V6, 160R3.
panka Sumpf"
patra Blatt"
mahvyasanapamkd u(d)dhrt 148R4.
127V2 \ 144V112 \ 152V3; s. kadalipatra.
pankti Reihe"
padma Lotosblume)"
134V5; 144V 2.
m(rdh)n( csya) padmam sambhavati tanpafica fnf"
nisanno bhagavm dharmam desayatil
pamca sveta gaj
tadadhirudhh pam- 144V2 \ buddhs ca padmdhirdhh 152R3;
ca (buddh)
(balnm adhipatirpam) buddhapratyekabuddhasrvakh padmdhi165V4 \ ^ (pamcnm balnm) pamca rudh 136R1; catnrvarnapadmo ta(dadhir)vajramay hastin(ali) 166V56 \ pamcnm dhs caturvarn buddh bhagavantah 146R4;
indriy(nm) 166V5 \ pamcadhtuvibhgena (lokam) padmacitam ta(dadhir)dh(m)s ca
160V5 \ pamca ca cyavannimittaiti duhkhi- buddhn pasyati 131R4; padmesu satv
tm 149R3; pamcaramga 133R3; rupvacara nisannm
buddhavapurdhrino 146R2;
pamcaskandhasvabhv (sc. mudit, = ka- grhitapadm buddhh yogcrsrayam padrun) 153V3 - 147R3; 132V2 \ 149R5.
mair vyavakiramti 131R3; buddh
pancaka Fnfzahl"
tammukhanihsrtai ratnapuspapadmavarsair
skandhapamcakam 160R6.
loko (vyava)k(i)ry(a)te 127V3; (de)v*pancagatika die fnf Existenzformen um- nm ca padmaih prthivi pryat(e) 148R3;
fassend"
(pad)mmi
(suvarna)padmaih vaidryanpamcagatikam c(akram). . . .bhramyamnam daih ratnacitaih prn() 153V6 \ sauvarnam
150V2; 134R3(S. 32).
padmam dasadisah spharitv( sarvasatvn

Wrterverzeichnis

upagu)hya tisthati 145V5; padmapravhais


svam srayam prya(mnam) 131B5;
buddhapravho
padmesu nisanno drsyate
131V3; samjtaprasdasya pdamle padmam (utpa)dyate 152V4; vikasitebhyah padmebhyo tulym pritim 144V2; caturvarnbhisekali caturvarnapadma 146R3; sauvarnena padmam
nil(bham) 152V 2 \ nnratnacitai padmair 146R1; (pa)dm(a)jam
137V1; 123V5 \ 131V1; 131V3) 155R2 (S. 40;
S. 131,Anm9.).
padmakarnik Samenkapsel der Lotosblume"
bhagavm
(padmaka)rnikym nisidati
suddhvss ca devh patresu 152V3 ^ V4;
vaidryadamdpadmni | tatkarniksu ca
kirapuskirinyah 144V1.
padmadanda Lotosstengel"
padmadandnusrendhiruhya
s(ar)v(asatv) 144V1.
padmanda Lotosstengel"
tesu ca padmandesu padmapamktayo 'nam(ta)paryamt sambhavamti 144V2.
padmapankti Lotosreihe"
144V2/3; 134V5.
padmarga rubinrot"
(tesm) (sc. buddhnm)
'stanakhaprabhbhih padmargbhm (sc. jagat)
144R1;
indranilapadmargasphadikavarne
146R3.
padminl Lotosteich"
hr(daye pad)mim prdur bhavati| suvarnavlukasti(rn suvarna)padmaih
^prn()
153V5.
para (1) hchst", (2) fremd"
(1): 120R4; 144V 3 \ 144V4; 147V 3 \ 147R5;
159V2; (2): 147R1; 148V4; 152R4; 152R6;
153V1; 156V 3.
*paranirmitavasavartino devh Paranirmitavasavarti-Gtter''
(y)vat parinirmitavasavartidevm(sic) sukhena sukhitm (sc. satvm) 153R4; yvat
parani(rini)t(a)vasavartino devm 150V2
(S. 32,Anm. 8).
parama uerst"
paramena cittada(mopa)samena 154V3.
parampar Aufeinanderfolge"
janmaparampar 158V4, 158V6, 159V1.

221

paraspara jeweilig"
129R5; 134V 2 \ 155R6; 159R4.
parmrs (1) berhren", (2) nachdenken
ber"
(1): bhag(avm pni)n() mrdhnam parmr^ati 152V5; (2): astabhir kraih parmrsati
rogatah
(ga)ndatah
s(a)lyatah
(aghatah)
(anityatah)
duhkhatah
sunyatah
(antmatah parmrsanl) 133R6-134V4.
par hata weggeschlagen"
sarvvidydhipatirupni par hatni nirudhyamte 159R6.
*parikarman ,, Vorbereitung''
npnasmrti saparikarm| savises 128R2;
saparika(rm savi^es ka)run 152R4; (b)hyam parikarma dhytmikam tu parikarma 132V2; rupa-( = vedana-, = (samjn-), =
samskra-, = (vijnna)-)skandhaparikarma
132V 3 = 132V 4 = 132V 5 = 132V 6 \ krtaparikarmanah avasthitasamdheh 130R4 ^
130V 5; 145R1;
sildikrtapari(karmanah)
134R2/3 = 128R4; t(a)t(c. skandhaparlks)
parikarmdaul sdhranam maitrsaydi(m)
prvoktaml 132V1 (S. 30, Anm. 2).
*parikalpa Einbildung"
s. tmaparikalpa.
*parigaves sammeln"
ratnni puspni ca
^parigav(esat)e 152R3.
parigrh erfassen"
parigrhya 145R4; parigrhyamna 139R6,
147R3, 153V3, 155V6/R1) parigrhita 125R3,
127R2, 127R3, 147V2.
*paritta klein"
115V3.
paritr erretten"
kathayanti ca paritryasva kruniksmm
162R5.
*parinyaka Fhrer"
sym aham anga(te 'dhvani sarvasatva)parinyakel 152V 5.
*parinirmitavasavartide vh
, ,Paranirmitavasavarti-Otter"
s. paranirmitavasavartino devh (S. 32,
Anm. 8).
*parinirvna das vllige Verlschen"
(par)inirvnakle sthavir(am )namdam mamtrayati
(adya tathgatasya)

222

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

(niru)padhtee(sic) ni(r)v()na(dhtau pari)- ndni (sauva)rnaktgraparivritni 146V1;


nirvnam (bhavisyatiti) 164R34; bhagavat- par(i)sandm 146V1, 146V3; (parisa)ndh
parinirvnam abhimukhi bhavati 161R2; 146V4/5 (S. 21, Anm. 8; S. 129, Anm. 6, 9).
162113; 162R5.
parisikta besprengt"
paripavana Getreideschwinge"
^italajalaparisiktam iva 128V2.
pradip
yatanniparipavanvac
parisampta ,,erfat"
chidri kurvamti 136V3; pradips ca krtsnam parisampt vaineyh bantam nirvnam iti
lokam paripavatac(sic) ehidri krtv 136V4. 162R1.
paripka Reifen"
parlks betrachten"
117R1.
satv
(veda)yitam triprakram paripariprna erfllt"
kamnm(5ic) dr^yamte 158R5; pratity127R5; 128V3; 128R5; 129R4; 130R1; (asamutpdam parika)mansya(^c) 159V6.
130R2 130R3; 130R5; 135V 2; 136V 2;
parlks Betrachtung"
146R5 15IV 4; 154V4; 157V 2; 160R5; 136V5 \ 136R6; 159R5; s. skandhapanks,
165V2 165R3; 168V4; 169V6 \ 169R1; vedanskandhaparlks.
samjiiskandhapa169R3; 170R3.
riks, vijfinaskandhparlks, yatanapariparibhoga Geniessen"
ks, pratltyasamutpdapariks, addhtupa~
v(i)sayaparibhogdhi(patya)sam(pad) 143V3. rik (S. 27, 29).
parivra (1) Gefolge", (2) umgeben"
paryanka Ruhesitz"
(1): buddh bhagavamtah anekaataparivsvasvirnaparyamkas(sic) tadadhirdhn sa(r)h 127R6 ^127R4; buddhn anekasaha(tv)n 143R4; satvam paryamkena niannam
srapa(r)ivran 151R3; (bhaga)vatali s(r)va158V2; paryamkena nisannasya 145V1; sakapa(r)i(vra) 139R3 ^ 161R4; ryamaitretv pary (am )k(e)n(a) n(i)(a)nn upek(a)ks
yam aneka^rvakasahasraparivram 128 V5;
tithamti 159V6 \ (stri) paryamkena nisann
ryamaitreyas ca tatparivr^ ca 151V1;
upekdhipatirpam 161V3.
k&yapdivipayiparyamt b(uddhm) saparyanta (2) bis hin zu". (2) am Ende",
pa(riv)rm 128R1; bodhisatva
asam(3)
Umkreis"
khyasatvaparivrah 151V6 \ 127R6; 139V2 \
prthivim
astau mahnarakh soda^o(tsadapar)ivrli (1): aghanithaparyamtm
132R2
=
132i?3;
aghanithapa(ryamtam
lo148R5 ^ 145R5 (2): nilmkuraparivro
kam)
131R4;
rdhvd
aghanithaparyantam
manih 145R2 ~ 145R3.
146R1; (co)r(dh)vam yvad aghanist-haparyparivr umgeben"
amtam
129V4; samudraparyamt mahparivrya 130V3; parivrta 144R4, 147V1,
152V3, 152R2, 154R5, 164R5, parivrita prthivim 129V1 = 116V3; 116V4; (n)bhi146V1, 158V2 (S. 21, Anm. 8; S. 129, Anm. paryamtanimagnam ctm()nam 147V2;
(2): ksyapdivipasyiparyamt b(uddhm)
6,9).
128R1;
bhjanaparyamta 124V3, 124V5 \
parivrt zurckkehren"
(3):
s.
anantaparyanta.
pravhah
parivrtya 135V1 = 133R1;
parvata Berg"
= parivartya 129R2 L 135R3 == 147V1;
upari
csya nil(apitalohitvad)tarasapariparivrtta 118V1, HSV2.
prn()t parvatli 130R2; tat(^c. caturvarna)parisnta ruhevoll"
rasapariprnah parvatah 146R5; sthityupari
139V5.
(
ca parvat vicitryatanacit 135V2 \ (nilaparisuddha , ^makellos'
va)rnmk(u)racitah
parvatah 137R6; kle^a131R2.
parvata
150V2,
150V4,
150V5, 149V5 \ parpariSodhana Reinigen"
vatni va(n)n(i) ca| 167R5 (S. 184, Anm. 2).
adhytmavyupathaparisodhant 126R5.
pasct anschlieend"
*parisanda Rundstufe"
pari^anddhirdhm 145R6; sarvapari^a- 162R3.

Wrterverzeichnis

p trinken"
satv ca pibamto drsyamte 145R3.
pni Hand"
tato Jsya bhag(avm pni)n() mrdhnam
parmr&ati 152V5.
pndara gelbwei"
pattam
pndaram 127R4 ^ 121V4 ^
121V5; 120R3.
ptra Schale"
grhitatailaptryudhs trayah p(urusb)
162V3.
ptrl kr sich zum Gef machen"
lokam ptrl krtv 167R1.
pda Fu"
samjtaprasdasya pdamle padmam (utpa)dyate 152V 4\ (bhaga)v(a)tali pdayo pranamya 154R2 ** 152V4; = patamti 150V1.
pdngustha groe Zehe"
(p)dn(gu)tha(na)khavivare cittopanibaddhah kryah tato nakhavivaram makaramukham iva laksyate tena cittam prave^ayati| 128R4; dvitiyapdngus(th)e nakhavivaramakarm . . . 129V2; pdmgupte(sic)
gomayapindam 136R6.
pnlya Getrnk"
atmgopetam pniyam 149V3.
ppaka bse"
na ca p(pakam svapnam patyati) 147V4.
*pramrthika der hchsten Wirklichkeit
entsprechend"
(p)r(a)mrth(i)kam sanm| smke(tikam)
cvataramti 154R3; smketikena (^san)e(na)
tadanamtaram
p(ra)mrthikasad(dh)arma
166V2; smketikapramrthi(kam ssanam) 166R2.
prsva Seite"
(ca)tursu ca pr&v(e)su samudracatustayam
130R5 = 131V1; yatanarasapuru^a
tasya prsvebhyo dvracatutayam apvrtam
136V1] brahm
dakine cs(ya) pr^ve
sauvarnena padmam vme nll(bham)
152V2 \ vmapr^va^yinm 160V4.
*pitaka Beule"
tato 'sya karunrtasya bhruvor madhye
krsnataptam pitaka(m utpadyate) 148V1,

223

pinda (1) Klumpen", (2) Ballen"


(1): s. ayaspinda, ghrtapinda; (2): s. phenapinda; s. gomayapinda.
pitr Vater"
pitrvinayanam 164R2.
pld peinigen"
duhkhym pidyamnasya 158V4; (dub)khaih piditt 158V4 ~ 162R5; 143R5.
pita gelb"
(simhh)
pit(a)v(a)rns 166V4; nilapitalohitvadta 118R1, 130R1, 131V7, 133R4,
145V4, 169R6.
*putputa Falten und Entfalten"
(kada)lipatravat putputayogenvatisthamti 132V5 \ v(i)citraputputacitah puru^apravho 133V3; kadalipatraputputnirbhjanayogena 133V 3,
punya [religis] verdienstvoll"
trividhh samskr puny ah ap(unyh nifijyh) 137R4; tridhynopag^ ca punynm samskrnm 137R5; 139R4.
*punyaprasava Erzeugung von [religisem] Verdienst"
(pun)y(a)prasavpramnataypramneti (sc.
maitri) 145R1 = 146V6.
*punyasrotas Flieen von [religisem]
Verdienst"
prtimokasamvarvijnaptipunyasrotasah
169V3.
putraka Sohn"
152V5/6; priyaikaputrakava 145R4.
*pudgala Individuum"
brhmanak mamtrh pudgalam niti^rth
136R4.
punahpunar immer wieder"
152R5.'
pura Stadt"
s. nirvnapura.
purusa (1) Mensch", (2) Mann"
(1): kegadipurusa(pra)vhh
tadvan nndhtupurusapravh 129V2 \ v(i)citraputputacitah purusapravho 133V3; addhtumayaih purusaih prthivi prnm 129R5;
(2): puruah kathayati 151V5 a* 161R5 ^
169R5; samskrdhipatirpaml puru(a). . .
137R3; (hrlava)trpyadhipatirpam
(pratpa)ne narake| bhrtodbharjanapitara- stri purusa^ ca 159V2 \ (a)v(e)n(i)kn()m
s(m)rtyupasth()nn(m)
tr(a)yali puruprave^am 149V1.

224

Dieter Sehlingloff, Ein buddhistisches Yogalehrbuch

s grhityudhs tailabhjanahasta drya(nt)e


165V6 ^ 162V3; hastesu grhitaratnopakaran purus 170R5; (pu)rusa
wddharati
118R4; c purusenodriyamnam pasyati
125R4; sasastrah puru(sa) 130V 6 \ yatanarasapurusa 136V7, 136V 2, 149R2\ 150V3;
Jf62F5(S.16,Anm.2;S.49).
purusaka Mensch"
crnapurusaka utpadyate 129Rl.
*purusadamyasrathi Lenker der zu erziehenden Mnner"
164V1.
*puskirinl Teich"
padmnil tatkarniksu ca ksirapuskirinyah
s(ar)v(asatv ca ksirapus)k(i)r(i)nisu nimagnh 144V1; hrdaye ca| ksirapuskirini
t(amni)magnam naksatram maitrsayaparigrhitasya (adhi)patirpam 147V2; yatanarasapariprn puskirini m(r)dhn() sambhavati 136V2 \ (pu)rusas ca tasy()m (e)va
puskiriny(m). . . .grhyoddharatil tatah puskirini jvalati 118R4.
puspa Blume"
pusparatnavarsam 128V4 ^ 152V6 ^ 154R2
^ 126V3 ** 154R2 ^ 154R5 ** 162V4 **
170V6; ratnapuspapadmavarsair 127V3; pusparatnamayah 161R5; ratnni puspni ca
152R2;
168V3;
gandharatnapus(pa). . .
169V 2; ra(tna)puspamuktanaksatryatanacitaih 136V5 \ (m)uktpuspa. . . 123R2; pusparasadhrbhih 149R2; pusparasanadyah
130R3; nbhys csya (pu)spapravho nihsrtah caturdh gacchati 131V2 \ tni puspabhtni tatra n(i)patanti 144V5 \ p(u)spakalpa
168R5.
pya Eiter"
pyardhirakarnamalapravhb 135V 6;
135R1.
prva (I) zuerst", (2) frher", (3)unter
der Voraussetzung"
(1): 129R3; (2): 169V4; 169V5; (3): s.buddha-, dharma-, sangha-, j^ila-, devatnusmrtiprvam.
prvavat wie oben"
150R6; 160R2.
prvokta frher erwhnt"
132V1.

pr erfllen"
(pravhah pra)viliya- -(sra)yam prayati
154R4 ^ 165R3; catvra pravhah kcapribh.i(sic) sariram prayamti 146R5; pravhah
(yo)gcrasrayam
prayamti
135R2; pravhaih
anekavarsadhrbhi(r)
i(va) svam &rayam prya(te) 131R5 ^
136V4; nadl (srayam p)r(ayati) 152V1 ^
130R4; (n)nvarnena rasena sraym puraya(ti) 130R2; samudra rasaih pryamte
131V2/3; dev^ ca krtsnam gagana pryamn pusparatnavarsam utsrjanti 128V4; (de)vnm ca padmaih prthivi pryat(e) 148R3;
143V1; prnam svam srayam vyubhih pasyati 118V2; 143V1; anyakosthgais(sic) ca
p(r)thi(v)i prnm 132V5 \ (saddhtu)mandalaih lokam prnam 160R3; buddhsrayaih
sthiti(h prn) 152V2 \ brahmabhih
gaganam prnam 136V5; 122R3; 125R2;
145V 1\ 153V6 (S.37).
prthagjana die breite Masse"
115R6.
prthivi Erde"
hriyav(sic) prthivi nih(^rt)h
prthivy
psu pratisthitl pah vyo vyur kse
136B5; pravho
aghanisthaparyamtm
krtsnam prthivi spharati 132R2 = 132R3 ^
129R3 ^ 120V3; = (pr)thivim bhitvstau
mahn(arakn avabhsya) 117V3 \ = samudraparyamt mahprthivim prya 129V1 ^
116V3; padmaih prthivi pryat(e) 148R3;
purusaih prthivi prnm 129R5; anyakosthg&is(sic) ca p(r)thi(v)i prnm 132V5; karanthaih prthivim citm 132V4; ksudrair asucidra(vyaih prthivim citm) 132V4 \ (kt)(g)raih s(phu)t(m) prthivim 132V3 \ vaiduryamayi(m) prthivim vaiduryamayavajrsanaracitm 144V5; spandamnm prthivim
132V6; prthivym camkramati 144R6\
116R2] 126V 4; 153V 6 \ 164V 5; 165V 2.
*prthividhtu Element Erde"
131V3; 160V3; 160V6; 160R2 (S. 31).
*prthivimandala Erdkreis"
pravho
prthivimandalam bhitv
pmandalam vyumandalam ksadhtum avabhsya 129R2; = prathivimandalam(sic) bhitv apyagatnm satvnm

Wrterverzeichnis

sarvadulikhopasamam krtv y(vad vyumandalam bhitv) 146R6 (S. 31).


prstha Rcken"
. . .prsthatah upanibandhacetasah 155R2.
pesi [Embryonalzustand] Pesi"
mtuh kuksv arbu(dap)e(sighanapra)khnukramenal vardhamnam 129V6.
*paunahpunyena zu wiederholten Malen"
122V3/4; 127V5.
paurna frher"
yathpaurno Vati$thate 146V5.
*prakra (1) Mittel", (2) -artig"
(1): ebhi prakraih. satvn adhimucyamnasya 153V5; (2): nnprakrair asucibhih
128R5; s. triprakra.
praks (caus.) offenbaren"
138R1; 160R5; 160R6; 166R4.
prakhya hnlich"
vajraclaktaprkhyo(sic) Vatisthati 144R2;
** 155R3.
*prajiiapti Bestimmung"
prajnaptih loke saty ksam prajfiyate
prajnaptinihsrayah 136R5.
prajn erkennen"
loke saty ksam prajfiyate 136R5.
prajn Erkenntnis"
dnsilaviryaprajii 164V6 \ pradipahast ca
stri prajndhipatirupam
praksayati
pranam sich verneigen"
(sat)v()
maitrvihrinam pranamanti
145V2 c* 144R3; (bhaga)v(a)tah pdayo
pranamya 154R2 ^ 152V4; 151R1.
prandik

Kanal"

prandik(^c) 129V3.
pransita vernichtet"
pr(an)s(i)t(a)m ()sray(am) 160R4.
*pranidhna Gelbde"

dau bodhipranidhnam (sc. bodhisatvasya)


164V6) bodhau ca pranidhnam karoti (sc.
yogerab) 150V6 \ = bodhya pranidhnam
karoti 151R1 (S. 54ff.).
pratikla widrig"

157V2.
pratigha Feindschaft"
d(u)^(ca)ritacrisv abahumtt(sic) pratighah 156V6 \ pratighas ca dri bhavati
158V6 = 157V1.
15 Schlingloff, Yogalehrbuch

225

praticchad bedecken"
krans
^praticcheyam(^ic) 149V2 \ praticch(am)n(a) 150R1.
*pratijii Versprechen"
nistirn pratijn 162R1.
*pratipaksa Hindernis"
. . . .(pratipa)ksahsamanamtaram tmadrsti(pratipaksrtham skandhapariksrabhyate |)
132V1; bhavabhogatrsnprati(paks)nmtaram| mohapratipaksrtham pratityasamutpdaparlksrabhyate | 136R2; ajiinapratipaksnamtaram krodhapra(tipaksrtham) (sc.
maitriprayoganirdesah) 139R4; (krodhapratipaksnamtaram | parasukha)hitpanayanakranviskaranrtham | vypdapratipaksnamtaram vypdanisya(nda)
pratipaks()
dakranapratipaksviskaranrthaml karunprayoganirdesah kriyatel
147V6R2;
vihimspratipaksnamtaram
iryratipratipaksviskaranrtham | paraduhkh(a)pritipratipaksnamtaram v parasukhpri(ti)pratipaksviskaranrtham | (sc.
muditnirdesah) 152R6153V1; Irsyratipratipaksnamtaram kmarga(vypdapratipaksviskaranrtha)m| (sc. upeksnirde^ah)
155V3; 143R2; 148V5 (S. 30; 116).
pratibaddha gebunden"

126V5.
pratibimba Gegenbild"
130R2.
pratim Abbild"
buddhapratimh 159R1, 162V1.
pratibudh aufwachen"
sukham pratibudhyate 147V5 (S. 30, 116).
pratilabh erlangen"
pratilabhate 169V1, 169V2; upeksm pratilabhante 158V1 = 158R4 - 159V4, pratilabdha 169V 4, 169V5.
pratilbha Erlangung"
samdhipratil()bht| 127V1.
pratiloma rcklufig"
pratilomam ksyapdivipasyiparyamt b(uddhm) 128R1 (S. 84, Anm. 3).
pratividh durchdringen"
uttare capratividh(ya)(^*c) 147V6.
pratisidh zurckhalten"
(dau)vrikena pratisidhyate 142R4.

226

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

pratisth feststehen {Feststehen)"


tata(hsarvamarana)pratyayanirmuktam
bhyo {sc. pratityasamutpdah) dvividhah t(mna)m (pasyati) 144R4.
prati^thitotpatti kramabhedtl 136R3; prapratyaveks anschauen"
tisth | prthivy psu pratithit| pah vyo pratyaveksate 160V2.
vyur ke 136R5; chirsakplam griv*pratyaveksannimitta , .Anschauungssymsthipratisthi(tam) 137V 3; kmcanacakre pra- bol"
tisthitam 130V 5 == 146B1 =* 127V 3 ^ nirmaloj valasastracitam
pratyaveksanni151V4.
mittam utpadyate 133R5.
*pratyaveksanyoga , .Anschauungsyoga''
*pr atisam vedan , .Empfinden''
s. sarvakyapratisamvedan, pritisamveda- krtmtapratyaveksanyogenaitad dar^anam
n, sukhapratisam vedan, cittasamskra- utpadyate 169V5.
*pratytmavedaniya fr jeden erfabar"
pratisamvedan, cittapratisamvedan, vi(dharmah)
(pratytma)vedaniyo
vimuktipratisamvedan.
jiiaih
165R6.
*pratityasamutpda ,,Entstehen in Abhn*pratyutpanna Gegenwart"
gigkeit"
pratyutpamnpnasmrtibhvan
(sic) 128V4.
skandhadhtvyatanapratityasamutpdr*pratyekajina
Pratyekabuddha"
yasatydini. . . 169R1; bhye pratityasamutyath
pde krtakau^al(a)ti (dhyt)m(ap)r(a)t(i)- (sva)yamavabodhdhipatyasampad
pratyekajinnm
143V3.
ty(a)samutp()d(e) ' v(a)t(a)r(a)t(i)237F2
*pratyekabuddha , .Pratyekabuddha"
(S. 27; lllfT.).
buddhapratyekabuddha^rvakh padmdhi*pratityasamutpdaeakra Rad des Entrudh 136R1; 137V 5.
stehens in Abhngigkeit"
pradna ..Hinschenken"
pratity(asamutpdam pariksa)mansya dvmaitr&ayasya apramnapradnasthnmtadamgam pratityasamutpdacakram (sams(ra). . . 145R1.
k)rasmtnikam traidhtukam karmaklepradipa Lampe"
svabaddham bhramamtam abhimukhi bhapradipahast ca stri prajndhipatirupam
v(a)t(i) 159V6 ^ 139R1; tato ('sya dv)da160R4; te ca pravisth (sc. nirvnapuram)
^mgap(r)atityasamutpdacakrakrtam
papradipa iva smyamte 161R6 ^ 162R3;
rasparak(armaklesvabaddham satvasamu- 135V5; sa(m)kalh pradipatamtukalpodram abhimukhi bhavati) 159R4; vi(cak)rl
bhayahast 136V1; puskirini
tasy
(bhavati ca dvda)^(m)ga(m) pratityasa- pradipa nirgatya sarvny yatanni sarvs
mutpdacakr(am) 159R2 ^ 159R6 ^ 139V3/4. ca samkalh paripavanvac chidri kurvamti *pratltyasamutpdapariks
, Betrachtung
pradips ca krtsnam lokam paripavata
des Entstehens in Abhngigkeit"
(sie) cchidri krtv yog(cr^ra)ye patits
pratityasamutpdapariksrabhyate 136R3.
136V3-4.
*pratityasamutpdastra Lehrrede ber das
pradesa (1) Gegend", (2) Umgegend",
Entstehen in Abhngigkeit"
(3) Stelle"
pr(a)tityasamutpdasttram vistarena pra- (1): nimnam pradesam 128V4; 132R6;
k(sitam) 138R1.
(2): nbhipradee 167V5; bhuprade^e 165V4;
pratyanga Nebenglied"
cchatraprade^e 145R2; (3): (bhrmadhy)sarvmgapratymgabaddham tmnam
dhar nininapradest 146R6;,. . . madhye c169R5.
bhyunnate pr(a)d(ese) 133R5.
*pratyaya Ursache"
pradhv herbeilaufen"
hetupratyaydhinam (sc. lokam) 161V1; satv
samamtatah pradhv(amti)
svam &(rayam sarvama)ranapratyayaih pa- 154R2.
prabh Strahlen"
rivrtam pa^yati| srayc csya brahmno
drsyamte (| tem usnisapra)nirgatya tarn maranapratyayn udviksate buddh

Wrterverzeichnis

bhy krtsnam jagad indranilbham drsyate|


rnprabhy candrvadtam gtraprabhy()| kanakaprabhaml 'stanakhaprabhbhili
padmargbham 144V6E1; buddh bhagavantah prabhbhir lokam avabhsya 146R4;
= tajjanmadharma^ariranihsrtbhih prabhbhir lokam spharitv 165R1; buddhagunaprabhbhis cvabhsito loko 155V1; svsrayaprabhbhih krtsnam (lokam prayati|)
131V2; pravho
ratnaprabhbhir lokam avabhsya 154R4.
pramna

Ausdehnung"

mahpramnam 135V3; urupramn 128V 5 \


143V1.
pramdaphala Frucht der Verblendung"
169R5.
pramudita erfreut"
s(uva)rnbh stri pramuditotpadyatei muditdhipatirpam 153R3; satvn
pramuditm 153V 6.
pray am hingeben"

bodhisatvh sarvam sarvatra sarvad prayacchan 151V5.


prayuj ben"
prayukta 144V4, 154V2.
*prayoga bung"
ato 'nantaram dhtuprayogah yogasstropadisto 'nusartavyah iha tu prayogamtram
darsayisymah 128R3; bhiksavo dhtuprayogam bhvayamti 129B4; yatanaprayoganispattih 136R2; nisthita prayoga (sc. yatanaprayogah) 135R5; karunprayoganirdesah kriyate 147R2; skandhaprayoge 160R6;
tatprayogah 147R4, 153V4, 155V4; (asu)bhdiprayogena pravistasya 166V3 (S. 27ff).
pravarsana Regen"
satsparsyatangnipravarsana 149V1/2.
*pravha Strom"
tadanamtaram abhiekensrayam prinayan
tatol bhrumadhye cittopanibandhah tasmt pravho nirgatah prthivimandalam bhitv narakm pret^ cvabhsya kmcanacakram bhitv pmandalam vyumandalam
kasadhtum avabhsya parivartya nbhym
pravi^ya mrdhn nirgatyvyucchinnam
yvad aghanisthm devn avabhsya caturdhynarasam dya mrdhn punah pratil punar bhrumadhyd ekah pravho
15*

227

nirgacchati dvitiyo nbhy misribhtam


prathivi spharitv tisthatil prvam bhrumadhyd vicchidyatel tato nbhyh 129R1-3
=* 133R1-2 ^ 134R6 ** 135R3 c* 146R6 ^
152V1; abhisekapravhh 166R5 ^ 151V3 \
tato 'bhisekah raftnapravhah pra)viliya
mrdhn pravi(ysra)yam prayati prinayati ca hrdayc csya pravho ni(rgatya) . . . .
(a)dh(a)s c(or)dhv(am) c(a) gatv ratnaprabhbhir lokam avabhsya. . . .k(r)amena sthitim pray(atil) 154R4 ^ 165R2-3; (pravhah). . .(misri) bhtab. yvad vyumanda(lam) bh(i)tv()dh(as) c(ordhvam ca gatv)
163R1; pravho ni(r)ga(tah| traidht)ukam
spharitv tisthatil tatraiva nirudhyate 132R2
-133V 6;
(prav)h(a)spharananir(o)dh(au)
129V2 \ (bhrmadhyat phenapinda)pravho
132R2; bud(dh)nm pravha 132R3; vmd ams budbudapravho
(bu)dbudesu strimukhni 132R5; budbudacittnm
(sie) buddhnm pravho 132R6; daksinmd
amsd asya maricipravho 133V1; (s)uvarnbhnm buddhnm pravho 133V2; (ga)nd()d v(i)citraputputacitah purusapravho
133V3; nbhy ksanibhnm bu(ddhnm) pravho 133V4; 133V5 \ 133V6 \ (bhur)madhytl nn(ratna)mayah buddhapravho
nirgatah padmesu nisanno drsyatel prthividhtu sampadyamnah tatas ca ghanah
pravh. . . .
tato 'bdhtum sampadyate ta eva buddhh tebhya udakaprav(hebhyah) . . . .
(kasadhtum
sampadyate)k()(adhtuva)rnh pra(v)h
buddh
parisuddhabinducita(g)trh tatsadrs^ ca pravh (sc.
vijnnadhtum sampadyamnab) 13IV3
131R2; (au)c(i)dh()rbh(i)h pravh(a)h
(kmvacarm devm)
^rp(avaca)rms
ca
sarvsucidh(rbhir vi )kledayam |
dsayams ca 135R3; (caksurbhym). . . . .
(pravh) n(i)rgacchamti| srotrbhym pyardhirakarnamalapravhh
prasrvamrgt prasrvapravhh
(yo) gcrasrayam prayamti| 135V6R1; kesapra(vh)
e(vam) kesdipurusa(pra)vhh
tadvan nndhtupurusapravh
129V1 -3; ksirapravho
apyagatnm
satvnm
sarvaduhkhopasamam
krtv

228

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

146R6; buddhn
tannihsrtaih pravhaibi
padmapravhais cnekavarsadhrbhi(r) i(va) svam srayam prya(te) 131R4; bhagavatah sarirt pra(vho nirgatah) 154B1;
117V 2) 117V 6 \ 123V'1/2; 146R5; 167R2;
168R5 (S.35;38ff.;46f.).
pravill zerschmelzen66
nadyah pravilin y(o)gcr(srayam prayamti) 130R4; ra(tnapravhah pra)viliya
mrdhn pravi(ysra)yam prayati prinayati ca 154R4; = sa ca pravilinah tadsr(ayam) murdhna cchidrena prayati 165R2;
ghrtapindavat pravilinam jne(ya)m sarvam
tad&raye pravisati 136V6 \ (yata)nni yugapad utpamnny dhryamnni praviliyamte 135E6; yatanarasapursa praviliyam
136V2.
pravis eintreten"
sraye pravisati 136R1 = 121R6; = pravisamti 136R2; srayam pravisamti 144V1 =
144R5; nbhym pravisya 129R2 = 133R1
= 147V1; mrdhn pravisati 147V1 =
129R3; = pravisya 135V1 = 135R4 =152V1
= 154R4; pravisati 122V3, 150V4, 15IV6;
pravisamti 135V3, 162V6, 165R1, 167R1,
170V3; pravisatah 118V2, 151R3; pravisat
118V3, 161R5; praveksyasi 162R4; pravisya
162R2; pravesayati 128R4] pravista 131V1,
141R6, 156R5, 161R6, 162R3, 166V3.
pravrt sich entwickeln"
pravartate 146V4,169V 3; pravartante 124R1,
127R6; pravartamnam 118V4, 158R1,
160R6; pravrtta 140V3, 145V6, 145R2.
pravrtti Entwickeln"
133V 5, 160V 5.
*pravraj (caus.) [in den Orden] aufnehmen"
bhagavms caihibhiksukay pravrjayati te
pravrajit
vrkamlesu kutikm pith 159V 5.
*pravrajy Aufnahme [in den Orden]"
sarvasatv
bhaga(vato 'ntike)
pravrajym api ycante 159V5.
prasams rhmen"
brahman ca pra^amsitah 147V6.
*praskha [Embryonalzustand] Praskha6
mtuh kuksv arbu(dap)e(sighanapra)s-<
khnukramenal vardhamnam 129V6.

prasvas ausatmen"
prasvasatah 122V3, 125R1, 127V6, 127R2.
*prasvsa Ausatmen"
prasvsaparig(r)hitam (sc. cittam) 127R2\
prasvsaparigrhitas (sc. bladrakah) 127R3;
s. svsaprasvsa.
prasava Erzeugung"
punyaprasavp(ram)natay 146V 6 = 145R1,
prasda Vertrauen"
samjtaprasdasya 152V 4;
prasdajtah
152R2.
*prasrabdhakyasamskrat Gestilltsein
der Gestaltungskrfte des Krpers"
prasrabdhakysamskr (atym |)
118V 5,
123V2/3.
*prasrabdhacittasamskrat
, fiestilltsein
der Gestaltungskrfte des Geistes"
(p)r(asrabdhacittasamskratym |) 118R1,
125V 4.
prasrva Urin"
prasrvamrgt prasrvapravhti (sc. nirgacchamti) 135R1.
praharana Waffe"
sarvasatv(h sarvaprahara)nni ksipamti
144V 5; sarvasatvh sarvapraharangnivisdims cdya
tarn abhidravyamte
144R2; muktasamrambhapraharans tarn
eva pranamamtiti 144R3 =* 145V2
*prahna Anstrengung"
s. samyakprahna.
*prahnnudarsan Erschauen des Entsagens"
(prahnnudarsanyml) 118R6, 126V1.
*prahnnupasyan Erblicken des Entsagens"
prahnnupa^yanym | 128V1.
prkra Schutzwall"
prakravat(sic) sarvasatvn upaguhya 144R3.
*prtimoksa Ordenssatzung"
prtimoksasamvarvijnaptipunyasrotasah
adhipatirpam | sauvarnaratnacitarathdhir(dham brah)m()n(am) pasyati 169V3.
*prtihrya Wunder"
mahpratihryam 164R2.
prdur bh in Erscheinung treten"
prdur bhavati 152V2,153V5,154R5,155R2,
155R3, 161R5.

229

Wrterverzeichnis
prp erlangen"

prp(n)oty 147V 6\ (pr)pino 148R4.


*prmodya Freude"
pritiprmodyasamjtasya 150R2 ^ 151R2;
satvh pr(rnodyapr)pino 148R4; prmodyk(r)nuklamanasikaro 153V1.
prvrta bekleidet"

stri
avadtavastraprvrt
151R1
=
148V4 = 159V2 = 161V3; = nilavas(traprvrt) 162V3.
prsda Palast"

prsdam utpadyatel vaidryastambhadhritam| 126V2; vaidryastambh(a)m(a)h(p)r(sda) 158R3; ratnaprsdmtargatam (veda)yitam 158R4\ satvs ca ratnapr(sdmtargat)h 154R6; utthnakle muktcith
prsda utpa(dya) 128V 2 \ mahrhaprsdaviinndhirdh 154V5 (S. 22).
priya geliebt"
141V4; 141V 6.
priyaikaputraka geliebter einziger

Sohn"

satvh parigrhya priyaikaputrakava stanesu


slesayanti 145R4.
pri beglcken"

abhisekensrayam prmayan tatol bhrumadhye cittopanibandhaht asmt pravho nirgatah 129R1] tato 'bhisekah
^prinitsrayasya bhrumadhydhastt pravhah
nirgata 134R6; tato 'bhisekah ra(tnapravhahi)
(sra)yam prayati prinayati
ca 154R4; srayam prmayanti
sthitim
purayam(ti) 133R4.
prita beglckt"
153V4.
priti Beglckung"

bhagavm dharmam desayati| tac chrutv


vikasitebhyah padmebhyo tulym pritim
(anubhavamti sar)v(a)satvh 144V2 \ sarvasatvm
samudvaham parm pri(tim) samanubhavati 144V3/4 ^ 144V4 \ sukhena
sukhitm d(r)s(tv) p(r)itir utpadyate
153R4;
s(atvh)
srvakagunopetms ca drstv priti u(tpadyate) 154R3;
pritiprmodyasamjtasya 150R2 ^ 151R2;
paraduhkh(a)priti 153V1.
*pritisamvedan Empfinden von Beglckung"
pritisamvedanym 118V5, 123V3/4, 124R2.

preta Gespenst"
tiryakpretamanusy 145R5 ^ 149R3; pravho prthivimandalam bhitv narakm pret cvabhsya 129R2.
pr otsah

, ^anspornen''

stri
yoginam protsha(yati) 148V4 ^
151R1; hrdayasth karu(n) protsha(ty)
(sic) 148R2.
plu berschwemmen"

ksiradhrbhili
vyate 148V2.

sarvasatvsamudrah

pl-

phala Frucht"
(du)s(c)aritaphal(t) 159V2 \ s. angmiphala,
pramdaphala, ^rmanyaphala.
*phenapinda

Schaumballen"

ph(e)napindkulam svam srayam pasyatil


tadvad svsaprasvsm krtsnam ca lokam
virg(nudarsanym|) 118R6; prthivim pasyati pasyatas csya phe(na)p(i)ndam utpadyatel etad rupaskandhaparikarmal 132V 3;
(sva)m srayam phenapindamayam utpadyat(e)| ta(to bhrumadhyt phenapinda)pravho nirgacchati| 132R2.
*phenarsi

Schaummasse"

kvathamnam jagat krtsnam phenarsiva


d(a)vati(5ic) (vi)rgnupasyan(ym|) 128V2.
baka Reiher"
116R1.
bandh binden"

bhagavmi casya sirasi pattam badhnti


128V3 ^ 150R1 c* 127R4\ pattam sirasi
baddham 169V4; pattabaddham srayam
130V 4; sarvmgapratymgabaddham
tmnam 169R5; jvlair(sic) baddham tmnm pasyati 170V2.
bandhana Fessel"
bandhanabad(dh) 162R5; 150R4.
*bala Kraft"
balavaisradyvenikasmrtyupasthnamahkarundhi(patir)pni drsyamte t(at)r(a balnm raviman)dalacit dasa hastinah tadvarn tadadhirdh ravirnandalacit^ eva
da^a buddhapratimh yathsvabalagocaram
lokinvastabhya t(i)sth(am)ti
162V1-2;
pamca sveta gaj dityamandalacitasrayh
tadadhirudhlipamca(buddh). . . .(balnm

230

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

adhipatirpam) 165V4; (pamcnm balnm) pamca vajramay hastin (ah) 166V 5.


(S. 177, Anm. 9).
bahis auen"
127R1, 127R2, 127R3.
bahusas vielfach"
115V5.
*bla (1) Kindheit", (2) Tor"
(1): blakaumrayauva(madhyavrddh)
129V 6 \ (2): b(l)n avitargn 156B3.
*blacaritaratyupeks Oleichmut gegenber der Lust am kindischen Lebenswandel"
blaeariratyupeksa(sic) kata(r) 158R5; blacaritaratibhyas copeks samtisthatel tato
?
sya blacaritakrida . . . (satvasamudram abhimukhi bhavati) sa tesm blcaritarat)yupeksm upasamharati 159V3; blacaritaradhy(u)pek(s)(^c) 159V 6 \ 156V 4.
*bladraka junger Knabe"
vijiinadhtuli markatabladrakabinducitolkdim 128R6; bladrakamukham
vijnnadhtunimit(t)am 129V5; asvsaprasvsahiyam(sic) ctra bladrakam cit(tanimit)t(am) 118R3; ^ (blad)rakm svsaparigrhitam amtarnimajamnam 125R3; ^
svsaparigrhitam cittam bladrakarpi
amtahsamudre nimajjati ^vasatah prasvsaparig(r)hitam evam bahihsamudre pravasatah 127R2; t(am)nimagnam bladrakam
samdhisukhasaktam 118R3; =* am(tab.)samudre nimagnam samdhisukhasaktam
(sc. bladrakam) 127R2; o svasaparigrhitah sa bladraka(h amta)hsamudre nimajjati prasvsaparigrhitas ca bahih 127R3;
svasatab
bladrakas ca vaidryaml()dibhih kmcanacakram avatarati prasvasatah
bladrakas (c)a sarvaskhbhi nih sarvabuddhnm uparipattacchatram krtv tisthati 127V4-5 \ c* 125R1;
126R3; (dityamandal)ni tadamtargat() bladrakh 169R4; tadadhirdhh b(ladrakfc) 170V1/2 (S. 48, Anm. 5; S. 49).
bhu Arm"
(daksi)ne bhupradese pamca sveta gaj
(balnm adhipatirpam) 165V4; daksino
bhuli vyudhtuh sthirataratvt 160V3)
bhubhym 162R6.

bhya das uere [betreffend]"


(b)hyam parikarma dhytmikam tu parikarma 132V2; (a)dhy()tmabhyni satvsatvkhyni 132R1; bhyyatanni 135V3;
bhyah dhytmakas ca (sc. pratityasamutpdah) 136R3; bhye pratityasamutpde
krtakausal(a)h 137V 2; bhyasamu(d)r(e)
127R3.
bindu Tropfen"
bindubhyah saddhtumayam srayam nirvartate 160R4.
*binducita gesprenkelte Gazelle"
vijfinadhtuti markatabladrakabinducitolkdim 128R6; buddh
parisuddhabinducita(g)trh 131R2 (S. 48, Anm. 7).
*bimbasra Bimbasra"
bibasravinayanam(sic) 164R2,
*bila Stck"
goghtakah
(gam vadhayi)tv taccarmani sad bilm bhgasatL pratyaveksatel tato
yogino nbhym sastra nirgacchatil yogina^
c^rayam sad bilm bhgasah taccarmany
avasth(payati) 160V2 \ saddhtu dbilni(sic)
nirvidgnin jvalamti 160R1.
bija Same"
arhatvavisesabijam 169V 4.
buddha Buddha"
pratilomam ksyapdivipasyiparyamt b(uddhm) sapa(riv)rm pasyati 128R1; (va)j (r)(sann)i (c)odgacchamtil tesu nisann buddhh ra(t)nam(ay) 121R3; vajrasanesu
buddh usnlsaprvadarsant kramenodgacchamto drsyamte)| tesm usnisapra)bhy
krtsnam jagad indranilbham drsyate] rnprabhy candrvadatam gtraprabhy()|
kanakaprabham | 'tanakhaprabhbhib(sic)
padmargbham 144R1; caturvarnapadmo
ta(dadhir)dhs caturvarn buddh bhagavantah prabhbhir lokam avabhsya ti^thamtiti 146R4; buddhagunaprabhbhis cvabhsito loko 155V1; laksannuvyamjanavir()jit buddh() 140V6\ yathoktalaksan
buddha 133R2; (simhsan)dhirudhh
bhagavamto
buddhh
srvakaganaparivrt(h tamnih)srtai& ca ratnapus(p)a(va)r(s)ai(h)
154R5; vrk(s)e
buddh
drsyamte dharmam desayamtah tammukhaniljsrtai
ratnapuspapadmavarsair
loko

Wrterverzeichnis
(vyava)k(i)ry(a)te 127V2; grhltapadm buddhh yogcrsrayam padmair vyavakiramti
aghanisthapa(ryamtam lokam) padmacitam
ta(dadhir)dh(m)s ca buddhn pasyati
tannihsrtaih pravhaih padmapravhais
cnekavarsadhrbhi(r) i(va) svam srayam
prya(te) 131B4; 131B3\ sthityupari (ni)sannnm ca buddhnm sarvasroto(bhyo
ratnavrk)s()h nirgacchamtil tada(dhir)dhh samyaksamb(uddh)s candramandacit
(sie) yvad aghanisth dev iti tamn(bhinih)srtbhis candramandalasamksbhir nadibhir yogcrs(r)ayam pryate 152B2;
tatah sarvasrotobhyah buddhapratyekabuddhasrvakli padmdhirudh yathoktalaksanyatanacith sarvadigvidisah urdhvam
adhas ca spharitv tisthamti| amte ca tadsraye anitya(m a)nityam iti abdam udiray(am)tah pravisamti 136B1; b(u)ddhs ca
sabdam udirayan(t)i santam sntam i(t)i
121R5; buddhs ca padmdhirdhh kye
'ntargat drsyamte 152R3; (kt)grmtargata buddh drsyamte 154R6; lokadhtavah
ktgraih pariprn drsyamte | tadantargats ca buddh bhagavamtak anekasatapariv(r)h 127R5 ^ 165R4; sarvaparisandni (sauva)rnaktgraparivritni tadamtargatms ca buddhm bhagavamtah
tejodhtusampannm pasyati 146V1; buddh(a)t(e)jo 154V3; buddhn anekasahasraparivran nirupadhisese nirvnadhtau pravissbtx(sic) pa()y(a)ti 151R3; (simhsandhi)rudh astau buddhapratimh rystmgasya (mrgasydhipati)rpam 159R1 ^
166R1] (balnm raviman)dalacita dasa hastinali tadvarn tadadhirdh ravimandalacith eva dasa buddhapratimh yathsvabalagocaram lokinavastabhya
t(i)sth(am)ti
162V1; pamca sveta gaj
tadadhirudhh
pamca (buddh). . , .(balnm adhipatirpam) 165V4; catvriratnamandalnil tadamtargath simhsandhirudh buddhli satvebhyo dharmam de^ayanti (vais)radynm
adhi(patirpam) 165V5 \ caturnm smrtyu(pasthnnm catvrah simhh)
pit(a)v(a)rns tatsadr^(^ catvro buddhh)
simhandena krtsnam lokam pr(ayamt)i
166V4] (saptnm bodhyamgnm sapta). . .

231

.buddhh tammrdhasu sapt()d(it)y(a)mandalni 166V6 \ (st)r(i)


(bh)jana
tesu vajrsanni teu dityamandalni tes(u)
b(u)d(dh)s(rayh) 166R3 =* 165V3 ^
165R1; (b)u(d)dh()^rayesu dharma^arlram
drsyate | taj janmadharmasariranihsrtbhiti
prabhbhir lokam spharitv 165R1; buddhsrayaih sthiti(h prn dr)syate| 152V2;
tadvarn buddhsr(a)y 122V4 c* 164V4;
buddhsraye brahmsrayo drsyate 144R6;
nn(ratna)mayah buddhapravho nirgatah
padmesu nisanno drsyate 131V3\ 131V4\
buddh drsyamte | parisuddhabinducita(g)trh tatadrss ca pravh
(tatab)
(buddhray)(m)& ca sksmn avsyyabindn iva spandamnam pasyati 131R2
-3; . . .khanibhnm bud(dh)nm pravha
132R3; (ni)lbhnm budbudacittnm(5ic)
buddhnm pravho 132R6; (s)uvarnbhnm buddhnm pravho 133V2; ksanibhnm bu(ddhnm) pravho 133V4; ^
133V 6; (b)uddhadharmasamghesu 153R3;
127V 5 \ 127V6; 134V 5 \ 145V 3 \ 164V1; 170V 2
(S. 33, Anm. 6).
*buddhavapurdhrin das Aussehen von
Buddhas habend"
satv
tej (o)dhtusampann buddhavapurdhrino 146R2; buddhvapurdhribhih
146V3; . . . .[mj.ktaprakhy buddhvapurdhrina 155R3.
*buddhnusmrti Meditation ber den Buddha66
(buddhnusmrtih katar|) 163R6; buddhnusmrtiprvam
mrdhn(opanibaddha)cit(t)as(y)a 165V2; bh(agava)tas cadharmasarlram tasya vistarena buddhnusmrtau viv.
154V 4; buddhadharmasamgh(nusmr)ti
170V (S. 174fF.).
budbuda Blase"
ksudrair asucidra(vyaili prthivim citm pasyati | tato budbu)d utpadya(m)te| vedanaskandhaparikarma 132V 4; vedanskandhapariksdhi(muktih svam srayam udakabudbu)d(a)c(i)t(m) pasyati
tato vmd ams budbudapravho nih(srtah)
(bu)dbudesu strimukhni drsyamte | rgasydhipatirupam |
(tatah)
(nl)lbhnm budbudacittnm(sic) buddh-

232

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

nm pravho nirgacchati 132R46; vedanyh adhipatirpam utpa(dya)te| yathoktam vedanskandhapariksym tatra duhkhsukhym vedany udakavarnam budbudam
(utpad)y(a)t(e) 158V3 (S. 46).
*bodha Erleuchtung"
bodhya drdham adhysaya(m) 150R3;
bodhya pranidhnam karoti 151R1.
*bodhi Erleuchtung"
bodhau ca pranidhnam karoti 150V6; bodhipranidhnam 161V 6 \ abhisambuddha bodhe
(sie) 139V 4\ abhisam(bu)ddh(o) bodhim
151V6.
*bodhipaksya zur Erleuchtung fhrend"
(asu)bhdiprayogena pravistasya sm(rtyupasthn)dinm bodhipaksynm darsanam
utpadyate 166V3 (S. 51, Anm. 2; S. 180,
Anm. 5).
*bodhisatva Bodhisatva"
vrksdhas(tt). . . .yajnavt yatra bodhisatvah sarvam sarvatra sarvad prayacchan
asmim sthne bodhisatva sarvasatvnm sarvamanora(tha). . .k(r)tvbhisam(bu)ddho bodhim asamkhyasatvaparivrah nirupadhisese
nirvnadhtau
pravis'amtiti
151V 56) bodhisatvm(sic) dau bodhinidhnam. . . 164V6 \ bodhisatvamrdh(a)ni
parisantam pasyaty abhisambuddha bodhe
. . . 139V4; ryamaitreyah bodhisatvaganaparivrtah 152V3 = 152R2 ^ 151V1; brahm
ca bhrmgram dygratah sthito bodhisatvam kathayati
| bodhau ca pranidhnam karotil 150V6 (S. 14, Anm. 3; S. 55f.).
*bodhyanga Erleuchtungsglied"
(saptnm bodhyamgnm sapta). . . .buddhh tammrdhasu sapt()d(it)y(a)mandalni| 166V'6.
brahman (sg.) [Gott] Brahma",
(pl.)
, ,Brahma[-Gtter]''
brahm grhitsuvarnabhja(na)
151R6;
brahm ca bhrmgram dygratah sthito
bodhisatvam kathayati 150V5 \ brahm kathayaty 151V2 \ hamsarathdhirudhah brahm 150E6; hamsarathdhirudhah brahm
daksine cs(ya) prsve sauvamena padmam vme nil(bham) tato bhagavm
(daksine)
nisidati
ryamaitreyah
tme(sic) prsve
(nisidati) 152V2;

sauvarnaratnacitarathdhir(dham
brah)m()n(am) 169V3; brahman ca prasamsitah
147V6; brahmsrayo 144E6; tato ?sya brahmasadrsam srayam utpadyate 153R5; padmapamktayo
tadadhirudh brahmarupinah satv 144V3; brahmabhi 141R6;
brahmabhih
ra(tna)puspamuktanaksatryatanacitaih krtsnam gaganam prnam pasya(t)i| tebhyas cyatanebhyah rasadhr patit 136V5; brahmais ca gaganam prnam
karakahahastaih
brahmahastmgulibhyas ca varsam patati| 148R23] srayc
casya brahmno nirgatya 144R4; 143V3;
163R2 (S. 21; 33).
*brhmanaka brahmanisch"
brhmanak mamtrh pudgalam nihsrth
136R4 (S. 112, Anm. 2.)
*bhagavant der Erhabene"
karunnamtara mudit( n)irdistbhagavat|
152R5 ^ 155 V2; sa bha)gavms tathgato
'rh(am) sa(myaksambuddho vidycaranasampannah sugato lokavid anu)tt(a)rah purusa(damyasrathib sst devamanusynm
b)uddho bhagavn| 164V1; (svkhyto bhagavato dharmah) 165R6; bh(agava)tas ca
dharmasariram 154V4; tato bhagavm g(thm bhsate) 162Rl; (bhagavm)s tasym
vely(m) g(thm bhsate) 167R5; sarvasatv samvigns ca bhaga(vato 'ntike) gacchnti pravrajym api ycante| bhagavms
caihibhiksukay pravrjayati 159V5; te (ca)
satv bhaga van tarn drstv samamtatah pradhv(amti bhaga)v(a)tah pdayo pranamya. .
. .bhagavm dharmam des(a)y(a)t(i) 154R2;
bhagavm
simhsa (ndhirdha)
dharmam ca desayati te ca samvignb
bha;
ga(vata)h pdayo patamti 149R6-150V1bhagavmvajrsandhi(rdhah)
dhiragambhirodrena ca svarena dharmam desayati 149V4\ padmam
tannisanno bhagavm dharmam desayati 144V2 \ bhagavm
(padmaka)rnikym nisidati

(tatah karunvi)hrinahpdamle pa
dmam (utpa)dyate| sa bhagavatpdayo pranamya kathayati | bhagav(am) sym aham
anga(te 'dhvani sarvasatva)parinyake|
tato 'sya bhag(avm pni)n() mr-

Wrterverzeichnis
dhnam parmrsati | kathayati ca putraka
(bhavi)syasi tvam
samyaksambuddha iti 152V 3-6;
151V 1\ bhagavms
casya sirasi pattam badhnti 128V3 ^
150E1 ^ 127R4; bhagavatparinirvnam
abhimukhi bhavati
(nirvnapu)rastham ca bha(gavantam dhrm)y(m) gandikm kotayamtam pasyati 161R23; tadape(ksa)dosansya| tato bhagavmn utpadyate 159R5 = 159V4 ^ 161V6; stri
bhagavadsraye 162R1; gun
bh(a)g(avads)r(aye) 162V4; bhagavatah hrdaye ratnamayah sim(ha) J62F5; bhagavatah ^arirt
pra(vho nirgatah) 154R1; bhagavmmukhnihsrtair indryudhairi50.5; bhagavatah
parivrah 161R4; (bhaga)vatah s(r)vakapa(r)i(yra) 139R2/3; bhagavatah srvakasamgha 166R6; 121R5; 126R2; 144R6; 145V 3;
152R2; 164V5 \ buddh bhagavamtah 127R5,
128R1, 144R1, 146V1, 146R4, 150V 5, 154R5,
165V3 (S. 33, Anm. 6).
bhaya Furcht"
147R5.
bhava Werden"
bhavabhogatrsnprati(paks)nmtaram
136R2.
bhavana (1) Haus", {2) Behausung"
(1): nagarabhavanodynni 151R5; (2): tusitabhavan 164R1.
*bhavngopeks Gleichmut gegenber den
Gliedern des Werdens"
bhavmgopeksa katar 159V6; tato ('sya)
(satvasamudram abhimukhi bhavati | sa
tesm) bh(a)vmgopekam upasamharati
159R4; iti bhagavmgopeks (sic) 160V1;
156V4.
bhasman Asche"
116R4.
bhga Seite"
ekasmim bhge
dvitiye bh(ge) 154V2;
adharimo bhgah 170R4.
bhgasas gesondert"
160V 2; 160R2.
bhjana Schale"
brahm
grhitsuvarnabhja(na)
151R6;
(a)v(e)n(i)kn()m s(m)rtyupasth()nn(m)
(sc. adhipatirpam) tr(a)yahpurus grhityudhs tailabhjanahasta drsya(nt)e 165V6;

233

ratnbhjanam iva nirmalar(asa)pariprnam


srayam pasyati 130R2; amrtarasam ivendryudhavarn stri nirmalena bhjanena
grhitv 147V3; stri snehapariprnavaidr(yabhjanacitotpadyatel) bh()j(a)n(e)su vajrsana vajrsanesv dityamandalnil tesu
buddh bhagavamtat 165V2-3 ^ 166R3 ^
167V4 ^ 169R3 ^ 170R3-, (tato buddh bhagavamta dityama)nd(a)lesu pravisamti(| tni va)jrsanesu tni bhjanesu tni smrtinimittesu smrtinimittam yogeramrdhanil
165R2 ^ 166R4 ^ 167RI ~ 170V3;
124V 3; 124V 5.
bhra Brde"
143R5.
bhva Verfassung"
149R6.
*bhvan Entfaltung"
pratyutpamnpnasmrtibhvan(5ic) 128V 4;
angatabhvanym 128V4; atitabhvany
128V6; npnasmrti
upadese bhvanym ca 128R2.
bhs sprechen"
bhagavm g(thm bhsate) 162R1 ^
167R5.
bhsura leuchtend"
anamtabhsuram
sahasrraeakram
146R2.
bhiksu Mnch"
te ca bhiksavah keeid dirghatsampann
drsyamte keeid yvan n(irodhnupasya)nm
(sie) sampann drsyamte 128V5; tam(sc.
vrksa)mlanisann bhiksavo dhtuprayogam
bhvayamti 129R4.
bhid durchbrechen"
pravho
^prthivimandalam bhitv
129R2 = 146R6 ^ 117V3; = (yava)d vyumandalam bhitv 135R3 = 135V1 = 146R6
= 163R1 = 170V5 \ 167R5] bhinna 129V3,
134R5.
bh sein"
bhavati
124R2,124R6,125V4,126R1,126R6,
128V3, 130R6, 141V6, 141R6, 148R4, 149R4,
151V4, 152V 5, 153V% 153V5, 155V6, 157R5,
159R3, 170R6; bhavisyati 128V6, 139V5,
164R4; bhavisyat 150R1/2; abht 140R5;
bhtv 150R2.

234

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

bh (caus.) entfalten"
bhiksavo dhtuprayogam bhvayamti 129B4;
npnasmrtir bhvayitavy 128V3; 128V6;
bhvit (sc. npnasmrtili) 128V3; ku(sa)lamlaml bhvayamtam 128 Bl.
*bhmi Sttte"
bhmibhedena saptabhaum (sc. maitri, karun, upeks) kmadhtur angamyas catvri dhynni dhynmtaram ca 140V1 ^
147R4 ^ 155B1; bhmi(tali kmadhtau
dh)y()nadvaye ca (sc. mudit) 153V3/4
(S. 32; S. 117, Anm. 4).
bhya mehr"
149B5; 161R6.
bhrngra Krug"
brahm ca bhrmgram dya 150V5/6
(S. 142, Anm. 4).
bhrsta Braten"
(pratpa)ne narakel bhrt>odbharjanapitarapravesam 149V7.
bheda Einteilung"
kramabhedt 136B3) bhmibhedena 140V1;
samu(c)c()labhedms 131B6.
bhoga Genu"
bhavabhogatrsnprati(pak)nmtaram
136B2.
bhram sich drehen"
pratityasamutpdacakram
bhramamtam
159B1 ** 150V2\ 161V1; 126V 6.
bhr Braue"
bhrvivara upanibaddhacetasa cchidram utpadyate 151B4; bhrumadhye cittopanibandhaU 129B1; bhruvor madhye krnataptam
pitaka(m) 148V1; pravhah
bhruvivarm nirgato 152V1] = bhrumadhyd 129R3,
131V 3 \ = bhrumadhydhastt
134B6,
135V1;= (bhrumadhy)dhar nimnaprade^t
146B6 (S. 35).
makara Seeungeheuer"
(p)dn(gu)tha(na)khavivare cittopanibaddhah kryah tato nakhavivaram makaramukham iva laksyate tena cittam pravesayati 128B4; 129V1; 129V2; 129B5 (S. 36,
Anm. 4).
manca Lagerstatt"
164B3/4.

mani Juwel"
nimnam pradesam pasyati muktcitam tadupari urupramn bhsur manayah 128V5;
cchatraprade^e nilavarno nilmkuraparivro
manih utpadyat(e) tadvat sar(vasr)otobhyah
nilavar(n) (n)il(mkuraparivr mana)y(a)
utpadyamte 145B23; (m)(rdha)ni cas(ya
mani)r utpadyate
maninihsrtais ca
rasmibhir
jiieyam krst(am) svsray(m)targatam pasyati maniratnc ca ratnavarsah
amta patit(a) 169B1-2.
mandala (2) Scheibe", (2) Kreis"
(2): darsamandala 170B4; s. dityamandala, ravimandala, sryamandala, candramandala; (2): ratnamandalni 165V5; saddhtumandalni 130V1, 160B2-3; s. abmandala, prthivimandala,
vyumandala
(S. 21, Anm. 9; S. 32, Anm. 1).
*madhya (1) Mannesalter", (2) mittelmig", (3) Mittelpunkt", (4) Mitte"
(1): blakaumrayauva(madhyavrddh)
129V6 \ (2): ma(dhyam mrdum)
udsinam (sc. mitram) mrdumadhydhimtram
cmitram 147B6 ^ 140V2 ^ 153V4 ^
155V5; (3): bhrumadhye 129B1 ^ 148V1 ^
129B3 ** 131V3 zx 134B6 ~ 135V1 **
146B6; (4): 129V5; 133B5; 144V5; 146B2.
madhyama mittlere"
160V4; 164B4.
madhyastha neutral"
madhysthm viaym 157V1.
manas Verstand"
chrotraghrnajihvk()yamanah 134B4 ^
135V5 \ manodvraih 157V5.
*manasikra Beherzigen"
-manasikrnamtaram 153V1,153V 2,155V3;
-manasikrodyotanrtham 153V1, 153V 2;
manasikrasya 129V4; (mana)sikraprayuktasya 154V2 \ prvapratilab(dh)amanasikrnm 169V 5; 129B6; 154V 2; 163B6 (S. 116f.).
manusya Mensch"
tlryakpretamanusys 145B5 ^ 149B3; manusya(lokam de)v(m)s ca 154V2; priyo devamanusyanm 147V 6; 165V1; 170B2.
manoratha Wunsch"
151V6.

Wrterverzeichnis

235

mantra Rezitation"
mahprsda groer Palast"
brhmanak mamtrh pudgalam nibsrtb s. prsda.
J36E4 (S. 112, Anm. 2).
*mahbhta die [vier] groen Substanzen"
mar arm Tod"
mahbhtsivisa 160R5,117R2 (S. 48, Anm. 2;
jarmarana 137V 4\ maranapratyaya 144R4, S. 85, Anm. 2).
144R5.
*mahbhtasamat gleiche Ebene mit den
marici Luftspiegelung"
[vier] groen Substanzen"
karanthaih prthivim citm pasyatil pa^yats (i)me mahbht(a)samatayopeth ami cittacsya maricikalp (utpadyamtel samjn- samat(a)y(ope)t 154R1.
skandhaparikarma|) 132V4; (samj )fi()ska*mahrja Groknig"
ndhapanks (dhimuktiti |)
tatod aksi- raksadhipatya(sa)m(pad ya)th caturnm
nmd amsd asya maricipravho nirga- mahrj ()nm | 143V 2; caturmahrjike
136R6.
(cchati) 133V1.
marman Weichteil"
mahrha groartig"
(u)ddhatni ca marmny 115B4.
mahrhaprsdavimndhirdh 154V5; mamarkata Affe"
hrhlamk()rlamkrt 154V6.
vijnnadhtuh markatabladrakabinducimtr Mutter"
tolkdim 128R6 (S. 48, Anm. 6).
mtuh kuksi 129V6, 164R1.
malina befleckt"
mtrbhta zur Mutter geworden"
147R5.
sa(r)vasatvh
mtrbhts cmtabkuksimalla Malla"
gat() 143R5.
164R5.
mtsarya Migunst"
mahant gro"
147R5.
mahm c^rayo 149V6 ^ 149V3.
mna Hochmut"
^mahallaka gebrechlich"
150V3.
vydhitam ma(hallakam) 129V6.
mnasa geistig"
*mahkarun das Groe Mitleid"
sariramnasaih duhkhair 147R6 ^ 148V2 ^
balavaisradyvenikasmrtyupasthnamah148R1; sarlramnasai rogair 148V 2 ^
karundhi(patir)pni
drsyamte
148V3 ^ 148V6.
(mahkar)u(ny)h (ksava)r(n) h(r)daye
mrisa Geselle"
stri s(u)varnbh nilavas(traprvrt) 162V1 (a)pasarpa mrispasarpa parvatam pta-3 ^ 165V6) 162V4; 162V6/R1; 139V5; ymiti 149V 5.
139V6 \ (gr)hita karunh punahpu(nar )ra*mrga Weg"
bhyasyamn(sic) mahkarunvhika bhava- (simhsandhi)rudh astau buddhapratimb
titi 152R5.
ry^tmgasya (mrgsyadhipati)rpam
*mahcakravda der Groe Ringwall [um 159R1/2 ^ 166R1; prasrvamrgt prasrdie Erde]"
vapravhh 135R1.
parivrttam amtargatam ca kye| hrasvat*mrdava Sanftmut"
ym tiryan mahcakrav(da). . . dirghat- kmtisauratyamrjavamrdutve(^c)
paraym 118V1 (S. 32. Anm. 2).
kryavyasanitvm 152R4.
mahnaraka groe Hlle"
ml Kranz"
s. naraka.
stri
sapattasuvarnamlvabaddh
mahprthivi groe Erde"
151R1.
s. prthivi.
mitra Freund"
mahpramna groe Ausdehnung"
(tat(sc. maitri-)prayogah)
(a)dhimtr135V3.
dhimtre mitre mrduni evam udsine] tath
*mahprtihrya das Groe Wunder"
amitre m(rduni madhya) adhimtre 140V2 \
164R2.
tat(sc. karun-)prayogab adhim(trdhim-

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

236

t)r(am m)it(r)am
krpanam
drstv param krunyam utpadyate evam ma(dhyam
mrdum) tadvad udsinam mrdumadhydhimtram cmitram kramasah
dulikhair
pahatam drstv k(runyam utpa)dyate
147R56) tat(sc. mudit-)prayogah adhimtrdhimtrasya mitrasya sukhena prito bhavati evam madhyasya mrdunah udsmasya
e(vam adhi)mtrasymitrasya sukhena prito
bhavati 153V 4-5 \ =* 155V5.
misra vermischt"
157V4.
misribhta (1) vermischt", (2) Gemisch"
(1): murdhna
ratnapravhali
sahanbhini(h)s(rt)e(na prav)hena mi&ibhtah s(th)itim prayati 165R4; =* 163V6/R1;
(2): bhrumadhyd ekah pravho nirgacchati
dvitiyo nbhy misribhtam prathivi(sic)
spharitv tisthati 129R3.
mukt Perle"

muktmayi stri 168V2 \ pradesam


muktcitam 128V4 \ muktcith prsda 128V2 \
mu(k)t(cita)ktgre 134V 4; muktcitair
jvlair(<sic) 170V2; brahmabhih ra(tna)puspamuktanaksatryatanacitaih 136V5 \ (m)uktpuspa. . J23R2; 127R4; 167V6 \ 170V1
(S. 109, Anm. 12).
mukthra

Perlenschnur"

siraso mukth()r() n(i)rgacchamti 127R4/5;


mlbhmukthrdhirdhh
avadtamukt()hrdhirdhh 127V 6; mukthram cchatram 127V6.
mukha (1) Mund", {2) Antlitz",
(3) Maul", (4) Schnabel"
(1): buddh drsyamte dharmam desayamtah
tammukhanihsrtai ratnapuspapadmavarsair
loko (vyava)k(I)ry(a)te 127V2; astau buddhapratimh
tammukh(a)n(i)hsrt(ai)r (i)ndryudh(ai)r avidydhipatirpam abhyha(tam) nirudhyate 159R2 =* 159R5; sakalam
mukham vijnn(a)dh()t(o)h. . . 160V4;m(u)khad(v)re
daksinam(sic)
damstrym
142R4; (2): strimukhni 132R5; bladrakamukham 129V5; simhamukham 130V2;
(3): makaramukham 128R4, 129R5; (4): garudamukham 130V2.

muc entlassen"
varsam muncati 143V1 ^ 148V6 ^ 153R2;
mukta 130R4, 144R3, 145V2, 160R4.
mud sich freuen((
anumodankras ca modamtu bata satv
iti 153R4 - 153V6 = 154R3.
*mudit Freudigkeit"
karunnamtara mudit( n)irdist bhagava.
t|
kirn artham punah ka(runnam.
taram) muditnirdes*as tad ucyate
atha kimsvabhv mudit tad ucyate'
152R5153V2; muditsamanamtaram upeks nirdis(t) (bhagavat|) 155V2; s(uva)rnbh stripramuditotpadyatel muditdhipatirpam 153R3; 153R1; 156V2 (S. 149ff.),
muhrtt alsbald"
161V2.
*mtodi Stuch"
mtodivat pariprnam nnprakrair asucibhiji svam srayam pasyati 128R5 (S. 33,
Anm. 10).
mrdhan Haupt"
pravho
mrdhn nirgatya
mrdhn
punah pravisati 129R2-3 ^ 133R1-2 ^
135V1 c* 135R3-4 ^ 147V1 ^ 152V1 =*
154R4 z* 117V4; sr(ayam) murdhna
cchidrena prayati 165R3; mrdhnah ratn(amayo vrksa)h 127V2 \ ksiravrkso mrdhanirgato 145V1; m()rdhatah ksirastambhah iva
nirgataii 143V1; mrdhata c(a ni)hsrtam
ratnamayam cchatram 130V4; mrdhatah
vajram nirgacchati 121R4; mrdhno nihsrt
stri 148V1; m(rdh)n(as csya) padmam
sambhavati 144V2 \ puskirmi m(r)dhn(ah.)
sambhavati 136V2', (m)(rdha)ni cs(ya mani)r utpadyate 169R1; smrtinimittam yogcramrdhani (sc. pravisati) 165R2; bhag(avm pni)n() mrdhnam
parmrsati
152V 5; 128R5; 129R6; 132V 6; 135R5;
139V 4; 144R1] 149R2; 150R1; 153R2;
165V2 (S. 35).

mla Wurzel"
vrksamla 127V3, 129R4, 159V 5 \ vaidryamla 127V4; s. pdamla.
*mlasthnmtara ,, Ursprungsinhalt"
rpaskandhasya mlasthnmtarni| 132V6.
mrdu mig"

ma(dhyam mrdum)

udsinam (sc. mit-

Wrterverzeichnis

ram) mrdumadhydhimtram cmitram


147B6 cJ 140V'2 ~ 153V4 ^ 155V5.
mrdutva Zartheit"
ksmtisauratyamr j avamrdutve 152R4.
medini Erdboden"
134V5.
*maitr Gte"
m(ai)trnusrena| upeks samtisthate 161V5.
*maitrbhiseka Gtebespr engung"
146R4; 146B5.
*maitrvihrin in der Gte wandelnd"
(sat)v()
maitrvihrinam pranamanti
145V2.
*maitrsaya
Zuwendung zur Gte"
maitrsayaparigrhitasya 147V2; maitr^ayasya 142R5, 143R4, 143R6, 144R2, 144R3,
145V 29 145V3; abhivrddhamaitraya(sya)
145R4; 132V1; 142R2.
inaitrl Gte"
maitri sthiti(m prayati) 147V4; maitriprayuk(ta) 144V4 (S. 118 ff.)
*maitrlvihra Wandel in der Gte"
es apramno maitrivihrah 145V6; eso
'parh apramno maitrivihrah 146V5.
*maitreya Maitreya"
angatabhvanym
abhisambuddhm cryamaitreyam anekasrvakasahasraparivram (C. pasyati) 128V5 \ ryamaitreyas
ca tatparivrs ca 151V1; ryamaitreyah
bodhisatvaganaparivrtah tme(^ic) prsve
padma(kar)n(i)ky(m nisidati bo)dhisatv
pa(t)r(eu) 152V3; 152R2.
maithuna Geschlechtsgenu"
maithunayuddhakarananiriksanbhiratah
158R6.
moha Verblendung"
mohapratipaksrtham pratityasamutpdapariksrabhyate 136R2;
rgadvesamoha
150V3, 159V1.
yajiiavta Opfersttte"
yajfiavt yatra bodhisatvah sarvam sarvatra sarvad prayacchan 151V5.
yathgata so wie gekommen" 152R2.
*yathpaurna wie frher"
yathpaurno 'vatisthate 146V5.
yathbhilasita wie beabsichtigt"
141R1.

237

*yathsambhava der Entstehung gem"


129R1; 138V 6.
*yathsvabalagocara der jeweilige Wirkungsbereich der eigenen Kraft"
(balnm) (sc. adhipatirpam)
dasa buddhapratimh yathsvabalagocaram lokinvastabhya t(i)sth(am)ti 162VI.
yathsvavisaya das jeweils eigene Objekt"
(caksuh srotram ghr)nam jihv kynm
yathsvavi^ayam nipatamti 135V5.
yathokta oben erwhnt"
129R1; 133R2) 136V6; 136R1; 155R2;
156V 5; 162R6.
*yadbhyas zumeist"
(ya)dbhyaspyespapady(am)t(e) 166V1;
166R2.
yantra Zange"
148R6.
*yamakaslau iSlabaumpaare"
(p)r(aj )n(pa)ynamda
ya(ma)kaslayo(r
amtarenottarsirsam mamcam) 164R3 (S. 176,
Anm. 8).
yc bitten"
sarvasatv
pravrajym
api
ycante
159V5.
yma Wache"
(adya tathgatasya r)try()h m(a)dhy(a)m(e
yme)
(niru)padhise(sic) ni(r)v()na(dhtau pari)nirvnam 164R4.
yugapat gleichzeitig"
131R4; 135R6; 146R3.
yuddhakarana Kampfhandlung"
maithunayuddhakarananirikanbhiratah
158R6.
*yoga Yoga"
rsiyogen^iti krimikulasahasrni drsyamte
160R5; utkarsanayogena 124R5; (kada)Hpatravat putputayogenvatisthamti
132V5; ^ kadalipatraputputnirbhj anayogena 133V3; krtmtapratyaveksanyogenaitad darsanam utpadyate 169V5 \ yogavitysa(5ic) yoglamkrokta^(5ic) ca vi^ess
147V4 (S. 28f.; S. 29, Anm. 1, 2, 3; S. 30).
*yogasstra Yogalehrbuch"
ato 'nantaram dhtuprayogah yogasstropadisto 'nusartavyali iha tu prayogamtram
darsayi^ymah 128R3.

238

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

*yogcra Yogin"
yogcryaih yogcrais ca upadese bhvanym ca na visdah kartavya iti 128R2; yogcrah tmnam pa^yati 128V 5 \ yo(gc)r(a)sy(a) n()bhy(m) 139R3; yogcramrdhani 165R2; y(o)gcrapdatalaih 127V3;
165V1 (S. 28f.).
*yogcrsraya Gestalt des Yogin"
s. sraya.
*yogcrya Yogalehrer"
yogcryaih yogcrais ca 128R2.
*yogin Yogin"
yoginah sraye 144E6 ^ 160V2 ^ 144V5 \
yogino nbhym 160V2 \ ta(dda)rsanasamvignasya ca yoginah 130R5; stri
yoginam
protsha(yati) 148V4 (S. 28f.).
*yauva Jnglingsalter"
blkaumrayauva(madhyavrddh) 129V 6*
raks schtzen"
devat raksamti 147V5.
ranga Schaubhne"
pamcaramga 133R3,
racita versehen mit"
prthivim
vaiduryamayavajrsanaracitm
144V5.
rajas 8taub\teilchen\"
129V 3; 129V 4; 149R5.
ratna Edelstein"
maniratnc ca ratnavarsah 169R2; ratnavarsam 153R2 ^ 131R6; pusparatnavarsam
128V4 = 152V6 - 170R6 ^ 154R5 ^
170V6 ^ 126V3 ^ 162V3 \ ratnapuspapadmavarsair 127V2/3; gandharatnapu(pa). . .
169V2 \ ratnapuspa 168V3 \ pusparatnamayah 161R5; ratnni puspni ca 152R2; ratnapravhah 165R3 154R3/4; ratnaprabhbhir 154R4; ratnnm lokah 124R2; nnratnacitai padmair 146R1 ^ 153V6; (ra)tnamayaih k(u)m(bh)aih 164R6; ratnbhjanam 130R2; ratnamayam cchatram 130V4 ^
169V3; nnratnacitam
cakram 146R2;
sauvarnaratnacitarathdhir(dham) 169V3;
ratnamayo vrka 151V4 127V2; ratnavrksah 131R5 ^ 152R1; ratnamayam simhamukham 130V2 ^ 162V5 \ ratnaprsdmtargatarn 158R4 ^ 154R6; ratnaktgrair 153R6 ^ 165R4; sudvikasalkbhi

ratnaci(tbhih) 121V3; ratnasalk iva


ratnacitdity(a)m(a)nd(a)l(ni)
124V1 ^
124V3 \ ratnamandalni 165V5; nnvarnaratnanaksatracandramandalanadyab 130R3
c- 168R2; brahmabhih ra(tna)puspamuktanaksatryatanacitaih 136V5; grhitaratnopakaran purus 170R5; ratnajlvrtam
tmnam 169R5; (ratna)citam pattabaddham srayam 130V4; ratnacitam ratnavrksdhar nisanam ctmnam 131R5; buddhh
ra(t)nam(ay) 121R3; nn(ratna)mayah
buddhapravho 131V3; ratnamayi ca sthitir
165R4; 125R1; 126V1; 143R4; 167V5;
169R6.
ratha Wagen"
hamsarathdhirdhali brahm 152V2 =
150R6; sauvarnaratnacitarathdhir(dham
brah)m()n(am) 169V3,
rathnga Wagenrad"
rathngakilaSamkvacal 149V2.
rayimandala Sonnenscheibe"
(balnm (sc. adhipatirpam) raviman)dalacit da&a hastinah tadvarn tadadhirdh
ravimandalacith eva dasa buddhapratimh
162V1.
rasmi Strahl"
ra^mayo
satvm vicayam krtv 162V6;
(ra^)m(i)bhi visphulimgbhih istvisayn
upahamti 157V 6 \ dhvajm
dityamandalarasmibhi(r) bh(i)nn(m) 134R5; dityara&may(ah)&i ^127V6; candramandalarasmy. . . 144R5; 157R2.
rasmikalpa Strahlenbndel"
118R2; 157 R3.
rasa (2) Geschmack", (2) Essenz"
(1): chrotraghrnajihvk()yamanahrpasabdagandharasasprsta(vyadharm) 134R4;
(2):
nil(apitalohitvad)tarasapariprn()t
130R1; suvarnanilapitalohitvadtarasbhisekaih 145V4; nnvarnarasasekaih 148R3;
nildiras(a)n(i)magna(m) 170V1; tadvarnarasena 131V1; tadvarnanihsrtnekarasadhrsahasrni 145R3; snigdhasuvarnarasam
146V2; snigdharasa 155R6; ratnbhjanam
iva nirmalar(asa)pariprnam srayam
130R2; naksatram
tamnirjtam amrtarasam 147V 3 \ caturdhynarasam 129R3;
pusparasanadyah 130R3; pusparasadhr-

Wrterverzeichnis

239

bhih 149R2; yatanebhyali rasadhr patit sataili 148V3; mnasnm rog(nm)


136V 6; yatanarasapariprri
puskirini 148V6.
136 V2; yatanarasasamudram 136V4; yataromakpa Pore"
narasapurusa 136V1, 136V2; 130R3; 131V 2; romakpadarsanvidhik 170V4; 170V 2.
145V1; 146R5; 169R5 (S. 47).
*raurava Raurava[-Hlle]"
rga Leidenschaft"
[s.n].na sastrau grh(ita)
(raurava(sukhym vedanym sukhitasya rg ut)- yoh|) 149V1 (S. 139, Anm. 1).
padyate 158V6 \ rgadvesamoha 150V 3,
158R6; (bu)dbudesu stiimukhni dr&yamte|
*laksana \Buddhd\mal"
rgasydhipatirupaml 132R5; s. kmarga, yathoktalaksan buddha 133R2; buddhapadmarga, vitarga, avitarga.
pratyekabuddhasrvakh
yathoktalartri Nacht"
ksanytanacith 136R1; laksannuvyamja(r)try()h m(a)dhy(a)m(e yme) 164R4.
navir()jit buddh() 140V6 \ srayo laksarsi Masse"
nnuvyamjanavirjita 130R6 ^ 150R3 ^
rsiyogensiti krimikulasahasrni dr^yamte 163V2.
160R5; s(a)syariprnm 132V2; phenalaksay (pass.) aussehen wie"
rsiva 128V1 (S. 29, Anm. 6; S. 97, Anm. 6). laksyate 128R4, 131V5, 146R6.
ric entlassen"
layana Sttte"
recita 118V5.
130V3.
rudhira Blut"
lalta Stirn"
pyardhirakarnamalapravhh 135V 6.
laltt pravh(o nirgatya) 117V6; 132V6;
rpa Form"
165R3; 168R4.
117V 5; 134R4; 137V 3; 146V4; 154V1;
loka Welt"
157V4 (S. 16, Anin. 2).
118R5; 118R6; 124V2; 125R6; 127V2;
*rpaskandha Gruppe Form"
127V 3; 128V1; 129V1; 130V1; 130V2;
rupaskandhaparikarma 132V 3; rpaskan- 130V3; 130R6; 131V 2; 131V 5; 131R1;
dhasya mlasthnmtarni 132V6 \ rpa- 131R2; 131R4; 131R5; 134R3; 136V4;
skandham jardibhih salyair viddham 134V1; 146R4; 147V6; 151V4; 151R4; 153R2;
134V2.
153R4; 154V2; 154R4; 155V1; 160R3;
*rpvaeara der Formenwelt angehrend" 162V 6 \ 165R1; 166V1; 166V2 \ 166V 4;
rupvacara pamcaskandhasvabhv (sc. mu- 166R1; 167Rl.
dit, - karun) 153V3 = 147R3.
*lokadhtu Weltregion"
-pariprn 127R5;
*rpvacar devh [Wesen] der Gtter- anamta lokadhtavah
Massen der Formenwelt"
anamt lokadhtavab (sie) spharitv 127V2;
sat kmvacarm devn| rpvacarm^ ca anamta lokadhtm spharitv 130V4; 'namcaturdhynopapannm 145R6; (kmvaca- tam lokadhtm spharitv 145V1; anamta
rm devm) v(i)mnodynopabhogm rp(a- lokadhtun 161R3; anamtesu lokadhtusu
vaca)rm^ ca savimnm 135R4; ksiraprav- 150R1.
*lokavid ,, Weltenkenner''
ho
kmrprpyvacardevparivrto
164V1.
mrdhn pravisati 147V1 (S. 32).
rpya Silber"
lohita rot"
121V3; 121V4; 164V 4.
nitmtalohitavarnah 131V4; nilapitalohitroga Krankheit"
vadta 118R1, 130R1, 131V1, 133R4, 145V 4,
rogatah
(ga)ndatah
s(a)lyatah
169R6.
134V1; caturottaram rogasatam 160R5; sariramnasai rogair upahath sarvasatvh
vac (1) sprechen", (2) lehren", (3) besrirais caturuttarais catur(bh)i(h) rogasa- zeichnen"
taih mnasai^ cstottaraih (')te(bh)i(hr)oga- (1): uktv 162R2; (2): ueyate 143R3, 152R6,

240

Dieter Schlingioff, Ein buddhistisches Yogalehrbuch

153V2, 155V3; ukta 147V4; (3): vaktavya 162V6,163R2; navanitavarna 155R4,156V1;


128R2, 152E4.
ksavarna 150R5,165V 6; udakavarna2<5SF3;
vac (caus.) lesen"
nnvarna 127V3, 130R2, 130R3, 131V5,
vcayam 166V2.
131V6, 148R3, 150V2, tadvarna 123V4,
131V1, 145R3, 152V1, 158R4, 162V1, 164V4;
vacana Doktrin"
tatsadrsavarna 153R6; 129V 5; 131R1;
166V1.
143V4; 146R5(S. 41 ff.).
vajra Diamant"
samjtakarunyasya haste vajra utpadyate
varsa Regen"
150V 5; mrdhatah vajram nirgacchati dev hrsth
pusparatnavarsm ut121R4; svsaprasvsh vajracith pravar- srjamti 152V6 ** 128V4 ** 150R2 c* 170R6;
tantel lokam crnam visiryate 127R6\ indr- buddh
tammukhanihsrtai ratnapuspayudhair vajrkrai 159R6; pamca vajra- varsair nn()varnair loko (vyava)k(i)ry(a)te
may hastin(ah) 166V 6 \ vajrmayah srayo 127V3 ^ 154R5; = samgho vyavakiryate
yogina 144V5 (S. 22; S. 47, Anm. 1).
126V 3; stri
(ratna)puspavarsaih lovajrasaila Diamantfels"
kam prayati 162V4; (rat)n(a)pusp(a)161R2.
v(arsam k)sm patati 154R2; ratnapuspa* vajrcalakta , .diamantener Berggipfel" varsaih 170V6; maniratnc ca ratnavarsah
vajraclaktaprkhyo(sie) 'vatisthati
amta patit(a) 169R2; sarvo(pakara)nava144R1/2.
rsam amte ca ratnavarsam muncati 153R2;
vajrsana Diamantthron"
ksiravarsam muncati 143V1; brahmahastmbhagavm vajrsandhi(rdhah) 149V4; (va)- gulibhyas ca varsam patati 148R4; padmaj(r)(sann)i (e)odgacehamtil tesu nisann pravhai& cnekavarsadhrbhi(r) i(va) svam
buddhh 121R3; vajrasanesu buddh
kra- ^rayam prya(te) 131R4; tais ca c(ch)idrair
menodgacchamto drsyamte 144V6; stri sne- varsadhrbhir iva
^yogcrsrayam phapariprnavaidr (yabhjanacitotpadyate |)
ryate 136V3 (S. 22).
bh()j(a)n(e)su vajrsana vajrsanesv di-vast infolge von"
tyamandalnil tesu buddh bhagavamtah 158R1, 159V1.
165V3 ^ 166R3 =* 167V4 ** 169R3; (tato
vasana Gewand"
buddh bhagavamta
dityama)nd(a)lesu
147R5.
pravisamti (| tni va)jrsanesu tni bhjavastu Gegenstand"
nesu tni smrtinimittesu smrtinimittam yo169V2.
gcramrdhanil 165R2 ^ 166R4 ^ 167Rl
vastra Gewand"
c^ 170V3; prthivim vaidryamayavajrsanastri
avadtavastraprvrt 151R1 ^
racitm tanmadhye
srayo vajrsandhirdhah yogina utpadyate 144V5; 144V6; 148V4 c* 159V2 ~ 161V3 c* 162V6 ^
163R2; = nilavas(traprvrt) 162V3.
164V5.
vah leiten"
vadh schlachten"
goghtakh
(gm vadhayi)tv 160V1/2. vhayatah 127V1.
vma linke"
vanakampana Erbeben des Waldes"
tme(sic)
pr^ve 152V23; vmd ams
vajrasailam iva vanakampane 161R2.
132R4; 160V3; vmaprsvasyinm 160V4.
vapus Aussehen"
s. buddhvapurdhrin.
vyu Wind"
prthivy psu pratisthit| pah v,yo(sie)
varna Farbe"
nilavarna 121V3, 145R2, 153R6; indranila- vyur kse 136R5; evam udakasamksobhah
varna 150R6; indranilapadmargasphadi- agnisamksobhah vyusamksobhah yathkavarna 146R3; nitmtalohitavarna 131V4 \ samvartanisu 161V4; ^dakam vyun ksipita varna 166V4; indryudhavarna 147V 3 \ ptam 150R1; prnam svam srayam vyusuvarnavarna 151V6 \ avadtavarna 161V2, bhih pasyatil sarvasrotobhir vyun pravisato

Wrterverzeichnis

118V 2; adhytmavyupathapariodhant
126R5; (v)yukalp 131V6.
*vyudhtu Element Wind"
daksino bhuh vyudhtub sthirataratvt
160V 3 \ 131V 6.
*vyumandala Windkreis"
pravho
prthivimandalam bhitv
kmcanacakram bhitv pmandalam vyumandalam ka&adhtum avabhsya 129R2;
= (yva)d vyumandalam bhitv 135R3 ^
135V1 ^ 146R6 ^ 163R1 ^ 170V5; = adho
yvad vyumandal(am) 125V2 = 152V1;
(a)dhastd yvad vyumandalam 169V 6 \
vyumandalaparyamtam adhah 129V4 (S. 31).
vluk Sand"
(pad)mmi
suvarnavluksti(rn) 153V 5;
(suvarnav)lukcitam iva 133V2.
vikas aufblhen"
vikasitebhyah padmebhyo 144V2.
*vicakri bh den Eadcharakter verlieren"
(i)ndryudh(ai)r avidydhipatirpam abhyha(tam) nirudhyate vi(cak)ri (bhavati ca
dvda)(m)ga(m)
pratityasamutpdacakr(am) 159B2 ^ 159R6 ^ 139V3.
vicaya Sichtung"
satvm vicayam krtv 162V6.
viear (caus.) erwgen"
vicray(a)t(a)h 139R4.
vicra Erwgen"
vitarkavicroparamt 126R6.
vicikits Zweifelsucht"
rgadvesamohamnavicikitsdr(ti) 150V 3.
vicitra mannigfach''
133V3; 135V 2 \ 161V1.
vicchid teilen"
pravho
prvam bhrumadhyd vicchidyate| tato nbhyh 129R3/4; = dau galak(d vicchidya)t(e)| t(ato
nbh)y(h)
147V2.
*vijna einsichtig"
(dharmah)
(pratytma)vedaniyo vijfiaih
165R6.
*vijnapti Gelbnis"
prtimoksasamvarvijnaptipunyasrotasah
adhipatirpam 169V3.
*vijnna Bewutsein"
garudamukham
tadamtargatam khadyo16 Schlingloff, Yogalehrbuch

241

takrimim iva spandamnam jvalitam vijnnanimi(tta)m 130V3 \ 138V 5.


*vijnnadhtu Element Bewutsein"
vijfinadhtuli
markatabladrakabinducitolkdim 128R6; bladrakamukham pasyati
vijnnadhtunimit(t)am
129V5;
160V4;
160V6.
*vijnnaskandha Gruppe Bewutsein"
(vijnnaskan)dhaparikarma 132V6 \ vijnnaskandhapariksdhimu(ktih) 133V 4,
vitarka Nachdenken"
vitarkavicroparamt 126B6.
vid wissen"
vedit(av)y(a)m| 154V1.
vidis ,,Zwischenrichtung"
sarvadigvidi^ah 136B1.
*vidycaranasampanna der in Weisheit
und Wandel Vollkommene"
164V1.
vidyut Blitz"
154V3.
yidhi Anleitung"
romakpadar^anvidhit 170V4.
*vidhura sorgenfrei"
. . .vidhuraudbilynuklamanasikrnamtaram 155V 4.
*vinaya Ordenszucht"
stravinaybhidhar(ma)m 166V2,
*vinayana Bekehrung"
. . .vinayanam bibasravinayanam (sie) upa(tisyakolitavina)yanam pitrvinayanam
164R2.
vinas zunichte werden"
vinasyamti 149Rl,
vinsa Zunichtewerden"
161V4.
viniguhya zu verheimlichend"
147R5.
vinirmukta befreit"
149R1.
vinivrt umkehren"
vinivartya 117V5.
vinl erziehen"
satv(m)s ca vinaya(ti) 150R3.
vinysa Ordnung"
yogavitysa(sic) 147V4.

242

Bieter Schlingloff, Ein buddhistisches Yogalehrbuch

*vipasyin Vipasyin"
ksyapdivipasyiparyamt b(uddhm)
128R1.
*vipitaka gelbverfrbt"
116V5. (S. 60).
vibhaj darlegen"
tadadhipatirupni skandhaprayoge vibhaktni 160R6.
vibhga Zerlegen"
adhipativibhganisyandarpaih 146V4 =
154V1; sastrni
(addh)tuvibhgena
krtsnam satvasamudram avasthpayanti
asatvkhyam ca
pamcadhtuvibhgena
160V 5 \ sariram pamcavibh(ga). . . 132V2/3;
adharottaravibhg(ena) 166R1 = 169V 6.
vibhsita geschmckt"
153V6; 153R1.
vimna Schlo"
(kmvacarm devm) v(i)mnodynopabhogm rp(vaca)rms ca savimnm 135R4;
divyrmodynavimnny apsaroganakalilny 169R4; mahrhaprsdavimndhirdh 154V5.
*vimuktipratisamvedan Empfinden der
Befreiung"
vimuktipratisamvedanym 127R6.
vimukhi bh sich abwenden"
169R5; 170V1; 170V2.
*vimocanat Befreitsein"
cittavimocanatym 118R4, 125R6.
virahita ohne"
s. tmtmiyavirahita.
*virgnudarsan Erschauen der Entleidenschaftlichung''
virg(nudar^anym) 118R6/119V1.
*virgnupasyan Erblicken der Entleidenschaf tlichung"
(vi)rgnupasyan(ym) 128V2.
virjita prangend"
lakannuvyamjanavirjita 130R6, 140V6,
150R3, 163V2,
vivara (1) Zwischenraum", (2) Spalt"
(1): bhruvivara 151R4, 152V1; (2): nakhavivara 128R4, 129V1, 129V2, 129R4.
vivrta aufgedeckt"
147R5.
visis vorzglicher sein"
viiyate 154V3.

*visuddhideva Gott durch Lauterkeit"


i(me s)mrtyupapattidev() ami vteuddhideva
415V5 (S. 153, Anm. 4).
visr zerfallen"
krtsnam lokam vi^iryamtam pasyati 125R6
^ 130R1; sarvam visirnam crnibhtam
pasyati 129V3; (lo)kam crnam visiryate
128V1; layanam ca (v)isiryate 130V3.
visesa Besonderheit"
yath dharmnusmrti ayam tu visesah
167R2; arhatvavise^abijam 169V4; (sa)tvnm visesam payat45F6; (mait)r(^ayas)y(ai)vyam anyo vi&esa utpadyate 144R3;
npnsmrti saparikarml savise nispamn vak(tavy) 128R2; saparika(rm savi^e ka)run nipam(n va)ktavy 152R4;
yogavitysa(ic) yoglamkroktas(5ic) ca visess 147V4; vesavi^esm 161V1 (S. 30,
Anm. 3).
visa Gift"
144V 4; 144R2.
visaya (Sinnes)objekt"
v(i)ayaparibhogdhi(patya)sam(pad) 143V 2;
ekaviaylambanasamartham
cittam
149R4; 149R5; istavi^aya 157V5, 157V6 \
visayespek(s) 157R5; (viaye)bhyah upeksm 158V1; 135V 5; 157V1; 157R5; 169R5.
*visayopeks Gleichmut gegenber den
Sinnesobjekten''
visayopeks triprakr 156R6; (via)yopeksm upa(samharati) 157R6; 156V4) 158V2.
yisda (1) Verzagtheit", (2) Nachlassen"
(1): 147R5; (2): na vidati kartavya
128R2.
viskambh befestigen"
viskambhaya(ti) 148V6.
visamci untersuchen"
visamcayatah 140R5.
vistarena ausfhrlich"
138R1; 154V 4.
visphulinga funkelnd"
(ras)m(i)bhi visphulimgbhih 157V6.
*vihar wandeln"
wpeksakasya viharatah 161V5.
*vihra Wandel"
s. maitrivihra.
*vihrin wandelnd"
s. maitrvihrin, karunvihrin.

Wrterverzeichnis

243

vihims Grausamkeit"
khym vedany udakavarnam budbudam
152B6.
158V2-3.
vitarga von Leidenschaft frei"
*vedanskandha Gruppe Empfindung''
154V1; 156B3.
yathoktam vedanskandhapariksym
virya Energie"
158V3; vedanaskandhaparikarma 132V4; vednasilaviryaprajn 164V6,
danskandhaparikdhi(muktih) 132B3.
vrksa Baum"
vedaniya erfabar"
pravrajit
vrksamleu kutikm pith
(pratytma)vedaniyo vijnaih
159V 5 \ sthitis ca vrksapariprn drsyate (dharmab)
165B6.
tammlanisann bhik^avo dhtuprayogam
*vedayita Empfindung"
bhvayamti 129B4; mrdhnati ratn(amayo
vedayitdhyava(s)nasydivrksa)h anamt lokadhtavah($c) spharitv triprakrasya
navm
158B3;
(veda)yitam triprakram
tisthatil tasmim vrk(s)e
buddh drpariksamnm
158B5.
yamte
tammukhaniJisrtai ratnapuspapa*vedayitopeks Gleichmut der Empfindmavarsair
loko (vyava)k(i)ry(a)te| vrksa
mlni ca
kmcanacakre pratisthit- dung gegenber"
(sic) drsyante 127V23; ratnamayo vrksa vedayit(o)p(e)ks() k(atar) 158V2 \ satvasaudgatah krtsnam lok(am) spharitv( tisthatil mudram abhimukhi bhav(a)ti sa tesm
vrkamlni c kmcanacakre) pratisthi- vedayitopeksm upasamharati 158B3; iti
tni
dr^yamtel vrksdhas(tt). . . 151V4 vedayitopeksl 158B5; 156V 4.
5; ratnavrkdhar nisanam ctmnam pavel Gelegenheit"
yati| sa ca ratnavrksah anamtam lokam (bhagavm)s tasym vely(ni) g(thm
spharitv tisthati . . . .vrksd ratnavarsena bhsate) 167B5.
krtsnam satvasamudram (u)pagdham pavesa Kleidung"
syati| 131B56; buddhnm sarvasroto(bhyo su^iksitanatam iva vicitrm vesavisesm
ratnavrk)s(a)b nirgacchamti | tada(dhir)- kurvantam 161V1.
dhh samyaksamb(uddh)s
tamvest umkleiden"
n(bhinih)srtbhis
nadibhir yogcr^(r)abhagavamtahL
(yog)crsr(a)yam vestayam pryatel 152B1; ksiravrko mrdhayamti 144B1.
nirgato 'namtam lokadhtum spharitv tivaidrya (1) Glas", (2) glsern"
sthatil . . . . .(sat)v() nihsrtbhib ksiradh(1):
suva(r)narpy(a)vaidryasphadikamarbhih siktamtr 145V1.
(ya)
164V4;
vaiduryamayi(m) prthivlm vaivrdh wachsen"
duryamayavajrsanaracitm
144V5; vaivardhamnam 129V 6.
dryamay(i) stri 169V1 = 143V6 = 165V2 =
*vrddha Greisenalter"
166B2 = 167V4; (2): vaidryadamdpablakaumrayauva(madhyavrddh) 129V 6.
dm&ni
144V1 !padmaiti vaidryandait 153V6;
vrsti Begen"
vrksamlni
ca vaidrybhmny 127V3 \
(sa)r(v)opakaranavrstim mumcati 148V6.
vaidryaml()dibhih
127V4; vaidryabhvedan Empfindung"
jana
169B3,
165V2,
167V4,
170B3; vaidryavedanopa^myati 148V1; duhkhym (sc.
vedanym) pidyamnasya dvesam utpa- dhvajo 115V6 \ vaidryasop(nni) 166V5 \
dyate 158V4 \ (sukhym vedanym sukhi- vaidry aguh 119B4; vaidryastambh (a)tasya rga ut)padyate 158V6 \ sukhveda- m(a)h(p)r(sda) 158B3; 158B4; prsvaidryastambhadhritam 126V 2;
nsvdava^
duscarita
samutthpitam dam
158B1; duhkhym vedanym upeksa sam- vaidrybhab dauvrikah puruso 161B5;
tisthate 158V6 \ sukhym vedanym upe- 131B2 (S. 42, Anm. 12).
ks samtisthati 158B2; (tripra)k()r(y)h
*vaineya bekehrungsfhig"
vedanyh adhipatirpam
duhkhsu- parisampt vaineyb 162BL
16*

244

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

vaimukhya ,, Widerwille''
pratityasamutpdacakram
drstv csya vaimukhya(m) u(tpadyate) 159R1.
vairgya , 9Entleidenschaftlichung('
134V6.
*vairadya Klugheit"
balavairadyvenikasmrtyupasthnamahkarundhi(patir)pni drsyamte
vaisradynm cat(vro buddhapratimJh) s(i)mhsandhirdh svam svam gocaram lokenvabhsya ti(thamti) 161R6-162V2; catvri ratnamandalnil tadamtargath simhsandhirudh buddhh satvebhyo dharmam
desayanti (vais)radynm adhi(patirpam|)
165V5.
vyadh durchbohren"
rpaskandham jardibhih salyair viddham
134V1.
vyavakr berschtten"
buddhh yogcr^rayam padmair vyavaramti 131R3/4; ratnapuspavarsai sa samgho
vyavakiryate 126V3; ratnapuspapadmavarair
loko (vyava)k(i)ry(a)te 127V3.
yyasana Elend"
mahvyasanapamkd u(d)dhrt 148B4.
vyasanitva Anteilnahme"
parakryavyasanitvam 152R4.
vyasta gesondert"
kadcid dhtum vyastm patyati kadcit
samastt 129R5.
vyghra Tiger"
simhavyghrdaya^ 144R2.
vydhi Gebrechen"
s(ar)v(a)s(a)tv(a)vy()dh(m)m
apahart
samyaksambuddha 152V 5 = 152V6.
vydhita krank"
129V6.
*vypda belwollen"
vypdapratipaknamtaram 147R1; 155V3;
147V5.
vymisra vermischt"
115R3; 125V 2.
vyvrt sich abwenden"
vyvar(tat)e 158V6.
vyucchinna geteilt"
133R2.
*vyutthna Erwachen"
vyutthnakle ratnacitam ratnavrksdhar

nisanam ctmnam pasyati 131R5; (vyutthnak)l(e ratna)citam pattabaddham srayam utpadyate 130V4; utthnakle muktcith prsda utpa(dya)
bhagavms casya ^irasi pattam badhnti 128V3 ^ 126V2 \
amte ca sarva(m) jiieya(m n)bhym nirudhyat(e i)ti vyutthnam| || 166R5 ^ 139R3
z* 147V4 ^ 152R3 ~ 155V2 ^ 165R5 ^
167R3.
*vyutthita erwacht"
vyutthitasypi
nisyamdam
anuvartate
146V 6 \ (vy)utthitasya csya bodhya
drdham adhysaya(m ut)padyate 150R3;
151R1.
vrlhiyavh Reis und Gerste"
(pudgal vri)hiya(vm) nihsrthhriyav
{sie) prthivi nih(srt)h 136R5(S. 112, Anm. 3).
*sakti Speer"
148R5; 157Rl.
*sankal Skelett"
dvrebhya^ catasrab yatanacith ^a(m)ka
lab-
nirgaccham(ti) 136V1; 136V2 \
pradip
sarv ca amkalh paripavanvac chidri kurvamti 136V3; rasadhr
samkalhsu(5ic) tadsraye ca nipatith
136V6 (S. 59, Anm. 3).
sanku Nagel"
149V2.
sankha Muschel"
samkham kasadhtunimittam 129V5.
sabda(i) Ton", (2) Wort"
(1): rpa^abdagandharasasprsta(vyadharm)
134R4; bha(gavantam)
^gandikm kotayamtam pasyati sa sabdah anamta lokadhtun ()pr(a)y(a)t(i) 161R3; (2): b(u)ddhs ca sabdam udirayan(t)i santam sntam
i(t)i 121R5; buddhapratyekabuddha&rvakh
anitya(m a)nityam iti Sabdam udiray(am)tah 136R2; te ca (sc. satvh) samvignh. . . .v.ta iti sabdam niserayamti
150V1; simhamukham utpadyat(e).. . .lo(ka)h sab(d)am kurvno 130V2; gurudamukho(sic) chabdo (nirgaccha)ti 130V3.
&&m\,zum Erlschen bringen"
sarv kranh ^myamte 149V4; te ca pravisth (sc. nirvnapuram)
pradip iva smyamte 161R6.

Wrterverzeichnis
sayin liegend"
vmprsvasyinm 160V4.
sarana Zuflucht"
167R5-168V1.
salka Stbchen"
sudvikasalkbhi(sic) rdhvamukhbhih. ratnaci(tbhih) 121V 3; (rp)y (asa)lkbhyo
121V3, 121V4] amgrasalksadrs(a) 117R3;
ratnasalk iva 124V1; 124R5.
salya Stachel"
s(a)lyatafr parmrsan| rpaskandham jardibhih salyair viddham 134V1.
sarira Leib"
stri ksiradhrbhih sariram a(vasimcati)tasmc char(i)rt kslradhrbhihi sarvasatvsamudrab. plvyate 148V1V2; catvra
pravhh
sariram prayamti 146R5; bhagavatah ^arirt pra(vho nirgatat) 154R1 ^
161V6 \ 132V2 \ s. janmasarira, dharmasarira.
sastra Messer"
(kra)mati na visam na sastram kye 144V4)
nirmalojvalasastracitam
pratyaveksannimittam 133R5 ^ 167V 6; goghtakat grliitasa(stra)
(gm vadhayi)tv taccarmani
sad bilm bhga^ah pratyavekate| tato
yogino nbhym sastra nirgacchatil yogina^
csrayam sad bilm bhgasah taccarmany
avasth(payati) 160V1-2 ^ 160V5 \ sam(jtak)runyasya ca daksine haste tiksnam
ks(avar)na(m) sastram utpadya(te) 150R5;
sasastrah puru(sa utpadyat)e 130V6; 149V1.
skh Zweig"
vrk(s)e ghanapat(r)askhsu 127V2 \ 127V5 \
127V6.
snta ruhevoll"
b(u)ddhs ca sabdam udirayan(t)i santam
sntam i(t)i 121R5; sntam nirvnam 162R1;
anbhogam anabhisamskra(m) sntam
ci(tta)m 125V4; ciraklam s(ntam)
cittam 145R1; tatrastham ciraklam snt. .
.iratam ca cittam 135R6; t(a)tr(a)sth(am)
ca c(i)ttam snt(am) drdham 121R2.
srira leiblich"
s()rlramnasadulikhm 148V2 ^ 147R6\
sariraduhkha 148V5 \ sariramnasai rogair
srirais caturuttarais catur(bh)i(h) rogasataiti 148V2-3,

245

ssana Unterweisung"
(p)r(a)mrth(i)kam ^sanml smke(tikam)
ca 154R3 ^ 166V2 ^ 166R2.
sstr Lehrer"
(sst devamanusynm) 164V1.
sastra Lehrbuch"
krtsno lokah tirthyasstrni pathams 166V1;
s. yogasstra 128R3.
sir as Kopf"
bhagavms casya sirasi pattam badhnti
128V3 ^ 150R1 ^ 127R4 ^ 169V4; siraso
mukth()r() n(i)rgacchamti 127R4; siras
ca mahpramnam. . . 135V3; 143R4.
sigliratara schneller"
160V4.
*sitanaraka kalte Hlle"
astau mahnarakb
sahasitanarakai
148R5 = 145R5 (S. 31, Anm. 8).
sitala khl"
sltalajalaparisiktam iva 128V2.
sirsakapla Schdelschale"
yvac chlrsakplam grivsthipratisthi(tam)
pasyati 137V3.
sila Tugend"
dnasilaviryaprajn 164V6; sildikrtapari(karmanab) 134R1 = 128R4.
*sllnusmrti Meditation ber die Tugend"
i&lnusmrti katar ihryasrvakab (s)il(am
kratab sama)nusmarati itim(ni sil)ny
akhandny acchidr(ny asabalni) 167R3;
(si)lnu(smrti)prvam hrdayopanibaddhacetasah 169R2/3 = 167R4'= 169V5(8.183 ff.).
*suddhvs devh , fiuddkvsa-Gtter''
bhagavm
cch(u)d(dhvsadevapariv)r(to
daksine padmaka)rnikym nisidati suddhvss ca devb patresu 152V3 \ 152R2(S. 33).
*subhanimitta Symbol des Schnen"
yathoktasubhanimittya(tana)citam jagad
136V6.
snya leer"
yatanni ca| klinnajvalitasunyani 134R2;
()sray(am) suny(am tmtmiyavirahi)tam
dhtumtrakam 160R4 c* 129V3 \ 129V4;
sunyam tmt(m)iyavirahi(tam) (sc. lokam)
130V6; sunyatab parmrsat 134V3 (S. 16,
Anm. 1).

246

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

snyat Leere"
es sunyatnukl parik 136V5; sunyatnuklatvd 129V 4.
sr verfallen"
(lo)kah sciryate 118R5; satvsatvkhyni
siryamnni pa&yati 132R1.
soka Kummer"
U7R5.
sobhana vorzglich"
153R3.
saila Fels"
vajrasailam iva vanakampane 161R2.
smasna Leichensttte"
115V4.
sramana Asket"
(i)ine mahrhlamk()rlamkrt ami ramanlamkrlam(krth) 154V6.
*srmanyaphala Frucht des Asketentums"
smrtyupasthnnirvedhabhgiyas(r)manyaphalni sasambhrlamkr(ny) 128R3.
*srvaka Jnger"
buddhh
srvakagajftaparivrt(k) 154R5;
(bhaga)vatah (r)vakapa(r)i(vra) 139R3;
(supratipa)nno bhagavatah srvakasamgha
166R6; ryamaitreyam anekasrvakasahasraparivram 128V 5; buddhapratyekabuddhasrvakh 136R1; srvakaganam 154V3;
srvakagunopetms (sc. satvm) 154R3;
(sr)vaknm nirvnapurapravesaklam
161R4; srvakfr pasct pari(n)ir(v)(na). . .
162R3; (buddha-) (=dharma-, =samgha-, =
sila-) (anusmrtih katarj i)hryasrvakas tathg(atam) ( = dharmam, = samgham,
silam) (kratah samanusmaratil) 163R6
- 165R5 = 166R6 = 167R3; 162V4.
sru (1) hren", (2) vernehmen"
(1): cchrnvams 166V2; (2): chrutv 144V2,
149V5.
srotra Ohr"
chrotraghrnajihvk()yamanali 134R4 ^
135V5 \ (srotradvrena) 157R1; srotrbhym
pyardhirakarnamalapravhh 135V 6.
slis umschlingen"
sle^ayanti 145R4.
sveta wei"
sveto gajah 125V5 ^ 165V4.

sat sechs"
sat kmvacarm devn 145R6 =* 170R1;
satspar^yatan 149V1; sadyatananimittam 135R6; addhtupariknuklrtham
160V1; saddhtumayam srayam 160R 4;
addhtumayaih purusaih 129R5; buddhn
addhtusampannt | 131R4; addhtumandalny 160R2 = 130V1; (saddh)tuvibhgena
160V 5;
saddhtudbilni(sic)
160R1: sad bilm 160V2 \ addam(ta)b sveto
gajah 125V5 ~ 141R6.
satka sechszahl"
kalalvastham dhtuatkam 129V5.
sodasan sechzehn"
astau mahnarakh odaso(tsadapar)ivrh
148R5 ** 145R5.
samyuj (caus.) zuteil werden lassen"
stri
satvm parena sukhena samyojayati
147V 314.

samrambha Zorn"
muktasamrambhapraharans 144R3 =
145V2.
*samvara Zucht"
prtimoksasamvarvijnaptipunyasrotasah
adhipatirpam | sauvarnaratnacitarathdhir(dham brah)m()n(am) pasyati 169V3;
samvara pratilabhate 169V2 \ dhynasamvarasya 169R6.
*samvartam ,, Weltvernichtungsperiode''
evam udakasamksobhah agnisarnksobhah
vyusamk^obhah yathsamvartanisu 161V4;
(sam)vartanym iva krtsnam lokam visiryamtam pasyati 125R6 (S. 168, Anm. 5).
samvigna bestrzt"
sarvasatv samvigns 159V4 ^ 149R6;
ta(dda)rsanasamvignasya ca yoginab 130R5.
*samvedan Empfinden"
s. pritisamvedan.
samsra Geburtenkreislauf"
krtsnam samsram praksya 166R4.
*samsracakra Rad des Geburtenkreislaufes"
purusas tarn samsracakram dya tasmim
klesaparvatel pravisa(ti) 150V3.
*samskra Gestaltungskraft"
trividhh samskr punyh ap(unyb nifi137R4; tridhynopags ca punynm

Wrterverzeichnis
samskarnm 137B5; vicitram samskragatam (sc. lokam) 133V3 ^ 161V1 ^ 130V 6;
(samsk)rasmtnikam
prati(tyasamutpdacakram) 139V6/B1 = 159B1; samskrdhipatirpam 137B3; samskrespeks
utpadyate 161V1/2; (anity) bata samskr
162B2\s. cittasamskrapratisamvedan, prasrabdhakyasamskrat,
prasrabdhacittasamskrat.
*samskraskandha Gruppe Gestaltungen1'
samskraskandhaparikarma 132V5.
*saniskrta erschaffen"
abhisekapravh(li)
(dharmm)
samskrtsamsk(r)tm(sic) avabhsya 166B5.
samsth berkommen"
s csya samtistha(te) 150B4\ upek samtisthate 158V 3,158V6,158B2,159V3,161B1.
samsthna Form"
varnasamsthno 143V4.
*samsparsa Durchdrungensein"
navanitavarnasamspars stri 155B4; (su)khasamsparso mahms csrayo 149V6.
samhr einziehen"
samhrtni 141V3.
sakala ganz"
160V4.
*saklesa mit Befleckungen behaftet"
sakklesm niskle^n 156B3.
samksa scheinend wie"
candramandalasamk^a 127Bl;
142B3,
144B5, 150B3, 151B6, 152B1.
samkucita geschlossen"
144V1.
samksip zusammenfassen"
samksipya 123V1; samksipte 131B3.
samksobha Erschttern"
evam udakasamksobhah agnisamksobhatL
vyusamksobhah yathsamvartanlsu 161V4.
*sangha Gemeinde"
ratnapuspavarsai sa saipgho vyavakiryate
126V3; sthitis cryasarnghkirna drsyate
167B2\ i(hrya^rvakah samgham kratab)
sa(ma)nusma(rati | supratipa)nno bhagavatah srvakasamgha i(t)i 166B6; (b)uddhadharmasaipghesu 153B3.
*sanghnusmrti Meditation ber die Gemeinde"
buddhadharmasarpgh(nusmr)ti 170V4; sam-

247

ghnusmrtih. katar] 166B6; 167B3


(S. 182ff.).
*sanghta 8anghta-[Hlle]"
as(ma)
y(a)mtryoghanagajadyadryyodrony(a)h. s(am)gh()t(e) 149V1{S. 138,
Anm. 6).
*sacarcara samt Beweglichem und Unbeweglichem"
sacarcaro loka 162V6.
saj hingeben"
bladrakam samdhisukhasaktam 118B3 ^
127B2.
*samcaya Vermehrung"
(samca)ypacayau bahuso gatv 115V5.
samjta durchdrungen"
samjtapritiprmodya 151B2; pritiprmodyasamj tasya 150B2; samj takarujiyasya
150V4/5, 150B5; samjtaprasdasya 152V4.
*sanjlva Sanjiva[-Hlle]"
^aktyasipa
(samjive) 148B6 (S. 138,
Anm. 4).
*samjn Wahrnehmung"
(sukhasa)m jnym |
dulikhasam jny |
126B4.
*samjnskandha Gruppe Wahrnehmung"
(samjnskandhaparikarma) 132V 5; (samj )n()skandhapariks(dhimuktih) 133V1.
^satatasamitam stets wiederholend"
135B2.
satya Wahrheit"
skandhadhtvyatanapratltyasamutpdryasatydini. . . 169B1.
satva Wesen"
116V4; 116V 6 \ 116B2\ 129V1; 129B1;
132B4; 135V 3; 135B5; 137V 3; 138V 6 \
140V 3 \ 140B4; 140B6; 141V 3; 141V 6 \
141B1] 141B3; 141B4; 141B5; 142V4 \
143V 2 \ 143V4; 143V 5 \ 143B4; 143B5;
143B6] 144V1; 144V 2; 144V 3; 144V4 \
144B2; 144B3; 144B5; 144B6; 145V2 \
145V 5 \ 145V 6 \ 145B2; 145B3; 145B4;
146B2; 146B6; 147V3; 148V 2; 148V3;
148B2; 148B3; 148B4; 148B5; 149V 2;
149B2; 15OB1\ 150B3; 150B5\ 15IV 6;
151B2; 152V5 \ 152V 6 \ 153V5; 153V 6 \
153B3; 153B4; 153B5; 153B6; 154B2;
154B3; 154B6; 155B5; 155B6; 156B2;
156B4; 156B5; 158V1; 158V 2 \ 158B3;

248

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

159V 4 \ 159V 6) 159B5; 159B6; 160B1;


160B6; 162V6; 165V5 (S. 14, Anm. 3).
*satvasamudra Meer der Lebewesen"
130V5; 131B6; 145V 3 \ 148V 2 \ 151B2;
153B1; 158B2; 159B4; 160V 5 \ 163V1.
*satvkhya belebt"
satvkhyms csatvkhyms ca tulayati
160B2; (saddh)tuvibhgena krtsnam satvasamudram avasthpayanti asatvkhyam
ca pamcadhtuvibhgena 160V5.
*satvsatvkhya belebt und unbelebt"
krtsnam lokam satvsatvkhyam 130V1;
(a)dhy()tmabhyni satvsatvkhyni
132B1; satvsatvkhyam ca bhyo (sc. pratltyasamutpdali) 136B3; (sarvasatv)satvkhyni saddhtumandalny
160B2;
129V3; 160B6; 169V1; 169V2 (S. 85, Anm. 6).
sadrsa entsprechend"
117B3; 131B2; 145V4; 145V5; 153B1;
153B5] 153B6; 166V4.
*saddharma die wahre Lehre"
p(ra)mrthikasad(dh)arma 166V2.
sadbhva VorJiandensein"
153V4.
sadhana besitzend"
satvm
sadhann adhan(n) 156B2.
*samtna Nachfolge"
srvakaganam
pariprnasamt()nam
154V 4\ 169V 2.
*samdhraka Trger"
samdhraka(h pudgal vri)hiya(vm) nihsrth 136B4/5.
-samnibha gleichend"
134V3.
samnirudh vernichten"
samnirodhayitv 117B4.
*saparikarma samt Vorbereitung"
5. parikarma.
sapta sieben"
(saptnm bodhyamgnm sapta) . . . . bu-

ddhb 166V 6; 143V2.


*saptabhauma sich auf sieben Sttten
beziehend"
bhmibhedena saptabhaum (sc. maitri, karun, upeks) 140V1 ^ U7B4 ^ 155B1.
samam zusammen"
145V 5-, 160V 6.

samat gleiche Ebene"


(i)me mahbht(a)samatayopeth ami cittasamat(a)y(ope)t 154B1.
-samanantara unmittelbar folgend auf"
132V1; 153B5; 155V 2.
samanubh teilhaftig werden"
pri(tim) samanubhavati 144V4,
*samanusmr meditieren"
(i)hrya^rvakas tathg(atam) ( dharmam,
= samgham, = silam) (kratab samanusmaratil) 163B6 =165B5=166B6 = 167B3.
samantatas ringsum"
127B4\ 136V 5 \ 154B2.
samanvgata durchdrungen"
paramena cittada(mopa)samena samanvgatam 154V3.
samaya Zeit"
tasmim samaye 124B2,124B6,125V'4,135V 4,
159B3.
*samarpita durchsetzt"
nnsukhasamarpitab satvasamudrab 153B1.
samasta vereinigt"
kadcid dhtum vyastm pasyati kadcit
samastt 129B5.
*samdn Sammlung"
s. cittasamdn.
*saMidhnat Gesammeltsein"
s. cittasamdhnat.
*samdhi Kontemplation"
sthitacitto bhavati samdhipratil()bht |
126B6/127V1; bldrakam samdhisukhasaktam 118B3 ^ 127B2; krtaparikarmanah
avasthitasamdheh 130B4 =* 130V5.
*sampad eindringen"
nilalohitvadtam
sampadyabhinirhara(ti) 146V3; buddhapravho nirgatab
prthividhtu
sampadyamnab
-tato
'bdhtum sampadyate
tatas tejodhtu sampadyate
(tato vyudhtum
sam)(padya)m(t)e
(tata
kadhtum sampadyate) 131V3-B1; buddhn
addhtusampannt | 131B4; buddhm
tejodhtusampannm 146V1; satv
tej (o)dhtusampann
buddhavapurdharino
146B2; te ca bhiksavah kecid dirghatsampann drsyamte kecid yvan n(irodhnupasya)nm(5ic) sampann drsyamte 128V6
(S. 93, Anm. 5).

Wrterverzeichnis

*samuccla Hervorbringung (?)"


tatafr samu(c)c()labhedm ca sausirydim
pasyatil 131R6 (S. 95, Anm. 8).
*samutkrs loben"
stri
(sam)utkarsayati sdhu sdhu sobhanam idam rabdham 153R3.
samutth aufkommen"
duscaritam samutthpitam 159V1 158R1.
samudcra Benehmen"
dvesasamuderadosadar^ant 158V5.
samudra Meer"
(amtalisa)mudram utpadyat(e) | (dvi)tiyam
bahib svsaparigrhitam cittam bladrakarpi amtalisamudre nimajjati svasatah prasvsaparig(r)hltam evam bahilisamudre prasvasatahi 127R12; amte cm(tali)samudre
nimagnam samdhisukhasaktm pasyatil ulksahasrni cmtahsam(u)d(r)e nipatamti
evam bhyasamu(d)r(e)| svsaparigrhitah
sa bladraka(h amta)hsamudre nimajjati
prasvsaparigrhita^ ca bahih 127R23; maitrsayasya hr(day)dvram apvryate tatrmtah ksirasamudram sambhavati 143R6;
ksirasamudre ca nimagnb 141V4; yatanarasasamudram amtalipasyatil36F4; (ca)tursu
ca prsv(e)su samudracatustayam sarvsucipariprnm pasyati 130R5; (caturbhya)s ca
samudrebhya uttarati |
(pu)spapravho
samudresu catursu patatil tata samudra
rasaih pryamte 131V2; snigdhasuvarnarasam samudranimag(na). . . 146V2; 122R3;
151R5; s. satvasamudra (S. 22; S. 32, Anm. 3).
*samudracandra Mond[spiegelung] im
Meer"
123B5.
samudraparyanta meerbegrenzt"
samudraparyamt mahprthivim 129V1,
116V 3; 116V 4.
samutpad entstehen"
samutpadyate 151V6.
samudvah herausfhren"
samudvaham 144V3.
sampad Zustandekommen"
smrtisamprajanyasampaddvayam 169V1;
s(am)pannimittam 167V5, 167V6 \ s. dhipatyasampad.
sampanna vollkommen"
s. vidycaranasampanna.

249

*samprajanya Bewutwerden"
smrtisampraj anyasampaddvayam pratilabhate 168R6/169V1; 143V6.
*samprajna bewut"
(m)tu kuksisamprajnanikramanam 164R1.
*samprayoga Verbindung"
mudit
s tu snuparivart sasamprayog parigr(h)ya(mn|) 153V2 =* 139R6
^ 147R3 ^ 155V6.
sambhava Entstehung"
s. yathsambhava.
*sambhra Zurstung"
smrtyupasthnnirvedhabhgiyas(r)manyaphalni sasambhrlamkr(ny) 128R3 (S. 84,
Anm. 16).
sambh in Erscheinung treten"
sambhavati 136V1, 136V'3, 144V2; sambhavamti 143V5, 144V3.
*samyakprahna rechte Anstrengung"
caturnm samyakprahn(nm) 166V4.
*samyaksambuddha der vllig Erleuchtete"
(ratnavrk)s()h
tada(dhir)dhh samyaksamb(uddh)^ candramandacit(sic) yvad
aghanith dev iti 152R1; sym aham anga(te 'dhvani)
samyaksambuddha iti
152V5 ^ 152V6; 164V1.
*sarvakyapratisamvedan Empfinden des
ganzen Krpers"
sarvak(yapratisamvedanym)
118V 3/4,
122R4/5.
sarvatra berall"
131R6, 151V5.
sarvath berall"
140R5.
sarvad allezeit"
151V5.
*sarvasatvahitdhysayapravrtta entwickelt zur Hinwendung zum Heil aller
Wesen"
145V 6 \ 140V 3.
sarsapa Senfkorn"
165VL
salila Wasser"
astmgopet(bhi]i sa)l(i)ladhrbhir 148R1.
sahasra tausend"
buddhn anekasahasraparivran 151R3;
asiti krimikulasahasrni 160R5; sahasrracakram 146R2; 149V 3.

250

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

*sahlya (?) verbunden"

asvsaprasvsahlyam(sic) ctra bladrakam


118R2; smrtisahi(yo bha)gavn 127R4.
*smketika konventionell"
p()r(a)mrth(i)kam sanm| smke(tikam)
cvataramti 154R3; smketikena (^san)e(na)
tadanamtaram
p(ra)mrthikasad(dh(arma. . . . 166V2;
smketikapramrthi(kam ssanam) 166R2.
sdhrana Gemeingut"
132V1.
sdhu trefflich"
153R3.
*smtnika ,.ununterbrochene Fortsetzung
verursachend"
pratityasamutpdaeakram (samsk)rasmtnikam 159R1 ~ 139R1.
*smtarbahis innen und auen"
125R2.
*smdrstika aktuell"
(dharmab smdrtiko) 165R6.
*sbhisamskra , ,gestaltungsvolV'
sbhogam sbhisamskram ca tasmim samaye ci(ttam bhavati) 124R6 = 124R2 =
125V3.
*sbhoga angespannt"
sbhogam sbhisamskram ca tasmim samaye ci(ttam bhavati) 124R6 = 124R2 =
125V3.
smarthya Funktion"
152R5/6.
shyya Beistand"
stri
yoginam protsha(yati |)aham te
shyyam kari^ymiti 148V5.
simha Lwe"
simhavyghrdayas ca tarn abhidravyamte
144R2; nbhisthn(m)tare ca ratnamayam
simhamukham utpadyat(e) . . . . lo(ka)h ab(d)am kurvno niru(dh)yate 130V2; bhagavatab hrdaye ratnamayab sim(ha) 162V5;
simham dityamandalopacitam 126V1 (S. 89,
Anm. 14).
simhanda Lwengebrll"
(catvro buddhb) simhandena krtsnam
lokam pr(ayamt)i 166V4.
simhsana Lwenthron"
bhagavm simhsa(ndhirdha) 149R6; sim-

hsandhirudh buddhb 165V5 =* 126V2/3


c*l 50V5 ^ 154R5 (S. 51, Anm. 1).
sie besprengen"
tac codakam
satvn simca(ti) 150R1;
145V1; nnvarnarasasekaih satvm (simcya)mnaib pasyati 148R3; satvm
pusparasadhrbhib simeyamnam 149R3; tailadhr(bhiti sim)cyamnam 118V4/5; simcyamno 145V 4; (sat)v()
^ksiradhrbhili siktamtr 145V2 \ dhrbhih siktab
satvb 145V5.
sukha (2) glcklich", (2) Glck"
(1): (sukhym vedanym sukhitasya rga
ut)padyate 158V6; sukhvedansvdavas
duscarita samutthpitam 158R1; sukhym
vedanym upeks samtithati 158R2; duljkhsukhym vedany 158V3; (2): stri
satvm parena sukhena samyojayati
147V3; mitrasya sukhena prito bhavati
e(vam)- amitrasya sukhena prito
bhavati 153V45; nnsukhasamarpitah satvasamudrab 153R1; satv ihaloke paraloke
sukhen()nugr(hith | y )vat parinirmitavasavartidevm sukhena sukhitm d(r)(tv)
p(r)itir utpadyate 153R4; (a)nagatena sukhena sukhita(m)l(5ic) satvm (pa)syati
153R5; abhyudayikena sukhena sukh(i)n(si)\xl54V5; bladrakam samdhisukhasaktam 118R3 ** 127R2; (su)khasamsparso
mahm^ csrayo 149V6 \ hitasukha 140V1,
140V3, 153V2; (parasukha)hita 147Rl; s.
upasamasukha;
sukham glcklich"
(sa)rvadulikhavinirmuktli sukham ti^thamti
149R1; sukham svapiti sukham prtibudhyate 147V5.
*sukhapratisamvedan Empfinden von
Glck" (sukhaprat)isamvedanvahitacetasah
124R3; (sukhaprat)isamvedanym 118V6,
123V 4, 124R6.
*sukhasamjfi Glckswahrnehmung"
(sukhasa)m jnym |
dubikhasamjny |
126R4.
sukhita beglckt"
sukhena sukhitm (sc. satvm) 153R4 ^
153R5; (sukhym vedanym sukhitasya)
158V6.

Wrterverzeichnis

sukhin glcklich"
abhyudayikena sukhena sukh(i)n(a)b 154V5.
*sugata der Wohlgegangene"
164V1.
*sugati gute Existenzform"
sugatvy upapadyam(te) 149V5 \ 166R2,
supariprna gut ausgefhrt"
npnasmrtir
bhvit
supariprna
bhavati 128V3.
*supratipanna wohlgerstet"
(supratipa )nno bhaga vatafr sr vakasamgha
166R6.
*suprahlna vllig entledigt"
127V1.
suvarna von hoher Herkunft"
(su)varnadurvarnnm 156R2.
suvarna gold"
suva(r)narpy (a)vaidryasphadika
164V 4;
suvarnabhja(na) 151R6; (pad)mini
suvarnavluksti(rn
suvarna Jpadmaih
prn() 153V56; (suvarnav)lukcitam iva
133V2; suvarnasara(pa) 165V1; s(uva)rnbh stri 153R3 ^ 162V3 ^ 148V4 o*151V6;
suvarnabhni
candramaadalni
(satvm) tatsadrsavarnn 153R5; (s)uvarnbhnm buddhnm pravho 133V2; suvarna varnbhi snigdhbhir dhrbhir 124V4;
snigdhasuvarnarasam 146V2; suvarnanilapitalohitvadtarasbhisekaib 145V4; suvarna(varna^
ca)tuvarnamaitrbhisekas ca
146R5; 144V3.
susiksita gebt"
su^iksitanatam 161V1.
susira hohl"
vrksamlni
antahsusirni 127V 3 \ 126R4.
*susirataratva Ausgehhltersein"
madhyamam gandam ksadhtuh susirataratvtl 160V4.
sksma fein"
sksmn av^yyabindn iva 131R3.
sc ankndigen"
scayati 161R4.
sfltra Draht"
s. rastra.
*stra Lehrrede"
stravinaybhidhar(ma)m 166V2; s. pratityasamutpdastra.

251

*snsikstha Schlachtbank"
snsik^tha iva cchidyamna 73^F2 (S. 102,
Anm. 8).
sryamandala Sonnenscheibe"
124R4.
seka Besprengung"
nnvarnarasasekaili satvm (simcya)mnaib 148R3.
senpati Skanda"
(se)np(a)t(ir) bh(a)v(a)ti| um(patibi). . .
141V6.
sopna Treppe"
(caturnm rddhipd)n(m) catvri vaidryasop(nni) 166V5 \ (spha)d(i)kamayam sop()n(am) 121R1.
saumanasya (2) aus Frohsinn bestehend",
(2) Frohsinn"
(1): atha kimsvabhv mudit tad ucyatel
sauma(na)s(y)e(t)i sa svabhv 153V2; (2):
bhmi(tah kmadhtau dh)y()nadvaye ca
tatra sau(manasyam) dv(a)y(a)sadbhv(am)
153V4 (S. 117, Anm. 4).
*sauratya Milde"
kmtisauratyamrjavamrdutve 152R4.
sauvarna golden"
sauvarnam padmam 145V5 \ sauvarnena padmam 152V2; sauvarno dhvaya 153R2\ (vrksamlni)
sauvarnni 151V4; sauvarna
guh 146R1 ^ 146V6 \ sarvapari^andni
(sauva)rnaktgraparivritni 146V1; sauvarnaratnacitaratha 169V3 \ 168R2.
sauslrya Hhle"
ksadhtut oak^utisausirydinm 128R6;
tatall samu(e)c()labhedms ca sauslrydim
pasyati 131R6.
sauhrda Freundschaft"
aparopatpibhavah
^parakryavyasanitvam sauhrdam amgni karuayh 152R4.
*skandha Gruppe"
skandhadhtvyatanapratityasamutpdryasatydini . . . 169R1; (kmvacar catub)skandhasvabhv| rupvacara pamcaskandhasvabhv (sc. mudit, = karun)
153V3 = 147R3; skandhanimittni 133R6;
arpinali skandhm 134V2; skandhapamcakam 160R6; s. rpaskandha, vedanskandha,
samjnskandha, samskraskandha, vijnnaskandha (S. 27; 46; 96 ff.).

252

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

*skandhapariks Betrachtung der Gruppen"


(skandhapariksrabhyate) 132V1.
*skandhaprayoga bung der Gruppen"
skandhapamcakam
tadadhipatirupni
skandhaprayoge vibhaktni 160B6.
stana Brust"
satvh
stanesu slesayanti 145R4.
stambha Sule"
prsdamvaidryastambhadhritam
126V2; vaidryastambh(a)m(a)h(p)r(sda)
-vaidryastambhanihsrtaih pattai
158R3-4;
stambhopara(ci)th
ktgr
121R4; k^irastambhah iva nirgatah 143V1.
stirna bestreut"
(pad)mmi
suvarnavluksti(rn)i<53F5/6.
stri Frau"
(bu)dbudesu strimukhni drsyamtel rgasydhipatirupam 132R5; pradfpahast ca
stri prajndhipatirupam 160R4; (hriava)trpyadhipatirpam
stri purusas ca
159V2\ smrtisampraj anyasampaddvayam
tadadhipatirupaml vaidryamay(i) stri
smrtyh 169V1; karun
tadadhipatirupaml hrdaye stri su(varn)bh() av(a)d()tastraprvrta(^ic) utpadyatel utpamn yoginam protsha(yati) 148V4 ^ 151V6 \ (hr)day Jsya s(uva)rnbh stri pramuditotpadyate| muditdhipatirpam sainam (sam)utkarayati 153R3; (stri). . .(a)vadtavarn
avadtavastraprvrt paryamkena niannnbhogvasthit
upeksdhipatirpam
sambhavati 161V2 \ avadtavarn ca stri
avadta(vastr
mahkaru)n()dh(i)patirupam 162V6 \ (mahkar)u(ny)hL(^c. adhipatirupam) (k^ava)r(n)t h(r)daye stri s(u)varnbh nilavas(traprvrt) 162V3 ^ 165V6 \
p(nah hrdayopanibaddha)cetasah vaidryamayl (stri snehapariprnavaidryabhjana)c(i)t utpadyat(e) sn(e)h(abhjanesu vajrsanni tesv dityamandal)ni 167V4 ^
165V2 ^ 166R3 ^ 169R3 ^ 170R3; amrtarasam ivendryudhavarn stri nirmalena
bhjanena grhitv 147V3; stri anamtapa(r)yamtm darsam grhitvaikaikasya satvasygratah tis(thati) 158V1; mrdhno nihsrt
stri ksiradhrbhilL ariram a(vasimcati)
148V1; brahmahrdayesu cavadtavarn (stri)
163R2; (vai)d()ryamayl| stri 143V6 \ mukt-

mayi stri 168V2 \ navanitavarnasamspars


stri 155R4 ^ 156V1; 168V3 (S. 4 2 1 ; 49f.).
*sthavira der lteste"
sthavir(am )namdam mamtrayati 164R3
(S. 176, Anm. 7).
sth {stehen")
tiethati 118V1, 118R2, 126V 4, 127V2, 127V5,
127V6, 129R3, 129R6, 130V4/5, 131R6,
132R5, 133V2, 133V% 133V 5, 133V6, 136V2,
137R2, 145V1, 145V5, 145R5, 149R4, 150V3,
150R5, 155R4, 158V1, 166R5, 168R6; tisthamti 127R6, 130V5,131R3,135V4, 136R2,
146V2, 146R4, 147V2, 149R1, 151R2, 154R2,
159V6, 162V2, 168V3; sthita 150V6.
sthna Stelle"
ksirapravho
mrdhn pravisatil punas tata eva sthnm niJtisrto 147V1 ^
135R5; 15IV 5.
*sthnntara (1) Zwischenraum", (2) Inhalt"
(1): yvad aghanitha sthnmtaram prya
146V2; rpvacarm ca caturdhynopapannm sthnmtarapari. . . 145R6; tebhya
sthnmtarebhya yathoktalakan buddha
133R2; nbhisthn(m)tare ca ratnamayam simhamukham utpadyat(e) 130V2.
(2): rpaskandhasya
mlasthnmtarni
132V 6; hitasukhopas(am)h()r(a)li sth()n(m)taram| 141V1; 141V2; maitrsayasya
apramnapradnasthnmta(ra). . . 145R1;
y (atanasth)nmtarny yatanni C&134R2;
&vsapravsasth()n()nt(a)r(am) 121R2;
133V5;142V3;143R3.
*sthitakya feststehenden Krpers"
sthitakyo (bhavati) 126R5.
*sthitacitta feststehenden Geistes"
sthitacitto bhavati samdhipratil()bht|
126R6.
sthiti Standort"
pravho ni(rgatya)
k(r)amena sthitim. pray(ati) 154R5 ^ 133R4 c* 135R5 ^
147V1 ^ 152V2 ^ 165R4 =* 166R5 ^
117R1; ksiravarsam muncati yena (sthiti)r
pryate 143V1; sthitym ca sarvarasapariprnam 130R3; (sthi)tis ca vrksapariprn
129R4; (sthitir anam)taparyamt yata(na)p(a)riprna drsyate 135V2 \ maitri sthiti(m
prayati) 147V4; n()bhinihsrts ca dev

Wrterverzeichnis

sthitim prya tisthamti 147V2; buddhsrayaih sthiti(h prn) 152V2; sthitis ca yath
dharmnusmrti ayam tu vteesah
sthitis
cryasamghkirna 167B2; ratnamayi ca
sthitir drsyate 165B4; sthityupari (ni)sannnm ca buddhnm 152V6; sthityupari ca
parvat 135V 2; 139B3; 151V 3; s. karunsthiti.
*sthirataratva das Festersein"
daksino bhuh vyudhtufr sthirataratvtl
160V3.
sn reinigen"
(u)ddhara snpaya
satvn iti| (sa tm
sa)tvn uddharati snpayati ca 148R2.
snigdha lig"
suvarnavarnbhi snigdhbhir
dhrbhir
124V4; snigdhasuvarnarasam 146V2; snigdharasa 155B6; 146V1.
sneha l"
(sl)lnu(smrti)prvam hrdayopanibaddhacetasah vaiduryamayl stri snehahpariprnvaidryabhjancittotpadyate(sic) 169R3 ^
165V2 ** 166R3 ^ 167V4 ^ 170R3; nadyah
snehamirh 157V4.
spand flimmern"
khadyotakrimim iva spandamnam jvalitam
vijnnanimi(tta)m 130V 2; spandamnam
prthivim pa(syati| vijnnaskan)dhaparikarma
132V6 ^ 133V1; tr(aidh)tuk(am)
sksmn av^yyabindn iva spandamnam
pa^yati 131R3 (S. 48, Anm. 9).
*sparsyatana , ,Berhrungsbereich''
(avicau) narake tu satspar^yatangnipravarsana 149V1.
*sprstavya Berhrbares"
rpasabdagandharasasprsta(vyadharm)
134R4.
*sprhanisraya ,, Verlangensabhngigkeit"
dhrakah s(am)dh()ra(ka)li utpatti pratisth prajnaptih sprhanisraya^ ca 136R4;
136R6.
sphadika Bergkristall"
suva(r)narpy(a)vaidryasphadikama(ya)
164V 4;
indranilapadmargasphadikavarne
146R3; (spha)d(i)kamayam
sop()n(am)
121R1; sphadikamayaih ktgraih. 127R5 =
127R4 ^ 161R1; sphadikamayair abhraktaib 161V2 = 161R1; sphadikamayo lokah
^rayas ca 127V1 (S. 21, Anm. 4; S. 42).

253

*sphar durchdringen"
pravhoaghanisthaparyamtm krtsnm
prthivi spharati 132R2 =* 120V3 ^ 129R3 **
132R3; = traidhtukam spharitv tistha(ti) 133V2 = 133V1 = 131R3 ^ 133V3;
cchatram ca anam(tam lokam) spharitv
tistha(ti) 150R5 ^ 130V4 \ vrksa udgatah
krtsnam lokam spharitv( tisthati) 151V4;
~ 127V2 ^ 131R6 ** 145V1; sauvarnam
padmam da^adisali spharitv()
tisthati
145V5 \ amkal
disodteah urdhvam
ca spharitv tisthati 136V2 \ buddhapratyekabuddha^rvakh
sarvadigviurdhvam adhas ca spharitv tisthamti
136R2; prabhbhir lokam spharitv t(isthamti) (sc. buddhh) 165R1; dev hrthi
krtsnam gaganam spharitv 152V6 \ (karu)ndhipatirpam
-(kr)tsn(am) gaganam
abhrak(ta iva spha)r(i)tv 148V5 \ dhvaja
krtsnam lokam spharitv 153R2; 137R2\
145R5 (S. 37).
*spharana Durchdringen"
sph(a)rananirodhau 129V2.
sphut aufreien"
sphutita 116R1.
*sphuta voll"
(kt)(g)rait s(phu)t(m) prthivim pa&yati
132V3; ktgr yvat trtiyam dhynam
evam sphutam pa^yati 121R4; evam krtsnam
lokam sphuta(m) pa^yati 124V2.
smrti Achtsamkeit"
smrtisamprajanyasampaddvayam
pratilabhate| tadadhipatirupaml vaidryamay(i) stri
smrtyh 169V1; 127R4;s. npnasmrti.
*smrtinimitta ,,Achtsamkeitssymbol"
patth tadadhirdhni yathoktasmrtinimittni 127V4 ^ 127V5; (tato buddh bhagavamta dityama)nd(a)lesu pravi^amti(| tni
va)jrsanesu tni bhjanesu tni smrtinimittesu smrtinimittam yogcramrdhani
165R2 ^ 166R4; (sm)rtinimittaml snehapariprnavaidrya(bhjanacit stri|) 170R3;
121V2; 126R2; 157 B3.
*smrtyupapattideva durch Achtsamkeit als
Gott erstanden"
i(me s)mrtyupapattidev() ami visuddhideva
154V5 (S. 153, Anm. 4).

2S4

Dieter Schlingloff, Ein buddhistisches iTogalehrbuch

*smrtyupasthna Anwendungsbereich der


Achtsamkeit"
anirkrtadhyyinm smrtyupasthnnirvedhabhgiya&(r)manyaphalni
(u)tpadyamte 128R3;
balavaisradyvenikasmrty upasthnamahkarundhi (patir )pni drsyamte
(traynm aveniknm smrtyupasth)nanm
grhitatailaptryudhs
trayah p(urush) 162V13; ^ (a)v(e)n(i)kn()m s(m)rtyupasth()nn(m) tr(a)y(a)
tr(a)yah(sic) puru grhltyudhs tailabhjanahasta drsya(nt)e 165V5; sm(rtyupasthn)dmm bodhipaksynm dar&anam utpadyate| tatra caturnm smrtyu(pasthnnm
catvarah simhhi)
^pit(a)v(a)rns tatsadrs(s catvro buddhh) simhandena krtsnam
lokam pr(ayamt)i 166V4; 139V5.
sragdman Guirlande"
(ma)ndalaih sragdmabhir iva 125V2.
sraj Kranz"
149R5.
sru zerflieen"
sarvasatva
sravamto drgyamte 135R5.
*srutasra entwertet"
cchidram durbalam srutsram ca sarvajagat 136V5.
srotas Krperffnung"
sarvasrotobhya^ csyk^anibhh patt nihs(r)th 148R5 c*130V5; sar(vasr)otobhyah nilavar(n) (n)il(mkuraparivar mana)y(a) utpadyamte 145R2; sarvasrotobhys ca suvarnabhni candramandalni
nirgacchamti 153R5; sarvasrotobhya^ csya dvrany
apvryamte 143R6; sarvasrotobhyah buddhapratyekabuddha&rvakh 136R1; (sarvasrot)o(bh)ya^ ca tadvarn buddh^r(a)y
122V4; buddhnm sarvasroto(bhyo ratnavrk)s()h nirgacchamti 152R1; sarvasrotobhir vyun pravisato 118V2; sarvasrotobhis tailena pravi^at iti 118V3; 135R1;
135R2 (S. 35).
srotas Flieen"
prtimoksasamvarvijnaptipunyasrotasah
adhipatirpam 169V3.
svaj umschlingen"
bhubhym (krtsnam satvasam)udr(am)
sv(a)ja(m)n 163V1.

svaj an man die eigene Existenz"


svajan(m)avin&am 161V4.
svatantra unabhngig"
134V4.
svap schlafen"
sukham svapiti sukham pratibudhyate suptam enam devat raksamti 147V5.
svapna Traumgesicht"
na ca p(pakam svapnam pasyati) 147V5.
*svabalagocara Wirkungsbereich der eigenen Kraft"
s. yathsvabalagocara.
svabhva Wesen"
atha kimsva(bhv karun) ( = mudit,
= upek^) 147R2 = 153V2 = 155V6;
(kmvacar catuh)skandhasvabhv| rupvacara pamcaskandhasvabhv (sc. mudit,
= karun) 153V3 - 147R3 (S. 117, Anm. 5).
*svayamavabodha , elbsterleuchtung"
(sva)yamavabodhdhipatyasampad yath
pratyekajinnm 143V3.
svara Worte"
bhagavm
dhiragambhirodrena ca
svarena dharmam desayati 149V4.
svavisaya das eigene Objekt"
s. yathsvavisaya.
svasarira der eigene Leib"
161V6.
*svkhyta wohlverkndet"
(svkhyto bhagavato dharmati) 165R5.
svsraya eigene Gestalt"
s. &raya.
svstirna gut ausgelegt"
svsvlrnaparyamkas(sic) 143R4.
sveda Schwei"
gtrasvedo jyate 149R5.
hamsaratha Schwanenwagen"
hamsarathdhirudhab brahm 150R6 ~
152V2.
han erschlagen"
ght(i)ts 158V 4.
hasta Hand"
samjtakarunyasya haste vajra utpadyate
150V5 \ sam(jtak)runyasya ca daksine haste
&astram utpadya(te) 150R5; sa(m)kalh pradipatamtukalpobhayahast 136V1;
pradlpahast ca stri 160R4; brahmai^-

Wrterverzeichnis

karakahastaiti. 148R2/3; purus


tailabhjanahasta 165V6; hastesu grhitaratnopakaran purus 170R5 ;ca ndramandalahas(t)o
157V 2 \ (ha)st()bhym satvkhyms csatvkhymss ca tulayati 160E2 ^ 160V5;
(u)bh(a)yah(a)st(ngu)linihsrtbhih
(sa)l(i)ladhrbhir 148R1; brahmahastmgulibhyas ca varsam patati 148R3/4; 119R4;
162R6.
hastin Elefant"
(balnm (sc. adhipatirpam) raviman)dalacit dasa hastinah tadvarn tadadhirdh
ravimandalacith eva dasa buddhapratimh
162V1; (pamcnm balnm) pamca vajrarnay hastin(ah) 166V6.
hna Aufgeben"
165V1.
hita Heil"
hitasukhopasamhra 141V2, 141V1, 140V1;
priyahitasukhopade(s)e 142V4; hitasukh()numodan^ayamanasikro 153V2; sarvasatvahitdhy^ayapravrtta 145V6, 140V3.
himbhra Schneewolke"
himbhra. . . . krtsnam lokam (pa^yati)
131V6 (S. 94, Anm. 2).
hrdaya Herz"
hrdaye stri
utpadyate 148V4 c* 151V6
^153B3 ** 162V3 c* 165V6 \ c* (kar)u(ndhipa)tirupam csya
hrdaya u(tpadyate)
162R6; (karu)ndhipatirpam hrdayn nirgatah 148V5 \ hrdayasth karu(n) 148R1;
hrdaye ca|ksirapuskirini 147V2; hr(daye pad)mmi prdur bhavati 153V5 \ maitrgayasya
hr(day)dvram apvryate 143R6 ^ 141R4;
hrdayc csya sauvarno dhvaya utpadyate

255

153R2; hrdayc csya pravho ni(rgatya)


(a)dh(a)s c(or)dhv(am) c(a) gatv 154R4;
hrday()c cordhvam 169V6 \ hrdayt prav(hah) 167R2\ hrdaye csydityamandalam
169V1; bhagavatak hrdaye ratnamayah sim(ha) 162V5; brahmahrdayeu 163R2; 118R1;
118R3; 119V 3; 124R4; 140R2; 142V 2;
170V1 (S. 35; 50).
*hrdayopanibaddhacetas der sein Denken
auf das Herz konzentriert"
dharmnusmrtip(r)v(am
hrdayopanibaddhacetaso) 166R2; (hrdayopanibaddha)cetasab (sc. samghnusmrtiprvam) 167V4 \. (^Jnusmr)tiprvam hrdayopanibaddhacetasah
167R4 = 169V5 = 169R3; deva(tnusm)r(tiprvam hrdayopanibaddhacetasah) 170R2.
hrsta frohlockend"
dev hrth
puparatnavarsm utsrjamti 152V6.
hetu (1) Grund", (2) um. . . willen"
(1): hetupratyaydhinam 161V1; (2): upasamhraheto 161V6.
hrada Teich"
(taila)hradanimagnam ctmnam 118V3 ^
118V4.
*hrasvat Kurzsein [des Atems]"
hrasvatym 118V1, 118V2:
hri Scham"
tato (hriava)trpyadhipatirpam utpadyate
a(vad)tavastraprvrt stri purusas ca hri
klegebhyo lajjati avatrpyam ducaritebhyah hri duscaritebhyak ava(trpya)m (du)^(c)aritaphal(t)| d(r)t(v) csya par hri
utpadyate | 159V1-2.

VERZEICHNIS DER ABKRZUNGEN


UND DER IN DEN ANMERKUNGEN ZITIERTEN LITERATUR

A. = Anguttara-Nikya, 5 Bde., Pali Text Society, London 18851900.


Av. = Avadna-ataka, ed. by J. S. SPEYER, Bibliotheca Buddhica III, St.-Petersbourg 1907.
AbhdhK. = Abhidharmakosa, traduit et annote par L. DE LA VALLEE POTTSSIN, Paris 192331.
AbhdhKVy. = Abhidharmakosavykhy by Yasomitra, ed. by U. WOGIHABA, Tokyo 1932-36.
AbhdhS. = Abhidharmasamuecaya, ed. by PRALHAD PEADHAN, Santiniketan 1950.
BAILEY, D. R. SHACKLETON: The Satapancsatka of Mtrceta, Cambridge 1951.
BAILEY, H. W.: Khotanese Texts V, Cambridge 1963.
BASTIAN, A. : Die graphische Darstellung des buddhistischen

Weltsystems (Verhandlungen der Berliner anthropologischen Gesellschaft, Sitzung vom 21. 4. 1894, S. 203213), Berlin.
Bcv. = Bodhicaryvatra, s. Bcvp.
Bcvp. = Bodhicaryvatrapancik, Prajnkaramati's Commentary to the Bodhicaryvatra of Qntideva, ed. by L. DE LA VALLEE POTTSSIN, Bibliotheca Indica, Calcutta 1901.
BEAL, S.: A Catena of Buddhist Scriptures from the Chinese, London 1871.
BECHERT, H.: Bruchstcke buddhistischer Verssammlungen aus zentralasiatischen Sanskrithandschriften I. Die Anavataptagth und die Sthaviragth. Sanskrittexte aus den Turfanfunden VI,
Berlin 1961.
Ders.: ber eine abweichende Regelung des vokalischen Sandhi im Sanskrit (Mnchener Studien zur
Sprachwissenschaft, Heft 9, S. 59-65) Mnchen 1956.
BECKH, H.: Buddhismus (Buddha und seine Lehre), 2 Bde. (Gschen), 3. A. Leipzig 1928.
BERNHARD, F . : Udnavarga. Sanskrittexte aus den Turfanfunden X, Gttingen 1964.
BHSD = Buddhist Hybrid Sanskrit Dictionary, by F. EDGERTON, New Haven 1953.
BHSG = Buddhist Hybrid Sanskrit Grammar, by F. EDGERTON, New Haven 1953.
BURNOTJF, E.: Introduction l'histoire du Buddhisme Indien, Paris 1844.
CPD = A Critical Pli Dictionary, begun by V. TRENCKNER, ed. by D. ANDERSEN, H. SMITH and
H. HENDRIKSEN, Vol. I, 1924-48.

CPS = Catusparisatstra, s. WALDSCHMIDT, E.

D. = Digha-Nikya, 3 Bde., Pli Text Society, London 1947-49.


Daso. = Dasottarastra, s. MITTAL, K.
DEMIEVILLE, P.: La Yogcrabhmi de Sangharaksa (Bulletin de FEcole Francaise de TExtremeOrient, XLIV, 2, S. 340-436, Hanoi 1954).
Dhs. = The Dharma-samgraha, ed. by F. MAX MLLER and H. WENZEL, Oxford 1885.
Divy. = The Divyvadna, ed. by E. B. COWELL and R. A. NEIL, Cambridge 1886.
DUTT, N.: Gilgit Manuscripts, Vol. I l l , Calcutta 1943-1950.
ELIADE, M.: Schamanismus und archaische Ekstasetechnik, Zrich und Stuttgart 1957.
Ders.: Yoga. Unsterblichkeit und Freiheit, Zrich und Stuttgart 1960.
ERKES, E.: Geschichte Chinas von den Anfngen bis zum Eindringen des auslndischen Kapitals,
Berlin 1957.
FR AU WALLNER, E.: Geschichte der indischen Philosophie, I. Band, Salzburg 1953.
GLASENAPP, H. von: Das Gleichnis in der Vednta-Philosophie (Studia Indologica, Festschrift KIRFEL,
Bonn 1955, S. 87-100).
GONDA, J.: Remarks on Similes in Sanskrit Literature. Wageningen 1939.
GRASSMANN, H.: Wrterbuch zum Rig-Veda, 3. A. Wiesbaden 1955.
GRNWEDEL, A.: Altbuddhistische Kultsttten in Chinesisch-Turkistan, Berlin 1912.
Ders.: Bericht ber archaeologische Arbeiten in Idykutschari und Umgebung, Abh. d. k. bayr. Akad.
d. Wiss., Mnchen 1906.
HRTEL, H.: Karmavcan. Formulare fr den Gebrauch im buddhistischen Gemeindeleben. Sanskrittexte aus den Turfanfunden III, Berlin 1956.

Abkrzungs- und Literaturverzeichnis


HAUEB, J. W.: Der Yoga, Ein indischer Weg zum Selbst, 2. Aufl., Stuttgart 1958.
HATJSCHZLD, R.: Die vetsVatara-Upanisad. Abh. f. d. Kunde des Morgenlandes XVII,

257
3. Leipzig

1927.
R.: Manuscript Remains of Buddhist Literature found in Eastern Turkestan. Ed. in Conjunction with other Scholars, Oxford 1916.
HUBEB, E.: ]tudes bouddhiques (Bulletin de l'Ecole Francaise d'Extrme-Orient XIV, S. 919,
Hanoi 1914).
J. = The Jtaka, ed. by V. FAUSB0LL, 7. Bde., London 1877-1897.
Karmav. = Mahkarmavibhahga et Karmavibhangopadesa, ed. par SYLVAIN LEVI, Paris 1932.
Khot. = Khotanese Texts, s. BAILEY, H. W.
KIRFEL, W.: Die Kosmographie der Inder nach den Quellen dargestellt, Bonn u. Leipzig 1920.
Ders.: Symbolik des Buddhismus, Stuttgart 1959.
Ders.: Vgbhata's Astngahrdayasamhita, ein altindisches Lehrbuch der Heilkunde. bers, von
L. HILGENBEBG und W. KIBFEL. Leiden 1941.
Lahk. = Lahkvatra-stra, ed. B. NANJIO, Kyoto 1923.
LA VALLEE Poussra, L. D E : Bouddhisme. fitudes et materiaux. Theorie des 12 causes. Gand 1913.
Ders.: Vednta and Buddhism (Journal of the Royal Asiatic Society 1910, S. 135ff.).
LE COQ, A. VON: Die Buddhistische Sptantike in Mittelasien, Teil IV, Berlin 1924.
LUDERS, H.: Bruchstcke buddhistischer Dramen. Kleinere Sanskrit-Texte, Heft I, Leipzig 1911.
Ders.: Bruchstcke der Kalpanmanditik des Kumralta. Kleinere Sanskrit-Texte, Heft II, Leipzig
1926.
Ders.: Das ^riputraprakarana, ein Drama des AsVaghosa (SBAW, 1911, S. 388411 = Phil. Ind.,
S. 190-213).
Ders.: Die Pranidhi-Bilder im neunten Tempel von Bzklik (SBAW, 1913, S. 864-884 = Phil. Ind.,
S. 255-274).
Ders.: Epigraphische Beitrge. I I I . Das vierte Sulen-Edikt des Asoka (SBAW, 1913, S. 988-1028 =
Ph. Ind., S. 274-312).
Ders.: Medizinische Sanskrittexte aus Turkestan (Festgabe GARBE, 1927, S. 148162 = Phil. Ind.,
S. 579-591).
Ders.: Ktantra und Kaumralta (SBAW, 1930, S. 482-538 = Phil. Ind., S. 659-721).
Ders.: Das Zeichen fr 70 in den Inschriften von Mathur aus der Saka- und Kusana-Zeit (Acta Orientalia 10, 1931, S. 118-125 = Phil. Ind., S. 721-726).
Ders.: Bhrhut und die Buddhistische Literatur. Abh. fr die Kunde des Morgenlandes XXVI, 3,
Leipzig 1941.
Ders.: DasSanmaka (Zeitschrift der Deutschen Morgenlndischen Gesellschaft 92, 1938, S. 1527).
Ders.: Textilien im alten Turkestan. Abh. d. Preuss. Ak. d. Wiss., phil.-hist. Kl. Nr. 3, Berlin 1936.
LV. = Lalitavistara, herausgegeben von S. LEFMANN, 2 Bde. Halle 19021908.
M. = Majjhima-Nikya, 3 Bde., Pli Text Society, London 1948-1951.
MAV = Mahvadnastra, s. WALDSCHMIDT, E.
Mil. = The Milindapaiiho, being dialogues between King Milinda and the Buddhist Sage Ngasena.
The Pli Text ed. by V. Trenckner. London 1928.
MITTAL, K.: Fragmente des Dasottarastra. Sanskrittexte aus den Turfanfunden IV, Berlin 1957.
HOEBNLE,

MPS = Mahparinirvnastra, s. WALDSCHMIDT, E.


MLLEB, F. W. K.: ber den Ausdruck Klastra.

(Ethnologisches Notizblatt 1, Heft 3, S. 22f.).


Mus, P.: La Lumiere sur les Six Voies, Paris 1939.
Mv. = Mahvastu, publ. E. SENABT, 3 Bde, Paris 1882-1897.
Mvy. = Mahvyutpatti, ed. R. SAKAKI, Kyoto 1925.
NYANATILOKA : Visuddhi-Magga, oder der Weg zur Reinheit, bers. Konstanz 1952.
NYANAPONIKA: Satipatthna, Der Heilsweg buddhistischer Geistesschulung. Konstanz 1950.
P., p. = Pli.
Phil. Ind. = Philologica Indica, Ausgewhlte kleine Schriften von HEINBICH LDEBS. Gttingen 1940.
PTSD = The Pali Text Society's Pali-English Dictionary, ed. by T. W. RHYS DAVIDS and W. STEDE,
London o. Jahr.
POZDNEJEV, M. A.: Dhyna und Samdhi im Mongolischen Lamaismus. Untersuchungen zur Geschichte
des Buddhismus XXIII, Hannover 1927.
pw = Sanskrit-Wrterbuch in krzerer Fassung, bearb. von OTTO BHTLINGE:. St. Petersburg 1879
bis 1883.
RAU, W.: Lotusblumen (Asiatica, Festschrift FBIEDBICH WELLEB, Leipzig 1954, S. 505513).
17 Schlingloff, Yogalehrbuch

258

Dieter Schlingloff, Ein buddhistisches Yogalehrbuch

C : Randbemerkungen zur Sprache und Textberlieferung des Krandavyha (Asiatica,


Festschrift FBIEDBICH WELLER, Leipzig 1954, S. 514527).
ROSEN, V.: Der Vinayavibhanga zum Bhiksuprtimoksa der Sarvstivdins. Sanskrittexte aus den
Turfanfunden II, Berlin 1959.
Dies.: Das Sangitistra und sein Kommentar Sangitiparyya. Sanskrittexte aus den Turfanfunden IX,
Berlin 1965 (im Druck).
RUBEN, W.: Schamanismus im alten Indien (Acta Orientalia XVII, S. 164ff.).
S. = Seite, Siehe.
S. = Samyutta-Nikya, 6 Bde, Pli Text Society, London 1884-1904.
S. = Sadgatikriks, in P. Mus, s. dort.
Sl. = Slistambhastra, in LA VALLEE POUSSIN, Bouddhisme, s. d.
Sang. = Sangitistra, s. ROSEN, V.
SCHLINGLOFF, D.: Buddhistische Stotras aus ostturkistanischen Sanskrittexten. Sanskrittexte aus den
Turfanfunden I, Berlin 1955.
Ders.: Dasottarastra IXX. Sanskrittexte aus den Turfanfunden IVa, Berlin 1962.
Ders.: Chandoviciti, Texte zur Sanskritmetrik. Sanskrittexte aus den Turfanfunden V, Berlin 1958.
Ders.: Die Birkenrindenhandschriften der Berliner TurfansamtrJung (Mitteilungen des Institutes fr
Orientforschung IV, 1956, S. 120-127).
Ders.: Yogavidhi (Indo-Iranien Journal VII, 1964, S. 146-155).
Ders.: Die Religion des Buddhismus, 2 Bde. (Gschen), Berlin 1962-63.
SIEG, E.: Neue Bruchstcke der Sanskrit-Grammatik aus Chinesisch-Turkistan (SBAW, 1908, S. 182
bis 206).
Ders.: bersetzungen aus dem Tocharischen II. Abh. d. Deutschen Ak. d. Wiss. zu Berlin, Kl. fr
Sprachen, Literatur und Kunst, 1951 Nr. 1, Berlin 1952.
3iks. = ikssamuccaya, ed. by C. BEND ALL, (Reprint) 'S-Gravenhage 1957.
Sdhp. = Saddharmapundarika-Stram, ed. K E B N U. NANJIO, St. Petersburg 1912. Auch in R. HOEBNLE,
s. dort.
Skt. 3= Sanskrit.
$sP. = atashasrik-prajnpramit, ed. P. GHOSA, Bibliotheca Indica, Calcutta 19021913.
Sukh. = Sukhvatlvyha, ed. M. MLLEB, Oxford 1883.
THOMAS, F. W.: A new Poem of Asvaghosa (Journal of the Royal Asiatic Society, 1914, S. 753ff.).
TBIPATHI, Ch.: Fnfundzwanzig Stras des Nidnasamyukta. Sanskrittexte aus den Turfanfunden
VIII, Berlin 1962.
Uv. = Udnavarga, s. BEBNHABD, F.
Vism. = Visuddhimagga of Buddhaghosacariya, ed. by H. C. WABBEN. Havard Oriental Series, Vol. 41,
Cambridge, Mass. 1950.
VvA. = Vimna-Vatthu Commentary, Pali Text Society, London 1901.
DE VBEESE, K.: Skt. ktgra (India Antiqua. A Volume of Oriental Studies presented by his friends
and pupils to Jean Philippe Vogel, Leiden 1947, S. 323325).
VOGEL, J. P H . : Le Makara dans la sculpture de Finde (Revue des Arts Asiatiques, T. VI, Paris 1930,
S. 133-147).
WACKEBNAGEL, J.: Altindische Grammatik, Band I. II., Gttingen 18961905.
WADDELL, L. A.: The Buddhism of Tibet or Lamaism, London 1895.
WALDSCHMIDT, E.: Bruchstcke des Bhiksuni-Prtimoksa der Sarvstivdins. Kleinere SanskritTexte, Heft III, Leipzig 1926.
Ders.: Bruchstcke buddhistischer Stras aus dem zentralasiatischen Sanskritkanon I. Kleinere Sanskrit-Texte, Heft IV, Leipzig 1932.
Ders.: Das Mahparinirvnastra. (Abh. d. Deutschen Ak. d. Wiss. zu Berlin, Kl. fr Sprachen, Literatur und Kunst), Teil I, Berlin 1950; Teil II, Berlin 1951, Teil III, Berlin 1951.
Ders.: Das Mahvadnastra. (Abh. d. Deutschen Ak. d. Wiss. zu Berlin, Kl. fr Sprachen, Literatur
und Kunst), Teil I, Berlin 1953; Teil II, Berlin 1956.
Ders.: Das Catusparisatstra. (Abh. d. Deutschen Ak. d. Wiss. zu Berlin, Kl. fr Sprachen, Literatur
und Kunst), Teil I, Berlin 1952; Teil II, Berlin 1957; Teil III, Berlin 1961.
Ders.: Zum ersten Buddhistischen Konzil in Rjagrha (Asiatica, Festschrift FBIEDBICH WELLEB,
Leipzig 1954, S. 817-828).
Ders.: Identifizierung einer Handschrift des Nidnasamyukta aus den Turfanfunden (Zeitschrift der
Deutschen Morgenlndischen Gesellschaft 107, 1957, S. 372-401).

REGAMEY,

Abkrzungs- und Literaturverzeichnis

259

Ders.: Stra 25 of the Nidnasamyukta (Bulletin of the School of Oriental and African Studies XX,
1957, S. 569-579).
Ders.: Das Upasenastra, ein Zauber gegen Schlangenbi aus dem Samyuktgama (Nachrichten der
Akademie der Wissenschaften in Gttingen, phil.-hist. KL, 1957, Nr. 2).
Ders.: Ein zweites Dasabalastra (Mitteilungen des Institutes fr Orientforschung VI, Berlin 1958,
S. 382-405).
Ders.: Kleine Brhmi-Schriftrolle (Nachrichten der Akademie der Wissenschaften in Gttingen, phil.hist. Kl., 1959, Nr. 1).
Ders.: Grnwedels Buddhistische Kunst in Indien, Berlin 1932.
Ders.: Wunderttige Mnche in der ostturkistanischen Hinayna-Kunst (Ostasiatische Zeitschrift,
N. F. VI, 1930, S. 2-9).
WELLER, F.: Die Fragmente der Jtakaml in der Turfansammlung der Berliner Akademie. Inst. f.
Orientf., Verffentl. Nr. 24.
Ders.: Zwei zentralasiatische Fragmente des Buddhacarita. Abh. d. Sachs. Ak. d. Wiss. zu Leipzig,
Phil.-hist. KL, Band 46, Heft 4, Berlin 1953.
Ders.: Ein zentralasiatisches Fragment des Saundaranandakvya (Mitteilungen des Institutes fr
Orientforschung I, Berlin 1953, S. 400-423).
WENZEL, H.: Suhrllekha, Brief des Ngrjuna an Knig Udayana, Leipzig 1886.
YS. = Ptanjalam Yogastram| Rjamrttandkhyavrttisahitam| Calcutta o. Jahr.

DEUTSCHE AKADEMIE DER WISSENSCHAFTEN ZU BERLIN


INSTITUT FR ORIENTFORSCHUNG
VERFFENTLICHUNG NR. 62

Sanskrittexte aus den Turfanfunden


herausgegeben im Auftrage der Akademie von Ernst Waldschmidt

Vila

DIETER SCHLINGLOFF

EIN BUDDHISTISCHES
YOGALEHRBUCH
TAFELBAND

AKADEMIE-VERLAG- BERLIN
1966

Faksimilewiedergabe
der
Handschriften
ca. 1j2nat. Gr.

Korrekturen und Verbesserungsvorschlge


zur Textausgabe des Yogalehrbuchs
In diesem Verzeichnis sind diejenigen Druckfehlerkorrekturen und Verbesserungsvorschlge zusammengestellt, die sich ausschlielich in der Textausgabe bei der Auswertung des Yogalehrbuchs fr das Sanskrit-Wrterbuch der buddhistischen Texte aus
den Turfan-Funden (SWTF) ergeben haben.1
Alle Textzitate erscheinen in Kursive, und die von SCHLINGLOFF verwendete
Unterscheidung zwischen Normal- und Fettdruck wird hier nicht bercksichtigt. Lies"
bezeichnet die tatschliche Schreibung der Handschrift in einem erhaltenen Abschnitt
bzw. eine Druckfehlerkorrektur in einer ergnzten Passage.
S. 64

S. 67
S. 71
S. 73
S. 75
S.
S.
S.
S.
S.

77
83
84
92
94

S. 98
S. 99
S. 100
1

Das Fragment X 724 trgt nach dem neuen Numerierungssystem jetzt die
Katalognummer SHT I 786; es konnte inzwischen um ein weiteres Bruchstck
ergnzt werden, s. SHT IX 3091.
Das Fragment 1331 trgt jetzt die Katalognummer SHT IX 2065.
Das Fragment 715a gehrt jetzt zu SHT I 687a.
Abschnitt m(A): Statt des viermal ergnzten vimucya ist nach SHT IX 3091
vimocayams einzusetzen, vgl. dort die Anm. 5.
118R4: Lies tasy()m.
121R3: Lies va)[j](r)[](sanni oder va)[j](r)[](sans (zum Genus von
sana vgl. YL S. 21, Anm. 9).
123V2: Wohl eher nirgatah statt nihsrtah zu ergnzen, vgl. SWTF s.v. nirgata.
Anm. 12: Lies oddhriyamnam.
128V5: Lies (ditya)[man]d(a)[l](o)[p]aristhh (als Kompositum).
128R3: Lies sasambhrlamkr[](ny.
Anm. 9: Eher nildybhis zu lesen, s. SWTF s.v. nildya.
131R3: Lies buddhsray[](m)s.
131R4: Lies [pajdmapravhais (so Hs.).
132V6: Lies spandamnm.
132R6: Lies m[n]eva pradese und ergnze zu (tasmi)m[n] eva pradesel
133V2: Lies v)[]lukcitm (seil prthivim)!

Ich danke Herrn Dr. Michael Schmidt, dem Redaktor des SWTF, dafr, da er mir das der
Wrterbucharbeit zugrunde liegende Exemplar des YL mit den handschriftlichen Notizen zu den Verbesserungsvorschlgen der verschiedenen Wrterbuchmitarbeiter zugnglich gemacht hat.

306

S. 102
S. 107
S. 111
S. 114
S. 121
S. 124

S.
S.
S.
S.
S.
S.
S.

125
126
128
129
130
131
133

S. 135
S. 136

S. 138
S. 140
S. 141
S. 145
S. 146
S. 147
S. 151

S. 153
S. 154
S. 159

Korrekturen und Verbesserungsvorschlge

133R5: Lies pratyaveksan0.


134V4: Lies arupinah im Text und arupinah in Anm. 10.
135R1: Lies prasrvapravhh (so auch Ms.).
135R4: Lies rp(vaca)[r]ms.
136R3: Lies pratisthitotpatti6kramabhedt und vgl. die Bemerkung im SWTF
s.v. utpatti,
139V3: Lies r[p](ni).
142R4: Lies darnstryrn.
144V1: Lies [s](ar)[v](asatvs ca.
144V1: Hs. samkucita0.
Anm. 3: Lies damda oder damdni."
144R2: Lies abhidravamte.
145V1: Lies utksipte.
145R2: Lies dhranc.
145R5: Lies saha sitanarakais und vgl. unten zu S. 138.
146V4: Lies avitargnm.
146R2: Lies sahasrracakram.
147V5: Lies suptam.
Zum ganzen Abschnitt 12 vgl. den Hinweis von D. SCHLINGLOFF auf die
Parallele in SHT I 620 und im Anguttaranikaya, s. SHT IV, S. 339.
147R3: Lies rpvacar in der Ergnzung.
148V2: das Neutrum duhkha lt annehmen, da duhkhm hier als Hinterglied eines Bahuvrihi zu verstehen ist und die Ergnzung daher anders lauten
mte.
148R5: Lies saha sitanarakai und vgl. oben zu S. 129.
149R3: Lies cyavananimittaih.
149R6: Lies und ergnze zu devo ddh(r)tim n(a) [l](abhate), s. SWTF s.v.
[ud-dhati.
151R6: Lies sarnks.
152V2: Lies srayaih ... dr)[sya]te.
152V6/R1: Lies (ni)sannnm.
152R2: Lies pusp[n]i.
153V6: Lies krtsn(yrn.
153R3: Lies 'sya s(uva)rnbh.
153R4: Lies [d](r)[s](tv).
154V5: Lies (sam)[vr]tyupapatti.
154R1: Lies ami.
157V2: Das Manuskript hat pratikllmbanbh.
Anm. 6: Lies (rpnm.

Korrekturen und Verbesserungsvorschlge

S. 165
S.
S.
S.
S.

166
172
177
178

S. 179
S. 180
S. 181

S.
S.
S.
S.
S.

182
184
185
187
188

307

159R6: Wohl eher zu (dvdasmgh pratitya0 zu ergnzen, s. SWTF s.v.


dvdasnga.
160R3: Lies sarvni.
162R3/4: Zu (dau)vrikena s. SWTF s.v. dauvrika.
165V4: Lies adhipatirpam \).
165V5: Lies )v(e)n(i)kn()m.
165R1: Lies lokarn.
165R2: tad[sr](ayam) besser als Kompositum (tad-sraya) zu verstehen?
Anm. 14: Eher wohl zu mrdhnas zu korrigieren.
165R3: Lies saha nbhi.
166V2/3: Lies (asu)bhdiprayogena, s. SWTF s.v.
166V5: Lies indri[y](nm.
166R3: Bei ta)[d](bh)jana mit Anm. 5 und dem in R4 ergnzten bhjanh
ist wohl in beiden Fllen besser von einem Neutrum auszugehen und daher im
ersten Fall zu ta)[d](bh)jana<m> mit einem folgenden Singular zu verbessern und an der zweiten Stelle bhjanni zu ergnzen.
167V4: Lies pu(nar.
167R5/6: Eher wohl zu r(m)m zu ergnzen, vgl. SWTF s.v.
168V1: Lies srestham.
169R2: Lies adhaurdhvas[th]am, s. SWTF s.v. adha-urdhva-stha.
169R5: Lies (vimu)khibhavamti (hnlich in 170V1 und V2).
170V4: Lies romakpadarsanavidhih.

Neue Fragmente aus dem Yogalehrbuch4


Jens-Uwe Hartmann

Als zu Ende des letzten und in den ersten beiden Jahrzehnten unseres Jahrhunderts umfangreiche Funde buddhistischer Sanskrit-Handschriften aus den Oasen an der Seidenstrae nach Europa gelangten, lste dies eine Woge des Interesses unter den Fachgelehrten aus. Die Bearbeiter stieen zu ihrer berraschung auf buddhistische Werke, von
denen manche, wie etwa Asvaghosas Dramen, bis zu diesem Zeitpunkt vllig unbekannt
gewesen waren; andere, wie etwa die kanonischen Schriften der Sarvstivdins, waren
zwar wenigstens ihrem Namen nach und teils sogar aus bersetzungen bekannt, aber ihr
Sanskrit-Original hatte als unwiederbringlich verloren gegolten. Bei wieder anderen
Werken, etwa dem Saddharmapundarlkastra, kannte man bereits eine Sanskrit-Fassung,
stellte aber nun fest, da in Zentralasien eigenstndige Rezensionen berliefert worden
waren. Obwohl die Funde also von erheblicher Bedeutung fr die Erschlieung der
buddhistischen Literatur und fr das Verstndnis von deren berlieferung waren,
erlahmte das anfngliche Interesse vielfach. Dies wird leichter verstndlich, wenn man
den Zustand der Handschriften bedenkt; whrend man bis zu diesem Zeitpunkt gewohnt
war, mit zumeist vollstndigen Handschriften etwa aus Nepal zu arbeiten, bestanden die
zentralasiatischen Manuskripte hingegen berwiegend aus Fragmenten, die es nur in den
seltensten Fllen erlaubten, einen Text annhernd vollstndig zu rekonstruieren.
In den meisten Sammlungen kamen die Editions- und Katalogisierungsarbeiten daher
mehr oder minder rasch zu einem weitgehenden Stillstand. Lediglich der Berliner
Sammlung war ein gnstigeres Geschick beschieden, denn sie hatte in Ernst WALDSCHMIDT einen Gelehrten gefunden, der die notwendige Ausdauer und Beharrlichkeit fr
eine dauerhafte Arbeit an den Fragmenten besa und lebenslang dafr Sorge trug, da
auch nach dem Ende der ersten Euphorie die Sammlung weiter erschlossen wurde und
da beginnend mit seiner eigenen Dissertation1 kontinuierlich Handschriften in
philologisch einwandfreier Form verffentlicht und damit zugnglich gemacht wurden,
sei es von ihm selbst oder aber von seinen Schlern.
Unter diesen Schlern ist es vor allem Dieter SCHLINGLOFF gewesen, der sich mit
hnlichem Interesse den Berliner Handschriften zuwandte und sich durch seine Editionen unterschiedlichster buddhistischer Werke aus Zentralasien einen Namen gemacht
Dieser Aufsatz erschien ursprnglich in Festschrift, Dieter Schlingloff zur Vollendung des 65.
Lebensjahres dargebracht von Schlern, Freunden und Kollegen, ed. Friedrich Wilhelm, Reinbek 1996,

S. 127-135.
1

Publiziert als Bruchstcke des Bhiksunl-Prtimoksa der Sarvstivdins, Leipzig 1926 (Kleinere
Sanskrit-Texte, 3), nachgedr. Wiesbaden 1979 (Monographien zur Indischen Archologie, Kunst und
Philologie, 2).

310

Jens-Uwe Hartmann

hat. Als sicherlich eindrucksvollste unter seinen Bearbeitungen verdanken wir ihm die
Rekonstruktion eines Werkes, dessen eigentlicher Titel nicht erhalten ist und dem er
daher aus inhaltlichen Grnden den provisorischen Titel Yogalehrbuch" gegeben hat.2
Es war ihm dabei gelungen, eine aufgrund der Sprdigkeit des Materials in zahllose
Bruchstcke zerfallene Birkenrinden-Handschrift mit bewunderungswrdiger Geduld
und Akribie soweit zu ordnen und wieder zusammenzusetzen, da sich der Inhalt der
Handschrift erschlieen lie. Es ergab sich, da die Handschrift ursprnglich etwas
mehr als 170 Bltter umfat haben mute und zwei inhaltlich ganz verschiedene Werke
enthielt. Das erste reichte bis etwa zu Blatt 114 und lie sich aufgrund erhaltener
Kolophone als ein Text mit dem Titel Yogavidhi bestimmen, in dem in Stra-Form
gegebene Lehrstze kommentiert werden.3 Dieser sehr schwierige Text harrt noch einer
endgltigen Bearbeitung; bisher sind lediglich einige Textproben verffentlicht worden.4 Die Fragmente aus dem zweiten Werk konnte SCHLINGLFF mit geradezu detektivischem Sprsinn5 so zusammensetzen, da sich ber weite Strecken sogar ein mehr
oder minder zusammenhngender Text herstellen lie; insgesamt ist knapp die Hlfte
des Werkes erhalten.
Im Gegensatz zum ersten Teil der Handschrift enthlt dieser Text praktische Meditationsanleitungen; es wird beschrieben, wie der bende (yogin oder yogcr) bestimmte abstrakte buddhistische Lehrinhalte im Rahmen seiner Meditation in konkrete
Visualisationen umsetzen soll. Insgesamt werden fnfzehn Meditationsgegenstnde
behandelt. Sie beginnen mit der Meditation ber das Widerwrtige (asubh), gefolgt
von der bung der Atmungsachtsamkeit (npnasmrti). Daran schlieen sich die
Elemente (dhtu), Gruppen (skandha) und Grundlagen (yatana) sowie das Entstehen
in Abhngigkeit (pratityasamutpda) an. Es folgen die Gruppe der vier Unermelichkeiten {apramn), nmlich Gte (maitn), Mitleid (karun), Mitfreude (mudita) und
Gleichmut (upeks), und schlielich noch die fnf Objekte der Vergegenwrtigung
{anusmrti), nmlich der Buddha, die Lehre (dharrna), die Gemeinde (sangha), die
Sittlichkeit (sila) und die Gottheiten (devat).6
Obwohl bestimmte Fehler darauf hindeuten, da das Manuskript mit einiger Wahrscheinlichkeit von einer lteren indischen Vorlage in Gupta-Schrift abgeschrieben
worden ist,7 konnten auerhalb des Tarim-Beckens keine Parallelhandschriften aufgefunden werden; da auch keine bersetzungen des Werkes ins Chinesische oder Tibetische existieren, ist es bislang einzig aus Zentralasien bekannt. Dort allerdings mu man
ihm eine gewisse Bedeutung beigemessen haben, denn es handelt sich bei der Birkenrindenhandschrift keineswegs um einen Codex unicus. Schon SCHLINGLFF hatte fr
seine Ausgabe weitere fnf Fragmente aus insgesamt drei Papierhandschriften der

Dieter SCHLINGLFF, Ein buddhistisches Yogalehrbuch, Textband, Berlin 1964, Tafelband, Berlin
1966 (Sanskrittexte aus den Turfanfunden, 7 und 7a).
3
Vgl. YL, S. 12.
4
Dieter SCHLINGLOFF, Yogavidhi", Indo-Iranian Journal 7 (1964), S. 146-155.
5
Vgl. YL, S. ll,Anm. 2.
6
Zur Zusammenstellung dieser fnfzehn Punkte s. auch SeyR, Rez.YL, S. 157 ff.
7
Vgl. YL, S. 13.

Neue Fragmente aus dem Yogalehrbuch'4

311

deutschen Turfan-Sammlung8 heranziehen knnen, und inzwischen hat sich gezeigt, da


auch die Sammlungen in London und Paris Fragmente aus wenigstens jeweils einer
Handschrift desselben oder eines ganz eng verwandten Textes besitzen.
Soweit feststellbar, stammen die Handschriften berwiegend aus dem Bereich von
Kuc: die Katalognummern 150, 164a und 183a der deutschen Sammlung wurden
allesamt in Qizil gefunden. Zu den Fragmenten der Sammlung Pelliot (No. rouge 9.1-6)
ist auf kleinen Zettelchen als Fundortbezeichnung DA fr Duldur-aqur vermerkt; mithin
kommen sie ebenso aus dem Gebiet von Kuc. Der Herkunftsort der beiden Fragmente
aus der Londoner Sammlung lt sich zwar nicht nher bestimmen, aber die Fundumstnde anderer Bruchstcke aus derselben Sammlung weisen, soweit sie bekannt
sind, gleichfalls nach Kuc.9 Lediglich die Katalognummer 407a der Berliner Sammlung wurde in dem weiter stlich gelegenen Sorcuq gefunden.
Dieter SCHLINGLOFF hatte bereits darauf hingewiesen, da die Mehrheit der Handschriften somit aus einem Zentrum der Sarvstivda-Schule stammt und da das Werk
in seinen dogmatischen und mythologischen Grundlagen, wie zu erwarten, den Lehren
dieser Schule entspricht.10 Dennoch hatte er schon einen der besonders interessanten
Aspekte dieses Werkes herausgestellt, da nmlich an einigen Stellen bereits eine
Annherung an das Bodhisattva-Ideal des Mahyna zu beobachten ist, so etwa bei der
im Yogalehrbuch" zum Ausdruck kommenden Nirvna-Vorstellung (YL S. 169-172).
Im Rahmen der Meditation ber den Gleichmut (upeks) sieht der bende, wie der
Buddha in die Stadt des Nirvna" eintritt und dort einer Lampe gleich zum Verlschen
kommt; dies entspricht genau dem bekannten Bild aus dem Mahparinirvnastra, wo
die Erlsung (virnoksa) mit dem Erlschen einer Lampe (pradyotasyeva nirvnam)
verglichen wird.11 Der Vorgang ist irreversibel, denn ein Torwchter (dauvrika)
erklrt, da keiner, der die Stadt betreten hat, je wieder hinausgeht {iha nagare yah
pravisto na bhyo nirgacchatiti, YL 161 R5-6). Der bende selbst hingegen wird bei
dem Versuch, in dieselbe Sttte einzugehen, von dem Torwchter daran gehindert. In
seinem Herzen entsteht eine weibliche Gestalt,12 die das Groe Mitleid (mahkarun)
verkrpert und ihn fragt, wohin er zu gehen wnscht, nachdem er die leidende Welt
aufgegeben hat. Daraufhin berkommt ihn Mitleid, und er verzichtet offensichtlich
darauf, in die Sttte des Verlschens einzugehen;13 leider ist hier der Text nur sehr
fragmentarisch erhalten.14

SHT I 164a, 183a und 407a.

Vgl. HARTMANN/WILLE, S. 18 f.

10

YL, S. 10; vgl. auch Lambert SCHMITHAUSEN, Zu den Rezensionen des Udnavargah", Wiener
Zeitschrift fir die Kunde Sdasiens 14 (1970), S. 112, Anm. 257.
11
Vgl. Das Mahparinirvnastra, ed. E. WALDSCHMIDT, Teil III, Berlin 1951 (Abhandlungen der
Deutschen Akademie der Wissenschaften zu Berlin, Jahrg. 1950, Nr. 3), S. 400.
12
Es ist hervorzuheben, da in diesem Text durch den in der Regel wohl mnnlichen und vermutlich
oft dem Mnchsorden angehrenden Yogin immer wieder Frauen als Verkrperungen positiver Abstrakta
visualisiert werden (vgl. YL, S. 36 und bes. S. 49f.); dies verdiente, in den heute so populren Untersuchungen zum Bild der Frau im Buddhismus entwicklungsgeschichtlich mitbercksichtigt zu werden.
13
YL, S. 55.
14
Zu diesem Abschnitt und zu weiteren Mahyna-Einflssen s. auch SeyR, Rez.YL, S. 160-162.

312

Jens-Uwe Hartmann

Sieht man einmal von dem langen und sehr gehaltvollen Besprechungsaufsatz David
ab, dann hat das Yogalehrbuch" bisher nicht die Beachtung gefunden, die dieses singulre Werk verdient, und daher versteht sich der vorliegende Beitrag
auch als ein Versuch, die Aufmerksamkeit wieder einmal auf diesen Text zu lenken.
Nach dem Erscheinen des Yogalehrbuches" konnten, wie bereits erwhnt, sowohl in
London als auch in Paris weitere Fragmente diesem oder einem sehr hnlichen Werk
zugeordnet werden. In Paris war es wohl Bernard Pauly, der zu den insgesamt sieben
unter der Signatur Pelliot Sanskrit no. rouge 9.1-6 zusammengefaten Fragmenten einer
Handschrift vermerkte: Voir: Schlingloff (D.). Ein Buddhistisches Yogalehrbuch."15
Offenbar hatte schon er vergeblich versucht, anhand von SCHLlNGLOFFs Edition eine
genauere Bestimmung der Fragmente vorzunehmen, so da er sich auf den allgemeinen
Hinweis beschrnkte. Zwar zeigt der in den Fragmenten bewahrte Text (darunter ein aus
zwei Teilen zusammensetzbares fast vollstndiges Blatt) immer wieder wrtliche
bereinstimmungen mit dem Text des Yogalehrbuches", aber diese Entsprechungen
erlauben es an keiner Stelle, eines der Fragmente endgltig einzuordnen. Am deutlichsten zeigt sich dies bei Fragment 9.2: die Zeilen 1-3 der Vorderseite stimmen mit YL
118 R2-5 berein, whrend die Zeilen 5 und 6 der Rckseite ihre Entsprechung in einer
viel spteren Stelle, nmlich YL 121 R4-5, besitzen. Es hat daher den Anschein, da
die Pariser Fragmente einem Werk entstammen, das dem Yogalehrbuch" inhaltlich
zwar sehr nahe steht, aber keineswegs mit ihm identisch ist. Weiterer Aufschlu in
dieser Frage ist von der Edition der Fragmente zu erwarten, die Nobuyoshi YAMABE in
New Haven vorbereitet, und zwar im Rahmen seiner vergleichenden Untersuchung des
Yogalehrbuches" und inhaltlich verwandter Meditationshandbcher, die im 5. Jh. ins
Chinesische bersetzt wurden.
SEYFORT RUEGGS

Auch mit den zwei leider recht kleinen Fragmenten aus der Sammlung Hoernle in
der India Office Library in London verhlt es sich offenbar hnlich. Mit groer Wahrscheinlichkeit gehren beide derselben Handschrift an. Nur das erste der beiden Fragmente lt sich aber genau im Yogalehrbuch" einordnen; es entspricht YL 127 Rl bis
128 V5. Das zweite Bruchstck hingegen stimmt auf der Vorderseite anscheinend genau
mit YL 144 R6 bis 145 V4 berein, whrend die Rckseite, soweit berhaupt einzuordnen, mit YL 146 R5-6 zu verbinden ist. Der Text der entsprechenden Abschnitte des
Yogalehrbuches" ist relativ gut erhalten, so da man diese augenfllige Diskrepanz
zunchst wohl nur als eine mglicherweise verkrzte, auf jeden Fall aber vom Wortlaut
des Yogalehrbuches" etwas abweichende Fassung erklren kann.
Die beiden Fragmente sind nicht umfangreich genug, um einen wesentlichen Textzuwachs zu bieten. Ihr Wert bemit sich jedoch auch darin, da sie erstens bereits belegten Text besttigen und zweitens ein zustzliches Indiz dafr bieten, da das Yogalehrbuch" zumindest in Kuc einige Verbreitung genossen haben mu. Wenngleich man im
allgemeinen gewi vorsichtig sein mu, von der bloen Existenz bestimmter Handschriften Rckschlsse auf die religise Praxis der jeweiligen Besitzer zu ziehen, da

Vgl. auch Taijun INOKUCHI u.a., A Catalogue of the Sanskrit Manuscripts Brought from Central
Asia by Paul Pelliot Preserved in the Bibliotheque Nationale (Preliminary), Kyoto 1989, S. 8f.

Neue Fragmente aus dem Yogalehrbuch"

313

Bcher auch als reine Verehrungsgegenstnde gedient haben knnen, so drfte im Falle
eines nichtkanonischen und derartig auf die Praxis ausgerichteten Werkes wie des
Yogalehrbuches" doch anzunehmen sein, da die Zahl von wenigstens sechs Handschriften dieses Genres eine entsprechende Pflege und Verbreitung der beschriebenen
Meditationsbungen widerspiegelt.
Bei den zwei Londoner Fragmenten fllt auf, da sie hnlich wie auch die im Yogalehrbuch" publizierten Bruchstcke verhltnismig fehlerhaft geschrieben sind:16
vgl. Fragment 1 V2 (nima)jjat<i>, R2 prahn<>nupasya(nyrn), R4 mukt<>cito,
R6 mukt<>cit{t}am tad<u>(pary). Das zweite Hoernle-Fragment lt sich aufgrund
seines geringen Umfangs und seines schlechten Erhaltungszustandes weniger gut
beurteilen, aber auch hier findet sich wenigstens ein Schreiberfehler, nmlich Vb
u<t>ksi(pte).

1) Sammlung Hoernle, Fragment ohne Nummer (Photo 170) 17


yl8

1
2
3
4
5
6

///
///
///
///
///
///

.. gacrsraya candramanda[la] ....///


[jja]ta svsatah prasvsaparigr .. ///
.. ulksahasrni c[ntah]samudre .. ///
[svjsaparigrhltas ca bahih ante ca .. ///
.. pat[t]am badhnti pndaram sam
[c]. ///
[k] . .. raih pariprn d[r]s[y]am .[e] .. da ///
R

1
2
3
4
5
6

///
ti v[i]muktipratisa.[v]
///
///.... [y]. te I prahnanupasya
///
/// .. ryatam eva tarn phenarsim sltala ///
/// .. tatrmtah muktacito yogcr[sra] ///
/// .. bhavati I devs ca krtsnam gaga[n]. ///
/// .. sam pasyati muktacittam tad[] .. .. ///

VI: ergnze und verbessere zu (yo)gcrsraya<s> candramandala(samksah) und vgl.


YL 127 Rl.
V2: ergnze und verbessere zu (antahsamudre nima)jjat<y> oder jjat<i> und zu
parigr(hitam), vgl. YL 127 R2.
V3: vgl. YL 127 R2-3.
16

Vgl. YL, S. 13 ff.

17

Vgl. HARTMANN/WILLE, S. 37, Fragment m.

18
Die Wiedergabe der Fragmente folgt dem fr die Edition von Berliner Handschriften blichen
System: V = Vorderseite, R = Rckseite; ( ) = Ergnzung bei Textlcke; [ ] = Beschdigung und
unsichere Lesung; { } = Tilgung; < > = Ergnzung ohne Textlcke; ein Punkt (.) bezeichnet einen nicht
mehr lesbaren oder nicht mehr erhaltenen Bestandteil eines Aksara, zwei Punkte (..) ein nicht mehr
lesbares Aksara; + bezeichnet ein nicht mehr vorhandenes Aksara und /// zeigt den Abbruch des erhaltenen Textes an.

314

Jens-Uwe Hartmann

V4: ergnze zu (pra)svsaparigrhitas und vgl. YL 127 R3.


V5: ergnze zu sarn(antatas) c(a) und vgl. YL 127 R4.
V6: ergnze zu k(t)(g)raih pariprn drsyam(t)e (\ ta)da(ntargats ca buddh
bhagavantah) und vgl. YL 127 R5.
Rl: ergnze zu (tistham)ti vimuktipratisa(m)v(edanym) und vgl. YL 127 R6.
R2: ergnze zu (jvla)y(am)te7 Vgl. YL 128 VI. Ergnze ferner zu prahn<>nupasya(nym) und vgl. YL 128 VI.
R3: Ergnzung zunchst unklar, da die Zeile weitgehend mit einer Textlcke des YL in
128 V2 zusammenfllt; es ergibt sich jedoch, da im YL die Lcke zwischen
[y]o[g][c][r](srayam) und sitalajala0 grer sein mu als in der Ausgabe
angesetzt. Ist mglicherweise zu (visi)rya(m)tam zu ergnzen? Vgl. YL 125 R6
krtsnam lokam visTryamtam pasyati und unmittelbar vor unserer Stelle YL 128 VI
(lo)kam crnam visiryate. Ergnze dann zu sitala(jalaparisiktam iva) und vgl. YL
128 V2.
R4: lies muktcito und ergnze zu yogcrsra(yah), vgl. YL 128 V3 mit Anm. 4.
R5: ergnze zu gagan(am pryamnh) und vgl. YL 128 V4.
R6: ergnze zu (nimnam prade)sam und lies muktcitam; lies und ergnze ferner zu
tadu(pary), vgl. YL 128 V4-5.
2) Sammlung Hoernle, Fragment ohne Nummer (Photo 178)19
V
20
a /// .. sa[t]v. sr. [y]. + + ///
b /// simcati I uksi .. ///
c /// [s]atvh sannaddh[sr] ///
d /// pranamamti I e .. ///
e /// [s]. yasynantapa .. ///
f /// .. no drsyate .. .. + ///
R
a
b
c
d
e
f

/// [t]. nn. srt[bh]i .. + ///


/// [s]amaye [cit]t[a]m bha[va] ///
/// .. .r. ypramna ///
/// [bh]i[s]ekas ca a[s]. ///
/// rah pravhh k ///
/// .Irap[r]avho .[i] ///

Va: vgl. YL 144 R6 sarvasatvsrayh.


Vb: lies u<t>ksi(pte) und vgl. YL 145 VI tadrasaprnam simcati ut<k>sipte.

19

Vgl. HARTMANNAVILLE, S. 41, Fragment n.

Aufgrund des schlechten Erhaltungszustandes lt sich die Zeilenzahl nicht eindeutig bestimmen.
Wenn die Annahme zutrifft, da beide Fragmente derselben Handschrift entstammen, ist auch hier von
einem sechszeiligen Blatt auszugehen.

Neue Fragmente aus dem Yogalehrbuch"

315

Vc: die Wrter fallen offenbar genau in die Textlcke zwischen YL 145 VI und 2, so
da eine Ergnzung des auf satvh folgenden Wortes unmglich ist.
Vd: vgl. YL 145 V2 maitrvihrinam pranamanti I evam.
Ve: vgl. YL 145 V3 maitrsayasynamtam paryamtam satvasamudrarn.
Vf: vgl. YL 145 V4 simcyamno drsyate.
Ra: ergnze und lies n(i)<h>srtbhi(h)7 Vgl. etwa YL 145 V5 (ni)hsrtbhir dhrbhih.
Rb: mit den auf 145 V5 folgenden Zeilen lassen sich diese Wrter nicht verbinden; vgl.
jedoch die in YL 124 R2,6 und 125 V4 bewahrte Wendung tasmim samaye cittam
bhavati.
Rc: auch diese Zeile lt sich nicht endgltig einordnen; vgl. jedoch YL 145 V6 u. 146
V5 sray(p)r(amnatay).
Rd: vgl. YL 146 R4 maitrbhi[se](ka)/// und 146 R5 maitrbhisekas ca-s-tadrasapariprnah parvatah. Zu dem merkwrdigen Einschub eines s s. YL Anm. 15 ad
locum mit Interpretation als Hypersandhi; in der vorliegenden Zeile ist der Anschlu
jedoch als a[s] oder als a[ms] zu lesen, so da auch im YL die Mglichkeit einer
Textverderbnis nicht auszuschlieen ist.
Re: vgl. YL 146 R5 catvra<h> pravhh kcapribhih sariram prayamti.
Rf: vgl. YL 146 R6 ksirapravho nirgatya.

Abkrzungen
= J.-U. HARTMANN, Klaus WILLE, Die nordturkistanischen Sanskrit-Handschriften der Sammlung Hoernle (Funde buddhistischer Sanskrit-Handschriften, II)", Sanskrit-Texte aus dem buddhistischen Kanon: Neuentdeckungen u.
Neueditionen, 2, Gttingen 1992 (Sanskrit-Wrterbuch der buddhistischen Texte aus
den Turfan-Funden, Beiheft 4), S. 9-63.
SeyR, Rez.YL = David SEYFORT RUEGG, On a Yoga Treatise in Sanskrit from
Qizil", Journal of the American Oriental Society 87 (1967), S. 157-165.
SHT = Sanskrithandschriften aus den Turfanfunden, Teil 1-6, ed. Ernst WALDSCHMIDT, Lore SANDER, Klaus WILLE, Wiesbaden 1965-1989 (Verzeichnis der
orientalischen Handschriften in Deutschland, X,l-6).
YL = D. SCHLINGLOFF, Ein buddhistisches Yogalehrbuch (s. Anm. 2).

HARTMANN/WILLE

316

Jens-Uwe Hartmann

Anhang
Lesungskorrekturen zum ersten der beiden oben publizierten Fragmente
Offenbar war bei der Verfilmung des ersten in Hartmann 1996: 132-133 (oben, S. 313)
bearbeiteten Fragmentes (Sammlung Hoernle, Fragment ohne Nummer) eine linke Ecke
umgeklappt. Dies zeigte sich erst jetzt, als von der British Library ein digitalisiertes
Bild zur Verfgung gestellt wurde. Die dadurch neu hinzukommenden Aksaras sind fett
gedruckt.
r5 /// te pat[t] am badhnti pndaram sam
[c]. ///
r6 /// [k]tgaraih pariprn d[r]s[y]am .[e] .. da ///
vl /// .[uh]y. [tistham]ti v[i]muktipratisa.[v]
///
v2 /// [k]. jvla[y]. te I prahnanupasya
///
v3 /// .. paryamtam eva tarn phenarsim sitala ///
In r5 ist offenbar (utpadya)te anzunehmen gegenber utpadya YL (mit ausgefallenem
Aksara te!). Die brigen Zustze besttigen den bereits aus dem YL bekannten Text.
Freundlicherweise hat mir Ursula Sims-Williams die Grenverhltnisse der beiden
Fragmente mitgeteilt: Das erste, grere, Fragment mit 6,5 x 9,7 cm, das zweite 6,7
x 4,5 cm.

Neue Fragmente aus dem Yogalehrbuch"


Sammlung Hoernle, s. oben S. 313.

317,

318

Jens-Uwe Hartmann
Sammlung Hoernle, s. oben S. 314 f.

i.

'&*'*

"'r*'

Drei weitere Fragmente aus dem Yogalehrbuch


Jens-Uwe Hartmann

1. H. 150/84 und H. 150/76


1.1 Einleitung
Im Mai 2004 hatte Klaus WILLE (Gttingen) eine erste Abschrift der Nummern Hoernle
150/53-102 von den Originalen in der British Library vorgenommen und mir anschlieend freundlicherweise fr eine Durchsicht zur Verfgung gestellt. Dabei konnten die
zwei Fragmente H. 150/84 und H. 150/76 dem Yogalehrbuch (YL) zugewiesen werden,
und es stellte sich rasch heraus, da beide Bruchstcke aus demselben Blatt stammen
und unmittelbar aneinander anschlieen. Erst ein Vergleich mit den von Nobuyoshi
YAM ABE herausgegebenen Pariser Fragmenten des YL lie jedoch eine genauere Einordnung zu: Offenbar berschneiden sich die beiden neuen Hoernle-Fragmente teilweise
mit einem der Bltter aus der Sammlung Pelliot, und diese berschneidung legt nahe,
da es sich bei den Hoernle-Fragmenten um ein fast vollstndiges Blatt einer relativ
kleinen Handschrift handelt. Wie unten im einzelnen ausgefhrt, erlaubt diese Annahme,
insgesamt drei Zeilen berzeugend zu ergnzen; sie darf daher als weitgehend gesichert
gelten.
Wie YAM ABE schon fr das Pariser Fragment vermutete,1 entstammt der Text wahrscheinlich dem ersten Kapitel des YL, der bung der Hlichkeiten (asubhaprayoga)'\
wie SCHLINGLOFF den vermutlichen Titel bersetzt. Dieser Teil ist in der Handschrift
des YL leider extrem schlecht erhalten, und daher ist eine endgltige Zuweisung der
Pariser und Londoner Fragmente derzeit nicht mglich.
Der Text der vorliegenden Handschrift ist orthographisch recht fehlerhaft und teils
elliptisch; beides zeigt sich deutlich, wenn man etwa den in r3 bewahrten Satzteil
tato lalatd pavho dvitiyo nbhyah misritv ...
mit einer ganz hnlichen Formulierung in YL 129R3 vergleicht:
punar bhrumadhyd ekah pravho nirgacchati dvitiyo (n)[bh]y() misnbhtam ...
Daraus ergbe sich fr das vorliegende Fragment mit allen notwendigen Korrekturen
und mglichen Ergnzungen sowie unter Einfgung von Satzzeichen etwa folgendes:
tato lal<>td <ekah> p<r>avho <nirgacchati>, dvitiyo nbhy<>h, misritv
daraufhin geht ein Strom aus der Stirn hervor, ein zweiter aus dem Nabel; nachdem
sie sich vermischt haben ..."

YAMABE 1997: 28 (unten, S. 334f.).

320

Jens-Uwe Hartmann

Offenbar haben Fehlerhaftigkeit und Verkrzung im Ausdruck das Verstndnis aber


nicht behindert. Im Verein mit der Tatsache, da es sich um eine relativ kleine Handschrift fast in einem Taschenbuchformat" handelt, knnte dies darauf hinweisen, da
hier ein transportabler Gebrauchstext vorliegt fr jemanden, der mit der Anleitung im
wesentlichen vertraut war und nur einer Gedchtnissttze, einer Art Stenogramm, fr
den Ablauf bedurfte. Noch etwas zeigt sich deutlich: Ganz anders als bei den kanonischen Texten, deren Wortlaut in Zentralasien zu jener Zeit offenbar einen verbindlich
fixierten Endzustand erreicht hatte, war der Wortlaut von solchen Werken wie dem
Yogalehrbuch keineswegs festgelegt, sondern flexibel und modifizierbar. Dementsprechend sind die zahlreichen Textvarianten in den verschiedenen Handschriften, die
bereits frher aufgefallen waren,2 wohl eher als Regelfall anzusehen, nicht als Ausnahme und erst recht nicht als berlieferungsfehler.

1.2 Transliteration3
Or. 15002/28 = H. 150/84 (4,2 x 10cm) + Or. 15002/20 = H. 150/76 (4,2 x 4,5);
Faksimile s.u.4
Blatt 29, recto
1 prahya sa c. vitarkarahito vrajati saddham* parivartya ca [ta] .. + +
2 [ca]turdhynara o sam dya svamsraye pravesayati .[ri] + +
3 tim ca tato la o latd pavho dvltl[yo] nbhyah misritv [s].i + +
4 p. yati laltt purvam [v]icchidya[t]. tato nbhya samudrapa + + +
verso
1 vT spharitv nbhes ca sihitmimagnm srayam + + +
2 ti [ta]ta pa o ripakntd y sthiti pravesayati .. + +
3 tpdasthiti o vyutthnakausalam* sthityupari cittasam + +
4 [rthajm marasamjnbhvan amgrrsi/nijmagnam krtsnam sa + + +

1.3 Kommentar
Zu rl: saddharn* bleibt mir unverstndlich.
Zu r2: Vgl. in anderem Zusammenhang YL 129 R3 ca[t](u)r(dh)[y]narasam d[ya].
Zu r2 svamsraye pravesayati: lies svam srayam oder sva-m-sraye; im YL finden sich
beide Kasus, vgl. YL 136R1 tadsraye pravisati und 144V1 srayam pravisamti.
Zu r3: Lies laltt p<r>avho und vgl. die wahrscheinlich hierzu gehrige Stelle P 9.1
vl. Vgl. auch die hnliche Formulierung in YL 129R3 dvitiyo (n)[bh]y() misribhtam.
2

HARTMANN 1996:
Klaus WILLE habe

131 (oben, S. 312), YAMABE 1997: 30 und 35 f. (unten, S. 336 und 339).
ich fr die berprfung der Lesungen zu danken. Das Fragment 150/76 ist

kursiv gesetzt.
Dank gilt dem British Library Board fr die Publikationserlaubnis und insbesondere Ursula SlMSWILLIAMS fr ihre Hilfe bei der Beschaffung ausgezeichneter Reproduktionsvorlagen.

Drei weitere Fragmente

321

Zu r3/4: Vor dem Hintergrund von YL 165R4 sahanbhi[ni](h)[s](rt)[e](naprav)hena


misnbhtah [s](th)itim prayati mchte man an eine Ergnzung [s](th)i(tim
)p()<ra>yati denken. Die dabei zu Beginn von Zeile 4 erforderliche grere
Korrektur scheint angesichts des ungemein fehlerhaften Textes zwar nicht ausgeschlossen zu sein, bleibt aber natrlich unsicher.
Zu r4: Lies vicchidyate (das Fragment hat hier einen Ri, und die beiden Teile berlappen sich etwas). Vgl. YL 129R3/4 prvam bhrumadhyd vicchidyate I tato
nbhyh und 147V2.
Zu r4/vl: Wohl zu samudrapa(ryamtam prthi)vi<m> spharitv zu ergnzen, vgl. YL
116V3,4, 129V1 und P 9.1 rl zu dem Ausdruck samudraparyamt prthivi/mahprthivl.
Zu vl: Vgl. P 9.1 va + + sph(a)ritv na[bh], [s] c. (s)th(i)tinim(it)[t](a)/// (s. YAMABE, unten, S. 332); sicher zu (s)th(i)tinim(ag)[n](am srayam) zu korrigieren. Vgl.
auch YL 129R3 prathi[v]i (fr prthivfm) spharitv.
Zu v2: Der Punkt nach tata ist hier mglicherweise als Visarga aufzufassen, aber das
Verstndnis der Zeile bleibt unsicher.
Zu v2/3: Ergnze zu (etad u)tpda und vgl. P 9.1 vb etad utpdasthitivyutthnakausalam* II (s. YAMABE, unten, S. 332).

Zu v3/4: Ergnze zu cittasam(veg)rtham mara<na>samjnbhvan und vgl. P 9.1 vb


sthityupari cittasamvegrtham marana/// (s. YAMABE, unten, S. 332). Zwar liee
sich das erste Aksara der Zeile v4 auch als [rkham] lesen, da ein Abstrich links eher
auf kh als auf th deutet, aber die Parallele in der Pariser Handschrift lt keinen
Zweifel daran, da ein th mindestens zugrunde gelegen haben mu.
Zu v4: Vgl. P 9.1 vc ///[n](i)magnam krtsnam sasursuralokam pasyafmjti (s. YAMABE,
unten, S. 332).
Wenn die Vermutung zutrifft, da es sich um ein fast vollstndig erhaltenes Blatt
handelt, dann lt sich der folgende Wortlaut rekonstruieren (nur Ergnzungen und
Korrekturen der vermutlichen Verschreibungen sind als solche gekennzeichnet): ... (rl)
prahya sa c(a) vitarkarahito vrajati saddham* parivartya ca [ta] + + + (r2) caturdhynarasam dya svamsraye pravesayati .ri + + (r3)tim ca tato lal<>td
p<r>avho dvitiyo nbhy<>h misritv s(th)i(tim )(r4)p()<raya>ti laltt purvam
vicchidyat(e) tato nbhy<h> * samudrapa(ryantam prthi)(\l)vim spharitv nbhes
ca sthitinimagnm srayam + .+ + (v2)ri tatah paripakntd y sthiti pravesayati
(etad u)(w3)tpdasthitivyutthnakausalarn* sthityupari cittasam(veg)(v4)rtharn rnara<na>samjnbhvan amgrrsinimagnam krtsnam sa(sursuralokam pasyati) ...

322

Jens-Uwe Hartmann

2. Hoernle 156 unnumbered (Or. 15003/257)


2.1 Einleitung
Inzwischen wurde eine nicht unerhebliche Menge von bisher unbekannten und unbearbeiteten Sanskrit-Fragmenten in nordturkistanischer Brhmi aus der Hoernle-Sammlung im Nachlass von H.W. BAILEY aufgefunden.5 Sie wurden in die British Library
berfhrt und dadurch wieder zugnglich gemacht. Klaus WILLE konnte auch von
diesen auf drei Gruppen aufgeteilten Fragmenten (Hoernle 150/53-102 [50 Fragmente];6 Hoernle 156 unnumbered 1-289; Hoernle 149 unnumbered [etwas mehr als 400
Fragmente]) Abschriften anfertigen, die er mir fr eine Durchsicht zur Verfgung
stellte. Dabei konnte ein Fragment zweifelsfrei dem YL zugewiesen werden; bei einem
zweiten, kleineren Fragment ist die Zugehrigkeit wahrscheinlich, aber nicht gesichert.7
Der Text des greren Fragments entspricht YL 131R3-132V5.

2.2 Transliteration8
Or. 15003/257 = H. 156 unnumbered (ca. 5 x 4,2 cm)
recto
1 /// [n]dun iva spandam[] + ///
2 /// rudhms ca buddhm [p]. [sy]. ///
3 /// + .'. pasyat[i a] .. ///
4 / / / + . . ca r. [t]n. [v]r[ks]. ///
5 /// + + .. ta .. + + ///
verso
v /// + + [bh]ge[n]. + + ///
w /// + .. pari .. r[m]. .. ///
x / / / + . . [k]aramthaih [p]r + ///
y /// [vi] prnm ((pasyati)) [p]asya[t]. [s c]. ///
z /// [s]ya [k]rmayas[r] + ///

Nheres dazu s. Prods Oktor SKLERV0, Khotanese Manuscripts from Chinese Turkestan in the
British Library, A Complete Catalogue with Texts and Translations, With Contributions by Ursula SimsWilliams, London 2002 (Corpus Inscriptionum Iranicarum, Part II Inscriptions of the Seleucid and
Parthian Periods and of Eastern Iran and Central Asia, Vol. V: Saka, Texts VI), p. xlii.
6
Dazu s. auch K. WILLE, Some recently identified Sanskrit fragments from the Stein and Hoernle
collections in the British Library, London (1)", Annual Report of the International Research Institute for
Advanced Buddhology at Soka University for the Academic Year 2004, vol. 8, Tokyo 2005, pp. 61 f.
7
Hoernle 156 unnumbered (Or. 15003/31); die Zeilen Ax ///prnam drsya(te)/// und B3 ///to
yogc(ra)/// weisen nachdrcklich auf einen Text wie das YL, lassen sich aber bisher nicht zuordnen.
8
Das Fragment ist praktisch gleichzeitig publiziert in Klaus WILLE, The Sanskrit Fragments Or.
15003 in the Hoernle Collection", The British Library Sanskrit Fragments, vol. I, ed. Seishi KARASHIMA
and Klaus WILLE, Tokyo (Buddhist Manuscripts from Central Asia), S. 65-153; dort ist auch ein
Faksimile beigefgt.

Drei weitere Fragmente

323

2.3 Kommentar
Zu rl: Vgl. YL 131R3 avsy[ya]bindn iva spandamnam pa[s]yat[i].
Zu r2: Vgl. YL 131R4 [ta](dadhir)[dh](m)s ca buddhn pasyati.
Zu r3: Die Zeile fllt offenbar genau in die Textlcke in YL.
Zu r4: Vgl. YL 131R5 sa ca ratnavrksah.
Zu vw: Offenbar zu pari(ka)rm(a) zu ergnzen, vgl. den in YL 132VIff. mehrfach
vorkommenden Begriff.
Zu vx: Vgl. YL 132V4 ///[ry](ai)s ca karanthaih prthivim citm pasyati und den
Hinweis von Schlingloff auf das Wort karantha, dessen Bedeutung sich bislang
nicht erschlieen lt (Anm. 1), dessen Lesung aber hier besttigt wird.
Zu vy: Vgl. YL 132V5 p(r)[th]i(v)i prnrn pa(s)y(ati)//A
Zu vz: Mglicherweise sind die Aksaras genau in die Lcke vor YL 132V6 ///[rna]yas[k](r)totpadyamte einzuordnen. Die Bedeutung und die Lesung des auf -yas
folgenden Aksarateiles bleiben allerdings unklar.

Jens-Uwe Hartmann

324

Or. 15002/28 = H. 150/84 und Or. 15002/20 = H. 150/76.

Fragments of the "Yogalehrbuch" in the Pelliot Collection*


Nobuyoshi Yamabe

Introduction
In 1964, Dieter Schlingloff published an edition and German translation of an otherwise
unknown Sanskrit meditation manual1 mainly based on a birch-bark manuscript (SHT
150)2 brought by the third German "Turfan" expedition from Qizil (in the Kucha area).3
This text ("Yogalehrbuch" [FL]),4 which has been made available to us through Schlingloff's painstaking work, discusses various visions of Buddhist meditators (yogin or yogcr) in the following sections:
I. asubhaprayoga, "the practice of [the meditation on] the disagreeable"
II. npnasmrtibhvan, "the practice of mindful inhaling and exhaling"
III. dhtuprayoga, "the practice of [the meditation on] the elements"
IV. skandhapanks, "the examination of the aggregates"
V. yatanapanks, "the examination of the sense realms"
VI. pratityasamutpdapanks, "the examination of dependent origination"
VII. maitn, "friendliness"
VIII. karun, "compassion"
IX. mudit, "joy"
X. upeks, "equanimity"
XL anusmrti, "calling to mind"
i. buddhnusmrti, "calling the Buddha to mind"
ii. dharmnusmrti, "calling the Dharma to mind"
This is a slightly revised version of the article I published under the title "New Fragments of the

'Yogalehrbuch'" in Kyushu Rykoku Tanki Daigaku kiy XJMni^MMi^^i^

(Bulletin of Kysh

Rykoku Junior College) 43:11-39, 1997. Therefore, my statements in this article in principle reflect the
situation as of 1997.1 thank Professor Jens-Uwe Hartmann (Universitt Mnchen) for giving me the opportunity to revise my paper, Madame Monique Cohen (Bibliotheque Nationale) for permission to publish a
facsimile reproduction of Pelliot Sanskrit nos rouges 9.1-6, President Esh Kawasaki JHlHf S t (Kysh
Rykoku Junior College) for permission to publish this version of the paper, and Professors Robert Kritzer
and Elizabeth Kenney for checking my English.
1
Schlingloff 1964a.
2
See Waldschmidt, Clawiter, and Holzmann 1965, 85-86.
3
For more information concerning this manuscript, see Schlingloff 1964a, 9-22; 1964b, 146-47.
The facsimiles of this and three other manuscripts of the same text were later published as Schlingloff 1966.
4
Owing to the fragmentary nature of the manuscripts, neither the title nor the author of this work
was confirmed. For this reason, Schlingloff tentatively calls it "ein buddhistisches Yogalehrbuch" based on
its contents. In this paper, I would also like to call this text "Yogalehrbuch" out of respect for its meticulous
editor. Although Schlingloff is not using this word as a proper noun, this German word would sound somewhat like a proper noun in the English context.

326

Nobuyoshi Yamabe

iii. samghnusmrti, "calling the monastic community to mind"


iv. silnusrnrti, "calling morality to mind"
v. devatnusmrti, "calling deities to mind"
These are the items widely seen in the gama/Nikya literature and in the meditation texts
of both the Sanskrit and Pali traditions (Inokuchi Taijun # 7 P MW 1966, 9-14; David
Seyfort Ruegg 1967, 158-60). In particular, as Schlingloff points out (1964a, 27-28), this
text draws heavily on the Mahsatipatthnasutta (DTghanikya 2:290-315 [No. 22]) and
the Satipatthnasutta (Majjhimanikya 1:55-63 [No. 1.10]), corresponding to the *Snirtyupasthnastra (Nianchu jing) ^ j ^ n in the Madhyamgama (Zhong ahanjing) ^ H ^
jjfg Tl:582b-84b (No. 26 [98]).
Concerning the school affiliation, based on the agreement in doctrinal and cosmological framework, Schlingloff considers this text to be a Sarvstivda work (1964a, 10; 3033). Inokuchi (1966, 12-14) reaches a similar conclusion based on the structural similarities between the YL and the Damo duoluo chanjing ^ J P ^ J / W I ("The Meditation
Manual of Dharmatrta," T15:300c-25c [No. 618]), a meditation manual (yogcrabhmi) traditionally attributed to Dharmatrta, but now generally to Buddhasena,5 a meditation master in northwest India.6 On the other hand, based on the distinctive language
use, Schmithausen (1970, 109-13; n. 257) and Enomoto Fumio (1984, 21-25) suggest
that the YL belonged to the Mlasarvstivda tradition.7 Schmithausen further points out
that the emphasis on the bodhisattva ideal in this text suggests a link to the Mlasarvstivda tradition (1970, n. 257).
We should note here that the YL is not merely a text that describes the traditional
methods of meditation. The YL not only has a strong bodhisattva ideal (Schlingloff 1964a,
54-56; Ruegg 1967, 160-61); it is also filled with peculiar visions (e.g., pearl necklaces
coming out of the head of the meditator [127R4-5]8); and it even has some apparently
Tantric elements (such as abhiseka, "consecration," see Ruegg 1967, 162ff.).9 What is
particularly interesting to me is that similar mystical visions are found in some of the
meditation/visualization texts allegedly translated into Chinese in the early fifth century.10
For example, we find the following passage in this text (160V2-R1 [on upeks, "equanimity"]; cf. Ruegg 1967, 162):

On the Damo duoluo chanjing, see, for example, Lin 1949, 341-51, and Yamabe 1999b, 72-76.
In the Chu sanzang ji ji t t i H f E H ("A Collection of Prefaces to the Chinese Tripitaka,"
T55:66c26 [No. 2145]), he is said to have taught in Jibin WM , lit., "Kashmir." See Yamabe 1999b, 75. For
the exact meaning of "Jibin" in Chinese texts, see Enomoto 1993.
For Enomoto's present position on the meaning of "Mlasarvstivda," see Enomoto 2000.
For the conventions used for quoting from the YL, see n. 21 below. On these visions in general, see
Schlingloff 1964a, 33-54; Ruegg 1967, 165.
Abhiseka itself is not unique to Tantric texts, but judging from the general atmosphere of the YL, it
does not seem far-fetched to understand the abhiseka in the YL in Tantric contexts. I have discussed the
significance of abhiseka in Buddhist visualization in more detail in Yamabe n.d.
These texts are usually classified into two categories: chanjing /WIM, "meditation manuals," which
largely follow the framework of "Hmaynist" meditative practice, and guanjing IS IM, "visualization
stras," which take the format of Mahyna stras.
6

Fragments of the "Yogalehrbuch" in the Pelliot Collection

327

Then a sword comes out of the navel of the meditator and arranges the six parts
of (?) the meditator's body separately on his skin.11...
Then, in the same way, the swords that have come out of the body of the meditator arrange the whole sea of sentient beings according to the six elements and the
non-sentient according to the five. With both hands the [meditator] examines these
elements one by one; these [elements] are equally examined. Then he says: "This is
the earth-element, this is also the earth-element, this is the water-element, thus up to
the consciousness-element. This is devoid of Self and its possessions, this is also
devoid of Self and its possessions." Then ... six parts [representing] the six elements
burn by the fire of aversion.12
This should be compared with the following passage from the Wumen chanjing yaoyong
fa 5iP!;W^S^ffl& ("Essential Methods of the Meditation Manual Consisting of Five
Gates," T15:326c3-8 [No. 619]):13
The master says [to the meditator]: You must by yourself visually divide [your
own body] into five parts.... If [your] body has been successfully broken down into
five parts, then [you] realize that there is no Self; even each part has no Self. Thus
[your] mind becomes established in the gate of the samdhi of no-Self. If you see
swords coming out of your limbs all over during the samdhi, and if bright
flames come out of the blades of all of these swords, this is called the object of the
wisdom of no-Self.
Since many of these Chinese meditation texts, most importantly the Guan wuliangshou
jing l i i f g ("The Stra on the Visualization of Amitayus," T12:340c-46b [No.
365]), are of dubious origin, similarities with the YL can be important clues to clarify the
real provenance of these texts.14 Therefore, not only in the history of Buddhist meditation
in general but also from the point of view of East Asian Buddhism, the YL can be a very
important text. Nevertheless, except for two helpful reviews (Inokuchi 1966; Ruegg
1967), this text has not drawn much attention from scholars so far.15
tato yogino nabhyah sastram nirgacchati / yoginas casrayam sad bilam bhagasas taccarmany
avasth(payati/) (160V2), corrected according to the editor's notes.
12
tato yogcrsrayanihsrtni sastrni tadvad e(va saddh)[tu]vibhgena krtsnam satvasamudram
avasthpayanti asatvkhyam ca pam[cadh]tuvibhgena (hast)[](bhym ekaijkasas tm dhtm tulayati
/ te samam tulyamte tatah kathaya(ti/ ayam a)pi prthividhtur ayam api prthividhtuh ayam api abdhtur
evam [y](vad vijnnadhtuh / ayam apy tm)[]tmiyavirahito 'yam apy tmtmiyavirahitah tat[o]
ya saddhtusadbilni nirvidgnin jvalamti (160V5-R1). Corrected according to the editor's notes.
'l'3
'
14

The "Stra on the Visualization of Amityus" itself does not share many elements with the YL. This
stra, however, is closely related to the Guanfo sanmei haijing #Hlft$lfM ("Stra on the Ocean-Like
Samdhi of the Visualization of the Buddha," T15:645c-97a [No. 643]) and the latter does have significant
similarities to the YL.
15
In addition, Deleanu 1993, 6 and minami 1995, 73; 83 both lightly touch upon the YL in comparison with Chinese texts. There are also brief reviews of Schlingloff 1964a (and 1966): Berger 1967, Horsch
1967, and Meier 1970. (I owe the references to these three reviews to Bretfeld 2003, 205). For extensive
discussions of the content of the YL, see Yamabe 1999a, 1999b, 300-352; and Bretfeld 2003.

328

Nobuyoshi Yamabe

Other than the birch bark manuscript from Qizil (SHT 150), Schlingloff identified
three small fragments of the same text in the German collection: two (SHT 164a and 183a)
also from Qizil and one (SHT 407a) from Shorchuq (Schlingloff 1964a, 23; Waldschmidt,
Clawiter, and Holzmann 1965, 93-94; 103; 185).16 In addition to these, Jens-Uwe Hartmann found two relevant fragments in the Hoernle Collection, London (photo Nos. 170,
178).17 He further took note of another manuscript in the Pelliot Collection, Paris {Pelliot
Sanskrit nos rouges 9.1-6), which bears the note made by Bernard Pauly: "Voir:
SCHLINGLOFF (D.). Ein Buddhistisches Yogalehrbuch. " 18 On the other hand, the same
Pelliot manuscript was reprinted in the Dunhuang Dazangjing Ifcill^JiScfM ("Dunhuang
Buddhist Canon," 62:19-25) and came to my attention.
An edition of the Hoernle manuscripts has been published by Hartmann in the Festschrift for Professor Schlingloff (Hartmann 1996). The exact provenance of the Hoernle
manuscripts cannot be confirmed, but Hartmann considers the Kucha area as the likely
origin (ibid., p. 129; Hartmann and Klaus Wille 1992, 18ff.)
On the other hand, the fragments numbered 9(2), 9(3), and 9(4) are marked as "DA,"
and according to Monique Cohen (Bibliotheque Nationale, Paris), who has kindly
checked the notes of Bernard Pauly on my request, they are from the court of the convent
of Duldour-qour (in the Kucha area). The other fragments numbered 9 must be from the
same document (pers. comm. 1993). The manuscript is written on paper (Cohen pers.
comm. 1994) in North Turkestan Brhml type a-b, which, according to Lore Sander (formerly Museum fr Indische Kunst, Berlin), "indicates a little younger date (7th/8th century A.D.) than the paper manuscript [No. 164a] from Qizil used by Schlingloff (pers.
comm. 1993; see also Sander 1968, 46).

Transcription and Translation


Here I give a transcription of Pelliot Sanskrit nos rouges 9.1-6 with notations. This transcription is based on a microfilm (R. 44581) prepared by the Bibliotheque Nationale.19
The first folio was broken into four fragments, which have been put together into two
parts20 and numbered respectively as 9.1 gauche and 9.1 droite, but I have transcribed
16

Serial numbers given above are those given in Waldschmidt, Clawiter, and Holzmann 1965.
Since these Hoernle fragments carry no number, Hartmann specifies the Hoernle manuscripts by
the photo numbers of the microfilm made by India Office Library. See Hartmann and Klaus Wille 1992,
20-21. The manuscripts in question are listed in ibid., 37; 41. Additional fragments of the YL Hartmann has
recently identified in the Hoernle Collection will be discussed in his paper in this volume.
18
Seelnokuchi 1989,8-10.
I thank Madame Monique Cohen for permission to study this manuscript and publish the result
thereof. I further thank Dr. Lore Sander for her assistance at the early stages of this project. Professor
Stanley Insler, Yale University, kindly brought a microfilm of the relevant manuscript for me from Paris. I
owe particular thanks to Professor Jens-Uwe Hartmann, Humboldt-Universitt zu Berlin, who generously
checked my transcription and gave me many helpful suggestions. Needless to say, any remaining errors are
my responsibility, but this paper would certainly have been impossible without the help of these people.
(These are the acknowledgements made in the original version, and the affiliations of the mentioned people
are as of 1997.)
20
I owe this information to Cohen (pers. comm. 1996).
17

Fragments of the "Yogalehrbuch" in the Pelliot Collection

329

them continuously. Since the folios other than the first one are badly damaged, I have
translated only the first folio.
In these translations, in order to facilitate a comparison with the transcription, I attempted to reflect the line break of the transcription in the translation as much as possible.
Since the manuscript is fragmentary, in any case it is very difficult to translate it into
idiomatic English. For these reasons, sometimes I could not avoid irregular English syntax. This translation should be treated as a tentative device to approach the manuscript.21
9.1 recto22
1: (pa)syati / saku[m]nd[] antahkosthgabha str[Im] tata suc[i]pa[rip][r]n[]<m> katandyam lambamnm pasyati / eva<m> /// sv(a)m []&rayam tadvat sarvasatvn samudraparyamty<>h [p]r[th](i)vyh23 pasyati durbalasa(m)jn[]24 [g]. [hi] t. [b]. +
2: .. samskragatam patamtam iva pasyati crnasamjiiy<m> c[r]nlkrtam bhasmarsivad avasthitam svam sra(yam) /// (samudraparyant)25ym prthivym0 tatah
mtrpitrsamyogc chukrasonitam pasyati tadabhiratam ca vijnnam tatah kalal(rbu)3: (da)p(e)slgana26praskhnukramenbhinirva[r]tam < O > nam pasyati /jtasya
ca [b](lakumra-)27 III (pa)syati / evam nnrogopahatam mryamnam28 mrtam
[n]irhryamnam29 imasliiastham vimlakdi yva21

In the following transcription, I basically follow the conventions used for the transcriptions of the
German Turfan Collection (e.g., Schlingloff 1964a, 58; Hartmann 1996, n.18): [] = partly damaged letters; ()
= supplements by this editor; more uncertain supplements are given in italics in parentheses; < > = supplements
without lacunae; {} = unnecessary letters erroneously added to the manuscript; two points (..) indicate an
illegible letter; one point (.) indicates an illegible or lost constituent of a letter; + indicates a lost letter; and ///
shows a break in the manuscript. Further, < O > indicates the area of a punch-hole, and 0 stands for a virma.
"Read" in the footnotes shows standard spellings. For the following undoubled dentals, however,
I do not correct them: satva (for sattva); bhitv (for bhittv); badhv (for baddhv).
For parallels, significant agreements of some length are marked with black bold letters, while less
meaningful similarities are marked with gray bold letters.
" Sch" refers to the text transcribed in Schlingloff 1964a. References to this text are given by the
folio and the line numbers rather than the page and the line numbers. Here "V" refers to Vorderseite (=
recto) and "R" to Rckseite (= verso); note that "V" does not stand for verso, nor does "R" for recto. " P "
refers to the Pelliot manuscript. "H" refers to the Hoernle manuscript.
22
I use the folio numbers shown in Inokuchi 1989, 8-10. Strictly speaking, it is not certain if they
reflect the original order of the folios, nor do we know how the recto and verso of the folios were determined. Nevertheless, for the sake of convenience, I follow this numbering system. At least in the case of
Pelliot Sanskrit n rouge 9.2, the recto and verso seem to be correctly marked, judging from the parallel lines
in the YL I thank Jens-Uwe Hartmann for drawing my attention to this point.
23
Read samudraparyamtym prthivyml Cf. {samudraparyant)ym prthivymo in the next line.
24
Read samjnyml Cf. crnasamjny<m> in the next line.
25
Cf. samudraparyamty<>h prth(i)vyh in the previous line and the parallel passages to that line
shown below.
26
Read ghana.
27
Cf. Sch 129V6 quoted below as a parallel passage to this line. Cf. pamca garbhvasthh kalalrbudapesighanapraskhvasthh
pamca jtvasthh blakumrayuvamadhyavrddhvasth
ity (Abhidharmakosavykhy, U. Wogihara ed., 198.32-33, quoted in Schlingloff 1964a, p. 88, n. 1).
28
Read mriyamnam.
29
Read nirhriyamnam.

330

Nobuyoshi Yamabe

4: (c cz7)rnitam krtsnam jagat pasyati / svam csrayam tata30 < O > cflrnapurusaka utpadya[t]e /// tato 'bhisekah caturbhyah samudrebhyah purus jalakumbhn d<>ya
yogcram snpayamti / evam
5: + + + + h mrdh(a)c(ch)i(dr)ena ca sarpistailbhym p < O > rayamti / tata upari
p[rn].m /// .. accham csrayam suvarnasalksadrsam sni(g)dh(am) suvarna<m>31
sa<m>pariprnam drsyate tato llte ..
6:+ + + + + + + + + + (sa)l[k][s](aJria/z) p(ra)vho nirgacati34 [sa] prthivT<m>
bhi(tv) + + + + /// + + + .. .[tv] tatah kmcanamandalam bomandalam35
v[yu]mandalam ca bhitv parivart<y>a36 nbhym ..
7: (gauche not available) /// + + + + + .. .e + .. .h. m. [kh][n]ih
++
m .i
.[i] +r..m .i [ h ] i . . . . + +
Parallels:37
1: chidrlkrtam / Sani I(srayam) (116R3, asubha)
yvat samudraparyamt(m mahprthivim) (116V3, asubha)
(samu)[d]raparyamtym sarvasa[t](v)m (116V4, asubha)
samudraparyamt mahprthivim prya (129V2, dhtu)
2: (sukhasa)m[j]nym / jvalamti duhkhasamjny (126R4, npnasmrti)
y crnlkrtam bhasma (116R4, asubha)
tatah sarvam vislrnam cflrnibhtam vyumandalaparyamtam adhah (129V3-4,
dhtu)
punah kalalvastham dhtusatkam pasyati (129V4-5, dhtu).
3: arbu(dap)e(slghanapra)skhnukramena / [va]rdhamnam pa[sya]ti
jyamnam
blakaumrayau[va](madhyavrddh)
.. .. clryavydhitam
(129V6, dhtu)
(S)m(a)Snam iva pasyati (115V4, asubha)
4: (ya)th[o]ktah cfirnapurusaka utpadyate / tadanamtaram abhisekensra(yam
prmayan) (129R1, dhtu)
6: (pravho nirgatah)38 prthivlmandalam bhitv narakm prets cva[bh](sya
kmcana)[ca]k[r]am bhitv pmandalam vyumandalam kasadhtum avabhsya (pa)rivartya nbhym pravisya (129R1-2, dhtu)

30
31

Read snigdhena
suvarnenal
Read pasyati]
33
Read lalte.
34
Read nirgacchati.
Read abmandalam.
Parivarta<ti> is also possible, but considering Sch 129R1-2 quoted below as a parallel passage to
this line, parivart<y>a is more likely.
37
Hereafter I quote from Sch without correcting irregularities.
The closing parenthesis is missing in Sch, but I assume that this is the end of the supplemented part,
because line 1 ends here.
32

Fragments of the "Yogalehrbuch" in the Pelliot Collection

331

Notes:
1: The top edges of 9.1-4 recto are preserved, so the assigned line numbers are
reliable.
Svam srayam is an extremely common expression in the FL, and so if alone, this
correspondence may well be a coincidence. Nevertheless, we should consider
that both manuscripts have -y crnikrtam bhasma in common in the immediately following lines.
For samudraparyamty<>h prth(i)vyh, compare the Abhidharmakosabhsya
(P. Pradhan, 2nd ed., 338.8): yvad vihrrmaksetrakramena samudraparyantm prthivim asthisamkalm prnm adhimucyate.
2: For crnasamjn, compare the Satipatthnasutta (Majjhimanikya 1:58.3759.1): atthikni ptini cunnakajtni, so imam eva kyarn upasamharati.
4: Crnapurusaka, "a powder man," must be the personification of oneself
smashed into ashes in line 2.
7: This line is not preserved in 9.1 gauche.
Translation:39
1: {gauche untranslated)... in the same way, one sees one's own body as well as all sentient beings on the ground all the way to the ocean in the meditation on feebleness....
2: in the meditation on powdered [bones], one sees as if [one's body] belonging to the
conditioned elements were falling down; one's own body powdered and resting like a
heap of ashes... on the ground (all the way to the ocean).40 Then he sees a white and
red [combined drop] from the union of the mother and the father, and the consciousness
[of the gandharva] roused by the [scene]. Next, kalala, arbu-,
3: -da, pesT, ghana, and praskh\ he sees [the fetus] growing in this sequence. Then he
sees [the growth] of the [newly] born [in the sequence of] (baby, child, ...). 4 1 In the
same way, [he sees his body] harmed by various diseases, dying, dead, being carried
away, lying in a charnel ground, [becoming] blue and so forth until
4: (being powdered); he sees all beings and his own body. Thereupon, a powder man
arises.... Then, abhiseka. People bring water jars from the four oceans and bathe the
meditator. Thus
5: ... they fill [the body?] through a hole on the head with ghee and sesame oil. After that,
he sees filled up... and a body similar to a golden stick filled with glossy gold (?).42
Thereupon, on the forehead, ...
6: ... a stream (similar to) a stick comes out. Penetrating the earth ... then having penetrated the gold-circle, the water-circle, and the wind-circle, coming back, into the navel
7: (not translated)
39

In the translation, () indicates the supplement in the transcribed text and [] an explanatory supplement. Therefore, the square brackets in the translation do not correspond to those in the transcription.
40
Seen. 25.
41
See n. 26.
42
See nn. 31,32.

332

Nobuyoshi Yamabe

9.1 verso
a: (gauche not available) /// + + + + + + + + [p]r(a)[vh](o) [d]v(i)t(Iyo) [n]()[bhy](h)
+ .r. .r[t]v.43 [s]th. t. .e + .. t
++++
b: + + + + + + + + + + + .. t.r + + sph(a)ritv na[bh](e)[s]44 c(a) [s]th(i)tinim(ag)[n](am)45 + /// + + + + + / etad utpdasthit[i]vyutthnakausalam0 // sthityupari
cittasamvegrtham marana46 ..
c: + + +
[n](i)magnam47 krtsnam sasu < O > rsuram lokam pasya{m}ti [c]. ..
/// .t sva sraye pasyati / pndulohitamrttiksadrsa slvisah prthivTdhltoli48
tlasl[ka]-49
d: (sa)drsah bdhltoh 50 amgrasalksadrsa(h)51 < O > tejodhtoh52 abhmsal[k](sadrso vyudhioh)53 III [th]. m utsadTbhte saptottaram sTvisasatam
sambhavamti / tat saptottaram marmasatam samnirodhayie: (tv) tisthamti mrtpravhas ca mrdhnh54 pravisya sa < O > rvasrotmsi badhv
tisthamti + /// lokam0 bdhtau55 kupite saptottaram slvisa[s](ata)m []bdhtvsTvism56 nirgatya saptottara<m> marmaf: [s](a)ta<m> snym kledayamti tesu klinnesu [s]. [m] .. [y] vislisyante niscestam
svam srayam lokam ca + /// .s tvamta evlilvisl 57 tvat[s](v) eva marma[s]u .. [t].
[e58 s]nym dahyamti niscestam svam srayam sar(va)g: satvms caprthlvlm59 patamtam iva pasya(t)i (sna)[yu] .. .e..pite.. ..(sa)lkvarnas
tvanta [e](va) /// [kh]avinigatair asibhih .. .r c[chi]n[da]nti / nis[c]es(ta)[m] s(ra)yam
lo[k](a)m [c]a pasyati ga[le] [c]a vib .. + +

43

This should perhaps be restored as misritva. Cf. tato lalatad pravaho dvitifyo] nabhyah misritva
[s].i (H 150/84 + H 150/76, leaf 29, recto, line 3, discussed in Hartmann's paper in this volume). I thank
Hartmann for allowing me to refer to his draft.
44
Read nbhes. See n. 45.
5
After this, srayam should probably be supplemented. Cf. spharitv nbhes ca sthitinimagnm
srayam (H 150/84 + H 150/76, leaf 29, verso I, discussed in Hartmann's paper in this volume).
After this, apparently samjnbhvan should be supplemented. Cf. [rtha]m
marasamjnbhvan
amgrrsi[ni]magnam
krtsnam sa (H 150/84 + H 150/76, leaf 29, verso 4, discussed in Hartmann's paper
in this volume).
47
Apparently, amgrarsi- should be supplemented before [n](i)magnam. See n. 46.
48
Read-tos.
49
Read salk-.
50
Read (sa)drso
'bdhtor.
51
Read -sadrsas.
52
Read tejodhtor.
This is what one would expect from the context.
54
Read -l
55
Read bdhtau.
Read
abdhtvsivisnm.
57
Read sTviss.
58
The e may be v.
59
Read prthivim.

Fragments of the 'Togalehrbuch" in the Pelliot Collection

333

Parallels:
c, d, f: catvras ca mahbhtsl[v]i(s) (117R2, asubh)
tatra ca / slvi(s)
dhtuvarnh (129V5, dhtu)
d: amgrasalksadr[s](a) (117R3, asubh)
tarn samnirodhayit[v] (117R4, asubh)
Notes:
a: The top edge is damaged, so this may not be the first line. Therefore, instead of
assigning line numbers, I indicate the line by letters of the alphabet (similarly
below). Also, note that 9.1 gauche does not have this line.
c-d: In Buddhist texts, the four elements (mahbhta) are frequently compared to
four snakes. See the Samyuttanikya {sTviso, 4:172-75 [No.35.197]) and
Lamotte [1949J1981, 702-7.
d: Based on the common occurrence of amgrasalksadrsa, we can probably supplement tejodhtoh after amgrasalksadrsa in Seh 117R3.
Abhrasalk, "a stick of cloud," does not appear in Sch, but abhrakta, "a peak
of cloud," frequently does. See the index to Sch.
Also, tarn in Sch 117R4 should probably be restored as tat saptottaram marmasatam.
e: For kupite, "agitated," compare the following passage from the Samyuttanikya
(siviso, 4:173.2-6): yad ca kho te ambhopurisa imesam catunnam sTvisnam
uggatejnam ghoravisnam anhataro v annataro vkuppissati // tato tvam ambho purisa maranam v nigacchissasi maranamattam v dukkham //
f: On the verb klid-, "moisten," perhaps the following passage from the Pitputrasamgamastra should be noted for comparison (quoted in the Bodhicaryvatrapanjik, P. L. Vaidya ed., Buddhist Sanskrit Texts 12:238.23-25): bhavati
Mahrja samayah, yad ayam kyah smasnaparyavasno bhavati / tasya tat
kakkhatatvam samklidyamnam samnirudhyamnam na prvm disam gacchati, na daksinm, na pascimm, nottarm, nordhvam, ndhah, nnuvidisam
gacchati.
Translation:
a: ... a second stream from the navel, (mixing,) ...
b: ... filling, and up to the navel, ... (the body) sunk in the site .... This is the mastery of
arising, staying, and coming out [of meditation?]. Above the site, in order to make the
mind dejected, (the practice of meditation on) death ...
c: ... he sees the whole world including gods and demons (sunk [in] a heap of charcoal).
... He sees in his body a snake similar to pale-red clay [representing] the earth-element,
[a snake] similar to a cotton stick
d: [representing] the water-element, [a snake] similar to a stick of charcoal [representing]
the fire-element, [a snake] (similar to) a stick of cloud ([representing] the wind-ele-

334

Nobuyoshi Yamabe

ment).... When they become abundant, one hundred and seven snakes arise, and destroying one hundred and seven joints,
e: they stay. Then, the stream of clay enters the head(?), binding all the vessels, they
stay.... When the water-element is agitated, one hundred and seven snakes [representing] the water-element come out, and one hundred and seven joints
f: [and?] tendons they moisten. When they are moistened, ... are separated. [The meditator's] own motionless body and the world .... So many snakes in so many joints ....
They burn the tendons. [The meditator] sees his own motionless body and all
g: sentient beings as if falling down on the ground. (Tendon)... the color of the stick. So
many... they cut... with the swords that have come out of.... He sees the motionless
body and the world. In the neck ...
It is difficult to determine the exact identity of this folio. As we notice from the above
parallels, some phrases in P 9.1 recto 3-6 are very similar to those in Seh 129V6-R2
(dhtuprayoga). Also, because the word dhtu appears several times on the other side of
this folio (verso d, e), one possibility is that this folio belonged to the chapter on dhtuprayoga. There are, however, some difficulties with this hypothesis. First, none of the
"parallels" listed above exactly agree. Let us compare them once again:
P 9.1 recto 3: p(e)slganapraskhnukramenbhinirva[r]tamnam pasyati / jtasya
Seh 129V6: (p)e(slghanapra)skhnukramena / [va]rdhamnam pa[sya]ti jyamnam
P 9.1 recto 3: nanarogopahatam
Seh 129V6: clryavydhitam
P 9.1 recto 4: curnapurusaka utpadya[t]e /// tato 'bhisekah
Seh 129R1: curnapurusaka upadyate / tadanamtaram abhisekensra(yam prlnayan)
P 9.1 recto 6: p(ra)avho nirgacati [sa] prthlvl<m> bhi(tv) + + + + /// + + + .. .[tv]
tatah kmcanamandalam bomandalam v[yu]mandalam ca bhitv parivart<y>a
nbhym ..
Seh 129R1-2: (pravho nirgatah) prthivlmandalam bhitv narakm prets
cva[bh](sya kmcana)[ca]k[r]am bhitv pmandalam vyumandalam kasadhtum avabhsya (pa)rivartya nbhym pravisya
Obviously they are discussing the same topics with very similar words, but the differences
in wording are clearly beyond the range of copyist errors. Furthermore, other than recto
3-6, Pelliot 9.1 does not closely agree with any part of dhtuprayoga in Sch. On the other
hand, since the chapter on dhtuprayoga in Sch is relatively well-preserved, there is no
big lacuna that can possibly be filled with this folio. Therefore, if this folio indeed belonged to the chapter on dhtuprayoga, the only possibility seems to be that this folio was
a part of a text that was closely related to but not identical with the YL.
We must, however, consider another possibility. As we have also seen, there is some
parallelism between this folio and Sch's asubh. In particular, the similarities between P
9.1 verso d and Sch 117R3-4 seem significant, considering the very fragmentary state of
this chapter in Schlingloff's manuscript. Since the YL is a very repetitive text, there is no

Fragments of the "Yogalehrbuch" in the Pelliot Collection

335

difficulty in considering that the same topic was repeated in the chapters on asubh and
dhtu\ the content of this folio can fit in the context of asubh well. Furthermore, as we
shall see later, the following three folios (9.2-4) seem to have belonged to the second
chapter on npnasmrti. Therefore, if we assume that the numbering of the Pelliot manuscript reflects the original order of the folios (although this point is not certain), we
would have to say that the first chapter on asubh is the more likely place to assign this
folio.
Unfortunately, the chapter on asubh in Sch is too fragmentary to make a final judgement. At this stage, we must leave this question open.
9.2 recto
1:
2:
3:
4:
5:

/// .o tebhyas ca [ci]tt[]bh(i)pramo(danym) ///


/// (b)ladraka(m) samdhisukhasaktam pa[sya]ti [a] ///
/// (ji)r[na]m [s](v)[m]60 [s](ra)yam pasyati61 svsa[p]ras < O > (vs) ///
/// [sa]p(r)asv[sa]sam < O > ///
/// .. .. ///
Parallels:
1: (cittbhipramodanym /) (118R2, npna)
2: bladrakam samdhisukhasaktam pasyati (118R3, npna)
3: svam srayam pasyati / sv(sa) (118R5, npna)
4: svsaprasvsm jvalitm pasyati / (118R5, npna)
Notes:
1: Although cittbhipramodanym in 118R2 is a reconstruction by Schlingloff,
this wording is confirmed in 125R2 and 127R1. Judging from the correspondences to the following lines (2, 3, 4), here we have to refer to 118R2. This is one
of the sixteen items based on the Satipatthnasutta. Owing to a lacuna in Sch, we
cannot compare the first half of the line with Sch.
4: Since prasvsa appears very frequently in this section, it is not certain that this
line corresponds to 118R5 of Sch.

9.2 verso
a: /// .. .. ///
b: /// [b]dha62 utpa(d)yate < O > ///

60
61
62

Read svam.
Read pasyaty.
[B]dha may be [sjtha.

336

Nobuyoshi Yamabe

c: /// vat63 trt[I]yadhynam evam sphutam pasya < O > (ti) ///
d: /// [s]m te b(uddh)s ca sabda[m] udlrayamti s[ntam] sn[ta](m) ///
e: /// .. .. dayam utpadyate e[va]<m> ///
Parallels:
c: yvat trtiyam dhynam evam sphutam pasyati (121R4, npn)
d: te b(u)d[dh]s ca sabdam u[dTrayan](t)i [sa]ntam snta[m] i(t)i (121R5,
npn)
Notes:
b: There is no corresponding element in Sch, but perhaps it is because the corresponding part falls into one of the small lacunae.
e: Sch has a big lacuna at the corresponding portion.
Schlingloff 's manuscript is not well preserved in the chapter on npnasmrti, and therefore exact comparison is difficult. The above parallels appear to indicate that Pelliot 9.2
recto 1-4 corresponds to Sch 118R2-5, and verso c-d to Sch 121R4-5. If that is the case,
the Pelliot manuscript seems to represent a much more abridged text than Sch. Cf. Hartmann (1996, 131).
9.3 recto
1:
2:
3:
4:
5:

///ddhy.[h] yogc(ra). o III


HL. mapr.v.s[]nm s(rya)mandalamo64 ca(nd)r(amandalam) ///
///k[l]pa65yogenapraspa(ry)[e66] < O > III
///[p]dm.[m ] < O > ///
///.. ..///
Compare:
2: [lasujryamandalni nimagnni (124R4, npn)
candraniaiiclalareci[ta] (118V5, npn), etc.
Notes:
2: Pelliot 9.3 recto 2 does not indeed seem to correspond to Sch 124R4 or 118V5.
Sryamandala appears only once in Sch, while candramandala appears many
times (see index to Sch). Perhaps this image is related to the following passage
from the Kyagatsatisutta (Majjhimanikya 3:98.8-9 [No. 119]): ime pi candimasuriye evammaddhiddhike evammahnubhve pnin parimasati parimaj3

This should probably be restored as yavat. Cf. Sch 121R4 quoted below as a parallel passage to this

line.
64
65

Read -mandalam.
Read kalpa-.
E may be ai.

Fragments of the "Yogalehrbuch" in the Pelliot Collection

337

jati. Cf. tato bhagavmn utpadyate / grhitacandramandalah (Seh 159R5,


upeks)
3: Judging from the following praspa(ry)[a], perhaps we can supplement nadabefore k[l]pa-,
9.3 verso
a:
b:
c:
d:
e:

/// .. .. ///
///(pa)syati [sa]rvam ///
/// [ekaik](e)na srots67 sksmam v[yu]m < O > ///
/// .. y .. [n]irgat [pr]Itisamvedan[y]m < O > III
/// .. antarmukha(m) s[n]
///
Parallels:
d: nirgat pritisamvedany am (118V5, npna)
e: amdarmu[kha] (121V6, npna)

Other than 9.3 verso d, the correspondence to Sch is not certain. Judging from the similarity in the vocabulary, however, it is likely that this folio also belonged to the chapter on
npnasmrti.
9.4 recto
1:
2:
3:
4:

/// .. .. tv .. s ti[stha]ti vyu .. + .. ///


/// (catur)thadhynam muktv es dlrghat tato vyu tamtu .. ///
/// .[]s(v)s bhmisth 2 sarve satv < O > ///
///1. r nbhym manda < O > (la) ///

9.4 verso
a: /// [t]y vyu < O > ///
b: /// [bhajdraibhyo68 nihsrtyftdiiaii69 vyuman[d]a < O > (la) //
c: ///.. sm(r)[t]i70 prati smrtinm tailapurnabhjana .[r]. ///
d: /// rigrhitni pasyati.. + .e .. ///
Compare:
b: vymisrh adho yvad vyumanda[l](am) (125V2, npna)
pravhah adho y(vad y3yumandalam) (152V1, karun)
c: smtarba[hi]s ca t[ai]la(p)[](rnam) (125R2, npna)
67
68
69
70

Read srotasa.
Read bhadrebhyo.
Read -dho.
Read smrtiml

338

Nobuyoshi Yamabe

Notes:
b: Vyumandala appears many times in this text, but no passage from Sch exactly
corresponds to this line.
c: Here again, Pelliot and Sch do not precisely agree. For tailaprnabhjana, "a
vessel filled with sesame-oil," see the Samyuttanikya (Janapada, 5:169-70
[No. 47.20]); Telapatta-Jtaka (Jtaka No. 96,1:393-401); Wayman 1961,12223; Ruegg 1967, 165.
Again, it is difficult to identify the exact place of this folio in the text. For now I would
like to relate this folio to the chapter on napanasmrti based on the common occurrence
of tailaprna, "filled with sesame-oil."
9.5 recto
a:
b:
c:
d:
e:

/// + ..///
///. yam [s]rtv ///
/// [d].'rsan[nu]gu71 < O > ///
/// .. y [sop]eksa[h] ///
///.. + .[!].[!]///

9.5 verso
a:
b:
c:
d:
e:

III x.. .[y].. gill


III [d]. ..ta[sa]m.pa///
///.. .[ai]vada[s].<O>///
///.. [sa]tva < O >///
///+ +///

Unfortunately this folio is too fragmentary to make any meaningful observations.


9.6 recto
a: ///
///
b: /// vcam marmbhighatti ///
c: /// [svajyam datum iccha[t]i ///
9.6 verso
a: /// .. bhflto yva[t] t ///
b: /// [] .. ratgandham[ly]. ///
c: ///... ..bhik///

71

Gu may be su.

Fragments of the "Yogalehrbuch" in the Pelliot Collection

339

Compare:
a: (misri)bhfitah yvad vyuma[n]da(lam) (163R1, upeks)
Again, the folio is too fragmentary to make significant observations.

Observations
Unfortunately, the identity of the best preserved folio 9.1 is uncertain, so it is difficult to
make a final assessment of this manuscript. Nevertheless, because of the significant similarities in the phraseology and the contents, it is clear that Pelliot Sanskrit nos rouges 9.16 were closely related to the YL. At the same time, it is also very likely that the original
text of this manuscript was not identical to the YL; folio 9.2 strongly suggests that this text
was significantly shorter than the YL. Here we should note that one of the Hoernle fragments (photo No. 178) also seems to have come from an abridged and somewhat variant
version of the YL (Hartmann 1996, 131).
The existence of several manuscripts closely related to the YL would indicate that the
YL enjoyed some popularity on the Northern Route of the Tarim Basin, even if it has not
been translated into Chinese or Tibetan (cf. Hartmann 1996, 131). It would also be reasonable to infer, as Hartmann does (ibid., pp. 131-32), that, in the case of the YL, the
existence of the text reflects the actual practice of meditation, since the YL is not a canonical text that could have been held just for the sake of veneration.72
Schlingloff (1964a, 13; 1964b, 146) suggests that the birch-bark manuscript of the YL
(SHT 150) may have been copied from an Indian original. This is an important point to
keep in mind. At the same time, we should also note that, judging from the existence of
the divergent manuscripts, the tradition of the YL does not seem to have been standardized
in the Kucha area.73 Since the Pelliot manuscript is written in the standard Central Asian
format (on paper in Northturkestan Brahmi), it must have been written in Central Asia. Of
course, it may have been copied from another Indian version, but we should note that there
is no evidence to prove that the YL circulated widely in India. Therefore, given the available information, it might be possible to suspect that the variant versions of the YL were
created in Central Asia based on the core tradition from India, rather than that divergent
versions of the YL were brought from India. In other words, residents of the Kucha area
might have had their own recensions of the YL. How distinct their recensions may have
been from the Indian tradition largely depends on the identity of Pelliot Sanskrit n rouge
9.1. If this folio belonged to the chapter on dhtu, then we must say that the Kucha people
were exercising a significant degree of originality in regard to this text. If, however, this
folio belonged to the ill-preserved chapter on asubh, it is difficult to assess the degree of
their originality. Unless we find more fragments of the same manuscript, we must refrain
from making a definitive statement concerning this point.

72

In China, the "visualization surras" were often used for devotional purposes as well. In those cases,
however, we should note that the surras were believed to be canonical.
73
Cf. Yamabe 1999b, 63; 100.

340

Nobuyoshi Yamabe

Bibliography
BERGER, HERMANN

1967

Review of Ein buddhistisches Yogalehrbuch, by Dieter Schlingloff. Gttingische Gelehrte Anzeigen 219(3/4): 309-10.

BRETFELD, SVEN

2003

Visuelle Reprsentation im sogenannten buddhistischen Yogalehrbuch" aus Qi'zil. In Indien


und Zentralasien Sprach- und Kulturkontakt, ed., Sven Bretfeld, and Jens Wilkens, 167-205.
Wiesbaden: Harrassowitz Verlag.

DELEANU, FLORIN

1993

Srvakayna Yoga Practices and Mahyna Buddhism. Waseda Daigaku Daigakuin Bungaku

Kenkyka kiy bessatsu Tetsugaku, shigakuhen - f - S H ^ ^ ^ ^ K ^ ^ W ^ L ^ S S S U f l H ' 1t


^ J J ^ I (Bulletin of the Graduate Division of Literature of Waseda University, special
issue, Philosophy and History) 20:3-12.
ENOMOTO FUMIO

1984

1993

2000

W&^JCM

Higashi Torukisutan shutsudo Bonbun Agon no keifu M h A ^ ^ 9


^tH^tXM^^^It
(The Affiliation of the Central Asian Stra Fragments). [Kach Tanki Daigaku] Kenky kiy
[MWMM
] W35IBS (Bulletin of Kach Junior College) 29:11-26.
Keihin: Indo Bukky no ichi chshinchi no shozai Jfif : -i 1/ K { A i t o ^ 4 ^ i t i ^ @ f & (Jibin, the Location of a Center of Indian Buddhism). In Tsukamoto Keish kyju kanreki kinen
ronbunsh, Chi no kaik: Bukky to kagaku M^WW^kSMMtil&tmJch
P<>BI?: (A
Wi t. f 4 ^ (Encounter of Wisdom between Buddhism and Science: Essays in Honour of Professor Keisho Tsukamoto on His Sixtieth Anniversary).
'Mlasarvstivdin' and 'Sarvstivdin.' Vividharatnakarandaka. Indica et Tibetica 37, ed. Christine Chojnacki, Jens-Uwe Hartmann, and Volker M. Tschannerl, 239-50. Swisttal-Odendorf.

HARTMANN, JENS-UWE

1996

Neue Fragmente aus dem "Yogalehrbuch." Festschrift Dieter Schlingloff zur Vollendung des
65. Lebensjahres dargebracht von Schlern, Freunden, und Kollegen, ed. Friedrich Wilhelm,
127-35. Reinbek: Dr. Inge Wezler, Verlag fr Orientalistische Fachpublikationen.

HARTMANN, JENS-UWE, AND KLAUS WILLE

1992

Die nordturkistanischen Sanskrit-Handschriften der Sammlung Hoernle (Funde buddhistischer


Sanskrit-Handschriften, II). In Sanskrit-Texte aus dem buddhistischen Kanon: Neuentdeckungen und Neueditionen, vol. 2, ed. Jens-Uwe Hartmann, Klaus Wille, Claus Vogel, and Gnter
Grnbold, 9-63. Gttingen: Vandenhoeck & Ruprecht.

HORSCH, PAUL

1967

Review of Ein buddhistisches Yogalehrbuch, by Dieter Schlingloff. Asiatische Studien/Etudes


Asiatiques 21:140-41.

INOKUCHI TAIJUN # 7 P MW
1966
Saiiki shutsudo no bonbun yuga ronjo MfiKttji^^^SfJJPfralf (*A Sanskrit Yoga Text
Excavated in Central Asia). Rykoku Daigaku ronsh t l ^ ^ ^ f r a i l (The Journal of Ryukoku
University) 381:2-15.
INOKUCHI TAIJUN, ED.

1989

A Catalogue of the Sanskrit Manuscripts Brought from Central Asia by Paul Pelliot Preserved
in the Bibliotheque Nationale (Preliminary). Kyoto: Institute of Buddhist Cultural Studies,
Ryukoku University.

LAMOTTE, ETIENNE

[1949] 1981 Le traite de la grande vertu de sagesse de Ngrjuna (Mahprajnpramitsstra), vol. 2.


Louvain-la-neuve: Institut Orientaliste, Universite de Louvain.

Fragments of the "Yogalehrbuch" in the Pelliot Collection


LIN LI-KOUANG

1949

341

P^%%

UAide-memoire de la vraie loi (Saddharma-smrtyupasthna-stra): Recherches sur un stra


developpe du Petit Vehicule. Introduction by Paul Demieville. Paris: Adrien-Maisonneuve.

MEIER, F. J.

1970

Review of Ein buddhistisches Yogalehrbuch, by Dieter Schlingloff. Orientalistische Literaturzeitung 65(5/6): 292-94.

MINAMI RYSH ; ^ i i #
1995
Kan muryju ky no seiritsu to zenkan kyten | f i & ^ m # l l j (Dj$&hWW$k&
(The
Compilation of the "Guan wu Hang shou jing" and the Scriptures on Meditation). Taish

Daigaku kenky kiy Ningengaku-bu, Bungaku-bu ^ Z E ^ ^ W ^ f c S A ^ S JC^U


(Memoirs of Taish University, Faculty of Human Studies, Faculty of Literature) 80:67-97.
RUEGG, DAVID SEYFORT

1967

On a Yoga Treatise in Sanskrit from QMl. Journal of the American Oriental Society 87(2):
157-65.

SANDER, LORE

1968

Palographisches zu den Sanskrithandschriften der Berliner Turfansammlung. Verzeichnis


der Orientalischen Handschriften in Deutschland, Supplementband 8. Wiesbaden: Franz
Steiner.

SCHLINGLOFF, DIETER

1964a
1964b
1966

Ein buddhistisches Yogalehrbuch: Textband. Sanskrittexte aus den Turfanfunden, vol. 7. Berlin: Akademie-Verlag.
Yogavidhi. Indo-Iranian Journal 7(2, 3): 146-55.
Ein buddhistisches Yogalehrbuch: Tafelband. Sanskrittexte aus den Turfanfunden, vol. 7a. Berlin: Akademie-Verlag.

SCHMITHAUSEN, LAMBERT
1970
Zu den Rezensionen des Udnavargah. Wiener Zeitschrift fr die Kunde Sdasiens und Archiv
fr Indische Philosophie 14:47-124.
WALDSCHMIDT, ERNST, WALTER CLAWITER, AND LORE HOLZMANN

1965

Sanskrithandschriften aus den Turfanfunden. Part 1. Verzeichnis der Orientalischen Handschriften in Deutschland, vol. 10, pt. 1. Wiesbaden: Franz Steiner.

WAYMAN, ALEX

1961

Analysis of the " Srvakabhmi" Manuscript. University of California Publications in Classical Philology, vol. 17. Berkeley: University of California Press.
|Jj|5tgfi
The Significance of the "Yogalehrbuch" for the Investigation into the Origin of Chinese Meditation Texts. Bukky bunka {UfcXiY* (Buddhist Culture) 9:1-7.
The Stra on the Ocean-Like Samdhi of the Visualization of the Buddha: The Interfusion of
the Chinese and Indian Cultures in Central Asia as Reflected in a Fifth Century Apocryphal
Stra. Ph.D. Dissertation. Yale University.
Visionary Consecration: A Meditative Reenactment of the Buddha's Birth. Forthcoming in the
proceedings of the conference, "The Birth of the Buddha," held at Lumbini International Research Institute, October 4-7, 2004.

YAMABE NOBUYOSHI

1999a
1999b

n.d.

An asterisk (*) in this bibliography indicates that the English translation is made by this
author.
At the last stage of this project, I had a chance to examine the original manuscript at the
Bibliotheque Nationale during my trip to Paris in August, 2006, funded by Grant-in-Aid
for Scientific Research (C). I thank Japan Society for the Promotion of Science for providing me with this grant.

342

Nobuyoshi Yamabe
Pelliot Sanskrit n rouge 9.1 (gauche)

Fragments of the "Yogalehrbuch" in the Pelliot Collection


Pelliot Sanskrit n rouge 9.1 (droite)

-i ' ' 1

/ I

:i

343

344

Nobuyoshi Yamabe
Pelliot Sanskrit n rouge 9.2

^ ^

Fragments of the "Yogalehrbuch" in the Pelliot Collection


Pelliot Sanskrit n rouge 9.3

345

346

Nobuyoshi Yamabe
Pelliot Sanskrit n rouge 9.4

.^ .. /

Fragments of the "Yogalehrbuch" in the Pelliot Collection

347

Pelliot Sanskrit n rouge 9.5

-; I

Maas

Pelliot Sanskrit n rouge 9.6