You are on page 1of 112

Inex

HOMES
Page 41

52
%

mo
re
rea
de
rs *

in
th
ew
es
te
rn
su
bu
rb
s* s

Cambridge

Vol 42 No.36

Ph. 9381 3088, 276 Onslow Road, Shenton Park, 6008.

www.postnewspapers.com.au

Sweaty bedside manner

September 5, 2015

ee
pa
ge
2

Sell Subi
Oval for
cricket
By LLOYD GORMAN
Subiaco Oval should be sold
and demolished, and the cash
used to rebuild the WACA
ground, cricket bosses said
this week.

Charity push Portia Smallbone, left, Cassandra McCloskey, Daniel Dorevitch, Danielle Malatzky, Sarah Cole, Malcolm Teo, and Jennifer
Alderson train for their pyjama bed-push. Photo: Paul McGovern

rainee doctors will probably develop a bit


of a sweaty bedside manner in the name
of a good cause.
A large group of pyjama-clad medical students plan to push a hospital bed from QEII
Medical Centre through Subiaco and into

Perth next Friday for Radio Lollipop.


They will push the bed from the medical
library in Monash Avenue, up Thomas Street,
down Rokeby Road and into Hay Street, where
they will make a pit stop at the home of Radio
Lollipop, Princess Margaret Hospital, before

heading up Murray Street into the city.


Organisers Portia Smallbone and Cassie
McCloskey from the charity arm of the WA
Medical Students Society said the bed push
would start at 8am and take about 3 hours
to complete.

Giant road trains


rumbling our way

The WACA would form part of


a two-stadium model for Perth,
with the new 60,000 stadium at
Burswood, across the river.
A WACA report published
on Thursday said a compelling
case existed for significant redevelopment of the WACA, which
would get state and federal government support and funding.
The Premier has been very
clear that any state government
consideration of funding for development of the WACA ground
would only be on the following
basis ... including co-location of
the WA Football Commission at
the WACA, enabling the state
government to demolish and
redevelop the current Subiaco
Domain Oval site, the report
said.
It cited a radio comment by
Premier Colin Barnett that
he didnt see any future for
Subiaco Oval and that he urged
the WAFL and the Football
Commission to get together
and co-locate at the WACA.
Subiaco councillor Julie
Matheson, a WACA member,
attended the launch of the
WACAs $100million plus plan.
I was shocked to see the WA
Football Commission form part
of the WACA redevelopment and
Please turn to page 109

RARE LAND FINALLY ON MARKET


See POST Property page 99

By LOUISA WALES
Massive outback-style road
trains are coming to the western suburbs.
The road trains, known as
B-triple multi-combination
trailers, would be allowed on
the controversial Perth Freight
Link, Main Roads WA confirmed
to the POST this week.
The three-trailer road trains
are already allowed access
to Curtin Avenue, which runs
through Leighton, Mosman Park
and Cottesloe.
Few now use this route, but
when thousands of vehicles are
funnelled into the North Wharf
container terminals from the
southern suburbs, leakage
will see them use Curtin Avenue
to get to the northern suburb
industrial areas, according to
transport experts.
The governments own modelling showed a likely 42% leakage from the proposed tolled
freight link on to surrounding
roads, Opposition Leader Mark
McGowan told a public forum in
Cottesloe this week.

Heres
where
we go

Trucks like this B-triple are allowed to rumble through the western suburbs.
Cottesloe council has voted
to lobby local MP and Premier
Colin Barnett to remove the current permission for restricted
heavy vehicles to use Curtin
Avenue.
By 2050 the freight link will
funnel 13,000 trucks per day
into East Fremantle and North
Fremantle on their way to
Fremantle port.
Mr Barnett has said truck
drivers may be confined to the
new link, but stopped short of
making a commitment (Link
will bring 13,000 trucks a day,
POST August 29).
B-triples can carry up to three
12m-long containers at a time,
can weigh up to 127 tonnes and
are up to 53.5m long.
These juggernauts are not
urban technologies, Curtin
University sustainability expert

Peter Newman said.


They are road trains that
belong outside cities.
They are used for long-haul
freight transport in outback
areas of WA and across the
Nullarbor, and are allowed only
on a limited number of roads
in the eastern outskirts of the
Perth metropolitan area.
In theory, they are permitted
on the southern end of Stirling
Highway to McCabe Street,
Mosman Park and along Curtin
Avenue and West Coast Highway
to the north.
The government has kept a
tight lid on the fact the road
trains are coming, but Main
Roads has confirmed they will
be allowed to travel along the
Please turn to page 100
See also: Cott forum _ page 9
Cottesloe council vote page 27

The POST is local and relevant with the highest readership in the Western Suburbs. See www.postnewspapers.com.au

Registered by Australia Post publication No. WBF1752.

Each week 51,990 copies of the POST are distributed, reaching every household and business in the western suburbs.
These suburbs are shown on the map on page 2. Extra copies are delivered to other selected riverside suburbs.

Page 2 POST, September 5, 2015

Letters to the POST

Editor, 276 Onslow Road, ShentonorPark


email558
to letters@postnewspapers.com.au;
or fax toRoad,
The Editor
at 9388
andevery
address
should
be given,
and there
Please send
emailletters
letterstotoThe
letters@postnewspapers.com.au;
SMS6008;
to 0429
001; or mail to: The Editor, 276 Onslow
Shenton
Park2258.
6008.Full
Wename
require
letter
intended
for publication
should
be a the
daytime
phone
Boring
letters,phone
or thosenumber
longer than
300 words, willBoring
be cut.letters,
Email letters
shouldlonger
carry the
writer
residential
Deadlineisisnoon
noon Wednesday.
Wednesday.
to
include
writer
s fullnumber
name for
andverification.
address plus
daytime
for verication.
and those
than
300s full
words
will beaddress.
cut. Deadline

Bishop saw plans we


were told did not exist

Heritage upgrade
likened to theft

It was both heartening and puzzling to read


the excellent front-page report by Rhiannon
Shine and Linda Callaghan in last weeks POST
(Bishop, SAS developer at odds over security).
Heartening to know our federal Curtin MP,
Julie Bishop, is worried about the proposed
development of private houses at Seaward
Village. Puzzling because Ms Bishop said she
had seen the plans.
Local residents who had a meeting with
Defence Housing Australia (DHA) the day before Ms Bishop spoke to the POST were told as
they have been told many times by DHA there
were no plans, only concept drawings.
So far, the two drawings we have seen have
been very confusing and alarming.
We ask Ms Bishop to listen to the concerns
of her electorate and to keep asking questions
about this development.
Is she aware traffic from the development
will be directed across A-class reserve 19283,
which has been in place for 90 years?
That the intended use of local community
roads is not part of the improvement plan DHA
has presented to the WA Planning Commission?
That new defence houses are being designed
to sit back-to-back with new private houses,
increasing the nervousness of defence families?
That the improvement plan that has been put
to the WAPC does not show the impact of the
project on the local community, yet complies
with its guidelines?
Sadly, if this shocking development proceeds it
will only be after completion, when it is too late,
that the full extent of its harmful impact will be
felt by both civilian and defence communities.
Malcolm Murray
Sayer Street, Swanbourne
Wembley Woodlands
Downs
Churchlands
City Beach

City Beach

I refer to the report, Heritage fight (POST,


August 29) about Peppermint Grove councils
heritage listing upgrade of 58A Leake Street
to category 1.
In a feeble defence of its action, shire
president Rachel Thomas said: Recent
information and feedback [from residents]
has underlined the importance of identifying
and protecting the shires heritage.
In my view, the councils action in upgrading the heritage listing is like common theft.
It is likely to have devalued the property,
has denied the owners their right to deal
with their own property in accordance
with normal planning conditions, and has
financially burdened them with building
From last weeks POST. Peppermint Grove council has upgraded this houses restrictions and requirements above and
heritage listing.
beyond the norm.
If this house is deemed so worthy of heritage protection, then it is the entire community of Peppermint Grove that should bear
I have just paid my rates, due just died a natural death.
the cost of maintaining the property to this
That was wrong, because before
today.
standard, not just the owners.
I do this begrudgingly, because council contractors came to my
I wonder how many of the councillors, and
with the advent of spring, I am street, the system was working
those residents who provided the feedback
now forced to order a new Orbit perfectly.
to the council, would be willing to financially
Correspondingly, I pay my rates
Irrigation controller, total cost
support their decision?
under sufferance.
$184.15, not including fitting.
James Young
And as such, I am still very anAs a consequence of the conThe Esplanade, Peppermint Grove
tractors laying a new concrete noyed at the whole process.
And, Im led to believe, I am not
footpath outside our house, my
faithful retic controller was no the only one who was dissatisfied
with the contractors duty of care,
longer programmable.
I have had people from the or lack thereof, during this parSubiaco council services area come ticular work in our street.
Peter Hayes
around to look at it, but they were
Waylen Road, Shenton Park
of the opinion that the controller

Why I begrudge Subi my rates

Its time we had a


change in Cambridge

Perth CBD

Wembley

West
Leederville
Jolimont
t
Hackett Estate
West
Daglish
Subiaco Perth
Mount
Claremont
Shenton Park
Crawley
Swanbourne
Hollywood
d
Floreat

Cottesloe
Beach

North
Fremantle

Matilda Bay

Cottesloe
Claremont Nedlands
Peppermint
Grove Fresh
Fres Dalkeith
Water
Bay
Swan River
er
Mosman
Park

DUNG HO
276 Onslow Rd,
Shenton Park

WEED FREE
Sheep Manure

80lt bags $11 ea


or

10 for $99

Heres where we go

Other Manure &


Potting Mixes/Mulch

Every household and business in this area has a POST


delivered free each week.

40lt bags $7.70 ea

Bulk drops are also made to other riverside suburbs.


The POST delivers 52,000 newspapers each week.

FREE DELIVERY
Ron

The POST is read each week by


more readers than any other
local publication in the western suburbs.*

52%

News and advertisements


are published in all four editions
of the POST.
Contact us: for news and all
advertising enquiries
phone 9381 3088, fax 9388 2258.
Classieds: can be faxed, or lodged via our secure
website. See the inside back page for details.
Email: mailbox@postnewspapers.com.au
* Roy Morgan Research March 2015

www.postnewspapers.com.au

0423 590 015

Thank you Mr Trowell for pointing out that


indeed anyone can run for office (Why change
a top council?, Letters, POST, August 29).
Cambridge council may have developed
exciting new facilities for the area previously,
but the future vision is only as good as those
people who are guiding it.
It would appear that we now have some
council members who have developed tin
ears and are not representing our community
particularly well.
It is time for change, and it is exciting that
we have a group of new and capable people
wanting to get involved.
A vote for Keri Shannon and selected candidates on October 17 will ensure we have a
top council in the future that has the communitys interests ahead of its own.
Jon Richardson
Catesby Street, City Beach
More letters pages
36, 38

S
U
O
I
C
I
DELSA
LANKOODLES

ESH AL
R
F
H
T
I
MADE NWD OUR SPECI
VEGESPIACED CHICKEN
S

Exceptional oral health care for


all children
in a friendly and nurturing
environment, promoting
healthy mouths for life.

263 Stirling Hwy, Claremont


www.kinderdental.com.au

No referral required

9384 8800

MOSMAN PARK

17 Lochee Street Tel 9384 5697


7am - 8.30pm Mon to Sun

Open 7 days
NEDLANDS
25A Hampden Road Tel 9386 1661
9am - 3pm Mon to Fri

has just confirmed


h

ACTON is the Number 1 Real Estate Group


Sales Market Share for the 12 months to March 2015
PROUDLY 100% WESTERN AUSTRALIAN OWNED AND OPERATED (SINCE 1969)

POST, September 5, 2015 Page 3

Claremont in dark
on social housing

e
h
t
s
i
n
e
e
Gr
new black

By DAVID COHEN
Claremont residents and their
council say they are in the dark
over state government plans for
an Ashton Avenue block.

By DAVID COHEN
Rachel Siewert has been
rocking the Senate with recycled fashion.
The Greens Senator from WA
was inspired by style prompts
for 21 days and used op shop
clothes for her looks.
It was part of Restyle, which
is part of the Perth Fashion
Festival, Ms Siewert said.
Every day there was a
prompt and you had to find
something that went with it.
Prompts included black and
black, dapper, fringe, floral,
animal print and pencil skirt.
Some of the more challenging ones included neon and
fluoro, Ms Siewert said.
For those I wore a hot pink
dress and teamed it with a
jacket.
There were a couple of
prompts I couldnt wear in the
Senate the 90s denim look
wasnt appropriate.
Ms Siewert had a look
around the Salvation Armys
shop in Subiacos Rowland
Street on Wednesday.
She wasnt tempted by a pair
of Manolo Blahniks for $400
that cost the original owner
$1325.
Shop manager Kelly Morris
said a woman had donated four
pairs of Blahniks that hadnt
been worn.
Ms Siewert said op shops did
more than raise money for vulnerable people and families.
Ive found women in particular who are trying to find
work often dont have the
outfits employers expect of
them, she said.
I donate to op shops. If Ive
worn something a number of
times but its still good quality, I would rather someone

The land, on the corner of


Mofflin Avenue, is slated for
social, affordable, Defence, and
full-sale homes.
The Housing Department said
the final number and mix of apartments would be determined once
development approval had been
obtained.
Mofflin Avenue resident
Richard Smith wrote to Housing
Minister Colin Holt seeking
information about the departments plans.
In his reply, Mr Holt told Dr
Smith there would be approximately 25 apartments, but heights
and use had not been decided.
The main concern of residents
will be the height of the proposed
development, if it goes higher
than present housing, and the
additional number of cars in an
already busy and congested area,

Police visit ice home


Police visited the home of the
City Beach ice addict twice in
one day last weekend and interviewed a visitor neighbours
feared was a drug dealer.

Stylish Senator Rachel Siewert scours op shops near her oce


and home to look sharp.
else use it.
The campaign finished last
Sunday. Aims included encouraging people to donate to
op shops run by the Salvation
Army, Red Cross, St Vincent
de Paul Society, Good Sammys
and Anglicare.
Ms Siewert said several

Senators had asked her where


she got her braid jacket from.
She said there were snazzy
dressers in the Senate, and
they werent all female Greens.
Michaelia Cash doesnt
dress in clothes I would wear,
but she looks sharp, Ms
Siewert said.

Armani scammer strikes again


A POST reader who remembered a report about an
Italian con-artist targeting
the western suburbs came
face-to-face with the man in
Subiaco this week.
Gabrielle Brooks father, a
West Leederville resident, was
approached by the con-man in
the Subiaco Coles carpark on
Wednesday and asked for his
credit card details.
The con-man gave his signature spiel about being lost en
route to the airport.
He said he needed to borrow a credit card to buy his

Dr Smith said.
Also, with no community facilities, there will be a lack of trees
and green vegetation, creating
a hot concrete jungle that is not
conducive to the mental health
of its occupants.
These impacts will not be
assessable until the design is
available for public comment.
This process has not been
set out.
A department spokesman said
representatives from Defence
Housing Australia and the
Housing Authority met Claremont
council to discuss the proposal
on July 30.
There is no date yet for the first
formal presentation to Claremont
council, the spokesman said.
Council CEO Stephen Goode
said a Claremont worker had
been given an informal briefing.
In July, the department said
DHA had expressed an interest
in about 30% of the homes.
The department said it intended to retain up to 10% for
social housing and up to 20% for
affordable housing.

daughter an Apple computer


online to take back to Italy,
but he only had cash.
The man, who had an Italian
accent and drove a white SUV,
gave his victim a business card
which said D. A. Antonio,
Fashion Designer, Milano.
Last month, the POST reported that a Cottesloe resident
had almost succumbed to the
same Armani scam.
The West Leederville resident, a retired surgeon, told
the man his wife was in the
Brew Ha cafe and she had his
credit card.
The con-man followed him

into the cafe but ran away once


they were inside.
Gabrielle was also in the
cafe and remembered reading
about the scam in the POST.
She said her father had
thought he was doing the
right thing by helping a
stranger in need.
Its terrible the man has
to be caught, she said.
The Department of
Commerce has reported a man
with an Italian accent, going
by the name of Mr Antonio, is
selling jackets which he claims
to be leather and made by the
designer Giorgio Armani.

The first call to police was at


4pm after a man came out of the
Tarango Way home and collapsed
on the verge.
The addicts mother also arrived. Neighbours said she
screamed at police to take her son
away, while the addict screamed
at his mother to leave.
The officers left after 30 minutes, but were back just before
midnight.
He (the addict) was out the
front screaming in his underpants, a resident said.

This man seemed fatigued after


he visited a City Beach ice addicts
home last Saturday.
Police arrived, spoke to him,
and left.
Residents said Sunday was intermittently noisy as the agitated
addict prowled his home.
Police did not reply to a query
asking if anyone was arrested or
if any charges were laid.

Free
Market
Appraisal
Your local agent with
25 years experience.

David Azzopardi
0418 924 950

PE

NO

LIFESTYLE & SUPPLEMENTS

>qi^kb^g\^<hmm^leh^lg^p^lm
p^eeg^ll]^lmbgZmbhgZg][^
lZ_^%gZmnkZeZg]hk`Zgb\'
Ocean Health are dedicated
to the support of Australian,
organic and fair trade farming.
They are highly selective about
what they stock and are committed
to high quality, sustainably
sourced, wholesome products.

Oblbmnlmh]ZrZg]^qi^kb^g\^Z
]b__^k^gmdbg]h_ebobg`

OceanHealthCottesloe
Shop 9, 36 Eric Street, Cottesloe
(08) 6181 4297
vicki@oceanhealth.com.au

Are your childs NAPLAN results


concerning you? Perhaps we can help.
One-to-one specialist tuition for students who learn
differently
Evidence-based individually tailored tuition
Specialist tutors at affordable fees
Age 6 to 18 years old
Literacy/English and numeracy/maths focus
Face-to-face or personal videoconferencing sessions
Not-for-prot organisation
Suite 5/4 Gugeri Street, Claremont
(08) 9383 4812 www.aceseducation.org.au

LOCAL
SUPPLIERS

We want to show you what


Fruit and Veg really taste like.
wafreshandfruity.com.au
Youll nd more than just fresh fruit and vegetables,
were your local online grocer for all things fresh and fruity!

Page 4 POST, September 5, 2015

Page 4
Wilson close to home
Subiaco council isnt the only
branch of government having
a run-in with Wilson Parking.
Since its small beginning in
the 1960s, Wilson has grown
into a multinational company
and Australias biggest carpark
operator.
Last month, the ACT govern-

ment passed emergency laws to


protect the identity of drivers
who overstayed in Wilson-run
carparks.
Wilson had taken the government to court to access the
names and addresses of the car
owners.
In June, the NT government
blocked a court order demanding it supply Wilson with the

names of drivers with outstanding fines at Royal Darwin


Hospital.
Two years before the dispute
hit the WA Supreme Court,
former POST reporter George
Williams was the first journalist
to report that Department of
Planning and Infrastructure
had given Wilson the details of
25,000 vehicle owners in 2008.

Keep Cambridge
Moving Forwards

Peppermint Groves biggest eyesore has been vandalised again.

Guilty grati

During the past eight years the Town of Cambridge has


become one of the best councils in Western Australia.
We have transformed from a
council without a plan to a council
with clear direction.
We have transformed from a council
without unity or leadership to one
where the council and the
administration work together to
deliver major improvements for our
residents
.
8 years ago I promised to deliver new leadership and strong financial
management to the Town. My record shows that I have achieved that.

IP FOR CAMBRIDGE
FRESH NEW LEADERSH

r
o
y
a
M
r
fo
s
r
e
h
it
W
n
o
Sim
mbridge needs new
Ca
leadership

lems behind us.


sand and put the past prob
I will draw a line in the
Town.
the
of
d
goo
the
for
together
The Council must work

sound
Cambridge needs
ent
financial managem

eeds it will receive


the substantial cash proc
The Council must reinvest
ner.
man
ble
onsi
resp
from land sales in a
s
to ensure that our Town
er in investment banking
future.
I will draw on my care
wisely, now and for the
and
y
fairl
ated
alloc
revenues are

hter Phoebe,
Simon Withers with daug
and Willie O.
wife Emma and dogs Elsa

Cambridge,
r to do with the Town of
k to me about any matte
If you would like to spea
-2959.
9285
on
me
call
e
pleas
(08) 9285 2959
Beach WA 6015 Phone
s, City
30 Branksome Garden
Authorised by Simon Withers

Post Newspapers 22 September 2007

Under my leadership the Town of Cambridge has prospered and we have


built some fabulous facilities, but the job is not yet done.
A massive amount of money is about to flow into the town and we must
seize the opportunity to set up our Town for the future.
I have the skills and the experience to do this - my record speaks for itself.

Why risk our future?

Vote for someone who delivers,


not someone who makes promises.

Re-elect
Simon Withers
as Mayor
Authorised by Simon Withers, 40 Branksome Gardens, City Beach WA 6015 Phone 0456 193 744

Graffiti vandals left some qualified abuse on Radhika Oswals


unfinished mansion on Wednesday.
SEE! INDIANS ARR was
sprayed on a dome at the property

in Bay View Terrace, Peppermint


Grove.
Then the vandal added: NOT ALL
OF THEM THOUGH OBVIOUSLY.
Ms Oswal is trying to stop the
councils demolition order against
her half-completed building.

Beds go abroad
Shenton Park Rehab Hospital has
closed to make way for high-rise
development, but some of its beds
have found their way to a new life
in Somaliland in Africa.
The equipment was in very good
condition which meant we could
donate it for further use, said
RPH director of infrastructure and
facilities John Doherty in a hospital
newsletter.
He said 46 hospital beds that
were not needed in WA had been
donated to Australian Doctors for

Africa (ADFA).
The beds were shipped to
the Hargeisa Group Hospital in
Somaliland, a public hospital for
the less fortunate.
In a thank-you letter to RPH,
Rachael Maritanu from ADFA said:
The donation has been gratefully
received by the hospital and community.
The beds will be serviceable
for many years and are a major
improvement to a newly renovated
ward.

Stirling Highway Hub to get to the nub


A Nedlands marketing and communications firm has been given
the job of rebranding Subiaco CBD
as a top shopping and social spot.
Based in Stirling Highway, not
far from the rose garden, The Hub
was set up in 2005 and counts some
big mining companies, government
departments, charity and other

groups as clients.
The creative company will develop a name, logo and hashtag
for the Subiaco centre.
Subiaco CEO Ian Hill said he expected the work to be completed
within two months, to coincide
with the launch of the Markets on
Rokeby late next month.

Subi Black Dog riders


to hog US roads
A three-week motorcycle charity ride across America later
this month, which may include
Arnold Schwarzenegger, can
trace its beginning back to the
western suburbs.
The Black Dog Ride will see 65
Australians travel 4300km from
New York to Los Angeles from
September 13 to October 3 to
raise awareness of depression
and suicide prevention.
They hope to raise $1million
for Mental Health First Aid USA
which helps soldiers, police and
emergency workers cope with
stress and trauma.
The ride starts just after the 14th
anniversary of the September 11
attack on the World Trade Centre,
the aftermath of which involved
thousands of emergency workers.
Former Claremont resident
Steve Andrews and long-time
friend Subiaco real estate agent
Jack Michael organised the ride.
When Steve lost his mother
and his best friend lost his wife
to suicide, he rode solo across
Australia in 2009 to raise awareness of mental illness.
Since then the Black Dog Ride
has raised $2million in Australia.
Jack, who had been best man at
Steves wedding, also lost his wife
Anna to suicide.
I had no idea until my wife
took her own life that she had
even suffered from depression,
said Jack, who will be riding his
Harley Davidson on the US tour.
She kept it from all of us and
I only wish I had known anything
about it or the warning signs so
that I might have had a chance to
do something.
Jack said there was a high

suicide rate among military and


emergency service veterans who
had a high risk of developing
depression, anxiety and posttraumatic stress disorder.
It is estimated that there is a
suicide attempt every 13 minutes
in the US and 78% of all suicides
in US are by men, he said.
He said mental health firstaid training could help reduce
suicides.
T he group hopes form er
Californian governor, motorcycle
enthusiast and Hollywood star
Arnold Schwarzenegger will join
them near the end of the ride.
They hope to meet many Aussies
along the way as well.

Subiaco real estate agent Jack


Michael on his Harley Davidson.

POST, September 5, 2015 Page 5

Mercury research has a silver lining


St Hildas Year 11 student
Emily Price is heading to
Melbourne next week to
collect the inaugural Dr
Roneal Naidu Award for
research on environment,
food quality and human
health but its a trip she
didnt expect to be making.
As part of the community
service component for my
silver Duke of Edinburgh
Award, I decided to research
the different levels of mercury in fish and the health
impacts this can have on
consumers, Emily said.
She said her project was
inspired by Professor Ravi
Naidu, managing director of the Co-operative
Research Centre for
Contamination Assessment
and Remediation of the
Environment (CRC Care),
which is sponsoring the
award.
The research took a couple of weeks of going through
existing unprocessed data
and collating my findings,
Emily said.

I looked at mercury levels


in a variety of fish species
from a range of locations
across the world and was
really surprised at the potential health impact even
small levels of mercury can
have.
I have always assumed
that eating fish was a good
source of protein, and fish oil
is also promoted as having
incredible health benefits.
But there are people who
can be at risk with even low
mercury levels.
It was quite an eye-opener to learn that widely sold
common tinned tuna can be
a major culprit.
Unbeknown to me,
Professor Naidu shared
my report with a few of his
colleagues at CRC Care and
it inspired them to begin a
high-school essay competition that focuses on environmental sustainability and a
safer, cleaner environmental
future.
I am the inaugural winner
and will receive my $1000
prize at the 2015 Cleanup

Emily Prices research into the mercury levels of canned fish has won her an inaugural environmental award.
CRC Care brings together
industry, government, science and engineering to
prevent, assess and clean
up environmental contamination.

Conference, where they will


also launch the national
competition for 2016.
The award was named in
honour of Professor Naidus
son.

Wilson Parking talks pinged


By LLOYD GORMAN

A planned meeting between


Subiaco council and Wilson Parking
last Tuesday was cancelled after a
group of councillors objected.
Some councillors threatened to
call an emergency council meeting to
order the CEO, Ian Hill, not to meet
the private carpark operator.
Mr Hill had said after last weeks
council meeting that he would meet
Wilson for a discussion.
At that council meeting, Wilson was

branded a corporate psychopath


and councillors voted for a report to
the September 22 council meeting
which could end an agreement with
the company.
Councillor Murray Rowe said in an
email on Monday morning this week:
I notice there is still intent to hold a
meeting with Wilsons prior to the report
on this situation coming to council.
There are a number of councillors
who do NOT agree with that proposal.
If you are intending to proceed
with a meeting then please take this as

Infill hits the courts

EXOTIC IMPORTS

Ratepayers have asked the Supreme Court


to step into the Cambridge infill housing row.

BALI STYLE

The Coast Ward Ratepayers Association


lodged papers with the court last week asking
it to review the councils decision to change
the town planning scheme.
A hearing is due in just over a week.
Cambridges Amendment 31 to allow for
higher density and reduced setbacks on larger
blocks brought an outcry from many residents.
They raised $60,000 to fight it in court.
Protesting residents fear the Amendment,
now being considered by the WA Planning
Commission, will severely degrade the garden
suburb character of City Beach and Floreat.
Defenders of the plan say it will allow more
housing options with little impact.
Papers lodged with the court reveal the
grounds challenge the legality of votes on
Amendment 31 at two meeting of Cambridge
council, citing lack of quorums because of
alleged financial interest of mayor Simon
Withers, heritage issues, and allegedly misleading notices advertising the proposed changes.
Weve heard it all before and we do not
accept the claims, Mr Withers said. Our lawyers will respond and the court will decide.
Why were taking legal action: Letter page 36.

CLOSING
DOWN SALE
Closing Oct 2015
Everything must go >>>
Crazy Prices

immediate notice from that point of a


calling of a special meeting of council
to consider that action.
Mr Rowe, who owns and operates a
pharmacy in Rokeby Road, said the
large amount of feedback to councillors
had highlighted the need for the issue
to be carefully managed.
The community wants its council to
support business and residents alike to
achieve better parking amenity including access, considerate management
and reasonable cost, Mr Rowe said.
Please turn to page 109

YOGA FOR A MORE FLEXIBLE


BODY AND BRAIN

New classes starting


Thursday, September 10th. 6.30-8pm
WAREHOUSE CAF
221 Onslow Road, Shenton Park
For more information:
www.yogaforlifebalance.com
Trial class $10. Max 10 students.
Please email to register: suebill888@gmail.com
EVERYONE DESERVES YOGA

GOREY

Plumbing Services
Maintenance Specialist Roof Work
Hot & Cold Water Services
Bathroom Renovations Licensed Gas Fitter
Sewer Blockages & Drainage Works

0407 381 727


Subiaco, Claremont, Nedlands, Peppermint Grove, Dalkeith,
City Beach + all areas in Western Suburbs
PLMWA Lic No. 615 Gas Lic No. 6654

Independent Financial Advice

Need a better way to


resolve family issues?
Divorce or separation is a difficult time.
We have experienced solicitors to
assist you to achieve a settlement that
best meets the specic needs of you
and your children.

Keyperson Insurance (Illness, Accident, Life)


Portfolio Advice and Management
3/30 Collingwood St
Osborne Park
TEL: 9244 8130

Your local advisers:


Brendan Downes, Simon Phillips

www.exoticimports.com.au

41A Kirwan Street, Floreat

08 9284 1188

mon-fri 8.30-4.30pm sat 9-3pm


PERSONAL INSURANCE BROKERS

www.aurumplanning.com.au

www.clairskeeley.com.au

(08) 9228 0811

Page 6 POST, September 5, 2015

Paul makes his final Great Escape


By BRET CHRISTIAN
Paul Royle, whose death
in Nedlands last week at 101
left just one survivor of the
famous Great Escape, had no
idea why the Germans didnt
shoot him.

Paul Royle, German prison camp escape survivor, photographed by the POST
last year at Hollywood Village on the 70th anniversary of The Great Escape.
He turned 100 the same year. Photo: Paul McGovern

Our services are


tailored to meet your
home care needs

Personal Care
Respite
Domestic Assistance
Social Support
Shopping
Transportation
Home and Ga
Garden Maintenance
Care
End of Life Ca
Assistance
Medication As
Nursing

But the clue might be in his


name.
In 1944, 76 of a planned 250
prisoners tunnelled their
way out from Stalag Luft 111,
emerging near forest outside
the barbed wire, Paul told the
POST in 2009.
But a guard spotted number
77 and sounded the alarm.
By then, Paul and his escape
partner, Englishman Edgar
Humphreys, were half-an-hour
away, but 24 hours later as
they moved through a village
at midnight, the healthy young
men were spotted by home
guardsmen and recaptured.
Only three of the 76 had
made it to neutral countries
and freedom.
A furious Adolph Hitler
ordered that the re-captured
escapees be shot.
But Paul was among those
spared, with two other prisoners, one named Nelson and
the other Churchill, who were
not shot because the Gestapo
believed they had famous
relatives.
British man Dick Churchill
(94) is now the only surviving
member of the legendary
prison break.
Hitler was so enraged by the
escape that the Gestapo even
executed the German soldiers
who had failed to report the
theft of wire that the escaping

ST
PO
LE
EOP
P

A rare photo of downed Allied aircrew posing in Stalag Luft 111.


Paul Royle is standing in the back row at the right-hand end. The
photo was taken by a friendly German ocer, Hans Pieber, who
freely handed out prints to the prisoners.
airmen had used when they
rigged lights in their tunnel
under Stalag Luft 111.
Prisoners had dug three
tunnels, nicknamed Tom, Dick
and Harry.
Paul had helped spread soil
dug from Harry by filling false
trouser legs with dirt, pulling a
piece of string to release a nail
securing the bottom of each,
then walking new dirt through
old in the exercise yard.
Prisoners used 4000 bed
boards to shore up the sand
inside the tunnels.
In the end it made the
beds pretty uncomfortable,
Paul said.
Tunnelling was an activity
common to most German prison
camps, but on his return to
the camp Paul was grilled by
Australian pilot and peace
time Sydney newspaper reporer Paul Brickhill, who wrote

the book, The Great Escape.


It was later made into the
movie starring American prisoners and a motorbike, neither
of which featured in the real
thing, Paul said.
His flying days had ended
early in the war, in May 1940,
when the light Blenheim
bomber he was piloting at almost zero feet was shot down
over northern France by much
faster German fighters.
After the war he returned to
Kalgoorlie and mining as an
engineer, married twice and
had five children and eight
grandchildren.
He retired to Dean Street,
Claremont, and then to
Hollywood Village in Nedlands.
He died in nearby Hollywood
Hospital after breaking his hip
in a fall.
A memorial service was held
on Wednesday.

Oliver conquers
English Channel
By RHIANNON SHINE
No amount of Rottnest swims could have
prepared University of WA law student Oliver
Mills for the English Channel.

9388 3866
Mission accomplished Oliver Mills swam the
English Channel twice in less than two weeks.

ARE YOU
AGED 9 - 17?
Join our September School Holiday Program
which includes:
Creative Writing Workshop with Sally-Ann Jones
Barista Training
Mindfulness for Kids and Teens
Archery
Coding/programming (Unity Game Design)
Introduction to Babysitting
And more!

Tuesday, 29 and Wednesday, 30 September 2015

Bookings

Have
fun!
Meet
new
friends

Visit www.allsaints.wa.edu.au

Learn
new
skills

TOWN OF
CLAREMONT
Call for Nominations
Committee Vacancies
The Town of Claremont invites nominations
from local residents to serve on the following
Committees:
Audit and Risk Management Committee
Lake Claremont Management Committee
Foreshore Management Committee
Museum Committee
Meetings are generally held on a quarterly basis,
and the role of a committee member is an important
one. Council appoints people as committee
members that it considers have the interest of
the Town of Claremont at heart and have the
necessary expertise and knowledge to add value
to committee meetings. The role of a committee
member is to attend meetings and participate in
making decisions on recommendations to Council.
These recommendations are then used to assist
Councillors to make informed decisions.
Further information and nomination forms can
be obtained from the Governance Ofcer by
telephoning 9285 4300 or toc@claremont.wa.gov.au
Closing date: Nominations should be forwarded to
the Chief Executive Ofcer, PO Box 54, CLAREMONT
WA 6910 by Friday 25 September 2015.
Stephen Goode
CHIEF EXECUTIVE OFFICER

Oliver said he spent more than a year training


for the swim, with two solo crossings to Rottnest,
long hours in the pool and three early morning
swims a week in the Swan River.
Even swimming the Channel doesnt prepare you for swimming the Channel, because
it changes so often, Oliver said.
The English Channel is 35km across, but
strong tides mean swimmers can be forced to
swim almost double this distance.
Oliver, a former Scotch College student, came
close to failing.
He set off on July 11 in perfect conditions,
but after 11 hours of swimming, just 6km from
his destination, the pilot of Olivers support
boat aborted the swim due to rough conditions.
Devastated, he decided he couldnt give up,
changed his flight home, and waited in the
UK for favourable weather so he could have
another shot.
After 10 days of waiting anxiously for conditions to improve, Oliver got a text from his
skipper to say the window of opportunity was
open he had three hours to prepare for a
night-time crossing.
He set off about 10pm on July 31 and arrived
in France at 11.19am on August 1.
Oliver said despite the swells, jellyfish and
cold water, he had never wanted to give up.
Strong tides off the coast of France delayed
the finish significantly, with the last 2km into
the beach taking a gruelling two hours, as a
three-knot tide tried to throw me back into the
ocean, he said.
Olivers coach, former Australian longdistance swimmer Shelley Taylor-Smith, said
he had shown extraordinary discipline and
dedication.
It takes a champion mindset to make the
toughest of decisions to return to the English
Channel less than two weeks after the swim
was aborted, she said.
Oliver was on the front page of the POST in
2010 when, despite a broken arm, he became
the youngest solo swimmer in the Rottnest
Channel Swim.
He said after accomplishing the Rottnest swim
so young, he had set his sights on the Channel.
With swimming its about whats next, he
said.

POST, September 5, 2015 Page 7

Greens support 11
council candidates

y
h
t
l
a
e
h
s
e
e
b
Keeping
Boris Baer is trying to save
the world.
The UWA professor is investigating how to keep Australian
bees alive and will talk about
his work during the universitys
Research Week.
These prime pollinating
insects are so important,
Professor Baer said. About a
third of what we eat has to be
pollinated.
We are sitting on the last
remaining healthy bees on earth
and were trying to keep this
Noahs Ark as it is.
Australia is the only continent
not to have been hit by the varroa mite, which is disastrous
for bees.
The US has lost 10 million
hives in the past six years.
These animals are extremely
complicated, Professor Baer
said. One hive of 40,000 bees
has the neurons of two human
brains.
A hive collectively flies hundreds of times around the globe
every day.
Professor Baers lecture
starts at noon next Thursday,
September 10, at the Wilsmore
lecture theatre in the chemistry Oh, bee-have Boris Baer says Australia is a Noahs Ark when it
building.
comes to healthy bees. Photo: Paul McGovern

Kill Bill, says Claremont


The state governments City
of Perth Bill looks like it was
written on the back of a napkin, a Claremont councillor
said on Tuesday night.
The Bill was excoriated at
the meeting. Other descriptions
were beyond comprehension,
makes no sense, terribly drafted, and disenfranchising.

This is the worst Bill Ive


ever read, deputy mayor
Bruce Haynes said.
Claremont CEO Stephen
Goodes report recommended
the council express concern
about the Bill.
Mr Goode said unless good
explanations could be made
for Perth council taking parts

of Subiaco and Nedlands,


the Bill should be withdrawn
from Parliament.
The initial impetus from
this Bill is remembered
from the rhetoric around the
Robson Report, being that
Perth should enhance its
status and its capacity like
Please turn to page 100

By DAVID COHEN

The Greens are encouraging


their members to stand in next
months council elections.
The party says there will be 11
candidates across the metropolitan area, who they will help with
training and support.
Greens (WA) co-convener Giz
Watson would not confirm in which
councils members would stand.
The POST has heard there
could be candidates in Subiaco,
Cambridge, Nedlands, Vincent
and perhaps Victoria Park.
Ms Watson said: We are asking members who are interested
in local government to consider
putting their hands up and well
assist in the process.
Ms Watson said some members
who were keen to put their hands
up had approached the party for
help.
She said it was the first time the
Greens had offered this level of
training and support, though the
party had run basic information
sessions about local government
for the past 10 years.
She said the party would not be
endorsing any candidates.
If one of our members is a
candidate in a local government

election they may seek the support


of their local or regional group,
but this is not a requirement,
Ms Watson said.
She said in past years some local
and regional Greens groups had
done some local fundraising to
help candidates with leaflets or
advertising.
It will be the same at this election, Ms Watson said.
The only additional funding is
to hold information and training
sessions, which are being funded
from our central budget.
Ms Watson said it was well
known the ALP and the Liberals
were active in encouraging their
members and supporters on to
councils.
Most recently the Liberals
made a concerted effort to gain
the numbers on local councils to
push through the governments
amalgamation agenda, she said.
The ALP use local government
as a training ground for state and
federal parliament. The City of
Vincent is just one obvious example.
The Greens have always been
strong advocates for local government and welcome more members
of local government that share our
values and vision.

CAN A HEARING AID


CHANGE YOUR LIFE,
WITHOUT CHANGING
THE WAY YOU LIVE?
LYRIC CAN.
Lyric is the only 100% invisible,
24/7 wearable, showerproof,
for-months-at-a-time
hearing aid.*

A R T S & C R A F T S FA I R
SEPTEMBER 19 & 20
YO R K TO W N H A L L
M A R K E T S TA L L S + W O R K S H O P S +
A R T I S T TA L K S + E X H I B I T I O N S +
P I C N I C I N T H E PA R K

YO R K B Z Z A A R . C O M . AU

more than just handymen

30 DAY NO OBLIGATION TRIAL


CALL TODAY FOR AN APPOINTMENT
343 Railway Road
SHENTON PARK
*Optional with any wash. Please mention ad

Ph: 9388 8003


www.hearingandaudiology.com.au
Clinics located at Subiaco and Duncraig
*Individual replacement needs may vary. Duration of device battery life varies by patient and is subject to individual ear conditions.
Lyric is water resistant, not waterproof and should not be completely submerged underwater. Professional fees may apply.

Page 8 POST, September 5, 2015

Subiaco scene

Places are limited. Please book online at


www.subiaco.wa.gov.au/events or contact Subiaco
Library on 9237 9300 for more information.

Call for feedback


Draft Integrated Transport Strategy
In 2014 the City of Subiaco engaged independent consultants
Cardno to develop a new draft Integrated Transport Strategy.
You are invited to provide feedback on the recommendations
in the draft strategy, which aim to increase the use of public
transport, cycling and walking, and manage parking, vehicle
trafc and travel demand.
Draft Bus Shelter Improvement Plan
The City of Subiaco has developed a draft Bus Shelter

Crime prevention forum


The City of Subiaco is working with local police to ensure that
residents and their property stay safe. Join the city and WA
Police for a free information evening with Wembley Stations
local policing team to discuss the ways you can protect your
home and valuables.
Gain an insight into crime rates throughout Subiaco, tips on
securing your home, what the city and WA Police are doing to
address crime in Subiaco and how you can help reduce incidences.
When: Tuesday 15 September, from 6pm to 7pm
Where: Subiaco Community Centre, 203 Bagot Road, Subiaco

Improvement Plan and would like to receive feedback from the


community about the draft plan.

Fathers Day in Subiaco

The Bus Shelter Improvement Plan aims to provide clean, safe


and universally accessible bus shelters, seats and other facilities to
support a more environmentally sustainable method of transport.

Does your dad tell the worst dad jokes? This Fathers Day,
we want to hear them. Come in to Subiaco on Saturday 5
September, tell us your best or worst dad joke and you will go
in the draw to win an iPad mini.

Visit www.subiaco.wa.gov.au/haveyoursay to view the


draft documents and complete one or both surveys. Hard copies
are available at the citys Administration Centre, 241 Rokeby
Road, Subiaco and Subiaco Library, 237 Rokeby Road, Subiaco.

Between 10am to 2pm the city will be celebrating all things


dad with a host of free exciting events throughout the town centre
and if youre stuck on what to buy the dad who has everything,
youre sure to nd some great retail and hospitality specials.

Please submit your feedback by 5pm on Monday 5 October.

For more information about Fathers Day in Subiaco, check out


www.visitsubiaco.com.au

All ages are welcome to attend. RSVP to the city on 9237 9320
or adminscc@subiaco.wa.gov.au

Author talk with Charles Hall


Local author Charles Hall will discuss the writing of his new
novel Summers Gone which takes readers back to the
nostalgia of 1960s Australia and explores how the politics of
that time shaped the future generations.

Night walks with frogs


Lake Jualbup provides important habitat for a variety of wildlife,
including ve species of frogs. Learn more about these amphibians
by spending an evening with ecologist Rob Browne-Cooper. Join
us for a short presentation before walking over to Lake Jualbup
for a eld survey. Attendees are encouraged to bring a narrowfocusing torch to spot frogs, a camera, and wellington boots.

The talk will include an acoustic performance of Sunshine River


by 1960s Perth band Gemini.

When: Thursday 10 September, from 6.30pm to 8pm


Where: Shenton Park Community Centre, 240 Onslow Road,
Shenton Park

When: Friday 11 September, from 12.15pm to 1.30pm


Where: Subiaco Library, 237 Rokeby Road, Subiaco

RSVP by Tuesday 8 September by contacting the city on


9387 0942 or city@subiaco.wa.gov.au

Community notices
Q Development Services Committee
meeting Tuesday 8 September
Agenda items
22 Park Street, Subiaco SAT
8 Onslow Road, Shenton Park
6 Federal Street, Subiaco
11 Evans Street, Shenton Park
285 Railway Road, Subiaco
Rescission of Planning Policy 2.1 Streetscape Finalisation
Rescission of Planning Policy 2.4 Residential Car Parking Policy
Finalisation
Draft Planning Policy 2.26 Site Works Finalisation
Parking Local Law review
Proposal to expand the Rawson Street Conservation Area to
include 108135 Heytesbury Road, Subiaco

Q Amendments to the Local Government


Inventory
The city is inviting public comment on a proposal to amend
the level of signicance of places on the Local Government
Inventory adopted under the classication of HCWA Register
of Heritage Places and Recommended for Register of Heritage
Places to exceptional signicance (Level 1).
Comments are to be received by 5pm on Monday 7 September.

Q Additions to the Town Planning


Scheme Register of Places of Cultural
Heritage Signicance
The city is inviting public comment on a proposal to amend
the level of signicance of the following places on the Local
Government Inventory to considerable signicance (Level 2)
and to include these places on the Town Planning Scheme
Register of Places of Cultural Heritage Signicance:
230 Hamersley Road, Subiaco
142 Hensman Road, Subiaco
219 Heytesbury Road, Subiaco
90 Onslow Road, Shenton Park.
Comments are to be received by 5pm on Monday 7 September.

Q Additions to the Local Government


Inventory and Town Planning Scheme
Register of Places of Cultural Heritage
Signicance
The city is inviting public comment on a proposal to include the
following places on the Local Government Inventory and the Town
Planning Scheme Register of Places of Cultural Heritage Signicance
with the classication of considerable signicance (Level 2):
1 Hay Street, Subiaco
19 Redfern Street, Subiaco
240 Heytesbury Road, Subiaco
54 Nicholson Road, Subiaco.
Comments are to be received by 5pm on Monday 14 September.
For more information on the above, visit
www.subiaco.wa.gov.au/formalsubmissions or view hard
copies at the citys Administration Centre, 241 Rokeby Road,
Subiaco or Subiaco Library, 237 Rokeby Road, Subiaco during
normal operating hours.
Comments should be submitted in writing
through the online submission form at
www.subiaco.wa.gov.au/formalsubmissions, via email to
city@subiaco.wa.gov.au or addressed to the Chief Executive
Ofcer, City of Subiaco, PO Box 270, Subiaco WA 6904.
Comments should clearly indicate the name and address of the
person making the submission and the proposal or application
to which the submission relates.

Q Development applications received


Property

Proposal

6A Waylen Road,
Shenton Park
25 Bishop Street,
Jolimont
24 Stanmore Street,
Shenton Park
2A and 2B Raphael
Street, Subiaco

Alterations and additions to an


existing dwelling
Change of use from ofce to health
studio
Alterations and additions to an
existing dwelling
Alterations and additions to existing
dwellings

Public submissions in respect to these proposals are not


being requested at this time. Formal consultation, where
required, will be undertaken in accordance with the citys
policy on planning public consultation. To view the policy,
visit www.subiaco.wa.gov.au

Whats happening in Subi


QTeach your children protective behaviours
Help your children identify and deal with unsafe situations.
Safe4Kids will run this free workshop for parents of children
aged three to ten years old.
Wednesday 9 September, 1pm
Shenton Park Community Centre, 240 Onslow Road,
Shenton Park
Places are limited. RSVP on 9237 9317 or
culture@subiaco.wa.gov.au

QREACH Population Health Check


Take fteen minutes out of your day to see the friendly
Roaming Education and Community Health (REACH) staff and
have a free health check.
Friday 11 September, 10am to 1.30pm
Subiaco Library, 237 Rokeby Road, Subiaco
No RSVP required. Please contact the city on 9237 9320 for
further information.

QSee Subi on Sunday Maternity and


museum
Discover the history of the State Heritage listed King Edward
Memorial Hospital by taking a ninety minute guided tour of
the original hospital.
Sunday 13 September, 1.30pm
Start and nish on the corner of Bagot and Hensman roads,
Subiaco
All are welcome. No RSVP required.

QCHILDREN QALL AGES


QADULTSQSENIORS QYOUTH

241 Rokeby Road, Subiaco WA 6008 | T (08) 9237 9222 | E city@subiaco.wa.gov.au | W www.subiaco.wa.gov.au | F www.facebook.com/cityofsubiaco

POST, September 5, 2015 Page 9

People power
can stop Link
By RHIANNON SHINE
People power is the only way to
prevent the controversial Perth
Freight Link from progressing,
a Cottesloe residents meeting
heard this week.

Oil artist Jen Mellor was inspired by Kings Parks Honour Avenue. Photo: Paul McGovern

Anzac centenary inspired artist


Local artist Jen Mellor
drew inspiration from the
Anzac centenary when creating her submission for this
years Claremont Art Award
and Exhibition.
Her painting depicts the
Kings Parks Honour Avenue
and features three firewood
banksia flowers in different
stages of life.
It has a meaning of life and
end, and how weve grown
these trees along Honour
Avenue to remember peoples

lives, she said.


Jen, a plein air artist, said
she enjoyed painting nature
and botanicals.
My favourite subject matter is the beauty of my surrounds, she said.
Kings Park has become
my backyard. You will find
me often visiting, gathering
reference and inspiration to
capture the beauty of Western
Australian flora on to a canvas.
Painting is my passion it
takes me to another place.

Jen was a finalist in the


Black Swan Heritage Awards
in 2012 and her paintings are
represented in WA galleries.
Her Anzac-inspired oil
painting is one of the finalists
in the art award.
The exhibition will be held
at council headquarters,
308 Stirling Highway, from
September 12 to 25.
Visitors to the exhibition
can vote for their favourite
artwork and be in the running
to win $500.

Opposition Leader Mark


McGowan told a packed Cottesloe
Residents and Ratepayers
Association meeting the state
government planned to sign off
on the Freight Link by November.
But Mr McGowan told them to
remember shark culling and forced
local government amalgamations.
People went out there and had
a go and protested, he said.
Shark culling is now no longer
happening and forced local government amalgamations are off
the agenda.
So sometimes getting out there
and having a go pays dividends.
Greens senator Scott Ludlam
told the meeting: How we win
this is by campaigning until they
are convinced that if they persist
they will lose the next election.
You folk happen to live in the
electorate of the federal Foreign
Minister and you are in the electorate of the Premier, Mr Ludlam
said.
Last week, Premier Colin Barnett

said the Roe 8 highway stage of


the Perth Freight Link would
undoubtedly go ahead.
But he did not know how the
final stage connecting Stirling
Highway to the Fremantle port
would be built.
Curtin University sustainability
expert Peter Newman agreed the
best course of action was to lobby
the Premier.
I personally think the only
real hope is with Colin Barnett,
Professor Newman said.
In that cabinet we can already
see a division appearing.
[Transport Minister] Dean
Nalder and [Senator] Mathias
Cormann are saying they will build
it, its complete, its happening.
And the Premier is stepping
back and saying: Well, we dont
even know what were building
for that second part.
Association chairman John
Hammond urged those at the meeting to write to Mr Barnett and said
Cottesloe council had a hopeless
attitude towards the issue.
Cottesloe council has decided
not to do anything about this issue,
he said.
Please turn to page 100
Cottesloe councils vote see report,
page 27

Cut this fee, say hairdressers


Claremont hairdressers
say they wont pay a new $50
council fee.
I ripped mine up and put it
in the bin, said Shane Dias,
who has a salon in Old Theatre
Lane.
I pay $4000-something in
rates. I dont understand why
we have to pay this.
If we stick together, lets see
what they do about it.
Claremont council said the
new fee would cover biannual
inspections of hairdressers,

beauty therapists and other


businesses under the Health
Act.
It started in July.
Josie Doria, at Lucianos
in Claremont Quarter, was
incensed when she got two
invoices instead of one.
If we all refuse to pay it,
theyve got nowhere to go,
she said.
Thomas Jaeger, whose salon
is near the library, also said
he would not pay the new fee.
Claremont is the ninth

Telecast first for soccer


The Western Knights soccer game this
Saturday against the Dianella White Eagles at
Nash Field in Mosman Park will be telecast
live on the clubs website.
This is the first time that a WA State League
game has been telecast live.
Ashley Morrison Media will telecast the game,
with Ashley providing the commentary during
the game and interviews before and at half time.
It can be seen at westernknights.com.au.

postnewspapers.com.au
To view our classifieds online

government department to
charge me, he said.
The Health Act dates from
1911 thats how ridiculous
it is.
I believe we pay enough
in rates.
Claremont pays a contractor
to do health inspections on
businesses.
In its letter to businesses,
the council said: This fee is
believed to be set at a reasonable rate and at minimal cost
to business.

BINDY - EYE
(Jo - Jo)
Want prickle-free lawns through summer holidays?

Book your lawn spray NOW

Standing room only All 200 chairs were filled at Cottesloes Memorial Hall
when big numbers of locals and some outsiders turned up to the Freight Link
forum on Tuesday night.

Warning Blatant Self Promotion Below


You may not
see my face on every
signboard
and newspaper
You may not see
me driving around
in my real estate
agents car much

Nedlands Garden Service

But you will see me selling properties


pro
like no other.
Selling all my listings as if they were my own.

THE PERFECTIONISTS

Phone Tony Direct - Mob

I may even
wear the
wrong
thing now
and then

Scott Banister-Jones 0438 933 634

0419 905 053

Health Dept. Licence 597

scott@scottbj.com.au www.scottbj.com.au

p r e pa r e to b e i n s pi r e d.
To see how a PLC education will inspire your daughter, come
along to our School Expo. To book visit www.plc.wa.edu.au

Middle & Senior School Expo


Wednesday 9 September

bcells33859

5.00 pm 5.30 pm
5.30 pm 7.00 pm

www.plc.wa.edu.au

Principals Address
Expo

Page 10 POST, September 5, 2015

CAMBRIDGE NEWS
September 2015

NEW stations make recycling easy


Recycling household items, that cannot be placed in the yellow-lidded recycling bin, just got a whole lot easier with the
Town installing new multi-purpose recycling stations at convenient locations around the Town.
Residents can dispose of old fluorescent tubes, light globes, printer cartridges, batteries and mobile phones at the new
stations, which can be found at:
Town of Cambridge Administration, 1 Bold Park Drive, Floreat
Cambridge Library, 99 The Boulevard, Floreat; and
Wembley Community Centre, 40 Alexander Street, Wembley
A fourth recycling station will be positioned at the new Bold Park Aquatic when it reopens in October.
The new recycling stations are part of the Town of Cambridges commitment to Maximum Recovery and contribute to
helping us maximise the amount we recycle and minimise the amount we send to landfill.

For more information contact our Waste Minimisation team on


9347 6000 or waste@cambridge.wa.gov.au
Waste minimisation officer Jackie Dickson demonstrates the
new recycle station at the Towns Administration Centre

WHATS on in TOWN ...


Square Metre Veggie Garden
Theres nothing better than home grown veggies and better still you dont need
much room to do it.
Find out how to grow your own food garden, one square metre at a time.
When:
Time:
Where:
Registration:

Thursday, 17 September 2015


6.30pm-9.30pm
Town of Cambridge Administration Centre,
1 Bold Park Drive, Floreat
Essential. Please register online at
www.cambridge.wa.gov.au/springgardening

For more information contact a Sustainability Officer on 9347 6000 or email


sustainability@cambridge.wa.gov.au.

Library to get a little CLUCKY


The Cambridge Library will be transformed into a nursery this
September when Livings Eggs brings a unique 10-day chick
hatching program to the library.
Residents are invited to drop into the library and enjoy the
experience of seeing chicks hatch out of their eggs, right before your eyes.
The stork will be delivering eggs to the library on Monday, 21 September with the
chicks expected to start hatching a few days later.
A brooder box, heat light, bedding, feed and water will be set up and a large
viewing window will allow visitors to witness all stages of hatching.
Once the chicks are 10-days old they will be re-homed to a free range farm.
For more information visit www.livingeggs.com.au

On-request
mattress
collection
for Cambridge
residents
Residents are invited to take
advantage of the Towns free
on-request mattress collection and
recycling service.
As part of our Maximum Recovery
Program any size mattress and box
springs will be collected and recycled,
reducing the amount of waste we send to
landfill.
Collected mattresses will be disassembled
and repurposed, with the metal used as
scrap, the wadding turned into carpet
underlay and the frame and springs
converted into dog beds.
Collections are made every Thursday and
items should be placed on the verge by
6am on the day, and be visible and easily
accessible.
To book a collection contact us on 9347 6000
or email waste@cambridge.wa.gov.au

Bold Park Open Day


Join the Friends of Bold Park Bushland at the Bold Park Open Day
on Sunday, 13 September 2015 for a morning of nature activities,
free guided walks, encounters with native reptiles and raptors,
interactive displays, childrens nature-based activities, and tips for
the home native garden.
The event will be held at the WA Ecology Centre on Perry Lakes Drive in Floreat
from 9.30am-1.30pm.
Visitors can also learn about the activities of local conservation groups and
how to get involved.

Maggie season swoops in


Residents are reminded that with Spring now upon
us, its time to stay alert and be on the lookout for
swooping magpies.
Magpies have a very strong urge to protect their eggs and
nests and during the breeding season are known to swoop
cyclists and walkers who unwittingly stray into their territory.
Some tips to avoid being swooped:
Stay alert for possible nesting sites and, if necessary,
change your walk/cycle route during the nesting season;
Wear a wide-brimmed hat to protect your head and
eyes;
Supervise children at all times;
If swooped when walking - remain calm, walk away
quickly (do not run), avoid looking directly at the magpie;
If swooped when riding - remain calm, disembark and
walk with your bike (the magpie may stop swooping);
and
Do not provoke or harass magpies by trying to hit them,
screaming, flapping your arms or throwing objects at
their nests.
Please remember that magpies are protected under the
Wildlife Conservation Act and that their swooping behaviour
is just their way of protecting their young.
For more information contact Ranger Services on
9347 6000 or the Department of Parks and Wildlife
Wildcare Helpline on 9474 9055.

The morning will also see the launch of an illustrated book of essays about
wildlife and science, based on a popular newspaper column by nature writer
Mike Bamford.
The Bold Park open day is supported by the Botanic Gardens and Parks
Authority, the Town of Cambridge, BirdLife WA, the Wildflower Society of WA
and the WA Naturalists Club.
Light refreshments will be available for purchase.
For further information including walk times and the book launch visit
www.bgpa.wa.gov.au or phone 9480 3996.

Subscribe to receive the Cambridge News via email at www.cambridge.wa.gov.au/subscribe


1 Bold Park Drive Floreat | 08 9347 6000 | mail@cambridge.wa.gov.au | www.cambridge.wa.gov.au

POST, September 5, 2015 Page 11

Station crossing to be made safer

By LLOYD GORMAN

The pedestrian island in


Railway Road opposite Daglish
Railway Station will be widened and extended in a bid to
make it safer.
The work will lengthen the island to 100m and widen it to 2m,
making it safer for pedestrians
crossing near the busy intersection with Hamersley Road.
The wider pedestrian island
was the last option open to
Subiaco council after Main
Roads WA rejected a call for
traffic lights or a pelican crossing, which the council and a
community group had wanted.
Main Roads said the site did
not meet the criteria needed
for it to install either a traffic

signal control system (which


would cost about $450,000) or a
signalised pedestrian crossing
(about $280,000).
A council-commissioned study
found that more than 14,000 cars
a day used Railway Road, while
1700 used Hamersley Road and
up to 724 people a day crossed
the road there.
The traffic study also found
that there had been 14 crashes
at that spot, including one involving a pedestrian.
While Main Roads acknowledges the concerns council has
for pedestrians who utilise
this crossing, the provision of
new traffic signals and pelican
crossing cannot be supported
in this instance, Main Roads
told Subiaco in a letter.

Too narrow Cyclists and pedestrians have trouble crossing busy


Railway Road with the current refuge island.
[We] suggest that council consider widening the median refuge islands on Railway Road to
assist pedestrian movements.
Darron Freegard, a member of
the Daglish Crossing Community

Group, told councillors at a


recent committee meeting that
the group was profoundly disappointed with the response of
Main Roads.
He said that as well as follow-

ing general policies, Main Roads


could also factor site-specific
issues into its decision.
The reality is that Main
Roads has failed to consider
the local conditions and specifically the use of the crossing by schoolchildren and a
disproportionate number of
the elderly people living in our
community, he said.
Mr Freegard said the group
would campaign for a controlled
crossing but would accept a
wider refuge as an interim
solution.
Councillors at last weeks
council meeting voted unanimously to fast-track designs and
funding (an estimated $180,000)
for the upgraded crossing in the
November budget review.

Cafe approval imminent


Planning approval for the
new Peppermint Grove cafe at
Keanes Point is imminent, the
council says.
CEO John Merrick said he was
waiting on the final building plans
for the Mosmans-run operation.
I predict approval within a
week or two and then we can sort
out a construction timetable, Mr
Merrick said.
The building will be construct-

ed mostly off-site and so should be


a fairly short completion time.
The site is occupied by Cappuccino by the River. Operator Kenny
Nguyen has been on a month-bymonth tenancy since Mosmans
restaurant won a council tender
last year.
Mr Nguyen, who has run the
business for about four years,
tendered with eight others but
was not on the shortlist of three.

Upcoming Wellness Events @ Remde


Fertility + Preconception Health Wed 09 Sept: 7.30pm
FREE with Rebecca Tanner & Geoff Brothers

Bench mark Ayad Alqaragholli in front of the western suburbs latest artwork, on which PLC Year 6
students Megan Steinberg, left, and Lola Hanna, are sitting. Photo: Paul McGovern

PLC ladies in waiting


By DAVID COHEN
Ayad Alqaragholli was
mobbed after his newest
sculpture was unveiled in
Peppermint Grove.
The artists 400kg bronze at
Presbyterian Ladies College
features two elongated women
dancing on a sofa.
Ayad said it taken him about
a year to create the work.
It was unveiled last Thursday
in front of PLC principal Beth
Blackwood, dozens of students
and parents, and the schools
pipe band.
Ms Blackwood said she
counted Ayad, who has been an

artist-in-residence at PLC, as a
precious friend of the school.
This sculpture will stand
here as a landmark, Ms
Blackwood said.
It is designed to be interactive and we hope a tradition
is formed of students being
photographed here when they
arrive at PLC.
Ms Blackwood said girls had
wanted joy, friendship and
community to be represented
in the sculpture, which was
unveiled the day after the
school marked its centenary.
The artwork was unveiled
on Ayads 47th birthday.
He was born in southern
Iraq and migrated to Australia

with his wife and two children


in 2005.
When I was in primary
school, I used to go to museums
in Mesopotamia and look at the
sculptures, Ayad said.
It is important for people
to be engaged with art.
Ayad has had work at
Sculpture by the Sea in
Cottesloe since 2010.
He said the human figure was
very important in art.
Nature without people is
nothing, he said.
The figure is the most beautiful creation in nature.
The school will run a competition to find a name for Ayads
sculpture.

Trees to make way for cars


Seven trees will be cut
down when the carpark on
the corner of Shenton and
Davies roads, Claremont, is
sealed next year.
On Tuesday night, councillors
voted unanimously to spend
$387,000 on the work.
A report to councillors did
not mention trees but Myera
Street resident and Friends of
Lake Claremont coordinator
Heidi Hardisty quizzed
councillors about what would
be cut down.
Corporate governance
manager Les Crichton said the
carpark tuarts would stay, but
seven smaller trees, including
four paperbarks, would have
to be removed.
Mr Crichton said more trees
would be planted elsewhere.
Councillor Karen Wood said:
I use this carpark a lot and I

Trees to go But this tuart will stay, Claremont council says.


love the trees in it.
Theres just no way we can
leave it in this state.
The big tree in the middle
is one of the best in Claremont.
Im absolutely delighted its
staying.
Upgrading the carpark will
cost $584,000. LandCorp will
contribute $197,000.

Work is expected to begin


after March next year, after
Shenton Road works are done,
and is expected to take five
weeks.
After the meeting, mayor
Jock Barker said Claremont
had 1000, or 20%, more trees
than it did five years ago, as
well as at least 15,000 plantings.

In this seminar, Fertility Specialists Rebecca & Geoff will share essential dietary and
lifestyle foundations that should be considered by prospective parents to help
them conceive a healthy baby. They will discuss the research on natural treatment
options to help overcome fertility challenges in both men and women, as well as
strategies to prepare for & enhance IVF success.

Weight Loss That Works Wed 23 Sept: 7.30pm


FREE with Naturopathic Nutritionist Jan Purser
Jan Purser will discuss the latest research on various diets such as The Fast Diet,
The HCG Diet, Low Carb diet, Low GI Diet & the Paleo Diet. Find out which
tests are available to help you with weight management such as gene testing,
cellular health analysis, and thyroid & hormone testing.

Bookings essential to reserve your seat


Call 9286 1166 or reception@remede.com.au
naturopaths | doctors | psychologists | acupuncturists | nutritionists | massage
13 Glyde Street, Mosman Park

www.remede.com.au

Board Treasurer required for a not-for-prot retirement village based in the western
suburbs of Perth. Lisle Villages (Inc.) is an independent retirement village, comprising
137 independent living units.
Position Overview.
In conjunction with the Chief Executive Ocer, the Treasurer is tasked with keeping the
nances healthy so the Association can achieve its mission.
The Treasurer should have the ability for critical appraisal, can contribute to strategic
planning and be creative about generating funds. Recognised Australian qualications
in accounting are essential. A working knowledge of the provisions of the Retirement
Villages Act 2015, the Fair Trading Code (Retirement Villages) 2015 and the Associations
Incorporation Act will be highly regarded.
Some people on the Associations Board do not have well developed nancial skills and it
is important the Treasurer is able to explain the nance report simply and clearly.
The main duties of the Treasurer are to oversee the nancial administration of the
Association, review procedures and nancial reporting, advise the Board on nancial
strategy, advise on appropriate investing of the Associations cash reserves and review the
Investment Policy on a regular basis.
While Lisle Villages (Inc.) is a not-for-prot organisation, the Board understand that
people should be compensated for their time. A salary of up to $1,000 per month, plus
any reasonable expenses will be negotiated with the successful applicant.
Applications to be sent to the attention of the Chief Executive Ocer.
Post: 50/57 Lisle Street, Mount Claremont, WA, 6010.
Email: nickt@lislevillages.com.au,
Fax: 08 9385 0016.
Telephone: 08 9384 5481.

Page 12 POST, September 5, 2015

HA
FAT H E
Tasmanian
Cape Grim Rib-eye
On The Bone
You will get a free bottle
of Majella 2009 Cabernet
Sauvignon with every
whole rib-eye on the bone
purchased.
Let us dry age this for you
for up to 90 days in our
Himalayan salt brick room.
Give your Dad the Fathers
Day gift he really wants!

POST, September 5, 2015 Page 13

PPY
R S D AY
New Season
Shark Bay King
Prawns
Also known as the King of
Kings these delicious local
WA prawns are of premium
export quality.
They are world renowned
and sought after for
their superb quality and
sensational sweet flavour.
Enjoy with friends and
family this weekend!

/$5*((;0287+
/
$5*(( ;0287+
.,1*35$:16
.,1*35$:16
SHARK BAY
KING PRAWNS

95

19 95
19

KILO

PRICE VALID UNTIL SUN 06 SEPT 2015

Page 14 POST, September 5, 2015

NEWS UPDATE
SEPTEMBER 2015

UPCOMING CAPITAL WORKS IN A


PARK NEAR YOU
The Parks Services department has the following projects scheduled to start in
September/October 2015:
Installing solar-powered bollard lighting in the turfed access way between Haldane St
and Montgomery Ave, Mt Claremont. This also includes lighting the laneway connecting
Earls Court. The use of solar power is in line with the Citys sustainability focus while
ensuring the lighting does not prove obtrusive to nearby residents.
Extending existing bollard lighting from the corner of Beecham Rd and Cleland St to
Montgomery Ave, Mt Claremont. This will provide added safety and security to path
users enjoying the bushland setting walk.
Replacing Sunset Foreshore bollard lighting following increasing maintenance. These
lights run from the Iris Ave staircase to Beaton Park. The replacement lighting will be
LED, in line with the Citys sustainability focus.
Resurfacing Hollywood Tennis Courts. This will require the courts to be closed for about
a week. These works will extend the life and functionality of this facility. Works will
include court grinding, tree root removal, resurfacing and line marking. The City will be
liaising with the court booking agent and affected coaching groups.

BUSHCARES MAJOR DAY OUT 2015


HOLLYWOOD RESERVE SUNDAY
13 SEPTEMBER
The Friends of Hollywood Reserve invite you to join them on
a walk through the bush and to enjoy a pleasant morning
tea at 10.30am bring the family along!
Meet at the lawn area on the western boundary of the
Perth Cemetery and Garden of Remembrance, Smyth Road
Nedlands. Bring sturdy shoes, sun protection and some
water. Enquiries to 0413 577314 or kisimot@iinet.net.au

STRENGTHEN YOUR COMMUNITY


THROUGH VOLUNTEERING
Are you interested in volunteering?
The Nedlands Volunteer Resource Centre, located upstairs
in the Nedlands Library, is your local one stop shop for
nding out about volunteering.

Installing modern outdoor tness equipment at Mason Gardens, Nedlands. Designs are
currently being evaluated for suitability at the park and for the best location.

The centre offers you free, friendly information about


volunteering and what volunteer positions are available
and can assist you in nding a suitable role.

FOOTPATHS AND OBSTRUCTIONS

For more information contact Robyn Forrest (Community


Development Officer Volunteering) on 9273 3640 or
volunteering@nedlands.wa.gov.au

The City of Nedlands recognises that many residents


put substantial effort into developing and maintaining
gardens on their property and the nature strip.
The City generally supports overhanging shading
of footpaths, parked cars and roadways. However,
vegetation from private property or nature
strip gardens can grow to encroach onto public
thoroughfares and reduce required clearances. These
vegetation obstructions can be a problem, particularly
for people with reduced mobility or access difculties.
Residents are responsible for ensuring that
vegetation located on private property, or any plant
they place on the nature strip (other than a street
tree), does not grow in a manner that may cause
obstruction to a footpath or laneway.
Where the City observes plants or trees are causing
obstruction, the resident will receive notice to prune
the vegetation away from the footpath or laneway.
Failure to remove the obstructing vegetation may
lead to the City issuing an infringement.

DOGS OFF LEAD IN PARKS


The City has recently had an increasing number of
close encounters with dogs running in front of lawn
mowing tractors and causing a nuisance around mowing
equipment. Please keep in mind that these open space
areas are used for other recreational purposes and
need to be maintained constantly by the Citys Park
staff. Please ensure you are capable of controlling your
dog while exercising it off leash and that your dog is not
causing a nuisance to other park users.

SNAKE SEASON
Spring is here, so snakes will be coming out of
hibernation. Snakes are especially conspicuous in the
spring when they rst emerge from winter dormancy
searching for food. The City encourages visitors to
our beaches and bushland areas to be vigilant and to
consider keeping their dogs on a leash.

NEDLANDS LIBRARY TALK - WHAT


IS COELIAC DISEASE?
If you have coeliac disease, going gluten-free is
imperative - as it is for those with the lesser gluten
intolerance. With two daughters and a sister all
diagnosed with coeliac disease, Nikki Watson of
Coeliac WA has learnt a lot about this condition.

YOU CAN MAKE A DIFFERENCE!


This years local government election will be held on
Saturday 17 October and will be held as a postal election
for the City of Nedlands.

Nikki will talk about identifying the signs that say


gluten is not for you and learn what to do about it.
If its not that, she will also give advice on what else
could be causing the symptoms.

If you want to make a difference in your community and


have a say in local decision-making, vote or stand for
election as a councillor in your local government elections.

Learn about gluten free foods (they have come


a long way), and how this condition is very
manageable.

All eligible electors will receive a postal voting package around


three weeks prior to polling day. The package will include a list
of candidates, ballot papers, instructions on how to vote and
a declaration. For more information, go to the Citys website.

Wednesday 23 September 2015


10.30 am 11.30 am
Nedlands Library
60-64 Stirling Highway
Nedlands WA 6009
Free event, bookings essential.
Book online at nedlands.evanced.info/signup

GOING PLACES TOUR GRAVITY


CENTRE GINGIN AND KINGS PARK
WILDFLOWERS
On Thursday 1 October, 8:45am to 4:00pm join us for:

WARATAH AVENUE PLACEMAKING STRATEGY


The Waratah Avenue Concept Plan has been prepared and
is now out for community feedback. This plan has been
developed as part of the Placemaking Strategy Study for
Waratah Avenue which was undertaken over the last two years.
The plan focuses on the streetscape along Waratah Avenue
between Adelma Road and Alexander Road and aims to set
the context for implementing streetscape improvements.
The plan is available for viewing on the citys website
at nedlands.wa.gov.au or at the Citys libraries,
Administration Centre and Nedlands Community Care.
Community Consultation will close Friday 25 September
2015 at 5pm.

A guided tour of the Gravity Discovery Centre in


Gingin; a two-course lunch at the Gravity Cafe; and
a visit to Kings Park to marvel at the wildowers
and explore the Aspects of Kings Park gallery shop.

For more information, please contact the Citys Planning


Team on 9273 3500.

Price per person $61 which includes Gravity tour,


morning tea, lunch and coach tour.

Committee meeting 8 September


Council meeting 22 September

Places are limited please book by Thursday


17 September 2015. To book, call the City on
9273 3500.

Meetings start at 7 pm and are held in the Council


Chambers, 71 Stirling Highway. Please enter from the
Smyth Street entrance.

COUNCIL MEETING DATES

71 Stirling Highway. Nedlands WA 6009 | 9273 3500 | council@nedlands.wa.gov.au | nedlands.wa.gov.au

POST, September 5, 2015 Page 15

Davenport makes a
silk road road to MLC
Fashion designer Liz
Davenport has given rolls of
fabric to Methodist Ladies
College students.
She had accumulated them
over the 30 years before she
closed her Nedlands headquarters last year.
But despite the closure she
said she had never been busier.
Its great being just Liz
Davenport, she said.
Ive taken myself out of compliance and administration and
Im just focusing on design.
As well as giving the textiles
including Thai silks to the
Claremont school, Liz donated a
huge cutting table, zips, buttons,
beads, and sequins.
The link to MLC was the
schools part-time theatre arts
assistant Nicola Morrison.
Nicola walked in one day to
get some fabric, Liz said.
I said, Just help yourself.

LEFT: Of corsets silk Liz Davenport, left, Rachel Osborne, and


Cheryl Lundy with some of the precious fabrics Liz gave to MLC.
Photo: Billie Fairclough

Heads roll
at iiNet

Heads have already started to roll in the


first week of new management at iiNet, and
more Subiaco staff could follow.
The internet and technology firms chief executive, David Buckingham, was ousted from
the top job last week.
Other senior managers are also reported to
have left the company, which has been based
in Hay Street since 2009.
The Financial Review reported that the
new owner had also cut the staffs free sweets
and fruit.
Former rival TPGs $1.6billion takeover of
iiNet started on July 24 and would seem to
have started a cull of senior staff that could
spread to the Subiaco head office, which employs about 650 people.
Around the time of the takeover, Michael
Malone, the Perth entrepreneur who set up
iiNet in his parents garage in 1993, said he
was worried for the jobs and security of his
former employees.
In an interview with the business press, TPG
chief operating officer Craig Levy said iiNets
call centre would stay in Perth, but did not
guarantee job levels.

Some Cottesloe councillors would like to see the


railway underground.

Rail motion sunk

Sinking the railway line would make a huge


difference for Cottesloe, Jack Walsh says.
But a majority of his colleagues did not
agree to his motion to lobby Cottesloe MP and
Premier Colin Barnett about the initiative.
Instead, councillors last week went with
mayor Jo Dawkins move to develop a plan for
the town centre and railway land.
Cottesloe has had several approaches for
spot [zoning] upgrades, Mr Walsh said at last
weeks meeting.
We should be doing it in blocks.
Sinking the track would make a huge difference to Cottesloe.
Rezoning would go a long way to paying
for the sinking.
Councillor Jay Birnbrauer said Cottesloe had
pushed for the sinking six years ago.
Its long overdue, Mr Birnbrauer said.
Ms Dawkins said she did not disagree.
But she said the council needed to define what
it wanted to do, include the town centre, and
have development options for Station Street.
The vote against Mr Walshs motion was 6-3;
the vote for Ms Dawkins was 7-2.
Council CEO Mat Humfrey will prepare a
report for this months council meeting.

Authorised by Ian Argyle 2B Thomas Street, Nedlands WA 6009

When we shifted from the


headquarters there was 30
years worth of things around
every corner.
They were precious, but
needed to find a home.
One students projects were
Thai silk corsets.
Liz said Thailands Queen
Sirikit was a champion of her
countrys silk-making cottage
industry.
The silks Liz donated are
pre-dyed. It takes great skill to
weave the fabric.
On Monday, Liz looked at Year
10 students projects, including
Rachel Osbornes sleeveless
river cruise dress in stretched
silk.
Ive been studying design and
textiles since Year 7, Rachel
said.
MLCs head of textiles Cheryl
Lundy has seen her students
win the top Year 12 WACE mark
in the subject for the past five
years.
Cheryl has been teaching textiles there for the past 15 years.
Its creative and innovative
and kids are allowed to do their
own things, she said.

Page 16 POST, September 5, 2015

Boatshed gets
liquor licence

Boys will
be girls

Its taken the state government 71 days to approve a


liquor licence being shifted
400m.

This week prefects from St


Hildas and Christ Church
Grammar School faced off on
the netball court.

This week, a delegate for


Liquor Licensing director Barry
Sergeant said the Boatshed
Market in Cottesloes Jarrad
Street could use the licence
of Railway Streets Grants
of Cottesloe, which closed in
February.
The Boatsheds Craig Skead
said it would be six months
before the first bottle was sold.
We will now apply for a development application from the
Town of Cottesloe and then proceed to tender and finally build
the wine shop, Mr Skead said.
We are using the old boat
building gantry system to suspend the wine store bringing
back a bit more of the buildings
history into the business.
Americas Cup-winning yacht
Australia II was built at the site
when it was a boatshed.

In a long-standing tradition, St
Hildas invites its brother school
for the contest as a fundraiser
for Anglicare WA.
Cross-dressing was the order
of the day, and unfortunately for
the girls, brute force won out
despite hopes that the skirts
would slow the boys down.
The final score was 10:2 to
Christ Church.
The gold netball trophy was
considered to be worth the effort, as well as the hundreds of
dollars raised from spectators.

Josh Greenwood, left, Jack


Hawkesford, Alex Finlay-Jones
and Monika Blakenburgs fight for
ball possession.

City Beach snakes


get used to them

Congerton reappointed
Swan councillor Mel
Congerton has been reappointed chairman of the Local
Government Advisory Board
for another three years.
Mr Congerton has been on the
LGAB, which makes recommendations about council mergers
and boundary changes to the
state government, since 2008 and
his current term as chairman
expired last Monday.
Responding to a query from
the POST, a senior media
adviser to Local Government
Minister Tony Simpson said
Mr Congerton had been reappointed as chairman.
Mr Congerton, who also sits
on a development assessment
panel, presided over the LGAB

during the state governments


failed council cull policy.
The LGAB accepted
Cambridges proposal to swallow
up Subiaco and recommended
it to the Minister.
Morawa councillor Karen
Chappel, who was a deputy
member of the five-person panel,
replaces Kalgoorlie-Boulder
mayor Ron Yuryevich as a fulltime member.
Bunbury mayor Gary Brennan
has been made a deputy member
of the LGAB.
Mr Brennan was chief of staff
for almost five years to former
local government minister John
Castrilli.
Their terms run until August
31, 2018.

There are always snakes at


City Beach, Rod Bradley wants
to remind people.

Rod Bradley found a snake skin


but no snake in his shed.

And they are not necessarily


confined to the dunes or the
bush, he says.
Mr Bradley, a Cambridge
councillor, wants people to take
extra care since a woman died
after being bitten by a snake
near Fremantle last month.
Mr Bradley, a grandfather of
six, said he had found poisonous
snakes in his swimming pool
and on the steps near his front
door as well as signs of one in

a shed at his home in Lowanna


Way, City Beach.
I opened the door to the shed
and there was the whole skin of
a snake intact, he said.
Another day I stepped out of
the front door and there was a
snake stretched out across the
top step, basking in the sun.
It slid away into a crack between the bricks and when the
snake catcher came we could see
it poking its head out but it went
too far in for him to catch it.
Mr Bradley is standing for reelection to Cambridge council.

AUCTION
Art

Jewellery

Furniture

Collectables

Lot 192Jade & Diamond Brooch,$2000 - $3000

Lot 44, Brett Whiteley $9000 $15000


Lot 302, Victorian Cabinet, $5000 $7000
Lot 70, Bronze Bull, $1500 $2000

Lot 132, 2.28. Diamond


Pendant, $10,000 $13,000

Tuesday 8th September

Lot 1403.75ct Emerald & Diamond Ring $3600 $5500

6pm

Catalogue Online: www.mckenziesauctioneer.com.au


Viewing: This Weekend 11 - 4 & Monday 11 - 5.30
C
Est 1988

M KENZIES

8 Stirling Rd, Claremont WA 6010

Enquiries: (08) 9385 4180

POST, September 5, 2015 Page 17

EORFNVVROG-XVWOHIW

Build your new home in the


dress circle of Cottesloe.
Siteworks completed December. You can start building early next year.

614m2
631m2

501m2

554m2

Walk The Quarry


Cottesloe Homesites
Saturday and Sunday
12 noon 1pm
2b Nailsworth Street
Cottesloe

501m2

Land sizes from 424m2SNL2. Prices from $.LSN$.L "DMSQDCHMSGDGD@QSK@MCNE"NSSDRKND VHSG@MDMSQXN


prestigious Nailsworth Street, are 13 spectacular new homesites.

Sculpted around a historic limestone quarry and surrounding a central parkland streetscape, each lot provides the perfect
platform for you to create a truly outstanding individual home. And for inspiration, weve asked four multi award-winning
6DRSDQM TRSQ@KH@M@QBGHSDBSRSNCDRHFMSGDHQUHRHNMNEGNLDRADSSHMFSGHR@ARNKTSDKXTMHPTDKNB@SHNM 
To view these exceptional plans, or simply learn more about this rare land opportunity, visit quarrycottesloe.com.au
or talk to Frank Torre from House Real Estate on 0411 866 550 or 9284 5554 .

THE QUARRY

COT T E S LO E

quarrycottesloe.com.au

Page 18 POST, September 5, 2015

WVU77V
JMV
,UWVA@

U7K@V

7(AUHV
JMVFFMU@7=A(U>AVm
Available in:
Q Teak
Q Durawood
Q Woodlore
QAluminium
With Choice of:
Q Hinged
Q
Bifold
Q
Sliding
Q Wide range of colours
to choose from

n
Plantatio

Save

Shutters

Pop in with your Measurements


for Great In-store Discounts!

22SHQLQJ5RRI6\VWHP
Roof Closed

6WXGLR1HGODQGV6WRUH

Roof Open

N
ISATIOER
OTOR20
FREE M
STOM S
CU
T
RS
FI
FER

LIMITED OF

See in Store fo

Q
Q
Q

r Details

Blades rotate through 180 allowing total sun management under the roof.
Every kudos opening roof is waterproof & features its own in-built guttering system.
Available as both hand operable & motorised. Q Guaranteed not to leak

Leading the way is Verosols range of metal backed fabric blinds which provide unparalleled
and uncompromised performance. These metal backed fabrics reduce heat and glare
without sacricing interior or exterior appearance.

:LQGRZ)DVKLRQV*DOOHU\

6KDGH6\VWHPV

2VERUQH3DUN6WRUH

5HGXFH:LQG *ODUH
ZLWK(QYLURVFUHHQ

Retractable Folding Arm Awning


The iShade Sundance folding arm awning stylishly extends
your living area by acting as a retractable, fabric roof. Its
slimline headbox is neat & compact in appearance.
Choice of manual or remote control operation.

Reduce your heating


costs by up to 49% with
DUETTE ARCHITELLA
Mnage SHADES

OSBORNE PARK: 96 Frobisher St 9443 9111


OPEN: Mon to Fri 9am - 5pm, Sat 9am - 3pm, Sun open by appointment
PTY LTD

www.solashade.com.au
RT150927

NEDLANDS: 125 Stirling Hwy (cnr Broome st, opp. Rose Garden) 930 930 12
OPEN: Mon to Fri 9am - 5pm, Sat 9am - 12noon, Sun open by appointment

POST, September 5, 2015 Page 19

FT G
I
G IN
E
E PP
R
F A
R
W

PHARMACY OPEN LATE FOR LAST MINUTE GIFTS!

REMEMBER
YOUR LAST MINUTE GIFT FOR

FREE

RAFFLE EN
TRY
WITH ANY
PURCHASE
For you
r chan
a hamper ce to win
valued
at $500

THIS SUNDAY, 6TH SEPTEMBER


Need a last minute Fathers Day present - we have a great range of gift ideas!

Corkcicle
$32.99

Build you
your own
Thunder
Thunderbirds
2
$14.
$14.99

Thunderbirds
Glasses
Repair Kit
$
$19.99

Smartphone
Projector
$44.99

Thunderbirds
Mug
$14.99

PHARMACY OPEN LATE FOR LAST MINUTE GIFTS! ONSLOW & HERDSMAN STORES OPEN TIL 9PM

OPEN
7 DAY
S

OCEAN VILLAGE
PHARMACY

ONSLOW ROAD
PHARMACY

HERDSMAN
PHARMACY

2 Kilpa Court
City Beach WA 6015

159 Onslow Road


Shenton Park WA 6008

3/1 Flynn St
Churchlands WA 6018

Ph 9245 2080

Ph 9381 8029

Ph 9387 6665

Page 20 POST, September 5, 2015

$ 99

11

Sliced Yearling Rump Steak

$ 99
Fresh New Season WA Grown
125g Punnets of Blueberries

125G
PUNNET

Born Coconut Water 1 Litre


$2.99 per litre

EA

Berlla Terra Virgin


Coconut Oil 450ml
$1.11 per 100ml

UNDER

Heinz Baked Beans


or Spaghetti 420g
24 per 100g

$ 99

EA

HALF

HALF

$ 29

$ 14

EA

99

EA

16

KG

Squisito Organic
Diced Tomatoes 400g
$2.48 per kg

99

EA

Greenseas Tuna 95g


(Selected Varieties)
$10.42 per kg

99

EA

UNDER

PRICE

Kleenex Toilet Tissue


8 Pack
23 per 100 sheets

Liveringa Always Tender


Porterhouse Steak

99

NIC
A
G
OR

ANIC
G
R
O

$ 99

KG

PRICE

Cadbury Marvellous
Creations 270/300g

Sanitarium Weet-Bix 575g


52 per 100g

EA

$ 99

EA

Doritos Corn Chips


150/170g or Salsa 300g

Nescaf Coffee Sachets


20 Pack 250/370g

$ 99

EA

$ 99

EA

Red Rock Deli Chips 165g


$1.81 per 100g

Capriccio Beans, Lentils


or Chick Peas 400g
(Selected Varieties)
$1.98 per kg

$ 99

EA

79

EA

WHOLEFOODS & GROCERIES OPEN 7 DAYS 7AM

POST, September 5, 2015 Page 21

$
Mt Barker Free Range
Multi-Pack Chicken Breast

14

99
KG

Boneless Butteried Leg of Lamb (Plain,


Red Wine & Garlic or Mint Flavoured)

14

99
KG

N
GROW
AUST.

15

Bulk Beef Stir Fry Strips

99
KG

Mt Barker Free Range


Peri Peri or Moroccan
Split Chicken

$ 99

$ 99

EA

KG

Fresh Tasmanian
Twin Pack Salmon
Portions Skin On

Frozen Imported Sashimi


Grade Tuna Pieces

KG

Frozen Tasmanian
1kg Smoked Sliced
Salmon Side
$21.99 per kg

EA

22

$ 99
Chicken Drumsticks

99
KG

2kg Minimum

HT
CAUG
AUST.

$ 99

$ 99

HT
CAUG
AUST.

E
MAD
AUST.

1kg Primo Short Budget


Bacon
$5.99 per kg

Mt Barker Free Range Sweet


Chilli Lemon Grass or Peri Peri
Chicken Breast Strips 450g
$17.75 per kg

21

99

EA

KG

HT
CAUG
AUST.

Frozen Australian
1kg Medium Cooked
Northern King Prawns
$13.99 per kg

13

99

EA

Frozen 500g Shark


Bay Sea Mullet Fillets
$17.98 per kg

$ 99

EA

TIL LATE CLAREMONT, SUBIACO & WOODLANDS

Page 22 POST, September 5, 2015

UNDER

HALF
PRICE

$ 84
Connoisseur
Ice Cream 1 Litre
48 per 100ml

$ 99

Harvey Fresh
Semi Matured or
Matured Cheese 1kg
$5.99 per kg

EA

EA

Riverina
Natural Yoghurt 2kg
30 per 100g

$ 99

EA

UNDER

MA D
W.A.

West N Fresh
Yoghurt 350g
85 per 100g

$ 99

HALF

EA

FR E S
W.A.

PRICE

Meadow Lea
Spread 500g
33 per 100g

$ 64

$ 99

South West Full


Cream or Hilo
Milk 2 Litre
$1 per litre

EA

Kraft
Cheese Singles
360/432g

EA

$ 99

EA

Brunswick Tasty
Shredded Cheese 1kg
$9.99 per kg

$ 99

EA

BIG
MA D
W.A.

Dorsogna
Rind on Rib or
Rindless Bacon
Rashers 250g
$19.96 per kg

Streets
Blue Ribbon
Ice Cream 2 Litre
30 per 100ml

$ 99

EA

$ 99

EA

MA D
W.A.

Hunsa
Sliced Meats 100g
(Selected Varieties)
$29.90 per kg

McCain
Beer Batter Chips
or Wedges 750g
$3.99 per kg

$ 99

Harvey Fresh
Flavoured Milk 2 Litre
$1.50 per litre

EA

$ 99

MA D
W.A.

LITRE

Lean Cuisine Meals


350/390g
(Selected Varieties)

EA

$ 99

EA

$ 99

EA

MA D
W.A.

Kraft Philadelphia
Pour Over 220g or
Sweet Chilli Philly 250g

McCain
Healthy Choice Meals
280/400g
(Selected Varieties)

$ 99

EA

$ 99

EA

Tip Top The One or


9 Grain 700g
43 per 100g

Ingham Chicken
Breast Tenders 400g
$14.98 per kg

$ 99

EA

$ 99

EA

is now directly opposite Farmer Jacks Subiaco entrance!

AT
AVAILABLE
RE ONLY
SUBIACO STO

Sicilian Green
Olives

1699

kg

AT
AVAILABLE
RE ONLY
SUBIACO STO

Oven Roasted
Turkey Breast

2699
kg

AT
AVAILABLE
RE ONLY
SUBIACO STO

Virginian Ham
Maffra Farmhouse
Cheddar

3999
kg

AT
AVAILABLE
ORE ONLY
SUBIACO ST

1099

kg

WHOLEFOODS & GROCERIES OPEN 7 DAYS 7AM

POST, September 5, 2015 Page 23

$ 99
N
GROW
AUST.

2
Australian Grown Hass Avocados

250G
PUNNET

Freshly Picked Straight From The Farm Stringless Beans

FOR

OR $2. EACH
39

Bunches of Freshly Grown Spring Onions

99

BUNCH

$ 99
Locally WA Grown Fresh Cauliower

JCs Value Pack


Cashews Salted or
Unsalted 500g Pack
$15.98 per kg

Coca-Cola
Drinks 1.25 Litre
(Selected Varieties)
$1.59 per litre

$ 99

EA

$ 99

EA

JCs Pitted Dates


500g Pack
$5.98 per kg

Coca-Cola
Drinks 24 x 375ml
$2 per litre

$ 99

EA

17

99
EA

$ 99

EA

JCs Apricot & Coconut


Slice 375g Pack
$21.31 per kg

Leggos Pasta Sauce


565/575g
(Selected Varieties)

Carnarvon Grown Punnets of Ripe Tomatoes

$ 99

EA

$ 79

EA

$
JCs Fruit & Nut Mix
Premium 375g Pack
$23.98 per kg

Kraft Vegemite 380g


$1.44 per 100g

99
EA

$ 49

EA

KG

$
JCs Cranberries
Dried 500g Pack
$13.98 per kg

Uncle Tobys
Plus Cereal 690/820g
(Selected Varieties)

699
EA

$ 99

EA

UNDER

HALF
PRICE

Arnotts Chocolate
Biscuits 160/250g
(Selected Varieties)

$ 49

EA

Arnotts Assorted
Creams Biscuits 500g
80 per 100g

$ 99

EA

Nestl Milo 750g


$1.20 per 100g

$ 99

EA

Cadbury Breakaway
Biscuits 180g
$1.66 per 100g

30

99
EA

EA

Pepsi or Schweppes
Drinks 12 x 375ml
$1.33 per litre

$ 99

EA

UNDER

HALF

PER BOTTLE

Frantelle
Spring Water
24 x 600ml
49 per litre

$ 99

PRICE

Dine Desire
Cat Food 6 x 85g
(Selected Varieties)
$1.37 per 100g

99
EA

Dynamo
Ultra Laundry
Liquid 2 Litre
$5 per litre

$ 99

EA

Fructis Shampoo or
Conditioner 700ml
86 per 100ml

$ 99

EA

Nestl Carnation
Milk 300/375ml or
Sweetened Condensed
Milk 395/400g

$ 49

EA

TIL LATE CLAREMONT, SUBIACO & WOODLANDS


SPECIALS START SATURDAY 05/09/15 AND FINISH SATURDAY 12/09/15 WHILE STOCKS LAST. SO THAT ALL CUSTOMERS HAVE AN OPPORTUNITY TO PURCHASE SPECIALS
WE RESERVE THE RIGHT TO LIMIT SPECIAL PURCHASES TO REASONABLE RETAIL QUANTITIES. PHOTOS USED ARE FOR ILLUSTRATION PURPOSES ONLY AND MAY NOT FULLY REPRESENT THE ITEM ON SALE

towntalk

Page 24 POST, September 5, 2015

KEEPING THE TOWN OF CLAREMONT COMMUNIT Y INFORMED | SEPTEMBER 2015

12 - 25 SEPTEMBER

FROM THE MAYORS DESK

Mon - Sat 10am - 4pm


Sun 10am - 2pm
Number One Claremont
308 Stirling Hwy, Claremont

Local government ordinary


elections are to be held on
17 October this year. Held every
two years for half of the Council,
this will mean five positions will
be up for election.
I have been proud to be your
Mayor since 2009. During
that time we have had many
challenges which have turned into opportunities
because of the positive way councillors with diverse
interests and ideas have worked together for the good
of Claremont.
The Claremont community is unique, strong and
active and Im proud to be a part of it. I encourage you
take an active role by getting to know the candidates
and their interests.
Voting is not compulsory however I would encourage
you to have your say on who represents your
neighbourhood at a local level.
For further information, please visit
www.claremont.wa.gov.au/Council/CouncilElections
Jock Barker,
Mayor

Art lovers will be delighted by the return of the 2015


Claremont Art Award and Exhibition this month. The
Art Award boasts 8 entry categories and a $10, 000
prize pool and was open to Western Australian artists
aged 18 or over.
The exhibition will showcase works from both
established and emerging artists. The annual exhibition
features 56 high quality pieces in a range of mediums.
All artworks are available for purchase, with the
exception of the winning piece.

Its Duck
Crossing
Season

Senior Ranger John Balcombe herding ducks through the town centre.

Actually, it is duckling crossing season. Each year around


this time, parent ducks are making the arduous journey,
with their new ducklings in tow, from breeding areas
near the Swan River through to the safe haven of Lake
Claremont. Drivers are asked to be vigilant when driving
in and around the town centre and to help these lovely
little ducks if you can.

The art award is another opportunity for artists to


connect with audiences said 2014 Claremont Art
Award winner, Cynthia Ellis, The organised process
and professionally presented show was well received
last year. I was glad to be a part of it, Cynthia Elliss
piece is on display on level 2 in the Town of Claremont
Administration building.

Pedestrian Safety a Town Priority

The Royal Show is just around the corner, commencing


26 September. The Town has been working hard to develop
parking and traffic management strategies to manage the
expected additional vehicles in the area. A campaign to
encourage the wider community to take public transport to
the Show will commence shortly. For further information,
please visit www.claremont.wa.gov.au

Get into the


WINTER/SPRING EVENTS

2014 Winner Cynthia Ellis with her painting


if I stay quiet I can hear the river sing on a windless day

Town of Claremont

Exhibition
Art
ol
Scho
12 - 25 S
EPTEMBER

CLAREMONT QUARTER

Following a recent traffic count and speed study of


Bay View Terrace in the town centre, it was noted that
speeds entering Bay View Terrace from Gugeri Street
were higher than warranted. The current legal speed in
the shared pedestrian and vehicle space is 10km/h. For
the safety of pedestrians in the Terrace, a new traffic
calming speed hump has been installed at the Gugeri
Street entrance. Main Roads WA have agreed with the
Town to formally sign Bay View Terrace as a Shared
Zone. New signage will be installed to remind drivers
that Bay View Terrace is a shared zone and pedestrians
have priority as per the Road Traffic Code 2000.
Town of Claremont Presents

2015

IN YOUR COMMUNITY - SEPTEMBER & OCTOBER


12 to 25 September
Sun 20 September
1 October
Town of Claremont
School Art Competition & Celebrate Lake Claremont History in a Coffee Cup
A fun morning for the whole family
Celebrating 40 Years of the
Art Award & Exhibition
Exhibition
Number One Claremont
12 to 25 September
(see above for opening times)

Upstairs Claremont Quarter


(open during shopping hours)

10am to 1pm
Lake Claremont
Stirling Road Entrance

Museum - 10am to 12pm


Freshwater Bay Museum
Bookings on 9340 6983

SUNDAY 20 SEPTEMBER
FREE EVENT

AT THE CLAREMONT COMMUNITY HUB - 327 Stirling Hwy, Claremont *9285 4353 to reserve a place.
Saturday
Monday
Tuesday
Wednesday
French Conversation
English Conversation
The Knitting Club*
Baby Rhyme Time
9.30am - 10.30am
6th October
10.30am
Class*
1pm
to
3pm
1.30pm
to
2.30pm
Chinese Conversation
10:45am - 11:45am
Broadband for Seniors*
Practice your spoken English,
if English is your second language.

10am to 12noon

town of claremont events

10AM - 1PM

www.claremont.wa.gov.au

Thursday
Silly Snakes

Friday
Book Club*

8 October, 10am - 12pm

18th September2pm to 3pm

Italian Conversation

Story Time - 10.30am


Lego Club 3.30pm - 4.30pm

5.45pm - 6.45pm

JP Service 6.00pm - 6.45pm

NUMBER ONE CLAREMONT, 308 STIRLING HIGHWAY, CLAREMONT


P: 9285 4300 E: toc@claremont.wa.gov.au www.claremont.wa.gov.au
If you would like to receive this newsletter and other Council information on events and activities, please email SUBSCRIBE to jcarter@claremont.wa.gov.au

FOR INFORMATION ABOUT


ANY OF THESE EVENTS,
PLEASE VISIT US @ Town of
Claremont Events

POST, September 5, 2015 Page 25

Surf here we come


Western suburb streets came alive with
runners and volunteers on Sunday as tens of
thousands of participants brought fun and fitness to our doorsteps.

According to the organisers, more than 50,000


people took part in the City to Surf run, which
over its 41-year history has evolved into four runs
over a variety of routes.
The day kicked off at 6am with the start of the
full 42km marathon. Other events are the halfmarathon, 12km City to Surf run and walk, and
the 4km run/walk/wheelchair.
Friends, relatives and locals turned out to cheer
on and encourage the participants, while some
motorists who had forgotten about the traffic
stops got caught in snarls.
Apart from the start and finish, Subiaco was a
centre of huge activity, with local radio station
Nova taking full advantage of its location.

Every marathon runner was oered a free high-ve in


Bagot Road, Subiaco.

Nun on the run.

ABOVE: City to Surf runners


choke Hay Street, Subiaco,
as far as the eye can see
from the Subiaco Hotel to
Princess Margaret Hospital.

Sunday morning dog-walkers were only one hazard


as the marathon ran through Subiaco.

Desmond tu-tu?

RIGHT: Runners are oered


a sugar hit of free sweets
as they cross Rokeby Road,
Subiaco.

Runners get
the message
Conservationists were out in
force at the City to Surf run.
Armed with banners and
placards, they took the chance
to pinpoint the threatened
Underwood Avenue bush to runners tackling what has become
known as heartbreak hill past
Underwood Avenue Bushland.
Margaret Owen, from the
Friends of Underwood Avenue
Bushland, said: The stand of
Banksia prionotes on the north
side of the bushland is one of
the biggest around and provides
food to support the carnabys
cockatoos while they are in
the area in the non-breeding
season.

Parking tickets down

Bush campaigners spelled out their message to runners about the importance of the Underwood Avenue site on the route that is threatened
with development.

The message about parking


restrictions during the City
to Surf seems to be getting
through to motorists.
Each year, drivers caught out
illegally parking complain they
have been unfairly treated, but
Cambridge council staff said
the number of tickets issued
was down this year.
Council CEO Jason Buckley
said: The City to Surf resulted
in 46 parking notices being

issued, which included four


cautions, Mr Buckley said.
It is a significant reduction
from last year, when 82 tickets,
including 19 cautions, were
issued.
This could be attributed to a
slight reduction in competitor
numbers, but could also be the
result of greater driver awareness of the parking restrictions
and, as a result, better driver
behaviour.

Page 26 POST, September 5, 2015

www.mosmanpark.wa.gov.au

TOWN OF

MOSMAN PARK

Green Waste Collection


Councils collection of green waste will start from 7.00am on Monday
21 September 2015. Residents can place green waste out on the verge
for collection NO earlier than 10 days prior to the scheduled pick up.
Each street will be serviced once; therefore any late placement of waste
will not be accepted.
PLEASE DO
Only place tree and shrub
prunings on your verge

Australia Day Award winners for 2015

Australia Day Awards


It is time to acknowledge and reward the individuals and local
organisations that have made an outstanding voluntary contribution
during 2015 or contributed to the local community year after year.
Categories include:
Citizen of the Year (25 years and older)
Young Citizen of the Year (under 25)
Community Group or Event of the Year
The Awards will be presented on Australia Day, 26 January 2016
as part of the Australia Day celebrations. Nominations close on
Friday 16 October 2015. Nomination forms and guidelines are
available at the Administration Centre, on the Towns website
www.mosmanpark.wa.gov.au, or by contacting the Community
Development Team on 9384 1633.

Ensure that your prunings


are no longer than 1.5
metres (5 ft)
Ensure that your prunings
weigh 16kgs (35lbs) or less
Stack green waste neatly on
the street verge with the cut
ends facing the street

PLEASE DONT
Bundle or bale green waste, tie it with
string or place it in boxes or other
containers including garbage bags,
plastic bags, wool bales or bulker bags
Include tree stumps, large tree roots,
large tree trunks or branches

Include household rubbish with your


green waste
Deposit waste on the road, footpath,
driveway, laneway or in a mews.
Residents in laneways should place their
waste on the nearest verge for collection
Use ONLY the authorised
Put loose green waste in unauthorised
Town of Mosman Park Green bags
Waste Bags that are available
for sale from Council
Authorised Green Waste Bags, for the disposal of leaf and lawn clippings,
are available for sale for $5.50 at the Towns Administration Centre.
For further details, visit our website at www.mosmanpark.wa.gov.au
or call 9384 1633.

New Microchipping Laws for Dogs

Do I have to microchip my Dog?


Yes you do... As of 1 November 2015, all dogs over 3 months of
age must be microchipped under the Western Australian Dog Act
Amendment 2013.
How much does it cost to microchip a dog?
There is still time for residents, non-resident property owners
Typically, about $60.00, however contact your vet to provide you with a cost.
and members of the general public to read the draft of the
Town of Mosman Parks draft Local Planning Scheme No.3 and
My dog is old and would not cope with getting a microchip, what
make submissions.
can I do?
The draft can be viewed at the Administration Building at Memorial Park, The Town requires your vet to issue you with an exemption certicate if
on the corner of Bay View Terrace and Memorial Drive, Mosman Park;
microchipping the dog is likely to adversely affect its health.
and are available for inspection during ofce hours (8.30am to 4.30pm
Monday to Friday). Copies of the Scheme and submission forms are also What will happen if I dont get my dog microchipped?
Failure to comply with the registration and microchipping requirements
available on our website at www.mosmanpark.wa.gov.au Submissions
under the Western Australian Dog Act 1976, Amended 2013 can result
can be received any time from now until 1 October 2015.
in a ne up to $5,000.
Reminder: Cat & Dog Registration Renewals
Cat & Dog registrations are due by 31 October 2015. You will receive a
Join us for the upcoming FREE Skate Clinic at the McCabe Street Skate
registration renewal notice in the mail early October 2015.
Park on Tuesday 6 October, from 10am to 12pm. Learn how to skate or
get tips on doing tricks these clinics are a great opportunity to develop
your skateboarding skills, learn how to prevent injuries and practice
skate park etiquette. All skateboards and safety gear provided.
Registration forms are available at www.skateboardingwa.com.au
The Mosman Park YAC are proud to present STOMP!, an event
For more information contact the Towns Community Development
like televisions The Amazing Race, that will see teams of local
Ofcer, Haylie Clark by email to hclark@mosmanpark.wa.gov.au or
young people aged 10 to 18 years travel by foot to various
visit www.mosmanpark.wa.gov.au
locations around Mosman Park where they will participate in
exciting Checkpoint Challenges.
Groups may be comprised of 2 to 6 people and must be registered
prior to the event, and teams with participants under 12 years must be
accompanied by a supervising adult.
If you are planning any changes to your crossover or verge please
When: Sunday 20 September 2015, 9am to 1pm with lunch provided
remember that you need to submit an application form rst.
Cost: $16.50 per person (includes lunch, drinks & event T-shirt)
Failure to do so may result in your being required to remove unauthorised
For registrations and further information contact the Community
works. Contact our friendly Technical Services Team for more information
Development Ofcer, Danelle Fauntleroy by email to
by visiting our website at www.mosmanpark.wa.gov.au or by calling
dfauntleroy@mosmanpark.wa.gov.au or by calling 9384 1633.
9384 1633.

Submissions Open on
Local Planning Scheme

Mossie Park Skate Clinic

Are you ready to STOMP!?

Before You Plan to Change Your Verge


or Crossover

Between River and Sea

POST, September 5, 2015 Page 27

Despite protests,
Cott wont fight link
By DAVID COHEN
Cottesloe council has voted
twice not to oppose the Perth
Freight Link.

Aurelia Brown, left, Jorja Ilias, Rebecca Murphy, Sienna Norris, Maisie Smith, and Summer Chalder celebrated
a literary sesquicentennial. Photo: Billie Fairclough

Keeping Alices adventures alive


Alices Adventures in
Wonderland had transcended
time, Methodist Ladies College
teacher/librarian Deborah
Bourke said.
Students dressed up as characters from the book last week
to mark the 150th anniversary
of its publication.
The story of Alice, the bored
little girl who went in search of
adventures, has been entertaining children ever since Lewis
Carroll first told the story to

the children of a friend, Ms


Bourke said.
The real Alice was one of
those children.
It still sparks childrens imaginations, as Alice journeys
through the rabbit hole, meeting an array of interesting and
topsy-turvy characters along
the way.
Ms Bourke said the book was
perfect for dress-ups.
The wide range of characters
in the story can be interpreted
in traditional or modern dress,

she said.
All our junior-year girls know
the story of Alice and had a great
time choosing their favourite
characters to be for a day.
There arent many books
that are 150 years old that still
impact children in the way that
this one does.
Lewis Carroll aka Charles
Lutwidge Dodgson wrote his
first Alice draft in 1862 but
added the Cheshire Cat and Mad
Hatters Tea-Party episodes two
years later.

Two public demonstrations


against the $1.6billion project
a road link between Fremantle
port and Perths eastern industrial suburbs have been held,
but at the July council meeting,
the vote to oppose the link was
lost, 3-5.
The council has now voted
twice by slim majorities not to
oppose the freight link.
The first time was on June
22, when mayor Jo Dawkins
used her casting vote to join
councillors Philip Angers and
Peter Jeanes to defeat a motion
to oppose the link.
Councillors Jack Walsh, Sally
Pyvis and Jay Birnbrauer voted
to oppose the link.
At its meeting on July 27, the
same three councillors were
outvoted on the same issue by
councillors Jeanes, Angers,
Rob Rowell, Katrina Downes,
and Helen Burke. Mrs Dawkins
was absent.
Before the council voted on
opposing the link, Grant Street
resident Peter Rattigan said
councillors should fight it.
I urge this council to oppose
what is going to be a waste of
money, Mr Rattigan said.
Put money into the outer
harbour instead that would
take trucks off all suburban
roads, particularly Cottesloe.
Ms Pyvis said she disagreed
with a council administration
report which said a report about
the link by Professor Peter
Newman had not been based
on references.
There are many references,

many being to government documents, Ms Pyvis said.


The Perth Freight Link is a
road that leads to nowhere.
There are so many unanswered questions.
A detailed business plan
supporting the PFL has not
been released.
Where is the transparency?
Mr Rowell said fuel tankers
would still be in the area until
a fuel line was built from North
Fremantle to Armadale.
We will continue to have container trucks going to Osborne
Park and Wangara, he said.
The Perth Freight Link has
nothing to do with Curtin Avenue
and West Coast Highway traffic.
Mr Walsh also disagreed with
the council report.
Main Roads says there will
be a 42% leakage from the
Perth Freight Link to roads,
Mr Walsh said.
Acting mayor Mr Jeanes said
the worst-case scenario was that
nothing happened.
He said the Perth Freight Link
would be better than nothing.
Premier Colin Barnett was
invited to speak at the link
forum held last Tuesday in the
Cottesloe Civic Centre.
But he refused to attend,
telling the local ratepayers
association that advertising
for the meeting was under the
banner of Rethink the Link,
and the event appeared to be
a political debate.
Ms Dawkins said Main Roads
had told council officers the
Freight Links intention was to
provide a safe route and remove
heavy vehicles from roads other
than the Link.
This would include roads in
Cottesloe, she said.

Early 1900s Private 3 Acre (1.24ha) Estate

117 Hardey Road, GLEN FORREST from $1,700,000

Surrounded by beautiful lush green


established grounds & terraced rock
walled gardens nestles this unique original
stone home with Architect designed brick
2 storey additions providing the
combination of the old & new lifestyles.
Features high ceilings, ornate cornices
& fireplaces, u/croft stone cellar, study,
5 x 2, soaring glass walled walkway to
huge main living & dining areas,
essa stone tops in gourmet kitch/meals
area, ducted a/c, solar heated luxury pool
area, wisteria covered old kitchen remains
alfresco, free form Gaudi inspired feature
walled entertainment area & studio
retreat above garage.

A LIFESTYLE INVESTMENT!
Trevor Clark
0408 914 335

Inspections By Appointment
For Home Open Times Next Weekend See Internet From 7th September

Joss Clark
0403 717 942

Page 28 POST, September 5, 2015

Block
owner
objects
to B&B

Drinking in
the show
By DAVID COHEN
Stephen Brook once got into
strife over a book he wrote on
the power and politics of the
Bordeaux wine industry.
I didnt pull my punches,
Mr Brook said.
It was about the peculiarities of the place and it got me
into trouble.
People still come up to me
and say what a great book it was.
Mr Brook, from the UK, was
at Claremont Showgrounds this
week for Perth Royal Wine Show
judging.
He has written 32 books on
wine, Britains class system,
Jews, travel, the Salvation
Army, and other topics, but
said the Bordeaux book was
his favourite.
Its important writers remain
100% independent, he said.
It was his third time in WA.
His first trip was an exploration
at Margaret River and a big tasting at Cullens; the second was
to the towns wine show.
Globally, the wine industry
is in pretty good shape, Mr
Brook said.
There are new emerging
markets: China, Brazil, eastern
Europe.
Mr Brook said he got into wine
journalism by accident.
I was writing a lot of book
reviews for the New Statesman
and they asked me to do something on wine, he said.
Eventually I was writing a
wine column every week.
Then I moved to Vogue after
I wrote to them and got lucky.
Mr Brook said the Australian
wine show judging system had
its critics, but he thought very
highly of the process.

The only neighbour to object


to a bed-and-breakfast business in their street owned a
vacant block, Peter Dhu told
councillors.

Oenophiles Stephen Brook and Ainslie Gatt at the Perth Royal Wine Show in Claremont.
Photo: Paul McGovern
Also at the Showgrounds was
Cottesloe resident Ainslie Gatt,
a member of The Fabulous
Ladies Wine Society.
The group says members are
... sick of the testosteronefuelled, high falutin and (lets
face it) downright yawn-inducing
way in which this most deliciously wonderful beverage is
communicated.

I do like riesling at the moment its fresh and crisp, Ms


Gatt said.
Years ago it was sweet and
horrible.
Ms Gatt, an art consultant,
said she drank a lot at the Show.
With the ladies was Houghton
Wines Courtney Treacher, a
wine judge, who wore an eye
mask so she didnt see the labels

on the bottles.
The Perth Royal Wine Show
ran from Monday to Friday,
September 4.
Twenty-five other judges
joined Mr Brook in tasting 2091
wines from 346 entrants.
Judges results were due to
be announced on the last day
of the Show.

Mr Dhu and his wife Violet are


empty nesters and want to rent
a spare room and bathroom in
their five-bedroom, two-storey
home in Tower Street, West
Leederville.
But the owner of a block opposite told planners it would
spoil the area.
As it happens, this street is
already too close to Leederville
commercial hub, the landowner
said in a letter to the council.
He said a bed-and-breakfast
use would have a negative effect
on the value of his property and
he would want compensation.
We residents of the street will
fight the approval of this unfair
decision either as a class action
or individually, through all legal
and social media avenues.
Mr Dhu told the development
committee he had spoken to
most of his neighbours.
They think it is a good idea,
he said.
We will live upstairs.
Cambridge council agreed
the Dhus could run a bed-andbreakfast business from their
home.

Like the POST


on facebook

Every renovation
starts with a
trusted builder
"

I love living and working in this community. While choosing to renovate is a big decision,
all of my clients are so glad they nally made those long-awaited improvements. Call
me old fashioned, but I think that being hands-on in every project is the only way
to ensure absolute quality, value for money and client satisfaction. I also make sure
we leave a clean site at the end of each day it usually gets me another cup of tea!
Ralph Brewer Director of Exactus Homes

Get our guide


to the cost of
renovating at
exactus.com.au

"

OUR SHOWCASE

Lets discuss that renovation youve been day dreaming about. Chances are, Im already in the area! Call me on 0450 922 887 or email ralph@exactus.com.au.
NT
CLIEIN
G
RAT/10
10

Castle Rd,
Woodlands

NT
CLIEIN
G
RAT/10
10

Alderbury St,
Floreat

NT
CLIEIN
G
RAT 10
9/

Cobb St,
Scarborough

NT
CLIEIN
G
RAT/10
10

Brockway Rd,
Mount Claremont

NT
CLIEIN
G
RAT/10
10

Parramatta Rd,
Doubleview

NT
CLIEIN
G
RAT/10
10

Skipton St,
City Beach

NT
CLIEIN
G
RAT 10
9/

Grovedale Rd,
Floreat

EXACTUS
HOMES
built with pride

exactus.com.au

POST, September 5, 2015 Page 29

/,=,@(

;/,653@ 5(;<9(3
(5+69.(50*3(;,?
4(;;9,:::<7730,9
 6--(33;,(2),+:(5+/,=,@(4(;;9,::,: *

Perths only organic latex and adjustable bedding


professionals with over 29 years experience.
/L]L`HPZ[OLVUS`IYHUKVMJLY[PLKVYNHUPJILKKPUNWYVK\J[ZPU(\Z[YHSPH
0MP[ZUV[/L]L`HP[PZUV[ 6YNHUPJHSS`*LY[PLK3H[L_>O`JVTWYVTPZL&
 (SS5H[\YHS-PIYLZ)HTIVV*V[[VUHUK:PSR
 (SSLYN`-YLLHUK 6YNHUPJ
 ,_JLW[PVUHS*VTMVY[HUK:WPUHS:\WWVY[
 *\Z[VTPZLK6YKLYZ(]HPSHISL
*VUKP[PVUZHWWS`:LLPUZ[VYLMVYKL[HPSZ

HeveyaTM9HUNL,_JS\ZP]L [V,\YVWLHU)LKKPUN
www.europeanbedding.com.au | 557 Stirling Hwy, Cottesloe | Ph: 9384 0388

Page 30 POST, September 5, 2015

Withers in the crosshairs

By LINDA CALLAGHAN

Council elections could turn


into a bloodbath in Cambridge.
Four candidates will compete for the mayoral chain and
whatever happens the vote will
be split.
Anger among ratepayers has
built up over the past six months
because of proposed changes
to housing types allowed in
the town.
Mayor Simon Withers has been
the prime target.
He held off announcing
whether he would run again
until Thursday, he said to spare
his family from what had become
increasingly personal attacks.
During the Amendment 31
debate I was subjected to five
months of nasty and personal attacks, including banners outside
the primary school where I take
my children, he said.
I delayed announcing because I wanted to minimise the
time that my family would be
exposed to this kind of abuse.
In a way, this election is a
vote on whether that kind of
behaviour is acceptable.
Five candidates led by lawyer
Keri Shannon declared themselves a ticket for more than
half the seats on the council.
Ms Shannon works for a resources company and has degrees in finance and accounting.
She lived in West Leederville
before moving to City Beach.
Maverick councillor Rod
Bradley, who has often been
a lone voice on the council, is
standing. Three others who have
stood in previous elections and
been defeated make up the rest
of the ticket.
The other two candidates for
mayor are City Beach lawyer
Gary Mack and councillor
Pauline OConnor.
Mr Mack started canvassing

Ted and Pauline OConnor after


their wedding.
months ago delivering his own
leaflets and chatting to voters
on the streets.
He has been working his way
through West Leederville.
He worked for Fremantle
council before going back into
private practice with a Subiaco
firm.

Married to high school teacher


Leila for 32 years, they have a
son and two daughters.
He said he had been approached by an agent for the
ratepayers group asking him
not to run because he would
split the vote.
Ms OConnor (68), who has a
seat as a councillor for another
two years, said she would not
join ratepayers because she had
never run on a ticket.
That is just not me, she said.
What you see is what you get.
I am a straight shooter.
I have never run with any
group and they never asked me.
A former deputy mayor who
was acting mayor following
the resignation of Marlene
Anderton, Ms OConnor was
also previously a member of
Perth city council when Simon
Withers late father, Reg, was
lord mayor.
Now the rugby union season
has wrapped up, Ms OConnor
said she was putting all her time
into her campaign to be mayor
of Cambridge.
She described herself as rugby
mad, a devotion she shares with
her husband, Ted, who played
in the No.8 shirt.
He is a New Zealander and

Simon Withers crossing the London Marathon finish line in 1992.


the London Marathon.
Mr Withers and his wife,
Emma, have two daughters
aged nine and seven who have
a hectic round of ballet, scout
groups, cubs and joeys as well as
looking after two dogs and a cat.
Mr Withers said he used to
play tennis and hoped to return
to it after having back surgery
last year.
A former lap swimmer, he
has taken the plunge at HBF
Stadium to get fit again in readiness for the rebuilt Bold Park
pool opening.

Former lawyer to stand in Cott


By DAVID COHEN

A wine-loving father of three


and former lawyer has put his
hand up for Cottesloe council.

South ward bid Mark Rodda is


standing for Cottesloe council.

Mark Rodda (47) has nominated for the South ward and
says he wants to be involved in
Cottesloes improvement.
Thats my number-one reason, the Forrest Street resident
and business consultant said.
One Cottesloe issue Mr Rodda

Free pickup Margaret River,


Busselton, Dunsborough
4 Wineries, Cocktails, 1 Brewery, Chocolate
& Cheese companies and unique Australian
gourmet lunch at a winery.
TOURS
$95 DAILY 10 - 5PM

watched was the contentious


3m-wide dual-use path laid on
his verge last year.
That certainly could have
been handled a lot better, Mr
Rodda said.
It could have been done
to a better standard. Various
crossovers had to be repaired.
As with anything, consultation is key.
Various people said they
didnt receive a flyer about the

project. I have no recollection


of whether we received a flyer.
Mr Rodda said he had never
been a member of a political
party and his decision to stand
was his own.
Its a decision I made entirely
by myself, he said.
I dont believe local government is a place for party
politics.
Mr Rodda is no stranger to
Please turn to page 100

BEST DAY OUT


IN YEARS!
bushtuckertours.com

Margaret River
WINERY &
BREWERY TOURS

$40

Pauline is from Sussex in


England. They met when he was
playing at Langley Park where
she was a spectator.
I was a 10-pound Pom, she
said.
They celebrated their 40th
wedding anniversary on St
Patricks Day, March 17.
They married at Rangiora,
New Zealand where Teds parents lived.
I had no one here and we
thought rather than drag everyone over to Australia we would
get married where his family
lived, she said.
He played rugby the day
before even though I told him
not to.
He got smacked in the face
and had 17 stitches in his chin
on our wedding day and in all
the wedding photos.
I think he might even have
had a broken nose.
Mr Withers is limbering up
for his third tilt at the mayoral
office.
Four years ago he was appointed unopposed.
Last weekend his whole family
completed the 4km walk in the
City to Surf.
When he worked in London in
the 1990s, Mr Withers completed

LONG
WEEKEND
HOT DEALS!

See more, do more, taste more

Cave and Canoe Tours


on the Margaret River

Unspoilt wilderness, cave adventure, local guide, Australian


native foods and gourmet wildfood lunch.
TOURS DAILY 10-2PM

FAMILY OF FIVE DEAL $220

Ph: (08) 9757 9084 or visit

Adults $100

Children $40

A
R

U
S
R
&
FF
L

ST

L
IVA

CUL
TU

POST, September 5, 2015 Page 31

GRAB YOUR MATES AND JOIN US FOR AN ABSOLUTE RIPPER OF A DAY FILLED
WITH GOOD VIBES AND GOOD TIMES WHILE YOU IMMERSE YOURSELF
IN INDIGENOUS COASTAL CULTURE.
CULTURAL ACTIVITIES
SKATEBOARDING WA BEST TRICK JAM
FUNKY FOOD
FREE TOWN OF COTTESLOE BUS SERVICE EVERY 15 MIN 10AM - 2PM

JAKE AND THE COWBOYS


Jason Bartlett Jam Yang The Durongs Candice Lorae & Dazastah
To register for the surf competition head to:
https://www.surngaustralia.com/states/wa/events/2015-icea-classic
To register for Skateboarding WA Best Trick Jam head to:
http://skateboardingwa.com.au
For more information check out:
http://iceafoundation.com.au/classic
Reconciliation Inspired by Young People

Page 32 POST, September 5, 2015

How mens sheds can


help with dementia
Being an active member of
a mens shed can help with
dementia, according to a senior
dementia consultant.
Michelle Harris, from
the Bethanie Care Group,
dropped into the Mosman Park
Community Mens Shed recently
to give a talk to members on
Living Well with Dementia.
She was so impressed with
the shed that she declared it
dementia friendly, and said it
was a model of what society
needed.
Ms Harris said that every
four seconds, one person was
diagnosed with some form of
dementia across the globe.
The rise is so significant
that I dont believe there will
be enough care homes in 2050
in Australia to cope with the
dramatic rise in dementia,
she said.
She explained that part of
the problem was that funding
was based on disability rather
than ability.
We need to support peoples
abilities rather than focusing

on pills and potions, she said.


The mens shed is therapy.
It is brilliant, and we need
more of them around the world.
Ms Harris said she had been
particularly impressed by the
signs, photos and accessibility
of the Mosman Park shed.
Every person with dementia
has a different experience, so
our approach to communication must be person centred,
she said.
We need to build a dementiafriendly community with services that support a person to
maintain their autonomy.
She said dementia caused a
shift in the way someone experienced the world.
As a society, we must become
more dementia aware and
friendly by changing our minds
about people whose minds have
changed, she said.
With the support of the
WA Mens Shed Association,
Bethanie has recently opened
four sheds in its lifestyle villages
in Busselton, Capel, Rockingham
and Yanchep.

Visiting judo master Akitoshi Sogabe, from Japan, helps train students enrolled in the new judo academy at
Shenton College. Photo: Billie Fairclough

Judo on the curriculum

Some Shenton College students have added judo to the


list of things they study at
school and their learning
curve is going to be part of an
academic study.

Michelle Harris with members of the Mosman Park Community Mens


Shed. Photo: James Campbell

Last month, with the support of


the UWA Judo Club, the school
started its own judo academy
and nearly 40 students signed
up for weekly lessons.
Shenton College principal
Michael Morgan said it was
the rst high school-based judo
club in WA.
This initiative will allow
Shenton College students to

Town of Claremont Presents

enjoy the international Olympic


sport of judo through high school
and continue into university,
while beneting from the physical and moral teaching of judo
and the incredible opportunities
for international exchange,
he said.
We hope to develop a competitive edge and foster international student exchange
with Shenton Colleges established international network
of schools.
The club was of great interest
to judo master and academic
Akitoshi Sogabe, visiting from

Konan University in Kobe,


Japan.
Dr Sogabe, a 6th dan, was at
Edith Cowan University two
years ago to research knee injuries in judo, and during this
time he coached and trained at
UWAs Judo Club.
He was back in Perth last week
as part of another international
research project for the All
Japan Judo Federation.
Dr Sogabe was in WA as part
of a survey of four countries
Australia, Japan, France and
Germany to look at judo in the
education system.

Mosman tighter on grants


As part of its budget tightening, Mosman Park council has
changed its community chest
program.
Since it began in July 2013, 13
grants of between $1000 and $3000
have been given to community
groups for community projects.
A staff report to Tuesday nights
council meeting suggested changing the program to allow local
groups to buy small equipment,
such as printers, that allow them
to function better; cover the cost
of promotional materials such as
brochures or signs which encour-

age membership; or cover the cost


of training or courses to allow
volunteers to develop skills.
At the corporate and technical
services committee meeting on
August 11, North ward councillor Zenda Johnson welcomed the
proposed changes, saying the current system probably cost more to
administer than it gave out.
The council will now have
one round of grants a year, with
this years applications due on
November 6.
It will review the program next
February.

Industry finalists named


Six western suburb organisations are among this years
finalists in the WA Industry and
Export Awards.

A free event to celebrate the beautiful Lake


Claremont with a fun morning for the whole family.
WOODWORKING ACTIVITIES
BIRD WATCHING TOURS
FARM TO PLATE WORKSHOP
ROCK ART FACE PAINTING

SUNDAY 20 SEPT

10AM - 1PM
LAKE CLAREMONT, STIRLING RD
town of claremont events
www.claremont.wa.gov.au

Commerce Minister Michael


Mischin named the 16 nalists on
Wednesday.
The western suburb six are: the
Engineering Institute of Technology,
West Perth, for the education training award; CSA Global, of West
Perth, the minerals and energy
award; Proteomics International, of
Nedlands, the health and biotech-

nology award; Scitech Discovery


Centre, West Perth, the education and training award; Austral
Fisheries, West Leederville, agribusiness award; and Linear Clinical
Research, of Nedlands, the business
services award.
They will be presented with their
certicates on September 16 and
the winners will be announced on
October 16.
The winners will become nalists in the National Australian
Export Awards.

Transgender sperm storage


A Nedlands reproductive clinic
is providing sperm storage for
transgender people undergoing
the change from male to female.
The Keogh Institute for Medical
Research at the QEII Medical
Centre said the stored sperm
could later be used for IUI or IVF
procedures in the female partners
of transsexual women.
The institute said hormonal and
surgical treatments were known to
decrease fertility.

In male to female transition, the


number of viable sperm reduces
gradually. Within a few years of
treatment there will be no detectable sperm and ultimatelythiswill
become irreversible.
Ideally, sperm storage should
be done before hormonal therapy
starts.
The institute is the only sperm
storage centre in WA not attached to an IVF clinic, allowing
transgender people to feel more
comfortable.

Like the POST on facebook

POST, September 5, 2015 Page 33

FOR SALE

166A TOWER ST WEST LEEDERVILLE

$1,100,000 - $1,150,000

2
220sqm

THE EASY LIFE


This Webb and Brown-Neaves home is only 3 YEARS OLD and immaculately presented. Capitalising on its prized position
on the preferred NORTHERN side of the street, this abode boasts MOOD LIFTING sun soaked living areas. A clever design
has provided the OPTION to have MASTER BEDROOM ON UPPER OR LOWER LEVEL. An upstairs sitting room has City Skyline
views and provides a peaceful retreat from the main living area. Only a short stroll from the bridge linking it to the VIBRANT
Leederville cafs strip and train station, who needs a car ?

Agent
Tony Young
0412 041 954

tony@optimusre.com.au

9385 9000

w w w. o p t i m u s r e . c o m . a u
B o u l eva rd S h o p p i n g C e n t re , C i t y B e a c h

HOME OPEN:
SATURDAY
5TH SEPTEMBER
2.15PM - 3.00PM

Page 34 POST, September 5, 2015

Audi, Land
Rover stolen

Cumquat tree stolen

BEAT

An Audi and a Land


Rover were stolen from
homes in City Beach and
Claremont this week.
The red Audi A3 was
taken from a Marapana
Road home in City Beach
between 7.25 and 7.55am
on Wednesday.
The car was in the garage, and the roller door
was open.
The day before, the maroon Land Rover was stolen from a Stirling Highway
home in Claremont.
Thieves got in thanks
to an unlocked front door
between 7.15 and 7.45am
and grabbed the keys to
the 2000 car.
Neither car has been
found and police believe
the crimes could be linked.

Footy writer
burgled
POST columnist Austin
Robertsons address book
was stolen from his car
on Wednesday night.
Austin is appealing for
the book to be returned.
It was taken from
the car either at the
Glendalough shopping
centre or Pollard Street,
Glendalough, Austin
said.
The thieves also stole a
bottle of Wolf Blass Grey
Label wine from the car,
a Hyundai i45.
Also taken were articles
and proofs of Austins stories for the POST.
The address book is the
killer, Austin said.
If that could be returned, or if someone finds
it, that would be great.

A cumquat thief struck


in Onslow Road, Shenton
Park on Wednesday
night.

with DAVID COHEN

Police wonder if these two men can assist with queries


about a Claremont crime.

Men sought for assault info

Two smartly-dressed
men in their 20s may be
able to help with queries about an assault in
Claremont last month,
police say.
At about 12.45am on
Monday, August 10, two
men were in a physical
confrontation in Stirling
Highway.
Detective Senior
Constable Terry Gilmore
said a third man had
approached the men in
an attempt to calm the
situation, but he had been
forcefully pushed against
a wall, knocking him out.
The injured man was
taken to hospital and later
released.

The first man had light


skin and dark short hair,
was about 1.8m tall and of
medium build.
He was wearing a black
leather jacket, white
button-up collared shirt,
brownish grey skinny
pants, and brownish grey
shoes.
The second man had a
tan, a slim build and short
dark or black hair, and was
about 1.82m tall.
He had on a blue suittype jacket, blue collared
button-up shirt, and tan
pants and shoes.
Information can be
given to Crime Stoppers
quoting reference number
7817.

Drugs, cash seized in raid


Police seized ice, heroin, cannabis, and $10,000
cash during a raid on a
Mt Hawthorn home on
Tuesday morning.
Wembley police joined
detectives from Perth and
Midland to search the
Fairfield Street home.
Acting Senior Sergeant
Dave Stevenson said tips
to Crime Stoppers from the
public were instrumental
in getting the warrant.
A Mt Hawthorn man
(39) has been charged
with a range of offences,

including 73 counts of
offer to sell or supply a
prohibited drug, Sergeant
Stevenson said.
A 49-year-old Mt
Hawthorn woman has
also been charged with
30 counts of offer to sell
or supply a prohibited
drug.
Both people had their
bail refused when they
appeared in the Perth
Magistrates Court.
Vincent council workers
declared the home unsafe
for human habitation.

Methadone
tip-o
A Mosman Park man
had methadone in his
home last Friday, police
allege.
Officers from Cottesloe
police station searched in
the morning at the 45-yearolds Stirling Highway
home.
The man was charged
with possessing a prohibited drug and unlawful
possession of property.
Station officer-incharge Neil Morton-Smith
said the search had happened in part thanks to
a tip-off.
Information from the
community can be very
helpful and we are grateful when residents report
suspicious activity or
people, Senior Sergeant
Morton-Smith said.

Burglars
walk in
Some Cottesloe residents were home when
they were burgled last
weekend.
The burglars got into the
Avonmore Terrace home
through an unlocked back
door between 11pm on
Saturday night and 8am
on Sunday.
They took a wallet, cash
and jewellery.
A bank card in the wallet
was used to commit frauds.

On Wednesday morning, John Woodhouse was


admiring his cumquatladen tree which stood
outside his Orangery
Gallery in Onslow Road.
During night, someone
else was apparently
equally impressed with
the fruiting tree and
stole it.
Leaving tyre marks in
the grass, the fruit-loving
thief appeared to have
tried to lift the entire pot,
realised it was too heavy
and pushed it over to pull
the tree out.
The thief left the second
less impressive cumquat
tree to stand alone.

Now there is only one


cumquat.

40 charges for ex-Telstra man


A former Telstra
worker is due in court
next week after allegedly stealing Telstra
property valued at more
than $250,000.
Major fraud squad officers charged the 38-yearold Applecross man with
40 counts of stealing as a
servant.
He has been sacked from
his job, which included
managing client accounts.
A Telstra spokesman

said no company customers had been affected by


the alleged crimes.
Police said that between
January and October last
year, the man had ordered
phones and iPads under
different customer accounts and forwarded the
items to himself.
They said he had sold
the items online and kept
the proceeds.
The man is due to appear in Perth Magistrates
Court next week.

52kmh over the Freeway limit


Police said a 20-yearold Churchlands man was
speeding on the Freeway
two weeks ago.
They said the man had
been driving a Subaru
Forester at 152kmh
when he was pinged in

Joondalup at 10.15pm on
Friday, August 21.
The Mitchell Freeway
has a 100kmh limit.
Last Wednesday, police
impounded the Subaru
and charged the 20-yearold with reckless driving.

c
o
s
i
v
e
D
r
,
e
r
o
l
p
x
E
,
k
l
Wa

Get outdoors, have fun and meet new friends on our


professionally-guided walks on the Bibbulmun Track.

Check out new events in the latest Bibbulmun Track calendar. From easy
day walks, family and kids events to womens only escapes
BOOK EARLY!
and overnight adventures. Theres an event for you!

WE ARE THE TRACK SPECIALISTS


Take the first step visit

www.bibbulmuntrack.org.au and BOOK ONLINE

We also run all-inclusive


8 to 9-day guided tours on the
Bibbulmun Track with accommodation,
meals and transfers included.
Experience the best of the
Bibbulmun!

P: 9481 0551 E: events@bibbulmuntrack.org.au W: www. bibbulmuntrack.org.au

POST, September 5, 2015 Page 35

AUCTION

Auction 26th September 2015 @ 11.00am

5
S O
10 , 12 AT PE
.0 , 1 UR N
0A 9
D
M & 2 AY
-1 6S
0. E
45 PT
A
M

28 Jarrad Street, Cottesloe

PERIOD PERFECTION
Grace and Charm abound in this amazingly preserved and
renovated period home with generous living spaces set on
531sqm complementing its prominent Central Cottesloe
location.
A perfectly appointed gourmet kitchen is central to the
home, ensuring a perfect blend of modern functionality and
old school charm. Jarrah oorboards, doors, skirting and
window frames, pressed with characteristic ceilings and
open gas re places accompany the original proportions
throughout. Stunning leadlight and bay windows complete
the special features.
Externally there are stunning landscaped grounds and
gardens perfectly framing a a glistening, crystal clear below
ground pool for all the family to enjoy.
So many other features abound including:
Reverse cycle air conditioning
Master bedroom with large built in robe and bay windows
Surround sound in main living area
Landscape gardens with outdoor entertaining and pool
Reticulated gardens
Garden lighting
Double carport with storage
Security features include remote electric gates, video
intercom system and sensor lights
Limestone cellar/Store
A sophisticated residence that is a MUST SEE!

531sqm
Land

Frank Torre

0411 866 550


frank@housere.com.au

www.housere.com.au
p: +61 8 9284 5554 | a: 10 Station St Cottesloe WA 6011, Australia

Andrew Gill

0439 955 725


andrew@housere.com.au

Page 36 POST, September 5, 2015

Letters to the POST

Editor, 276 Onslow Road, ShentonorPark


email558
to letters@postnewspapers.com.au;
or fax toRoad,
The Editor
at 9388
andevery
address
should
be given,
and there
Please send
emailletters
letterstotoThe
letters@postnewspapers.com.au;
SMS6008;
to 0429
001; or mail to: The Editor, 276 Onslow
Shenton
Park2258.
6008.Full
Wename
require
letter
intended
for publication
should
be a the
daytime
phone
Boring
letters,phone
or thosenumber
longer than
300 words, willBoring
be cut.letters,
Email letters
shouldlonger
carry the
writer
residential
Deadlineisisnoon
noon Wednesday.
Wednesday.
to
include
writer
s fullnumber
name for
andverification.
address plus
daytime
for verication.
and those
than
300s full
words
will beaddress.
cut. Deadline

Why Coast ward ratepayers are taking Cambridge council to court


Letter from Robert Walker
Coast Ward Ratepayers Association

On August 25, Cambridge Coast


Ward Ratepayers Association
applied to the Supreme Court for
a judicial review of Cambridge
councils decisions to initiate and
adopt scheme Amendment 31.
Amendment 31 may result in
45% of City Beach residential
lots and 33% in Floreat being
strata-titled for multiple and
grouped dwellings.
In some streets, the amend-

ment affects 80% to 95% of lots.


In addition, grouped dwellings
on corner lots are to be granted
concessions with reduced setbacks,
effectively destroying the uniform
setbacks for which these suburbs
are renowned and admired.
In Floreat, heights for multiple
dwellings will be greater than
are now permissible.
Over 82% of respondents to
the statutory advertising period
opposed Amendment 31, but the
council ignored its own planners
and experts advice and adopted

it with only minor modications


and without further advertising
or consultation.
The amendment was adopted
by mayor Simon Withers and
councillors Corinne MacRae,
Colin Walker and Tracey King.
Professional advice we have
received says the adopted
amendment is still fundamentally awed, will not achieve the
stated aims of creating housing
diversity, and will severely affect
the character of these suburbs
as we know and love them.

We are opposed to Amendment


31 as adopted because:
It does not represent a good planning outcome for these suburbs;
It delivers density without
diversity;
There have been failures in
legal and statutory process that,
if followed, might have led to a
better planning outcome;
There is a better way affordable housing and diversity can be
obtained with minimal impact or
conict on homes in traditional
suburban streets.

Andrew Mills defensive


arguments (Wembley matters, Letters, POST, August
22) over being handpicked by
Keri Shannons Save Our City
Beach Our Floreat group to
run for Cambridges Wembley
ward give the impression he is
a Wembley boy with an address
in Cambridge Street, Wembley,
in my view.
In fact, he lives in Hovea
Crescent, City Beach, which
is the address he gave when
he asked questions about
Amendment 31 at the Cambridge
council meeting on April 28.
At the same meeting I was
present he said: Ive got a
shop in Wembley and I think its

Great white took woman in 1985


Re Sharks dont eat women
(POST, August 22).
During the 1980s and 90s, I
was living in South Australia.
In 1985, a woman was killed
while abalone diving and snorkelling not far from the shore in
the Port Lincoln Peninsula area,
not far from where tuna shing
boats were moored.
Her husband and children
were watching from the shore

when a huge white pointer came


out of nowhere, took hold of her
and pushed her out of the water.
No remains were ever found.
It was a terrible event for
her family to have witnessed.
J. Ward
Karrinyup Road, Stirling
More letters pages 38

Please turn to page 100

Are possums
missing old
home comforts?

Candidates not from Wembley


a great idea they build an eightstorey building right nearby
with residential housing. No
one bought in there thinking it
would be low density forever,
did they?
But two apartments in a twostorey building the size of a City
Beach house were unacceptable.
I can see hed like eight storeys in Wembley, where he has
a business.
If you are seeking election,
giving your home address when
you write to the POST would be
a good place to start.
Louis Carr
Cambridge councillor
Simper Street, Wembley

Save our City Beach, Our


Floreat and the association have
obtained, at their own expense,
professional town planning, architectural, real estate and legal
advice and acted on it.
An alternative planning proposal that seeks to introduce
more affordable and diverse
housing has also been commissioned.
But despite requests, the council chose not to engage with us,

Stand up to them, Withers


I am utterly disgusted reading some of the vile letters
and comments that have been
presented over the past few
weeks regarding Cambridge
mayor Simon Withers and
councillors.
I have been watching and
listening to the unruly and
rude attacks on the above by a
small group of uncouth people
who must surely have some
unstated agenda, unrelated to
their objection to the zoning

amendment proposed by the


council.
No doubt we all have an
opinion, but dont express this
in such a manner.
Hopefully Mr Withers and
the council will stand up to
this bunch of rabblerousers,
and get on with the excellent
way Cambridge has been run
over the past few years.
Sheila Warren
Alexander Street, Wembley

Gill
Trent
Julie

Keeping it Real
sales | leasing | auctions

Real Estate

Last night, out on the terrace,


for the rst time ever I watched
a possum eating the berries off
the cape lilac on the verge.
I have been thinking for quite
some time to start an anti-cape
lilac movement.
They are an intrusive weed
and a home for those nasty white
moths whose caterpillars invade
anything that isnt hermetically
sealed.
Get rid of them.
But now even the possums are
feeding on them.
The twenty-eights have been
doing so, and for the past two or
three years the black cockatoos
have been at it too.
Is this because the natural
food source for the birds has
been phased out of the city
environs, and the possums are
running out of old rotting roofs
to feel comfy in?
These guys need to be fed, but
an alternative to the cape lilac
needs to be introduced.
Tony Harrison
Keightley Road, Shenton Park

0415 853 926


0432 392 387
0407 008 570

viviansresidential.com

It is a hard market but we


ARE leasing properties!!
Looking for experience
and dedication look no further
than Julie!!
Mosman Park resident great
local knowledge
A straight shooter you will get
real advice!
We are looking for more rentals,
call today for a condential chat

Julie Harrington is a highly regarded property professional in the


western suburbs. She commenced her real estate career in Cottesloe
in 1998 and rapidly developed a passion and great understanding
of the industry. During her 17 years in the sector she has carried out
a wide variety of roles and has gained a reputation
as a trouble shooter for her broad knowledge across
many sectors of the business and her capacity to
resolve complex issues.

View all our listings on REIWA.com.au

viviansresidential.com

Julie Harrington 0407 008 570


julie@viviansresidential.com

POST, September 5, 2015 Page 37

Gill
Trent
Julie

Keeping it Real
sales | leasing | auctions

0415 853 926


0432 392 387
0417 425 433

viviansresidential.com

Real Estate

19/30 Wellington St, MOSMAN PARK

6 Burrill Turn, BURNS BEACH

Oers from $540,000 by 5pm 7th September 2015


The owner reserve the right to sell prior

All oers from $520K will be presented

Build Your Beach Home

Afternoon Delight

This is your chance to buy some rare earth in Burrill Turn, Burns Beach
Prime land positioned around all new homes. Walk to the beach,
stroll to Burns Beach Caf and a choice of picnic areas.
5 minute drive to Joondalup City, accessible to public transport, close
to established schools and health care facilities.

This 3 bedroom townhouse is in original condition and neat as a pin.


Renovate to your own design or just live in as it is. Nestled in a secure
complex of just 20 makes this a desirable place to call home.
110sqm
3

Vacant land 556sqm

Please call to inspect

Open Saturday 11.00am - 11.45am

Gill 0415 853 926


Trent 0432 392 387

Gill 0415 853 926


Trent 0432 392 387

Real Estate
Get your gardening gear on and enter our
competition for the loveliest garden in the
Western Suburbs.
TO ENTER GO TO OUR FACEBOOK PAGE AND
UPLOAD YOUR PHOTO!
To vote for the loveliest garden just go to our
Website viviansresidential.com and follow us
on our Facebook page and click like for your
favourite. Voting starts on 15th September.

Spring

Is Here!

9,9,$165(6,'(17,$/
*$5'(1&203(7,7,21

The garden with the most likes will win a


double pass to the Camelot Outdoor Movies.
The nal decision will be made by Gill Vivian
and the FIRST PRIZE is a $500.00 voucher
to spend at Dawsons Garden Centre.
Entries close 7th October and the winner
will be announced on 14th October on our
Facebook page and results will be published
in the POST.

View all our listings on REIWA.com.au

viviansresidential.com

Page 38 POST, September 5, 2015

Letters to the POST

Editor, 276 Onslow Road, ShentonorPark


email558
to letters@postnewspapers.com.au;
or fax toRoad,
The Editor
at 9388
andevery
address
should
be given,
and there
Please send
emailletters
letterstotoThe
letters@postnewspapers.com.au;
SMS6008;
to 0429
001; or mail to: The Editor, 276 Onslow
Shenton
Park2258.
6008.Full
Wename
require
letter
intended
for publication
should
be a the
daytime
phone
Boring
letters,phone
or thosenumber
longer than
300 words, willBoring
be cut.letters,
Email letters
shouldlonger
carry the
writer
residential
Deadlineisisnoon
noon Wednesday.
Wednesday.
to
include
writer
s fullnumber
name for
andverification.
address plus
daytime
for verication.
and those
than
300s full
words
will beaddress.
cut. Deadline

Avoid them,
dont fell them

I wish I could
save the old
trees next door
Having read the councils
policy on trees in Claremont,
I was hoping the large stone
pine trees (Pinus pinea) in my
neighbours backyard would be
protected.
However, after speaking to
Andrew in the councils park
department over the weekend, I
learnt the homeowner can chop
down any tree on his private
property, though the council
tries to preserve trees.
These are a cluster of magnificent stone pines, about
30m high and a haven for birds
and wildlife, in particular the
already threatened carnabys
cockatoo.
I believe my new neighbour is
planning to take some of these
trees out.
Already some significant peppermint trees have gone.
Ria Kitson
Airlie Street, Claremont

Why do mature trees have to


be cut down at such an alarming rate in our suburbs?
As I drove past Karakatta
station last week, I thought they
were pruning, but no!
By the afternoon, at least
six trees had been cut to the
ground to make way for a bike
track.
If we can ride a bike, surely
we can steer around a tree?

Too many trees get the chop in our

Ashlea Wilken suburbs, says Claremont reader AshSecond Avenue, Claremont


lea Wilken.

Dont toe Liberal party line


on bombing, Julie Bishop

Claremont reader Ria Kitson sent in this photo of stone pines she fears
her neighbours may be planning to get rid of.

So thats why Barnett wanted small councils gone


At a recent Cottesloe council
meeting, I asked two questions
specific to Marine Parade.
When would the no standing
and speed limit stencilled signs
be repainted?
The response was that the
first would be repainted in due
course and that Main Roads was
responsible for the second.
Apparently, Main Roads installed speed limit stencilled
signs as a trial and has decided
to abandon them, because they
have had no effect.
The council then said speed
limit compliance was strong
in Marine Parade, so I guess it
concurs that signs are not really
necessary because everyone
pretty much does the right thing,
mostly!
My second question was about
safely crossing Marine Parade
at or near the Wearne Hostel
and Lady Lawley Cottage, which
cater to aged residents and children with disabilities.
The council response was
that the area did not meet the
minimum volume of traffic
and pedestrian use to justify
installing safe havens like zebra
crossings.
In fact, the council said safe
havens or crossings actually
increased pedestrian accidents,

based on its experience.


So now I find out speed limits
painted on the road and zebra
crossings are actually not only
a waste of time but also hazardous to pedestrians, based on the
councils experience!
I just hope that if any councillors are fortunate enough to be
cared for at the Wearne Hostel,
they remember their comments
as they are getting wheeled
across Marine Parade and a
car is approaching them at or
above the speed limit.

I hope they say to themselves


as they try to huddle within the
confines of the traffic median:
Thank God I didnt support a
crossing or my well-being might
have been in danger.
I am starting to see why
Premier Colin Barnett wanted
to do away with councils that
wasted money and time and
did nothing.
He has to look no further than
Cottesloe council, in his own
electorate.
Shirley Primeau
Marine Parade, Cottesloe

I was astonished to hear


Foreign Minister and Curtin MP
Julie Bishop call for Europe to
join the bombing of Syria as a
way to stem the flow of refugees.
The refugees, predominantly
from Syria, are fleeing the bombing by the US, Turkey, Saudi
Arabia, the Syrian government
and now, apparently, Australia.
The bombing of ISIS positions,
mainly by the US, over the past
year or more has made no difference to the strength and fighting
capacity of ISIS on the ground.
The bombing campaigns kill
more civilians and destroy more
civilian infrastructure than ISIS
strongholds in fact, the bombing seems to be hit and miss, with
the emphasis on miss.
Plainly and simply: more
bombing leads to more refugees,
but Ms Bishop knows that.
Does Australia take in extra
refugees from the dipterous
wars it waged in Afghanistan
and Iraq?

Im wheelchair bound and looking forward to Uber


I am disabled and require
round-the-clock care.
I use an electric wheelchair
for mobility and rely heavily on
maxi-taxis for transport.
Last Friday, I was forced to
make yet another formal complaint about a taxi driver who
showed up to the job extremely
late with his pants undone and
underwear visible.
He clearly had a hunger for
fast food, because he insisted
that my friends operate the
wheelchair hoist and strap my
wheelchair into the van themselves while he ordered food
and left the meter running.
When he returned to the

vehicle after a considerable


delay, he proceeded to drive
as though he was competing in
the Grand Prix.
In the end, because one of my
friends was in a rush to get to
work and the driver had no idea
how to get there, or how long
it would take, we dropped my
friend at his house, which was
nearby, and he called an Uber.
During the rest of the taxi ride,
my other friends and I feared
for our lives.
I assume the drivers appalling conduct was all because we
were travelling a short distance,
meaning that almost the whole
fare paid was consumed by

overheads and fees imposed


by the parent company and
government.
That said, there are many good
taxi drivers out there, some of
whom are my regular drivers
who I book privately, as do most
wheelchair users, bypassing
dispatchers.
I want UberAssist to enter the
market for the drivers benefit.
I am sure you would never
want to work 16 hours a day,
assisting people living with disabilities with their transport,
for approximately $10 to $12 an
hour, would you?
James Davies
Fortview Road, Mt Claremont

Of course not!
We seem to expect them all
to go to Europe, already overcrowded.
Australia buries its head in
the ground when it comes to
refugees escaping wars, death,
bombings and destruction.
We lock them up, hide them
away, throw away the key, refuse them entry to Australia or
anywhere where they will be
afforded the dignity befitting a
human being.
Come on, Ms Bishop: you are
an educated, intelligent woman.
Dont make ignorant statements that toe the party line
rather than telling the truth.
Give Australians the benefit
of being able to assess your
comments and those of your
government for what they are
worth.
Walk in their shoes.
Carole Metcalfe
Oban Road, City Beach

Horseplay in Cott
Why the long faces? Theyre
in Cottesloe, my bridge club
friend Annie said about last
weeks front-page photograph
(Cops rein in protestors,
POST, August 29).
It was great to see elderly
horse Shilo and owner Alison
on Marine Parade, taking things
into their own hoofs.
I bet everyone there thought
she was the mane attraction
and not the stinky disgusting
toilets below Indiana.
I told Annie we were all a bit
horse from complaining about
the toilets.
Mercy Stone
Stirling Highway, Claremont

POST, September 5, 2015 Page 39

CONGRATULATIONS
Peter Burns

SOLD
The Highest
Value of Western Suburbs
Residential Property in 2014/15

REIWA Grand Master 2014/15 and REIWA #2 Top Sales Person in WA by Value Sold 2014/15

Get your home sold now, ring Peter 0418 925 012!

Page 40 POST, September 5, 2015

SOME OF OUR

NEW ARRIVALS

SEE MORE AT www.louisantiques.com.au

Unparalleled Choice. Outstanding Quality.


VISIT LOUIS ANTIQUES
PERTHS LARGEST SHOW ROOM
Quality antique furniture

9383 9239
www.louisantiques.com.au

83 Nanson Street,
Wembley (Cnr Grantham)
OPENING HOURS:
Monday - Friday 11am-5pm
Saturday 10am-4pm Sunday 1pm-5pm

ior

te r

ex

interio r

Inex

POST, September 5, 2015 Page 41

springtime
Image courtesy
Terrace Gardener

15, 2015
Page 18
42 POST, August
September
5, 20

ex

te r

ior

interior

Inex

Expert says Wedges


OK not DAPs to give

The good life


in Nedlands
By LLOYD GORMAN

Mr Foley said the land had the opportunity to comment on


been reserved as use for public what sort of uses should go on
A development assessment purpose hospital in the 1963 that land, because the council
opposed that, but it was still
panel (DAP) was not the Metropolitan Region Scheme.
The WA Planning Commission approved.
right authority to have ap- has 100% development control
In 2011, West Perth developers
proved the four-storey office over reserved land, but that Blackburne applied to the newly
block
nextit to
King
Edward had not been the case in this established DAP for approval to
freezing
or give
it away.
down to as little as $17.
RHIANNON SHINE
Memorial Hospital for Women, instance.
knock over five one-storey homes
My neighbours often get
Carolyn renovated her home
in Subiaco.
For the DAPs to be making and a shop on the site and build
a few
eggs
or Shenton
a bunch of
in 2000, installing insulation,
tart small is the
This
was
what
Park decisions on reserved land is a four-storey building with more
planning
expert
Neil
Foley told inappropriate, he said.
than 5000sq.m of office space and
sunflowers.
double eaves, skylights, breezeadvice from Carolyn
a recent hearing of the parliaMr Foley is also a professor of two levels of parking.
When
we really
too
oriented windows and ceiling mentary
Groves, who recently
inquiry
into have
DAPs.
It was the first commercial
urban and regional planning at
Mrmuch,
FoleyI said
hangthat
the because
produce of UWA and has been chairman of office building for Blackburne,
fans.
won Nedlands councils
the zoning of the site, on the cor- two DAPs.
which develops apartment
onBagot
the fence
with a little
sign
She also changed to LED
sustainability competition.
ner of
and Railway
roads,
It should have gone through complexs.
inviting
to take
lights, and put in garden beds it had
Carolyns sustainable lifestyle,
beenpassers-by
inappropriate
forit.a a scheme amendment first, he
At the DAP meeting, the DAPs
DAP
to
OK
the
$18.5million
offi
ce said.
I also have an electric bike
chickenmeant
pen. the DAP
which
includes
growing
Planning
expert
Neil Foley
said more
the Wedgeand
sitesa zoning
building, dubbed the Wedge.
Local people missed out on Please turn to page 76
had no
authorityand
to approve the
with baskets for shopping and
Webuilding.
have three compost bins
than 70 fruit,
vegetable
we use Transperth cards to
used in rotation, Carolyn said.
herb varieties on her homes
access public transport.
Chook poo, newspaper,
quarter-acre block, was 20
Carolyn said while the decision
green waste that the chooks
years in the making.
to
change
sustainable
dont
like
and
chips
from
the
She said her home, which for the
agoto
when
she wasliving
in- those personally affected by
top grades in school, but eight years
By RHIANNON SHINE
to lead
top schizophrenia
I noticedget
hismixed
grades
were vitedcould
beadaunting,
the key was schizophrenia to those who
to produce
was built in 1931, used to run then mulcher
W h e n C y n d i S h a n n o n slipping.
were simply interested in the
program
Sydney.
to startinslowly.
soil for the vegetables.
power,twin
gas and
water was
bills into
Weickerts
brother
Last week, she gave a pub- human brain.
He got worse. He withdrew
Join a at
permaculture
group, There is a lot of intrigue in
Shehis
saidroom.
frogs, birds,
the thousands
of dollars.
lic lecture
Christ Church
diagnosed
with schizophrenia
more into
Grammar
School, in Claremont, the human brain, she said.
Hepossums,
would listen
to Beatles
when heThat
waswas
17, it
was
the
first
she said.
bees and
other
until
she
installed
If you think about it, it may be
and play them back- about her latest research and
time she had heard the word. records
It becomes
a way of life
to one of the most complex organs
frequented
her
garden.her personal
solar electricity
a solar hot
experience
with
wardswildlife
and think
they had
special
She grew
up in theand
US alongschizophrenia.
accept that we have to have a on the planet.
Her for
fronthim.
yard is currently being
water
system.
side him,
shared
teachers and messages
Professor Shannon Weickerts
My aim is to discover bioWhen a psychiatrist diagfriends, We
played
baseball
and
lesser impact on the planet that
changed over to include more
save between $300 and
nosed schizophrenia, Professor logical subsets of schizophre- lecture was organised by mental
went on holidays.
wethat
live on.
vegetables,
fruitsdecided:
and herbs.
a power
CarolynShannon
we can target novel health awareness group Meeting
Weickert
I nia so
She $400
said they
hadcycle,
both been
therapeutics
bynot
re-purposing
gotta
learn
this
biology
stuff,
intelligent
children,
but
once
My aim is
only to improvefor Minds.
More organically grown food
said.
Details about the groups
the teenage years hit, something because I gotta find out whats available drugs that are already
my to
familys
wayfor
of other
life butdisalso events can be found at meetis with
produced
and we are more known
be safe
wrong
his brain.
changed.Our gas bill used to be
she others
said. walking by that ingforminds.com.
I wantedshe
to said.
help my eases,
I remember
I gas I knew
to show
self-sufficient,
around $300that
whenwhile
we had
My aim is to apply what we
brother, because the medicines
was socialising
and
partying,
you can have your beautiful
When we have more food
hot water now we pay about
my brother was starting to that were available to him at the know, or what we have learnt
Nedlands
home
begoing RIGHT: Professor Shannon
than
can
be
used,
we
either
$30.
so
far,
and just
test and
if its
time
were
terrible.
withdraw, Professor Shannon
made it her life mission
to
be
of
benefi
t.
Now
a
world-leading
neuroloWeickert
said.
environmentally friendly too. Weickert
store the produce by drying or
In summer, the gas bill gets
A way of lifethe
... Carolyns
gardenof
supplies all the fruit and veggies she needs.
root cause
She said a range of people ton uncover
We were both very academic gist, Professor Shannon Weickert
Photo:
Billie
Fairclough
attended
her
lectures,
from
schizophrenia.
over-achievers and competed moved to Australia from the US

Brothers illness a catalyst for study

20% Off All Antique Bedroom Furniture

New French
Shipment
MPIR
E
E
ANTIQUES

377 Fitzgerald St, NORTH PERTH


Phone: 9227 5502

Facebook.com/empireantiques
Facebook.com/Secondempireantiques

Open: 10am to 4pm Mon - Sat 1pm to 4pm Sun


Op

www.empireantiques.com.au

Inex

Cushioned by design
LOUISA WALES

he quest to find the perfect


cushion led Cottesloe textile
artist Sally Philip to the
obvious answer: make it herself.
I kept buying more and
more cushions, trying to find the
perfect cushion, Sally said.
It got so bad that I had to
actually sell some on Gumtree
just to make room for the new
ones.
Laughingly dubbing herself
the Imelda of cushions, Sally
said she had always been
creative, and her cushion quest
had led her to begin a design
process that recently culminated
in her range of hand-stencilled
linen cushions.
I had an idea of what I
wanted and what I would like,
she said.
There are so many massproduced printed cushions, and
they all start to look the same.
I thought it was time I just
created what I loved.
Weary of the sheen and
gaudiness of synthetic fabric
cushions pumped out by the
thousands in factories, Sally

Sally Philip is continuing a family tradition of being creative with fabrics.

opted for the tactile and earthy


pleasure of plain linen, adorned
only with her monochrome
stencilled designs.
I love the raw, clean feel of
linen, she said.
I found some really goodquality softened linen in
America. Then I just came up
with all the sorts of simple clean

designs that I would like to see in


my home.
She says her designs have a
coastal influence, born of her
love of living near the sea.
With a similarly coastal colour
palette soft yellows, neutrals,
shades of blue, sea greens and
soft pinks and stencil designs
ranging from a whimsical moose

to a rhapsodic oak tree Sallys


cushions combine simplicity with
subtlety.
I have always loved painting,
she said, and I enjoy the
process of hand painting each
picture, keeping the end quality
really high.
Im a bit of a perfectionist,
and Im very particular.
For Sally, a busy mother of
three girls who works parttime, the decision to follow her
creative impetus through to
completion has been a joy.
Im never happier than when
Im creating, she said.
Ive always wanted to do
something creative; I actually
wanted to be an interior
designer when I was younger,
but I followed the sensible path
rather than the creative path
and became a nurse and then
trained as a sonographer.
I feel like Im at the stage of
my life where I just want to give
it a go.
With a mother who was a
very creative and gifted quilter,
and three daughters who love
to contribute to Sallys design
decisions, there is a strong sense

ior

te r

ex

interior

POST, September 5, 2015 Page 43

of feminine continuity in Sallys


endeavour.
She plans to develop a bigger
range of cushions, including some
for outdoors, and table linen.
I can never find table runners
that are long enough for the
tables these days, she said.
They all look short and stumpy.
Drawing on another creative
avenue of hers, floristry, Sally
has an innovative idea to make
a decorative runner that could
provide a two-dimensional
artwork for the table.
I want to be able to lay
something on the table and
make it look beautiful with hand
painted images, so that you can
have a dinner party with it rather
than having all the flowers and
candles, which take up all the
space, she said.
Sallys designs can be
customised, and her range
includes fun colours and stencils
that would be suitable for
childrens rooms.
She hopes to have her
cushions stocked in some small
boutique shops, but for now
is selling them online through
Facebook at Sally Philip Designs.

SO
AL BLE
W A &
NO AIL VY
AV NA ITE
IN WH NG
PI
PI

ALBOO

ALUMINIUM FAUX BAMBOO OUTDOOR


STOCK LANDING NOV
PRE ORDER NOW | LIMITED STOCK AVAILABLE

SEBASTIANALEXANDER.COM.AU
(08) 9387 - 5357 | 80 JERSEY ST JOLIMONT

Inex
ior

te r

ex

interior

Page 44 POST, September 5, 2015

New roo paw comes up gold


A

specially bred kangaroo paw


will be the feature flower at the
Friends of Kings Park plant sale
and will be in full bloom throughout

the gardens.
Named Anniversary Gold to
commemorate the WA Botanic
Gardens 50th year, it is a yellow and

Discover native plants that have survived the test of time at the sale in Kings Park.

green version of WAs floral emblem,


the red and green kangaroo paw
(Anigozanthos manglesii).
Anniversary Gold will be available
to buy at the plant sale, from
September 26 to 28, and from most
big nurseries.
The sale will also include tried
and tested plant varieties that have
proved their worth to Perth gardeners
over the past 50 years, such as
the beautiful Silver Princess gum
(Eucalyptus caesia), red cap gum (E.
erythrocorys), and the scarlet honey
myrtle (Melaleuca fulgens).
The Friends plant sale is one of the
biggest and most eagerly anticipated
events of this years Kings Park
Festival, which celebrates spring
throughout this month.

Stop scrolling, start purling


CATHERINE MAZZA
Do-it-yourself projects often begin
with the best intentions.
The prospect of creating something
yourself is initially met with enthusiasm
and grand expectations, but
sometimes, even the best intentions
can fall by the wayside when a
project starts to get too hard, takes
too long or if the results dont quite
look as they should.
With this in mind, several Perth
businesses are running workshops
that give people a chance to

complete DIY projects or learn skills


without the long-time investment.
Interiors retailer Corner Store started
its Crafting at the Co-op earlier this
year, run at its Fremantle premises.
The Corner Stores self-confessed

September 10: Meet Kings Parks

horticulturists and gain insights into the


practices used in the WA Botanic Garden.
The Botanic Garden Secrets Walk is a free
event and registrations close at 5pm on
Wednesday, September 9.
September 13: Live music from Jacob
Diamond, Helen Shanahan and Tired Lion
at the Pioneer Womens Memorial, from
10.30am to 4pm.
Daily: Free guided walks led by Kings
Park volunteers depart daily from Fraser
Avenue, outside Aspects.
Meet the artist: On select days meet
some of the local artists whose creations
are stocked in Aspects.
September 10, 2.30pm: Conservation
and Spiders science seminar.
For bookings and information, go to
bgpa.wa.gov.au/kings-park.

craft overlord Lynn Jones said


workshops at the Co-op had been a
surprising success.
People are wanting to slow down
and get back to basics, she said.
They want to put down the iPad,

Caroline
Thew, coowner of
Corner Store,
is satisfying
the demand
for DIY workshops.

Festival highlights

stop scrolling and start purling.


So far there have been workshops in
floristry, knitting and crochet, but given
their popularity, Lynn and her team will
be expanding the workshop schedule to
include classes in homewares and DIY
Christmas decorations.
The classes are typically held on
weekend afternoons and the costs
include all materials.
If that isnt enough to tempt you, they
provide morning or afternoon tea to
ensure there is no DIY fatigue.
Our workshops are a fantastic
antidote to the fast-paced digital
generation, Lynn said.
In Leederville, Studio Bomba hosts workshops

in its adult classroom, The Skillsmithery, with


classes in crafts, hobbies and homewares. People
can learn how to create terrariums, knot macram
hangers and do hand lettering.
Northbridge-based printmaker Beau Est Mien

runs workshops for those keen to learn screenprinting techniques. They are designed for
beginners.

Unique pieces
of Timeless
Elegance and Style
WA Stockist of

Inside + Outside Natural Paint

BAUWERK
COLOUR

www.bauwerk.com.au

Design Service Available

Shop 3A/ 1 Leura Ave, Claremont 6010


(08) 9286 2225
Aube Nouvelle Shopping & Retail

Inex

ube Nouvelle means


new dawn and
for retail stylist and
textile artist Gloria Ford,
that is just what her little
Claremont shop has been.
The small Leura
Avenue store, crammed
with beautiful, tactile
homewares, was a whole
new beginning for Gloria
when, last year, she
decided to use her talents
in interior design, styling,
textiles and handcrafting
and bring them all
together under one roof.
Its really about
community and giving
back, she said of her
warm, friendly shop with
its eclectic range of linens,
tableware, homewares,
artworks, jewellery and
childrens clothing.
Everything I love is in
this shop, she said. It
is a place to fossick in. It
has evolved over the year
as Ive got to know my
clientele, but really I bring
together things I love, and
that have a story.

mix of antique and


avant-garde with
a bit of whimsy
thrown in.
The homewares, furniture
and artwork are largely
locally-made because
Gloria wants to support
local businesses and
artists.
Other goods that come
from interstate or overseas
have been chosen
because of their own back
stories. Voyage Maison,
for example, is a Scottish
family-run company that
produces cushions with
handpainted watercolour
scenes on linen matched
with local tweeds and
velvets.
A new furniture range,
Xavier, comes from

Brisbane.
Aube Nouvelle will be
the sole WA stockist for
a range of high-quality
furniture that Gloria said
was perfectly designed for
WAs climate and style.
Gloria has also started
a consultation service with
interior designer Yvonne
Mettham.
She said that in their
collaborative approach
to interior design, they
worked closely with clients
on designs suited to them
and their lifestyles, not
necessarily what was the
latest fashion.
Gloria also runs knitting,
crochet and beading
classes, crafts that have
become very popular
again, especially among
young people
Its also another way of
bringing the community
together, she said.
Grandmothers used
to teach this sort of thing.
I learnt knitting and
crocheting from my greatgrandmother.

ior

te r

ex

Little shop of love


A
I love the eclectic

interior

POST, September 5, 2015 Page 45

Gloria Ford has brought together everything she loves under one small roof.

"Discover Perth
s best
kept secret"
Contact our Landscape Company
Hort Plan for a complete
Landscape & Concrete swimming
pool Design & Construct
service or view our work at
www.hortplan.com.au

Opening Hours
Mon - Fri 9 to 5pm
Saturday 10 to 4pm

Garden Design Centre


& Collectables
Guildford Post Office Building
24 Stirling Street,
Guildford WA 6055

Phone - 08 9379 2333


Email - hortplan@bigpond.com

Page 46 POST, September 5, 2015

POST, September 5, 2015 Page 47

Page 48 POST, September 5, 2015

POST, September 5, 2015 Page 49

Page 50 POST, September 5, 2015

Community news
A stroll through
medical history

Turning
kids into
foodies

A Sunday afternoon walk will


take interested people past the
art deco King Edward Memorial
Hospital and into the medical
museum, Harvey House.

Perth chef Peter Manifis has


strong ideas about what children should be eating.
Last week, Peter spent time
showing food coordinators from
several childcare centres some
delicious dishes using produce
like local kangaroo and mackerel.
There are plenty of meat
cuts and fish that are fresh and
affordable, Peter said, at the
cook-up at Unicare in Nedlands.
Kangaroo has great properties. It is lean, cheap and delicious.
Daycare centres often serve
tinned salmon from overseas
when we have local mackerel
that can be served fresh and is
cheap.
I serve mackerel in my restaurant, Incontro, and I think
children can be taught to eat
everything.
Peter said the willingness of
the childcare centre to embrace
opportunities to improve childrens health was commendable.
It is a privilege to cook for
children, he said.
Last year, more than a million
Australian children spent time
in childcare, which amounts to
a lot of meals.
At Unicare, Virginia King
and Hua Zhar, who took part
in Peters workshop, prepare
124 meals a day and put a lot
of thought into making the food
healthy and balanced.
We have chicken once a week
and soup once a week, Virginia
said. We also have vegetarian
meals, fish and mince.

Food for thought Chef Peter Manifis throws around some meal ideas with childcare chef Virginia King
for happy consumer Alessandra Rose Kelemanis from Unicare. Photo: Paul McGovern
The workshop was organised by Australasian Health
Development Network nutritionists Ros Sambell and Amanda
Devine, who provide nutrition
training in the community.
The network has developed an
online menu planning tool that
saves childcare centres time
and money.
And parents are interested too.
Karen Palmer from Unicare
said the centre had hosted a
session for nearly 40 staff who
then applied their knowledge.
This training has also resulted
in our families wanting to have
a training session themselves,
she said.

Titled Maternity and Museum,


the free See Subi on Sunday walk
on September 13 will start and
finish at the corner of Bagot and
Hensman roads at 1.30pm.
It will pass KEMH, which was
built in 1935, on the way to Harvey
House in Barker Road, which
began life as an industrial school
in the 1870s.
In 1916 it became King Edward
Memorial Hospital.
Harvey House is named after
the hospitals first matron and
became the WA Medical Museum
in 1985.
Volunteers there will give a
guided tour of the original hospital and provide an insight into
WAs medical history through the
interesting exhibits
The relaxed and informal walk
will last about 1 hours and is
suitable for all ages.

Sing some songs in Subi


Now is your chance to join
a choir and be part of a musical show all in one night.
Vocal ensemble Voiceworks
will hold its annual community
singing workshop on Tuesday,
September 15, at 6pm in the
Shenton Park Community
Centre.
Crooners and croakers alike
are encouraged to head along,
make some music and be part
of the fun.
The workshop will run

from 6 to 7.30pm, with light


refreshments provided for all
participants before a public
performance at 8pm, followed
by supper for everyone taking
part and the audience.
The workshop will be run by
Voiceworks director Maggie
Wilde West under the baton of
musical director Joshua Webb
and with accompanist Gavin
Nicklette.
It is all happening at the community centre on the corner of
Herbert and Onslow roads in

Shenton Park.
The cost to be part of the
workshop and performance
is $20 and tickets to the show
are $10.
Workshop application forms
are available at the Shenton
Park Community Centre and
Subiaco library or phone Bev
on 0448 131 153.
The forms need to be returned by Friday, September
11.
For tickets to the show, phone
Bev on 0448 131 153.

The Heart Foundation warmly invites


you to join us for a

Free Public Health Forum


Women and heart disease women have heart attacks too!

Tuesday, 15 September 2015, 1pm to 2pm


Shenton Park Community Hall, 240 Onslow Road, Shenton Park
Please join us for what promises to be an informative and enjoyable
lunchtime health forum to raise awareness about women and
heart disease the single biggest killer of Australian women

Our special guest speakers will be:


Dr Paddy Ramanathan, General Practitioner and advocate for womens heart health
Dr Michelle Ammerer, Cardiologist and Heart Foundation Board Member
Helen Kingsbury, Heart attack survivor and Heart Foundation Volunteer

A complimentary healthy lunch pack and bottled water will be provided

RSVP by Friday, 11 September by telephone: 9388 3343 or email debbie.slater@heartfoundation.org.au


Please note, places are limited, and offered on a first come, first served basis

We look forward to welcoming you!


Maurice Swanson Chief Executive, Heart Foundation WA

Proudly Supported by

POST, September 5, 2015 Page 51

Peter Clements 0415 920 920


Grand Master 2015

Selling a home is easy. Selling for a great price is Mint.

6/1 Roydhouse Street

OV $4 SOL
E 5
AS ,0 D
KI 00
NG
PR
IC
E

JU
ST

JU
ST

263 Salvado Road

TOTAL OF THESE 8 SALES:

SO
LD

SO
LD

74 Solomon Street

38b Alfred Road

AS A SOL
KI BO D
NG VE
PR
IC
E

9 Fortview Road
AB
OV $5 SOL
E 0
AS ,0 D
KI 00
NG
PR
IC
E

AB
OV $2 SOL
E 51 D
AS ,0
KI 0
NG 0
PR
IC

3/15 Freshwater Parade

AB

E
OV $2 SOL
E 10 D
AS ,0
KI 0
NG 0
PR
IC
AB

AB

OV $3 SOL
E 00 D
AS ,0
KI 0
NG 0
PR
IC
E

Over $9 million worth of property sold in the past 2 months:

$9,575,000
based on sold and under offer properties by
Peter Clements since 1 July 2015

3 Cowan Street

6/4 Perina Way

Discover what my clients are smiling about. Contact me today if


you're thinking of selling. Peter Clements M: 0415 920 920
Mint Real Estate Claremont | 36 St Quentin Avenue | 9284 6000

mintrealestate.com.au

Page 52 POST, September 5, 2015

OFFERS ABOVE
Never look back

Never look back

$1,250,000

4
1

653 m2

FOR SALE

SELLER RESERVES THE


RIGHT TO SELL PRIOR

325 m2
CONTACT

SWEET GREEN TITLE SURPRISE

Peter Clements

24 Chatsworth Tce, CLAREMONT

M 0415 920 920


P 9284 6000

ALL WRITTEN OFFERS ABOVE $1,245,000


PRESENTED 5PM TUES 22ND SEPT 2015
Elegant & low maintenance, this home offers the very best in
fuss-free living. It's in a superb location just two minutes' walk
to the quality schools, cafes, restaurants, shops & transport that
Claremont has to offer.
Spacious two-storey oor plan with fantastic separation
High ceilings & top quality nishes
Four living areas and a generous entertaining courtyard
Total Privacy
North-facing living & entertaining areas
Ducted reverse-cycle air-conditioning
Six solar panels keep power bills to a minimum
Extensive storage throughout
Two large bedrooms upstairs

OPEN
Sat 5th Sept 12:15pm - 1:00pm
Wed 9th Sept 5:00pm - 6:00pm
Sat 12th Sept 10:00am - 10:45am
Sat 19th Sept 12:00pm - 12:45pm

CLAREMONT OFFICE

36 St Quentin Avenue
Claremont
mintrealestate.com.au

Never look back

POST, September 5, 2015 Page 53

5
2
2

EXCEPTIONAL CHARACTER HOME

Peter Clements

18 Langsford Street, CLAREMONT

M 0415 920 920


P 9284 6000

ALL WRITTEN OFFERS ABOVE $1,895,000


PRESENTED 5PM MON 21ST SEPT 2015
Langsford St is an idyllic family neighbourhood & number 18 is a truly
exceptional home. Its a grand character residence with a sensational
rear extension and the coolest backyard we've seen in a while.

CLAREMONT OFFICE

36 St Quentin Avenue
Claremont

mintrealestate.com.au
Family street where everyone is friends
Walk to schools, Claremont Quarter & Lake Claremont
Stylish outdoor kitchen with built-in bbq, fridges & pizza oven
Awesome kids' cubby house
Sought-after traditional features, elegantly pared-back for modern living
Light-lled, open living spaces
King-size bedrooms, ensuite & walk in robe
Modern kitchen & bathrooms
Generous oor plan with versatility to suit your family
OPEN
Sat 12th Sept 12:00pm - 12:45pm
Sun 13th Sept 11:00am - 11:45am
Wed 16th Sept 5:00pm - 6:00pm
Sat 19th Sept 11:00am - 11:45am

FOR SALE

CONTACT

SELLER RESERVES THE


RIGHT TO SELL PRIOR

653 m2

Page 54 POST, September 5, 2015

Confirms

ACTON #1
Real Estate Group in WA
Sales Market Share for the 12 months to March 2015
ACTON Applecross
ACTON Baldivis
ACTON Bunbury
ACTON Busselton
ACTON Canning Vale
ACTON Carine Glades
ACTON Central
ACTON Commercial
ACTON Coogee
ACTON Cottesloe
ACTON Dalkeith
ACTON Dunsborough
ACTON Fremantle

9316 8088
9523 3888
9791 5777
9754 9200
6350 0000
9246 0611
9381 5566
9386 9981
9434 8200
9384 6999
9386 8255
9755 3399
9319 3022

ACTON Mandurah
ACTON Margaret River
ACTON Mount Lawley
ACTON North
ACTON Projects
ACTON Rockingham
ACTON South
ACTON South Central
ACTON South East
ACTON Strata
ACTON Victoria Park
ACTON West Coast

9550 2000
9758 8898
9272 2488
9285 0111
6160 6480
9592 8999
9474 2088
6310 0300
9497 3773
9468 7705
9470 5556
9400 1600

PROUDLY 100% WESTERN AUSTRALIAN OWNED


AND OPERATED (SINCE 1969)

WWW.ACTON.COM.AU

POST, September 5, 2015 Page 55

COTTESLOE & DALKEITH

Strive not to be a success,


but rather to be of value
Albert Einstein
RECENT TESTIMONIALS
Selling my home was a stressful time for me until Bev came on the scene. Not only was she available to answer my
queries, she acted in my best interest at all times. With her honesty, professionalism and her knowledge of the area
she gave me confidence in selling. I highly recommend Bev Heymans and her fantastic team to anyone selling a house
- you won't be disappointed Cottesloe Seller - Sold May 2015
I have bought and sold many homes over the years, so feel I've had experience in what does and doesn't work when
choosing my real estate agent. Out of all the agents I've selected, Bev Heymans remains at the top of my list for selling
success, professionalism, honesty, integrity, dollar value of my home vs outcome, dedication, perseverance and attention
to detail. This is why I've chosen her time and time again, and recommended her to my family and friends. It is always a
pleasure dealing with Bev and I trust that she will get results. She also has a great support team and nothing is ever too
much. I highly recommend Bev and all the expertise that she offers. North Fremantle Seller - Sold July 2015
This was a difficult journey for us, made bearable by an outstanding agent. From day one, nothing was ever too much
trouble for Bev to organise or undertake. It seemed most of the time that we were her only customers, such was her
commitment, efficiency, availability and dedication. Cottesloe Seller - Sold July 2015

Bev is a consistent performer,


rated year after year in the
top 5 agents in Western Australia*
(Top salesperson ACTON 2015, Number 5 in REIWA 2015, Number 3 in WA REB 2015).

Bev Heymans 0419 099 243


bev.heymans@acton.com.au
bev.heyman

ACTON COTTESLOE 500 STIRLING HIGHWAY, PEPPERMINT GROVE PH: 9384 6999 WWW.ACTON.COM.AU
ACTON DALKEITH 160 STIRLING HIGHWAY, NEDLANDS PH: 9386 8255 WWW.ACTON.COM.AU

Page 56 POST, September 5, 2015

COTTESLOE

IC
R
O
ST ITE
I
H S

THE YORK MILL

$1,199,000

A UNIQUE OPPORTUNITY

11,500sqm

With the landmark York Flour Mill at its centre, this impressive 11,500sqm complex
offers a mix of retail shops, cafe and gourmet food outlets, gallery spaces, and
large undercover warehouses suitable for concerts/markets. Set in the beautiful
Avon Valley, York is a popular destination just 90 minutes from the city. The York
Mill, circa 1892, stands proud as you enter the town on the main road from Perth,
and with vision could become an even greater drawcard for visitors. Markets,
music festivals or showrooms... This is a site that deserves to endure as a landmark
destination. Please go to our website for a video tour of the premises.
PLEASE CALL TO INSPECT
INTERNET ID# 2914221

MICHAEL WATTS
0417 952 557
Michael.Watts@elders.com.au

W
NE ICE
PR

DEBORAH BRADY
0405 570 903
deborah.brady@acton.com.au

60 PANMURE ROAD, YORK

KHOURABENE CIRCA 1900

$369,000
3

8,897sqm

A delightful mix of heritage charm and modern convenience, this spacious home
offers the best of both worlds. Situated on a large 8897sqm sub-dividable block in
an elevated location overlooking York, it offers a modernised kitchen, large family
room, three spacious bedrooms, two bathrooms, laundry with storage space, and
a separate double garage. Original features include high ceilings, jarrah oors,
verandahs and open replaces. The extensive grounds have established fruit trees,
wood shed and chicken coop. Act quickly to secure this very appealing property!
PLEASE CALL TO INSPECT
INTERNET ID# 2914220

MICHAEL WATTS
0417 952 557
Michael.Watts@elders.com.au

,
G
IN G
O
G OIN
G

DEBORAH BRADY
0405 570 903
deborah.brady@acton.com.au

103 SPICES ROAD, YORK

YORK COTTAGE

$345,000
2

4,047sqm

A charming country escape awaits you at this beautiful cottage complete with
shingled roof, a large open replace, wood stove and claw foot bathtub and set in
picturesque valley with winter creek and only a 2km walk to historic town of York.
Build a crackling re and settle in! Just 5 minutes to the York town centre, currently
tenanted, surrounded by peaceful green pastures. This is a rare opportunity to own
a slice of heaven. Surrounding 4.860 hectares available from $150,000.

PLEASE CALL TO INSPECT


INTERNET ID# 2914362

MICHAEL WATTS
0417 952 557
Michael.Watts@elders.com.au

DEBORAH BRADY
0405 570 903
deborah.brady@acton.com.au

ACTON COTTESLOE 500 STIRLING HIGHWAY, PEPPERMINT GROVE PH: (08) 9384 6999 WWW.ACTON.COM.AU/COTTESLOE

POST, September 5, 2015 Page 57

COTTESLOE

W !
E
N ICE
PR

7/44 BARNFIELD ROAD, CLAREMONT

SUBSTANTIAL APARTMENT

$1,195,000
2.5

237sqm

With a New York loft ambience, this two bedroom apartment offers lowmaintenance living with incredible style. Sunlit and spacious open plan living and
dining areas, streamlined white stone kitchen with quality Smeg appliances, plus
a private alfresco courtyard. Upstairs, a mezzanine living area, a bright main
bedroom with BIR and ensuite, plus a second bedroom and bathroom. There is
excellent storage, a powder room/laundry, and double garage with ROW access.
Its effortlessly cool with polished timber oors, exposed brick walls, raked ceilings,
louvre windows, corrugated cladding, reverse cycle air conditioning, and stone
benches. Walk to cafes, shops and train. Youll love the industrial chic!
HOME OPEN SATURDAY 5TH SEPTEMBER 11.45AM - 12.20PM
INTERNET ID# 2858628

DEBORAH BRADY 0405 570 903


deborah.brady@acton.com.au

W
NE ICE!
PR

8 FLORENCE ST, COTTESLOE

$2.8M - $2.95M

LARGE LANDHOLDING

1014sqm

Prime Cottesloe location


Large 1014 sqm block
North facing rear garden
700 metres to the best beach
Modest home on site
North Cottesloe Primary School catchment area
Zoned R20
Potential to apply for subdivision approval
Close to all amenities

HOME OPEN SATURDAY 5TH SEPTEMBER 9.45AM - 10.35AM


INTERNET ID# 2872503

DEBORAH BRADY 0405 570 903


deborah.brady@acton.com.au

BE CK!
I
U
Q

36 PARRY STREET, CLAREMONT

SO FRESH

$1,950,000
5

527sqm

Gracefully designed and brilliantly located, this modern near new beauty is fresh
and vibrant. Northern light lls the living areas, fabulous family kitchen with
4 metre stone bench, scullery/laundry, sunny alfresco, mezzanine lounge, main
bedroom with WIR and luxe spa ensuite, three additional spacious bedrooms with
BIR, double garage, store room, secure bike store, ROW access and a lush walled
garden with mature trees. PLUS a self-contained fth bedroom with kitchenette and
living. Quality nishes create a relaxed style and include spotted gum wood oor
boards, ducted reverse cycle air conditioning, stone benches, high ceilings, and
excellent security. Walk to the train, bus, excellent schools and Swanbourne shops.
Youll be thrilled by this spacious, contemporary home.
HOME OPEN SATURDAY 5TH SEPTEMBER 12.40PM - 1.20PM
INTERNET ID# 2901854

DEBORAH BRADY 0405 570 903


deborah.brady@acton.com.au
ACTON COTTESLOE 500 STIRLING HIGHWAY, PEPPERMINT GROVE PH: (08) 9384 6999 WWW.ACTON.COM.AU/COTTESLOE

Page 58 POST, September 5, 2015

SOUTH WEST
5 CAMPBELL BOULEVARD, VASSE

EXPRESS 28 DAY SALE

S E
ES AL
R
S
P
E X D AY
28

BUSSELTON

HOLIDAY HOME TO GO!

ALL OFFERS PRESENTED BY 29TH SEPTEMBER, 2015 (UNLESS SOLD PRIOR)


Built in 2011 with dual access and room for the boat/van, featuring Gemmil Homes 25 year structural
warranty certicate registered for short term accommodation! Centrally located between Dunsborough
and Busselton, and 25 minutes to Margaret River. Convenience rich with schools and
shops nearby, this is a great chance to make the rst step to your down south future!

$890,000

EW

ROOM TO PLAY!

An amazing lifestyle on offer on 3.5 acres! Boasting a large open-plan setting with pool and property
views, additionally there is a large shed and bore. Here the new owners can live a country lifestyle, have
pets and swim in the pool. This home is just an 8 minute drive to the town centre or the beach, and has
much more to offer than what is listed. This is a very unique purchase and is sure to make the next owner
very happy.

HOME OPEN: SATURDAY 4.00PM - 4.40PM & THURSDAY 4.30PM - 5.30PM

TY CRIDDLE 0427 175 426

JASON DRAGSTRA 0400 208 268

ty.criddle@acton.com.au

jason.dragstra@acton.com.au

DUNSBOROUGH

$799,000

VASSE

FROM $165,000

EW

LUXURY ON THE BLUEWATER LAKE

FINAL RELEASE OF BIRCHFIELDS BLOCKS

This immaculate home is bound to please, perched right on the edge of the Bluewater Lake and a quick
stroll from the park and golf course. Featuring a huge master bedroom, three large minor bedrooms, fully
ducted reverse cycle air-con and home theatre. With a very spacious light and bright open-plan area
with access out to the large purpose built alfresco dining area featuring uninterrupted lake
views and built-in outdoor kitchen.

Some of the best blocks in the estate now available, with surrounding parklands and gardens rmly
established. A nal stage maximising all that is great about living in booming Vasse Newtown. Famed
Margaret River attractions on your doorstep, world class wineries, restaurants and breweries, Abbey
Bay beaches a 3 minute drive and centrally located between Dunsborough and Busselton
with Cowaramup and Margaret River nearby. Building prices are still low with timeframes
only 29 weeks!

GAVIN HOWLETT 0428 567 090

VINCENT MARRUFFO 0418 901 418

gavin.howlett@acton.com.au

vincent.marruffo@acton.com.au

11 PRINCEP STREET, GEOGRAPHE

SUBIACO STYLE CLOSE TO THE BEACH

$900,000

From the moment you step through the front door you will be captivated by this home with its high
ceilings, stain glass, solid jarrah kitchen, open-plan living areas overlooking picturesque gardens an
old world charm and ambiance which would be hard to replicate today.

MAYANUP

$199,000 - $386,000

THREE WINNEJUP RIVER FARMS


You have the choice of three farms 100 acres, 32 acres, and 92 acres. Available for sale as a whole
or separately, and the price is negotiable upon the requirements of the buyer. Located 25 minutes drive
from Bridgetown amongst rolling hills and loam soils, additionally the Blackwood River fronts two of the
farms with magnicent views.

HOME OPEN: SATURDAY 2.00PM - 3.00PM

LYNDA BROUGHTON 0407 513 874

PETER JOHNSTON 0439 971 150

lynda.broughton@acton.com.au

peter.johnston@acton.com.au

BUNBURY (08) 9791 5777 BUSSELTON (08) 9754 9200 DUNSBOROUGH (08) 9755 3399 MARGARET RIVER (08) 9758 8898
WWW.ACTON.COM.AU

POST, September 5, 2015 Page 59

SOUTH WEST

LOT 22 CAVES ROAD, HAMELIN BAY


NS
O
SI EST
S
RE TER
P
EX F IN
O

EXPRESSIONS OF INTEREST

A UNIQUE OFFERING 293 ACRES


ALL OFFERS PRESENTED BY 4PM 16TH OCTOBER 2015 (UNLESS SOLD PRIOR)
An extremely rare slice of land mainly all pastured but with generous stands of Peppermint trees and
good spring-fed water supply. With distant views to the Indian Ocean through the Deepdene cliffs, this is
a unique opportunity to purchase a large tract of land on the well known Caves Road tourist route. With
world class surng and swimming beaches nearby, along with numerous tourist destinations being world
renown tourist caves, galleries, wineries, restaurants and National Park.
INTERNET ID# 2917089

MAT MOULTON 0438 523 456 mat.moulton@acton.com.au


HENTY

EXPRESSIONS OF INTEREST

S
N
SIO EST
S
RE TER
P
EX F IN
O

9 VERA PLACE, DARDANUP WEST

EXPRESS 28 DAY SALE

SS LE
E
R SA
P
EX AY
D
8
2

FERGUSON VALLEY 70 ACRES

COPPLESTONE FARM

The vendor says its time to sell this one, with a well-appointed modern
home that has magnicent coastal views out across the treetops to Bunbury,
located just 15 minutes away. The property is set up for cattle, with
improved pasture, and suitable for horses or Equine pursuits. Including
two dams, spring-fed soaks, weekender workshop/shed and yards.

ALL OFFERS PRESENTED BY 5PM 11TH SEPTEMBER 2015


(UNLESS SOLD PRIOR).
This unique 5 acre estate is located on the doorstep of Ferguson Valley, 3km
from the Dardanup village. The elevated country homestead and ambient
garden setting is complimented with private swimming pool and tennis court and
separate weatherboard cottage. Once the main homestead of the surrounding
dairy farm, this home has been renovated and extended to accommodate more
bedrooms, a large country kitchen, ofce and entertainment rooms.
HOME OPEN SATURDAY 5TH SEPTEMBER 11:00AM 12:30PM

INTERNET ID# 2830446

PETER JOHNSTON 0439 971 150


peter.johnston@acton.com.au

INTERNET ID# 2912602

PETER JOHNSTON 0439 971 150


peter.johnston@acton.com.au

BUNBURY (08) 9791 5777 BUSSELTON (08) 9754 9200 DUNSBOROUGH (08) 9755 3399 MARGARET RIVER (08) 9758 8898
WWW.ACTON.COM.AU

Page 60 POST, September 5, 2015

PROJECTS

58-9 SALVADO ROAD, SUBIACO

$995,000

MOVE INTO A BRAND NEW APARTMENT

Without question this is the most sought after apartment living for families and couples. Enjoy direct access to
trendy Subi shopping, restaurants/cafes, theatres and play houses. Watch the footy, or take a stroll through the
parks and public open space that this extremely sought after suburb provides. Easy access to the best public and
private schools and the best medical facilities in the Metro area make this an apartment fit for the whole family!
Only a quick train trip to Perth CBD in one direction, or the playgrounds of Cottesloe Beach and Fremantle in
the other, mean you are right in the heart of all of the excitement in Perth.
Your friends and family will envy your holiday lifestyle!! This really is the ultimate playground for families, without
any concerns about home and garden maintenance you can spend your precious free time with those who
deserve it most and doing things you most enjoy. With large bedrooms and spacious open plan living areas that
more than cater for the whole family. Luxury, quality, location and many other 5 star features will capture the
attention of all families with the desire for more in their home.

INTERNET ID# 2890520

Brad Raynor
0414 425 338

brad.raynor@acton.com.au

Glenn OConnor-Smith
0413 545 044
glenn.oconnorsmith@acton.com.au

ACTON PROJECTS 191-193 STIRLING HIGHWAY, NEDLANDS WA 6009 PH: 6160 6480 PROJECTS@ACTON.COM.AU

POST, September 5, 2015 Page 61

Recent Sales by Burgess Rawson


Sold

49 Hardy Road, Nedlands

Sold

35 Adelaide Street, Fremantle

Sold

420 Bagot Road, Subiaco

Sold

10 McCourt Street, West Leederville

Sold

12 St Georges Terrace, Perth

Sold

14-16 Irwin Street, Perth

Sold

12 Leura Street, Nedlands

Sold

14/23 Railway Road, Subiaco

Sold

20 Kings Park Road, West Perth

Sold

100 Outram Street, West Perth

Sold

716 Murray Street, West Perth

Sold

273 Stirling Highway, Claremont

Sold

Sold

153 Broadway, Nedlands

72/328 Stirling Highway, Claremont

Sold

Sold

48 Kishorn Road, Applecross

3 Centro Avenue, Subiaco

Sold

Sold

2 McCourt Street, West Perth

Fire Station, McCourt Street, West Leederville

Sold

Sold

20 Churchill Avenue, Subiaco

5/62 Ord Street, West Perth

Sold

Sold

16 Jersey Street, Jolimont

343 Stirling Highway, Claremont

Sold

Sold

981 Wellington Street, West Perth

102 Cambridge Street, West Leederville

Over 120 properties sold in the 2014/2015 nancial year.


Should you be considering selling your commercial/retail property, please contact Perths leading commercial
real estate agents.

Brian Neo

Rob Selid

0411 868 486

0412 198 294

bneo@burgessrawson.com.au

rselid@burgessrawson.com.au

08 9288 0288 burgessrawson.com.au

Page 62 POST, September 5, 2015

Community news
Summer loving
with Charles

Her mission is
water for Perth
into the future

Cottesloe beach, conscription


and crossing the Nullarbor are
brought to life by Melbournebased author Charles Hall in
his new novel.

Former UWA civil engineering student Sue Murphy is now


CEO of the Water Corporation
and will be the guest speaker
for the Friends of UWA library.
She will talk about how, in
response to the dramatically
drying climate in WAs southwest, the Water Corporation has
embarked on a process of reform
to drought-proof Perth by 2022.
Sue won a Clough scholarship as an undergraduate and
joined Clough Engineering in
1980, working there for nearly 25
years before joining the Water
Corporation in 2004.
Since 2009, she has been listed
in the top 100 most influential
engineers in Australia by
Engineering Australia.
Her talk will be in UWAs Reid
Library ground-floor meeting
room. The doors open at 7pm
on Tuesday, September 8, and
the talk starts at 7.30pm.
Members of the public are
welcome and the cost of entry
is a $5 donation.
For more information, email:
susan.oconnor@uwa.edu.au.

Enjoy excerpts from Broadway musicals presented at the Regal in Subiaco by the team from MSJ Productions.
Photo: Billie Fairclough

Sing along to Best from Broadway Reflections

A cast of all ages will sing


and dance their way through
The Best of Broadway at
Subiacos Regal Theatre.

Seventy talented performers


from MSJ Productions, one of
Perths music theatre schools,
will present some of the biggest

Find out about the latest ideas for better hearing


Anyone with an interest in
hearing loss is welcome at the
two-day national conference of
Better Hearing Australia in
Fremantle next month.
The Esplanade Hotel and
Fremantle will be the centre
of activities for the conference, which will offer people
the chance to test out their
lip-reading ability with the Lip

Meet Charles for an entertaining evening at the Grove library,


where he will talk about his
novel, Summers Gone, published by Margaret River Press.
Some may remember Charles
as a former band member of
Gemini, which had a No. 5 Perth
hit in the1960s.
There will be wine and nibbles
as well at the talk on Wednesday,
September 9, from 6.30pm.
The event is free but people
are asked to RSVP to librarian
Lance Hopkinson, Lhopkinson@
thegrovelibrary.com.
Charles will then be talking
about his book at Bookcaffe
in Swanbourne at 2pm on
Thursday, September 10, where
he will also perform Sunshine
River, the song that hit the Perth
charts.

Reading Challenge DVD, filmed


in Fremantle.
Topics at the conference
will range from advice on audiologists by an audiologist,
BHA-supported software for
those interested in lipreading
and Auslan conversation, and
much more.
BHA will host an advice desk
for those with special concerns.
Professor Harvey Coates will

speak of research into tissue engineering new ear drums while


PhD student Michelle Tan will
discuss the importance of having
resources to support the social
and emotional development of
young deaf children.
The conference is on October
16 and 17. For more information,
download a free conference
information pack at www.betterhearingaustraliawa.org.

hits from musicals.


Each featured musical in The
Best of Broadway will be presented with dazzling costumes,
memorable characters and the
highlights of the story.
Enjoy numbers from classic
shows like Les Miserables,
Gypsy, Carousel and West Side
Story through to newer mega hits
like The Producers, Hairspray,
Matilda, Shrek The Musical and
many more.
The audience will be welcome
to sing along.
The Best of Broadway is on
Sunday, September 13, and tickets are available from Ticketek
at 1300 795 012.

for judging
The challenging topic
for members of Westside
Photography Club this month
is Reflections.
A photography expert will
judge digital and print images
of a wide range of subjects.
The meeting will be at 7.30pm
on Tuesday, September 8, at Mt
Claremont Community Centre,
107 Montgomery Avenue, and
visitors are welcome.
For more information visit
www.westsidephoto.org.au, or
phone Chris on 0419 044 601.

Take away
pizza

Newmenu
out now
Book your private function now
BREAKFAST + LUNCH + DINNER
19

- E 9"7

Super Special
Lunch & Dinner
$30 FULL

CRAYFISH TAIL
served with CHIPS & SALAD

Take away
coffee
5 Senses Blend

Now Licensed
@YABBADABBAKITCHEN
/YABBADABBACAFE

WWW.YABBADABBA.COM.#7

CALL 9386 7744

Opening hours:
.PO BNoBN
$PGGFF4OBDLT
Tues Sun (7am Late)
99 Waratah AV, Dalkeith WA

POST, September 5, 2015 Page 63

43 Kinninmont Avenue, Nedlands


4

2 m2 1012

Character and Charm


Bidding to start at $1.4Mil

Set on a magnicent 1012sqm block with mature


trees and endless potential, this classic Nedlands
family home offers a tranquil lifestyle in a sought
after location.

AUCTION: On site Saturday


12th Sept
at 1:00pm
(If not sold prior)

Listen to the birds in the beautiful gardens, as you


enjoy the comfort of this absolutely charming four
bedroom home, offering the grace of yesteryear
and still complete with many original features.

Viewings: Saturday
1:00pm - 1:30pm

Two living zones


Spacious kitchen with breakfast bar
Master bedroom with feature bay window
Jarrah oorboards
Luscious gardens plus work shop

WEST COAST

Cam Greig | 0411 888 891 | camg@oneagency.com.au

Page 64 POST, September 5, 2015

ESTABLISH
PROPERTY

POST, September 5, 2015 Page 65

ESTABLISH
PROPERTY

Page 66 POST, September 5, 2015

Community news

Whats on

Perth Mod
lights up

in POST community

Glaucoma support

Dr Stephen Colley will speak at


the Glaucoma Support Meeting
on Saturday, September 12,
in the newly-renovated Perth
Eye Hospital at 42 Ord Street,
West Perth. His talk is from 2
to 3pm and will be followed by
question time and afternoon
tea provided by Word of Mouth
Catering. The cost is $5, which
includes a rae ticket. RSVP
to Gaela on 0416 074 415 for
catering purposes.

It was an enlightening Science Week for


students at Perth Modern School as they
learnt about the science of light.
The school organised a plethora of fun science
activities, talks by experts and a science fair.
In a collaboration between arts and science,
students created holograms of objects they
had artfully designed.
Talks by a series of experts in the different
fields started with breakfast talks on particle
and theoretical physics and physics in marine
science and technology.
Other lectures centred on forensic chemistry,
astronomy, including the Square Kilometre
Array, optics and biomedical engineering and
epigenetics.
During the Science Fair, students presented
scientific research on a range of topics and
were in the running to win prizes.
Students were able to take part in a panel
discussion, speed dating with the scientists,
involving scientists in the fields of mechanical
engineering, molecular biology and geology.
Finally, students were dazzled by a mind
blowing experimental light display that showcased the scientific principles of light.
Midaiah Harnett (13) said Science Week was
an incredible opportunity to understand more
about the world around through science.
Perth Mod students are very curious and
science provides a lot of answers so it was
awesome to spend a whole week focusing on
science and how it will help revolutionise the
21st century, Midaiah said.
Perth Modern School was awarded a National
Science Week school grant that contributed
towards Science Week activities.

Join the fight for numbats


Meet Nurla, Project Numbats cuddly
mascot this Sunday in Fremantle at an event
devoted to WAs endangered animal emblem.
From 10am to 4pm in Kings Square in
Fremantle, there will be stickers, face painting and colouring-in for kids as well as stalls
and information as Project Numbat, a not-forprofit community group, raises awareness of
threatened numbats.
Only about 1000 numbats are left in the wild.

MANNING & ASSOCIATES


OPTOMETRISTS

Unitarian association

Perth Modern School students, from left, Midaiah Harnett, Melissa Lee, Hayley Andrews, Victoria Henderson and Savanna Kile at the hologram workshop.

Science goes out of the classroom


Rockets launched and
spaghetti towers tumbled
as science experiments
were brought to life at
Jolimont Primary School.
Students, parents and
teachers gathered to see
presentations by UWA
Professor Stephen Powles,
who is also the director of
the Australian Herbicide
Resistance Initiative and
a Fellow of the Australian
Academy of Science and
the Australian Academy

of Technological Science
and Engineering.
Jolimont principal
Barbara Iffla said Professor
Powles enthusiasm was a
wonderful catalyst to inspire students enquiring
minds.
Jolimont has prioritised science in 2015,
establishing our science
specialist program and
emphasising the use of our
science laboratory for our
students, she said.

Why not marry your cousins, millions do? is the topic


Professor Alan Bittles has
chosen for his talk at the
next meeting of the Perth
Probus Club. Professor Bittles
is adjunct professor and research leader in the centre
for comparative genomics at
Murdoch University. The talk
will be at 10am on Tuesday,
September 8, at the Lake
Karrinyup Country Club.
Wildflower walk

The Friends of Wireless Hill,


with the Wildower Society,
will hold guided walks at
Wireless Hill reserve on Sunday,
September 13. Meet at the
main carpark on the right side
of Almondbury Road, Ardross,
and the 1-hour walks start
at 9am. The walk surface is
suitable for prams and wheelchairs. A gold coin donation
is welcome and dont forget
your camera.

Why is it so?
students ask
Last week, Hollywood
Primary School students
enjoyed lots of science fun
brought to the school by
Richard Rennie from the Light
and Sound Discovery Centre.
One contraption that intrigued
the Year 1s was the invisible
box, which is a mirror-lined box
with a glass front.
When the students poked a
finger inside, it disappeared.
The children also made
spectroscopes to analyse light
sources and did some chromatography to discover that black
is made of a mixture of colours.

Subiaco Probus Club

Dan Dowsett, the bee


man, will be the speaker
at the public meeting of nutrition group
Orthomolecular Support
WA (OSWA) this Saturday.
The meeting is at 2pm on
Saturday, September 5, at

Guest Ros Thomass topic, Was it


Something I Said? Misadventure
in Suburbia, has members of
the Probus club intrigued. The
meeting will be at 10am on
Monday, September 14, in the
Victoria League building, 276
Onslow Road, Shenton Park.

Isaac Hiew and Joshua Grin reach out for a light bulb
they can see but which isnt really there. What they are
actually seeing is a reection from a concave mirror.

the Anglican church hall


in Barker Road, Subiaco,
next to Coles.
In a talk titled Bees and
People, he will explore in
his inimitable and interesting way the reasons why
bees are dying and how this

Save thousands on
yearly maintenance.
Keep your pride and joy away from
the elements by storing it safe and
sound at The Boathouse. Our stateof-the-art fully enclosed facility, in the
heart of Fremantles Fishing Boat
Harbour, is perfect for any vessel up
to 34 feet long.
Just call 60 minutes before you
arrive and your boat is in the water,
ready and waiting. Your car is safe in
our secure parking. And when you
get back, we hose it, ush it and
carefully rack it until the next time.
Rack spaces are limited, so call now
on 0432 692 228, see us
at 16 Mews Rd Fremantle, or visit
theboathousemarina.com.au

Perth Probus Club

Professor Powles presentation was an entertaining way to take science


beyond the classroom and
let our junior scientists at
Jolimont hear from a leading Australian scientist.
Over the day, Jolimont
staff coordinated students
as they took part in experiments such as balloon
rockets, circuit chasers,
spaghetti towers, balancing acrobats and quacking
ducks.

Why our bees are so important

Cottesloe Central Shopping Centre


Stirling Highway, Cottesloe 9384 6720

Richard Smith will talk about


Human Impacts on the Earth
when the Unitarians gather
at 10.30am this Sunday,
September 6. The meeting
is at Drabble House, behind
Nedlands library. Enquiries:
Perthunitarians.org or 9336
4809.

affects people.
Entry is by donation of $7,
which includes a healthy
afternoon tea.
All are welcome and
there is no need to book.
For information, call
Tessa Jupp on 9383 9050.

Garage sale

St Edmunds Anglican
Church garage sale is on
Saturday, September 12, at 54
Pangbourne Street Wembley,
from 9am to noon. There will be
books, white elephant, clothes,
cakes and jams.

First edition sold out!


THE
ADVANTAGES
OF INDOOR
BOAT STORAGE
REALLY
STACK UP

New updated
edition now on sale

$30
Signed copies of Presumed Guilty are available from
the POST at 276 Onslow Road, Shenton Park or
The Lane Bookshop, Claremont or buy online from the ABC Shop

POST, September 5, 2015 Page 67

TEAM GRANT
Awarded REIWA High Achievers 2013/14/15

LJ Hooker Claremont are so proud to have TEAM GRANT


working with us. This hard working husband and wife team
were awarded one of REIWAs top honours last weekend.
They have Listed and SOLD a property for us already! All we
can say is if you are looking to sell your home, you should
call Chelsey and Daniel Grant to enjoy the very best advice,
service and results.
Call Team Grant now for an up-to-date market appraisal

Premium Service, Premium Results.


Daniel and Chelsey Grant 0478 950 811
claremont.ljhooker.com.au

LJ Hooker Claremont 08 6588 5888

Page 68 POST, September 5, 2015

A BIG THANKYOU to my family, friends and clients who have supported me


throughout my real estate career. Without you, I will not receive these achievements and awards each year.
You are TRULY MY NUMBER ONE! Vivien Yap

It all starts with an


appraisal... and ends
XJUIBTNJMF
In todays market all smart property
decisions should start with an appraisal.
Whether you are staying, moving,
renovating or investing,
take control of your future
now and call your local
LJ Hooker office to
organise a free sales
or rental appraisal.

Contact us today or
visit ljhooker.com.au/win

LJ Hooker Claremont
0433 258 818
( 08) 6558 5888
2/53 Bayview Terrace, Claremont WA 6010
claremont.ljhooker.com.au
teamvivien@ljhooker.com.au
*Full terms and conditions at ljhooker.com.au/win. Authorised
under permit numbers ACT TP 15/06373 NSW LTPS/15/04850.
LJ Hooker Limited. 0915 LC2653-74

POST, September 5, 2015 Page 69

ljhooker claremont
Land size

Crawley 147 Fairway

18

ATTENTION DEVELOPERS!

845sqm

Offers

Extremely rare opportunity to purchase landmark block of nine


apartments just minutes from UWA and the river!

laundries on ground level. The four storey building is on a 844sqm


block with two street frontage.

View By Appointment

This gem is ripe for renovation by a developer who can see the
massive potential for excellent returns.

,WVDXQLTXHFKDQFHWRUHGHYHORSWKLVVFRPSOH[)LUVWWLPH
offered for sale since it was built, and now ripe for an overhaul.

claremont.ljhooker.com.au

Each apartment has two bedrooms, bathroom, kitchen/dining,


balcony and living area. PLUS there are seven undercroft
car bays on ground level, extra car parking, and two common

In a prime location walking distance to the river, shops, university.


First to see will buy!

Chris Tsokos


Vivien Yap


Land size

Waikiki6KHOWRQ6WUHHW

LUXURIOUS BEACHSIDE RESIDENCE


The ultimate in luxury, this extremely spacious family home
offers unsurpassed luxury and endless panoramic ocean views.
-XVWPLQXWHVIURP3HUWKDQGDVWRQHVWKURZIURPWKHFU\VWDO
clear waters of Warnbro Sound, this extraordinary home offers
a resort lifestyle complete with heated indoor pool, stunning
central kitchen, poolside entertaining area, bar, gym, games
room, wine cellar, and an extensive and lavish main bedroom

14

5228sqm

Offers

suite. Also, spacious bedrooms, BIR, the highest quality finishes


WKURXJKRXWDQGH[FHOOHQWVHFXULW\DOORQDQHOHYDWHGVTP
block with landscaped gardens, PLUS an independent selfFRQWDLQHGEHGURRPDSDUWPHQW

View By Appointment
claremont.ljhooker.com.au

Stroll down to the beach and take a long walk along the smooth
white sand, or just sit and enjoy the amazing view. Perfection
exists believe it!

Vivien Yap


Daniel Grant


All information contained herein is gathered from sources we consider to be reliable. However, we cannot guarantee or give any warranty about the information provided. Interested parties must solely rely on their own enquiries.

claremont.ljhooker.com.au

LJ Hooker Claremont 08 6588 5888

Page 70 POST, September 5, 2015

Community news

Small fish are the sweetest


In-between seasons can
be unpredictable and a bit
frustrating for anglers so it
may be a case of setting your
sights on smaller species.
But dont get me wrong, the
smallest fish are usually the
sweetest.
Bread-and-butter fishing
is how more than 90% of
recreational anglers cut their
teeth, and it is just like riding a bike, you never forget
how to do it.
You can rely on getting a
feed of fresh fish if you just
go back to basics and there
are always places to fish no
matter what the weather.
The Fremantle Moles are
always good platforms for
fishing for herring and skippy
and there are still a few good

An honorary father to many, Alan Earnshaw will spend Fathers Day with his
family, including son Gavin and grandson Louis.

One grandfathers
life of giving
As Fathers Day approaches,
Alan Earnshaws children are the
first to admit they think their dad
is the best in the world.
And hundreds of West Australians
would agree because for them,
hes a lifesaver.
Thats because Mr Earnshaw (88)
has a very rare kind of blood plasma
that includes an antibody that stops
babies dying from rhesus disease,
a form of severe anaemia.
He has given blood every few
months since he was in his early 20s
and has racked up hundreds of donations in more than four decades,
enabling countless mothers to give
birth to healthy babies.
Donating blood to help babies
gave me a wonderful feeling, and
it was a magnificent experience
to often have the opportunity to
nurse the baby Id donated blood
to, said Mr Earnshaw, who now
lives at Mercy Health Mont Clare.
Normally Id donate two pints of
blood every seven to eight weeks at
the WA Blood Bank, but sometimes
Id be asked to donate two pints in
a six-week period and Id always be

happy to oblige.
The most memorable time was
when my wife and I were about to
go out for a family dinner and I
received a call from King Edward
Hospital asking if I could donate
straight away and, of course, there
was no way I was going to refuse.
So we went straight to the hospital
instead of the restaurant.
When I look back now I do feel
proud of being able to help all those
babies over more than 40 years of
my lifetime. It makes me very emotional actually.
Mr Earnshaw is now a resident
at Mercy Health Mont Clare, where
service manager Jenny Jones said
Fathers Day presented the ideal
opportunity to recognise the unsung
heroes of the community fathers
like Mr Earnshaw.
She said Alan would spend time
with family on Fathers Day including his son and daughter as well as
his grandchildren.
They are understandably very
proud of him and his contribution
to the lives of other WA families
over the decades, she said.

FISHING

with Gary Shugg


tailor around at the moment
as well.
Good numbers of skippy and
silver bream can be caught in
the inner harbour at E shed
and Stirling Bridge. And it
will not be long before the
mulloway start their river run.
From October, the deeper
waters of Mosman and
Blackwall Reach should be
alive with good numbers of
mulloway because there have
already been pretty good
reports of substantial fish
being caught.
You do not really need
a boat to land these great
fighting fish, try the jetties at

Bicton, Mosman, Claremont


and Nedlands.
It is worth casting a line
along the beaches in POST
territory, with most favourite
haunts holding good numbers
of whiting, skippy, and nice
silver bream, along with
plenty of herring and a few
half-decent tailor.
City and Floreat beaches
have been fishing particularly
well over the past week or so
for bread-and-butter species.
If you happen to be lucky
enough to get out in a boat between the weather, plenty of
king george whiting are being
caught as well as squid and
herring over the weedy areas.
Remember, the smallest
fish are the sweetest, just
ask my mum.

Leschenaultia is not always blue


The Wildflower Societys
emblem, blue leschenaultia,
and its relatives in the
goodeniaceae family will
be the focus when the Perth
branch of the Wildflower
Society meets on Tuesday,
September 8.
Society member Jim
Barrow, who is also the
author of How to Enjoy WA
Wildflowers, will talk about
this varied, colourful and
almost entirely Australian
group of plants.
Many people like this group
because lots of its species
have brilliant blue flowers.
But there are also many
that are red, yellow or white,
such as red leschenaultia,
the wreath leschenaultia and
the cancer bush (Scaevola
spinescens).
Members of the family
are also very widely grown
and have been developed
as pot plants or living posies in Europe and North
America.
Meetings of the societys
Perth branch are held on the
second Tuesday of each month
in the Subiaco Community
Centre, across the road from
Crossways shopping centre in
Bagot Road.

Blue Leschenaultia is the emblem of the Wildflower Society of WA.


The doors open at 7.30pm
and the meeting begins at
8pm. You do not need to be

a member of the society to


attend, entry requiring a $2
door charge

POST, September 5, 2015 Page 71

32/1 Corkhill Street, North Fremantle

THE RIVER LIFE

Offers Above $1,695,000

All offers above $1,695,000 presented 5pm Monday 7 September 2015.


Stylish, private, secure and peaceful living in the Western Suburbs premier
riverside apartment development - The Moorings. The design and build quality is
part of the DNA - it is built in for life. Offering a generous 169sqm of living space
plus 76sqm of terrace, three double bedrooms, two bathrooms, double garaging,
river views, access to your own boat pen, use of gymnasium, tennis court and
pool. A brilliant lifestyle in an enviable location.

Home Open:
Saturday 5th September
12.15pm - 1.00pm

1 Butler Way, Peppermint Grove

Henry Willis

3.5

LUXURIOUS RESORT LIFESTYLE

$4,750,000

4XDOLW\ QHDUQHZ KRPH ZLWK H[SDQVLYH RSHQSODQ OLYLQJ DUHDV RZLQJ WR
undercover alfresco and pool. Featuring four spacious bedrooms, three in a
separate upstairs wing with its own living area, three bathrooms plus powder
room, study, kitchen/family/meals, covered alfresco with outdoor kitchen and
RYHUVL]HGJDUDJH+LVSHFQLVKHVLQFOXGLQJWUDYHUWLQHRRUVFRSSHUJXWWHUVDQG
(XURSHDQDSSOLDQFHVDQGWWLQJV

Home Open:
Saturday 5th September
1.30pm - 2.15pm

Henry Willis

2IFHZZZULYHUDQGVHDFRPDX

Page 72 POST, September 5, 2015

MORRIS FRESH MEAT MARKET


EARLY BIRD SPECIALS 7AM - 11AM EVERYDAY
TONY

ANTHONY

10 Shanks for ............................ $35


Baby Lamb Cutlets................ $10.99kg
Baby Lamb Chump Chops ....... $13.99kg
Baby Lamb Loin Chops........... $15.99kg
Crumb French Cutlets ............ $15.99kg

Lamb Backstrap ................... $25.99kg


Gravy Beef/Osso Bucco .......... $11.99kg
Loin Pork Chops .....................$9.99kg
Breakfast Sausages 2kg ............$6.00
Baby Lamb French Cutlets....... $19.99kg

QUALITY CONTROLLED BUTCHERS


WEEKEND PACK

BUDGET PACK

1kg BBQ Sausages


1 Rolled Roast
1kg BBQ Steak
1kg Lamb Chops
1kg Mince

1kg Mince
1 Roasting Chicken
1kg BBQ Sausages
1kg Pork Cutlets
1kg Chicken Pieces
1.5kg Roasting Pork
1kg Diced Steak
1kg Rump Steak
1kg Grilling Steak
1kg Lamb Cutlets
1kg Rolled Rib Roast

kg Rissoles

40

BBQ PACK
1kg Rump Steak
1kg BBQ Sausages
1kg BBQ Steak
1kg Lamb Chops
1kg Pork Chops

105

FOREQUARTER PACK

1kg Rissoles
1kg Italian Sausages

70

LAMB & PORK PACK


1kg Lamb Loin Chops
1kg Lamb Cutlets
1.5kg Roast Lamb
1.5kg Roast Pork
1kg Pork Loin Chops
1kg Pork Cutlets
1kg Pork Ribs

90

VARIETY PACK
1kg Thick Sausages
1kg Mince
1kg Porterhouse Steak
1kg Lamb Chops

2kg Rump Steak


2kg Mince
1kg T-Bone Steak
1.5kg Round Steak
1kg Topside Steak
1kg Skirt Steak
1kg Gravy Beef
2kg Silverside
1kg Thin Sausages
1kg Thick Sausages

GIANT PACK

1kg Leg Lamb Chops

2kg Blade Roast


2kg Porterhouse Steak
1.5kg Shin Beef
1kg Oyster Blade
2.5kg Sausages
2kg Chuck Steak
2kg Rolled Rib Roast
2kg Corned Brisket
2kg Mince

150

HINDQUARTER PACK

1 Rack of Lamb

1kg Rissoles
1kg Pork Chops
1kg BBQ Sausages
1kg Grilling Steak
1kg Chicken Pieces

100

2kg Porterhouse Steak


1kg Pork Chops
2kg Grilling Steak
2kg BBQ Sausages
1kg Rissoles
2kg Roasting Pork
2kg Lamb Cutlets
2kg Mince
1.5kg Italian Sausages
2kg BBQ Steak
2 Roasting Chickens

199

SUPER PACK
2kg Leg of Lamb Roast
2kg Lamb Loin Chops
2kg Lamb Cutlets
1kg Lamb Chump Chops
1kg Italian Sausages
1kg Chilli and Garlic Sausages
2kg BBQ Sausages
2kg Mince

140

1kg Gravy Beef


2kg Rolled Roast Beef
1kg Porterhouse Steak
2kg Rump Steak
1kg T-Bone Steak
2kg BBQ Steak
1kg Pork Chops
1kg Chicken Breast
1kg Chuck Steak

259

specials
EFTPOS Accepted
Accepted
specials end
end 19th
19th September
September 2015
2015 or
or until
until sold.
sold. EFTPOS

Baby Lamb Loin Chops 5kg .................$50


Lamb French Cutlets 5kg......................$80
Pork Spare Ribs.............................$9.99kg
Rump Steak .................................$18.99kg
Porterhouse Steak .......................$26.99kg

BULK MEAT SPECIALS


Gravy Beef................................5kg for $45
Baby Lamb Cutlets ...................5kg for $45
Osso Bucco ..............................5kg for $50
Lamb Loin Chops .....................5kg for $70
Chuck Steak .............................5kg for $55
Porterhouse Steak ..................5kg for $125
OUR OWN
PICKLED MEATS

Corned Brisket............................... $7.99kg


Pickled Pork ...................................$6.99kg
Corned Silverside ........................$12.99kg
Corned Ox Tongues.......................$6.99ea
9244 7960

(Next to Supafoods Fresh)

H BARNES ST
U
N
T
R
I
S
S

MORRIS RD

Shop 2, 11 Morris Place INNALOO

THURS, FRI & SAT 7AM11AM MAD SPECIALS

R
D

to ODIN

Rd

MORRIS PL
WE ARE HERE

POST, September 5, 2015 Page 73

Community news

Brass band
pulls out
the stops
WAs premier A-grade brass
band, the Royal Agricultural
Society of WA Brass, will
present a concert based on
the letter S.
Appropriately it will be on
Saturday, September 12.
The band will play from 6
to 7.30pm in UWAs Callaway
Music Auditorium.
Tickets $15, $10 children
and free for under-15s will
be available at the door.
RIGHT: S will be the theme
when the Royal Agricultural Society of WA Brass plays at UWA
next Saturday.

Flying to WAs far corners


The chief pilot of the Royal
Flying Doctor Service (RFDS),
Captain Michael Bleus, has
been flying with the service
since 1973.
Next week, he will talk about
some of his experiences for the
Floreat and districts branch of
National Seniors Australia.
With bases in Jandakot,
Kalgoorlie, Meekatharra, Port
Hedland and Derby, the RFDS
flew 4million nautical miles last
year, carrying 8846 patients and,
in total, helped 34,700 patients in
many different ways.
Captain Bleus will tell how the
RFDS lives up to the motto The
Furthest Corner. The Finest Care

as it spreads a mantle of safety


over those in remote places.
The meeting is at 9.30 for 10am
on Thursday, September 10, at Mt
Claremont Community Centre in
Montgomery Avenue.
A big crowd is expected to enjoy
great fellowship and a legendary
morning tea.
All people aged 50 and over are
cordially invited to attend and will
be assured of a warm welcome.
The cost is $5 and parking is available. The meeting finishes at noon.
The following meeting, on
October 8, will focus on India,
with Indian delicacies for
morning tea and Indian food
for lunch after the meeting.

Botanic Garden
is turning 50
Professor Stephen Hopper
will be the guest speaker at a
dinner to mark the 50th anniversary of the WA Botanic
Garden.
The dinner will be at
Frasers restaurant in Kings
Park at 6.30pm on Tuesday,
September 8.
Professor Hopper is the
former director and CEO
of the Botanic Gardens and
Parks Authority and was the
first non-British person to
be appointed director of the

prestigious Royal Botanic


Gardens in Kew, England.
He will speak on Science,
Plants and People the
role of botanic gardens in
the century of East Asian
ascendency.
Tickets for the dinner are
$90 and bookings can be
made online via www.friendsofkingspark.com.au or www.
trybooking.com/147448.
The dinner is part of the
2015 Kings Park Festival.

A musical trip
around the world
The Claremont Concert band is
celebrating its 40th anniversary
by making music.
The bands ruby anniversary
concert will feature the bands
favourite hits from around the
world.
The concert will be led by musical director Peter Sunman at
2.30pm on Sunday, September 20,
in the John Leckie Music Centre
in Melvista Avenue, Nedlands.
Admission is $10 and there will
be free parking and disabled access.
For more information about the
concert or joining the band, call
Gerry on 0409 335 774 or email
gerardhugh@amnet.net.au.

for sale
20 Lake Avenue, Shenton Park
ZXT
7YLZ[PNPV\Z(KKYLZZ6LYPUN7HUVYHTPJ3HRL=PL^Z
6--,9:*36:05.74;/:,7;,4),9
<53,:::63+79069

offers

This superbly located family home boasts incredible panoramic views of


3HRL1\HSI\WPU:OLU[VU7HYRZULZ[HUKTVZ[[PNO[S`OLSKSVJH[PVU

6WLU:H[\YKH`[O:LW[LTILY!WT!WT
;^PSPNO[;O\YZKH`[O:LW[LTILY!WT!WT

(U[OVU`/H`LZ| 0408 942 862 | HU[OVU`'HILSTJNYH[OJVTH\

Claremont

Leederville

Subiaco

9286 3655

9208 1999

9381 2055

abelmcgrath.com.au

Page 74 POST, September 5, 2015

Community news

All you need is a pen


No lycra or running shoes
are needed for the marathon
writing competition.
The Society of Women
Writers WA is hosting the contest on Saturday, September 19,
from 9.30am to 4pm, at Citiplace
Community Centre in the Perth
railway station concourse.
Notepaper will be provided
and all people need to take
along are their pens.
Society president Helen Iles
will provide prompts to ignite
creativity and help contestants
mine the landscape of their
imaginations. She says people
will be amazed at how much
writing they can produce.
Helen, who is an award-win-

ning author and poet, publisher


and editor, said: Dont worry
about grammar, punctuation
or spelling, but let the words
flow and fall as they may.
The winner will receive a
trophy and certificate. There
are also prizes for second and
third places.
The cost of the marathon is
$20 and it is open to men and
women. Tea and coffee are
provided.
For bookings, call 0415 840
031 or email swwofwa@gmail.
com.
For information on the
Society of Women Writers
WA, check the website: www.
swwofwa.com.

Shaking cans for Vinnies


The St Vincent de Paul
Societys annual street appeal
is on next Friday, September
11, and many volunteers will
be out and about.
US lacrosse players Evan Leeder and Brendan Murphy are helping build enthusiasm among young Subiaco
players .

Imports pass on passion for lacrosse

Two US players are boosting


the standard of play and providing support for local junior
coaches at Subiaco Lacrosse
Club.
The club recruited Brendan
Murphy from New York State and
Evan Leeder from Pennsylvania,
both fresh from success in the
competitive US National College
Lacrosse League.
Subiaco vice-president Andrew
McTaggart said the move was
part of a strategic plan to help
junior coaches with their skills.
In Perth, we play in our own

little bubble, but outside here


lacrosse is a massive international sport, Andrew said.
Through the American boys,
our junior players and coaches
are getting a window into the
international lacrosse world
and can see the level at which
lacrosse can be played.
He said that as a specialist
junior coach, Brendan was able
to engage young people.
Brendan was so passionate to
get to Australia after graduating
from college that he resorted
to crowd-funding to raise the
necessary finances.

I was a little nervous as I had


heard that people from American
get a bit of stick here, Brendan
said. But the people Ive met
so far have been real friendly.
The kids are really enthusiastic and it seems that part of
the Australian character is to
always give things a go.
The two men are visiting
schools to run coaching clinics
and also hold after-school clinics
at Rosalie Park.
For more information, call
Brendan on 0448 132 020 or Evan
on 0484 346 053.

St Vincent de Paul CEO Mark


Fitzpatrick said the money
raised would go towards providing emergency relief and support to families and individuals.
The society responds to welfare needs in the community by
way of food, clothing, furniture
and financial assistance, Mr
Fitzpatrick said.
Last year, Vinnies provided
emergency relief to around
40,000 people in WA.
With a high cost of living and
increases in the cost of utilities,
we are experiencing a higher
number of people struggling
financially so we are hoping
West Australians will give what
they can.
Some local places where
you can look for volunteers

include Rokeby Road, outside


Woolworths in Subi Square,
at the Park Street entry of
Coles Subiaco, Coles West
Leederville, Bunnings at Home
Base, and Subiaco railway
station.

Got the answers?


Alliance Francaise will host
a quiz night in French and
English in Wembley.
The annual quiz at 7pm on
Saturday, September 19, will
feature nine rounds of mindpopping trivia, including questions on history, cinema, sport,
geography and more.
It is at the Wembley Community Centre and anyone
wanting to take part in a fun
evening can enter by registering their team with a maximum
of eight at www.afperth.com.au
or by calling 9386 7921.
Tickets are $16, $12 for AF
members and students.

for sale
46a Mengler Avenue, Claremont
3

VLYZ
from
$850,000

268 sqm

Pretty As A Picture
Tucked away behind high walls, extremely private and secure and
surrounded by low maintenance landscaped gardens, this charming
contemporary single storey 3 bed 2 bath home is an ideal downsizer, lock
up and leave or perfect entry into the prestigious Western suburbs. With a
large storeroom, secure garage and alarm and in a fabulously convenient
JLU[YHSSVJH[PVU[OPZKLSPNO[M\SOVTLVLYZ[OLILZ[PUSV^THPU[LUHUJL
contemporary living in highly sought after Claremont.

Open Saturday 5th September 9:50am - 10:30am

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
john.hunter@abelmcgrath.com.au
u

Claremont

Leederville

Subiaco

9286 3655

9208 1999

9381 2055

abelmcgrath.com.au

POST, September 5, 2015 Page 75

for sale
)HYULSK9VHK*SHYLTVU[
3

auction

630 sqm

FINAL NOTICE. AUCTION THIS SATURDAY.


BIDDING STARTS $900K
Perfectly located in the heart of vibrant Claremont, this classically
designed and beautifully renovated 3 bed 2 bath period residence
combines original character with contemporary style to deliver an
immaculate family home in a highly sought after location. With reverse
J`JSLHJ[OYV\NOV\[VZ[YLL[WHYRPUNJSVZL[V:JV[JO43*
Christchurch, the train and Claremont Quarter, this lovely family home
VLYZ[OLWLYMLJ[VWWVY[\UP[`[VSP]L[OLILZ[VMIV[O^VYSKZWYP]H[L
and peaceful, yet close to everything!

Open Saturday 5th September 12:00pm - 12:30pm


Auction on-site \USLZZZVSKWYPVY | Sat 5th September 12:30pm

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
john.hunter@abelmcgrath.com.au
u

)LU[SL`*SVZL4V\U[*SHYLTVU[
4

765 sqm

auction

FINAL NOTICE. AUCTION THIS SATURDAY.


BIDDING STARTS $1.050M
;\JRLKH^H`PUHWYP]H[LSLHM`J\SKLZHJPK`SSPJ.YHPUNLY9LZLY]LPU]PL^
HUK1;*TPU\[LZ^HSRH^H`SPLZH^HYTPU]P[PUNHUKPTTHJ\SH[LS`
WYLZLU[LKZPUNSLZ[VYL`MHTPS`OVTL(L_PISLVVYWSHUVLYZMVYTHSSP]PUN
HUKKPUPUNVWLUWSHURP[JOLUSP]PUNHUKKPUPUNNHTLZYVVT[LLUHNL
YL[YLH[^PULJLSSHYO\NLHSMYLZJVWYPZ[PULZ^PTTPUNWVVSHUKTHUPJ\YLK
NHYKLUZ*VTWSL[LS`ZLJ\YLHUKL_[YLTLS`WYP]H[L[OPZSV]LS`OVTL^P[O
[OLWLYMLJ[TP_VMMVYTHSHUKJHZ\HSSP]PUNHUK^VUKLYM\SV\[KVVYZWHJLZ
VLYZ[OLILZ[VMTVKLYUMHTPS`SP]PUNPUHU\UYP]HSSLKSVJH[PVU

Open Saturday 5th September 10:30am - 11:00am


Auction on-site \USLZZZVSKWYPVY | Sat 5th September 11:00am

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
john.hunter@abelmcgrath.com.au
u

Claremont

Leederville

Subiaco

9286 3655

9208 1999

9381 2055

abelmcgrath.com.au

Page 76 POST, September 5, 2015

for sale
34 Narla Road, Swanbourne
4

522 sqm

auction

FINAL NOTICE. AUCTION THIS SATURDAY.


BIDDING STARTS $2MIL
+PZJYLL[S\_\Y`HUK\UKLYZ[H[LKLSLNHUJL[VNL[OLY^P[OKLZPNULYUPZOLZ
and extraordinary attention to detail, form an expansive and spectacular
4 bed, 3 bath executive residence across three levels. A secure gate leads
to the oversized timber and frosted glass entry. Soaring ceilings, huge
windows and cleverly placed voids enhance the feeling of light and space.
*SL]LYS`KLZPNULK^P[OYLTHYRHISL\ZLVMSPNO[HUKZWHJL[OPZTHNUPJLU[
YLZPKLUJLVLYZHUL_[YHVYKPUHY`VWWVY[\UP[`[VZLJ\YLHZ\IZ[HU[PHSHUK
distinctive family home in an unrivalled location.

Open Saturday 5th September 1:30pm - 2:00pm


Auction on-site (unless sold prior) | Sat 5th September 2:00pm

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
u
john.hunter@abelmcgrath.com.au

11 Butler Avenue, Swanbourne


4

850 sqm

auction

LAST CHANCE. BUYERS IN HIGH $2MILLIONS


INVITED T0 VIEW.
A masterpiece of architectural design, based on mid century modernist
WYPUJPWSLZ[OPZ\UPX\LHUKL_[YHVYKPUHY``YVSK[YPSL]LSYLZPKLUJLYLLJ[Z
timeless style, understated elegance and uncompromising quality. Natural
LSLTLU[ZV^ILH\[PM\S0UKPHUZSH[LVVYPUN^HYTZ[HPULK=PJ[VYPHU(ZO
stairs, glass and steel, commercial quality windows and sliding doors,
walnut cabinetry, clerestory windows to allow light in yet retain privacy,
Z[VULPU[OLRP[JOLUHUKIH[OYVVTZWS\Z\UKLYVVYOLH[PUN[OYV\NOV\[
;OPZTHNUPJLU[YLZPKLUJLVLYZHUL_[YHVYKPUHY`VWWVY[\UP[`

Open Saturday 5th September 3:00pm - 3:40pm


Auction on-site (unless sold prior) | Sat 12th September 11:00am

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
u
john.hunter@abelmcgrath.com.au

Claremont

Leederville

Subiaco

9286 3655

9208 1999

9381 2055

abelmcgrath.com.au

POST, September 5, 2015 Page 77

for sale
2c Athelstan Road, Cottesloe
3

VLYZ
from
$1.850m

329 sqm

Brand New Execuive Home For Slightly Used Executive Couple


Search anywhere on the exclusive Cottesloe coastal strip and you
^VU[UKHTVYLWLYMLJ[VYNSHTVYV\ZSPMLZ[`SLH[HIL[[LYWYPJL0KLHSS`
SVJH[LKPUHWLHJLM\SSLHM`Z[YLL[VUS` TL[LYZMYVT[OLNVSKLUZHUK
VM[OL*V[[LZSVLILHJO[OPZPTWYLZZP]LIYHUKUL^OVTLJVTIPULZ
uncompromising quality with understated luxury to create a sophisticated
HUKYLSH_LKSP]PUNLU]PYVUTLU[>OL[OLY`V\]LZVSK[OLMHTPS`OVTLVY
Z[PSSULLK[VI\[HSZVULLK[VKV^UZPaL"[OPZPZ`V\YWLYMLJ[VWWVY[\UP[`
*HSS:PTVUHUK1VOUMVYTVYLPUMVYTH[PVUVU]LUKVYUHUJPUNHUKL_PISL
settlement terms.

Open Saturday 5th September 9:50am - 10:30am

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
john.hunter@abelmcgrath.com.au
u

115 Townshend Road, Subiaco


4

304 sqm

auction

BIDDING STARTS AT $1MILLION


3VJH[LKPUOPNOS`ZV\NO[HM[LY:\IPHJV[OPZNSVYPV\ZM\SS`YLUV]H[LK
HUKL_[LUKLKJOHYHJ[LYYLZPKLUJLLVY[SLZZS`IHSHUJLZVYPNPUHSJOHYT
and contemporary design to deliver an immaculate and exceptionally
ZWHJPV\ZMHTPS`OVTL*OHYHJ[LYMLH[\YLZHIV\UK^PKLWVSPZOLKQHYYHO
VVYIVHYKZZVHYPUNJLPSPUNZVYUH[LWSHZ[LY^VYRYLWSHJLZZ[HPULK
NSHZZ^PUKV^ZHUKKVVYZISLUKZLHTSLZZS`^P[OTVKLYUUPZOLZ[OPZ
V\[Z[HUKPUNMHTPS`OVTLPUH^HYTHUKMYPLUKS`JVTT\UP[`VLYZ[OLPKLHS
JVTIPUH[PVUVMJOHYHJ[LYHUKTVKLYUP[`PUHWLYMLJ[SVJH[PVU

Open Saturday 5th September 2:45pm - 3:20pm


Auction on-site (unless sold prior) | Sat 19th September 11:00am

Simon McGrath
0418 918 678
simon@abelmcgrath.com.au

John Hunter
0427 654 352
john.hunter@abelmcgrath.com.au
u

Claremont

Leederville

Subiaco

9286 3655

9208 1999

9381 2055

abelmcgrath.com.au

Page 78 POST, September 5, 2015

space
THE BOUTIQUE EXPERIENCE

FOR SALE

%URZQ6WUHHW&ODUHPRQW

EUROPEAN HIDEAWAY

OFFERS

'HVLJQHGE\DUFKLWHFW5RVV0F$QGUHZWKLVIDPLO\KRPHKDVDFODVVLFDOXQGHUVWDWHG(XURSHDQ
VWUHHWVFDSH
6HWRQDJHQHURXVVTPEORFNWKHKRPHRHUVSOHQW\RIDFFRPPRGDWLRQLQFOXGLQJODUJH
EHGURRPVVLWWLQJURRP79VWXG\SOD\URRPRSHQSODQNLWFKHQGLQLQJIDPLO\DUHDEDWKURRPV
ODXQGU\SRZGHUURRPWHUUDFHXQGHUFRYHUDOIUHVFRDUHDVZLPPLQJSRROZRUNVKRSZLQHFHOODU
VLQJOHJDUDJHSOXVDFDUSRUWIRUWZRFDUV$ULJKWRIZD\RQWKHQRUWKHUQERXQGDU\RIWKHSURSHUW\
SURYLGHVDFFHVVWRWKHFDUSRUWDQGSULYDF\IRUWKHQRUWKIDFLQJOLYLQJDUHDVDQGJDUGHQV
7KHFRPELQDWLRQRIDODUJHEORFNDVSDFLRXVIDPLO\KRPHZLWKJHQHURXVSURSRUWLRQVDQG
SUHPLXPTXDOLW\QLVKHVPDNHWKLVDQLGHDOKRPHIRUIDPLOLHVZLWK\RXQJFKLOGUHQ0RYHVWUDLJKW
LQDQGHQMR\WKHKRPHDVLWLVDGGLQJ\RXURZQWRXFKHVDQGVHQVHRIVW\OHDORQJWKHZD\


HOME OPEN SATURDAY 2.20PM - 3.00PM

876sqm

Susan James
m. 0408 003 700
e. susan@spacerealty.com.au

FOR SALE

0RLQ$YHQXH&ODUHPRQW

NORTHERN SUNSHINE

ALL OFFERS ABOVE $1,250,000 TO BE SUBMITTED BY 2.00PM ON


15TH SEPTEMBER 2015. SELLER RESERVES THE RIGHT TO SELL PRIOR.
7KLVIDEXORXVFRQWHPSRUDU\KRPHZLWKDQRUWKHUO\RULHQWDWLRQRHUVDQH[FLWLQJOLIHVW\OH
RSSRUWXQLW\LQDQLQFUHDVLQJO\SRSXODUSRFNHWRI&ODUHPRQW
:LWKRZQHUVZKRDUHIDVWLGLRXVDERXWPDLQWDLQLQJDQGXSJUDGLQJWKHKRPHVIHDWXUHVWKHOXFN\
EX\HUFDQORRNIRUZDUGWRPRYLQJVWUDLJKWLQZLWKRXWVSHQGLQJDQRWKHUFHQW7KHKRPHKDVD
ZRQGHUIXOO\ZHOFRPLQJDPELHQFHKLJKTXDOLW\QLVKHVDQGDH[LEOHRRUSODQPDNLQJLWVXLWDEOH
IRUVLQJOHVFRXSOHVDQGIDPLOLHV
&RQYHQLHQWO\ORFDWHGZLWKLQWKH6KHQWRQ&ROOHJHFDWFKPHQWZDONLQJGLVWDQFHWRWKH/RFK6WUHHW
WUDLQVWDWLRQDQGDSDUNDWWKHHQGRIWKHVWUHHWZKLFKKDVEHFRPHDEXVWOLQJPHHWLQJSODFHIRU
IDPLOLHVIURPDOODURXQG&ODUHPRQWWKLVLVDQHLJKERXUKRRG\RXZLOOZDQWWREHDSDUWRI

HOME OPEN SATURDAY 12.20PM - 1.00PM

2 386sqm

Susan James
m. 0408 003 700
e. susan@spacerealty.com.au

POST, September 5, 2015 Page 79

space
THE BOUTIQUE EXPERIENCE

FOR SALE

'XQEDU5RDG&ODUHPRQW

BEYOND THE BLUE GATE

ALL OFFERS ABOVE $2,000,000 TO BE SUBMITTED BY THURSDAY


17TH SEPTEMBER 2015 (SELLER RESERVES THE RIGHT TO SELL PRIOR)
7XFNHGSULYDWHO\DZD\EHKLQGWDOOZDOOVWKHFKDUPLQJEOXHJDWHJLYHVDKLQWRIZKDWOLHVEH\RQG
DPXFKORYHGKRPHIHDWXULQJWKHSHUIHFWEDODQFHRIFKDUDFWHUDQGFRQWHPSRUDU\QLVKHVODUJH
OLJKWOOHGURRPVDQGDZHOOWKRXJKWRXWRRUSODQ
$FFRPPRGDWLRQLQFOXGHVEHGURRPVVWXG\EDWKURRPVVSDFLRXVOLYLQJURRPRSHQSODQ
NLWFKHQGLQLQJIDPLO\URRPODXQGU\VHFXUHGRXEOHFDUSRUWRDUHDU52:YLQHFRYHUHG
DOIUHVFRVZLPPLQJSRRO
,GHDOIRUWKHJURZLQJIDPLO\WKHRULJLQDOSDUWRIWKHKRPHKDVEHHQH[WHQGHGZLWKDFRQWHPSRUDU\
DGGLWLRQWKDWKDVWUDQVIRUPHGWKLVURPDQWLFFKDUDFWHUFRWWDJHLQWRDYHU\VSHFLDOIDPLO\KRPHWKDW
ZLOODGDSWWRWKHFKDQJLQJQHHGVRI\RXUIDPLO\IRUPDQ\\HDUVWRFRPH

HOME OPEN SATURDAY 1.20PM - 2.00PM

612sqm

Susan James
m. 0408 003 700
e. susan@spacerealty.com.au

FOR SALE

%D\5RDG&ODUHPRQW

CHARACTER CHARM
OFFERS

%HKLQGWKHZKLWHSLFNHWIHQFHRIWKLVFLUFDKRPHOLHVDVRSKLVWLFDWHGDUFKLWHFWGHVLJQHG
DGGLWLRQPDNLQJLWSHUIHFWIRUPRGHUQOLYLQJ
7KHRULJLQDOSDUWRIWKHKRPHFRQVLVWVRIIRXUTXHHQVL]HEHGURRPVLQFOXGLQJWKHPDVWHUVXLWH
ZKLFKKDVDZDONLQUREHDQGDZHOODSSRLQWHGHQVXLWHZLWKPDUEOHEHQFKWRSV7KHUHLVDVHFRQG
EDWKURRPZLWKDEDWKVKRZHUDQGWRLOHW7KHH[WHQVLRQHQFRPSDVVHVWKHNLWFKHQVSDFLRXV
IDPLO\GLQLQJURRPVLWWLQJURRPDQGDODXQGU\WKDWGRXEOHVDVDVFXOOHU\7KLVDUHDKDVEHHQ
GHVLJQHGWRWDNHPD[LPXPDGYDQWDJHRIWKHDEXQGDQWQRUWKHUQOLJKW)XOOZLGWKELIROGJODVV
GRRUVFDQEHSXVKHGEDFNWRFUHDWHDKXJHLQGRRURXWGRRUVSDFHPDNLQJWKLVDUHDSHUIHFWIRU
DOOIRUPVRIHQWHUWDLQPHQW
/RFDWHGZLWKLQZDONLQJGLVWDQFHRI&ODUHPRQW3DUN&ROOHJH3DUNWKHULYHUDQGSXEOLFWUDQVSRUW
WKHVLQJOHOHYHOKRPHZLOODSSHDOWRVLQJOHVFRXSOHVVPDOOIDPLOLHVDQGGRZQVL]HUV

HOME OPEN SATURDAY 10.30AM - 11.10AM

2 400sqm

Susan James
m. 0408 003 700
e. susan@spacerealty.com.au

Page 80 POST, September 5, 2015

space

THE BOUTIQUE EXPERIENCE

FOR SALE

0DQQLQJ6WUHHW0RVPDQ3DUN

ARCHITECTURAL
LIFESTYLE
RESIDENCE
EOI $2 MILLION

7KLVIDEXORXV6LPRQ5RGULJXHVDUFKLWHFWLQVSLUHGKRPHZDVJLYHQYLUWXDOO\
D FRPSOHWH UHEXLOG WR FUHDWH RQH RI WKH PRVW FRPIRUWDEOH FKLF DQG
DFFRPPRGDWLQJIDPLO\KRPHVLQWKHKHDUWRI0RVPDQ3DUNVFDIHDQGSDUN
SUHFLQFW
3ULYDWH DEXQGDQW OLJKW OOHG DQG LQVSLULQJ WKLV IRXU EHGURRP KRPH KDV
IDQWDVWLFOLYLQJ]RQHVZKHUHWKHIDPLO\FDQPHHWDQGLQWHUDFW7KHZRQGHUIXO
IRUPDO OLYLQJ DUHD HQVXUHV SDUHQWV FDQ HQMR\ WKHLU RZQ SULYDF\ ZKLOH WKH
RSHQSODQHQWHUWDLQLQJDUHDLVSHUIHFWIRUWKHNLGV
$ JHQHURXV VL]H EORFN ZLWK D FRRO DQG VRSKLVWLFDWHG KRPH WKLV SURSHUW\
ZRXOGEHDGHOLJKWWROLYHLQHQWHUWDLQLQDQGHQMR\IRUPDQ\\HDUV

HOME OPEN SATURDAY 10.30AM - 11.15AM

Justin Davies

Alex Blain MBA (UWA)

m. 0419 909 350

m. 0438 007 155

e. justin@spacerealty.com.au

e. alex@spacerealty.com.au

POST, September 5, 2015 Page 81

space

THE BOUTIQUE EXPERIENCE

FOR SALE

*LEQH\6WUHHW&RWWHOVRH

CONTEMPORARY
BEACHSIDE
LIVING
EOI $2 MILLION

7KLV ZRQGHUIXO FRQWHPSRUDU\ OLIHVW\OH KRPH LV RQO\ P WR WKH EHDFK
RHULQJDFFLGHQWDOLQWHUDFWLRQZLWKWKHVRXWK&RWWHVORHVKRUHOLQH
6XQ GUHQFKHG LQ IDEXORXV QRUWKHUQ OLJKW ZLWK ODUJH URRPV DQG IDQWDVWLF
RXWGRRU OLYLQJ VSDFHV WKDW RZ HRUWOHVVO\ IURP D ODUJH VXQ OOHG NLWFKHQ
OLYLQJDQGGLQLQJDUHD
'HVLJQHG IRU WKRVH ZKR DUH FKDVLQJ D FRDVWDO OLIHVW\OH LQ D KRPH WKDWV
EULJKWIUHVKDQGFRPIRUWDEOH7KLVSURSHUW\LVSHUFKHGKLJKRQWKHKLOOZKHUH
\RXFDQKHDUWKHVRXQGRIWKHZDYHVEUHDNLQJDQGHQMR\&RWWHVORHEHDFK
OLYLQJDWLWVEHVW
2HULQJ DQ DPD]LQJ LQYHVWPHQW LQ FDSLWDO JURZWK FRXSOHG ZLWK QDQFLDO
XSVLGHWKHSULFHLVWKHVLOYHUOLQLQJWRWKLVSURSHUWLHVUHOD[LQJDQGLQYLJRUDWLQJ
ZD\RIOLIH

HOME OPEN SATURDAY 11.30AM - 12.15PM

Justin Davies
m. 0419 909 350
e. justin@spacerealty.com.au

Page 82 POST, September 5, 2015

space
THE BOUTIQUE EXPERIENCE

FOR SALE

6FRWW6WUHHW6RXWK3HUWK

SKY PALACE

ALL OFFERS BY WEDNESDAY 16TH AUGUST 5.00PM


7KLVVHQVDWLRQDODVQHZSHQWKRXVHQRWRQO\RHUVLQFUHGLEOHULYHUDQGFLW\YLHZVEXWDOVR
LWVRZQVTPH[FOXVLYHURRIWRSHQWHUWDLQLQJGHFNFRPSOHWHZLWKNLWFKHQEDUEHTXHDQG
VWRUHURRPZLWKOLIWDFFHVV7KHGHVLJQLPPDFXODWHSUHVHQWDWLRQDQGOX[XU\QLVKHVLQFOXGLQJ
RRUWRFHLOLQJJODVVWLOLQJVWRQHWRSVDQG0LHOHDSSOLDQFHVUHHFWWKHUHTXLUHPHQWVRI
VRSKLVWLFDWHGEX\HUVZDQWLQJWKHXOWLPDWHORZPDLQWHQDQFHOLIHVW\OHIRUHYHU\GD\HQMR\PHQWRU
XQIRUJHWWDEOHHQWHUWDLQLQJ
:LWKDPDVVLYHVTPLQWHUQDOO\WKHRRGOLWRSHQSODQLQWHULRURHUVGRXEOHVL]HG
EHGURRPVDOOZLWKUREHV RUZLWKDVWXG\ HOHJDQWEDWKURRPVSOXVWKHDWUHURRPIUHH
RZLQJRQWRDYDVWVTPZUDSDURXQGEDOFRQ\VKRZFDVLQJWKHHYHUSUHVHQWULYHUFLW\
0HOYLOOHZDWHUVDQG.LQJV3DUNSDQRUDPD7KLVSHQWKRXVHSUHVHQWVDUDUHRSSRUWXQLW\WR
SXUFKDVHRQHRI6RXWK3HUWKVQHVW

HOME OPEN SATURDAY 12.30PM - 1.15PM

Amy Di Vincenzo

Linda Sullivan

m. 0433 510 561

m. 0439 926 688

e. amy@spacerealty.com.au

e. linda@spacerealty.com.au

FOR SALE

+H\WHVEXU\5RDG6XELDFR

RECIPE FOR A HAPPY FAMILY

6LWXDWHGLQDYHU\SUHVWLJLRXVSDUWRI6XELDFRWKLVIXOO\UHQRYDWHGDQGH[WHQGHGIDPLO\KRPH
H[XGHVFKDUPDQGVRSKLVWLFDWLRQ7KHUHVLGHQFHRHUVEHGURRPVZLWKJUHDWDFFRPPRGDWLRQ
WKURXJKRXWLQFOXGLQJWKHRSHQOLJKWGUHQFKHGOLYLQJDUHDZLWKZKLWHWLPEHU)UHQFKGRRUVRSHQLQJ
RQWRFRYHUHGGHFNLQJRYHUORRNLQJDEHDXWLIXOJDUGHQDQGRQWRDVHFRQGFRXUW\DUG7KHPRGHUQ
(XURSHDQVW\OHGFKHIVNLWFKHQKDVODUJHEHQFKVSDFHDQG(XURSHDQDSSOLDQFHVZLWKJODVV
VSODVKEDFNVDQGORWVRIFXSERDUGDQGGUDZVSDFH7KHRSHQRRUSODQOLYLQJDUHDLVH[WHQVLYH
DQGSURYLGHVDEUHDNIDVWEDUGLQLQJDQGFDVXDOOLYLQJDUHDVWKDWVSLOOVRXWRQWRWZRXQGHUFRYHU
GHFNHGDOIUHVFRDUHDV7KLVLVQLVKHGRZLWKSHULRGIHDWXUHVRIKLJKPHWHUFHLOLQJVSROLVKHG
ERDUGVGHHSVNLUWLQJVFRUQLFHVDQGFHLOLQJURVHV7KHHQWLUHVTPORWVJDUGHQDUHDLV
UHWLFXODWHGDQGIHQFHGRIURPWKHVWUHHWWRJLYH\RXSHDFHRIPLQG$UHDUULJKWRIZD\SURYLGHV
DFFHVVWRDWZRFDUJDUDJHWKURXJKDQDXWRVHFWLRQDOUHPRWHGRRUDQGPRUHVWRUDJH7KLVLV
DKRPHZLWKRXWKDVVOH7KHUHVQRWKLQJWRGRMXVWPRYHLQDQGHQMR\WKLVZRQGHUIXOIDPLO\
UHVLGHQFH)LUVWLQEHVWGUHVVHG
All offers by 5pm Wednesday 23rd September unless sold prior.

HOME OPEN SATURDAY 11.00AM - 11.45AM

4/5

2 521sqm

Aaron Potter

Amy Di Vincenzo

m. 0411 870 008

m. 0433 510 561

e. aaron@spacerealty.com.au

e. amy@spacerealty.com.au

POST, September 5, 2015 Page 83

There is one agency consistently awarded by the Real Estate Institute of Western Australia for achieving higher sales than any
other agency in the western suburbs. An agency setting new records for the best prices achieved from selling humble abodes
WR 3HUWKV PRVW EHDXWLIXO DQG OX[XULRXV KRPHV 7KHUH DUH  LQGLYLGXDOV ZLWKLQ RQH UP ZKR FROOHFWLYHO\ UHSUHVHQW WKH PRVW
successful team of agents in the western suburbs, all of whom are a part of a business that donates a percentage of each
commission earned to charities and organisations. There is one agency that guarantees an outstanding level of service by
limiting the number of properties that an agent can represent at any one time. An agency that has proven over and over again
WRGHOLYHUDQH[FHSWLRQDOUHVXOWZKHQRWKHUUPVKDYHQRWEHHQDEOHWR$UPZLWKJHQXLQHLQWHJULW\DQGPDUNHWLQJIRUHVLJKW
DOORZLQJ \RX WR HQWUXVW WKH VDOH RI \RXU SURSHUW\ ZLWK DQ DJHQW ZKR ZLOO GHOLYHU WKH EHVW SRVVLEOH SULFH WKH PDUNHW ZLOO SD\

+,*+(676(//,1*:(67(5168%85%6$*(1&< DQGQRZ

THE BOUTIQUE EXPERIENCE

space
%DVHGRQ5(,:$FRP$ZDUGV7RS2IFHVE\9DOXH6ROGIRU UVW3HDUG $VVRF+LOODU\VVHFRQG+DUEHU5(  UVW3HDUG $VVRF+LOODU\V  UVW3HDUG $VVRF
+LOODU\V  UVW3HDUG $VVRF+LOODU\V  UVW3HDUG $VVRF+LOODU\V  6RPH$JHQFLHVGRQRWSDUWLFLSDWHLQWKH5(,:$FRPDZDUGV

Page 84 POST, September 5, 2015

Community news
Inverarity at the Grove
Former cricket selector and Hale School
principal John Inverarity will talk about
his life of cricket and teaching at the Grove
on September 8.
Despite being an Australian cricket player
and then Cricket Australias chairman of
selectors from November 2011, John says he
has always regarded himself as a teacher.
Education is his main interest and commitment.
He has had a long teaching career and was
Hale principal from 1989 to 2002.
Not attracted to the prospect of retirement,
he is channelling his energies into Teach
for Australia, which runs parallel to Teach
First in the UK.
John will be interviewed from 10 to 11am.
The audience will be invited to join in
the discussion.
Contact Westcoast Community Centre on
9286 8676 or email westcoastcommunity@
gmail.com if you would like to attend.

O to the national championships are, front from left, Zoe Shanahan (Shenton College), Millie McCarthy (PLC), Holly Halliday (St
Stephens), Caitlin Watts (MLC) and, back from left, Molly Norrish (St Marys), Ruby Hamilton (Shenton College), Tahni Geer (Ocean
Reef SHS), Olivia Basso (Ocean Reef SHS), Emma Bond (St Marys) and Natasha Oberman (Churchlands SHS).

Fix it quickly
Renovating or
repairing your home?

The POST each week lists tradesmen who


provide every household service, from
unblocking drains to unravelling the
mysteries of your new flat-screen television.
They will do your books, clean or paint your house,
landscape the garden, do handyman
repairs or build an entire house.
Readers tell us they have carried out major
extensions and renovations just by using the
POST trades and services directory near the back
of the newspaper.
The directory is also available on the Internet at
postnewspapers.com.au
To advertise email
advertising@postnewspapers.com.au

Support POST advertisers they make your


free local newspaper possible.

Girls to take on Australias best

The under-14 girls


Perry Lakes Hawks team
have won their way to the
national basketball championships.
In an incredible 2014-15
season, they have won their
2014 Basketball League
Championship, the 2014
State Championship and the

2015 Challenge Cup.


Their success means
they have now qualified
to play in the Australian
National Championships in
NSW, where they will play
against the most talented
under-14 basketball teams
in Australia.
Most of the girls have been

playing together for the past


three years, topped up with
three new players this year.
For the past two seasons
they have been coached by
Georgia Clarke, who plays in
the state basketball league.
The Perrry Lakes Hawks
are based at the Bendat
Stadium in Underwood

Avenue.
They will fly out to
the championships on
September 26 and need to
raise $35,000.
The girls have been fundraising since January but
would welcome donations
from basketball-loving
people.

Special day out in


Bold Park bush
The Bold Park open day
on Sunday, September 13,
will be a fun event for all
ages hosted by the Friends
of Bold Park Bushland.
Head along to celebrate
spring and the wildflowers
between 9.30am and 1.30pm
at the WA Ecology Centre.
It is part of the Kings
Park Festival and will be
a day full of free guided
walks, encounters with reptiles and raptors as well as
kids craft activities.
Guided walks will showcase the parks birdlife,
nature for kids and bushland conservation as well

as giving information on
growing natives in home
gardens.
An array of interactive
displays will be run by a
range of local conservation
groups.
Visitors will have the
chance to learn about
these groups and how to
get involved.
The Wild Side, an illustrated book of essays about
wildlife and science by
Mike and Mandy Bamford,
will be launched.
The open day is supported
by the Botanic Gardens and
Parks Authority, Cambridge

Discover nature in Bold Park.


Photo: Botanic Gardens and Parks Authority
council, BirdLife WA, the
Wildflower Society and the
Naturalists Club.
Light refreshments will

be available to buy.
For further information,
visit www.bgpa.wa.gov.au
or phone 9480 3600.

Need to boost your business?


At the POST our consultants regard you as friends and partners.
We love to help you succeed.

First get your advertisement noticed


A photograph boosts an
ad by 20%, compared with
simple line art.
Same-sized ads with full
colour are noted 20% more
often than black-and-white
ads, and are read 62% more
often.
Ads that display a product
in use are noted 25% more
often and receive most-read
scores 30% higher than ads
with no product portrayed.

Ads with prices are


noted 80% more frequently
than ads without prices.
Too much price clutter,
however, achieves
diminishing returns.

The POSTs consultants and artists will


help you design ads that work, in good
times and bad.
The POST has been recognised for
36 years as the most cost-eective way
to reach Perths best market.
Western suburbs households look
forward to their POST each week and read
it all the way through.

Full-page ads are


noted 39% more than
quarter-page ads.

The POSTs award-winning journalism


and biggest number of papers homedelivered make it by far the best-read
newspaper in the western suburbs.

Placing ads next to


editorial content rather
than next to other ads has
no impact on readership.

Call Trina on
9381 3088
www.postnewspapers.com.au

POST, September 5, 2015 Page 85

$1.885m

V
Sa th iew
tu i s
rd
ay

607/2 Bovell Lane, Claremont

Could This Be Claremonts Best Apartment?


Outstanding location, presentation and refurbishment however its point of dierence is quite unique.
Sub penthouse end apartment 196m2 living no neighbours
3 beds, 2 baths + powder room + separate study or 4th bedroom
Generous entry, very spacious living and dining
Stunning Miele kitchen with brand new wide capacity oven
Reverse cycle air conditioning, full security, double glazing
4 car parking and large store room with power and light

Unique views from 3 entertaining balconies Northerly views


out over the pool and parkland, Easterly to the City skyline and
escarpment and South over the Swan River
Enjoy all the benets of Claremont shopping, cafes, the rail and
only minutes to the river and beach
Also boasts resort style pool and use of gymnasium

James Paxton 0418 923 900


james.paxton@paxtonhoad.com.au

(08) 9381 9111 | www.paxtonhoad.com.au

15 Roydhouse Street, Subiaco

Subiaco On a Budget
Take your pick from Studio or 1 bedroom apartments. Conveniently located in Subiaco Centro in the Encore apartment building, these brand
new low maintenance apartments are not to be missed. These are the perfect lock-and-leave apartments for singles, couples or rst home
buyers and are just a short walk from all that Subiaco has to oer.
European stainless steel appliances
Stone benchtops
Soft-closing cabinetry

Ducted reverse-cycle air conditioning


throughout
Built-in wardrobes

Spacious balconies
Single secure car bay and storage unit
Secure entrance

Prices starting from $316,000


Call now to arrange an inspection or for further details.

Rory Feely 0450 520 227


rory.feely@paxtonhoad.com.au

(08) 9381 9111 | www.paxtonhoad.com.au

Page 86 POST, September 5, 2015

Community news
Cambridge
The winners of
last Wednesdays
social games at the
Cambridge Bowling
Club were Brian
Bond, Julie McGrade,
Rosalie Armstrong and
Maya Lal with +10.
The runners-up on
a count-back, with +3,
were Maureen Young,
Mary Bond, Norma
Samuel and Audrey
Smith.
On Friday, the
team of Gavin Arrow,
Rosemary Goddard,
Joan Sadleir and Andy
Jenkins won the day
with +11.

Claremont
In last Thursdays
mixed bowls, the
winners were
Barry Caporn, Dan
Chadwick, Ireton
Parker and Rick
Kendall, with runners-up Peter Hiatt,
Hazel Warr, Patricia
Hubbard and Des
Lynch.
The winners of
Saturdays rain-affected mixed bowls
were Dave Leeson,
Mike Diamond, Peter
Channer and Gordon
Gray from Barry
Caporn, Dot Leeson,
Rick Kendall and
Patricia Hubbard.
DaveLeeson also
won Sundays scroungers, for the second
week in a row, with
Estelle Boak second.
The limestone retaining wall between
A and C greens is

bowling
complete and quotes
are being received
for renovations to the
clubrooms.

Hollywood
Subiaco
In last Tuesdays
undercover pennants,
Anne Ormsby, Alannah
Brindley, Nada Bonny
and Betsy Tapley won
nine ends but ended
up losing 13/19.
On the other rink,
Jenni Lush, Deirdre
Duncan, Petina Evans
and Margaret Gawler
got in front and never
looked back, winning
23/7 and earning three
valuable points.
Robbie Blythe and
Mac Hughes tied with
Bill Ford and Malcolm
Moore in Thursdays
three-bowl pairs, with
Robbie and Mac the
winners on count-back.
There was not a great
deal of interest in the
cup and saucer, but
after a below par first
game, Peter Evans and
Uncle Arthur bounced
back to claim the china
ware.
On Saturday, after
back-chatting the Beeg
Fat Controller, Ray
Preston was teamed
with Peter Evans and
Laurie Ward with Alan
Brindley for a game of
four-bowl pairs. Ray
and Peter outlasted
Laurie and Alan to
win by seven.

The well-mannered
Bob Porter and
Graeme Gerrans were
allowed to play Anne
Ormsby and Uncle
Arthur in three-bowl
pairs.
Bob and Graeme got
off to an early start and
were the big winners
of the Mars Bars pairs,
with Ray and Peter a
creditable second.
With the sun shining,
the birds singing and
no threat of rain, it
can only be assumed
the scroungers mob
were home watching
the Eagles.
The
POSTs
Hollywood Subiaco
correspondent hopes
the Dalkeith-Nedlands
correspondent successfully defends
his litigation case,
and that his exile in
Uzbekistan is a short
but pleasant one.

Mosman
Park
A new committee
was elected at the
bowling clubs annual
general meeting on
Sunday and members
wish them all the best
for the coming year.
Rain stopped play
on Saturday, but there
was a big roll-up on
Tuesday.
It was good to see so
many members getting
practice in for the new
season.

The winners were


the mighty ladies
team of Sue Epis,
Sandra Ellis and
Yvonne Barron, with
runners-up Dale
Walsh, Peter Smyth,
Sheila Binns and
Graham Povey. Well
done to all.
Fish and chip meals
are still available on
Tuesday evenings
from 5.30pm.
Members are reminded the opening
day of the season for
everybody is Sunday,
September 20.
The ladies midweek opening day
is Wednesday,
September 16, when
there will be bowls
in the morning, then
lunch.

Ptanque
At
Subiaco
Ptanque Club last
Saturday, a reduced
group of members enjoyed social ptanque.
The threatened
storms failed to eventuate, but a number
of members took part
in the state doubles
championship being
held at Maison de
France Ptanque
Club throughout the
weekend.
Remarkably, Nick
has returned to the
pistes after his recent
knee surgery.
Congratulations to
Stephanie who has
been voted in for a
second term as vicepresident of Ptanque
WA.

Charlotte Roe (4) has a close encounter with a frog.

Cottesloe kindy goes wild


Much to their delight, the
children from Cottesloe Primary
Kindergarten had the chance to
get close to snakes, frogs, snails
and lizards, all thanks to Animal
Ark.
Cottesloe Primary Kindergarten
teacher Jillian Creedon said the
visit was a great way to inspire
the children.
Kindy is all about stretching
your horizons, she said.
This wild encounter was a way
to experience something new and
to expand personal boundaries in

a supportive environment.
Mrs Creedon said that though
kindy was optional, it was a very
important school year.
Kindy helps children to develop
language and to learn to interact
with peers and adults in a range of
play and more formal situations,
she said.
She said at Cottesloe it was
integrated with the rest of the
primary school, with access to all
the schools facilities, including
the library.
Enrolments for 2016 kindergarten
intakes are still open.

Delivering Heatset & Coldset Printing

Environmentally
Responsible

Logistics

Heatset & Coldset


Printing

Pre Press

Call us for your catalogue work NOW !


About
Uss
A
b out U
Fairfax Media Mandurah is part of the Fairfax Media Printing and Distibution
group, the largest producer of newsprint publications in Australia with 14
print sites located across the nation.

If it is catalogues you are after then you have the option of inserting into one
of our countless newspapers printed on site. Use these products as the carrier
of your production giving you last minute deadlines.

Our state of the art site at Mandurah produces full colour heatset gloss and
newsprint publications in a range of sizes. This means that we are one of the
most flexible printing organisations in the world. No job is too big or too
small.

If you want a stand-alone catalogue solution, then let us look after your print
requirements. We will even help organise your distibution!

We have the firepower and speed to produce mass quantities of catalogues


and newspapers for the West Australian market.
We also have the efficiency and skill to produce small orders.

CONTACT - Wayne Bailey

Our quality work, friendly and dynamic approach to printing and logistics
allows us to enhance your brand and always exceed your expectations

T (08) 9550 2700

M 0419 007 928


www.fairfaxmediaprinting.com.au

email: wayne.bailey@fairfaxmedia.com.au

POST, September 5, 2015 Page 87

Coppelia gets the Degas look


SARAH McNEILL

When Coppelia was first


staged in Paris in 1870, the
ballet perfectly reflected
Parisian cultural life.
It was a world of
Impressionist painters, like
ballet-loving Edgar Degas,
popular bal-musette music
and comic opera.
Europe was on the cusp
of the Franco-Prussian war
and people were fleeing
persecution to settle in the
New World.
It is in this era that

Queensland choreographer
Greg Horsman has set his
new version of Coppelia for
a co-production between
Queensland and WA ballet
companies.
He has moved the action
from its original setting in
the 18th century Austrian
Empire to Hahndorf in
South Australia, around the
same time that the ballet was
conceived.
Greg first visited Hahndorf
in 1986 and was inspired
to move the ballets story
to this town, settled mainly

by German migrants. His


research showed that many
children and adults had been
lost in transit to their new
homes and this fuelled the
idea that Dr Coppelius might
invent an animated dancing
doll, Coppelia, in an attempt
to re-create a lost daughter.
People in the second half
of the 19th century were
fascinated by automata, moving
machinery and puppets.
Writing an introduction
to WA Ballet Companys
production of Coppelia,
music lover and arts

researcher Alan Dodge says


automaton makers, like
Frenchman Pierre JaquetDroz and Swiss mechanic
Henri Maillardet, created
dolls that were able to draw
pictures and write poems.
By the time the ballet
Coppelia was created, there
were many family-based
firms making automata in
Paris, Alan said.
A comedic ballet about a
beautiful, life-sized dancing
doll was bound to be popular
in 1870 Paris.
Choreographed by Arthur

Saint-Lon, with Charles


Nuitters libretto based on E.
T. A. Hoffmanns fairy tale,
the ballet was set to music by
Lo Delibes.
Delibes was described as
a dancers composer he
attempted to do what the
new Impressionist painters
of the time were doing: make
colour matter.
Alan said: Delibes
loved colour, especially
oriental colours, and he was
inventive. He knew how to
Please turn to page 88

Photo: Paul McGovern

POST September 5, 2015

TIMEOUT

POST

Page 88 POST, September 5, 2015

TIMEOUT

arts

Art vision expands to Mirage

Edgar Degas painting Two Ballet Dancers.

Coppelia gets
the Degas look
cover

story

From page 87

describe the action with


music.
The ballets debut was
at the Thtre Imprial de
lOpra, better known as
the Salle Le Peletier, which
was the favoured theatre
of Degas, who also loved
the charm of colour and
devoted most of his time
to painting dancers, mostly
backstage or in rehearsal.
In his introduction, Alan
writes: The company was
filled with dancers taken
from the lower levels of
society, often forced into
prostitution on the side as
they were paid so little.
Most of the corps was

made up of very young


girls, known at the time
as les petits rats (the
little rats), who spent their
lives in rehearsal rooms
being ogled by men in top
hats and fur coats who
were prospects for added
income.
This is a new world version of one of the oldest
ballets still performed.
The WA Ballet presented
Chrissie Parrotts cheeky
1950s version of Copplia
in 2007. This new production of Copplia, which
premiered in 2014 with
Queensland Ballet, is the
second of two new cocommissions for the two
companies.
Coppelia will be
performed at His
Majestys Theatre from
September 11 to 26.

utnabout

ARTS

Stephen Fry: Telling


Tales
2nd Perth show announced
Riverside Theatre,
Perth Convention
Centre
Tuesday and
Wednesday,
November 17
and 18
Book at Ticketek

Nanga Music Festival


October 9 to 11
Standard weekend passes
are now on sale but are
already selling fast.
To book, go to
nangamusic.org.au

The York Bzzaar

York Town Hall


September 19 and 20
Stalls of art and craft
by 80 artists to browse
through and exhibits by
the Botanic Artists Group,
Melbourne animators
Isobel Knowles and CatRabbit as well as a selection of garments from the
2015 Common Threads
Wearable Art exhibition.

WASO 2016

Next years concert


program for the WA
Symphony Orchestra is
out. Principal conductor Asher Fisch is back
and new concertmaster

If you had shown


me Australian
paintings
when I lived
in Germany, I
would never
have believed
those colours

A new gallery space in

Subiaco offers local artists


an opportunity to show
original works.
Andreas Buse has been
running a gallery space at
the front of Art Framers
in Claremont for the past
year, but lost half his
hanging space when Nick
at Art Framers did a bit of
refurbishment.
Nick and I will still
show artworks at Art
Framers, Andreas said.
But I decided I needed
more exhibition space.
Mirage Digital in Hay
Street, Subiaco, offered
Andreas a large gallery
space and, after a few
renovations, A & A
Art Display opens this
weekend.
German-born Andreas
has always loved the
strong bold colours of the
Australian landscape.
If you had shown me
Australian paintings when

Lucky Lizards by Peter


Ryan.

I lived in Germany, I
would never have believed
those colours were real, he
admitted.
To celebrate vivid
Australian colours,
Andreas has invited
four artists for his first
exhibition landscape
artists Peter Ryan and
Amanda Humphries,
seascape painter Genevieve
Montgomerie and Demi
McLeod.
A & A Art Display is at
88 Hay Street.

Ranchu by Demi McLeod.

Laurence Jackson will


bring his wealth of experience to the orchestra.
Buy a package and get
the best seats.
Call 9326
0000 or
visit waso.
com.au.

Perth
Upmarket
UWAs Winthrop Hall and
Hackett Hall
Sunday, September 13
Original and hand-crafted
wares by more than 150
local designers and craftspeople offering unusual
gifts for adults and children. There will also be
plenty for the foodies.

Perth Writers
Festival
An exclusive evening
with Australian author
Geraldine Brooks.
Octagon Theatre, UWA
Thursday, November 12,
7pm
Brooks new novel,
The Secret Chord, is a
retelling of King Davids
extraordinary rise to
power and subsequent
fall from grace.
Book through
perthfestival.com.au.

hanging
AROUND THE

galleries
Artist and tutor Gail Dell
from Perth Art Studio starts
evening art classes in Floreat
this month.
She has been running
classes in Balcatta and said
she had had lots of enquiries
about classes locally.
Classes started this week at
the Perry Lakes Clubhouse,
off Perry Lakes Drive, and
will continue fortnightly.
The classes are miniworkshops for first-time
painters and each session
has a theme. All art materials
are provided, along with two
hours of instructor-led tuition
to complete a painting in a
friendly and non-competitive
environment.
The next Floreat class is
White Poppies on September
17 at 6.30pm.
To book, go to www.
perthartstudio.com.

Gullotti Galleries is showing


Janine Daddo, whose work

is always designed to make


people smile, in Claremont
Quarter.
The collection is titled
They Dreamt Themselves
a Garden, with her
whimsical
mixed-media
works celebrating love, life,
families and gardens.
The exhibition is on show
upstairs in the Quarter until
September 17.

Sculptor Paul Kaptein is


showing his remarkable
hand-carved distorted figure
sculptures in a solo exhibition
at Turner Galleries.
In Black Holes, Wormholes,
Portals and Potholes, Paul
explores philosophies of
time and space, with a
sensible amount of humour
thrown in.
His work is on show from
this weekend until October
10 at Turner Galleries, 470
William Street, Northbridge.

A Sparkling Day on Rottnest by Genevieve Montgomerie.

direct

I recently
found a
goal list my
boyfriend had
made. These Wayne & Tamara
were to be fulfilled by
August this year.
anything to him, every
At first it seemed cute,
time he pulls away or
until I got to this goal:
comes home a little late,
Fall in love with the girl
I think he wants her, not
of my dreams. I still
me. I dont know if he
thought was cute, until I
does, but I wonder if Im
saw the name beside it,
only temporary. I dont
which was not me. It was
know. I love him, but Im
a girl I was once friends
scared.
with.
Now Im trying to avoid
I panicked, then got
a pregnancy test because
angry. Then felt maybe
Im terrified it will be
I was overreacting. Then
positive, and hell wish
cried and felt I wasnt
it was her carrying his
good enough.
baby.
Because I did not say
Ingrid

answers

Ingrid, you
need to
confront him
because you
need access
to more information.
You need an internal
resolution about his love
for you.
But before you confront
him, decide if you want his
honest answer, or if you
want the answer you want
to hear. The answer you
want to hear may make
you temporarily happy, but
every good or bad event in
the future will be coloured
by what the truth is.
Before you confront
him, find out if you
are pregnant because

a possible pregnancy
should not be part of the
discussion. I might be
pregnant will colour his
answer, but it does not
solidify his link to you. At
most it solidifies his link to
your baby.
When you trap a man
into marriage, when times
get tough and all you have
to lean on is his love for
you, you wont have even
that.
If you still arent sure of
his love, pretend you are
deaf. Take all the words
away. Observe. A man in
love shows love through
his actions.
Wayne & Tamara

POST, September 5, 2015 Page 89

SARAH McNEILL

Kimberley writer Jub

Ebony McGuire, left, plays young Lizzy as she faces the struggles of life with her
grandparents Iggy (Kelton Pell) and Ruby (Irma Woods) in new play The Fever and the Fret.

Clercs new play explores


a universal question is
progress financial or
cultural? Is it about politics
or place?
In her play, The Fever
and the Fret, Jub, who is
aYawuru woman, looks
at progress from the
perspective of the WA
mining boom.
Against a background of
around 1.5million tonnes
of ore a day being hauled
out of the ground, she
looks at one small family
and what mining means for
the people living on that
ground.
In what Jub describes as
this frantic rollercoaster
ride that is life,
young Lizzy and her
grandparents, Iggy and
Ruby, are struggling to
find their place in this new
world.
Yirra Yaakin Theatre
Company presents the
world premiere of The

This is a
family on
the cusp
of a huge
development

Fever and the Fret from its


new home at the Subiaco
Arts Centre.
It is directed by Kyle
Morrison, Jubs friend
since they were about
three, and Kyle said the
semi-autobiographical
story was a shared
experience.
Jub wrote the play
as part of an Australian
playwrights residency in
Broome, and this one was
a stand-out, he said.
The story begins in the
1980s and travels through
to current day.
This is a family on
the cusp of a huge
development, Kyle said.
They have suffered,

embraced and, at times,


even celebrated it.
Progress is part of
all our narratives in this
country, and particularly in
this state, and we need to
look at the results and the
repercussions.
Jubs thoughts
on contemporary
Aboriginality are beautiful
and poetic.
It is not our place to say
what is right or wrong. Its
our job, in the theatre, to
throw up the conversation.
Lets talk about it.
Kyle said Yirra Yaakin
was proud to be back in
Subiaco and the company
was facing a healthy and
exciting future.
The Fever and the
Fret will star Kelton Pell
(Redfern Now, Waltzing
The Wilarra), Irma Woods
(The Cake Man, Waltzing
The Wilarra) and Ebony
McGuire (Kep Kaatijin).
The play will run from
September 10 to 24 at the
Subiaco Arts Centre. Book
through Ticketek.

Tahlia can take a bow


Tahlia Norrish said she
played it very cool when she
met Sir Paul McCartney: Oh
my god, youre a Beatle! she
said as she accepted her award
and sat down.
Tahlia (20), from
Swanbourne, had just finished
a year of study at the Liverpool
Institute of Performing Arts,
which Paul McCartney opened
in 1996 in what was once his
high school.
She studied acting and music
theatre and, at her graduation,
unexpectedly received the
Philip Holt Human Spirit
award.
I was just so shocked by

challenges before
the award I was
I embark on a
sure it was typo
professional career,
that I wasnt really
said Tahlia, who
thinking straight,
developed her love of
Tahlia said.
acting at Claremonts
Following
John XXIII College.
her success in
Her aim is
Liverpool, Tahlia
ultimately to work
has been accepted
with prestigious
into Rose Bruford
companies like the
College of theatre
Royal Shakespeare
and performance
Tahlia Norrish
Company or
in Kent, south of
Londons National
London.
Theatre.
She left Swanbourne
Eventually Id like to
this week to start another three
come back home with a bit of
years of theatre studies.
I still feel like I need
experience and contacts, she
said.
to commit myself to new

One of the most beautiful exhibitions to be seen in Perth in recent years it is not to be missed.
-William Yeoman, The West Australian

ELISE BLUMANN
ELISE
BLUMANN

AN MIGR ARTIST IN WESTERN AUSTRALIA, 1938-1948

AT THE LAWRENCE WILSON ART GALLERY


UNTIL 19 SEPTEMBER
OPEN TUES - SAT 11AM - 5PM
FREE ENTRY
DR HAROLD SCHENBERG ART CENTRE
LAWRENCE WILSON ART GALLERY
OPEN TUES - SAT 11AM - 5PM

THE UNIVERSITY OF WESTERN AUSTRALIA


35 Stirling Highway, Crawley, WA, Australia 6009
P +61 (0)8 6488 3707 W lwag.uwa.edu.au

Elise Blumann, Summer nude, 1939, oil on board, 121.5 x 91.5 cm. The University of Western Australia Art Collection,
Acquired with the assistance of the Visual Arts Board of the Australia Council and the Dr Albert Gild Fund, 1976

POST

TIMEOUT
One family and
the mining boom

arts

POST

Page 90 POST, September 5, 2015

TIMEOUT

musictime

80s music icons


still grooving

Performer Cat Hope is delighted an archive of new music is being built up at the state library, which is hosting a series of
new music concerts.

New music saved for posterity


The state library will host
a series of free lunchtime
concerts to showcase new
music.
Composer Cat Hope, an
associate professor at Edith
Cowan University, was
instrumental in establishing
a project for the library to
record new music as part
of its collection.
The state library has a
comprehensive collection
of music in scores, records
and CDs, Cat said. But a
lot of new electronic music
doesnt have a score, or
its hard to understand the
notations. Most new music
needs to be performed to
make sense of it.
The library combined
with Tura New Music and
Edith Cowan University
to develop the WA New

Music Archives.
Students from the
music program at the WA
Academy of Performing
Arts are performing new
music live in the library,
partly to make new WA
music accessible to a wide
audience, and partly to
allow recording of the
music.
Students are now
encouraged to record their
new work, said Cat, who
was an independent artist
for many years, composing
and performing her own
new music.
She said the library
performances were an
opportunity for emerging
composers to have their
music performed outside
WAAPA, and to road-test
it in a public space.

SPRING SPECIAL

$39 for 30 days of unlimited yoga*


NEW CLIENTS ONLY. *Conditions apply

Sri Lanka Yoga Retreat

Y Seven nights twin share accommodation


Y Three delicious organic meals per day
Y Twice daily yoga
p
Y Surng and other optional
activities
Y $1,550
beyondbeing.com.au
+61 411 581 550
info@beyondbeing.com.au
32 Townshend Rd, Subiaco

The library will


collect and preserve this
new music for future
generations.
New composers and
musicians will perform in
the state library once a
month until the end of the
year.
On Friday, September
18, the Newhouse
Collective will perform the
original jazz-influenced
compositions of talented
young composer Tim
Newhouse.

a peep into
the

past

On Friday, October 30,


WAAPA piano students
will showcase a range of
approaches to new piano
music, and on November
13, harpist Catherine
Ashley will perform
compositions for harp.
On December 11,
Josten Myburgh, studying
honours in composition
and music technology,
will demonstrate the
relationships between
electronic digital and
acoustic sound.

Black is
beautiful

STEVEN SHER

Did you know the expression jet black comes from


fossilised wood found in
Whitby in Yorkshire?
Jet is found in seams of
shale, some of which extend
under the sea. Pieces often
break away in bad weather
to be washed up on the
shore.
The manufacture of jet
jewellery in Whitby began
in the early 1800s and
gained world prominence at
Londons Great Exhibition
in 1851.
When Queen Victorias
husband, Prince Albert,
died in 1861, the nation
was plunged into mourning.
It was decreed that the
Queens court had to
wear black and the public
followed suit for many
years.
As a result, the demand
for jet jewellery grew
significantly and, at its
peak, around 1400 people
connected to the industry
were employed in the small
town of Whitby.
By the 1880s, the mourning
code had relaxed and the
jet industry had declined
considerably.
Jet jewellery is still made
today and you can find
pieces of jet on the beach
in Whitby.
And jet was not just an
ornament of mourning

black jewellery was the


height of fashion and worn
for its beauty and sentiment.
Amazing skill is needed to
carve and polish jet.
It is light in weight, so
large pieces could be worn
comfortably. Its still very
fashionable to wear jet
today, with black always
in vogue.
Be careful not to confuse
Whitby jet with French jet,
which is basically black
glass. You can tell the
difference because the glass
is brittle and cold to touch.
Jet may induce an electric
charge when rubbed and
is sometimes referred to
as black amber because
amber does the same thing.

Paul Young led a new genre


called blue-eyed soul

Most would like to forget


the fashion of the 1980s,
but who can forget the
music?
Coming hard and fast
out of the disco-andglitter-ball era, the 80s
saw the emergence of an
exceptional range of music
and singer songwriters who
have stood the test time.
AC/DC, Queen, and
Culture Club made their
mark, as did singersongwriters Michael
Jackson, Madonna, Bruce
Springsteen and Sinead
OConnor.
In Britain, singer and
musician Paul Young led
a new genre called blueeyed soul.
The young frontman of
three short-lived bands,
turned solo and became an
80s teen idol.
He is famous for such
hit singles as Love of the
Common People, Wherever
I Lay My Hat, Come Back
and Stay, Everytime You
Go Away and Oh Girl.
Headlining a touring
show direct from the UK,
Paul Young comes to the
Astor next month.
Hes joined by another
80s teen idol, Nik
Kershaw.
In the mid-80s, Nik had
a string of hits, including
I Wont Let the Sun
Go Down on Me and
Wouldnt It Be Good,
which had him on the UK
Singles Chart for 62 weeks,
beating all other solo
artists.
Elton John described
him as one of the
best songwriters of a

Paul Young

Nik Kershaw

generation.
Pop duo Go West was
formed in 1982 by singer
Peter Cox and guitarist
Richard Drummie. Their
international top 10 hits
included We Close Our
Eyes and King of Wishful
Thinking. They were
named best newcomer at
the 1986 Brit Awards.
Rock band Cutting Crew
are best remembered for
their hit singles Died In
Your Arms and Ive Been
In Love Before.
These British icons from
pop to rock perform in 80s
Mania at the Astor Theatre
on Wednesday, September
9. To book, call 9370 5888.

POST, September 5, 2015 Page 91

Fast food gets a healthy spin


David Kane would
like to revolutionise the
fast-food industry. And
the way he plans to do
that is with his own-made
soups.
David lives and works
around Fremantle and
said he was frustrated by
the lack of healthy takeaway food options for
lunch.
I was sick to death
of sandwiches, burgers
and kebabs, David said.
And unless you want a
full-blown meal, we are
extremely limited to what
is on offer.
So he started making
soup.
David has always been a
passionate amateur cook.
He has six sisters and
soup was always a family
favourite as a quick,
healthy option.
Encouraged by friends
and family, David started
a pop-up gourmet soup
bar called Suppa Club,
and asked for a stall at the
Subiaco Farmers Market.
They said they were
full, but liked the idea of
home-made soup so much
that I had a stall within a
couple of weeks, David
said.
To get the business
up and running in
a whirlwind couple
of weeks, he hired a
commercial kitchen at
Mantle in Fremantle
and worked well into the
night making up a range
of his own recipes to suit
vegan and vegetarian
palates, refining classic
soup recipes and creating
hearty meat options.
Davids pop-up Suppa
Clubs at Subiaco and
now South Fremantles
Growers Green markets
have become a success.
Its great seeing people
line up for healthy food,

POST

TIMEOUT

goodtaste

Your
chance to
disrupt the
experts
The state librarys
second Disrupted
Festival: debate,
discussion and
disagreement will be
held on the afternoons of
September 6 and 13.
Cartoonist writer,
painter, philosopher and
poet Michael Leunig will
be joined by Professor
Carmen Lawrence,
gardener Sabrina Hahn,
foreign editor and
political analyst Greg
Sheridan, and author Liz
Byrski in a festival of
ideas.
Questioning,
discussion, debate and
potential disagreement is
encouraged in the series
of Sunday afternoon
sessions.
Every session will
include a chaired Q&A
panel where everyone is
encouraged to question
and challenge the
presenters.
Tickets, organised
through Eventbrite, are
needed for all sessions.

David Kane is wowing the market scene with his


super soups.

firmly in eating less, eating


well with fresh, locally
sourced produce, drinking
lots of water and taking
regular exercise.
He is currently cutting
back on his day job with
a creative agency, and
spends Friday nights
cooking up to 100 litres of
soup from his popular
pumpkin and coconut
cream, and classic potato Fast food that is healthy, too.
soups to beef goulash and
Moroccan lamb.
Ive always wanted to
do something with my
passion and hopefully,
by bringing back a
The next concert by
traditional, healthy dish
Allegri Chamber Orchestra
such as soup, I can do my
will follow cycle of life
bit to improve the fastfrom lullabies to laments.
food industry, David
In what promises to be a
said.
very interesting performance,
He rarely has any leftthe orchestra will be joined
overs, but if he does,
by Eneksis Vocal Ensemble,
he donates them to St
which is made up of students
Patricks Community
from the WA Academy of
Centre in Fremantle.
Performing Arts.

From lullabies to laments

There are soups for


vegetarians.

he said.
David has a common
sense approach to food,
saying that he doesnt
like fad diets but believes

tsunami ko
20 Glyde Street
Mosman Park
Ph: 0422 780 661

www.tsunamiko.com

Buy online at

www.supersake.com.au
or in store at Tsunami Restaurant

New
Italian

Caf-Restaurant

Try our delicious BREAKFAST and


LUNCH MENU with 15% DISCOUNT
OR get a REGULAR TAKEAWAY
COFFEE for only $2.50

The orchestra will be


conducted by Laurissa
McCarthy and the singers
will be directed by her partner, Michel.
The program will feature
works by eastern European
composers, some rare and
some old favourites.
The concert is at 3pm on
Sunday, September 13, at

Special
Menu
Available
Mon-Thurs

JADE COURT
Chinese Restaurant

U8/569 Stirling Hwy,Cottesloe


near Cnr Jarrad Street

NOW OPEN SUNDAY LUNCH


Phone:
Ph
hone: 99383
3883 34
3431
431
31 ffor
or enq
enquiries
uiiries
i or bbooking
ooki
king
Opening hours:
Lunch: 12-3pm Mon, Wed, Thurs, Fri & Sun
Dinner: 7 nights a week from 5pm
at t,
en rke St
Op Ma Hay pm
x
i
2
y F m & 1Cit illia ys 1
W sda
r
cn dne
We

Simply bring this ad with you oer valid


Monday - Thursday until 24th September

open
Mon - Thur: 9am-5pm
Fri: 9am - 6.30pm
(Fresh bread after 11am)

Mon - Tues 8am - 3pm Wed - Sat 8am - 10pm


BOOKINGS 08 9387 2206
info@davvero.com.au

Subiaco Primary School


FARMERS MARKET
Saturdays 8am to Noon

1 Howtree Place, Floreat Forum Shopping Centre


(outdoor area opposite Australia Post)

St Thomas Church, on the


corner of College Road and
Melville Street, Claremont.
Take a cushion for extra
comfort.
Tickets are $20, $15 concession, and free for children under 18.
Refreshments will be
available during the interval
for a gold coin donation.

Gluten & Grain


Free Paleo
Fruit Loaf

POST

Page 92 POST, September 5, 2015

TIMEOUT

movietime

A gift that keeps on giving


The Gift (M)

REVIEW: PIER LEACH

One thing that can be


said about The Gift is that
it keeps on giving not
just for the full length of
its absorbing 108-minute
running time but for
hours after, as its lingering
creepiness continues to
make you shudder.
Its the feature directorial
debut of Joel Edgerton,
who also wrote and stars,
and is a taut psychological
thriller that on one hand
delivers a series of jump
scares but on the other
offers the kind of nuance
and intelligence rarely seen
in stalker films.
One of its great strengths
is the manner in which
Edgerton shifts audience
perception, tipping the
scales of empathy between
characters until virtually

It is creepy stuff, as the audiences perception of the characters played by Rebecca Hall,
Jason Bateman and Joel Edgerton keeps shifting.

nothing is clear-cut.
It starts out with an
amiable, upwardly mobile
couple, Simon (Jason
Bateman) and Robyn

(Rebecca Hall), buying a


house in the Los Angeles
hills, having just moved
from Chicago. Its Simons
hometown; hes just landed

a new job while Robyn is


easing back to work after a
miscarriage.
By chance, while theyre
out furniture shopping, they

bump into a man named


Gordo (Edgerton) who
went to school with Simon
but whom Simon does not
initially recognise. The next
day he drops by, leaving a
gift on the doorstep, and
slowly starts insinuating
himself into their lives.
While Robyn
tentatively likes him,
or at least his gestures,
and empathises with
his social awkwardness,
Simon remembers him
more clearly Gordo the
weirdo and wants the
acquaintance cut off.
Thats when things start
getting overtly creepy,
especially for Robyn,
and a chance discussion
compels her to start
investigating just what kind
of relationship her husband
had with Gordo in high
school.
Apart from playing
Gordo with a kind of meek
sweetness mixed with a

cinema

REWIND

life by the

drop

What the critics are saying


Me and Earl and the Dying Girl
(M)

What begins as a spirited but safely


familiar pastiche of John Hughes
and Wes Anderson is compelled
to become its own thing, GomezRejons film embracing the most tired
tropes of stereotypical YA weepies
so that it can kiss them goodbye,
says Time Out New York. The New
York Observer agrees: Me and Earl
and the Dying Girl treats a serious
subject with wackadoodle humour
that is endearingly contagious.
Its tender, clever, wise and highly
recommended.

Straight Outta Compton (MA15+)

Rolling Stone says Compton would be


better if it didnt sidestep the bands
misogyny, gay-bashing and malicious
infighting but what stands is an
amazement, an electrifying piece of
hip-hop history that speaks urgently
to right now. The Guardian semiagrees: The first half of Straight Outta
Compton, F Gary Grays two-and-ahalf hour opus about the birth of west
coast gangsta rap, is bursting with
energy, exuberance and inspiration.
The second half is immobilised by
bloat and sanctification.

We Are Your Friends (MA15+)

The feature debut of director


Max Joseph can occasionally be
as entrancing and euphoric as
the pulsating dance songs on the
soundtrack. But even an empathetic
performance from Zac Efron (and an
impressive, nuanced turn from Wes
Bentley) cant distract from a movie
that mistakes surface flash for probing,
zeitgeist-y insights, says Screen
International. Rolling Stone reckons
The clichs tick off with metronomic
regularity in a film that panders to
formula instead of exploding it.

Average star ratings

steely-eyed creep factor,


Edgertons real coup is
landing Bateman and Hall
as the central couple.
Bateman, usually the
sweet, funny, slightly
ineffectual guy (Arrested
Development, Identity
Thief), plays superbly
against type, while
Hall (Frost/Nixon, The
Town) gives Robyn a
complexity that only adds
to the perplexingly blurred
character lines.
Edgertons strength
is writing wonderfully
flawed, complex
characters, as we saw in
the last film he wrote, the
excellent and underrated
Australian drama Felony
(directed by Matthew
Saville).
Thats the strength of
The Gift. Despite some
too-obvious manipulations,
he has crafted a fine,
thorny thriller that sticks
with you.

Having a bit in
reserve
Every year, the Comit
Interprofessionnel des Vins de
Champagne sets a maximum yield
that is designed to control quality
and output from the French region.
Like the Pink Floyd album of the same name, The Wall is a concert film that
is also intensely personal.

Documenting
history of our times
Two epic pieces of modern history
are committed to documentary film
in The Wall and How to Change
the World.
The Wall is a concert film in which
Roger Waters, co-founder and primary songwriter of Pink Floyd, fuses
the public and the personal.
Written and directed by Waters
and Sean Evans, it is based on
Pink Floyds ground-breaking
concept album, The Wall, and
embarks on an intensely personal
road trip that deals with the loss
Waters has felt throughout his life
due to war.
Screening at Luna Leederville
and Luna on SX in Fremantle
as part of a worldwide screening
event at 8pm on Tuesday,
September 29, the film is followed
by a recorded Q&A called The
Simple Facts, in which Waters and
his Pink Floyd band mate Nick
Mason are reunited to answer
questions submitted by fans from
around the world.
The other piece of history,
How to Change the World, will

screen for a limited season at Luna


cinemas and is a real-life thriller
about the pioneers of Greenpeace.
Jerry Rothwells self-described
hippie heist movie chronicles the
fledgling days of Greenpeace, from
its beginnings in the early 70s,
as a group of friends sail a boat
into the maelstrom of a nuclear
test zone in Alaska, capturing
the worlds attention, through its
internal struggles and politicking
as the movement grew into an
international phenomenon.
With extraordinary, neverbefore-seen, mint-condition 16mm
footage from the archives and
personal collections of seminal
figures, How to Change the World
presents a character-rich rendering
of how a disparate group of hippies
ascended to an iconic activist
movement.
Its score includes numbers from
Pink Floyd, Leonard Cohen, Joni
Mitchell, Brigitte Bardot and
Canned Heat.
It screens for a two-week
season at Cinema Paradiso from
September 17.

Drought in Champagne
set in at the end of May
this year and left the vines
short on water, resulting in
slow growth. This will see a
reduction in wine volume,
and so a lower maximum of
10,000kg per hectare has
been set, with an additional
500kg per hectare being
allowed to be released from
the reserve.
Reserve wines are a
fascinating aspect of
champagne production.
Reserve is the term used for
still wines held in reserve
at the end of primary
fermentation. This wine can
be used by a chef de cave
(winemaker) at a future time
of their choosing.
The wines are stored in tanks,
barrels or, in the case of
Bollinger, en magnum.
Reserve wines serve several
purposes. Firstly, their
addition to a blend can
contribute texture, depth
and richness. By choosing
wines that have particular
characteristics, the chef de
cave can smooth out the
vagaries of the vintage.
For example, reserve wines
kept from a warm and
therefore ripe year such as
2003 may be contributed
to wines from cooler years
with reduced ripe fruit
characteristics.
Reserve wines also provide

insurance against extreme


weather events that can affect
the yields of vineyards frost,
hail and other damaging
events.
A winery with a large bank of
reserve wines can ensure that
its production is not severely
hampered by unexpected
weather events.
In July 2013, a hailstorm
wreaked havoc on the
vineyards around Epernay,
where Pol Roger is produced,
and the Cote des Blancs.
Some vineyards had extensive
damage and lost up to 30%
of their yields a costly night.
It was estimated that more
than 300ha of vineyards
were completely destroyed in
that storm, and up to 3000ha
were badly affected.
For wineries that had a
large stock of reserve wine
in the bank, the financial
cost of the storm could be
reduced, however for wineries
producing all that they grew,
or bought, there could be little
insulation against this scale of
damage.

ERIN LARKIN
LIQUOR BARONS
TASTING PANEL

POST

POST, September 5, 2015 Page 93

TIMEOUT

styletime

LEFT: Stacey Clark says sharing meals builds a community and she
uses styling to create a sense of intimacy. ABOVE: Delicious winter
food served with panache at a winter long-table dining experience.

Creating a long-table experience


CATHERINE MAZZA

Stacey Clark knows


how to make people feel at
home.
She works with big
brands, brides and
magazines to style
intimate, long-table dining
experiences.
Sharing meals creates
conversations and builds
community, Stacey said.
As a former stay-at-

home mum, Stacey always


enjoyed organising her
childrens birthday parties
and family celebrations.
I had long been
interested in styling and
decided that I had to work
in a creative industry, she
said.
Four years later, the
move has paid off.
Stacey has been
approached by
international brands like

and you can do this by


what you put on the table.
Asked for her tips on
styling a table, Stacey
suggested using simple,
natural and organic
adornments that did not
clutter the space.
Have a signature point
in the setting, like a floral
arrangement, to give people
something to look at when
they come in, she said.
Candles create a nice

THE NEW

Wear it once and return it.

RESURFACING

Don't Buy, Hire Instead.

PEEL
An intensive blend of AHA
ingredients to gently resurface
the skin whilst actively targeting ne
lines, wrinkles, hyper pigmentation,
post acne hyper pigmentation,
large pores, dehydrated and dull
devitalized skins. With no inammation,
skin irritation or side eects.
Purchase your
resurfacing peel in
salon and receive
an exclusive Ella
Bache application
brush.

Williams-Sonoma and
Kinfolk magazine to plan
Perth-based events.
She credits this success
to her attention to
detail and modern yet
atmospheric aesthetic.
There are lots of stylists
in Perth, but I think it is
important to develop your
own voice and distinct
look, she said.
Its so important to me
that guests feel comfortable

The Resurfacing Peel has a retail formulation


that can be used at home at 22% or a
professional strength for salon use at 26%.

1260 Hay Street, West Perth


PPH:
H: 99321 0560 Email: ebspa@iinet.net.au

new
client
hires
Custom Made Mens Blazers, Vests and Pants from Milan in
sizes XS to XXL. Womens designer Label hire sizes 6 to 20.
Contact Lisa@valentecouture.com.au OR 0466 891 467
Appointment only as my studio resides in my home.

nd me on facebook

valente couture

mood, especially at night.


A self-confessed listmaker, Stacey said it was
important to be organised
to make sure you and
your guests enjoyed the
evening.
Envision people arriving
and try to predict what
they will want when they
walk into your home, she
said.
Finally, make sure it
feels like a gathering of

friends we invite people


to pass food down the
table rather than waiting
on them. It gets people
talking.
While she also enjoys
sitting at her exquisitelyfashioned dinner tables,
Stacey loves the challenge
of being on the other side
of events.
Planning long-table
dinners is what drives me,
she said.

PP
Page 94 POST, September 5, 2015

POST

PROPERTY

PROPERTY REVIEWS

AUCTIONS

Reviews by JULIE BAILEY and BEN DINEENDICKINSON

CHANGING HANDS

H I D E AWAY S

spotlighton
CITY BEACH

Offers by September 9
51 Aruma Way
There are spectacular ocean
views to the west and the
north from this home with
a pool.
AGENT: Scott Swingler,
Space Real Estate.

A manicured back garden enhances the homes parkside location.


Auction
September 19, 11am.
22 Bent Street
Teenagers will love the built-in
work stations in their bedrooms
while parents will appreciate
having a separate wing.

Parklands at your doorstep


4
2

AGENTS: Robbie Young and


Tony Young, Optimus Real
Estate.

2 Olinda Avenue
CITY BEACH
$2.4million
Mack Hall

he tagline on the sign at


the front of this contemporary home reads Fields
of Dreams.
You only have to turn
around to see why.
Just over the road lie
more than 3ha of verdant
Auction
parklands, ringed by
September 26, 11am
towering native trees and
serenaded by birds.
29 Kalinda Drive
Its not a bad front yard,
Hungarian-born
architect
Julius Elischer designed many something the designer
striking buildings in WA, acknowledged by orienting
including this 1960s home.
the house westward on its
850sq.m corner block.
AGENT: Justin Wallace,
Though it was built 15
Wallace Real Estate.
years ago, the use of materials like Tasmanian oak,
FAST FACTS
steel and glass lends it a
Median City Beach house
timeless quality that makes
price: $1,695,000.
it very easy on the eye.
Properties for sale: 33

Use of materials like Tasmanian oak, steel


and glass lends it a timeless quality
Nature continues to play
a part in the backyard,
where a wisteria-covered
trellis brings shade and
romance to the alfresco
deck by the pool.
Inside, the house is both
functional and spacious.
The social hub of the
home is the downstairs living area, where gleaming
timber floors connect the
kitchen, dining area and
lounge.
If youre looking for an
excuse not to cook then
youre straight out of luck,
as the well-equipped
kitchen features high-end
stainless-steel appliances,
ample storage space and
the unusual combination of
steel and timber benchtops.
The timber benches lend

warmth to the breakfast


bar area, before swapping
to the more practical steel
in the main food preparation area.
Four spacious bedrooms
can be found in the house,
including a luxurious
parents retreat with park
views and an elegant marble ensuite.
The three childrens
bedrooms are upstairs
and they open to a study
nook with built-in desks
and cabinets.
There is also a sunlit sitting area on the top floor,
including big sliding glass
doors that open to a small
balcony with you guessed
it park views.
The selling agent is Greg
Williams, of Mack Hall.

Natural light floods the elegant marble bathroom.

Big glass bi-folds connect the dining area to a romantic


alfresco deck, crowned by a vine-covered trellis.

FOR LEASE

5 Perina Way, City Beach


$1,150 per week
CITY AND THE BEACH
What a wonderful opportunity for you and your family! Nestled right on the
coastal fringe, you can embrace and immerse yourself in the wide open
spaces, fresh sea breezes and echoing night time shore breaks that are
such a characteristic of the City Beach coastal lifestyle.
With plenty of room to move, this property consists of four plus size
bedrooms, an additional study, three bathrooms, three separate living areas
and an expansive kitchen/dining. Room to entertain with great balcony
views and a large easy care backyard for the kids to play, this property is
ideal for families!

4
Patrick Spillman
p. 9284 4008
m. 0411 833 579
e. patrick@spacerealty.com.au

space

THE BOUTIQUE EXPERIENCE

PPPROPERTY

POST, September 5, 2015 Page 95

POST

The POSTs property writer, JULIE BAILEY, would like to hear your
real estate news. Please email julie@postnewspapers.com.au.

and Emma Gilbert, of Realmark


Western Suburbs. In other auction
news: 13 Styne Road, City Beach,
was passed in on August 22 but
it was sold a week later by Vivien
Yap, of LJ Hooker Claremont.

Home fit for a hobbit

A spectacular colonial estate built for a wine merchant and politician is for sale
just outside Adelaide.

Fancy the aristocratic life?


Despite the efforts of a few jumpedup sheep farmers in the late 19th
century, Australia has never really
embraced the idea of an Australian
aristocracy. Had the idea got off
the ground, however, you can be
sure than an Australian house of
lords would be stacked to the brim
with South Australians. Prominent
families like the Playfords and
the Downers have made SA their
home since before Federation, so it
shouldnt be that surprising to find
a 131-year-old English mansion in
the Adelaide Hills. Built for wine
merchant and politician Sir William
Milne in about 1884, Eurilla boasts
2ha of manicured formal gardens,
a stable and a palatial main residence. The five-bedroom property
is listed for an undisclosed price by
selling agents Nathan Casserly and
Victoria McGregor-Reid, of Ouwens
Casserly Adelaide.

Lets be honest
Perths property prices are falling
and the market will remain flat
next year, according to the NABs
Australian Housing Market Report.
So what should agents tell vendors?
The truth, according to Craig
Gaspar, of Caporn Young. Honesty
is the best policy, Mr Gaspar said.
Sellers rely on agents to give them
the correct information. We are
having some difficult conversations
with sellers about what prices
they can expect in this market, but
its important to be honest. Mr
Gaspar had two scheduled auctions
last weekend: 3/16 Perina Way,
City Beach, which went under
the hammer for $785,000, and
19 Hibiscus Court, Churchlands,
which was snapped up beforehand
for $1.41million. Meanwhile
in Nedlands, a two-bedroom
apartment at 4/35 Esplanade was
sold before the auction by Adam

If the property market is getting


you down, then heres a chance to
escape into fantasy land. Fit for a
hobbit/elf/fairy or a human with
a sense of humour, the Mushroom
House is for sale. The weird and
wonderful house in Perinton,
New York, is on the market for
US$729,000. Mike Bell, from
lightersideofrealestate.com, said the
home had everything from organic
patterning to luxury appliances and
a breathtaking view of a ravine
adjacent to Powder Mills Park.
This is truly a wizards place, Mr
Bell said. This homes wonderland
includes a fairy er meditation
pond, complete with a running
waterfall. Theres a full kitchen that
any hobbit would be proud of, with
lots of mahogany worked in, and
a wide-open view to the woods
outside. There are no prizes for
guessing when it was built in the
1960s and early 1970s. It was built
for a lawyer/artist couple, Robert
and Marguerite Antell.

Only in America: the


weird and wonderful
Mushroom House
is on the market for
US$729,000.
the move ended one of the home
builders main frustrations the
need to get planning approval and
a separate building permit. It has
never been very practical to get two
approvals for the one house and
this has added a lot of time to the
process, Mr Airey said. Thankfully,
the Minister has overseen a
commonsense change that now
means a planning-compliant
single house will no longer require
approval.

Red-tape win for builders


Home building and renovation times
in WA could be cut by up to two
months thanks to a planned state
government move to slash red tape.
Single dwelling projects that already
comply with R-codes will no longer
require planning approval, while
council planning schemes will be
standardised into a uniform format.
REIWA president David Airey said

Australias worst house has sold at


auction for $168,000 over the reserve.

Youre amazing. Lets talk!

Simon McGrath

Principal
0418 918 678
simon@abelmcgrath.com.au
Claremont | 303 Stirling Highway

abelmcgrath.com.au

Buyers compete for


unsafe home
At the other end of the desirability
scale, the Queensland home dubbed
Australias worst house has
sold at auction for $668,000. The
seriously dilapidated home on a
427sq.m block in Dutton Park, about
4km from the Brisbane CBD, fetched
$168,000 more than the reserve in
a suburb where the median house
price is $785,000. Ray Whites
Gunther Behrendt listed the home
as structurally unsafe to enter
in his online listing, but that only
heightened interest among buyers
eager to get their hands on the
valuable block. There is no way to
sugar-coat this, Mr Behrendt wrote
truthfully in the listing. More than
100 people attended the auction to
watch 25 bidders compete for the
timber home, which was built before
1946.

hiring
amazing
people
now

Scan here
to meet
our family
follow us

Page 96 POST, September 5, 2015

PPPROPERTY
Lap up the riverside life
POST

3
2

24/1 Corkhill Street


NORTH FREMANTLE
High $2millions
Abel McGrath

ou can keep an eye


on your boat from the
balcony of this luxurious
riverside apartment.
Set in the sought-after
Moorings complex, the
three-bedroom lifestyle
property is so close to the
water that a champagne
cork launched from the
balcony could easily end
up bobbing in the Swan.
Thats not an unlikely scenario, beause a big covered
balcony and a spacious interior with high-end finishes
make the apartment an ideal
venue for social events such
as family get-togethers and
Christmas lunches.
You can cater for the
events in the upscale
kitchen, which has plenty
of floor space, a big pantry and sleek white stone
benchtops.
If you want to impress the
guests, you can wander over
to your private boat pen and
take them for a cruise.
Unfortunately, you still
have to provide your own
boat.

The alfresco balcony is an ideal entertaining venue, with room to have the family over for Christmas lunch.
Built on one level, the
apartment reserves its
best views for the living
area and the palatial main
bedroom, which also features a walk-in robe and
an elegant ensuite.
Two minor bedrooms
look out to the complexs
landscaped internal courtyard, which connects you to
a communal lap pool, gym
and tennis court.
The selling agent is
Nicole Jones, of Abel
McGrath.

LEFT: Any closer to the river, and youd probably get


wet. ABOVE: The spacious living area soaks up the river
views in this lavish North Fremantle apartment.

Funky style in Subi townhouse


3
2
1

333 Roberts Road


SUBIACO
Oers from $995,000
The Property
Exchange

The quirky faade gives you an idea of what youre in for.

n any list of funky


Subiaco townhouses,
this ones got to be up there.
Part New York loft, part
North Freo warehouse conversion, part Melbourne
apartment, the narrow but
long 2005-built duplex half
exudes contemporary style
at every turn.
Even from the street you

In the other, youll find an alfresco dining area with established trees.
know what youre in for, as
a bohemian faade of glass,
iron and steel piques your
curiosity.

COTTESLOE

E
AS TO
E
PL LL ECT
CA SP
IN

5 FRESHWATER CLOSE, CLAREMONT


OFFERS FROM $1.250M
3

233sqm

SUN-KISSED STYLE

Walk through the front


door, and it only gets more
interesting.
First up is a spacious
kitchen and dining area,
bordered on one side by a
wall of polished concrete,
and on another by a row
of bi-folds opening to an
internal courtyard with a
timber deck.
There are even some
established trees in the

courtyard, which is bordered by walls clad with


corrugated iron.
A long, narrow corridor
leads farther back, past
a spacious bedroom and
bathroom, to a second
courtyard with a spa.
Right at the back of the
280sq.m block is another
bedroom, which could also
be used as a lounge.
The top floor is no less
original, featuring a big
living area and the main
suite, which includes a
small ensuite.
Sloping, timber-panelled ceilings overhang
the whole space, while
big windows offer plenty
of natural light.
The selling agents are
Annie McCarthy and Niki
Peinke, of The Property
Exchange.

JJust steps from the beautiful river, this light


and bright luxury two storey lock-and-leave
townhouse has an open plan design with a
thoroughly modern kitchen, living and dining
areas. Bifolds open up to two sun-kissed
alfresco courtyards, offering a range of
entertaining options and there are spacious
bedrooms, chic bathrooms and undercover
parking. Youll love the fantastic location of
this immaculate modern apartment.
INTERNET ID# 2901854

DEBORAH BRADY
0405 570 903
deborah.brady@acton.com.au

500 STIRLING HIGHWAY, PEPPERMINT GROVE PH: (08) 9384 6999 WWW.ACTON.COM.AU/COTTESLOE

Polished concrete walls and floors lend an industrial feel


to the main living area.

POST, September 5, 2015 Page 97

PPPROPERTY
POST

recent
sales
$1,050,000
SUBIACO
147 Roberts Road
A big selling point for this
3x2 was the location, opposite Mueller Park.
AGENTS: Dean Sims and Lili
Tan, Bellcourt South Perth.

$1.22million
MOSMAN PARK
55 Solomon Street
This modern, three-bedroom
house is on an easy-tomaintain 425sq.m block.
AGENT: Bev Heymans,
Acton Cottesloe.

Shady gardens surround the backyard pool.

Everybody asks
about the floors
4
2
3

$1,675,000
NEDLANDS
49 Hardy Street
In need of a renovation, this
character office was sold off
the market.
AGENT: Brian Neo,
Burgess Rawson.

11 Butler Avenue
SWANBOURNE
Auction 11am
September 12
Abel McGrath

hen asked about the floors,


selling agent John Hunter,
of Abel McGrath, doesnt need to
look up the material.
Theyre Indian slate, he says,
without missing a beat.
Everybody asks about the
floors.
The rough-cut stone is an integral part of the contemporary
design, which relies heavily on
natural materials to create the
feel of a country retreat.
Timber cabinets and reedeffect wallpaper complement
the cool stone flooring, which
covers most of the main living
area and the hall.
The living area at the rear is
the centrepiece of the house,
featuring a high-end kitchen,

sunken lounge and big alfresco


terrace.
Quality finishes define the
kitchen, where rich timber and
composite stone are combined to
create a beautiful breakfast bar.
There is also a butlers pantry hidden behind one of the
cabinets.
A partition with an embedded
double-sided gas fire marks the
end of the kitchen, where steps
lead down to a dining area and
an adjoining sitting room.
The alfresco terrace overlooks
the pool at the back of the 850sq.m
block, where a limestone retaining wall and landscaped gardens
mark the boundary.
Back in the homes foyer, a
short staircase leads up to the
main suite, which is appropriately elevated over the rest of
the house.
It features a spacious bedroom
and a walk-in robe that leads to
a luxurious ensuite.

landmarkharcourts.com.au

Cool slate floors underscore the homes stylish kitchen.

Sunken living areas add a mid-century feeling.


Next door, a study with internal windows overlooks the
hall like the managers office in
a factory.
The property is also listed by
Simon McGrath.

FAST FACTS
Median Swanbourne
house price: $1,472,500.
Properties for sale: 52

FOR SALE BY AUCTION


DANDARAGAN 48.56 Ha 120 Ac
Caren Caren Brook Farm
Lot 2390 Walyer Walyer Rd
Redgum Country
Rare small farming opportunity
Family 4x2 air-conditioned brick homestead
Large 440m2 shed with brick residence
Stockyards, shearing, hay, GP sheds
Picturesque undulating grazing enterprise
Excellent fencing
Versatile productive property
Abundant ground water
Fresh water creek
10% Deposit. Settlement 16th December 2015

AUCTION To be held Friday, 9th October, 2015 at 12 noon on-site.

Landmark Harcourts WA

Web Id: LEP22383

Brad King 0429 911 504

Page 98 POST, September 5, 2015

PPPROPERTY
POST

Rolling
surf
beckons

hideaways

onview

y
a
w
a
e
Hid
$345,000

BALLADONG
103 Spices Road

Life was a lot simpler in 1865


when this cute cottage, near
York, was built.

he surf shack at 130 Wisteria


Drive might be a little difficult
to find, but its certainly worth
the effort.
The four-bedroom rural
Quindalup home was a labour
of love for the owner, who was
drawn to the 3.77ha site by its
open pasture, native trees and
the sound of the surf rolling at
nearby Smiths Beach.
The use of Colorbond on the
buildings interior and exterior
was as much a practical choice
as a stylistic one.
Im not a chippy, but I can cut
and weld steel, the owner said.
We wanted to build a place
overlooking the dam, so I chose
Colorbond for its ease of use.
The home is well insulated for
all seasons and has a big slowcombustion wood heater in the
open-plan living area.
There is a workshop and shed,
with room for surfboards and
dirt bikes.

AGENTS: Deb Brady, Acton


Cottesloe, and Michael
Watts, Elders.

Pops of colour add a bit of fun to the kitchen and living area.
After a surf, you can shoot
some pool in the games room and
pour drinks at the built-in bar.
The selling agents are
Stewart Bettenay, of JMW Real
Estate, and Brett Merifield, of
Professionals South West.
Mr Bettenay described the
luxury shed-style home as
inspiring.
The property is on the market
for $835,000.

Auction
September 26, 11am

PORT
GEOGRAPHE
30 Keel Retreat

Calling all boaties: this


luxurious home, overlooking
the marina, has its own jetty.

The north-facing veranda is the ideal place for family barbecues and
kangaroo-watching, according to the owner.

AGENT: Ty Criddle, Acton


South West.

Auction October 9, noon

DANDARAGAN
Lot 2390 Walyer Walyer
Road
Colorbond steel was a practical choice, but it also
makes for a stylish statement.
Wake up to this
tranquil view and
the sound of the
winter creek that
runs through the
property.

COTTESLOE
E
M :
HO PEN SEPT PM
O TH .30
1
T5 SA 0PM
.5
12

AGENT: Brad King, Landmark


Harcourts North.

FAST FACTS
Median Quindalup
house price: $662,500.
Properties for sale: 47

COTTESLOE
E
M :
T
HO PEN SEP 5AM
O TH 1.5
T5 -1
SA AM
0
2
.
11

The best
houses in

the western
$3.5million
suburbs are in
EAGLE BAY
the POST and 20 Fern Road

52%
*

28 SALVADO STREET, COTTESLOE

OFFERS FROM $2,950,000

THE LUXURY OF LIGHT

333sqm

OFFERS CLOSING 5PM 7TH SEP 2015 (UNLESS SOLD PRIOR)


Architecturally designed this home has been custom built with
elegance, quality and attention to detail. It offers the luxury of space
and light, with an easy care, relaxed vibe. With open plan living
areas, alfresco courtyard and a stunning kitchen, this modern
low maintenance beach side retreat is a must see!

JODY FEWSTER 0414 688 988


jody.fewster@acton.com.au

500 STIRLING HIGHWAY, PEPPERMINT GROVE


PH: (08) 9384 6999 WWW.ACTON.COM.AU/COTTESLOE

1C CHARLES STREET, COTTESLOE

DOWNSIZE WITHOUT
LIFESTYLE COMPROMISE

OFFERS
3

When all the farm work is


done, put your feet up on
the veranda that surrounds
the 2002 homestead.

299sqm

Expansively proportioned and showcasing quality nishes


throughout, this family home is perfectly appointed for
contemporary in/outdoor entertaining. It is peacefullyy
situated just a short stroll to Cottesloe Beach.
INTERNET ID# 2882032

BEV HEYMANS 0419 099 243


bev.heymans@acton.com.au

500 STIRLING HIGHWAY, PEPPERMINT GROVE


PH: (08) 9384 6999 WWW.ACTON.COM.AU/COTTESLOE

more
readers
in the western
suburbs than its
competitor
* Roy Morgan March 2015

Owners must sell and will


look at all offers, according
to the agent who is selling
this beachfront cedar house.
AGENT: Debbie Bridges,
Stocker Preston.

POST, September 5, 2015 Page 99

PPPROPERTY
POST

onview
From $925,000
SUBIACO
109 Thomas Street
This renovated 1920s home
is rented for $800pw until
April 2016 and the tenant
wants to extend the lease.
AGENT: Janey Sanderson,
Hive Real Estate.

Lot 7-975sq.m

Lot 8-914sq.m

$1.05million
FLOREAT
106 Grantham Street
Art deco-style features give
this three-bedroom home
character and warmth.
AGENT: Cam Greig, One
Agency West Coast.

Two neighbours have joined forces to sell their adjoining properties in Saunders Street, Mosman Park.

Rare landholding finally


comes on the market
3
2

Mid $1millions
CLAREMONT
15 Shenton Road
You have until September
23 to put in an offer for
Hamlin House, which was
built circa 1890.

Mid to high
$2million
MOSMAN PARK
4 Faulkner Circle
Mind-blowing is how the
agent describes the view
from this riverfront home.
AGENT: Andrew Cooper,
Abode Real Estate.

2 Saunders Street and


17 Owston Street
MOSMAN PARK
Oers
Abode Real Estate

or almost a century,
the Kennedy family
have held on to their
prime piece of land at 17
Owston Street, Mosman
Park.
You may recognise the
old limestone house with
its wraparound veranda,
round window, two chimneys and a flagpole in the
front garden.
With its broken lattice
and peeling paintwork,
the 1921 interwar bungalow has seen better days.
But its all about the
180-degree view of the
river from its elevated
2079sq.m site.
Its the house many
people have been waiting for ... but its not for
sale yet.
However, a 914sq.m
slice of the Kennedy
property is on the market,
along with a brown brickand-tile house next door
at 2 Saunders Street.
Members of the
Kennedy family have
joined forces with neighbour Anthony James
Lennon to sell the two
adjoining properties at
the same time.
As director of Peet
Ltd, Mr Lennon knows a
thing or two about land
banking.
In 2002, he paid
$2.05million for 2
Saunders Street, accord-

The old bungalow at 17 Owston Street is not for sale


but lot 8, the 914sq.m block next to it, is available.
FREMANTLE

80 DUKE ST, East Fremantle


Your Ultimate On-Trend Home Awaits
AUCTION
5 Sept @ 1PM
N
IO
CT AY
AU TOD

AGENTS: Susan James


and Linda Sullivan,
Space Real Estate.

This rare and


remarkable oering
commands 1889sq.m of
prime elevated land

Land developer Anthony James Lennon paid


$2.05million for for 2 Saunders Street in 2002. Its now on
the market, along with a block next door.
ing to Landgate records.
The modest, threebedroom and twobathroom home is on a
975sq.m corner site.
Selling agent Andrew
Cooper, of Abode Real
Estate, described it as
a once in a lifetime
opportunity to secure a
significant landholding
perched on the crest
of Perths most exclusive enclave, Saunders
Street.
This rare and remarkable offering commands 1889sq.m of prime
elevated land, he said.
Tightly held since the
land was first released
in 1918, this property is

steeped in rich local history and has remained in


the same family for four
generations.
The old house at 17
Owston Street has a
category-three heritage
listing on Mosman Park
councils municipal inventory.
The inventory said
it had been built for
Richard Kennedy (18841957), who described
himself as a traveller and
a brewery worker.
Richards wife Ellen
lived at the home until
her death in 1973, and
it has remained in the
Kennedy family since
then.

Jennifer Castle
9438 8412 0414 572 440
jennifer.castle@acton.com.au

For style, luxury


and sophistication
in the Plympton
Ward, this on-trend
W
home is a must see!
h
OPEN SAT 12.30-1pm
O

Bullsbrook Fr $1.45M
135 Clarkson Road

NEW LISTING

A rare opportunity: dress circle of Shady


Hills. An immaculately presented, modern,
spacious home on 40 gently undulating,
shire approved sub-dividable acres with
breathtaking views over the picturesque
Avon Valley. Seclusion and abundant
RUDIDXQDDQGIUXLWIRUQDWXUHORYHUV
luxury retreat, potential equine property
or investment opportunity. See website for
video and full details. Be the 1st to view.

Call 1300 578 504

Page 100 POST, September 5, 2015

Giant road trains rumbling our way


From page 1
length of the freight link into
East Fremantle and across the
river to North Fremantle, entering Fremantle Port.
People will be horrified when
they discover road trains are
going to be driving through our
suburbs, said Kim Dravnieks,
convener of Rethink the Link,
the public campaign opposing
the freight link.
The government has been
utterly duplicitous, he said. It
goes totally against their advertising campaign at the moment.
Theyre spending a lot of
money saying that the freight
link will make it safer for you,
safer for children.
But theyre not telling people
that these huge trucks will be
on the new Perth Freight Link
with a mix of cars at a greater
speed, making it more dangerous, not less.
Traffic on the freight link, including the huge road trains, will
be allowed to drive at speeds up
to 80kmh, even around curves.
Main Roads has not yet responded to questions about what
measures, if any, would be in
place to prevent the B-triples from
following already established
freight truck routes north from
Fremantle along Curtin Avenue,
Marine Parade, Stirling Highway
and West Coast Highway.
If you want to avoid a toll, you
drive on other roads, so we can
safely say we are going to have
more heavy trucks on roads that
arent the freight link, Professor
Newman said at a public forum
opposing the freight link held in
Cottesloe this week.
He said it was highly inappropriate to have B-triples sharing

Container trucks pass in Curtin Avenue, Cottesloe.


roads with other suburban traffic, and penetrating deep into
the urban area.
It should be obvious that you
dont run any kind of B-triple
traffic through the suburbs, no
matter what measures you might
take to try to protect people
from them with walls and other
devices to separate them from
the community.
The reality is the freight link
is going to be used by substantial numbers of cars as well
as trucks, because its going
through the main urban area.
He said the sheer bulk and size
of the road trains were major
concerns on shared roads.
These road trains are significantly more dangerous in
mixed traffic because of their
size, he said.
It doesnt matter how good
their engines are, how good their
brakes are you know what a
road train is like in the country,
how hard it is to get around to
pass one.
That is what we will be
contending with en masse in
Perth now.
Chair of the Freight and
Logistics Council Fred Affleck
said he thought the B-triples
on the freight link would not
be popular.

P
P
Classifieds
POST

PROPERTY

DALKEITH

DALKEITH

COMMERCIAL

NEDLANDS

STEVEN MAILEY
"REIWA GRANDMASTER"
FOR ALL YOUR RESIDENTIAL
REAL ESTATE NEEDS
"What is worth doing
is worth doing well"
9386 8255
0416 191 941

SUBIACO

Commercial and
Industrial Leasing
Commercial and
Industrial Sales
Retail Leasing
Property Management

Stephen de Courtenay
0413 515 190

ALL AREAS

FREE
MARKET
APPRAISALS
MARINA BERZINS
9381 9111

0419 195 873

MARINA@PAXTONHOAD.COM.AU

KEEPING IT REAL
HELPING PEOPLE MOVE
GILL VIVIAN
0415 853 926
TRENT VIVIAN
0432 392 387

People tend not to like big


trucks, he said.
But he said B-triples were
very safe trucks and their advent would be economically
beneficial to the port.
Its about efficient movement
of freight, and this is certainly
one of the most efficient ways
to do it, Dr Affleck said.
Professor Newman agreed that
the road trains would be highly
unpopular.
I think its the final nail in
the coffin for the Perth Freight
Link, he said.
When people realise that
these massive juggernauts are
going to be sharing our roads,
thundering through our suburbs,
theyll say this must not happen.
He agreed with Dr Affleck
that road trains would bring
a heightened cost efficiency
to freight movement, but he
said this efficiency would be
achieved only with social and
environmental costs.
This will kill off the rail option, he said.
I hesitate to say rails completely dead for the long-term
future in the outer harbour at
Kwinana, but I think B-triples
will kill off trains going to the
port in Fremantle; the trains
just cant compete.

John Hammond, president


of the Cottesloe Residents
and Ratepayers Association,
called both the freight link
and the change of law to allow
road trains on the link totally
demented.
If the multi-combination
trucks are going to come down
Curtin Avenue and Marine
Parade then that will cause severe vibrations in homes along
those streets, he said.
There are going to be greater
emissions of diesel particulate
which is a threat to health and
its going to cause substantial
noise for our area.
It will have a profound effect
on the way we recreate in our
suburbs.
People will be much less
likely to use footpaths or ride
bikes, and travelling on our roads
will become more dangerous.
What this demented plan will
do is ensure we have thousands
of road trains rumbling through
our suburb to a port that will be
in excess of capacity one year
after the unfinished link is built.
Its madness.
He agreed with Professor
Newman that the prospect of
road trains travelling on mixeduse roads through suburban
areas highlighted the need for
an outer harbour at Kwinana.
It dramatically emphasises
the need for the outer harbour
in Kwinana to proceed, he said.
We must be looking at rail to
transport freight. Using trucks is
the antiquated way of doing it.
We need to seriously look at
rail to carry freight and people
through our suburbs; thats what
the other major cities of the
world are doing.

People power
can stop Link
From page 9

Other councils all up and


down the coast are understanding whats happening.
The only council that seems
to have its head stuck in the sand
is Cottesloe.
Cottesloe mayor Jo Dawkins
said the council had resolved to
lobby Mr Barnett and Transport
Minister Dean Nalder for the
removal of heavy vehicles from
roads within Cottesloe and to
request models and costs of
alternatives to the link.
Regardless of whether or
not the Perth Freight Link goes
ahead, residents in Cottesloe are
concerned about the increasing
volume of heavy trucks on Curtin
Avenue, Mrs Dawkins said.
Cottesloe councillor Jack
Walsh said the council did not
have a strong position on the
link, but offered his views as a
resident.
Environmentally, the Perth
Freight Link is a disastrous
proposition which will destroy
wetlands and threaten the
health of the community due
to the huge increase in diesel
particulate emissions, which are
known to cause cancer and heart
and lung conditions, he said.
Also, lets imagine the impact
on Cottesloe during those years
of construction, when the roads
in the south end of Cottesloe
are all under construction and
the traffic is really jammed up.
It will have a lasting detrimental effect on the amenity
and lifestyle of the Cottesloe
community.

Why Coast ward ratepayers are taking Cambridge council to court


From page 36
instead labelling us NIMBYs
and so on.
A sad day for democracy in
Cambridge.
Some would have you believe we are about pushing
density into other areas; that
is not the case.
We understand that the
state governments policy
regarding infill means our
suburbs are not immune to
change and infill, but they
need to be achieved sensibly,
with due regard to character
and amenity.
This is about what is right
for these suburbs to preserve
their character for our and
future generations.
This is about taking time to
make sure we get things right.
In normal circumstances, a
council would have listened
to ratepayers, engaged with
them and worked collaboratively to achieve an acceptable outcome.
But in this case, circumstances that unfolded were
anything but normal.
Worries about process were

at the outset brought to the


councils attention.
When they were ignored,
they were raised with Local
Government Minister Tony
Simpson.
We had comprehensive
advice from a prominent
law firm and a legal opinion
from a QC.
Mr Simpson and his department refused to investigate
our worries, saying they had
no responsibility to act.
These concerns are now
the subject of the legal proceedings.
We have also met Planning
Minister John Day, WA
Planning Commission representatives and Premier Colin
Barnett.
As no one in government
has been able to allay our
concerns, and given that any
application for a judicial
review of a decision must be
brought within six months
of its being made, we were
left with no alternative but
to preserve our legal rights
and begin legal proceedings
against the council.
The decision was not taken

lightly and it is with a heavy


heart that we began proceedings against our own council,
whose elected members are
supposed to represent ratepayers interests.
We would also like to take
this opportunity to thank

everyone in our community


and beyond for their generous support, and Churchlands
MP Sean LEstrange for his
support to date.
Robert Walker president, Coast
Ward Ratepayers Association
Palana Road, City Beach

Former lawyer to stand in Cott


From page 30

Cottesloes civic centre.


His wife Catherines father,
Charles Murphy, was mayor
for seven years, and Catherine
has been a councillor.
He said he was concerned
about cyclist and pedestrian
safety, the much-complainedabout public toilets below
Indiana, and other foreshore
issues.
I dont send my kids in
there, Mr Rodda said about
the Indiana toilets.
Eventually we also have
to deal with the congestion
at Jarrad Street.
Id like to be on the inside
and understand the issues.
Mr Rodda ducked a ques-

tion on whether Premier and


Cottesloe MP Colin Barnett
did a good job for his suburb.
In many ways hes in a
difficult position, Mr Rodda
said.
Especially in the current
climate, where he could be
criticised for spending too
much on his electorate.
Mr Roddas children go to
Cottesloe Primary School,
Presbyterian Ladies College
and Christ Church Grammar
School.
He is chairman of the primary schools board, has been
on the Sea View kindy board,
and sat on a Law Society
sub-committee when he was
a lawyer.

Kill City of Perth Bill, says Claremont


From page 7

other cities on the world stage,


Mr Goode said in his report.
The Bill does almost nothing to achieve such ideals.
Mr Goode said the Bill
would not give Perth any new
powers.
The state government has
clearly held the planning and
infrastructure power to itself,
which would be a significant
disappointment for the City of
Perth and other advocates for
the Bill, he said.
If the Bill is enacted, after
July 1 next year, council
boundaries would change to
encompass all of Kings Park
and portions of Nedlands and
Subiaco.
The only explanation for
the annexation of these lands

has been that as a capital city,


Perth should include icon
infrastructure, attractions
and facilities, Mr Goode said.
The new boundary will
draw into Perth UWA, Kings
Park, QEII Hospital campus and Hollywood Private
Hospital.
There do not seem to
be demonstrated problems
with the operation of local
government in respect to
these facilities under the
current boundaries, nor is
there any operational benefit
from annexing Kings Park
into Perth.
The much commentedupon situation of UWA having to deal with three local
governments at the moment
could as easily be addressed
by adjusting a boundary to

include it into the City of


Nedlands the most sensible
option or into the City of
Subiaco as a slightly less nonsensical option than including
it in the district of Perth.
Mr Goode said Subiaco
would lose 1347 rateable
properties with an estimated
loss in rates of $2,032,000, or
9.1% of rate revenue.
There would also be an
estimated $500,000 of lost
revenue from parking fees
and charges.
Significant revenue impacts have also been reported
by the City of Nedlands, Mr
Goode said.
He said the proposed
boundary changes were arbitrary, lacked logic and were
entirely contrary to planning
for good local government.

The fact that the changes


will rob the cities of Nedlands
and Subiaco of revenue while
leaving them with inevitable
problems simply highlights
how poor the idea is, he said.
Councillors agreed and
voted unanimously for Mr
Goodes recommendation.
Councillor Peter Edwards
said the Bill looked as though
it had been done on the back
of a napkin.
Councillor Chris Mews said:
Its another underhand move
by the state government to
disenfranchise members of
the Subiaco community.
Councillor Peter Edwards
said: This Bill really makes
no sense.
Mr Haynes said the City of
Perth had managed to wobble
on for a century without it.

POST, September 5, 2015 Page 101

trades & services directory trades & services directory trades & services directory
ACCOUNTANTS

BATHROOM
RENOVATIONS

CHRIS BROGAN & ASSOC. P/L

John Chivers
Asphalt Service

CHRIS BROGAN
Chartered Accountant

Your Local Professional


Ph: 9386 2550
0411 384 841
Suite 7, 202 Hampden Rd, Nedlands

AIR CONDITIONING

RENOVATIONS &
EXTENSIONS
Bathroom - Kitchen - Laundry
One Stop
Tradesman Shop
YOUR COMPLETE

Renovation
Lic No L023518, AU 11676

SALES SERVICE INSTALLATIONS


Wall splits Ducted Evap System
Privately Owned and Operated
Personal Service Guaranteed
Free Inspections and Quotes

Phone JOHN 9200 4266

email: johndee@netspace.net.au

DEFT Air Conditioning


Split A/C supplied and/or installed.
Check my price first

Demolition - Electrical - Plumbing


Gas - Concreting - Brick Laying
Carpentry - Glazing - Roofing
Plastering - Painting - Tiling
Air Conditioning - Cabinetry - Solar
Re-Grouting - Paving - Landscaping

15 Years
Experience
Call or visit

Mention
this ad and
get 10%
discount

0433 019 676

Phone 0424 037 289 Mark

Registered Builder 15314 EC008512


AU31311 PL8903A5903985 GF015914

Roberts
Renovations &

RCHandyman
Environmental
Pty Ltd
Service

Reverse Cycle Split AC Installs


Domestic/Commercial
COMPETITIVE PRICES ARC CERTIFIED

0437 745 368

ANYTHING TO DO
WITH BATHROOMS

experience. Specialising in houses,


outbuildings. Fences, roofs etc
NO JOB TOO SMALL
CALL YOUR LOCAL EXPERT
FOR A FREE QUOTE

Rob 0409 958 186


BATHROOM
RENOVATIONS

STOP LEAKING
SHOWER

Bathroom Renovation
Regrouting
Pensioners discount
30 years experience
12 years warranty

Jacks Intersealed
0417 915 951
www.jacksintersealed.com.au

BATHROOM
international
RENOVATORS
OWNER/BUILDERS

MUIRS

Biggest Selection of
Vanities, Taps, Spas,
Floor & Wall Tiles
Showroom:
325 Canning Hwy Palmyra

Email: john_chivers@bigpond.com
www.jcas.com.au

JANSENS BRICKPAVING
& LIMESTONE SERVICE

Experience in MYOB, Xero and


Quickbooks. BAS Reporting, all
aspects of bookkeeping. Extensive
knowledge in different industries.
Over 20 years experience.
Reasonable hourly or daily rates.
Can do books from your premises
or from mine.
Call Gill

Bookkeeping
FOR SMALL BUSINESS
www.rcnbusinessconsulting.com.au
Rob

9384 3989
Mob 0407 916 114

BORES

MINI BOBCAT HIRE AVAILABLE

BOBCATS, EXCAVATOR,TIPPERS
ROCK BREAKER

ALL JOBS FREE QUOTES

MIKE BRYANT

0428 910 341


A/H 9381 9126

Bores Pumps Electrical


Sales and Service
Quality Since 1983

9329 9700 0403 774 303


stirlingwater@bigpond.com

JOEL IRRIGATION &


LANDSCAPES 15:
-5%

bcc@aapt.net.au

Personalised service with a better deal at

BOBCAT
WORKS

0419 771 323


www.bobcatworks.com

1/2 Loch Street, Nedlands

9386 3183

Local Nedlands Builder

Your supervisor is the owner


of the business

0418 927 799 - 9296 1041

DAVID COLLINS
0418 954 086

Phone Gary

/LIH0HPEHURI:$66$

david@bastilledevelopments.com.au
www.bastillehomes.com.au
Registered Builder 13523

STAR

Bathroom
Renovations
Neil Davey
Kitchens
& Laundries
Professional Work at honest prices
All Areas No job too small

9401 9613
M: 0419 930 368

One Company All Trades


Perth TLC Group can project
manage your bathroom
improvement/renovation
www.tlc-perth.com

9284 0165

info@tlc-perth.com
Have a look at our main ad in the Home
Improvement section

0417 969 480

BOOKKEEPING

VAN BEMMEL
BRICKLAYING
RELIABLE LOCAL TRADESMAN

Experienced in all aspects of brickwork,


No job too small. FREE QUOTES

With 20 years experience in small


business accounting practices,
Angela Brock & her team of
friendly, professional bookkeepers
can help you with yours!! Call us to
discuss your requirements.

r.:0#4QFDJBMJTUT
r0OTJUFPS0GGTJUF
r1BZSPMM#"4
r3FHJTUFSFE#"4
Agent
r4FUVQ 5SBJOJOHPS
3FHVMBSCPPLT
r$FSU*7"DDPVOUJOH
r5JEZ6Q1SPCMFN
r"DDUT3FDFJWBCMF
Payable
4PMWJOH
r$PNNFSDJBM/PUGPS1SPUT

"WBJMBCMFUISPVHIPVU
1FSUI.FUSPBSFB

Call Angela
0438 611 822
Specialising in complete bathroom
renovations and building works,
demolition, wall removals and space
re-congurations from start to completion.
All works guaranteed and carried out by
qualied trades. References upon request.
For a quote please call
Ian Brickelbank

JBS Bookkeeping

David Macdonald

Fifteen years experience offering


one off catch up or regular service

0401 373 750 or


0488 208 999

BITUMEN PAVING

CLAREMONT ASPHALT
& PAVING SERVICES
&$53$5.6
'5,9(:$<6
&2/285('$63+$/7
$//%,780(15(3$,5:25.
2%/,*$7,21)5((4827(6
12-2%72260$//%,*

&RQWDFW9LQFH0407 196
a/h 9383 3951

683

Cert. IV Bookkeeping

BAS reporting, Debtor/Creditor


Control Monthly reporting &
Business Admin.
Payroll/Inventory control

Contact

Jeff 0407 130 921


jeff@jbsbooks.com

ACCOUNTS BOOKS
REPORTS
MYOB, QuickBooks, Xero,
Point of Sale/Retail Software

ADVANCED BOOKKEEPING

Reasonable Rates & Proven Savings


Free 1 hour Consultation Call:

9381 7995

Registered BAS Agents

Est 1972 1st Class Work

t"MMQBWJOHBOESFQBJST
t-JNFTUPOFSFUBJOJOH
t#OPTJOHt4NBMMKPCT

0414 441 877

BRICKPAVING
AND
F BRICKLAYING

USmall-Medium
LLY B Jobs
OO
28 yrs experience.
Free
K Quotes.
Ph Mike 0407

ED

771 893

0408 129 186


Specialising in your brick work
XWater & garden features
X BBQs & letter boxes
XFeature & retaining walls
X Rendering & rejointing
X Fences & piers X Extensions
X Insurance & repairs to bricks
XEntertainment & small paved areas
Free Quote no obligation

FREE QUOTES
COMPETITIVE RATES
NO JOB TOO SMALL

0420 308 455

PAVING REPAIR MAN

0412 908 205

Paving & Limestone


Professional

Bricklaying Division
BBQs
Letterboxes
Retaining Walls
Stone Work
Plastering
Insurance Work

0400 565 545

Crack Repairs, Mortar Repairs


Concrete Cancer & Waterproofing
All work guaranteed 10 years

DOWNLOAD OUR
FREE BROCHURES!
www.tuckpointing.com.au

9242 2952

Comco Restoration
r3JTJOH%BNQ
r'SFUUJOH.PSUBS
r$PODSFUF$BODFS
r-JOUFM3FQMBDFNFOU
r5VDLQPJOUJOH
r8BUFSQSPPG.FNCSBOFT
Over 20 years experience
"OESFX

0400 776 449

31 yrs exp
FREE QUOTES

DPNDP!CJHQPOEDPN

KEARLEY
BRICKLAYING

BUILDING

All aspects of bricklaying


Limestone
Insurance Work
Owner builder Service

Mark 0432 260 011


BRICK PAVING

National Estate
Builders
New homes plus
additions & renovations
by a specialist who
understands & appreciates
the older home.
Full Design Service.

Tel. 9381 7094


7 Forrest Street Subiaco
EST 81

PETER HARPER

Landscaping, Paving, Reticulation,


Limestone Walls and Ponds

0412 917 818 Ph & Fax 9384 9224

Quality Work
No Job Too Small
Free Quotes

S PAVING

0411 696 179


9385 4228

KELLYS BRICKPAVING
Quality workmanship at an
affordable price.
All work guaranteed. Friendly advice.
FREE QUOTES CALL
SHAUN
Mobile 0412 292 488

Nth & Sth Landscaping


Mini Bobcat Service,
Landscaping, Paving,
Retaining Walls, Reticulation

Ph: 9207 3501


Mob: 0419 858 247
Bernie Parsons

FURNITUREMAKER
CABINETMAKER
est 31 years

SPECIALISING IN CARPENTRY
AND CONSTRUCTION

Renovations Additions
Maintenance Design &
Drawing Service
Building & DIY Assistance
Call Dane 0409 928 882

CHALCRAFT
ALL STRUCTURAL
WORKS CARRIED OUT TO
COMPLETION.
NEW WINDOWS / DOORS
DESIGN NEW
KITCHENS & BATHROOMS
FULL DECORATION SERVICE

Call CHALCRAFT

0405 353 787


Builders Reg: WAS1118

BUILDING AUSTRALIAS
HERITAGE
neb@bigpond.net.au

Western
Suburbs
Wall removal specialist with
licensed Electrical contractor
EC008431 on hand.
WILL BEAT ANY WRITTEN
CONTRACT.
20% discount for pensioners.
30 years exp in building
industry
PETER

0433 969 639

Call us on
9381 3088
to advertise
in the

Trades &
Services

CUSTOM
CABINETRY
OF ALL TYPES.
Specialising in Painted and Timber
Media Cabinets, Bookcases,
Home Offices and
Full Carcase Robes

I PERSONALLY DESIGN,
MANUFACTURE AND
INSTALL ALL ITEMS
ENSURING THE
HIGHEST STANDARDS.

0417 092 134


Visit our website
ww.baradineholdings.com.au
A Good Price Guaranteed

Jaycraft Cabinets
Quality Kitchen Renovations
Workmanship Designed Cabinets in

Robes Laundries Vanities


Office Study Entertainment
Call Jason For Free Quote

9302 5209
0417 998 435

Kip Woodsmith Design


INTERIOR SOLUTIONS

finished konstruction
Over 30 years experience in
expertly finished Additions,
Renovations & Homes
Honesty, Integrity and
Quality Guaranteed
Classic character style
our speciality
Fulltime personal supervision
Built on our reputation in the
Western Suburbs
Contact Jimmie Roche

0413 327 435


Registered Builder 8549

www.finishedkonstruction.com.au

092 350

BRICKWORK
RESTORATION

CABINETMAKING

JONATHAN TOWERS

Construction & Installations


Restoration, Clean and Seal Work

Property
Maintenance
est 1997

BUILDING

PAVEWEST
ALL WORK GUARANTEED

Call Dave 0408

PH MARK NEWBOLD

A B Bookkeeping

M.P. & K.J. GOURDIS

Small Jobs Immediate Attention


Ring Frank
25 yrs exp

"#/

r.JOJ#PCDBUNUSXJEF
r*EFBMGPSMJNJUFEBDDFTT
r(SBTTBOETPJMSFNPWBM
r1BWJOHPSDPODSFUFQSFQBSBUJPO
r4IBQJOHGPSMBOETDBQJOH
r(FOFSBMZBSEDMFBSJOH
rFor Free Quote Ring Kevin on

Ph: 9381 9815

BRICKLAYING

40 Years Experiece

$//$5($6P3 TRUCK

PAVING - Driveways patios


and garden paths
LIMESTONE GARDEN WALLS
14 Gloster Street, Subiaco

Re-lay: Drives, Patios,


Around Pools, Soakwells,Tree
Roots & all types of paving.

LYNX BOBCAT
& TRUCK HIRE

Additions | Alterations
Bathrooms | Kitchens

JOHNS BRICKPAVING
& STONEWORK

r/FXCPSFJOTUBMMBUJPOTUPBMMBSFBT
r$POOFDUJPOUPFYJTUJOHTZTUFNT
r1VNQFMFDUSJDBMSFQBJST

0417 930 607

Built on Relationships

5(&<&/('%5,&.63(&,$/,67
/,0(6721(:$//6
48$/,7<:25.0$16+,3*8$5$17(('
WIM JANSEN 9384 9606
Mob. 0410 300 681

ALL ASPECTS OF

Any Job Any Area


Any Time

Lawn - Concrete - Rubbish removal


Save time and $$$ large 20m truck
Brick paving, concrete, lawn preps
Pools filled-site cleans-soils delivered
All work big and small
Do it right with a local experienced
operator. Competitive rates and
quality work - Call SCOTT

Rod Halcombe

0431 858 038

Phone: 9383 9743

t
Bathrooms,
Laundries & Toilets
,GLVFXVVDGYLVHSODQDQGTXRWH
<RXVHOHFWDOOYLVLEOHILQLVKHV
DQGGHWDLOV
,GRWKHZRUNP\VHOIZLWK
TXDOLILHGWUDGHVPHQDVUHTXLUHG

0411 843 554

Mob: 0418 944 934

angela@abbookkeeping.com.au

to letterboxes in
the western suburbs
than any other free
publication, says an
independent audit.
Separate surveys
also show that the
POST has far more
readers in all age
groups each week.
see P. 2

Mobile Bookkeeper

CHRIS ATKINSON

7 DAYS - FREE QUOTES - ALL AREAS

9339 8113

The POST
delivers
more
newspapers

BRICK PAVING

Bobcat and Truck Service

30 years experience

ASBESTOS

Asbestos
Removal
Accredited removalist with 20 years

Mobile 0447 576 441

BOOKKEEPING

ORGANISED WITH ONE PHONE CALL!

htcontractorsperth.com.au

ARC #AU 20600, ARC #L011927, EWL #137884

Guarantee lowest quotations


20 years experience in the industry
Free Quotations
Residential Driveways
Trench Reinstatement
Coloured Bitumen
Pothole Patching
Speed Humps
Bitumen Cutting
Wheelchair Ramps

BOBCATS

Lic No L018461

AIRCONDITIONING SERVICE,
SUPPLY AND INSTALLATION
Call Eddie on 0411 723 533
Prompt and Reliable Service
Fully Insured and Licensed

BITUMEN PAVING

Individual designs & hand crafted


Cabinetry and Furniture including:
Kitchens & vanities, dining tables, beds &
side drawers, lounges, storage robes & more
For a free Design & Quote
Call Kip

0415 137 081

info@kipwoodsmithdesign.com.au

CAR DETAILING
ALL-WHEELS DETAILING
Mobile Car Cleaning & Detailing
From a wash and vacuum to a
full detail
Call 0409 442 714
a/h 9244 2716
for a free quote

CAR WASH
One Company All Trades
Perth TLC Group can project
manage your next home
improvement/renovation
www.tlc-perth.com

9284 0165

info@tlc-perth.com
Have a look at our main ad in the Home
Improvement section

BUILDING
SERVICES

BUILDING SOLUTIONS
We Remove, Repair, Replace
Brickwork / Fretting mortar,
Stud walls, Render, Concrete,
Chimneys, Ceilings, Roofing,
Lintels, Eaves, Windows,
Carpentry, Tiling,
Box Air-Conditioners etc.
Hidley Pty Ltd

044 97 88 778

Perth Central
Maintenance Co
WE DO IT ALL

Residential - Commercial 27 years


Experience Personal Service
Call Louis

0416 096 071

CAR WASH & DETAILERS


*REALISTIC PRICES*
We come to you (Home or Office)
7 Days Per Week

0417 984 561

Indigo
Painting
CARPENTRY
KAYES CARPENTRY
QUALITY CARPENTRY WITH RELIABILITY

:LQGRZV'RRUV6KHOYLQJ5HSDLUV
+LQJHV6DVK&RUGV %DODQFHV
/RFNVHWFSmall jobs Welcome
Phone '$9,'.$<(

9384 5287

0418 920 574

DAVID HAYWARD
CARPENTER & JOINER
Qualified Craftsman over 42yrs exp

FOR ALL JOINERY


Property Repairs, Doors,
Windows, Sash Records,
Skirting Boards, Locks etc
Quality Work Guaranteed
NO JOB TOO SMALL

Ph 9382

4172 all hrs


0402 538 449

JUST DOORS

DOOR INSTALLATION &


MAINTENANCE SERVICE
COMMERCIAL & DOMESTIC
Timber & Aluminium Trimming. External
Doors Priority. Draught Weather Seals
Eye Viewers & Accessories

Enzo De Palma

Mobile 0412 194 842

CABINETMAKING

SUBIACO
FURNITURE
FACTORY
Custom-made Furniture
Kitchen, Wall and Vanity Units
Bookcases

9381 6098
Traditional Craftsmanship
7 Forrest Street,
Subiaco WA 6008.

Fax 9388 2089


Aiming for Perfection
Cabinets & Carpentry
New kitchen vanities, built-in-robes,
kitchen and bathroom renovations.
QUALIFIED TRADESMEN: FREE QUOTES
NO JOB TOO SMALL

9344 1884, or
0418 914 284
THE CABINET MAKER
Top quality work
Prices to suit all budgets
For new or complete renovations
Kitchen, bathroom, built-in robes etc

9332 8596 all hours

CARPENTRY

Because Quality Counts


LORNE EDWARDS
PERGOLAS/ROOFING/
CARPORTS/VERANDAHS
DECKING TIMBER FLOORS SKIRTINGS
ALTERATIONS GENERAL MAINTENANCE

Ph: 0416

126 048 Anytime

MARTINS CARPENTRY
& CONSTRUCTION
$OO7\SHVRI&DUSHQWU\ 
%XLOGLQJ:RUN8QGHUWDNHQ
'RRUV)ORRUV5REHV
3HUJRODV*D]HERV'HFNV
9HUDQGDKV &RORQLDO:RUN
2ZQHU%XLOGHU6HUYLFH
30 years exp, contact
EDDY on 0407 827 721 all hours

Page 102 POST, September 5, 2015

trades & services directory trades & services directory trades & services directory
CARPENTRY

CARPENTRY
CREATIONS

X Decking X Cabinetry
Specialists X Skirting &
Doors
X Pergolas
X Carports X Owner Builder
X Fencing X Garden
Gates
X Kitchen
Makeovers

FREE QUOTES

PH TONY 0434 835 036

www.carpentry-creations.com.au

CARPENTER
Extensions & Renovations
Maintenance & Repairs
All Jobs, Big & Small

0423 247 903


carpentry

specialist

Residential and Commercial


tSFOPWBUJPOT
tGJUPVUTtFYUFOTJPOT
tPVUEPPSTUSVDUVSFT

XXXTQFDJBMJTUDBSQFOUSZDPNBV
WA TRADE QUALIFIED

:34&91&3*&/$&r10-*$&$-&"3"/$&

&YDFMMFODF"TTVSFE

0410 444 959

CARPET & VINYL


REPAIR
Carpets, Vinyl Repair,
Restretch, Lay
Carpet and Lounges
STEAM CLEANED
Ian 0419 448 406
9444 7531

CARPET LAID ADAPTED


Repair Specialist 35 yrs exp.
Power Restretching. Patching
Fit Back Carpet to Tiles/Wood
Old, New. No Job Too Small
Underlay Supplied

9447 4429 0417 184 655

CARPET CLEANING

Established 1981

Domestic & Commercial


Carpets L/suites
Steam extraction voted
best way of cleaning
carpet by
CHOICE MAGAZINE
Our Reputation and
Quality is why we RETAIN
our Customers
Dont take a chance
Contact Martin Cook

Roberts
Renovations &

David Macdonald
0488 208 999
Carpentry &
Maintenance
Solutions
Over 30 years experience.
All aspects of Carpentry and Joinery.
Heritage/Federation/Colonial
restoration and renovation.
t1FSHPMBT
t$FEBSMJOJOH
t%FDLT
t7FSBOEBIT
t%PPST
t4LJSUJOH
t#BMVTUSBEFT t4USVDUVSBM3PPG3FQBJST
BOE-FBLTGJYFE
(VBSBOUFFBQVODUVBMBOESFMJBCMFTFSWJDF
Paul Cubitt
0427 676 574 / 9284 6184
DVCJUUBOEDVCJUU!PQUVTOFUDPNBV

B P HUMPHREY
CARPENTRY & JOINERY

t%PPSTt4LJSUJOHt"SDIJUSBWF
t4IFMWJOHt#VJMUJO3PCFTt,JUDIFOT
t8PPE-BNJOBUF'MPPSJOHt$MBEEJOH
t3PPmOHt%FDLJOH
Qualified & Professional Tradesman
Over 20 Yrs Experience

Call Brett 0451 153 966


bphumphrey@bigpond.com

Outdoor Carpentry
20 Years Experience

For the cleanest


carpet possible
COTTESLOE CARPET
CLEANING
Western Suburbs
Specialist!
RESIDENTIAL
COMMERCIAL
RENTAL
UPHOLSTERY

Now available
New Technology
TILE & GROUT
CLEANING
NO MESS
NO FUSS

9383 4931

MELITA
CLEANING SERVICE

FREE

Bedroom
clean when
you mention
this ad
Carpet Steam Clean,
(Conditions
also Dry Clean Carpets, Apply)

Clean Lounge Suites


Also Stain Guard for Carpets.
Floors Stripped & Sealed
Windows Cleaned
Tile & Grout Cleaning
25 years experience
Free Quotes

9309 9967
E X P E RT

Carpet
Steam
Cleaning
Tile & Grout Cleaning

FREE QUOTES

0418 957 690

MUIRS
Glyn Phillips
CARPENTRY AND JOINERY
Renovation and restoration specialist, for
all your carpentry and renovation needs.

0417 093 966

Email: gkphillips@amnet.net.au

ACCI Trained & Certified


Contact GRAEME

LATEST TRUCK MOUNTED


STEAM CLEANING
CARPETS, RUGS AND
UPHOLSTERY
TILE AND GROUT
OWNER OPERATED
AVAILABLE 7 DAYS
FREE CALL

STAIGERS
Carpet & Cleaning

Kurt Carter 0424 476 036


kurtcarter01@gmail.com
www.allbuildconstruct.com

Carpet
Tiles & Grout
Vinyl & Lino
PH: ELSA

Upholstery
End of lease cleaning
Office cleaning
OR RAGETH

0410 659 580


RUG CLEANING
t1JDLVQBOEEFMJWFSZTFSWJDFGPS-BSHFSVHT
t3FQBJST3FGSJOHJOH
t4FMFDUFETPGUGVSOJTIJOH%SZDMFBOFE

0407 076 552

CARPENTRY
& MAINTENANCE
Qualied Charpenter with over 30 years experience
Specialising in:
lf in
I Pride myse work
completing allon
to perfecti

Ph Nick

Doors Skirting
Stud Framing
Gates Cedar Lining
Pergolas & Decking

0414 337 873

RESIDENTIAL & COMMERCIAL


Organic & Non-Toxic
Green Certified

t $BSQFUT$MFBOFE %FPEFSJTFE
BOE%SZJOIPVST
t6QIPMTUFSZ-FBUIFS$MFBOJOH
t4UBJO3FNPWBM1SPUFDUJPO
Domestic - Real Estate - Commercial
CALL STEVE

0407 475 860

DESD!JJOFUOFUBVr/PSUI8FTUPG3JWFS
*OEFQFOEFOUMZ0XOFE0QFSBUFE

%XLOGHUV&OHDQ
5HJXODUDQG9DFDWHV
6SULQJDQG2QFHRII
&RPPHUFLDODQG'RPHVWLF

PH: Rhonda 0409 688 854

www.fastidiousclean.com.au

OCEAN LINE CLEANING

CEILINGS
&(,/,1*),;(5

B-ABLE CLEANERS

EXPERT REPAIRS TO - SAGGING


CEILINGS - DAMAGED CEILINGS
- HOLES - CRACKS ETC PLASTERGLASS OR GYRPROCK
SMALL JOBS WELCOME
OVER 35 YRS EXPERIENCE

3K5DOSK

PLASTERLINE
INDUSTRIES

Ceilings installed & repaired


Decorative cornices & centre roses
All ornate work
Gyprock specialists and plaster glass
specialists
Suppliers of decorative cornices,
centre roses, arches, domes and
picture rails

General ofce and common


area cleaning, carpet & window
cleaning. Vacate cleaning
Commercial & Domestic

Ph: Ben 0408 566 431


RITA CLEANING

0411 547 487


APEX CEILINGS
& PARTITIONS
Ph

PULL DOWNS DECORATIVE


DRYWALL REPAIRS
INSURANCE SUSPENDED
Police Cleared - Free Quotes

Ph Andrew

M 0413 568 580


Fax 9285 2888
CHIMNEY SWEEP
THE ORIGINAL

The Swiss Chimney Sweep


All types of FLUES /
OVENS / POT BELLIES etc

Adrian 0411 848 404


CLEANING

Cleaning

t1&45$0/530-4&37*$&

Free quote call Galen

0433 145 346


Liu33yang@hotmail.com

BMUDMFBODIVDL!IPUNBJMDPN
"-5*56%&$-&"/*/(

Better Cleaner
@ Better Price
Reliable
Hardworking
0412 226 328

Advertise your
goods in the

Regular/Spring
Window Clean
Moving In/Out
Vacate Clean
Office Clean

Classifieds

ALL JOBS FULLY


GUARANTEED!

448 Stirling Highway, Cottesloe

9384 5656

DECKING

t7JSVT4QZXBSF.BMXBSF3FNPWBM
t*OUFSOFU.PEFN4FUVQ
t3FQBJSTBOE6QHSBEFT
t4FSWJDF1$T-BQUPQT 5BCMFU%FWJDFT
t)BSEXBSF4PGUXBSFJTTVFT
t&NBJMTFUVQ.JHSBUJPO
t/FUXPSL5SPVCMFTIPPUJOH
t4FOJPST5VJUJPO%JTDPVOUT
t0WFSZFBSTFYQFSJFODF
t1PMJDF$MFBSBODF

All types of boards


Stairs & Balustrades Oiling

Call for basic metre rates


FREE DESIGN & QUOTE
Call Liam

0403 939 742


DEMOLITION

Call 0439 333 449


www.thePCguy.com.au

DUTCH ANTIQUE
Timepieces

COMPUTER HELP
t4PGUXBSFt8FC4JUFT
t5VJUJPOt5SBJOJOH

Buying, Selling
& Restoration of
Antique Clocks
& Barometers

9349 9438

By a qualified clockmaker
Member of the Watch &
Clockmakers of Australia

CONCRETE

Unit 23/145 Stirling Hwy, Nedlands

9385 3054
COMPUTING

Mosman Computer Training


One-one to suit your needs
Word, Excel, PowerPoint, Photos,
Emails/Internet/Banking
Windows 8/IPads/Tablets
Mature aged VERY welcome
Phone Margaret

MIKES FULL CONCRETE WORK

Extensions, Driveways,
Pathways, Concrete Cancer and
repairs to all concrete Brickpaving,
Limestone Walls and repair to
limestone walls.

Your local tradesman for 20 years


NO JOB TOO SMALL
Ph

9385 7150 or 0414 660 051 DAY

0412 477 294

DEMOLITION

Houses Yards Cleared


Outbuildings Asbestos Removed
Rubbish Removed
20 years exp
DONT MISS OUR QUOTE

0409 958 186

Vincent Demolition

 Concrete cutting & pool


removals
 Driveways shed fence &
patios removals
 Kitchen & bathroom
stripouts
 Site clearing & clean ups

 Gary 0415 390 297

WA Exposed Concreting

Eco-Friendly & ENJO Cleans

r&YQPTFE"HHSFHBUFr)POFE1PMJTIFE
$PODSFUFr-JNFTUPOFr(FOFSBM
$PODSFUJOH
Obligation free quotes

REGULAR HOUSE CLEANS


RENT INSPECTION
& VACATE CLEANS
WINDOW CLEANING

Phone Ben 0419

We love our job and it shows!

0467 056 052

t Vacate tOne Off


tRegular Home Cleaning
tPolice Cleared
tChoice of 1 or 2 Cleaners
All Equipment and Consumables Supplied

or

info@housekeepingwa.com
CHEMICAL FREE
ENJO CLEANING
German trained, professional Euro staff
High quality, satisfactory work
Police cleared + insured
Since 14 years in the Western Suburbs

Sabine 0414

231 164

BETTYS Home
Cleaning Service
$40.00 per hour
Friendly & Reliable

Ph Betty 0408 241 464

Domestic & Vacate Cleaning


Windows & Commercial Cleaning
Professional & Friendly Staff

www.ASKYcleaning.com
Call us Today @

0404 118 811

All-U-Need
CLEANING SERVICE
Quality service, experienced, reliable friendly cleaners
Fully insured, police cleared
COMMERCIAL & DOMESTIC cleaning
Free
Quotes

0439 695 273

J&K
HOME CLEANING
Been working the whole day
and terribly tired?
House still untidy?
Concern for you kids cleanliness?

NOW Less than


$50 per week
We could get your home sparkly clean

Call us for help today @

0404 118 811

CLEAN PERFECT
Regular Vacate Moving In/Out
Spring Rent Inspection
COMMERCIAL & DOMESTIC
Police Cleared Experience
References Guaranteed

0413 929 436/0403 164 133


cleanperfect1@gmail.com.mx

www.vincentdemolition.com
DRAFTING &
DESIGN

908 230

JOGP!XBFDDPNBV

VIKING CONCRETE

www.pristinecleaning.com.au

Free Call

1800 095 318

0272

We bring our own equip and chemical


Special house cleaning $25p/hr

COMMERCIAL & DOMESTIC


t8JOEPXT
t1BWJOH$MFBO4FBM
t(VUUFSTt(BSEFOJOH
t3VCCJTI3FNPWBM
t:BSE$MFBOJOH

Tel/Fax: 9384

www.dutchtimepieces.com

FULLY INSURED & POLICE CLEARED

COMPUTING

COTTESLOE
WATCH REPAIRS
CLOCK REPAIRS
BATTERIES
STRAPS
FREE QUOTES
EASY PARKING
OVER 35 YEARS EXPERIENCE
Shop 5a Station Street Village
Cottesloe 6011

SERVICE
Domestic & Commercial Cleaning
Window Cleaning Service

FOR ADVICE & QUOTE


PHONE RHYS ON

FOR ALL YOUR


CEILING PROBLEMS
CALL THE EXPERT.
OLD OR NEW CEILINGS
REPAIRED OR REPLACED
40 Years Experience

CLOCKS & WATCHES

Husband & Wife Team


Commercial / Domestic
Police Clearance

Ph 0411 445 452

0433 445 916

ALL ASPECTS OF CARPENTRY


Restoration & Refurbishment
Timber Framing Sash Windows
Patios & Verandas Decking
Phone Henry

)DVWLGLRXV

&OHDQ
&KHPLFDO)UHH(QMR&OHDQHUV

t)"/%:."/4&37*$&

Ph 9383 3510
Mob 0413 833 966

Excellence in
Building and Carpentry

CLEANING

9446 2011
HERBS CEILINGS

For Quality Timber


r1FSHPMBTr(B[FCPT
r%FDLJOHr4DSFFOT
r$BSQPSUTr'FODJOH

Simon 0423 350 458

Worlds Largest Carpet


Cleaning Company

CARPET CLINIC

9383 7977
0418 940 145
Undertaking all aspects
of carpentry.
Handyman
Service
Specialising
in Renovations.
Restoration on Colonial
& Heritage Properties.
References upon request.
Service & Quality Guaranteed.
Please call

CARPET CLEANING

Computer Problems?
t8JOEPXT7JTUB
t)BSEXBSF4PGUXBSF
t*OTUBMMBUJPO 3FQBJS 6QHSBEF
t*OUFSOFU/FUXPSLJOH
t5SBJOJOH
EBZT -PX$PTU'BTU4FSWJDFT

0417 961 440 or 9382 8646

COMPUTERS
TELEPHONE

WE COVER ALL ASPECTS OF


CONCRETE SPECIALISING IN
EXPOSED AGGREGATE WITH
20 YEARS OF EXPERIENCE.

Ph Mick on 0400 212 917

Extensions design and


drafting specialists
1 and 2 storey additions,
Custom Designed Homes

for a free site visit and assessment

call Chris

0421 348 136

Indigo Painting
colourstone JAMES GREENFIELD
CONCRETE

www.extensionsbydesign.com.au

Liquid Limestone
Honed & Polished
Exposed Concrete
Home Extensions
or any aspects of concrete

DESIGN & DRAFTING

t$BSQPSUTt1BUJPTt/FX)PNFT
t"EEJUJPOT&YUFOTJPOT
FREE Initial Consultation

0438 834 410

John 0418 949 269

www.colourstoneconcrete.com

Broadband, Domains, Networking,


Repairs, Virus & Spyware removal
Licensed Cable/Phone Installer,
PABX, VOIP, Digital TV, LAN

CURTAINS

Smartwire Communications

www.smartwire.net.au

Call Brett 0419 234 567


25 Years Experience

1 Hour
Response

24/7 Onsite Service


Police Clearance
Virus Removal
Data Recovery
Backup Solutions
Wireless Network
Internet Connections

Century IT
Consultants
www.centuryitc.com.au

Call: 6465 4444


0411 357 645
Mac Man
- Need help with
your next Apple
hardware or
software
purchases?
- Need help installing and
integrating your new Apple
products in your home?
- Need on-site tutoring for your
mac, iPhone or iPod?

Aussie

Curtain Call

Claremont

Curtains
Swags & Tails
Pelmets
Romans
Shutters
All Blinds
Domestic
Commerical
FREE MEASURE & QUOTE

9240 8006 : 0408 569 515


Personalised Service - BEST PRICES

Diana Rice Interiors


Beautiful Curtains & Blinds

Curtains
Swags & Tails
Romans
Venetians
Timbers

Sheers
Pelmets
Rollers
Verticals
Shutters

Phone: 9245 5305 / 0433 337 467

D2R DRAFTING
PLANS DONE FAST
info@d2rdrafting.com.au

DRAFTING SERVICES

Tracks Supplied & Fitted


Re Fitted & Shutters.
Top Fix. Blinds at trade
prices. Reasonable Rates
25 + Yrs Experience

Ph: Peter 0417 772 230

CURTAIN CLEANING
t$VSUBJOUBLFEPXOSFIBOHTFSWJDFCZBSSBOHFNFOU
t;JQPGGTPGBDPWFSTBOEDVTIJPODPWFST
t%PPOBT#FETQSFBETBOE6OEFSMBZT

448 Stirling Highway, Cottesloe

Quick Click IT

DECKING

Phone Chris on 0417 990 396

Ian 0408 156 303

CURTAIN FITTER

9384 5656

Installation, Upgrades and


Repairs
Virus Removal
Networking
Email and Internet
Data Backup

at a competitive price

Over 25 years experience


in designing new homes,
extensions, patios & carports
COUNCIL SUBMISSIONS DONE
Call today for a FREE
consultation and site visit

0439 091 688

Email: jamesrslewis@me.com

Computer Headaches?
We can help

BUILDING PLANS

For an obligation free quote

MAC MAN CAN HELP!


CALL JAMES FOR ALL
YOUR APPLE NEEDS

Ph: 0417 928 439

PERTH HOME
DESIGNERS

A DECK ABOVE

Custom decks and pergolas.


Outdoor living specialist.

Don 040 116 7232


a-deck-above.com

Council Approval
Drafting
Extension &
Renovation

0411 329 003

Call Tony
NO JOB TOO SMALL !

OUT OF TOWN?
Read the entire

on the internet

www.postnewpapers.com.au
ALL THE NEWS
AND VIEWS

POST, September 5, 2015 Page 103

trades & services directory trades & services directory trades & services directory
DRAFTING &
DESIGN

ELECTRICIANS

A consultancy based
fee to discuss BCA
requirements and council
constraints for your
extension design.
Garage or even a
front fence. DA and BL
drawings can also be
produced for council.

0402 519 505

master architecture (uwa)

GRAY

Residential

RESIDENTIAL DESIGN
CONSULTANT
LUXURY NEW HOMES
ADDITIONS/EXTENSIONS
RETAINING/LANDSCAPES
POOLS/CABANAS

EC 7341

Extending and
need Council
Advice or a few
Design Ideas?

ELECTRICIANS

ALL ELECTRICAL WORK


LIGHTING DESIGN
LIGHT FITTINGS
GARDEN LIGHTING
POWER OUTLETS
HOT WATER UNITS
OVENS
SAFETY SWITCHES
TELEPHONE OUTLETS

Ph

0422 238 213

CREATIVE AND INNOVATIVE


20YRS EXPERIENCE
SPEAK TO JOHN DIRECTLY

0408 099 233

9381 5802
EMERGENCY SERVICE

m: 0421 699 954

Martin Sladen
ELECTRICAL

STEVE

MURPHYS
ELECTRICAL
9384 1163
ALL ELECTRICAL WORK
MAINTENANCE AND BREAKDOWN SERVICE
HOT WATER SYSTEMS & REPAIRS
OVENS & HOTPLATE REPAIRS
STOCKIST OF STOKES APPLIANCE PARTS
ELEMENTS, SWITCHES
APPLIANCE SALES AND REPAIRS
EXTENSIVE RANGE OF GLOBES AND TUBES

PH: 9384 9232

MIKE 0417 189 942

24/7 emergency service


All your domestic &
commercial electrical
services covered
Discounts if you book us
for more than one trade

0407 770 910

Electrical Contractor
All electrical work
Air con split system installer
Safety switches, smoke alarms
Renovations, rewiring
Power points, lights, fans
Maintenance, emergency callout

Grant 0433 749 858

Wembley Electrics

24 HOURS

t"MMFMFDUSJDBMXPSL
t3FXJSFT
t4BGFUZ4XJUDIFT
t4NPLFBMBSNT
1SPNQU3FMJBCMF4FSWJDFT

Phone 9221 3700

EC929

EC 3697

0412 955 633


A/H 9385 1443
Lic EC004241

ALL ELECTRICAL WORK

Denco Electrical Services


ENLIGHTENING YOUR DAY
All Electrical Work
'RPHVWLF&RPPHUFLDO
,QGXVWULDO
Professional & quality workmanship

Call Dennis 0450 672 717


Specialising in all electrical work
Quality workmanship

(&

FREE QUOTES & ADVICE

0418 912 451


MUIRS
6644

htcontractorsperth.com.au
All Areas

EC 8293

WEST COAST
CABLING SOLUTIONS

Power Points: Single/Couble,


Indoor/Outdoor
Lights: Down lights, Fluoros,
Garden lights
Fans: Ceiling fans & Exhaust fans
Renovations: Home, Ofce,
Bathroom, Kitchen
TV & Phone Points
Internet Cabling
Fault Finding
7 DAY/24HR EMERGENCY CALL OUT

NRK
Electrical EC 8576
ALL ELECTRICAL WORK
Maintenance and Fault Specialists
Repairs to Hot Water Systms
Telephone and Computer Cabling
After hours emergency repairs.

0422 626 719

Try the difference in customer service!


t"MMFMFDUSJDBMXPSL
t.BJOUFOBODFBOECSFBLEPXOT
t5FMFQIPOFBOEBOUFOOBDBCMJOH
t'BVMUmOEJOH
t)PUXBUFSTZTUFNBOEBQQMJBODFSFQBJST

CALL MICK

9384 7079 0412 779 947

OUT OF TOWN?

FREE QUOTES

0481 106 115

Read the entire

on the internet

www.postnewpapers.com.au

8FBSFGVMMZMJDFODFEBOEJOTVSFE

Sick of junk mail?


We will mail you a letterbox
etterbox
IL
NK MA
sticker FREE !
only
NO JU
Just phone the POST
on 9381 3088.

M: 0451 030 640


FIREWOOD

288A CAMBRIDGE ST, WEMBLEY

GARAGE DOORS

FLOORING

TIMBER FLOORS
Suppliers / Installers of

New & Used Flooring


Stagger cuts to additions
Repairs to existing boards
White ant damage
Skirting, Beading, 1/4 rounds

CALL JOHN

0412 229 200

Hardie & Colorbond


Fencing Specialist

QUALITY

PINE LAP, CLOSED


PICKET, AND
COLONIAL SPECIALIST
Ph: 9493 0344
0419 905 033
Fax: 9493 0355

Focus
FENCING
Specialists in Colorbond
Repairs Removals
Replacements
Installations
Call Adam

0424 101 026

FLOOR SANDING
Ring Joseph or Dino
for a Free Quote
on Your Flooring Needs.
Sanding, Sealing & Repairs
to all Timber Floors
to Your Satisfaction.
Ph: 9389 8903

0411 724 099

OBrien
Flooring

REPAIRS LAYING,
SANDING & FINISHING
Jimmy 0420 235 709
www.obrienflooring.com.au

SANDING & COATING


TIMBER FLOORS

Call Dave on
0412 187 585

www.sherwoodooring.com.au
Member of Australian Timber Flooring Association

Call your Local


Jim on 131 546
r$PMPSCPOE
r)BSEJGFODF
r3VSBM
r1JOFMBQ
r5JNCFS
r1PPM
r(BUFT
r$IBJO.FTI
r'FBUVSF'FODJOH
www.jimsfencing.net

-*$&/4&%"4#&4043&.07"-*454

0413 122 012


GARDENING

NIGELS GARDEN
MAINTENANCE
For complete care of your
garden with reliable service.
Regular or casual. Call Nigel

Member WA Timber Flooring Assoc.

T TI MBER
BUDGE
EST 1983
F-E-N-C-I-N-G

RANDELL HALL

0412 689 643

FENCING

BOSCH
FLOORSANDING
Sanding / coating and
Timber repairs
Full restoration services
AFTA member
All work guaranteed

FREE QUOTES

Call Jeff 0419 908 837

0407 166 177

NEDLANDS
GARDEN SERVICE
THE PERFECTIONISTS

* For Excellence in Garden Care


* Plant Selection & Planting
* Hort/Weed Control Spraying
* Expert Pruning and Espalier
* Professional advice
Specialising
DALKEITH TO MOSMANS
Phone Tony direct on:

0419 905 053

0423 153 677

woodlandstimberflooring.com

ALL LANDSCAPE AND


GARDEN SERVICES
Professional Garden
Maintenance Plans
Reticulation : Serviced
Repairs and Installation
Servicing the POST area since 1983.
Ph Mark Scrine. C. Hort

0417 093 578


9203 9985

Free Quotes at your convenience


Call or Email James

0409 889 679

or james@jcfencing.com.au
www.jcfencing.com.au

REPAIRS & REWIRE


WOOD & ALU. SCREENS
AND DOORS
NEW SCREENS & DOORS
BARRIER SCREENS
WHEEL REPAIRS

9384 4566
MOB 0412 770 881

Advantage Fencing Make extra cash


Specialists in Colorbond and
Gramline fencing and gates

Phone Jarod
0414 519 819
Free Quotes and Advice
Asbestos Removal Licence
Installation and Remove Old
Advantagefencing@hotmail.com

sell your unwanted


items in the POST
for only
8 words

$ 40

See inside back page for details

ALL GARDEN
MAINTENANCE
REG

ULAR
Pruning
Weeding
S ON
LY
Cleanups Mulching

Rob 0450 384 711

Gardening
and Landscaping
Transform your tired old garden into an oasis of
beauty Specialises in complete garden
transformation to suit all budgets. All aspects of
Landscaping Design & Construction. Residential
& Commercial. Garden maintenance
Lawn installing and repairing Specialised in
pool renovation Limestone and brick work
Retaining walls Colorbond fencing Supplying
trees, plants, soils, mulch, manure ... Irrigation
plan & installation Property maintenance High
pressure & Gutter cleaning Free quotation &
advice Guaranteed job quality

Call 0421 895 463 and 0432 999 400

MORE
THAN A MOW
GARDENING SERVICES
t(BSEFODMFBOVQT
t3FHVMBSHBSEFONBJOUFOBODF
t)FEHFUSJNNJOH
t5SFF-PQQJOH
t(BSEFOCFETNBEFDMFBOUJEZ
t.VMDIJOH
t'FSUJMJTJOHt3FUJDVMBUJPO

ALL ASPECTS OF GARDEN WORK

0413 016 555

GENERAL GARDEN
MAINTENANCE
r-BXONPXJOH 8FFEJOH
10-*$&
(BSEFO$MFBOVQ
$-&"3"/$&
r4VQQMZPG1MBOUT.VMDI
r1SVOJOH .PXJOHFUD
r(FOFSBM.BJOUFOBODF
 XFFLMZ GPSUIOJHIUMZ NPOUIMZ

r)JHI1SFTTVSF$MFBOJOHUP#SJDLXPSL 
1BUJPT %SJWFXBZT
r*OTUBMM.BJOUFOBODFPG1VNQT1POET

Indigo Painting
rDMFBOVQT
rHBSEFONBLFPWFST
rMBOETDBQJOH
rMJNFTUPOFXBMMT
rSFUJDVMBUJPO
The locals who arrive on time and
do the job properly

www.landscaperenewal.com.au

Roger Hill 0419 921 122

HUNTS GARDEN SERVICES

Garden
Maintenance
Have your garden maintained

All Garden Work.


Regular Maintenance.
Reliable & Meticulous
Ph Colin on

0414 959 309


THE
CLAREMONT
GARDENER
REGULAR GARDEN MAINTENANCE AND CLEANUPS.
ROSES AND COTTAGE
GARDENS A SPECIALITY
ALL AREAS
FOR PROMPT AND
PROFESSIONAL SERVICE
Phone MATTHEW
Matthew: 0414

710 110

Im talented, friendly 30 years


experience in your area and can
solve your plant selection probems.
Phone now nothing free but
great work.
Horticultural Cert.

0416 029 992 9381 5371


janragenovich@bigpond.com

LANDSCAPES 2000

FLYSCREENS

Mike Jones 0417 181 827


Nina Jones 0427 056 785

Peter 0439 930 966

Garden Makeovers
Select & Deliver Plants

Polishing & Re-Coating, ATFA


Member & Police Cleared

Garden Maintenance
Residential & Commercial
Design & Installation

email: wanaqa@bigpond.net.au

JAN RAGENOVICH

SANDING & VARNISHING

GARDENING

GARAGE DOORS
SUPPLY, INSTALL AND SERVICE
6XSSO\DQGLQVWDOODOOW\SHV
RIJDUDJHGRRUVDQGPRWRUV
VHFWLRQDOUROOHUHWF
3URIHVVLRQDOUHSDLUVRQDOOPDNHV
DQGPRGHOVRIJDUDJHGRRUVDQG
PRWRUV
,QGXVWULDODQG'RPHVWLFQRMRE
WRRELJRUWRRVPDOO
3URIHVVLRQDOUHOLDEOHVHUYLFH
KUVEUHDNGRZQVHUYLFH

FOR ADVICE PHONE JOHN

Subiaco based contractor


Rewires Safety switches
Power points

rob@allfencingperth.com.au

0413 415 845

Dry bush jarrah


white gum
mallee roots

FLOOR SANDING

Call 0403 968 164

Repairs that last French Polishing


- Spray Work - Stripping etc.
Ernest Palmer

SWANBOURNE WOOD YARD

BRIAN CLARK ELECTRICAL


INSTALLATION (Lic EC007548)

Good old fashion country service in the city

A-Z Electrical Service

4OUCHWOOD
2ESTORATIONS
Quality furniture restoration -

waimahaka@gmail.com

Colorbond Pinelap Jarrah


Asbestos Removal Fence Removal
Security Fencing Rural Fencing

ALL ELECTRICAL WORK


SAFETY SWITCHES SMOKE ALARMS HWS
BATHROOM HEATERS UPGRADE RENTALS

Gates, Fences, Pool Fences, Iron


Work, Safety Doors, Rolla Doors,
Windows and Colorbond Fences
E. aitolos69gmail.com

www.livingelectricswa.com.au

www.westernwiring.com.au
EC4634

24

7
D
A
Y
S

FURNITURE
RESTORATION

dave@westcoastcabling.com.au

Trusted & Reliable


Electricians

skilledelectrical@hotmail.com
Lic 003542

Mob: 0409 393 110


A/H 9336 6909

DAVE

Ask about energy savings


FREE QUOTES

0418956459 9444 0989

24 HR EMERGENCY SERVICE

Ph: 0419 907 502

EC8582

POWER POINTS, LIGHTS,


BATHROOM HEATERS,
SECURITY LIGHTS, TEL A
NTENNA, SW. BOARD AND
MAIN UPGRADE, REWIRING,
RENOVATION, SAFETY SWS ETC

REC 6541
Quality Electrical Work
LED Lighting Design & Conversion
RCDs & Smoke Alarms

9387 4401
0417 942 962

0433 019 676

FENCING

0407 088 082

Twinside Retaining Walls


Gates & Asbestos Removal
No Job Too Difficult
Experienced Contractor

LIC EC5706

Skilled Electrical
All Electrical Work

HOURS

Mention this
ad and receive
10% discount

Phone Richard King


0417 956 575

MENTION THIS AD FOR 10%


DISCOUNT. ASK FOR DETAILS
PH: PETER
A/H: 9302

EVERYTHING

Electrical

EC008394 L 048187 AU 20388

129 CLAREMONT CRESCENT, SWANBOURNE


ELECTRICAL CONTRACTORS & RETAILERS

ALL
HRS

Electrical, Solar Power


Renovations, Plumbing
& Gas, Air-Conditioning
One Stop
Tradesman Shop

Call or visit

0412 922
648 0412 924 134
www.cablenet.com.au

Visit our Facebook page

STEPHEN DEW

ALL DOMESTIC - ELECTRICAL


WORK LIGHTING, POWER,
UPGRADES, GARDEN LIGHTING

24 HOUR 7 DAYS

RAY

9314 2407
0412 300 363

0407 997 049

Tel 0411 123 769

Lic No EC 3474

All electrical work


Maintenance & breakdown
specialists
All safety switches Lic EC4326
Repairs to hot water systems
Everdure-Electra-Rheem-Solahart
Stove & oven repairs
Computer & Telephone Cabling

Contact Tony

EC8097

Specialising in all
commercial and domestic
electrical installations
and maintenance ...
... servicing all western
suburb areas

All electrical work


MAINTENANCE and
BREAKDOWN Mt Claremont
and surrounding areas

Handyman Service

FREE QUOTE

EC 005680

Mintech Electrical

Roberts
Renovations &

r.BJOUFOBODFBOE#SFBLEPXO4FSWJDF
r)PU8BUFS4ZTUFNT
r0WFOT)PUQMBUFT
r%PNFTUJDr$PNNFSDJBM
r*OTUBMMBUJPO
r(BSEFO-JHIUJOH
r'BVMU'JOEJOH3FXJSFT

EC00475

Residential - Commercial - Industrial


All electrical work
Serice and repair evaporative air
conditioners
Split system air conditioning installations
High Voltage specialists

www.electricbluewa.com.au

Lic ec 8358

ELECTRICIANS

YOUR LOCAL ELECTRICIAN


FOR ALL YOUR ELECTRICAL NEEDS

Phil:

Floreat

FROM CONCEPT TO CONTRACT


ALL COUNCIL/BUILD APPROVALS
DETAILED SPECIFICATIONS

ELECTRIC BLUE

ELECTRICIANS

25 yrs experience in
Landscaping
& Garden
Ful
Maintenance.
Specialising in
l
y
Bo& topiaries
hedging

ked
PH GEORGE
0408 851 901

FULbyLa professonal
Y BO
OKED

Ring Tony on 0413 765 452


Roses need pruning?
WE CAN HELP

weeding women
Hard working,meticulous gardeners
Pensioner discounts available

1800 24 74 84

weedingwomen.com.au

Greenkeepers Delight
Garden Care and
Lawn Mowing Service

Services provided:
r-BXO3FQBJST3FOPWBUJPO
r-JRVJE(SBOVMBS'FSUJMJTJOH
r8FFE1FTU$POUSPM
r)FEHF5SJNNJOH1SVOJOH
r1SPCMFN$POTVMUJOH

Phone Glenn
043 892 8190
Qualified
Greenkeeper

Garden clean-ups
t)FEHJOHt3PTFQSVOJOH
t-BXONPXJOHt/FXUVSG
t3FUJDVMBUJPOt.VMDIJOH
t3FQBJST
All Rubbish Removed
SENIORS RATES

GARDENSCAPES
Call now for
r-BXO(BSEFO$BSF
r1SVOJOH1MBOUJOH
r1FTU%JTFBTF$POUSPM
r(BSEFO3FOPWBUJPO
r$MFBOVQT
r.PJTUVSF3FUFOUJPO1SPHSBNNFT
4FSWJDFECZ2VBMJFE
)PSUJDVMUVSJTUT

Call Brad on 04EVERGROW

(0438 374 769)

Email: info@evergrow.com.au

(SFH 0409

597 014

All
Garden Work
Lawns, Hedges, Roses, Trees pruned,
Weeds, Council pickups, Vacant blocks
cleaned and maintained. Make overs.
Reliable, Competitive rates
Good References.
Keep this cutting on your Fridge

Text or phone Theo

0429 880 004

Page 104 POST, September 5, 2015

trades & services directory trades & services directory trades & services directory
GARDENING

GARDENING

Prompt Gutters

B.J.s Garden Maintenance

The Guttering Specialist

r(BSEFO$MFBOVQT
r8FFE1FTU$POUSPM
r1SVOJOH)FEHJOH
r3VCCJTI3FNPWBM.VMDIJOH

0428 792 042

1I#FO

LEAF IT TO US
Gardening Service
r)FEHF$VUUJOH
r5SFF1SVOJOH
r.VMDITVQQMJFEBOE
EFMJWFSFE
r.BKPSHBSEFODMFBOVQT
r(BSEFONUDFQSPHSBNT
ZFBSTFYQFSJFODF
'6--:*/463&%
1I1BVM 0417 977 910

Cambridge
Gardening
Services
Yard Clean-ups
Small-medium
sized tree lopping
Rubbish Removal
Lawns
Hedge trimming

Call

Roberts
0421
997 585
Renovations &
Handyman Service

SPECIALIST
GARDENER
Now taking on new clients

TIM LYNCH
Cert. Hort. B.Bus

ADVANCED GARDENING
SERVICES

0403 010 212

tim-lynch@iinet.net.au
www.advancedgardeningservices.com.au

VALUE
TRUST
RELIABILITY
30 Years serving the
Western Suburbs
Garden Renovations
and Maintenance

08 9384 9555
admin@mclgroup.com.au
www.mclgroup.com.au
(20% off your rst
service if you say
you found us in
The Post!)

GARDEN CLEAN UPS


WEEDING
MULCHING
PRUNING
PLANT CARE & ADVICE

0435 510 087

0429 809 357

JOGP!HBSEFOJOHTFSWJDFTXBDPN
XXXHBSEFOJOHTFSWJDFTXBDPN

Reliable
Gardener
r$PNQFUJUJWF3BUFT
r(BSEFO$MFBOVQT
r8FFEJOH1SVOJOH
r(VUUFS$MFBOJOH
r3VCCJTI3FNPWBM
Call Mike Today on

0408 335 461

0481 374 143

GARDEN BAGS

LITTER SACK
Garden Refuse
Bags
Regular Service
for Business &
Home Collections
Ph: Clif

Hill 9307 3906

Glass repairs,
shower screens, doors
and windows, pet doors
www.freshwaterglass.com.au

Ph 0418 944 590

BALCATTA
GLASS
Glass Repair
9240 4422 All Hours
188 Balcatta Road, Balcatta
(opposite Bunnings)

GLASS and MIRROR


CUT TO SIZE
WHILE YOU WAIT
GMA 95-12-005F

FLOREAT GLASS

+ GLASS REPAIRS +

PH: 9383 9334


PENSIONER DISCOUNTS

MUIRS

ANGUSS GARDENING
Gardening Clean-ups
Mulching Fertilising
Rubbish Removal
Fully Insured. Phone Angus

0437 712 039


or Rosie 08 9381 5454

Adelines Essential Organic Garden Care


Landscaping & Design
All garden maintenance
Hydration & Fertilizing

ALL GLASS REPAIRS


General glazing Mirrors
Pet doors Tabletops
Frameless showerscreens
Energy efficient glazing
Security glazing Shelves

Mob: 0407 933 959

Richards

9336 2615

Domestic and Commercial


Total Lawn and Garden
Care Tree Lopping
Landscaping
Property Maintenance

Mobile: 0414 080 753


Northern Suburbs. W.A.

ROOTS AND ALL


Garden Maintenance
All aspects of garden maintenance
Ongoing or one off maintenance
Fully qualified and insured
Book now for winter pruning
Ph: Chad 0407 995 277

Gutters & Downpipes


100% Guarantee
Ask about our RUST PROOF option with

25 Year Warranty
Professional & Reliable
Colorbond, Zincalume &
Aluminium
No job too big or too small
FREE QUOTES
Job done right ... first Time!

Call Shannon
0413 243 006

info@smittysgutters.com

Gutters &
Downpipes
BRIAN WARD
Free Quotes
9341 7631

Ph Denis 0418 898 893


9304 1321

Cornerstone

Gutters & roong


FREE QUOTES

0402 432 437

SPECIALISING IN ALL YOUR


ROOF PLUMBING NEEDS!

r(VUUFS*OTUBMMBUJPO
r%PXOQJQFT
r3FSPPOH3PPG3FTUPSBUJPO
r'MBTIJOH
r3PPG-FBLT
r3JEHFDBQQJOH
r(VUUFS(VBSE
r3VTU5SFBUNFOUT
www.cornerstonegutters.com

GUTTER CLEANING

1R0HVV'RZQ3LSHV&OHDUHG
*XWWHU*XDUG,QVWDOOHG
7UHH/RSSLQJ5RRI5HSDLUV

Angus 0403 758 242

Affordable Vacuum Gutter Cleaning


Professional. Reliable.
Comprehensive insurance cover.
Fully roof-safety trained.
For an obligation-free quote call
or book online at
www.guttervac.com.au

Gutter Cleaning
Downpipes flushed, roofs cleaned
of debris from $99.00
Also high pressure cleaning

Jack 0412 986 151


9387 4442

Call STEVE 9242


Mob 0407 788

8923
272

The NEDLANDS handyman


(and surrounding suburbs)

All those jobs your husband wont


or cant do. Picture hanging,
blinds, mirrors, gates, flyscreens,
cupboard/drawer repair, broken
sash cords replaced.
Police Clearance

BERT 0403 917 935

One Company All Trades


General house repairs
and maintenance
We carry out all household
maintenance as well as specialty
services - Electrical, Plumbing,
Gas Fitting, Painting, Plastering,
Tiling & Carpentry
www.tlc-perth.com

9284 0165
info@tlc-perth.com

t1JDUVSFIBOHJOHt1BJOUUPVDIVQT
t3PPGSFQBJSt(VUUFSDMFBOJOH
t'MZTDSFFOTt4IFMWJOH
t'MBU1BDLTt(BUFSFQBJS
t4BTIDPSETt%PPSTBOE-PDLT
Skilful Solutions All Jobs
DAVID

9383 9394/0408 866 787


Your home is your castle ...
keep it that way!
Call us for fast, clean, professional:
Carpentry
Painting
Installation
Pergolas
Decking
Gates
Timber fences
All home maintenance
Call Simon 0419 925 452

Cambridge
Handyman
0419 925 452

JOHNS HOME
MAINTENANCE

For all your home maintenance and


timber decking call John for fast and
reliable services

0421 809 872

THE FIXER

HOME & GARDEN


MAINTENANCE & REPAIRS
ALL ODD JOBS

Specialised Outdoor Services

GUTTERING
REPLACE your
gutters NOW

Gutter / Downpipe Clean


Free Roof Report
All Maintenance

Have your gutters, flashings and box


gutters installed correctly.
Many roofs flood because of incorrect fitting.
Ph VLASI now for a free inspection & quote.
Over 20 years experience.

www.sos-services.com.au

0419 927 224, 9245 2034

Pensioner Discount / Insured

Advertise your
goods in the

NO MESS GUTTER
CLEANING

08 9433 1077

Experienced Reliable
Ph: Seb

0410 089 830

Our quality services will put


a smile on your face
NATIONAL POLICE CHECKED,
CURRENT INSURANCES

Mob: 0416 932 432

buildings.
Give us a call today.
No job too large or small.
We can:
t Fix walls windows and tiled

areas
t%PPSTBOEnPPST
t1BUDIBOEQBJOUXBMMTBOE
ceilngs
t#VJMEBOESFQBJSBMMUZQFTPG
fences and retaining walls
t%FUFDUBOEmYXBUFSMFBLT
t'MBUQBDLGVSOJUVSFBTTFNCMZ
t1JDUVSFTIVOHBTXFMM
t1SPWJEFFNFSHFODZSFTQPOTF
cleaning and repair
t#BUISPPN LJUDIFOBOE
MBVOESZNBLFPWFST

For a free quote Phone


Tony 0468 484 382 or
1300 788 714

.BSLt

Qualified tradesmen in the building


industry for over 25 years.
I only provide quality maintenance
services ... on time and without fuss.
CALL FRANK FOR A
FREE QUOTE!

0418 919 312

Police cleared Reg Business Fully Insured

4 Vaucluse Ave
Claremont

Specialists in high pressure cleaning

Specialists
in all large and small
landscaping projects

Roofs Driveways
Cleaning of all surfaces
Also sealing of surfaces
Steve 0410

033 343
Manu 0435 611 381
FREE QUOTE, FULLY INSURED

HOME IMPROVEMENTS

Bobcat work Paving


Lawns
Planting
Retic
Lighting
Limestone walls

Phone Peter Harper

0412 917 818 9384 9224

Rejuvenate
your
Tired Garden
One Company All Trades
We are the HOME
IMPROVEMENT experts
t)PNFSFOPWBUJPOT
t,JUDIFO #BUISPPN
 -BVOESZVQHSBEFT
t1SFTBMFSFTUPSBUJPOT
t )BOEZNBOTFSWJDFT
t "MM*OTVSBODFXPSLT
www.tlc-perth.com

9284 0165
info@tlc-perth.com

HOT WATER
SYSTEM

 Retention & Removal of


Existing Foliage. Reticulation upgrades
 Plant Selection & Design Service
 $5,000 Budget - I have ideas
letsdoitlandscaping.com.au
email + ideas on web site

Ph Andrew 0418 915 881


Gradient Landscapes
Working with you to create perfection
Paving
Concreting
Reticulation
Retaining Walls
Garden Preparation
Maintenance
Decks and Pergolas
All aspects of landscaping
Free quotes

Call Leon on 0417

049 923

Office

9387 2339

Mobile 0418 941 571


Fax 9387 8581

ALL AREAS - 24 HOURS


General Maintenance
Emergency Repairs Blockages
Hot Water Systems
PL6669
GL7760 and All Gas Services

r&45r

r(VUUFS$MFBOJOH
r'MZXJSFSFQBJST
r1JDUVSFIBOHJOH
r(BSEFODMFBOVQT

Jesse 0421 650 806

UBUFTUSFFUCSPUIFST!HNBJMDPN

+EXPERIENCED HANDYMAN+
Quality Work + PROMPT Service
Carpentry - Doors, Windows, Skirtings, Floors + Decks
Plastering, patching + making good
All home maintenance jobs considered
Call Rod:

0418 924 016

QUALIFIED TRADESMAN
Roofing, Flashing
Gutters Installed OR Cleaned
Tiling etc.
All Handyman Jobs

0423 511 303

White Knight Repairs


& Home Maintenance
Are you looking for:
Repairs and Carpentry
Decking, Pergolas and Gazebos
Home maintenance jobs - Interior
& Exterior
Painting, Plastering & Crown
moulding
Quality work - with attention to detail

KITCHENS

EUROMART
KITCHENS
Complete kitchen and wet
area renovations
Alterations for
dishwashers/ovens etc
Installation of flatpack
kitchens and quality
kitchens made in Germany
Decking
German craftsman, 25 years experience

9245 3303

0400 424 357

One Company All Trades


Perth TLC Group can
project manage your kitchen
improvement/renovation
www.tlc-perth.com

9284 0165

info@tlc-perth.com
Have a look at our main ad in the Home
Improvement section

Innovative landscape design,


construction and maintenance.
Expert in native and waterwise
gardens. Highly qualified team
of professionals with 25+ years
experience.

Indigo Painting

Matt Siomos, B.Sc (Botany),


horticulturalist, 0408 384 542
Teik Oh, B.Sc (Environmental Sc.),
0415 170 135

Good old fashioned,


friendly and
professional
service
All aspects of landscaping
from maintenance to
limestone retaining walls
Small team to create
beautiful gardens at the
right price

Free Quotes
Call Mike Kuba

0413 015 808

LANDSCAPING

Call Scott on 9386 6138


or 0417 461 087

Property Maintenance
and Handyman Services
Repairs, Flat Pack Furniture,
Doors, Locks.

Trevor 0458

796 455

HIGH PRESSURE
CLEANING

29 Walter St
Claremont

Est 1982

www.ibislandscapes.com.au

9383 2915
0412 946 476

Design & Construction of


your outdoor living area
r$3&"5*7&1"7*/(
r450/&."40/
r8"5&3'&"563&4
r8"5&38*4&
r.*/*."-*45
r*33*("5*0/
r;&/

Damian 0403 126 970

Enviroblast

JOEL IRRIGATION &


LANDSCAPES PTY.
LTD.

High pressure cleaning of


paved areas
driveways
pool areas
tennis courts

0415 860 884


Stevens

Painting
Doors and locks
Paving
Repair reticulation
Gutter cleaning
Kitchen cupboards
Storage solutions
Built in wardrobes

Industrial High Pressure

RELIABLE
t(FOFSBMIPNFSFQBJSTBOE
.BJOUFOBODFt2VBMJUZXPSLNBOTIJQ
tZFBSTFYQFSJFODF

Love Your Home

EST 81

SKILLED HANDYMAN

Vacuum Recovery means NO MESS


Call Geoff for a FREE QUOTE

ODD JOBS MY SPECIALITY

LANDSCAPING

www.thepropertyserviceswizards.com.au

davidfixer@iinet.net.au

Quality Maintenance
Services

HIGH PRESSURE
CLEANING

We provide huge array of


services for home, ofce or

HANDY SOL
Brickpaving, Painting,
Picture Hanging, Irrigation,
Gates, Fencing, Welding
All General Handyman Jobs

Pressure Cleaning Garden Cleanups


Lawns Laid Retic Paving Repairs
Painting - Pergolas, Fences Gates,
Fences & Decking Repairs
Gutter Cleaning Soakwells Installed
Inside Work Driveways Painted

Free Quote

Classifieds

Pre-sale Home Detailing


Rental Property Services
General Repairs
Handyman for Home or Office
All Timber Joinery
Insured and Police Cleared

A Better
Handyman Service

Call Kevin Ph: Hme 9381 2080


Mob 0419 907 986

For household repairs eg house and


fence painting, small tiling or
brickpaving areas, gardening, house
cleaning, cleaning gutters etc.

SKILLED

GUTTERS and/or
windows CLEANED
TREE PRUNING

SAME DAY SERVICE


SUPPLY & INSTAL
GUTTERGUARD
DISCOUNT FOR SENIORS

Handyman Service

THE PROPERTY
SERVICES WIZARDS

0407 193 606

0414 011 220


GUTTER CLEANING
& WINDOW CLEANING
SPECIALIST

CALAUTTI

Call Charlie on 0401 019 975

GUTTER
CLEANING

POST AREA SPECIALIST 20 YEARS


DOWNPIPES CLEARED
LEAKS AND OVERFLOWS SORTED
FREE QUOTES PENSIONER DISCOUNTS
PROMPT SERVICE
Phone
MARTIN

HANDYMAN

9448 8486
PROPERTY MAINTENANCE

1300 654 253 or 0457 077 536

149 South Terrace,


Fremantle(CNR PRICE ST)

Better Lawns & Gardens

0433 210 028

Esmes

For all your Gardening


needs call

Backyards cleared, tree lopping,


Brickwork, pavers cleaned and sealed.
General repairs and maintenance
Heavy work done, reasonable
and reliable.
PHONE DAVID (Jocks Retired)

Email: promptgutters@gmail.com

guard, soakwells, small roofing


repairs, high pressure cleaning.
Free Quotes.
Pens. Disc. No two storeys.

Gardening Service

HANDYMAN

ADAM CLARKE

D.M.
& J.M. Rhodes
Gutters & Downpipes, gutter

Freshwater Glass
r"MMHBSEFOTFSWJDFT
r3FHVMBSPSPOFPGG
r8BTUFSFNPWFE

Gutters &
Downpipes
Colorbond or
Zincalume
Fully Insured
All work
guaranteed

www.loraflora.com

GLASS

Great value, professional care

GUTTERING

Since 1982

r /Fw Landscape to suit every budget.


r 3PMMPO5VSG
r 3FUJDVMBUJPO#PSFT
r 3FTJEFOUJBM$PNNFSDJBM

9386 3183

-PDI4USFFU /FEMBOET

HIGH PRESSURE CLEANING SERVICE

Specialising in roofs, driveways,


courtyards, pool areas, retaining
walls etc. Surface sealing also.
No job too large or small, free quote.

0427 005 724

ALL THE NEWS


AND VIEWS

ALL LANDSCAPE AND


GARDEN SERVICES
Professional Garden
Maintenance Plans
Reticulation : Serviced
Repairs and Installation
Servicing the POST area since 1983.
Ph Mark Scrine. C. Hort

0417 093 578


9203 9985

www.landscaperenewal.com.au

t-BOETDBQF%FTJHOBOE
$POTUSVDUJPOt3FUJDVMBUJPO
t/FX-BXOTt.VMDIJOH
t1MBOUJOHBOENVDINPSF
$BMM-VLFPO

0401 372 277


www.lukeslandscaping.com.au

POST, September 5, 2015 Page 105

trades & services directory trades & services directory trades & services directory
Locksmiths
Guaranteed Same
Day Service 20 years exp

Honest and Reliable

9381 5454
0437 712 039

Ph Angus

0412 153 846


7 DAYS PER WEEK
www.sheehanlocksmith.com.au

Free Messure & Quote

Phone: 9209 2669

www.greenplanetgrass.com.au

KEVIN SHEEHAN
Master Locksmith
Security Consultant
Glad to be of Service

- Lawnmowing - Edging
Brett Campbell (Proprietor)

Mobile 0418 921 418

email: brettcam60@hotmail.com

SEAMUS HOME SERVICES

LAWNMOWING SERVICES

0450 225 113


6143 8721

9Specialist in pre-house sale renovation


9Retic
9Basic hard-scaping
9Turf laying
9Earth works
9Plant selection 9Soil amendment

Precision
Edge Mowing

Save money using a small


operator with less overheads!

LAWNS & GARDENS


Call
Rob

PH: Oliver Calnan

0409 373 685

EDDIES
MOWING

LAUNDROBAR

JOLIMONT LAUNDROBAR
Sheilas Washing, Ironing
and Alterations
2/24 CARDIGAN TCE

ABN 72 910 338 191

9387 8641
Handyman
Service

Mat 0409 930 924

Domestic Laundry,
Service Washes
Pickup & Deliver

LEADLIGHT

WINTER SPECIAL
Doonas & Blankets

J.B. Leadlights

9383 9252

Repairs Restorations
Windows, Doors & Cabinets
New Commissions
JOHN BURROWS

EDDIES LAWN AERATION

9284 5638
0419 966 945

LAWN CARE SPECIALISTS

Call Eddie

LIMESTONE
Reg 1964

Specialising in:
Limestone walls,
Feature walls, Arches,
Steps, Retaining walls,
Restoration,
TIM ROBERTS

Wintergrass and Weedspray


Licensed Operator

Simon 0413

744 752

25 YEARS EXPERIENCE

Pristine Grass
& Gardens

9245 2550
0418 299 524

Ph/Fax:
M:

Lawn Weedspray(Licensed)
and Fertilising

Andrew 0466

PAINTING

PAINTING
A.J. BROWNING

Lawn Weed Spraying

PAINTING
PAPER HANGING
All work guaranteed
REGD PAINTER

1782 or 9388 1237

PAINTING SPECIAL
For all your internal/external
painting requirements.
For your highest quality job at a
very special price, phone

CLIVE 9383 3412


0447 433 412
Reg. No. 4280

FLOREAT & ALL


WESTERN SUBURBS
Painter - Decorators
30 years experience

Old fashioned workmanship,


HIGH QUALITY FINISH
References - prompt services. Free
quotes. All work guaranteed. No job
too big or small. Reg. painter.

9206 4504
CALL MICK 0434 835 728
or GAVIN 0415 385 501

DON McNALLY
20 years experience

INTERIOR & EXTERIOR

ROOMS FROM $250


REPAINTING
Reg.
SPECIALIST 3476

182 051

Painters Registration No. 5890

RESIDENTIAL & COMMERCIAL


PAINTERS & DECORATORS

MOW IT & MORE


Lawn Mowing Servicing
Mosman
Nedlands,
FULPark,
LY Cottesloe,
BOO areas
Dalkeith and
surrounding

KE

D
784 094
Atlas Lawn Services
Trevor 0412

Est 1985
COMMERCIAL & DOMESTIC
Steve

0411 223 637


David
0411 223 644

James Limestone
Restoration

Limestone RESTORATION
Limestone REPOINTING
Limestone TINTING
Limestone CAPPING
Rising DAMP
Brick REPLACEMENT
Brick TINTING
Brick MORTAR REPAIRS
Tuckpointing
Call James for your free quote

0400 219 056

BUDGET

MORE THAN A MOW LIMESTONE


LAWNMOWING SERVICE
r-BXONPXJOH
r&EHJOH
r8IJQQFSJOH
r'FSUJMJTJOH
r8FUUJOH"HFOUT
ZFBSTFYQFSJFODF
Quick, Reliable, Professional
Free Quotes - Call Darren today

ALL ASPECTS

INCLUDING BOBCAT WORK


SMALL AND LARGE JOBS
7RSTXDOLW\ZRUNDWDIIRUGDEOHUDWHV
IUHHTXRWHV
DQG<(6ZHDUHFOHDQDQGWLG\

CALL 0417 922 078

041 301 6555

NATURALISTE
STONE

Mow d Lawn

Stonework Specialists

Garden Services
Andy
04 900 405 20

Also:
Perth & South West
Contact Matthew Warren

0417 965 115

www.naturalistestone.com.au

SPECIALISING IN
RESTORATION OF PERIOD
HOMES

MOBILE 0432 322 026


COMMERCIAL & RETAIL

F: 9444 7863

BAGOT ROAD, SUBIACO

www.precisepainting.net.au

Subiaco
Painting Service
Small Jobs welcome!!!
Commercial / Residential

Ph/Fax 9382 3278


Mobile 0438 755 877

Call us on
9381 3088
to advertise
in the

Trades &
Services

0400 440 272


Reg No. 6791

Saari Quality
Painting & Decorating
European Craftsman
Very Reasonable
Reg: 6952
Rates

Reijo 0411 610 246


CAPITAL
PAINTING&
DECORATING

5 663

0420 44

r*OUFSJPSr&YUFSJPSr3FTJEFOUJBM
r$PNNFSJDBMr4QSBZ1BJOUJOH
r8BMMQBQFS*OTUBMMBUJPO
r0WFS:FBST&YQFSJFODF

Dirk Warburton 9407 9103


www.prestigepaintingwa.com.au

30 years experience

Painter & Decorator

0451 478 078

EFFECTIVE AND SAFE


ALL DOMESTIC PESTS
TERMITE INSPECTIONS
& REPORTS

COTTESLOE
PEST CONTROL
TERMITE & TIMBER PEST
INSPECTIONS

TO AUSTRALIAN STANDARD
Spot Termite Treatment
Rats Spiders Ants
MOBILE CREDIT/EFTPOS FACILITIES
Fully Insured - Health Lic No 43

ALL WORK
GUARANTEED

THOMPSONS
PEST CONTROL

Termite Inspections Ants


Spiders Cockroaches
Weed control Silver Fish
General Pest Control
$145 external. Free Quotes.

NO CALL-OUT
CHARGE
All plumbing repairs
Leaks
Ful Blockages
lywater
Hot
Bo units
oke
LOCAL TRADESMAN
Direct

d
0418 904 332

Gorey
Plumbing
Services

Phone Peter TODAY

6XELDFR&ODUHPRQW1HGODQGV
3HSSHUPLQW*URYH'DONHLWK
&LW\%HDFKDOODUHDVLQ
:HVWHUQ6XEXUEV
3/*/

AMP PLUMBING & GAS


YOUR LOCAL LICENSED PLUMBERS

PLASTERING

GAS Installation & Repair

Small renovations.
Patching all surfaces.
MIKE KELLEY

9204 4108
0408 908 683

BAMICA PAINTING
Rego: 8026

RENOVATION SPECIALIST

r3FTJEFOUJBM
r$PNNFSDJBM
r*OUFSJPS
r&YUFSJPS

All internal and external finishes


No Job Too Small
Over 20 years Experience
CALL TONY FOR
FREE QUOTE & ADVICE

IMMEDIATE START
2VBMJUZXPSL3FMJBCMF
-BSHFPS4NBMM+PC
$BMM"MFYUPEBZUPHFUZPVS
FREE QUOTE

0415 951 865


9300 5382

0423 620 032

0407 381 727


0DLQWHQDQFH6SHFLDOLVW
+RW &ROG:DWHU6HUYLFHV
%DWKURRP5HQRYDWLRQV
/LFHQVHG*DV)LWWHU
6HZHU%ORFNDJHV 
'UDLQDJH:RUNV
5RRI:RUN

Mob: 0433 288 164

PLASTERER AVAILABLE

Renovations, Internal
and Ext Sand Render

7am - 11pm 7 DAYS EMERGENCY


Electronic Burst Pipe Detection
Power Drain Cleaning, Blockages
ALL TYPES OF PLUMBING WORK
Pensioners Discount, Free Quotes

Freecall 1800 102 888


9384 0202
9384 1030
9389 8989 0419 950 430
MASTER PLUMBER
Lic. PL 5041

SEC. Lic. 4263

Skilled Plumbing &


Gas Services (local)
Burst pipes Blocked drains
Installation Repairs
Renovations
Pensioners Discount

9384 0877

9388 6299

Indigo Painting
PL 5580

Gas 4784

ALSO SMALL JOBS


PATCHING AND REPAIRS
22 yrs Westn Sub Exp.

P&N

Painting Services
Reg No. 5309
Specialising in

FREE QUOTES 7 DAYS


Your satisfaction is
our guarantee

+Domestic +Commercial
+Interior + Exterior
+Roof Painting
+ Any size jobs

Call JAY: 0410 413 327

FREE QUOTE

Ph: Jorge 0400 748


or 9386 3953

076

Wall Plastering &


Ceiling Repairs

Including all aspects of solid wall


plastering and plaster boarding.
More than fifteen years experience.

Call Travis 0468 789 879

NO CALL OUT FEE

HOT WATER
FAST

ELLIS PLASTERING  H.W.S. Gas/Solar


ALL AREAS
Free quotes will happily
take on little jobs

 Blocked Drains
40 Years Experience
 Toilets & Pans
Your Local Master Painter paintingservice1999@gmail.com
Pete The Plasterer  Cistern Repairs + New
Victoria Sky
Jeff Bond
 Water Leaks
Painting Services
Reg# 4004
20 YEARS EXPERIENCE
0405 069 500
High Quality Work Interior
 Water Filters
 Proficient in all
Exterior Small Jobs welcome
General Painting
First Class Materials used
PLASTERING/RENDERING  Local Plumber
Plus Renovating + Spraying Roofs.
 Honest, Reliable, Clean
 Handyman service

Ph: 0418 850 750


Attention To Detail Makes
All The Difference

A PLUS PAINTING
& SERVICES

CARING FOR SUBIACOS HERITAGE

Reg No 3468

MUIRS

MICHAEL ELLIS
PAINTING

Paul Stratton

9454 7711
0411 229 312

Mob: 0451 901 919


Ph: 9388 8055

0416 121 932

30 YRS EXPERIENCE
QUALITY WORK
FREE QUOTES / ADVICE

0410 478 246

LAWN MOWING

Phone
WARREN
on

capitalpaintingdecorating@yahoo.com.au

Broadleaf Bindi and Clover


Fully licenced and insured
call Adri
FOR FREE QUOTE

0431 200 866

COASTAL COLOURS
as your preferred painting
contractor.
With the highest level of
commnunication and
professional service,
I will complete the work in
agreed time frame and terms,
My goal is your happiness,
your peace of mind and your
referral.

PBL941

Lic. 2216 (B.Sc)

9384 7870

Commercial / Residential
Interior/ Exterior
High quality & low cost

Free
quote DAVID

MIKE STOKES

ANNUAL & PRE-PURCHASE

REG 7800

ALL HOURS
www.citygrouppainting.com.au

PLUMBING

Family Business Providing Local


Services Since 1958

Master Painting
Services

0418 914 041

please consider

Reg. No. 4989

Mob 0417

Mobile 0404 739 991

reg: 7822

WHEN ORGANISING
YOUR NEXT
PAINTING PROJECT,

HIGH QUALITY LOW COST!

113 620

r(SFBURVBMJUZ
r/PKPCUPPCJHPSTNBMM
r1FSTPOBMJTFE BGGPSEBCMFTFSWJDF
r'VMMZUSBJOFE SFHJTUFSFEFYQFSJFODFE
r-PDBMMZPXOFECVTJOFTT

TOM

REG 7089

Grounds
& Surrounds
Lawncare & Garden Maintenance

Roberts Limestone
Building Co.

Rego 8057

20 Years Exp - Free Quotes

0409 086 497

Ring 9381

Phone Jack for a


free, no obligation
quote

0499 874 988

Stirling Hwy, North Fremantle


/RFDO%XVLQHVV
'D\6HUYLFH
6HFXULW\/LFHQVH
3URPSW6HUYLFH

FREE QUOTES

4/115 Birkdale St Floreat (Cnr Cambridge)

By employing the services


of
CityGroup
Painting
& Decorating
you
are
guaranteed only the highest
standards of professional
service & communication.
Your work will be completed
by the owners of the
business and full-time team
members. We do not subcontract your work under
any circumstances.
You pay only once you
are satisfied the work
is proceeding to your
satisfaction.
Reg. No. 5298

PEST CONTROL

ENVIRO-CARE PEST
SERVICES

How to Get Your Painting


Completed Right The
First Time Guaranteed.

FREMANTLE
LOCK SERVICE

Lawn Mowing
Verti Mowing
Fertilising
Fully Insured

Roberts
Renovations &

0425 551 233


9381 6996

www.lockstock.com.au

0425 551 233


9381 6996 Reg 1964

OPEN 7 DAYS A WEEK


7am-8.30pm
Bag Wash, Soap Machine
and Drycleaning

LAWN CARE

7 Day Service

Ph: 6350 8500

All Western Suburbs

(near Hay, Jersey lights)

CAMBRIDGE LAUNDRY

0400 977 610

X Home X Office X Car

Reg. No. 3511

Creating your vision from design


to construction

Police Clearance, Fully Insured & Free Quotes

YOUR WESTERN
SUBURBS LOCKSMITH

PAINTING

GAS 532

Pol Lic SG 15935


ABN 22337056071

ANGUSS

Lawnmowing and
Gardening Service
Making Life Easy
Artificial Lawn
Environmentally Friendly
Australian Made

PAINTING

PL 1735

LOCKSMITH

Reg 7824

LAWN MOWING

Residential
Commercial
Interior
Reg # 6263
Exterior
IMMEDIATE START
Free Quotes
Call Fred

Mob: 0413 235 163


Phone: 9206 5331
Fax: 9206 5337

Public Liability Insurance $10,000,000

Phone: SEB

0410 089 830Reg No.


6113 6519 7402

PENGUIN

Reg 6621

LANDSCAPING

Specialist in plastering internal


feature brick and outside render
NO JOB TOO SMALL
35 years experience

Call Peter 0412 802 392


or 9330 5771

PLUMBING

PAINTING & DECORATING SERVICES

Commercial & Residential


Internal & External New Homes
Repainting Free Quotes
100% Customer Satisfaction
Guaranteed!

Jerry P: 9404 5706


M: 0421 477 899

PL.16

PLUMBING & GAS

penguin.painting@yahoo.com.au

Call us now
9387 3081

PAINTING &
DECORATING

0418 926 705

Make extra cash


ADARNA PAINTING
sell your unwanted
& DECORATING
items in the POST
Interior Exterior
Affordable Free Quote
for only
7
Days

ALL AREAS
reg: 7520

Call Emar 0413 691 125

info@adarnapainting.com.au

9335 1552

8 words

$ 40

See inside back page for details

The POST
delivers
more
newspapers
to letterboxes in
the western suburbs
than any other free
publication, says an
independent audit.
Separate surveys
also show that the
POST has far more
readers in all age
groups each week.
see P. 2

Page 106 POST, September 5, 2015

trades & services directory trades & services directory trades & services directory
PLUMBING

STEWART FRANK
PLUMBING

PL 7947

Prompt, reliable service


Blocked Drains
Burst Pipes
Leaking Taps
Hot Water systems
Cisterns
Toilet Pans
General Plumbing
Mobile

PL5094

0419 953 531

GL 006462

24 HR

Pensioner rates

CITY BEACH
Use Your Local Man Pty. Ltd.

FLOREAT

MAINTENANCE

Your local Plumbing & Gas Specialist

1800 18 12 24

PROMPT RELIABLE SERVICE


DOMESTIC & COMMERCIAL
New installations
& maintenance
Bathroom & Laundry
renovations
Hot Water Systems
Rainwater Tanks
Grey water systems
Water Filters
Block Drains & Burst Pipes
Office & Domestic refits
Toilet Pans & Leaking Taps

PLUMBING

1800 18 12 24
PL 7947

Roberts
Renovations &
Handyman Service

24 HR
Pensioner rates
Use Your Local Man Pty. Ltd.

CITY OF COTTESLOE
1800 18 12 24
Use Your Local Man Pty. Ltd.

CITY OF NEDLANDS
1800 18 12 24
Use Your Local Man Pty. Ltd.

PEPPERMINT GROVE
1800 18 12 24
Use Your Local Man Pty. Ltd.

PL 6899

GF 007802

EVERYTHING

24/7 emergency service


All your domestic &
commercial plumbing
services covered
Discounts if you book us
for more than one trade
Mention this
ad and receive
10% discount

Electronically Located
Blocked Drains Cleared
HWS Serviced / Replaced
General Plumbing

BURST PIPES
Call CRAIG

PL 7947

0419 922 657


Lic. 6039

Gas No. 4700

PARAMOUNT
PLUMBERS

Daniel 0412 904 769

Paramountplumbersperth.com.au

24 HR

Use Your Local Man Pty. Ltd.

MUIRS

HOLLYWOOD
1800 18 12 24
Use Your Local Man Pty. Ltd.

WEMBLEY
1800 18 12 24
Use Your Local Man Pty. Ltd.

SHENTON PARK
PLUMBING

1800 18 12 24
Use Your Local Man Pty. Ltd.

CLAREMONT
1800 18 12 24

ALL AREAS

ELECTRONIC WATER
LEAK DETECTION
Fast Efficient Service
Residential and Commercial

Contact LEAKY PETE

0415 114 172


9286 2450

BEST RATES

Renovations Hot water systems


New homes Gas
Tap maintenance & repairs
Blockages Sewer conversions
24/7 service Subdivisions
Senior discount
PL 7895 GS 015347

www.plumbway.com.au

Call Michael 0401 759 556

Us 2 U plumbing
r#BUISPPNLJUDIFO
SFOPWBUJPOT
r(BTUUJOH
r"MMQMVNCJOH
NBJOUFOBODF
r)PUXBUFSTFSWJDF
JOTUBMMBUJPO
r%SBJOTTFXFS
r/PDBMMPVUGFF
r'SFFRVPUFTBOE
UBJMPSFEBEWJDF
r/PKPCUPPTNBMMPS
UPPCJH
$SFEJU$BSE'BDJMJUJFT/PX"WBJMBCMF

For plumbing perfection


call Shane today on

0419 644 344


www.us2uplumbing.com.au
PL6544

GF010442

0428 976 777


thronezonewa@gmail.com

FREE QUOTES

(Est Since 1970s)

9371 0865 Fax 9473 0600

J. SUTTON
Plumbing & Gass Services

24 Hour Service

www.jsuttonplumbing.com.au

Plumbing Problems
Call Fred

0418 911 216


P.L. 693

G.F. 1515

Hot water specialists


Gas, Electric, Solar
Repaired or Replaced
Electronic leak detection
Leaking taps & toilets repaired
Drain blockages

Aquarium & Pond


Maintenance
Overhauls and Regular up-keep - Pumps and Filtration.
Installation and Maintenance
Supplier of Fish and Live plants.
Ph Gavin

0414 836 129

Pond And Aquarium Cleaning


Ongoing Maintenance
Pond Building And Restoring Of
Older Ponds
Pond Resealing Or Relining
Live Plants And Fish
Fish Health and Disease
Installation Of All Aqua Products
Package Deals Available
Eftpos Available

Ph David 0433 324 347


www.getwetponds.com.au
POOL
FENCING

NO CALL OUT FEE


t#MPDLFE%SBJOT
t)PU8BUFS4ZTUFNT
t#VSTU1JQFT
15%
t5BQT
OFF
t5PJMFUT
-BCPVSXJUIUIJTBE
t(BT#BZPOFUT

Call 0405 383 451


FOR ANY INFORMATION

EXPRESS REMOVALS
FOR A GOOD RATE AND
SERVICE LOOK NO FURTHER
7 days - 2 men, big truck
Experienced - Reliable - Careful
Packing Materials Available
Pensioner Discount

P & L Transport
OPERATING 7 DAYS A WEEK

Locally owned and operated


House and Office Removals
Pensioner Discounts
Packing Materials Available
Fully Insured
Ask for Peter on

Best Rates
in Perth
Only $110/hr
for 2 men

1800 2 SMOOTH

contact@thesmoothmovers.com.au

H.Santana Moves
&GGJDJFOUr)POFTUr3FMJBCMF4FSWJDF

4FSWJDJOHUIFMPDBMBSFBGPS
UIFMBTUZFBST
)6(0

0411 143 588/9381 7404


Home Packers Perth
We pack your home for
$30/hr.

Family business since 1983

4TH & 5TH GENERATION PLUMBERS


WITH OVER 50 YEARS EXPERIENCE

9380 6180, 0411 109 918

9309 2961 or
0419 836 484

24.7 Emergency service


www.nohotwater.com.au

NO-FUSS, AFFORDABLE
REMOVALS SERVICE FOR
THE WESTERN SUBURBS
WITH FOUR TRUCKS ON THE
GO, WERE ALWAYS READY
TO ACCOMMODATE YOU.

FULLY INSURED
0439 900 381

0433 019 676

Use Your Local Man Pty. Ltd.

CITY OF SUBIACO
1800 18 12 24

MIKE MURPHY
FURNITURE REMOVALS

Affordable Reliable
Storage Home or Office
Owner Operated Packing

PONDS

A FAMILY OWNED & OPERATED LOCAL BUSINESS

Pensioner rates

e Commercial & Residential


Sml, Med & Lg ns(Houses, Units, Flats & Offices)
Va
ed
os
cl
Fully En rates Same Day Service
competitive ount 7 Days Per Week
ALL AREAS
Pensioner Disc

Shift It Removals

PL 8650

Ph: 0419 993 192

Use Your Local Man Pty. Ltd.

0414 629 057

Plumbing

Zambeziplumbing.com.au

24 HR SERVICE

ELECTRONICALLY LOCATED
DONT BE A DRIP!
Call the exspurts
15 years experience
Senior Discounts
NO CALL-OUT FEE - 7 DAYS

THE TOILET
REPLACEMENT
SPECIALISTS

Call Steve Thomas

0408 917 109


Ph 9361 7665

BURST PIPES

One Stop
Tradesman Shop

r#MPDLFE%SBJOTr3FOPWBUJPOT
r/FX)PVTJOHr4VCEJWJTJPOT
r5BQ5PJMFUr)PU8BUFS
4ZTUFNTr(BT*OTUBMMBUJPO
r3PPG-FBL3FQBJST

Blocked Drains
All Plumbing Repairs
Gas Servicing Installation
Hot Water
Emergency Repairs
PENSIONERS DISCOUNT

TOTAL PLUMBING
AND MAINTENANCE

THRONE ZONE

htcontractorsperth.com.au

P/L 6956 G/F 010950

ALL FURNITURE
CARRIED
0416 226 434

Plumbing & Gas,


Electrical, Air-Conditioning
Solar Power, Renovations

Jon Howes 0433 824 613

ZAMBEZI

EMERGENCY PLUMBING
BLOCKED DRAINS

CALL KEVIN

WE OFFER A 5%
SENIORS DISCOUNT

SWANBOURNE
1800 18 12 24
MOSMAN PK
1800 18 12 24

0419 049 771

Call or visit

PLUMBING & GAS

REMOVALS

Lic No 5166

ALL AREAS - 24 HOURS


General Maintenance
Emergency Repairs Blockages
Hot Water Systems
PL6669
GL7760 and All Gas Services

PLUMBING

Dennis 1300 593 800

Mobile 0418 941 571


Fax 9387 8581

Use Your Local Man Pty. Ltd.

WOODLANDS

BASED IN MT CLAREMONT
t)PUXBUFSTZTUFNT
t (BT)FBUFSTFSWJDJOHJOTUBMM
t -FBLJOH5BQT
t 5PJMFUT DJTUFSOSFQBJSTJOTUBMM
t "MMQMVNCJOHHBTNBJOUFOBODF
t #VSTUQJQFTt(BTMFBLT
t %PNFTUJDBOE$PNNFSDJBM

9387 2339

CHURCHLANDS
Use Your Local Man Pty. Ltd.

GF 005836

www.smartgap.com.au

Office

1800 18 12 24

PLUMBING

PL 8445

$BMM4UFWF

Use Your Local Man Pty. Ltd.

1800 18 12 24

PLUMBING

1-('0

PLUMBING

r(MBTT1PPMGFODJOH
r(MBTT#BMVTUSBEF
r'SBNFMFTTBOETFNJ
GSBNFMFTT
r8PPEMPPLBMVNJOJVN
BOEQPXEFSDPBUHBUFT
BOETDSFFOT
r'VMMZJOTUBMMFEPS%*:
r'SFFRVPUFT$PNQFUJUJWF
SFMJBCMFTFSWJDF
WANGARA SHOWROOM
OPEN MONDAY - FRIDAY

9409 2597

info@glassboundaries.com.au
www.glassboundaries.com.au

Gila
94404711 or 0422931587

2 STRONG GUYS
Local lads w/ loads of energy.
Well move what you cant!
Around the house, garden or
place to place.
2 utes & trailer at your service.
Best rates @ $95 p/h
call us anytime

0400 998 805

RENOVATIONS

0418 942 157

REFRIGERATION
RONS
REFRIGERATION

Integrity & Expertise

NO CALL OUT FEE

9387 3872

r#MPDLFE%SBJOTr5BQSFQBJST
r)PU8BUFS6OJUTr#VSTU1JQFT
"MMZPVS1MVNCJOHBOE(BT
.BJOUFOBODFBOE*OTUBMMBUJPO/FFET
Family Owned and Local
Pensioner Discounts just ask!
XXXBMMQFSUIQMVNCJOHDPNBV
1-
('

Call us on 9381 3088


to advertise in the POST

Trades & Services

25 Years Experience
Personal Service
Guaranteed Repairs
ph 9375 3216
0407 199 046
Pensioners
Discount

One Company All Trades


Perth TLC Group can project
manage your next home
improvement/renovation
www.tlc-perth.com

9284 0165

Lic No AU 7200

info@tlc-perth.com
have a look at our main ad in the Home
Improvement section

Ridge Capping Fixed the Proper Way

PTY. LTD

Bores & Fully Installed


Reticulation Systems
Commercial & Domestic
Pump & Reticulation Repairs
Ph: 0403 248 845

BROOKWELL
IRRIGATION
Repairs on Pumps
& Reticulation
Irrigation Systems
Commercial & Domestic
Valve Locating & Wire Tracking

0414 475 527


MAINTENANCE
SPECIALISTS

JOEL

IRRIGATION
LANDSCAPES

r $VTUPN%FTJHOFE*SSJHBUJPO4ZTUFNT
 m3FTJEFOUJBM$PNNFSDJBMQSPKFDUT
r "MM*SSJHBUJPO3FQBJSTBEEJUJPOT
r /FX#03&*OTUBMMBUJPOTBMMBSFBT
r "MM1VNQ&MFDUSJDBM3FQBJST
 m*OTVSBODFDMBJNTBSSBOHFE
r -BOETDBQF$POTUSVDUJPO
 m/FX3PMMPO5VSG
r 'BDUPSZ%JSFDU3FUBJM5SBEF4BMFT
r 8"BQQSPWFEi8BUFSXJTFu$POUSBDUPS
4JODF

9386 3183

-PDI4USFFU /FEMBOET
IRRIGATION SERVICES
ALL PUMP &
RETICULATION
REPAIRS
12 YEARS EXPERIENCE
COMMERCIAL & DOMESTIC
SENIORS RATES
Ph: RYAN EGAN

0408 007 850

REPAIRS INSTALLATION
MAINTENANCE

WIRE TRACKING & VALVE LOCATING


OVER 30 YEARS EXPERIENCE
AFFORDABLE RATES AND
PERSONAL SERVICE
DISCOUNT FOR SENIORS

Support POST
advertisers
they make your
free local
newspaper
possible.

PETER HANSONS
IRRIGATION
t3FQBJST
t"MUFSBUJPOT
t4ZTUFN3FEFTJHO
t0WFSZFBSTFYQFSJFODF

Ph: 9284 9144


Mob: 04388 74788

2 YEAR WRITTEN WARRANTY

Special sealant for box gutters


Tile Replacement
Emergency work Gutters
Speciality Gutters/Downpipes
Valleys & Flashings Replaced
Soakwells Tin Reroofs
Seniors Rates
ALL WORK GUARANTEED
LOCAL SINCE 1986

0419 385 971 or


9385 9719

FLINT ROOFING
Re-roofing,
New Roofing
Gutters
Downpipes
Leaky Roof Repairs
Ridges Repointed
Soakwells Installed
Roof Vents

0408 944 891


9386 3667

ROOFING & BUILDING


MAINTENANCE
HIA
MEMBER

R.B.M.
Since
1986

ONE CALL WE DO IT ALL


FREE QUOTES
PENSIONER DISCOUNTS
Tile and Metal Roof
Replacement and Repairs
Specialising in R/EBuilding Reports
Internal Roof & Ceiling Repairs
Sagging Roofs Box Gutters
All Hours

0412 490 868


CREDIT CARDS
ALL WORK TO AUST STANDARD

Indigo Painting

Peter 0417 096 691


References Available

FIX RETIC

TROUBLESHOOTING
REPAIRS & NEW INSTALLATIONS
CONTROLLER / SOLENOIDS REPLACED
PROMPT PRO SERVICE
Call
Dave

0408 092 350

Reticulation Systems installed,


Serviced and modied.
Controllers programmed
and installed.
Solenoids located
and replaced.
Lawns installed and removed.
Bore Service
and replacement.
Electrical problems resolved.

0424 133 950

www.lukeslandscaping.com.au

RETIC
REPAIRS
 Police Clearance
 Lisas a member of Irrigation Australia
 Lisas a Water Wise contractor
www.reticrepairs.com.au
Call Lisa 0416

545 755

Re-Roofing
Old Tile, Asbestos, Iron
Roofing, replaced with new
Colorbond or Zincalume

Roof Restoration
Cement and
Clay Tile Restoration,
Ridge Cap Repairs,
Guttering and Downpipes

ROOFING

1300 137 663 or 9209 3980

ROOF & WALL


DOCTOR

www.advancedroofs.com
Licensed Asbestos Removal
Specilist.
FREE Quotes
10 Year Guarantee

READ THIS

RETICULATION

ROOFING

LOCAL ROOFING

3 Great Reasons to call Lisa:

ALL GENERAL PLUMBING & GAS REPAIRS


1-('HCMBDLCVSO!SPDLFUNBJMDPN

RETICULATION

If your re-roof is more than $20,000 (inc


GST) your re-roofing Company must be a
Registered Building Company. This
means Licenced with The Builders
Registration Board.
Otherwise the work is ILLEGAL

WE REMOVE and DISPOSE OF:


OLD TILE IRON ASBESTOS
WE SUPPLY and INSTALL
Colorbond, Zincalume
Skylights, Whirly Birds
Insulation, Gutters
Tile Roof Restoration

9430 6553

16 Essex Street, Fremantle

www.roofandwalldoc.com.au
WorkSafe Asbestos Demolition Lic
Builders Registration Number 13172

Swan River
Roofing
t$PNNFSDJBMt*OEVTUSJBM
t3FTJEFOUJBMt"TCFTUPT3FNPWBM
t3FSPPGJOH
"MMXPSLHVBSBOUFFE
'VMMZ2VBMJGJFE5SBEFTNFO0OMZ

Ron: 0403 842 218

'BY 

FNBJMTXBOSJWFSSPPGJOH!MJWFDPNBV

POST, September 5, 2015 Page 107

trades & services directory trades & services directory trades & services directory
ROOFING

ROOF PLUMBING

SHADE SAILS

Prompt Roofing

TILING

TREE SERVICES

When only the best will do

PROFESSIONAL

Digital TV Antenna

SURGEONS

t1PPS1JDUVSF2VBMJUZ1SPCMFNT4PMWFE
t4FU5PQ#PYFT*OTUBMMFE
t&YUSB578BMM1PJOUT"EEFE
t/FX"OUFOOBT*OTUBMMFE

The Roofing Specialist

Floor & Wall Tiling

Re-roofing & repairs


Gutters & Downpipes
Colorbond or Zincalume
Fully Insured
All work guaranteed

Ph Rick: 0402 751 878

FREE QUOTE ADAM CLARKE

0433 210 028

ROOF
IMPROVEMENTS
Gutters & Downpipes
Ridgecapping Repairs
Whirly Birds
Roof Coatings
All Roof Repairs/Leaks
FREE QUOTES

Graham
0432 119 526

Specialised Outdoor Services

All Roof Replacement


and Maintenance
08 9433 1077
www.sos-services.com.au

D Wynne Roofing
All Roofing Services
Re-roofing
Roof/leak repairs
Tile
RidgeReplacement
Repairs
Roof &Cap
Gutter
Cleaning
Roberts
Free Quotes
No
Job Too Small
Renovations
&
493 127
Call
Dave 0410Service
Handyman

Servicing the Western Suburbs since 1996

www.shadesolutions.com.au
patrick@shadesolutions.com.au

0418 958 607 Patrick

NO JOB TOO SMALL


CALL PETER FOR FREE QUOTE

Pensioner Discount / Insured


Builders Licence # 13954

SWIMMING POOL
SERVICE

Complete Wall and Floor Tiling


Experts In Shower Repair and Regrouting
Bathroom Renovations
www.alphatile.com.au

RUBBISH
DISPOSAL

CLAREMONT

RoofQuest

All metal roof sheeting, gutters


and downpipes, maintenance
work no job too small.
Australian Colorbond
Blue Scope Steel materials.
Please phone
0429 062 952 Mark

Specialists in Commercial &


Residential Shade Sails

Friendly Professional Service


All Work Guaranteed
Free Quotes Competitive Rates
Specialising in Diagonal Tiling
NO JOB TOO SMALL

0438 909 275

POOL
SERVICE
FOR OVER 20 YEARS

POOL & SPA SERVICE


CHEMICALS/REPAIRS
FREECALL 1800 835 444
* Western Suburbs
* Competitive Rates
(Including Tip Fees)
* Commercial & Domestic
* Prompt Delivery
Ph PETER PLAISTED

9389 8744
Mobile
0413 747 777

Prompt & Professional


or visit our shop at

257 STIRLING HWY


CLAREMONT

Western Suburbs
Pool Service
CLEANING CHEMICALS &
EQUIPMENT
QUALITY OWNER OPERATED
COMPLETE POOL SERVICE
JOSH MANN

0414 775 586

IMMEDIATE ATTENTION

9401 1820

Est. 1990

FREE QUOTES
BEST WORKMANSHIP
CHEAPEST PRICES
All Roof Repairs
Gutters & Downpipes
All Carpentry Work
Fire & White Ant Repair
Property Maintenance
Inspection
Insurance Claims
Renovations
Painting & Design

Phil 0400 340 228


(Licenced & Fully Insured)

DOUGS ROOFING
For all major and minor repairs on all types of roofs.

We set the highest standards in tradesmanship


and use the highest quality materials and tools.
All work carried out is insured followed by
a guarantee.

0481 374 143


GUTTERS AND
DOWNPIPES

RE-ROOFING WITH
COLORBOND AND
ZINCALUME, WHIRLEY BIRDS
AND LASERLITE SHEETING

0418 925 030 or 9384 9141


Fax 9384 5929

ROOF CARPENTRY

MUIRS

Roof Carpentry Team


Specialising in Architectural
Designed Homes. 15 yrs exp.

AT YOUR SERVICE

AT YOUR POOL
AND AT OUR STORES
11 SHOPS IN WA
ALL OWNER OPERATED
YOUR LOCAL SHOPS
NEDLANDS
134 BROADWAY

9389 6131

2m 3m 4m 6m 8m
0434 441 277

PH GEOFF
7 DAYS
RUBBISH REMOVAL
t:BSETt)PVTFT
t0VUCVJMEJOHT$MFBOFE
PVUPSEFNPMJTIFE
t4QFDJBMJTUJO
EFDFBTFEFTUBUFT
CALL ROB YOUR LOCAL MAN
Free Quotes 0409 958 186

SAND SUPPLIES

WESTERN
SUBURBS

BUILDING & GARDEN


SUPPLIES
WE DELIVER
232 STUBBS TCE,
SHENTON PARK
(Opp Lemnos Hosp)

OPEN 6 DAYS

912 874

PH: 9381 5455

ROOF PLUMBING

SECRETARIAL

Phone JEFF 0418

r3FSPPOH BMMSFQBJST
r(VUUFST EPXOQJQFT
r5JMF.FUBM3PPOH
r1BUJPT
FREE QUOTES - PENSIONER DISCOUNT

0432 941 148

All Roofcare
5(522),1* 1(:
*877(56'2:13,3(6
$//522)5(3$,56

0408 947 570

For All Your


Secretarial Needs
from Student to
Executive
- Resumes - CVs
- Audio Typing
- Word Processing/Mail Outs
- Bookkeeping
- Powerpoint Presentations
- Business Reports
- Photocopy/Binding/Scanning

9380 8333
We create the professional
edge that everyone wants

Like the
POST on
facebook


and now at
MOSMAN PARK
2 STUART ST - opp train stn

9384 6164

Complete and Professional Pool


Servicing with access to 300 years
of combined experience.
Regular maintenance our
speciality. Ring today for details.

Professional
pool service,
cleaning,
maintenance
For
and supply
all your
since 1984. Pool Needs

SIMPLY THE BEST!


John
Clark
Mark
Lynch

0417 912 362


0418 959 871

Maintenance & Repair


Including:
r3FTVSGBDJOHr5JMJOHr4LJNNFS
#PY3FQBJSr1PPM)FBUJOH
30 years Experience
LOCAL

Ring Ian on

0419 931 966

POOL CLEANER

Our $150 Service Includes


FREE leaf rake & vacuum
FREE pump check & diagnostic
FREE water analysis & balance
FREE cleaning of lter & baskets
FREE scrub of water line
FREE brush of pool oor
FREE wash of pool blanket
FREE chemicals added

Isaac 0450 121 475

r'PSNBUJWF1SVOJOH
r)FEHJOH4IBQJOH
r4BGF3FNPWBMT
r4UVNQ(SJOEJOH
r(BSEFO.BJOUFOBODF
r5SFF(BSEFO'FFEJOH
r1FTU.BOBHFNFOU
r'VMMZ*OTVSFE

No job too small


All aspects of tiling
Full bathroom renovation
Full re-routing or grout repair
20 years experience

Royce Turner

Call Lewis: 0451 636 666


corebathreno@gmail.com

STONECARE AUSTRALIA
Stone restorations Tiling Services
Clean & Seal Stone
Grind / Polish Stone
Call Massimo

0438 003 571

DON TILING SERVICE

All aspects of wall & floor tiling.


Specialising in bathrooms.
Ceramic, Porcelain, Travertine.
FREE QUOTES
Don 0435 722 362
don.yoon@yahoo.com.au

INTERIOR EXTERIOR TILING

Repair. Maintain. Improve

Certified Arborists
Offering Complete Tree
Service With Care

Original est 1967


Tree Guild of
WA # 8804

http://dontilingservice.com

HouseDoctor

TREE

Core Tiling

& Bathroom renovation

- Trees, Our Inspiration -


pts@bigpond.com
www.professionaltreesurgeons.com.au

TREE SURGEON
S.E.C. Cert.
All Facets of Tree Work
Satisfaction Guaranteed
For the personal touch
please phone RENE COOLEN

0407 774 549 9387 5153


Free Quotes

LAKESIDE
TREES & STUMPS
www.lakesidestumpgrinding.com.au

TREE & PALM REMOVALS


HEDGING & MULCHING
NARROW ACCESS
SPECIALISTS
FULLY INSURED
Call ANDY

9306 8599

Ph Joe 0408 094 444

0408 405 671

All reno & new work


Specialists in
Rectifieds Terrazzo Travertine
All ceramics Stone laying
Call Mark

Mobile

Stump Grinding

0456 734 775

Complete
Stump Removal

TREE SERVICES

Call Adam
Tel: 9246

0235
Mob: 0403 377 692

FORMATIVE AND
PRACTICAL PRUNING
SAFE TREE REMOVALS
PEST MANAGEMENT
ROOT ZONE
MANAGEMENT
CONSULTANCY
FULLY INSURED
FREE WRITTEN QUOTES

PH: 9359 9300


MAGDA
TREE SERVICES
0418 943 059
Local number 24 hours
Able to trim and remove
large and difficult trees.
FULLY INSURED. FREE QUOTES

Perths Premiere
Tree Service

Our professional service includes:


tUIFIJHIFTURVBMJUZXPSL
tQSPNQUSFMJBCMF IPOFTUTUBGG
tGSFFBEWJDFBOERVPUFT
tBMMBTQFDUTPGUSFFTVSHFSZ USFF
SFNPWBM IFEHJOHBOETUVNQ
HSJOEJOH
tUIFSJHIUNBDIJOFSZUPFGGFDUJWFMZ
DPNQMFUFUIFKPC
tUSFFTVSHFPOBMXBZTPOTJUF
tJOTVSFEXPSLXJUINJMMJPODPWFS

Phone: (08) 9309 6852


Mobile: 0431 159 207

Foxys
Treelopping
& STUMP GRINDING
'3&&2605&4t'6--:*/463&%

%"/(&306453&&403"//0:*/(456.14
3&.07&%4"'&-:"/%130.15-:
53&&453*..&%4)"1&%
t)&%(&136/*/(t("3%&/*/(
t(655&3$-&"/*/(

9433 4156

0407 473 626

TILING

Contemporary Tiling
Regrouting leaking shower,
swimming pools, repair chipped tiles,
marble stone travertine, porcelain
Reg tiler - Police clearance

Alex 0412 597 261

JEFF TILING
Floor and Wall
Ceramic and Porcelain
New House and Renovations
email: jeff.tilling@yahoo.com.au

0422 095 481

Services

Andrew & Ben offer


Dependable Personal Service
from a
QUALIFIED TREE SURGEON
Great Rates
Prompt Service
Good Advice
Quality Pruning/Shaping
Clean Removal
Quotes & Work Guaranteed
Registered & Insured

26 Years Exp Palms Shrubs


SMALL JOBS
MOST WELCOME
PENSIONER RATES FREE
Quotes Les 9387 8094

www.pdtas.com.au

0424 150 899

Qualified, Experienced, Insured


Large & Confined Tree Specialist
Tree/Palm Pruning / Removals
Hedging / Mulching /
Stump Grinding. Free Quote
Kieron Fiford : 0418 717 955

9448 2227

kieron@heritagetreesurgeons.com.au
www.heritagetreesurgeons.com.au

The Tree Specialists

Call Marco

0450 159 839


 Tree Pruning
 Palm Trimming  Stump Grinding
 Hedging & Trimming
Tree & Palm Removals
Powerline Clearances
Woodchipping
Fully Insured

teamtreelopper@gmail.com
www.teamtreelopper.com

SWANBOURNE
TREE
SERVICE
Free Quotes
Great Service

0423 655 222

Digital Antenna
Installations
From $179
Antenna
Repair
From $75
TV Mounting
From $149

The Local Guys

www.theinstallers.com.au
t&YUSB57QPJOUT
t4BNF%BZ4FSWJDF
t"WBJMBCMF8FFLFOET
t4JHOBM#PPTUFST

Call Clint 9379 3407


Indigo
Painting
7 Day 6am
- 10pm
6Q'SPOU1SJDF(VBSBOUFF

TV INSTALLATIONS
Narrow Access Fully Insured
Tree Work Undertaken Free Quotes

CALL
PETER
0407 520 430

BEST PRICE

Tree Service

TUNE INS
INSTALLATIONS
TV DVD VCR AUDIO
Digital Set Top Boxes
Entertainment Centres
Pre-Packed
Furniture Assembled
LINDSAY

0414 738 888


TV SERVICES

All Tree & Palm work


Discount Stump Grinding
Ph: Jason

TV & VIDEO REPAIRS


COMPUTER & DVD REPAIRS
NO HIDDEN CHARGES!
From $50 WORKSHOP QUOTES

TUCK-POINTING

Rear Laneway, 25 Heytesbury Rd

DOWNLOAD BROCHURES:
Seamless Mortar Pointing
Invisible Crack Repairs
www.tuckpointing.com.au
* Concrete Cancer
* Damp & Waterproofing
* Wall Alterations
* Structural Wall Removal

UPHOLSTERY

0411 351 251

9382 4752

9242 2952

MAINLINE
TUCKPOINTING
Building Conservation, Heritage
Restoration Tuckpointing,
Stonework, Brickwork Pointing,
Qualified Bricklayer

SAM GRANERI 0408 095 854

TV ANTENNA

FLOREAT TREE SERVICE

On Time / Experienced / Insured

Jason 0413 859 898

TRY US - YOU WILL BE HAPPY

Fully Insured / All areas

Free Quotes

If you have trees, you need


the Arbor Centre.
Take advantage of WAs
foremost company for truly
qualified advice and
professional service.

TV ANTENNA

Qualified Arb
Merristwood UK

:(7$5($5(*52876
%$7+52205(129$7,216
.,7&+(16:$//6 )/2256

TOP MARK TILING

TREE SERVICES

Your Local
UPHOLSTERER
Specialising in Leather & Fabric repairs
Re-Upholstery & Re-colouring
All work Guaranteed

9354 4524

WERE JUST A PHONE


CALL AWAY

Specialising in all styles of


household and commercial
upholstery.
CONTACT MICHAEL

0407 771 476

michaelstudman@hotmail.com

Tree Removal Palm Removal


Pruning or Removal Hedging & Shaping
Power Line Clearance
FULLY INSURED - FREE QUOTES

HALESTORM
ANTENNA &
AUDIO VISUAL

WASHING MACHINE
REPAIRS

Aaron: 0410 521 734

- Home Theatre Systems


installation & set ups
- Antenna installations, extensions &
problems: TV, Satellite & Radio
- Sites of difficult reception
- Troubleshooting & interference
resolution
- Telephone points
Mike Mobile 0404 803 324

APPLIANCES

soss_tree_services@yahoo.com.au

Advertise your goods in the


Classifieds

PROUD
WASHING MACHINES
DISHWASHERS, DRYERS
RANGEHOODS,
ELECTRIC OVENS
AND COOKTOPS
SALES SERVICE SPARES

4 Hood Street Subiaco

9388 2251

Page 108 POST, September 5, 2015

classifieds classifieds classifieds classifieds classifieds classifieds classifieds


FOR SALE
HOUSEHOLD
AGAPANTHUS
Large potted
plants. Daglish $6 or 10 for $50. Ph:
9381 3763
BEDROOM Suite: Queensize, solid
Pine, 4 pce, handcrafted in W.A.
Comprises Q/S bed with slatted
head + foot board, solid timber
slatted base + as new posturepaedic
mattress. Comes with matching
bedside drawers + tallboy/chest of
drawers. Outstanding cond $650.00
lot. Ph: 0477 433 591
DESK Beautiful order.
0412 470 809
DINING Chairs: French Country,
set 8 matching, solid Oak. Feature
ladder backs + woven Seagrass
seats. Very solid, excellent condition
$475.00 lot.
Ph: 0400 749 433
DOUBLE Bed ensemble beautiful
with new mattress $500 ono. Phone
9383 3613
DUNSBOROUGH 3 bed, 2 bath
house. Great location
0407 385 259
ELECTRIC
Barbeque hotplate.
Never used. $40.00 Swanbourne.
9383 1953
FIREWOOD Split Jarrah 6X5 ute
load. Good quality Jarrah sourced
from our own family farm in
Serpentine. Happy to unload & split
to your size. Generous loads, you
wont be disappointed $190. Free
delivery NOR or SOR. Call/sms
Tyson 0413 333 706
or tyson_bickers@hotmail.com
FRANGIPANI Mature 2.5-3 metres
high. Ph 9386 1579
FRANGIPANI Mature 2.5 metre
height by 2 metres.
Phone 0412 470 809

FOR SALE
HOUSEHOLD
FRANGIPANI Tree (mature)
0412 470 809

Uwes European
Appliance Repairs

Repair Miele Siemens


Bosch Neff Gaggenau
Microwaves / Dishwashers
Hotplate / Ovens
Over 30 yrs experience

Ph: 6201 1387

www.uwerepairs.com.au

WINDOW
CLEANING

SWANBOURNE
WINDOW CLEANING
EST. 1976

YOUR LOCAL BUSINESS


FOR OVER 30 YRS
INCLUDED SCREENS,
SILLS
GROUND SHEETS USED
POLICE CLEARANCE
FREE QUOTES
PROMPT SERVICE

PETE AND JOSH

0402 433 690

WESTERN SUBURBS SPECIALIST

WINDOWS and/or
gutters CLEANED
TREE PRUNING
15 YEARS WESTERN SUBURBS SPECIALIST
FREE QUOTES
INCLUDES SCREENS, SILLS & MIRRORS
PENSIONER DISCOUNTS
PROMPT SERVICE

9336 3129
0414 011 220

Phone MARTIN

Roberts
Renovations &

Mob

Handyman Service

WINDOW CLEANING
your local professional

t'-:4$3&&/3&1"*34t(655&3$-&"/*/(
t)*()13&4463&$-&"/

ANGUS

040 375 8242

GMR

Window Cleaning
Residential - Commercial
Industrial
Fully Experienced.
Ladder Work. Flyscreens and
Gutter Cleaning
Multi Storey
FREE QUOTES

0439 518 525


grwindowcleaning@bigpond.com

WINDOW CLEANER

$50 disc. for repeat clients


FREE Bathroom Mirrors
Cleaned
FREE Shower Screens
Cleaned
Est 1997
FREE Flyscreens plus
Cobwebs Cleaned
FREE Tracks of Sliding doors
Cleaned
FREE Pool Fencing Cleaned

Isaac 0405 300 298

DECEASED ESTATES

EDUCATIONAL

HOLIDAYS & RESORTS

PHILLIPS Fine Antiques & Art.


Huge annual sale. Everything
reduced 2/634 Stirling Hwy cnr St
Leonards St, Mosman Park. Open
Tues-Sat. Ph: 0414 242 659

TRUSTEES ACT 1962 DECEASED


ESTATES Notice to Creditors and
Claimants. Constance Joy Bridge
late of Mosman Park Nursing Home,
57 Palmerston Street Mosman Park
in the State of Western Australia,
Hairdresser. Creditors and other
persons having claims (to which
Section 63 of the Trustee Act 1962
relates) in respect of the Estate of
the Deceased who died on 30 April
2015 at Mosman Park Nursing
Home, 57 Palmerston Street
Mosman Park in the State of
Western Australia are required by
the personal representative, being
Alan Michael Brook to send
particulars of their claims to care of
Brook Legal, PO Box 93, Wembley
in Western Australia 6913 within 30
days of publication of this notice after
which
date
the
personal
representative may convey or
distribute the assets, having regard
only to the claims of which he then
has notice. Dated 25 August 2015.
BROOK LEGAL

SPANISH Online tutoring using


Skype. Qualified experienced
teachers living in Chilie. Improve
grammar, conversation and reduce
accent. All levels welcome.
Whatsapp message +56971 363321
or Skype davterr1984

MARGARET
River. Riveresque.
Enjoy a magical stay at this Balinese
inspired villa set amongst the tall
trees on the river. Voted number one
on Tripadvisor. Riveresque is
affordable luxury. Please phone Di
on
9757
2493,
email
riversque@bigpond.com
PEPPERMINT Grove Beach. Large
5 bedroom three bathroom house.
Phone 9389 6565, 0403 870 075

ARTS & CRAFTS


FRAN

BRENda
RECLINER
Electric sit down/stand up. Yellowish
floral fabric in good condition. Can
email/text photos. $600. West
Leederville pick up. 9388 1217,
0402 103 070
LOUNGE
Suite,
3
piece
v.comfortable Chinz covers, low wide
seats $75.00 ono.
0409 101 757
SOFABED
Modern
design,
Queensize stylish linen upholstery
with trampoline base + quality
mattress. Cost $950.00 as new
condition. Sell $175.00.
Ph: 0438 396 273
TWO Jarrah coloured sideboards
as new. Two coffee tables. Total
$180, 9384 2352
WARDROBE 1920's superb, bow
fronted with 2 mirrored doors + 4
large drawers. Solid Oak (Golden
colour) with crown to top. Measures
1580mm wide, 2060mm high,
600mm deep. Dis-assembles for
easy moving. Excellent condition
$475.00. Ph: 0477 433 591

ANTIQUES

BIRD Lover? Beautiful Australian bird


prints and originals at
www.brendaholdenart.com.au

BABY ITEMS
DOLL'S House and furniture. One
owner. Very good condition $60.00.
Also child's pine chair $30.00.
Swanbourne 9383 1953

BED AND BREAKFAST


ROSEMOORE B & B Mosman
Park. Sng/twn/dbl rooms, own
ensuites. www.rosemoore.com.au. 9384
8214

BOATING

33066

ANTIQUE Clocks for sale. Large


collection 9380 6399

trades & services directory


WASHING MACHINE
REPAIRS

ANTIQUES

WINDOW
CLEANING

DIVERSITY WINDOW
CLEANING
Residential / Commercial
1-4 Storeys
Includes Flyscreens & Mirrors
Police Clearance and Insurance
Gutter Cleaning
Credit Card Facility Available
Free Quotes Josh and Mike

0416 042 258 or 0413 998 955


1300 460 996
www.diversitycleaning.com.au

iSHINE Window
Cleaning

+ 1 to 4 storey house
+ Chandeliers
+ Hard water stain removal
& protection
+ Pool Fencing
+Fly screen repairs
FREE QUOTES
+ Fully Insured, Police Clearance

Trevor 0406 809 977

Reliable Service
Police Clearance
I Do the FREE Quote
I Do the Work

Call Rolf
9279 2981
0408 930 235
WINDOW
REPAIRS

Paul Jones

Carpentry & Joinery


Repair and Restoration of all
Timber Windows and Doors.
Double Hung, Casement and
Hopper Sashes.
Bi-fold Windows and Doors.
Quality Assured

PH 0417 915 636

SASH IN A FLASH
Specialist Timber
Window Repairs & Restoration
Double hung casement &
awning sashes
Sashcords & spiral balances
Fully insured

PH 0407 328 128

www.sashinaflash.com.au

WROUGHT IRON

Metal Ox Ironworks

Handmade Wrought Iron

Balustrades, Furniture
Gates, Window Grilles
All Ironwork
Quality & Service

9272 8282 0419 045 250


www.metalox.com.au

FATHERS' Day Gift idea. King Pin


Pegs and Jumbo Clips. Essential
items for boating, camping, balconies,
pool fences. Hurricane hold on sturdy
rails. Packets of 10 approx. $12.95.
Available all boating stores.
Info.cargo34@bigpond.com

DECEASED ESTATES
TRUSTEES ACT 1962 DECEASED
ESTATES Notice to Creditors and
Claimants. Kaija Sade Sinkka Rolfe
late of Hall and Prior Tuohy Aged
Care, 22 Morrison Road Midland in
the State of Western Australia,
Home Duties. Creditors and other
persons having claims (to which
Section 63 of the Trustee Act 1962
relates) in respect of the Estate of
the Deceased who died on 27
November 2013 at Hall and Prior
Tuohy Aged Care, 22 Morrison Road
Midland in the State of Western
Australia are required by the
personal representative, being Alan
Michael Brook to send particulars of
their claims to care of Brook Legal,
PO Box 93, Wembley in Western
Australia 6913 within 30 days of
publication of this notice after which
date the personal representative
may convey or distribute the assets,
having regard only to the claims of
which he then has notice. Dated 17
August 2015. BROOK LEGAL
TRUSTEES ACT 1962 DECEASED
ESTATES Notice to Creditors and
Claimants. Angelina Boase (also
known as Anne Marie Boase) late of
Unit 3, 85 Homer Street in the State
of Western Australia, Sales Person.
Creditors and other persons having
claims (to which Section 63 of the
Trustee Act 1962 relates) in respect
of the Estate of the Deceased who
died on 30 June 2015 at Fiona
Stanley Hospital, 102-118 Murdoch
Drive, Murdoch in the State of
Western Australia are required by
the personal representative, being
Alan Michael Brook to send
particulars of their claims to care of
Brook Legal, PO Box 93, Wembley
in Western Australia 6913 within 30
days of publication of this notice after
which
date
the
personal
representative may convey or
distribute the assets, having regard
only to the claims of which he then
has notice. Dated 26 August 2015.
BROOK LEGAL
TRUSTEES ACT 1962 DECEASED
ESTATES Notice to Creditors and
Claimants. Angelina Fragomeni late
of 17 Lalor Place Kalamunda in the
State of Western Australia, Records
Officer. Creditors and other persons
having claims (to which Section 63 of
the Trustee Act 1962 relates) in
respect of the Estate of the
Deceased who died on 10 February
2015 at St John of God Hospital
Subiaco in the State of Western
Australia are required by the
personal representative, being Alan
Michael Brook to send particulars of
their claims to care of Brook Legal,
PO Box 93, Wembley in Western
Australia 6913 within 30 days of
publication of this notice after which
date the personal representative
may convey or distribute the assets,
having regard only to the claims of
which he then has notice. Dated 24
August 2015. BROOK LEGAL

Classified
photos
starting
50
from $5s a.pply
n
Conditio

TRUSTEES ACT 1962 DECEASED


ESTATES Notice to Creditors and
Claimants. Reginald Richard Hugh
Doran late of Regis Park Lodge,
118-120 Monash Avenue, Nedlands
in the State of Western Australia,
Engineer. Creditors and other
persons having claims (to which
Section 63 of the Trustee Act 1962
relates) in respect of the Estate of
the Deceased who died on 12 April
2013 at Regis Park Lodge, 118-120
Monash Avenue, Nedlands in the
State of Western Australia are
required
by
the
personal
representative, being Alan Michael
Brook to send particulars of their
claims to care of Brook Legal, PO
Box 93, Wembley in Western
Australia 6913 within 30 days of
publication of this notice after which
date the personal representative
may convey or distribute the assets,
having regard only to the claims of
which he then has notice. Dated 26
August 2015. BROOK LEGAL
TRUSTEES ACT 1962 DECEASED
ESTATES Notice to Creditors and
Claimants. Wendy Ashton late of 10
Florence Way Broome in the State of
Western Australia, Librarian.
Creditors and other persons having
claims (to which Section 63 of the
Trustee Act 1962 relates) in respect
of the Estate of the Deceased who
died on 16 September 2009 at 10
Florence Way Broome in the State of
Western Australia are required by
the personal representative, being
Alan Michael Brook to send
particulars of their claims to care of
Brook Legal, PO Box 93, Wembley
in Western Australia 6913 within 30
days of publication of this notice after
which
date
the
personal
representative may convey or
distribute the assets, having regard
only to the claims of which he then
has notice. Dated 25 August 2015.
BROOK LEGAL

DRESSMAKING
ALTERATIONS Hems etc. Fast,
efficient, very reasonable rates.
Local lady many years sewing
experience. 0417 913 931

EDUCATIONAL
ACCOUNTING Tuition for Grade 10
to 12 plus first year Uni by qualified
teacher. Excellent results contact
Irene at 0415 741 040 or
gifinch@bigpond.com
CHEMISTRY
Physics,
Mathematics, English and other
WACE subjects. Individual tuition for
Years 10/11/12. The Tuition Centre,
Bayview Terrace, Claremont. 9284
3004

FOR HIRE
LOOKING For an inspiring venue for
your next workshop or meeting?
Discover A Place To Just Be in East
Fremantle.
0405
670
803
www.aplacetojustbe.com.au

GARAGE SALES
FREE Stuff. Crap stuff and some
good stuff! Garage sale. Saturday 05
/09 8am-12 noon. Moved home so
need to clear Fridge $100, washing
machine $100, 2 x filing cabinets,
bookcases, TV, single bed, trolley
bed, assorted glassware and kitchen
gear. Villa 1, 20 Richardson Ave,
Claremont. Peter 0414 926 016
ROTARY
Swap Mart. Every
Sunday 7am to 12 noon. Broadway
Shopping Centre, Nedlands. Seller
bays $5. Come and get bargains
galore or sell your goods

110% Care while you're away.


Owner operated since 1998. 9382
3550 or visit
www.homeoraway.com.au
ABSOLUTE Care of your home
and pets. Bringing peace of mind
while you're away. Police clearance.
Lovely references. 12 years
experience.
Marg 0421 274 427

HEALTH & BEAUTY

DO You have any friends/family


from
London
seeking
accommodation in the Western
Suburbs over Xmas? Comfortable 4
br home with pool in Mosman Park
available for a month for House
Swap Dec/Jan, seeking house in or
near London. Photo available, house
profile can be viewed on
homeexchange.com. Listing no
519014. Please contact Jane for
further information,
0403 881 144, or eton@aapt.net.au

CHAKRADANCE Rhythm for your


soul. Weekly workshops in Wembley
on Mondays 7.30pm-9.30pm and
Thursdays
9.30am-11.30am.
Contact Anne-Marie for more
information & bookings 0408 744
572
www.coessence.com.au
FACIALS Specialised & Intensive,
created to suit your skins needs.
Lash/Brow tint & shape. Dip Beauty
Therapy. In advance for your appt,
ph or sms Bilton Hilton Spa
0418 903 908
HERBALIFE
Independent
distributor for products call 9244
4318, 0450 032 061
MASSAGE By Alice: I combine
therapeutic massage with trigger
point therapy to give a relaxing
massage that loosens the client up,
leaving you more mobile, flexible,
and clear headed. My six years of
experience helps me best cater a
massage to effectively target your
specific needs. Mosman Park
location, $70 for one hour, $100 for
an hour and a half. Strictly non
sexual. Please call/text Alice on
0439 917 122
MASSAGE
Huna Hawaiian,
Swedish relaxation. Indulge yourself,
experience
deep
relaxation,
qualified, n/s Alanah
0405 755 715
SORE
Feet? Therapeutic foot
massage including Reflexology,
Reiki, Podiatry treatment. Genuine
care and time given. Health rebate.
Pip McGuinness Podiatrist, 39 years
experience. 9387 1027
WORKOUT
Fitness Cottesloe
classes. Gym Pilates. Maureen.
0418 950 112
YOGA
At North Fremantle
Community Centre. Vinyasa Flow
and Stretch & Relax. For all class
bookings & enquiries. Contact
Justine 0487 785 488
YOGA Kundalini. Ongoing open
classes Tuesday evening Wembley
and Thursday evening Fremantle.
Certified teacher
Suzanne 0414 883 139

ENGLISH And Literature tuition.


Very experienced Yr11/12 WACE
teacher/examiner/marker.
The
Tuition Centre, Bayview Terrace,
Claremont. 9284 3004

33601

ENGLISH
Specialist tuition at
Numberworks'nWords. Individualised
teaching, trained tutors. Full
Australian
curriculum.
Free
assessment. Ph 9388 3727,
www.numberworksnwords.com

DUNSBOROUGH
Absolute
beachfront, sleeps up to 6 adults & 4
kids, from $475 p/n. Still available
September and January holidays. See
our new website
www.catalpawhalerscove.com or
phone 9732 2040

FRENCH A to Z. Experienced tutor


from Paris. Specialised in WACE, IB
preparation. Business or private
travel. All levels welcome. 0404 172
287

5 Bdm beach house for holiday


rental in Dawesville. Sleeps 6 adults,
5 children. Ocean views. $400-$600
/night.
Call 0409 081 013

HUMAN Biology tutor. Eight years


tutoring experience. Current 5th year
Medical student with BSc Chemistry.
$50p/h.
James 0404 918 438

ALBANY 2 brm cottage. Central


views. Peaceful. $120 nt, $400 wk.
Also Granny flat (downstairs) 1
bdrm. $90pn, $300 pw, Nov/Dec.
0407 500 126

ITALIAN With an Italian. Beginners


to advanced levels. Language and/or
conversation lessons for students,
for business managers, for travellers,
for fans of Italian culture, habits,
food, fashion, opera, sport, politics.
Many tips on visiting my hometown
Ven
Venice where I have a rental
apa
apartment, capanada.com $30/h.
Co
Contact Signor Andrea on 0416 745
963 or email: pagnin.a@gmx.com

COTTESLOE Apartment. Great


ocean views from every room and
wide balcony. Renov 2brm fully furn
and equipped. Mins walk to beach
and train. Quiet street. Aircond, rates
from $110-$160pn, min 4. Special
weekly rates from $700 (winter). Ph
9339 4448 or 0405 670 803

NE
NEED
Help with maths? 1-1 tuition
at yyour home by UWA PhD for $65
/hr. Includes some free online tuition
before tests/exams! Ph Blair 0438
bef
965 775
ozimaths.com
ozi

HOUSESITTING

HOUSE SWAP

HOLIDAYS & RESORTS

MA
MATHS
Specialist tuition at
Nu
NumberWorks'nWords.
Ind
Individualised teaching, trained
tuto
tutors. Full Australian curriculum.
Fre
Free assessment. Ph 9388 3727.
ww
www.numberworksnwords.com

FAMILY Home close to the beach


in Cottesloe available from Friday
18th Dec until Friday 8th Jan 2016. 4
bedrooms and outside entertaining
area. Call Jane on 0408 938 560

SATURDAY 5th September at 200


Barker Road Subiaco. All under $15

CHEMISTRY Tutor Years 10-12.


Eight years experience. Current 5th
year medical student, with BSc in
Chemistry. Can tutor at your place or
meet at school/public library. $50 p
/h. Cottesloe local.
James 0404 918 438

MA
MATHEMATICS
Tutoring. Very
exp
experienced Yr11/12 WACE teacher
/ex
/examiner/marker. The Tuition
Ce
Centre, Bayview Terrace, Claremont.
928
9284 3004

HOMESTAY

COTTESLOE Beachfront apartment


avail. One b/r renov. Great views,
fully self cont. Rates from $95 pn
winter to $150 pn peak.
Ph 0405 670 803 or 9339 4448
www.24706.worldstays.com
DENMARK Charming 2x2 cottage
in Scotsdale Valley 0419 934 775
DUNSBOROUGH 3 bed, 2 bath,
$120/n. 60m to beach, near shops.
0457 357 431, 9341 3439
DUNSBOROUGH For rent. Holiday
house. 1 minute walk to town, 4
large bedrooms, 2 bathrooms, 2
toilets, large games room, air con &
deck area. Large block. $380 p/night
off season, $450 p/night peak period.
Call
0409 771 485

LOST & FOUND


FOUND One bracelet and two
diamond rings, Palmerston Street,
Mosman Park. Contact Cottesloe
Police Station 9286 7777
LOST Bunch of keys. Volvo key, 1
swipe, 1 bank token + 3 silver keys.
Possible Allen Park area, weekend
22nd-23rd August.
Please call 0412 898 434
LOST In Cottesloe area. Diamond
ring reward. 9384 0741
LOST Keys with everyday rewards
tag attached between Nedlands and
Claremont, Friday 28th August 2015.
Please ring 0403 497 498
LOST Pink and Grey Galah, male.
Mt Claremont area Tuesday. Please
ring Marie 0406 265 709

MARRIAGE
CELEBRANTS
COMMONWEALTH
Marriage
Celebrant-Professional and reliable,
Glenda Prideaux.
Mob: 0407 336 604.
Email: Glenda@glendaprideaux.com
www.glendaprideaux.com
PHOTOGRAPHER
Available.
Local, freelance. Capture that
special day or family event.
Reasonable rates. Mobile: 0412 294
711
www.faircloughphotography.com.au.
Email: newspics@iinet.net.au

MOTOR VEHICLES

CAR

MITSUBISHI Magna 1994 Auto, AC,


still runs good. Just serviced $875.
Floreat. 0406 710 065
SCOOTER
TGB. Blue. Good
condition. 2007, $600 neg. Please
phone 0434 902 146 or sms 0402
852 112
TOYOTA Camry Altise 2004. Very
good condition. Reliable first car,
regular service history, 200,305
Kms, licensed $3,700 neg.
0438 262 993 or SMS
VOLKSWAGON
Transporter
Van(White), 2 seater, good runner,
needs little work. $3,500 neg. Please
call 0434 902 146 and/or
sms 0402 852 112

MUSICAL
ALTO Saxophone, Clarinet, Flute,
Guitar, Piano, Trombone, Trumpet
lessons by qualified, experienced
teachers.
Piano
Exam
Accompaniment available with 6
weeks notice. Members of WAMTA,
TRBWA, ASMEWA, WWCC No.
from 8 years up. Michael/Mary. Ph
9387 7046
GUITAR Lessons. Eve Tsakalos
Guitar and String Inst School. Group
tuition and private lessons available,
any style taught. Learn from Perth's
most experienced teacher. Contact
Eve 9387 5014
GUITAR
Tuition, beginner to
advanced. eddierg@bigpond.net.au
9381 9146

OVERSEAS HOLIDAY
ACCOMMODATION
PARIS Apt. Sleeps 2-4. Perfect
location 2 minutes to Pompidou
centre, 12 minutes to Notre Dame.
Very clean, comfortable. All
conveniences. Visit
www.ourparisapartment.com.au or 0418
920 431
QUEENSTOWN NZ luxury Villa in
town, spectacular views of lake.
www.alpenview.co.nz or Karen 9384
4593

PERSONAL
ASIAN
Sensual
massage,
attractive. Understanding, your place
or my discreet home. From $75.
Cindy 0478 537 808
DANIEL
5000/Travelbum/Connor
1900. Contact Kim93216238
/chankheng123@gmail.com
HIGH Class Independent Escort.
Gorgeous blonde. Exclusive service
offering GFE massage, kisses,
cuddles & lots of fun! SMS Kitty 0455
105 798
SENSUAL
Massage qualified
therapist. Petite, brunette. By
appointment, Mosman Park, from
$70, Rachael, 0415 836 700
SENSUAL Relaxation/deep tissue
massage by experienced male
therapist. Mos Park.
Ph 0405 568 137
STUNNING Brunette Sara, for an
unbelievable sensual massage.
Cottesloe area. Ph 0451 700 143

PETS
110% Care while you're away.
Owner operated since 1998. 9382
3550 or visit
www.homeoraway.com.au
DOG Obedience classes. Qualified
dog trainer Neri Karazija Saturday
mornings and Wednesday evenings.
Bookings essential. Next classes
commence in late September 2015.
To express your interest ring Naomi
or Jaimee on 9384 2644
DOG
Obedience workshops.
Having trouble with recall, jumping
up and pulling on the lead? Our
Workshops with Neri Karazija are
just the thing. The next workshop will
be held in September. To express
your interest ring Naomi & Jaimee on
9384 2644
DOG Walker available. Sat & Sun
8am-4pm. Western suburbs. Max 2
dogs per walk $30 p/hr.
Call 0402 361 322
PUPPY
School and puppy
management.
Sundays
at
Swanbourne Veterinary Centre.
9:15am and 10:45 am respectively.
Barista coffee available! Just come
along or ring 9384 2644
SMALL Dog minding service in our
Wembley home. Huge yard walks
TLC. Ph Julie 0400 681 145

PHOTOGRAPHY
FREELANCE Photographer. Make
your business grow. Corporate and
private events.
Email:billie@faircloughphotography.com.au
Web:www.faircloughphotography.com.au. M:
0412 294 711.
www.linkedin.com/pub/billie-fairclough/22
/381/17

SITUATIONS VACANT
AIYANA Retreat in Denmark, is
looking for an experienced,
motivated massage therapist (Dip.
Remedial massage is preferred). We
offer an attractive combination of
accommodation, base salary plus
commission. Please send your
resume to
relax@aiyanaretreat.com.au or SMS
0427 483 258
FULL Time housekeeper required
Fremantle area. We require the
service of a full time housekeeper
6-7 days per week, 9am-11am
/12pm. You must hold a permanent
work visa for Australia, own transport
preferred. You must be: energetic,
punctual, efficient. Duties will
include: cleaning, ironing, laundry,
linen. Full housekeeping duties.To
apply please call Melissa (08) 9286
7402
GUTTER And downpipe installer.
Expanding company requires
experienced person to install gutters
and downpipes. Full-time position.
Must have car licence, own vehicle.
Hard work, good rewards. Good
team environment. Contact Shea
Vale at Rooftec on 0435 854 730 or
email: info@rooftec.com.au
RECEPTIONIST
P/t
Clinic
assistant:
Remede
is
multi-disciplinary wellness medicine
practice on Glyde St, Mosman Park.
We are looking for an experienced &
mature receptionist to join our
wonderful practice. Medical/health
reception experience is essential,
together with a genuine desire to
help others & personal interest in
health + wellness. The role involves
a high level of patient interaction & a
variety of reception & practice
support tasks, in a dynamic &
rewarding environment. Ability to
multitask & work with efficiency in a
busy environment is essential. This
permanent part-time position is
approx. 20 hrs/week with additional
flexibility essential to cover additional
shifts & staff leave. If you would like
to work in a practice that makes a
real difference to peoples lives,
please email CV to the Practice
Manager, Cherie White:
cherie@remede.com.au or call
9286 1166

Indigo Painting

OVERSEAS HOLIDAY
ACCOMMODATION
LONDON W2 Paddington Mews
House. Sleeps 5 quiet cul de sac.
150 meters from Heathrow Express!
Sue Millar 0418 904 229
PARIS Beautiful 2 bed apartment.
Left bank close to Notre Dame. Visit
www.5stjacques.com or call 0418
918 979

SITUATIONS WANTED
ACCOUNTING MYOB Mr Fixit. No
job too small, Phil 0419 952 261

POST, September 5, 2015 Page 109

Sell Subiaco Oval for cricket

classifieds classifieds
SITUATIONS WANTED
BABYSITTER Available for day,
evening and weekend work.
References, Police Clearance and
own reliable vehicle. $25 p/h, 3 hour
minimum. Please text and I can call
you back. West Leederville local.
Fran 0402 103 070
CAN-DO Uni student for general
jobs/labour/garden chores/clean-ups
etc. $24 hr. Can also use my small 4
wheel drive for minimum cost. Ph
0433 386 753
CHAUFFEURED Sedan service.
Airport and Western suburbs.
Luggage Trailer now available. VISA,
Mastercard and eftpos. Lic. 3862.
Call Barry 0422 376 943
CLEANER Housekeeper years of
experience in large homes and
antique furniture, Pol clearance with
excellent references. Honest, reliable
0415 170 739
CLEANERS Absolute Perfectionist
team of two with more than 10 years
experience in office, small business
and domestic cleaning. Reliable and
highly efficient w/ABN and Pol/Cls.
Call or leave message:
9203 9141, 0431 894 562
CLEANING Iron. Team of two.
Years of experience police c. $30
p.h. Nandy 0413 570 137
CLEANING
Lady experienced,
reliable, references, Pol Clr $30 p/h
0423 289 020
DOMESTIC Cleaner housekeeper.
Fastidious, experienced, efficient.
Excellent references, Pols/Cl 0431
915 972
GARDEN
A Backyard Blitz.
Experienced.
Phone Nick 0412 772 238
GARDENING
Lawnmowing,
whipper snipping, hedging, weeding.
Experienced and live local.
$30-$35ph.
Call Craig 0411 315 807
GARDENING
Reticulation.
Friendly, reliable and experienced.
One off or long term maintenance.
Free quotes. Reed 0401 498 737
GARDENING Weeding, clearing,
sweeping, hedge trimming. Steve
0410 089 830
GARDEN Maintenance. W/Subs.
Experienced,
special
rates
pensioners. 0498 837 612
GARDEN Makeovers, clean ups,
reticulation. Small jobs, free quotes.
Landscape apprentice.
Call 0423 477 822
HANDYMAN Efficient, reliable. 25
years
experience.
Painting,
gardening, tiling, craftsman etc. Call
Bob. 9444 6474, 0403 511 072
HANDYMAN
Repairs
and
maintenance. First class service.
Over 20 years experience. All work
guaranteed. Call David for a free
quote. Prompt reply 0448 793 841
IRONING A1 absolutely amazing
personal service by Chris who never
forgets you, talks to the kids and
pats the dog! Always on time, always
ironed the way you want. Early
morning pick up and delivery. Get
your summer clothes out now before
the rush. Casuals welcome. Call or
msg Lyn 0418 915 842,
email lynley@wsisperth.com.au
IRONING And Dry cleaning. Expert
24hr service. Quality work
guaranteed. Regular, reliable van
pickup and delivery to your door.
Local family run business.
Established 1986. Please phone
Prestige Ironers. "There are no
wrinkles in our reputation". 9385
7788 or 0403 121 181
IRONING Pick-up and deliver next
day, very good ironing $15/hr
Cottesloe/adjacent areas.
0438 968 215
MATURE Lady would like to help
with you cleaning ($35 p/h) or baby
sitting ($20p/h). Pleased to do odd
jobs while minding the children. First
aid, Police clearance, WWC card.
References available. Christine 0412
405 520 or 9446 2619
SEEKING
Employment, semi
retired. Anything considered. Ph
Trevor 9574 5762

TO LET
AAAAFOR more properties To Let
see the classified advertisement
in our Real Estate
APARTMENTS Subiaco/Nedlands.
Short-long stays, f/equipped fr. $86 p
/night. Near hospitals/l 0422 138 400
CLAREMONT 2 brm duplex plus
sleep-out, lounge/dining. A/C in
lounge and main bed. New kitchen,
bathroom. Private courtyard, off
street
parking.
Quiet,
low
maintenance. Close to Uni, transport
and shops. $395/week neg. 0412
234 885
DAWESVILLE For rent. Holiday
house, 2 storey with spectacular
views from large balcony. Large
theatre room, alfresco area, 4
bedroom, 3 toilet, sleeps 9 adults.
$640 per night or $3480 per week.
Call 0409 771 485
FLOREAT House 3x2x2 plus study,
close to Forum. Built in robes, walk
in robe, air con, dish washer, inc
gdning, long lease, $580/wk. For
details text
0419 920 408

From page 1

that it was there in black and white


that the state government is to
demolish and redevelop Subiaco
Oval, she said.
As a member I stood up and
asked them if the WAFC was going
to be able to make up the $15million difference that Subiaco Oval
generates for grassroots football
in this state.
They didnt like questions being
asked about football and they said
that was a matter for football.
Their response was that they
were just accommodating the
WAFC and that loss was up to the
football commission.
Ms Matheson described this as a
no-win situation and a devastating
loss for grassroots football and
Subiaco.
According to the WACA report,
the WAFC still has a 77-year lease
with Subiaco council for the Oval.
It is looking at other options
because AFL West Coast Eagles
and Fremantle Dockers matches
will move to the new Burswood
stadium in 2018.
The WAFC is now considering
alternative accommodation for its
administration and training facilities for its elite junior football and
umpires, the WACA said.
Co-location at a developed
WACA ground is one of the
WAFCs preferred relocation
options and presents some real
benefits for the WACA in terms of
sharing the ongoing maintenance

TO LET
MT
Claremont, Self contained
studio, 2 brm, new kitchen,
bathroom, a/c, courtyard. Suitable
working couple or single $450 pw.
Vacant now. Ph 0414 750 598
MT CLAREMONT
House, 3x1
great condition, alarm, retic, 2 car
space. Close to train, bus, schools.
Lease for a year with options from
January 2016.
Owner 0417 913 931
NEDLANDS To Let. Hampden Rd
Office, approx 48 sqm. Excellent
location $1250 + GST pcm inc. rates,
taxes and parking. David Azzopardi
0418 924 950
SMALL
Rear home, partly
furnished, close to Claremont
Quarter. Suit quiet tenant. $300 p/w.
0421 876 432
SOUTH Perth: Available now a 1 br
renovated, bright and cheerful ff
appt, in older complex with river
views. 5 mins walk to cafes,
restaurants, shops, hotel, ferry. Suit
working couple or single preferring
inner city living. Cycle to the CBD, or
Guildford or Fremantle. $300 pw. Ph
9446 4020
SUBIACO $750 pw. 8 Kings Rd, 4
/3 brm bathroom (bath) 2 toilets, sep
living areas, well loc stroll to Kings
Park, close to free bus to city/cbd.
Suit profess couple, very nice
property. Call Greg Hunter 9381
8686 or M: 0414 597 327
WEMBLEY W/Leederville duplex 3
br quiet secluded location, carport,
North facing courtyard, NO PETS
long lease, available now, suit
professional/couple $380-$420pw
0497 621 833 (phone only) 9383
9790

WANTED TO BUY
17TH To 20th Century antiques and
collectables wanted. Furniture, chest
of drawers, old clocks, pocket
watches, wrist watches, china, silver,
dolls, teddy bears. Will pay best
prices. Cash paid. Phone Philip of
Nedlands 0450 049 679 or 9380
6399
BRIC A Brac, old and vintage items
wanted.
Phone Paul 0412 736 291
DECEASED Estates, downsizing,
antiques, vintage, china, silver, cast
iron benches, wrought iron,
outdoors, garagenalia, mid century
furniture, Chinese, Japanese,
watches, tribal. Best prices paid. Gila
0422 931 587 or 9440 4711
QUALITY Antiques furniture & Art
17th to 20th C Chinese, Continental
& English, porcelain, Australiana.
Ted: 0414 242 659
VALVE Radios and old telephones
+ parts, any condition. Private
collector. Ph Andrew
9319 1703

WANTED TO RENT

house

HOME Or townhouse wanted to


rent in December for all or part of
period 7/12/2015 to 31/12/2015.
Ideal for house minding while owners
on hols.
Phone 0417 307 514

WEMBLEY
Single bedroom executive modern
apartment secure on first floor, fully
furnished morning sun private balcony.
Includes pool in group. One carport
and plenty more parking. Cambridge
street bus at your door and walk to
Subi train station and cafes. $300pw.
Wembley Estate Agency 0418 942
052

SEEKING Long-term house rental


in Cottesloe or nearby, one child at
Scotch. Excellent tenant with great
references from two previous
owners, Owner can access for
holidays if required. Experienced
with
house
and
garden
improvements, properties needing
work. Have furniture and white
goods. Prefer no agents, Flexible
starting date from immediate to mid
October. Contact Susie
0417 848 829

The WA Cricket Association suggests demolishing Subiaco Oval and using the money to rebuild the WACA ground.
and operational costs of the WACA
ground, potential cost efficiencies
associated with shared services
and maximising the utilisation
of the ground.
The WAFC also has a preference for a venue that is capable
of hosting the WAFL match-of-theround and finals matches.
Vacating Subiaco would also
open up purse strings for crickets
ambitions with the East Perth,
stadium the report said.
[Relocation] also provides a
strong argument for capital investment in the WACA ground, as it
would release the Domain oval site
for commercial and residential
development, the report states.
[We] have been pursuing negotiations with WAFC to develop a
draft memorandum of understanding to guide an ongoing negotiation
process.

Football bosses said they had


been in talks with cricket on a for
more than a year.
At this point in time, the WAFC
has made no decisions regarding
the location of its administration
facilities once AFL games cease at
Domain Stadium in 2018, but will
continue to examine and discuss
options, including the WACA
ground, the commission said in
a statement.
There is no agreement at the
current time for WAFL games or
finals to be played at the WACA
grounds.
In March, councillors unanimously voted to recommend the
turfed area, on which football
had been played for more 100
years, should be placed on the
state heritage list as a culturally
significant place.
Listing the 191m by 132m playing

Speed humps dumped


Speed humps in Claremonts Second
Avenue have been vetoed by councillors.
Chris Mews was the only Claremont
councillor who voted for the devices
and said they could be removed if they
didnt work.
A report proposed the cushions go in
between Graylands Road and Ashton
Avenue, after 49 residents signed a petition complaining about traffic speeds
and poor sightlines.
Its a very silly idea and Im very much
against it, councillor Karen Wood said.
She was worried about hump problems with horses in boxes during the
nearby Royal Show.
Councillor Jill Goetze said speed wasnt
an issue in Second Avenue.
Visibility and safety are, she said.
Parking bays on the crest [of the road]
would be very helpful.
The report cited Main Roads data from
2010 to last year, which showed there
were 13 crashes (two people injured,
and 11 properties damaged) between
Graylands Road and Ashton Avenue.

Nothing has changed my view that


the surface-to-air missile was supplied
by Russians to separatists, Curtin MP
Ms Bishop said.
It was an absolute bullseye it took
out the cockpit.
The atrocity on July 17 last year killed
298 people, including Scotch College boy
Mo Maslin, his siblings Otis and Evie,

Swinging voters
The swing planned for Swanbournes
Hatchett Park will be installed at its
original location.
Claremont council wanted to put it
in the northern part of the park, near
Brian Walker Lane.
But after notification letters were sent
to neighbours, one resident suggested
the swing go closer to Devon Road.
More letters were sent. Most of the
replies went with the original location.
The people have spoken, councillor
Karen Wood said at Tuesday nights
meeting.
The swing, deck replacement and bin
will cost $35,000.
Im delighted to see councillor Wood
is a swinger, councillor Peter Browne
said.

Wilson talks
pinged
From page 5

Crash central There were 13 crashes


on this Claremont road in the four years to
2014.
Councillor Bruce Haynes said humps
would only be a challenge to leadfoots.
The vote against the humps was 7-1;
The council will spend $8000 on traffic
islands and try to get Black Spot money
for roundabouts in the next financial
year.

MH17 work of expert


Foreign Minister Julie Bishop said
an expert had shot down MH17 over
Ukraine last year.

surface would have protected it


from redevelopment.
But last month, the day after
Subiaco councillors held a
workshop about the future of
the oval and grounds, they were
told the heritage push could be
in trouble.
A number of things have happened with this nomination that
indicated a very likely political
resistance to this nomination, a
senior council source told councillors.
Councillor Mark Burns who
moved the motion to heritage
list the oval said the WACA announcement proved why it needed
to be protected.
This is exactly what I had envisioned, he said.
Mr Barnett wishes to sell it
and listing it interferes with that
process, he said.
We need to be fighting the State
Heritage Office via public support
to list the oval or our involvement
in its future is over and done with.

and grandfather Nick Norris, who had


also gone to Scotch.
Ms Bishop was asked if the people
responsible for the atrocity would face
justice.
I believe so if the international
community remains focused on the
investigation, Ms Bishop said.
We need a prosecuting authority to
receive evidence.
Ms Bishop said Russia had vetoed a
tribunal.
Thats not the end of it, she said.
There are other options.
The best would be the United Nations
Security Council.
Ms Bishop said she was deeply concerned with Russian president Vladimir
Putins territorial aspirations.
Sanctions are hurting, but Putin has
an extraordinary way of presenting
Russias woes as the worlds fault.

Five on the list


Five people will be interviewed for
the job as Christ Church Grammar
Schools next principal.
Methodist Ladies College principal
Rebecca Cody is on the panel examining the candidates.

This action starts with us.


In his response to the email,
Mr Hill said there was clear opposition to what would have been
open discussions ... that could
bring a fresh and open mind to
the apparently long-standing yet
unresolved issues.
The situation has been discussed with [acting mayor Scott
Arbuckle] and while other options
were considered, I have taken the
decision to defer indefinitely any
meeting with Wilson Parking.
Wilson last week described
councillor Mark Burns psychopath comments as unprofessional,
inaccurate and damaging.
It said it had a long-standing
and successful contract with the
council and that it looked forward
to working with Subiaco.
Mr Arbuckle said: I would
prefer a more collegial approach
but at the end of the day we need
to move forward and the CEOs
determination has been pragmatic
and appropriate.
Mr Hill said it seemed now that
Wilsons only option to deal with
the council would be to make a
public statement at the start of
a committee or council meeting.
Meanwhile the high-profile spat
over the 46 council parking bays
in the Wilson carpark in Seddon
Street looks set to escalate.
Councillor Lee Hemsley will
put forward a motion later this
month to sever all commercial
links with Wilson.
Mr Hemsley said Subiaco
council occasionally used Wilson
Security, the same company which
subcontracts to Transfield Services
at the processing centres on Nauru
(since 2012) and Manus Island
(since February 2014) as part of
a more than $2billion contract.
There have been a string of
serious sexual and abuse allegations against asylum seekers and
detainees on both islands involving
Wilson staff at the centres.
Other allegations include claims
by former Nauru guards that
Greens Senator Sarah Hanson
Young had been spied on at the
island.

Page 110 POST, September 5, 2015

Austin Robertsons sporting

Cruise control

Fremantle midfielder
Michael Barlow is one of the
nice guys of football and has
been playing football brilliantly
since he was plucked out of the
VFL at the ripe old age of 23.
Hes always struck me as a
thoughtful sort of bloke: no tatts,
no weird hairdo, no embarrassing dickhead behaviour, no police chases -- just a good honest
footballer, fighting back after
having his leg smashed a few
years back in a horrible way and
giving every ounce of his being
for his team.
I asked Fremantle for an
interview with Barlow, but my
request was declined.
Why? I asked. Well, Freos
media guy said, he was subbed
two weeks ago.
Sure, I said, but he played well
again last week and, in any case,
I wasnt planning to interview
him about his form.
Who made that decision?
I asked.
Chris Bond [Freos football
manager], he replied.
So, no chinwag with Michael
a great shame, because hes a
very special player with quite a
story to tell.
He goes about his football like

a good sheepdog. No fuss, no


barking, no drama; and while
everybody else is faffing about,
all the sheep get rounded up and
deposited in the pen.
How did he do that without
us noticing?
How does he always seem to
be cruising? He doesnt look
fast and maybe he isnt. He just
seems to be one of those blokes
with an in-built radar, because
he always knows how to track
the ball.
Or maybe hes a magnet, and
the football just follows him.
Some players just know how
to read the play. These special
men do not have to learn or be
told where to go; they just turn
up where the ball happens to
be, without any rhyme or reason.
They always have the time,
and never hit the panic button.
Barlow is a bit like Guy
McKenna and Collingwoods
Scott Pendlebury, who also have
that special gift of never appearing hurried.
Hell hate me for saying it, but
my great mate from Subiaco FC
days and beyond, Wally Martin,
was another of those gifted
players who seemed to have an
in-built computer to calculate
where the ball was going next.

A real puzzler for WA sides


Every year, the last round
of the home-and-away season
throws up interesting issues
as teams jostle for position
and coaches and players hope
for the last-gasp performance
that might put ink on a new
contract.
This year, two really fascinating situations involve our WA
teams, and sorting them out
is trickier than doing Rubiks
Cube!
Pretty much everybodys
been happy that the Dockers
are resting as many as half
their wounded heroes from the
game in Adelaide this weekend, so theyll be cherry-ripe
for next weeks historic home
qualifying final.
But spare a thought for their
opponents, Port Adelaide.
Theyll finish ninth if they
win, but as low as 12th if they
lose, and while Im not saying
theyd ever tank to be beaten
and get better draft picks, its

a bit unfair if the other side


is allowed to, in effect, sit on
the grass and knit a purple
scarf while Port is forced to
run rings around them as if
nothing strange had happened.
I reckon the fair thing to
do would be to give Port the
same selection latitude that
Freo gets.
That gives them a chance to
test out some of their fringe
players and may give us a
more interesting spectacle.
Now, what an interesting position the Eagles are in. Youd
have to say that they will roll
over the top of the Saints and
secure second spot and a home
quarter-final, but is that actually the best thing for them?
Theyll almost certainly play
the Hawks then.
Win that, and the world is
their oyster.
But lose and the Hawks
are about as far from easybeats as you can get and they

have a danger home game


against a team like Richmond
or Adelaide, and then have to
front up to, probably, a rested
Freo in the prelim.
Whereas, if they lose to the
Saints and finish fourth, theyll
play Freo in the first round
with an extra day to recover
and no home-ground advantage
to either side and perhaps
theyd have a better chance
of going straight through to a
home preliminary final, more
than likely against the Swans.
So if the Eagles suddenly
found half their team had
come down with a mystery
flu virus and had to miss the
Saints game, that might not
be the worst thing thats ever
happened.
Its as hard to work out which
is the best path to what would
be an incredible Grand Final
appearance as it is to get all
the same coloured squares on
each side of that damn cube!

Thats real entertainment, folks


West Coast Eagle J-J-J-Josh
K-K-K-K-Kennedy has won the
Coleman Medal.

All talent and no fuss Michael Barlow.

Hallelujah.
With less emphasis on the
do I or dont I? this season,
Kennedy looks a different
player when shooting for goal.
In previous seasons, with his
stuttering approach, he looked
more like a drunken sailor walking the plank.
I actually found the Kennedy
shuffle entertaining, and the
Eagles faithful approved of it
wholeheartedly as well and
isnt that what our footy is really all about, entertainment?
These days, our football is a
full package of entertainment.
Lets take the stars of it all
the players and the various

trends in player appearance


on show every weekend.
Like society in general, theres
an ever-increasing number of
fashion statements.
Young (and not so young)
footballers use their skins as
canvases with terrific, grotesque
or melancholy graffiti.
It bobs up everywhere, led
by the flag bearer, the tattoo
supremo himself, Dane Swann.
I wonder sometimes where all
the ink starts and finishes with
Swanny. He looks like a map
of a Sydney inner-city suburb.
And what about bald heads
and beards?
Some of the bearded lads look
straight out of an early 1900s
Fremantle Derby.
J-J-J-Josh K-K-K-Kennedy
would blend into an old sides

black-and-white photographs
like he belonged.
And why, I ask (as I pamper
every remaining hair follicle
with expensive shampoo to try
to keep whats left from falling
out), do some of our young tyros
shave their heads?
Does it make them run faster?
There seems to be an increasing number of our football gladiators shaving off their youthful
locks like Gary Ablett junior.
Perhaps it is both a fashion
statement and a tactic to catch
the eye of the umpires when
Brownlow Medal votes are cast:
three votes for the bald guy, two
for the chap with red hair, and
one for the bloke with the beard.
Maybe J-J-J-Josh will win both
the Coleman and the Brownlow?

Wives and lovers in the sporting arena


The hue and cry about WAGS
(wives and girlfriends) being
on a cricket tour was a bit of
a giggle.
For a couple of weeks after
the disastrous Ashes series,
the chorus of leave the WAGS
at home sounded like Johnny
Cashs hit, Dont Take Your Guns
to Town complete with the same
dire consequences.
This probably happens in other
sports womens and mens
where sex the night before the
big match is taboo.
That admonition went about
in my football days, but if the
players were listening, very few
heard anything.

Though abstinence was recommended the Friday night before


a big match, my former coach
Haydn Bunton had a peculiar
take on it, saying Thursday was
the night to be avoided.
Maybe I should interview him
about why I never thought to
ask him.
To be fair, its different for
Test cricketers, who are away for
months and send text messages
every second night promising
they love her forever and will
make up for everything the second they get home.
Even home from a tour, they
often have time only to say hello
to the wife, pat the kids on the

head and get the grass stains of


the creams before theyre off to
yet another continent to do it all
over again.
Even when the Australian
team plays at home, its constant
travel around the country, even
immediately after theyve played.
You have to wonder whether
WAGS know what they are getting into when they sign on the
dotted line to share their lives
with a cricketer.
Back in the Bradman era,
rumour had it that only the Don
was permitted to take his wife
on tour.
It might have had something
to do with the mountain of runs

he scored, but I believe other


factors came into play with him.
I spent 20 years following
cricket tours interstate and
overseas, and wives were never
encouraged along. I know many
players some of the biggest
names in cricket found having
their wives around took their
minds off the job at hand.
And you didnt have to be
Nostradamus to predict that
having some players wives there
and others not split the ranks.
The problem didnt always revolve around good old-fashioned
nooky.
I can recall Allan Border
telling me one morning in

Birmingham that the previous


night, hed investigated a noise
outside his hotel room to find his
wicketkeeper, Wayne Phillips,
walking up and down the corridor comforting his crying
daughter.
It was 2am, and Wayne was not
out overnight.
AB was having none of it, and
in 1989, wives were not allowed
on tour until the boys had regained the Ashes.
I am not sure if theres a policy
about husbands, boyfriends and
lovers, but our womens side won
its Ashes series against the Poms,
so maybe the girls could give the
boys a few pointers!

POST, September 5, 2015 Page 111

Kids
Last weeks
doodle.

Jokes

Milla Leach (10)

Use this shape to make a drawing.


The best two entries will win.

Q: Which car is like a


sausage?
A: An old banger.
Ruby Read (7)

How to enter:
Complete your Doodlebug, drawing in the box on the page, and fill in the entry form. Cut
out your Doodlebug and entry form together and send them to POST Kids, 276 Onslow
Road, Shenton Park 6008, to arrive at our office by noon on Wednesday. The winning
entries will be published in the next POST Kids.

From robots
to an alien

Name: .........................................................................Age ............................

Hi Kids,

Address ...........................................................................................................

Regular reader Ruby Read (7),


from Subiaco, is one of our major
Doodlebug winners this week.
Her drawing of Ami the Robot
is a gorgeous riot of colour. I
particularly like the vibrant hair
shining in the sunlight. I hope
Ruby has a successful career in
the robot business because thats
some fancy robot design!
Milla Leach (10), also from
Subiaco, has created a funky-looking
alien for her winning Doodlebug. I
love the figures running away in the
background. I dont think he looks
too scary. Do you?

You could win $10

.....................................................................................Postcode ....................
Phone number: ..............................................................................................
What have you drawn?: .............................................................................

A card for Dad


What youll need:
craft paper
patterned paper
glue stick
kitchen string
scissors
pencil
marker
fineliner pen
ruler

Q: Whats a nuclear
scientists favourite
meal?
A: Fission chips.

We loved all the clever ideas you


came up with. Leilas bush camp
site was very inviting and Chloes
kookaburra was very rowdy. Neds
giant skull was terrific while Natalies
elephant was quite majestic.
Isabels school was surrounded
by beautiful gardens and I was glad
to see Cypresss building had plenty
of parking spaces. Sophies cow was
lovely and bright and Kates submarine was very well done.
Lilys TV show looked exciting
and Prestons robot was appropriately
named Rob.
I hope you have loads of fun
this week,
Jane

Q: What do you call a vet


with laryngitis?
A: A hoarse doctor.
Q: What do you call a pool
that costs more than
$1000?
A: An above grand pool.
Customer: Waiter, waiter,
bring me something to eat
and make it snappy!
Waiter: How about a
crocodile sandwich, sir?

ICE-CREAM WINNERS

Shop 4/531
Hay Street

Subiaco
9381 3100

What to do:
Fold the craft paper in half to make the card.
Cut three equal triangles from the patterned paper.
(Ours are 6cm deep)
Arrange the triangles and lightly mark with pencil
where they will go on the card.
Very lightly draw the D, A and D on the coloured
triangles with pencil and then use a felt pen to go
over them.
Cut two pieces of string about 5cm long. Mark
where they go with pencil and then use a tiny bit of
glue stick to hold them in place.
Glue the triangles over the string using the marks
you made before.
Lightly rule a pencil line at the bottom of your
card and pencil in your Fathers Day words and
then go over them in fineliner pen.
Finally, rub out your pencil lines.
Dont forget to write your message inside the card.

Lodge classifieds by web or fax


The POSTs successful pre-paid classifieds are
accepted by fax or on the special form on the POST
website at www.postnewspapers.com.au
Provided these ads are accompanied by valid
credit card details, they will be placed in the
next edition.
The POSTs standard low prices, shown on
the form on this page, also apply to the ads
faxed or lodged via the website.
After verification, a receipt can be faxed or
emailed back to advertisers on request.

Customer: Waiter, waiter,


theres a dead fly in my
wine.
Waiter: Well, you did ask
for something with a little
body in it, sir!

Fax your POST Classifieds to 9388 3883.


Website:www.postnewspapers.com.au
Dont forget to include the classification, such
as For Sale Household, Health & Beauty etc.
Security of credit card details on the website
is protected by military-level encryption. Its
security certification can be verified on the site.
The deadline is 10am Thursday.

These Doodlebug contestants have won


ice-cream vouchers.
Chloe Chan, Ned Moors, Sophie Nichols,
Preston Howesmith, Cypress Korten, Kate Correia,
Isabel Greenwood, Leila Read and Lily Nichols.

Classified ad.

ABN 50 008 917 717

Tongue twister
Four furious
friends fought
for the phone

40
Including
GST

FOR FIRST 2 LINES


Please write one
Word Per Space

Doodlebug

Q: What works only when


its fired?
A: A rocket.

This Advertisement to be included in the next issue of the


SUBIACO, CLAREMONT/NEDLANDS, MOSMAN/COTTESLOE and CAMBRIDGE POST.
CLASSIFICATION...........................................................Number of weeks

Amount Paid $........................................

$4.40
$5.50
$6.60
$7.70
$8.80
Lodge your ads by 10am Thursday on our secure website: www.postnewspapers.com.au

DEADLINES: At selected newsagents (listed below) by 2.30pm Wednesday,


or by 10am Thursday at POST Newspapers, 276 Onslow Road, Shenton Park 6008,
or Fax to 9388 2258 Attention Post Classifieds with valid credit card details. CLASSIFIEDS NOT ACCEPTED BY PHONE
If mailing please enclose $4.40 for the first 8 words plus $1.10 per 4 words thereafter. GST inc.
CLAREMONT

r$MBSFNPOU/FXT #BZ7JFX5FSSBDF
r"TIUPO"WFOVF/FXTBHFODZ OFBS4FDPOE"WF

r.PTNBO1BSL/FXTBHFODZ 
.POVNFOU4USFFU4IPQ$FOUSF

r$SPTTXBZT/FXT $SPTTXBZT4IPQQJOH$FOUSF

NEDLANDS

r4IPQ 4VCJBDP4RVBSF4IPQQJOH$FOUSF
4UBUJPO4USFFU 4VCJBDP

r%BMLFJUI7JMMBHF/FXT 8BSBUBI"WFOVF

r#SPBEXBZ'BJS/FXTBHFODZ #SPBEXBZ4IPQ$UF
r3PHFST/FXTBHFODZ #SPBEXBZ
r$BQUBJO4UJSMJOH/FXTBHFODZ
DPSOFS4UJSMJOH)JHIXBZ'MPSFODF4USFFU

FREMANTLE

PEPPERMINT GROVE

COTTESLOE

r/BQPMFPO4U/FXT "/BQPMFPO4USFFU
DALKEITH

r-VDLZ5FSSBDF/FXT 4PVUI5DF 'SFNBOUMF

r(SPWF1MB[B 1FQQFSNJOU(SPWF

SUBIACO SQUARE NEWSAGENCY

SWANBOURNE NEWSAGENCY

r4IPQ$MBSFNPOU$SFTDFOU 4XBOCPVSOF
WEMBLEY

r4NBSUT/FXTBHFODZ $BNCSJEHF4USFFU 
$OS+FSTFZ4UFFU

HOLLYWOOD NEWSAGENCY

r)BNQEFO3PBE /FEMBOET
MOSMAN PARK

r8FMMJOHUPO4U/FXT 8FMMJOHUPO4USFFU

Lodge your classified online at


www.postnewspapers.com.au for our secure website
SUBIACO

Page 112 POST, September 5, 2015

ljhooker claremont
1089sqm

at

S
12 atu
.3 rd Au
0p a c
m yS t
(U ep io
nl te n
es m
s S be
ol r 1
d 9
Pr
io
r)

Land size

5 Corry Lynn Road Claremont

1089sqm

COME ON IN!
Come on in and enjoy this spacious family home, which offers
true character on a generous 1089sqm block. Loved by one
family for many years and recently revamped, this grand old lady
has good bones, high ceilings and polished jarrah floors.
There is a spacious family room, dining room, country style
kitchen, large main bedroom with BIR and ensuite, a second
bedroom with ensuite, three further bedrooms, bathroom with
bath, laundry and double carport. Other features include split
system air conditioning, freshly painted, revamped bathrooms,

fireplaces, a front alfresco porch and large garden with mature


trees.

Auction Saturday September 19, 2015


at 12:30PM (Unless Sold Prior)

Full of potential to be a unique and spacious home for a


PRGHUQIDPLO\WKHSURSHUW\LVRSSRVLWHVRPHRI3HUWKVEHVW
schools. With shops just a stroll away and easy access to
the river, this is a brilliant setting on which to make your mark.
Come in and see the possibilities!

View Sat 11:00AM - 11:30AM


claremont.ljhooker.com.au

Vivien Yap 0433 258 818


vivien.yap@ljhooker.com.au
All information contained herein is gathered from sources we consider to be reliable. However, we cannot guarantee or give any warranty about the information provided. Interested parties must solely rely on their own enquiries.

claremont.ljhooker.com.au

LJ Hooker Claremont 08 6588 5888

Related Interests