You are on page 1of 254

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

So Cristvo, 2011

UNIVERSIDADE FEDERAL DE SERGIPE


REITOR
Josu Modesto dos Passos Subrinho

VICE-REITOR
Angelo Roberto Antoniolli

EDITORA/UFS
COORDENADOR DO PROGRAMA EDITORIAL
Pricles Morais de Andrade Jnior
COORDENAO GRFICA
Germana Gonalves Araujo
EDITORAO ELETRNICA
Luclio Freitas
CAPA
Sandra Pinto Freire
FICHA CATALOGRFICA ELABORADA PELA BIBLIOTECA CENTRAL
DA UNIVERSIDADE FEDERAL DE SERGIPE

Dik : revista do mestrado em direito da Universidade Federal de Sergipe / Programa


de Ps-Graduao em Direito. Vol. 1, n. 1 (jul./dez. 2011). -- So Cristvo:
Editora UFS, 2011.
252 p.
ISSN 2237-2040
1. Direito - Peridicos. I. Ttulo: Revista do mestrado em direito da Universidade
Federal de Sergipe.
CDU 34(05)

Cidade Universitria Jos Alosio de Campos


CEP - 490100-000 - So Cristvo - SE
Telefone: 2105.6920 - 21056922 - 21056923 - e-mail: editora@ufs.br
www.ufs.br/editora

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe


Nmero 1 - Julho a Dezembro de 2011

ADMINISTRAO
Editor Responsvel:
Constana Marcondes Cesar
Editor adjunto do nmero 1:
Luciana Aboim Machado Gonalves da Silva
Comit Editorial:
Carla Eugenia Caldas Barros, Carlos Alberto Menezes, Flvia Moreira Guimares Pessoa, Jussara Maria Moreno Jacintho, Luciana Aboim Machado Gonalves da Silva.
Comit Executivo:
Constana Marcondes Cesar, Clara Anglica Gonalves Dias, Daniela Carvalho Almeida da Costa, Henrique Ribeiro Cardoso, Lucas Gonalves da Silva,
Otvio Augusto Reis de Sousa, Ubirajara Coelho Neto.
Conselho Editorial:
Aquiles Cortes Guimares (UFRJ), Antonio Braz Teixeira.
(Universidade Autonoma de Lisboa), Denis Borges Barbosa (PUC RJ), Maria
Garcia (PUCSP), Eduardo Reale Ferrari (USP); Domingos Savio Zainaghi,
Trcio Sampaio Ferraz (USP), Jos Maria Arruda de Andrade (USP), Francisco Perez Amors (Universidad Autnoma de Barcelona), Alberto Levi (Universit de Modena e Reggio Emilia), Fabio Oliveira (UNESA), Paulo Ferreira
da Cunha (Universidade do Porto), Maria Augusta Paim (USP).
Equipe Tcnica:
Marcle Vanessa Menezes Santana: Reviso do ingls.
Descrio:
$5HYLVWDHGLWDDUWLJRVHUHVHQKDVGHFRQWH~GRORVyFRHMXUtGLFR2VWH[WRV
abordam aspectos crticos envolvendo tpicos relativos, focalizando preferencialmente os temas:justia, pessoa, liberdade, cuidado, responsabilidade,
direitos humanos, violncia. Busca ser expresso dos grupos de pesquisa em
'LUHLWRHHP'LUHLWRH)LORVRDEHPFRPRGRVJUXSRVGHSHVTXLVDHSHVTXLVDdores de outras instituies, preferencialmente vinculados a projetos conjuntos
e a acordos de cooperao com os da Universidade Federal de Sergipe.
A Revista tem periodicidade semestral.

DIK

Review Masters in Law of Sergipe Federal University


First Edition July December 2011

MANAGEMENT
Chief Editor:
Constana Marcondes Cesar
&RHGLWRURIWKHUVWHGLWLRQ:
Luciana Aboim Machado Gonalves da Silva
Editorial Commission:
Carla Eugenia Caldas Barros, Carlos Alberto Menezes, Flvia Moreira Guimares Pessoa, Jussara Maria Moreno Jacintho, Luciana Aboim Machado Gonalves da Silva.
Executive Commission:
Constana Marcondes Cesar, Clara Anglica Gonalves Dias, Daniela Carvalho Almeida da Costa, Henrique Ribeiro Cardoso, Lucas Gonalves da Silva,
Otvio Augusto Reis de Sousa, Ubirajara Coelho Neto.
Editorial Council:
Aquiles Cortes Guimares (UFRJ), Antonio Braz Teixeira.
(Universidade Autonoma de Lisboa), Denis Borges Barbosa (PUC RJ);
Eduardo Reale Ferrari (USP); Domingos Savio Zainaghi, Trcio Sampaio
Ferraz (USP), Jos Maria Arruda de Andrade (USP), Francisco Perez Amors
(Universidad Autnoma de Barcelona), Alberto Levi (Universit de Modena e
Reggio Emilia), Fabio Oliveira (UNESA) Maria Garcia (PUCSP), Paulo Ferreira da Cunha (Universidade do Porto), Maria Augusta Paim (USP).
Technical staff:
Marcle Vanessa Menezes Santana: english translation.
Description
7KHVFLHQWLFMRXUQDOSXEOLVKHVSDSHUVDQGUHYLHZVRQERWKODZDQGSKLORVRphical content. The articles have to involve critical aspects related to topics,
focusing mainly on themes such as justice, individual, freedom, responsibility,
human rights and violence. Its attempt is to be an expression of Law and Law
and Philosophy research groups of Sergipe Federal University, as well as research groups and researches from another institutions, mainly those related
to projects and cooperation agreement with Law research groups of Sergipe
Federal University. It is published periodically,each six month.

Sumrio

ARTIGOS

PGINAS

O direito de sequncia: sobre o preo ou sobre o aumento do preo?


J. Oliveira Ascenso
17
Imputao Objetiva: breve incurso doutrinria
Daniela Carvalho Almeida da Costa

29

Do principio quantum vindicatum em Propriedade Industrial


Denis Borges Barbosa

39

Direitos fundamentais no atendimento hospitalar


Flvia Moreira Guimares Pessoa

55

Acumulao de Cargos Pblicos e o Regime de Dedicao Exclusiva


no mbito das Universidades Federais brasileiras
Henrique Ribeiro Cardoso
69
Direito ao desenvolvimento e o municpio na cf/88
Jussara Maria Moreno Jacintho

101

Mediao interdisciplinar:Um caminho vivel autocomposio dos


FRQLWRVIDPLOLDUHV
Luciana Aboim Machado Gonalves da Silva
121
Direito e Msica: dois caminhos e um s rumo
Carla Eugenia Caldas Barros

137

O pacto de no-concorrncia no direito do trabalho portugus


Mrcio Granconato

153

The development of Syndicalism in Brazil and the convention 87 of the


ILO Constraints and Challenges
Otavio Augusto Reis de Sousa
169

Teoria dos bens e a essencialidade dos medicamentos: a funcionalizao da propriedade em prol dos valores existenciais
Pedro Marcos Nunes Barbosa
185
Estado constitucional e partidos polticos: Sistemas e Crises.
Ubirajara Coelho Neto

209

RESENHAS
GONALVES DA SILVA, Luciana Aboim Machado. Termo de ajuste
de conduta.
Anna Catharina Fraga Machado
247

Contents

ARTICLE
The right of sequence: is it about the price or about the prices increase?
J. Oliveira Ascenso
Objective Imputation: a brief doctrine overview
Daniela Carvalho Almeida da Costa
The principle quantum vindicatum in Industrial Property
Denis Borges Barbosa
Essential rights in hospital treatment
Flvia Moreira Guimares Pessoa
And Exclusive dedication on Brazilian public universities
Henrique Ribeiro Cardoso
Law and development and municipality in cf/88
Jussara Maria Moreno Jacintho
,QWHUGLVFLSOLQDU\PHGLDWLRQDSRVVLEOHZD\RIIDPLO\FRQLFWVFRPSRVLWLRQ
Luciana Aboim Machado Gonalves da Silva
Law and Music
Carla Eugenia Caldas Barros
The agreement of non-concurrence in Portuguese Labor Law
Mrcio Granconato
The development of Syndicalism in Brazil and the convention 87 of the
ILO Constraints and Challenges
Otavio Augusto Reis de Sousa

Property theory and remedy essentiality: the function property on the


behalf of existential values
Pedro Marcos Nunes Barbosa
Constitutional State and political parties: systems and crisis
Ubirajara Coelho Neto
Book review
GONALVES DA SILVA, Luciana Aboim Machado.Termo de ajuste
de conduta.
Anna Catharina Fraga Machado
247

EDITORIAL

Chamamos nossa revista de DIK, lembrando a deusa que era a


SHUVRQLFDomRGDMXVWLoDQDTeogoniaGH+HVtRGR2WHUPRVLJQLFDYD
tambm direito, justia, as vias da justia, o justo, e com esse sentido que aparece no Leis GH 3ODWmR$R ODGR GH7KpPLV SHUVRQLFDo da justia dos tribunais, Dik exprimia a justia como conduta,reto
DJLUpWLFD1RVSRHPDVGH2UIHX'LNppOKDGH7KpPLVHLUPmGH,UHQH
DSD] HGH(XQRPLD DRUGHPOHJDO VHXQRPHVLJQLFDa justa retribuio8PDYDULDQWHGDWHRJRQLDyUFDDPRVWUDFRPROKDGR6ROHGD
1RLWHVLJQLFDQGRVHXQRPHa justia no mais alto grau.
sob a gide da antiga e perene tradio, que apresentamos comunidade acadmica os trabalhos dos professores da Faculdade de Direito e alguns resultados das pesquisas em andamento no Mestrado e na
Faculdade de Direito da Universidade Federal de Sergipe. Contamos
tambm com a colaborao de colegas de outras universidades que tm
DQLGDGHVFRPDVLQYHVWLJDo}HVTXHUHDOL]DPRV
no intuito de estreitar laos entre a graduao e ps, em nossa
Universidade; e entre nosso Mestrado e outros grupos de trabalho de
outras instituies que expomos nossas contribuies e convidamos
nossos colegas a participar de nossa revista.
Esperamos tambm que a publicao seja um caminho para apresentar comunidade acadmica as linhas de pesquisa vigentes no Mestrado que ora iniciamos. Abordam a constitucionalizao do Direito, a
HFiFLDGRVGLUHLWRVIXQGDPHQWDLVQDVUHODo}HVSULYDGDVRJDUDQWLVPR
penal e a violncia, bem como estudam as relaes entre Direito e FiloVRDDIXQGDPHQWDomRGR'LUHLWRHH[DPLQDPDKHUPHQrXWLFDORVyFDHFRQVWLWXFLRQDO
A Redao

EDITORIAL

2XUVFLHQWLFMRXUQDOLVQDPHG',.eDIWHUWKH*RGGHVVZKRZDV
WKHSHUVRQLFDWLRQRIMXVWLFHLQ+HVLRGVTeogonia. The term also meant law, justice, justices ways, what is just, and this is the sense which
is used in The Laws of Plato. Dik expressed justice as conduct, the
right way of acting and ethics.In the Orpheus poems, Dik is the Thmis daughter and the Irenes (Peace) and Eunomias (Legal Order)
sister; her name means right retribution. A variation of the orphic theogonies presents Dik as a Sun and Nights daughter; she is the highest
level of the justice.
Under the aegis of the ancient and perennial tradition we present
to the academic community the professors works in progress from Law
College and some results of researches in progress at Masters Degree
course and Law course from Sergipe Federal University. We also have
the cooperation from colleagues of other universities who have similarities in their works with ours.
With the intent to approach undergraduate and graduate courses in
this university as well as between our Masters Degree and different
research groups from another institutions that we expose our contribuWLRQVDQGLQYLWHRXUFROOHDJXHVWRMRLQXVLQRXUVFLHQWLFMRXUQDO
We also hope that the periodical becomes a way of presenting the
university the research lines that we have just started.It copes with the
/DZV FRQVLWXWLRQ WKH HIFDF\ RI IXQGDPHQWDO ULJKWV LQ WKH SULYDWH
relations, the violence as well as it studies the relatins between Law
and Philosophy, and it examines the philosophical and consitutional
hermeneutics.
The editorial staff

O DIREITO DE SEQUNCIA:
sobre o preo ou sobre o aumento do preo?
Jos de Oliveira Ascenso
Resumo: O direito de sequncia recai sobre o suporte material de obras
DUWtVWLFDVWHQGRVLGRMXVWLFDGRKLVWRULFDPHQWHPHGLDQWHRDFHQWRPLVHrabilista da condio dos artistas. Mas hoje defendido como devendo
passar a recair sobre o preo total, o que o empolaria muito. A ser assim
SHUGHULDWRGDDMXVWLFDomRSRUTXHRGLUHLWRGRDUWLVWDUHFDLVREUHDREUD
imaterial e no sobre o suporte aps alienado. Traria consequncias absurdas, como a de gravar o revendedor mesmo quando sofre prejuzo
e provocaria a deslocalizao das vendas para pases que no estabeleam esse gravame. Representaria na realidade uma anmala tributao
de transaes em benefcio de interesses privados.
Palavras-chave: Direito de sequncia. Obra intelectual. Suporte material da obra. Obra de arte. Revenda de original de obra. Direito de autor.
Abstract: The right of sequencerests upon the material support on artistic
ZRUNVDQGLWKDVKLVWRULFDOO\EHHQMXVWLHGE\WKHDUWLVWVPLVHUDEOHFRQGLtion. However, it is nowadays defendedas something that has to rest upon
the total price, what would not beinteresting in its sale. In this sense, it would
ORVHDOOWKHMXVWLFDWLRQEHFDXVHWKHDUWLVWVULJKWUHVWVXSRQWKHLPPDWHULDO
work and it does not restupon the support after its alienation. It would bring
absurd consequences, suchas the dealers recording even when oneself suffers loss and it would provoke salesdisplacement in countries that do not
establish this lien. Indeed, it wouldrepresent an anomalous taxation in the
WUDQVDFWLRQVLQRUHGHUWREHQHWSULYDWHLQWHUHVWV
Key words: Right of sequence. Intelectual work.Works material support. Artwork. Works original resale. Authors right.
* Prof. Catedrtico da Faculdade de Direito de Lisboa e jurisconsulto. Antigo Professor Titular da Faculdade de Direito do Recife. Presidente da Associao Portuguesa de Direito Intelectual. Scio da Academia das Cincias de Lisboa. Delegado
de Portugal a vrias conferncias diplomticas. Autor de anteprojectos de diplomas
legislativos e de cerca de 375 estudos jurdicos.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

1. BASES DO REGIME NO BRASIL E EM PORTUGAL


O direito de sequncia representa um dos muitos aspectos em que o
GLUHLWRGHDXWRUDWXDOXOWUDSDVVRXRVLJQLFDGRHkPELWRTXHLQLFLDOPHQte lhe havia sido atribudo.
Concretiza-se em caso de revenda de obra de arte original: art. 38
da LDA (Lei dos Direitos Autorais brasileira1) e art. 54/1 do CDADC
(Cdigo do Direito de Autor e dos Direitos Conexos portugus2). A
lei brasileira acrescenta ainda a hiptese de revenda de manuscritos
originais: constava tambm do Cdigo do Direito de Autor portugus
de 1966 mas foi suprimida, por ter hoje escasso interesse. A lei portuguesa exclui ainda as obras de arquitetura ou de arte aplicada; apesar
de faltar previso semelhante na lei brasileira haver provavelmente
que chegar por interpretao restritiva a concluso idntica, dada a
QDWXUH]DGHVWHVEHQV0DVVHULDPHOKRUTXHDOHLRHVSHFLFDVVHSDUD
evitar perplexidades da praxis.
H tambm diferenas na caracterizao dos requisitos da revenda.
1. A lei portuguesa exige a interveno de qualquer agente que
DWXHSURVVLRQDOHHVWDYHOPHQWHQRPHUFDGRGHDUWH DUW 
A lei brasileira visa toda a revenda, sem mais.
2. A lei brasileira no prev limite mnimo para a incidncia do direito de sequncia, enquanto a lei portuguesa isenta as transaes
de valor inferior a 3.000,00 (art. 54/4 a).
3. A lei brasileira no prev limite mximo para a participao em
FDGDWUDQVDomRHQTXDQWRDOHLSRUWXJXHVDRFDHP
(art. 54/5).
(QPDOHLEUDVLOHLUDHVWDEHOHFHDLQFLGrQFLDGRGLUHLWRVREUH
RDXPHQWRGRSUHoRHYHQWXDOPHQWHYHULFiYHO (art. 38), enquanto a lei portuguesa a estabelece sobre o preo obtido, livre
de impostos.

O autor tem o direito, irrenuncivel e inalienvel, de perceber, no mnimo, cinco


SRUFHQWRVREUHRDXPHQWRGRSUHoRHYHQWXDOPHQWHYHULFiYHOHPFDGDUHYHQGDGH
obra de arte ou manuscrito, sendo originais, que houver alienado.
O autor de uma obra de arte original que no seja de arquitectura nem de arte aplicada
tem direito a uma participao sobre o preo obtido, livre de impostos, pela venda
GHVVDREUDUHDOL]DGDPHGLDQWHDLQWHUYHQomRGHTXDOTXHUDJHQWHTXHDFWXHSURVVLRQDO
e estavelmente no mercado de arte, aps a sua alienao inicial por aquele.

18

J. Oliveira Ascenso

No podemos prosseguir neste cotejo. Observamos que as diferenas entre as legislaes so tambm muito grandes a nvel mundial.
So maioria as leis que no prevem de todo o direito de sequncia;
e entre as que o prevem variam os regimes e percentagens concretamente estabelecidos. Essas diversidades explicam-se parcialmente
por a Conveno de Berna apenas contemplar o direito de sequncia a
ttulo facultativo, no art. 14-ter, sem o caracterizar mais precisamente;
e em consequncia esse direito ter sido recebido com o mesmo carter
no ADPIC / TRIPS, ao fazer a remisso para as disposies substantivas da Conveno de Berna, constante do art. 9 daquele Acordo 3.
Por outro lado, h que no esquecer que a lei portuguesa sofre a
incidncia das fontes da Comunidade Europeia, neste caso da Diretriz
n. 01/84/CE, de 27 de setembro, sobre o direito de sequncia. A lei
portuguesa regulara anteriormente o direito com incidncia sobre o aumento do preo (Cdigo de 1966). Hoje, no pode evitar a incidncia
da participao sobre o preo4.

2. A JUSTIFICAO HISTRICA DO DIREITO DE


SEQUNCIA: O LUCRO POR REVENDA DE QUE O
AUTOR NO PARTICIPA
2VLJQLFDGRGRGLUHLWRGHVHTXrQFLDSDUDDGRJPiWLFDGRGLUHLWRGH
autor muito maior do que poderia parecer primeira vista.
Dir-se-ia que tal direito seria um elemento do direito de autor como
qualquer outro, que recairia sobre a obra de arte original. Manifestaria
assim a genrica atribuio da obra ao autor para explorao econmica.
0DVQmRpDVVLPpDQWHVXPDJXUDGHWRGRjSDUWH2REMHWRGR
direito de sequncia no a obra, mas sim o suporte desta. Recai sobre
 6REUHDVGLFXOGDGHVGHDMXVWDPHQWRLQWHUQDFLRQDOQHVWHGRPtQLRQRPHDGDPHQWHGHcorrentes do condicionamento reciprocidade, veja-se j Eugen Ulmer, Le droit de
suite et se rglementation dans la Convention de Berne, na obra coletiva Hommage
Henri Desbois. A lei portuguesa sujeita reciprocidade a atribuio deste direito a
nacionais de pases no comunitrios (art. 54/11). A lei brasileira no se pronuncia.
4
No Brasil, o STJ pronunciou-se sobre este direito em Acrdo de 2.IV.09. Considerou, a propsito de uma alienao de obras de Portinari realizada pelo Banco de
Brasil, que o direito de sequncia incide mesmo nos casos em que a primeira alienao s tenha sido realizada pelos herdeiros do artista. Note-se que a deciso versou
sobre a situao luz ainda da Lei n. 5.988, que regia o caso.
3

19

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

o originalRTXHVLJQLFDTXHUHFDLVREUHXPDGDGDUHDOLGDGHFRUSyUHD
e no sobre um bem imaterial.
De fato, a obra de arte como objeto do direito de autor a expresso imaterial da criao, e no o suporte desta, tal como em qualquer outro direito intelectual. Por isso a obra indestrutvel. Uma obra pode ser
incorporada num suporte, mas o direito que recai ento sobre o suporte
no o direito de autor, o direito de propriedade. A confuso que se faz
em matria de direito de sequncia provm do valor que socialmente se d
ao original da obra sendo original o suporte que pessoalmente tiver sido
elaborado pelo artista. Mas essa mais valia meramente de carter social e
independente do direito de autor. A obra continua a mesma ainda que seja
objeto de mil reprodues. Persiste ainda que todos os exemplares tenham
sido destrudos, desde que se possa fazer a prova da obra o que hoje
PXLWRIDFLOLWDGRSHORVLQ~PHURVPHLRVWpFQLFRVGHUHSURGXomRHOH[LVWHQte. Quem se apresentar como autor da obra de outrem desaparecida comete usurpao; e comete plgio quem se apropria dos traos fundamentais
daquela em obra que assina como prpria. A obra, como bem imaterial,
imperecvel, pode perder-se a possibilidade de provar a sua expresso
nica, como aconteceu a tantas obras-primas de arte do passado.
$PDLRUYDOLDQmRWHPSRLVRVLJQLFDGRGHWRUQDURRULJLQDORREjeto do direito de autor: um fenmeno meramente mercadolgico. O
IDWRGHRGLUHLWRGHVHTXrQFLDUHFDLUVREUHRRULJLQDODSHQDVFRQUPD
que o objeto deste direito no a obra intelectual, mas um determinado
suporte desta. Ento temos de saber por que razo o autor vem incidir
sobre as revendas, quando nestas est em causa a propriedade do suporte, e no a titularidade da obra intelectual. A propriedade do adquirente, a quem o artista vendeu originariamente a obra, ou dos transmissrios deste; e o artista no tem nesse direito nenhuma participao.
A transferncia do objeto da proteo, do bem imaterial para o suSRUWHH[LJHSRLVXPDMXVWLFDomRPXLWRSDUWLFXODUTXHQDGDWHPTXH
YHUFRPDMXVWLFDomRGRGLUHLWRDXWRUDOHPVL$VVLPFRPRTXHPYHQGH
um automvel ou um bem material no participa do valor obtido em
caso de revenda, porque acontece diversamente quando o bem material obra de arte que revendido?
,QLFLDOPHQWHFRORFRXVHHVVDMXVWLFDomRQRDXPHQWRGRSUHoRREtido em caso de revenda da obra de arte.
Se o direito de sequncia recasse sobre o aumento do preo, haveria uma razo, embora em rigor extra-autoral (porque o que est em
causa o suporte, que propriedade do adquirente): o fato de o adqui20

J. Oliveira Ascenso

rente estar fazendo negcio custa da valorizao de uma obra de arte,


de que o artista no participaria.
(VVDMXVWLFDomRIRLDFHQWXDGDHUHSHWLGDHPGLVFXUVRVHDWpGHVHnhos de forte tom miserabilista. Apresentavam-se os herdeiros do autor
na misria enquanto os ricaos faziam pingues lucros em consequncia
da valorizao de quadros ou outras obras de arte. Em todo o caso, uma
MXVWLFDomRHPERUDQmRDXWRUDOLVWDeYHUGDGHTXHDDTXLVLomRGRVXSRUte da obra no d ao adquirente qualquer participao na titularidade do
direito de autor (arts. 37 LDA e 10/2 CDADC), mas a inversa tambm
verdadeira: a alienao do suporte no d ao autor, por invocao do
direito de autor, quaisquer direitos sobre o suporte. Nada impede porm
que, quando se regula o direito de autor, se regulem tambm situaes
acessrias que possam derivar do fato de, aproveitando a valorizao do
suporte, algum estar obtendo mais-valias de que o autor no participa.
Entendida neste sentido, a atribuio do direito de sequncia, embora no
VHMDSURSULDPHQWHFRQWH~GRGRGLUHLWRGHDXWRUWHPMXVWLFDomRquantum
satis, podendo o legislador a seu alvedrio reconhec-lo ou no.
(VWH SHUO GHVYLDQWH HP UHODomR DR GLUHLWR GH DXWRU MXVWLFD SRU
RXWURODGRRFDUiWHUXLGRGDVSUHYLV}HVLQWHUQDFLRQDLVQDPDWpULD2
direito de sequncia acolhido na Conveno de Berna mas sem conWRUQRVGHQLGRVHDWtWXORPHUDPHQWHIDFXOWDWLYR$JUDQGHPDLRULDGRV
pases desconhecem-no. J a Comunidade Europeia, numa senda exacerbadamente protecionista, o impe aos pases comunitrios, como
melhor veremos de seguida.

3. A EVOLUO PARA A INCIDNCIA SOBRE O PREO E


NO SOBRE O AUMENTO DO PREO
Mas a evoluo neste domnio no se quedou por aqui.
Uma vez dado este primeiro passo, logo se procurou ir alm, dentro
do movimento geral do empolamento do direito autoral a que se assistiu
no sc. XX, e que atingiu um ritmo galopante no ltimo quartel deste.
De fato, de vrias maneiras se procurou fazer atingir pelo direito
intelectual os prprios suportes da obra. exemplo a excluso do esgotamento internacional que permitiria ao autor comandar a comercializao da obra que lanara no mercado, contra os princpios normais da
concorrncia e do comrcio internacional.
Procurou-se reforar o direito autoral, tomando como base sobre
21

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

que incide o direito de sequncia, no o aumento do preo, mas o prprio preo obtido na revenda.
Invocaram-se razes vrias. Esgrimiu-se com o fato de o artista
QmR GRFXPHQWDU QRUPDOPHQWH R SUHoR GH YHQGD R TXH GLFXOWDULD D
demonstrao do aumento do preo.
Porm, se o artista no se precaveu, sibi imputet. O Direito no
pode tomar funo tutelar, defendendo o artista contra si mesmo. D os
meios, mas cabe aos interessados aplic-los. No pode porm agravar
a situao da FRPXQLGDGHSDUDUHPHGLDUDLQpUFLDGRVEHQHFLiULRV. E
DFRPXQLGDGHFDHIHWLYDPHQWHDJUDYDGDFRPRYHUHPRV
de fato muito de supor que a razo fundamental no seja esta. A
que a percentagem obtida sobre o preo da revenda, ainda que mais
baixa que a que fosse estabelecida sobre o aumento do preo, resultaria
em montante muito superior, porque o preo supera necessariamente o
aumento do preo. As entidades de gesto coletiva encontram aqui um
QRYROmRQmRREVWDQWHWHUHPMXVWLFDomRLQWUtQVHFDDYHUGDGHpTXH
elas agem como empresas, procurando sempre incrementar os proventos resultantes da sua atividade.
$UJXPHQWDVH HQWmR FRP DV GLFXOGDGHV UHVXOWDQWHV GR VLVWHPD
de aumento do preo. Diz-se que o autor no conhecer as transaes intermdias realizadas, porque no carecem de ser publicitadas.
Qualquer que seja a validade do argumento, a verdade que o sistema
evoluiu internacionalmente no sentido de recair apenas sobre as transaes realizadas por estabelecimentos especializados ou pelo menos
aquelas em que intervenha um intermedirio ou agente comercial. A
ser assim, ento o mesmo se poderia estabelecer se a participao recasse sobre o aumento do preo.
2VLVWHPDJHUDGLFXOGDGHVSUiWLFDVGHYiULDRUGHP8PDGDVPDLRUHVFRQVLVWHQDIDFLOLGDGHFRPTXHDDSOLFDomRGDOHLpDQDOIUXVWUDGD
porque bvio que se podem deslocar as obras de arte para pas em que
no esteja reconhecido o direito de sequncia. De fato, no s o merFDGRGDVREUDVGHDUWHpGLFXOWDGRSHORLQFUHPHQWRGRSUHoRTXHHVWD
participao provoca, como a deslocalizao de venda uma realidade
muito atual e frequente.
(VWDGLFXOGDGHpLOXVWUDGDSHODVLWXDomRQD&RPXQLGDGH(XURSHLD$
introduo do direito de sequncia provocou a deslocalizao das vendas
de obras de arte para pases que o no consagravam, como a Sua, o
Reino Unido e a grande generalidade dos pases extra-europeus. Por isso,
a proposta de diretriz levou anos at se lograr a sua aprovao. Mas os pa22

J. Oliveira Ascenso

ses que no contemplavam o direito de sequncia na sua legislao interna obtiveram o benefcio de s serem obrigados a introduzi-lo em 2010,
mais de 8 anos aps a aprovao da diretriz; perodo prorrogvel por mais
dois anos ainda (art. 8). E mais: a Comisso prope-se diligenciar que o
direito de sequncia seja tornado obrigatrio a nvel internacional5 .
Est em causa evidentemente o perigo de deslocalizao, em primeiro lugar para a Sua e outros pases europeus no integrados na Comunidade Europeia e aps, com muita acuidade, para pases extra-europeus. Ao que saibamos, nenhum avano se conseguiu at hoje nesse
sentido, pelo que a questo se suscitar com muita gravidade em breve.
Repare-se que a venda extra-comunitria no representa fraude
lei. Os bens mveis deslocam-se livremente e a incidncia deste direito
territorial, como tudo o que est ligado ao direito de autor.
No pois uma questo de somenos, muito longe disso, o perigo de
deslocalizao derivado de se introduzir o direito de sequncia.

4. A PERDA DE FUNDAMENTO DO INSTITUTO


9HULFDVHDLQGDRXWUDFRQVHTXrQFLDFXULRVD
O direito de sequncia teve como ratioDOHJDGRVQVGDSURWHomRGRV
artistas, por invocao da condio miservel em que se encontrariam os
meus conhecidos ou em comeo de carreira e seus herdeiros, enquanto terceiros lucrariam com a revenda das suas obras.
Mas a evoluo que se desenhou conduz-nos a quadrantes completamente distintos.
Quem lucra com o direito de sequncia, a recair sobre o preo, so
os artistas conhecidos e no a multido dos artistas comuns. A limitao do direito de sequncia s vendas de valor considervel, que se
MXVWLFRXSRUDUJXPHQWRVHFRQRPLFLVWDVGHLQVLJQLFkQFLDGRVYDORUHV
percebidos a seguir-se a soluo oposta, tem a consequncia fatal de
afastar os pequenos, em benefcio de quem conquistou o mercado. E a
exigncia de que a transao se faa em galerias ou leiles pblicos, tal
como aparece hoje na disciplina comunitria europeia e tende a se geQHUDOL]DUGiDPDFKDGDGDGHQLWLYDQDMXVWLFDomRLQLFLDOPHQWHDSUHsentada6 . O que est em causa dinheiro, e o dinheiro encontra-se nas
5
6

Veja-se o mesmo art. 8 da Diretriz.


Com a considerao pragmtica que a valorizao das obras de arte dada essencial-

23

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

grandes transaes e no nas revendas de obras de artistas obscuros, se


e enquanto estes no lograrem notoriedade.
Os defensores do sistema da incidncia sobre o preo invocam ainda questes de praticabilidade, que afastariam a participao sobre o
aumento do preo.
O raciocnio pode ser esquematizado deste modo:
 o artista tem direito a uma participao nas revendas;
 esse direito no se pode satisfazer com uma participao no
aumento do preo, por razes operacionais;
 logo, tem de recair sobre o preo obtido, e no sobre o aumento
do preo.
Daqui se retirariam consequncias muito relevantes.
Imaginemos que o valor da obra de arte no subiu aps a primeira
venda; pelo contrrio baixou. No hiptese acadmica: o mercado das
obras de arte tortuoso, sendo muito frequente que as obras de um autor adquiriam subitamente um grande valor por uma aura ou moda que
REHQHFLRX IUHTXHQWHPHQWHSRUIRUoDGHXPDFDPSDQKDRUTXHVWUDGD
por marchands); e se perca depois no esquecimento, quando a moda
passou ou o artista deixou de convir ao negcio. Pois mesmo ento
o adquirente ter de pagar a percentagem ao artista, o que nos parece
SHUIHLWDPHQWHLQMXVWLFDGR
Mas o fundamental no est ainda a. O fundamental est no fato de,
por essa via, se perder o fundamento do sistema.
O silogismo que atrs reproduzimos est errado. Assenta numa premissa que no tem nenhuma sustentao: a de que o artista tem direito a uma
participao nas revendas. Quod erat demonstrandum. Nada impe, por
OyJLFDRXSRUQDWXUH]DVHPHOKDQWHDUPDomR6HRGLUHLWRGHDXWRUUHFDL
sobre a obra, ente imaterial, e no sobre um suporte material desta, no h
nenhuma base para se pretender apresentar como um dogma que um direito
do artista a uma participao nas revendas tem de ser reconhecido.
De fato, o direito de sequncia ser quando muito um direito geneticamente subordinado ao direito de autor, por ter idntico tipo constitutivo (nos casos em que a obra originariamente atribuda a pessoas
fsicas); mas no deixa de ser um direito diferente daquele, com vicissitudes e regime prprios.
E, no seguimento, h que reconhecer que semelhante orientao faz
perder o fundamento do instituto. Como passamos a demonstrar.
mente pelas galerias e negociantes do sector, e no pelas transaes entre privados.

24

J. Oliveira Ascenso

5. UM TRIBUTAO EM BENEFCIO DE PARTICULARES


Este foi apresentado como sendo o de uma participao do artista
no lucro que terceiros iriam obter na revenda de suas obras.
Mas se esse fundamento se perde, nenhum o substitui. No h argumento que torne forosa a participao do artista no preo de revenda.
Se o direito de autor recai sobre a obra, ente imaterial, e no sobre o
suporte, nenhum motivo h para o artista participar do preo de venda
GRV VXSRUWHV XPD YH] DUUHGDGD D MXVWLFDomR GH SDUWLFLSDU DLQGD GD
explorao da obra quando h lucro na revenda realizada pelos proprietrios do suporte7.
&DGXFDGDHVWDMXVWLFDomRLQLFLDODSDUWLFLSDomRQRSUHoRGDUHYHQGDUHYHODVHQXPDJXUDDEHUUDQWHeXPDWD[DLPSRVWDVREUHFHUWDV
transaes em benefcio de particulares. O que os nossos ordenamentos
jurdicos no podem tolerar. A tributao estabelecida para a satisfao de interesses pblicos e no de interesses particulares. No pode ser
GLVWRUFLGDSDUDQDOLGDGHVSULYDGDV'RXWUDPDQHLUDUHJUHVVDUtDPRVj
pSRFDGRVSULYLOpJLRVTXHHQIDWLFDPHQWHWRGRVDUPDPUHMHLWDU
Em suma: se se abre mo do fundamento substantivo consistente no
aumento do preo obtido, portanto no lucro que terceiros auferem mas
de que o artista no participa, todo o instituto incorre em condenao.
1mRVHSRGHJUDYDURS~EOLFRSDUDEHQHFLDUFDWHJRULDVGHWHUPLQDGDV
de privados. Ora, a taxao do preo de revenda, por si, serve uma cateJRULDGHJUDQGHVLQWHUHVVHVSULYDGRVVHPTXHQDGDMXVWLTXHDVLWXDomR
GHSULYLOpJLRTXHRXWRUJD%HQHFLDRVDUWLVWDVFpOHEUHV TXHFRLQFLGHP
frequentemente com os artistas celebrados), os entes de gesto coletiva
que atuem neste domnio, e ainda outras categorias mais, mas deixa
desprotegidos aqueles em nome dos quais o direito de sequncia foi
LQVWLWXtGR1RVSDtVHVTXHDFROKHPRVLVWHPDEHQHFLDHVVHQFLDOPHQWH
os herdeiros ricos de artistas ricos.
2GLUHLWRGHVHTXrQFLDFULDPXLWDVGLFXOGDGHVPDLV6HPQRVSURpormos fazer uma exposio exaustiva do instituto, observamos que
uma das mais graves consiste na determinao do que seja a obra de
 $Wp$QGUp /XFDV TXH QmR REVWDQWH D VXD DOWD TXDOLGDGH UHHWH R SURWHFLRQLVPR
exaltado da ordem jurdica francesa, no deixa de reconhecer que indiscutvel
TXHRIXQGDPHQWRGDUHJXODPHQWDomRFDDIHWDGRSRUTXHRDUWLVWDSRGHID]HUYDOHU
o seu direito mesmo nas hipteses em que o preo de venda for inferior ao montante
que ele prprio recebeu pela alienao inicial: Trait de la Proprit Littraire et
Artistique, Litec (Paris), 3. ed., 2006, n. 431.

25

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

arte original. aquela que resulta das mos do autor? E as esculturas


que so fundidas em moldes? aquela que trouxe a primeira encarnaomRGDLGHLDFULDWLYD"(VHKiXPDSOXUDOLGDGH"2XQDVVHULJUDDVVHVH
fazem milhares, todas igualmente originais?
O sistema traria ainda outro inconveniente, que no nos parece de somenos: implicaria uma burocratizao considervel. Muito provavelmente, levaria entrada em cena de entidades de gesto coletiva, at para o
FRQWURORGDVVLWXDo}HV0DVHVVDLQWHUYHQomRpRQHURVD$QDORDUWLVWD
no receberia tanto como se pretenderia. Alis, manifestao dessa relativa
obliterao do artista em benefcio de terceiros intervenientes est nas prprias leis, que prevem que nesse sistema no se siga o recebimento directo
pelo artista; mas mesmo ento a quantia cobrada, o que implica que possa
haver uma constelao de interesses a funcionar em torno da quantia, que
poderia levar dispensa da interveno e at do benefcio do artista.

6. CONCLUSES
Como dissemos, no nos propomos visitar todos os problemas suscitados. A nossa indagao recai na ausncia de fundamento do instituWRTXDQGRVHODQoDIRUDDMXVWLFDomRUHDOHRULJLQiULDGDSDUWLFLSDomR
do artista no lucro apurado com a alienao da sua obra.
A Comunidade Europeia, na atual senda mercantilista da concepo
do direito de autor, imps a tributao sobre o preo de venda. Com
isto incorre nos grandes problemas suscitados, desde logo o da deslocalizao das alienaes para pases em que essa participao no seja
exigida. Seria bem fcil que assim acontecesse, havendo tantos pases
que no consagram esta tributao ( a palavra exata) do preo de venda
em benefcio de interesses particulares.
Portugal no tem outra opo, por fora da integrao na Comunidade Europeia a no ser que invoque a inconstitucionalidade do
LQVWLWXWR'HIDWRRGLUHLWRGHVHTXrQFLDQmREHQHFLDGDFRQVDJUDomR
constitucional do direito de autor porque no um direito sobre a obra,
um direito sobre o suporte, como vimos. Mas a invocao suscitaria
questes ciclpicas, que a Comunidade tem fugido sempre de afrontar8.
Mas o Brasil nenhuma necessidade tem de aceitar esta tributao,
luz dos instrumentos internacionais que o vinculam. Seria um erro, a
8

E que acabariam por ser resolvidas pelos prprios tribunais da Comunidade.

26

J. Oliveira Ascenso

nosso ver, se cedesse a presses ou a modas e alterasse o sistema vigente. Constituiria um retrocesso. H que aperfeioar o regime legal, que
demasiado sumrio, perante o grande nmero de problemas que deixa
HPDEHUWR0DVKiTXHID]rORVHPVHSHUGHUGHYLVWDD~QLFDMXVWLFDo admissvel do instituto: a de fazer participar o artista do lucro que
obtido por terceiros com a negociao da sua obra. Se se considerar que
isso no for possvel, ento a nica soluo seria a supresso do direito de sequncia e no a instituio de uma tributao aberrante sobre o
suporte da obra em caso de revenda deste, em benefcio de particulares.

27

IMPUTAO OBJETIVA:
breve incurso doutrinria
Daniela Carvalho Almeida da Costa1

Resumo:
O artigo viabiliza uma breve incurso nas mudanas ensejadas
na tipicidade luz da Imputao Objetiva, a partir das duas principais vertentes - que trazem abordagens um tanto quanto contrapostas - acerca da temtica: o funcionalismo teleolgico de
Claus Roxin e o funcionalismo normativista de Gnther Jakobs.
Palavras-chave:Imputao Objetiva; Funcionalismo; Tipicidade.
Abstract:
This paper intents to make a viable and brief discussion on the changes faced on Vagueness Doctrine in the light of Objective Imputation
through the assumptions taken from two main aspects, which bring different approaches concerning the theme: the former is Claus Roxins
teleological functionalism, and the latter is Gnther Jakobss normative
functionalism.
Key words: Objective Imputation; Functionalism; Vagueness Doctrine.

Advogada, Mestre e Doutora em Direito Penal pela USP; Especialista em Direito


Penal pela Universidade de Salamanca; Coordenadora Regional do IBCCRIM em
Sergipe e Alagoas; Coordenadora do Grupo de Pesquisa Estudos sobre violncia
e criminalidade na contemporaneidade da UFS; Professora Adjunta do Dept de
Direito da UFS; Professora do Programa de Ps-graduao - Mestrado em Direito
da UFS; Coordenadora Geral do Curso de Direito da FaSe; Professora da Graduao e da Ps-graduao da FaSe e da Fanese; Professora da Escola Superior da
Magistratura de Sergipe.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

INTRODUO
A doutrina contempornea insere, dentro da anlise da tipicidade, a
DQiOLVHGDLPSXWDomRREMHWLYDFRPROWURSUHOLPLQDUSDUDH[FOXLUDTXLlo que sequer de antemo pode constituir um delito.
A imputao ao tipo objetivo vem revolucionando os estudos na rea
da tipicidade, tendo como tarefa primria fornecer as circunstncias que
fazem de uma causao uma ao tpica, que transformam, por exemplo,
a causao de uma morte em homicdio, deixando a anlise do tipo subjetivo se houve dolo ou culpa para anlise em momento posterior.
A dogmtica mais antiga considerava o tipo objetivo preenchido
com a mera causalidade do comportamento do autor. Para a Teoria Causalista bastavam ao tipo seus elementos objetivos, eis que dolo e culpa
integravam a culpabilidade. Com a Teoria Finalista e a passagem do
dolo e da culpa ao fato tpico, este passou a possuir tambm elemento
VXEMHWLYRHDFRQGXWDSDVVRXDVHUDQDOLVDGDFRPRXPDWRQDOtVWLFR
entretanto, o tipo objetivo manteve o mesmo formato adotado pelo causalismo, esgotando-se por meio da mera causalidade. Portanto, nos crimes dolosos comissivos tentavam resolver os casos em que a punio
parecia inadequada negando o dolo. Neste sentido, Roxin analisa um
exemplo, comumente utilizado por Welzel, em que
QDLPLQrQFLDGHXPDWHPSHVWDGHDOJXpPPDQGDRXWURjRUHVta, na esperana de que seja este atingido por um raio. Se este
resultado, contra qualquer probabilidade, realmente ocorrer, no
se pode duvidar de que quem deu o conselho o tenha causado. Se
se considerar o tipo objetivo preenchido, s se poder fugir punio negando o dolo. o que faz WELZEL, ao considerar que,
neste caso, o provocador possui unicamente uma esperana
ou um desejo, no a vontade realmente capaz de atuar sobre
os acontecimentos, exigida pelo dolo. Isto, porm, no uma
fundamentao convincente: pois inquestionvel que o autor queria, no plano subjetivo, exatamente aquilo que causou
no plano objetivo (...). Se, ainda assim, no considerarmos
correta a punio, isto decorre, principalmente, de ser o acontecimento, de um ponto de vista objetivo, fruto do acaso. S
porque no consideramos que a causao de uma morte
completamente fortuita seja, sequer objetivamente, um homicdio em sentido jurdico, que o dolo a ela dirigido no
30

Daniela Carvalho Almeida da Costa

um dolo de homicdio, mas tem por objeto algo no punvel


(ROXIN, 2002, p. 306-7, grifo meu).

Entretanto, a teoria da imputao objetiva, que estava em decadncia


desde a segunda metade do sculo XIX, em virtude do pensamento causal
orientado pelas cincias naturais, teve seu renascimento, na Alemanha,
unicamente a partir da dcada de 60 do sculo XX e, na doutrina brasileira, tal teoria comeou a ser ventilada somente a partir da dcada de 90 do
sculo passado. Ao se empregar tal teoria, deixa-se de analisar o tipo objetivo por meio de uma relao de causalidade puramente material (empULFD DJUHJDQGRVHDHVWDDQiOLVHXPDDQiOLVHMXUtGLFDTXDOVHMDYHULFDU
se o resultado previsto pode ou no ser imputado ao autor. Mantendo-se,
todavia, intacta toda a anlise concernente ao tipo subjetivo, fruto dos
progressos trazidos pela Teoria Finalista da Ao.
$PGHDQDOLVDUDWLSLFLGDGHFRPRPtQLPRGHSURIXQGLGDGHTXH
o estudo em anlise requer, farei uma breve incurso nos dois principais
pensadores alemes da contemporaneidade sobre o tema da tipicidade
luz da imputao objetiva Gnther Jakobs e Claus Roxin.
JAKOBS (2000) parte da premissa que o contedo da imputao
depende do correspondente contexto social, portanto, a imputao objetiva do comportamento imputao vinculada a uma sociedade concretamente considerada.
Constri toda a teoria da imputao sob o fundamento de que sua
necessidade deriva da misso da imputao jurdico-penal. O causalisPRHRQDOLVPRLPSXWDULDPGHWHUPLQDGRUHVXOWDGRjTXHOHTXHRFDXsou, ou quele que o causou de modo adequado ou que, de qualquer
modo, o causou dolosamente. Entretanto, para Jakobs, tais respostas,
HP VHX QDWXUDOLVPR VmR DEVROXWDPHQWH LQVXFLHQWHV YLVWR TXH R UHsultado tambm foi causado por um crculo incalculvel de pessoas,
incluindo a prpria vtima. Neste sentido, o fabricante de uma arma
pode ter causado uma morte de modo adequado e, inclusive, conscientemente, sem que simplesmente por isso (apesar de demonstrada a causalidade) se tenha que lhe imputar o homicdio.
A conduta, ainda como conduta adequada ou dolosa, apresenta-se de
PDQHLUDPDQLIHVWDPHQWHLQVXFLHQWHSDUDIXQGDPHQWDUSRUVLVyDLPSXtao. A conduta unicamente afeta o aspecto cognitivo do fato ocorrido,
entretanto, se em todo contato social todos tivessem que considerar todas
as conseqncias possveis a partir de um ponto de vista cognitivo, ou seja,
evitar todos os danos possveis, a sociedade permaneceria paralisada.
31

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Por isso que se atribuem a determinadas pessoas e no a todas


as pessoas que ocupam determinadas posies no contexto de
interao, determinados encargos. (...) S deste modo so possveis contatos annimos ou, ao menos, parcialmente annimos:
QmRpQHFHVViULRDYHULJXDURSHUOLQGLYLGXDOGHTXHPWHPRVHP
frente, pois essa pessoa tomada como portadora de um papel.
Por exemplo: para o padeiro, o comprador de uma pea de po
to-somente um comprador; ao padeiro no lhe importa se o
sujeito pensa simplesmente em comer o po, sem causar dano algum, ou se pretende envenen-lo maliciosamente (...). Sem esta
desinvidualizao no seriam possveis contatos annimos em
alto grau para permitir o desenvolvimento das relaes econmicas e sociais (JAKOBS, 2000, p. 19-20, grifo do autor).

Desse modo, dentro do sistema construdo por Jakobs, o alvo da imputao objetiva a imputao dos desvios a respeito das expectativas
que se referem ao portador de um papel. Entretanto, no so decisivas
as capacidades de quem atua, mas as capacidades do portador de um
papel, referindo-se a denominao papel a um sistema de posies deQLGDV GH PRGR QRUPDWLYR RFXSDGR SRU LQGLYtGXRV LQWHUFDPELiYHLV
trata-se, portanto, de uma instituio que se orienta com base nas pessoas (JAKOBS, 2000, p. 20, grifo do autor).
Com base em tais constataes, Jakobs entende que a construo do
delito no deve se basear em dados puramente naturalistas causalidade
e dolo; ao contrrio, o essencial que ocorra a violao de um papel. J
QmRUHVXOWDVXFLHQWHDPHUDHTXLSDUDomRHQWUHFULPHHOHVmRGHXPEHP
jurdico. Portanto, a idia central dentro deste sistema de imputao objetiva
que aquele que se mantm dentro dos limites do seu papel no responde por
um curso lesivo, ainda no caso em que bem e perfeitamente pudesse evit-lo.
$PGHHVWUXWXUDURkPELWRGDLPSXWDomRREMHWLYD-DNREVWUDWDGH
descrever determinados limites aos papis, atravs de quatro institutos:
1. Risco permitido: no faz parte do papel de nenhum cidado
eliminar todo risco de leso de outro, h sempre um risco permitido. A
dinmica social sempre dar margem criao de riscos residuais por
PDLRUTXHVHMDPDVQRUPDVGHFXLGDGRGRFRQWUiULRDVRFLHGDGHcaria paralisada, haja vista que a sociedade no um mecanismo cujo
~QLFRPVHMDRIHUHFHUDPi[LPDSURWHomRDRVEHQVMXUtGLFRVPDVTXH
est destinada a possibilitar as interaes.
Os riscos permitidos esto e sempre estiveram presentes em todos os
32

Daniela Carvalho Almeida da Costa

mbitos vitais, entretanto, as condutas que conformam o risco permitido


devem ser determinadas pelas normas e no pela simples prxis social,
PXLWRHPERUDXPDSUi[LVUHLWHUDGDSRVVDSHUIHLWDPHQWHPRGLFDUDVQRUmas reitoras das condutas at uma regulao mais branda ou mais estrita.
 3ULQFtSLR GH FRQDQoD quando o comportamento dos seres humanos se entrelaa, no faz parte do papel do cidado controlar de maneira permanente a todos os demais; do contrrio, no seria possvel a
diviso do trabalho e das tarefas cotidianas. Por exemplo: o condutor de
XPYHtFXORTXDQGRSRVLFLRQDGRQXPDSUHIHUHQFLDOFRQDTXHRVGHPDLV
condutores respeitaro a sinalizao de preferncia e o deixaro passar. A
razo fundamental apia-se em que os demais so, por sua vez, sujeitos
WDPEpPUHVSRQViYHLVHQTXDQWRTXHRREMHWLYRGRSULQFtSLRGHFRQDQoD
tornar possvel a diviso do trabalho, por conseguinte, termina quando
esta perde seu sentido, especialmente quando se pode ver que a outra
SHVVRDQmRID]RXQmRIH]MXVjFRQDQoDGHTXHFXPSULULDDVH[LJrQFLDV
GR VHX SDSHO 3RU H[HPSOR Mi QmR VH FRQD HP TXHP VH HQFRQWUD HP
evidente estado de embriaguez ou imerso em evidente situao de erro.
3. Proibio de regresso: quem assume com o outro um vnculo que de
modo invariavelmente considerado inofensivo no viola seu papel como
cidado, ainda que o outro incorpore esse vnculo numa atividade no permitida. Por exemplo: o autor compra uma pea de po para envenen-la;
o autor vai de txi de X a Y para cometer em Y um homicdio. Ainda que
se parta da premissa que o terceiro padeiro, motorista conhece o que vai
suceder, este assume perante o autor um comportamento comum limitado
e circunscrito por seu prprio papel, no sendo possvel considerar que tal
comportamento comum seja parte de um delito. Posto que elementos to
cotidianos como a venda de po ou a possibilidade de transporte sempre
esto disponveis, de modo que a proibio deste tipo de contribuies
no suscetvel de evitar, de fato, o comportamento do autor.
importante ressaltar que diferente do que ocorre com o princpio
GHFRQDQoDDSURLELomRGHUHJUHVVRYLJRUDLQFOXVLYHTXDQGRDSODQLcao delitiva da outra pessoa evidente, visto que se trata de casos em
TXHRFRPSRUWDPHQWRHPVLFDUHFHGHVLJQLFDGRGHOLWLYR'HVVHPRGR
est permitido emprestar a um vizinho uma ferramenta comum, ainda
quando se saiba que este planeja utiliz-la para destruir coisa alheia.
Os limites da proibio de regresso podem ser discutidos. Entretanto, este princpio deve ser aceito por quem pretenda seJXLUJDUDQWLQGRTXHDOLEHUGDGHGHSHUVHJXLURVUHVSHFWLYRVQV
33

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

prprios no se afogue na massa dos possveis contatos sociais.


Uma sociedade que est necessitada de que se ofeream prestaes em massa, mais ainda, que requer em geral a existncia de
condies invariavelmente consideradas do comportamento social, no pode renunciar a uma proibio de regresso (JAKOBS,
2002, p. 28-9, grifo do autor).

4. Competncia (capacidade) da vtima: possvel que a vtima d


margem, com seu prprio comportamento, a que se lhe impute a conseqncia lesiva ou que se encontre nesta posio por obra do infortnio.
O consentimento o caso mais conhecido, entretanto, ainda pode acontecer que o autor tenha agido de acordo com o seu papel e que alguma
conseqncia lesiva derive desta ao, embora ele no seja obrigado a
impedi-la, deixando tais conseqncias competncia da vtima.
Um exemplo: um agricultor rega suas plantas num prdio situado numa ladeira; certa quantidade de gua habitualmente desce
pela ladeira e sacia os cultivos de seu vizinho. Certamente, este
fato no outorga ao vizinho afetado direito algum no sentido de
que no se possa desconectar a instalao de regar do campons
situado na parte superior da ladeira. Explicado de outro modo, os
apoios em favor de bens alheios que no so conformes o papel,
mas que excedem do que obrigatrio, podem ser revogados
licitamente (JAKOBS, 2000, p. 29).

Maior importncia se d aos fatos em que a prpria vtima d razo


a que a conseqncia lesiva lhe seja imputada, atravs de uma leso ao
dever de autoproteo, ou seja, aes a prprio risco. A idia central
de que a vtima no pode assumir um contato social arriscado sem aceitar como fruto de seu comportamento as conseqncias que, conforme
um prognstico objetivo, so possveis. Na atualidade h um exemplo
bastante discutido: quem tem relao sexual com uma pessoa dependente de drogas ou que se prostitui, atua com prprio risco, no que se
refere ao contgio com o vrus HIV (JAKOBS, 2002, p. 30).
(PJHUDOFRVWXPDVHGHQLUDLPSXWDomRREMHWLYDFRPEDVHHPGRLV
conceitos: criao de um risco e sua subseqente realizao no resultado, sendo o primeiro pressuposto do segundo. Por exemplo, no caso da
tempestade, esboado no incio, no se caracteriza um homicdio porque
PDQGDU DOJXpP D XPD RUHVWD QmR FKHJD VHTXHU D FULDU XP SHULJR GH
34

Daniela Carvalho Almeida da Costa

morte juridicamente relevante. Desse modo, enquanto a ausncia da criao do perigo leva iseno de pena, a no realizao do perigo em uma
leso tpica ao bem jurdico exclui unicamente a consumao, permitindo, dependendo do caso, a aplicao da pena pela tentativa. Entretanto,
quando o resultado apresentar a realizao do perigo criado pelo autor,
ele ser, em regra, imputvel, de modo que o tipo objetivo se considerar
plenamente preenchido. Ou seja, de maneira sinttica, pode-se dizer que
a imputao ao tipo objetivo pressupe a realizao de um perigo criado
pelo autor, no coberto pelo risco permitido, dentro do alcance do tipo.
ROXIN (2002) inclui a existncia de um terceiro nvel de imputao,
DVDEHURDOFDQFHGRWLSRRXVHMDRPGHSURWHomRGDQRUPDLQVFULWDQR
WLSR SRUH[HPSORSURLELomRGHPDWDUIHULUGDQLFDUHWF $PDLRULDGRV
doutrinadores analisa este grupo de casos no plano da criao de riscos,
enquanto Roxin o faz neste terceiro nvel de anlise: o alcance do tipo.2
O fato deixa de ser imputado ao autor quando, no caso concreto, o
alcance do tipo no compreender resultados da espcie do ocorrido
quando o tipo no for destinado a impedir acontecimentos de tal ordem.
Neste nvel se inserem todos os casos em que outras pessoas, alm do
prprio autor, contribuem de modo relevante para o resultado tpico.
Esta contribuio pode ser dada pela prpria vtima ou por terceiro.
Apesar de tais problemticas apresentarem maior incidncia nos delitos
FXOSRVRVQRVGHOLWRVGRORVRVFRQJXUDPVHSULQFLSDOPHQWHWUrVSRVsveis grupos de casos (ROXIN, 2002, p. 353-383):
1. Imputao de um resultado a um mbito de responsabilidade
alheio: esta teoria ainda est em franco desenvolvimento, dando margem a discusses acaloradas, entretanto, a relevncia prtica diz respeito principalmente a atividades que servem de combate a perigos, como
a dos bombeiros, salva-vidas, policiais etc.
Devem ser punidos por homicdio culposo o dono de casa que
culposamente causa um incndio e a professora que, numa exFXUVmR SDUD XP ORFDO GH iJXDV QmR YLJLD VXFLHQWHPHQWH XP
aluno, se, na tentativa de salvamente, vier a morrer um bombeiro
ou salva-vidas? (ROXIN, 2002, p. 377)
 $SULQFtSLR5R[LQWUDWDYDWDLVFDVRVVREDGHQRPLQDomRPGHSURWHomRGDQRUPD
expresso ainda utilizada por diversos doutrinadores. Entretanto, Roxin a abandonou para evitar confuses, vez que a norma, nos problemas aqui tratados, no era
a norma de cuidado (proibio de excesso de velocidade, de ultrapassagens a uma
distncia reduzida etc.), mas, o tipo penal.

35

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Apesar de a doutrina majoritria alem entender que sim, Roxin


entende ser possvel trazer baila razes considerveis em sentido
oposto, resumindo sua argumentao da seguinte maneira: a soluo
poltico-criminalmente sensata seria isentar o primeiro causador das
FRQVHTrQFLDV TXH GHFRUUHUHP GR FRPSRUWDPHQWR OHVLYR GR SURVsional, haja vista que tais riscos deveriam ser atribudos como riscos
WtSLFRV GR H[HUFtFLR GD SURVVmR DR kPELWR GD UHVSRQVDELOLGDGH GR
SURVVLRQDO QmR RV LPSXWDQGR D HVWUDQKRV *UXSRV GH FDVRV DLQGD
mais polmicos e de maior importncia prtica referem-se questo
de se erros mdicos podem ser imputados ao causador da leso, por
exemplo: quando a vtima, unicamente ferida pelo primeiro autor,
vem a falecer por motivo de um erro mdico.
2. Contribuio a uma autocolocao dolosa em perigo: dentre os
exemplos trabalhados por Roxin, encontra-se o seguinte: A entrega a B herona para consumo, estando ambos conscientes do perigo existente. B injeta a substncia e falece por overdose. A jurisprudncia alem no analisava
a autocolocao em perigo e punia por homicdio culposo at o advento
GDGHFLVmR%*+6WHPSULQFLSDOPHQWHVREDLQXrQFLDGH
Schnemann, que inaugurou uma espetacular virada na jurisprudncia, negando a imputao de tais casos ao tipo objetivo dos delitos de homicdio:
Autocolocaes em perigo realizadas e queridas de modo responsvel no se enquadram no tipo do delito de leses corporais
ou homicdio, ainda que o risco que conscientemente se corre
realize-se no resultado. Aquele que provoca, possibilita ou facilita tal colocao em perigo no punvel pelo delito de leses
corporais ou homicdio (ROXIN, 2002, p. 357-8).

Portanto, no caso em anlise, apesar de o risco criado ser juridicamente desaprovado (venda/ entrega de txicos) e se ter concretizado
no resultado (a morte adveio do uso do txico), o resultado no estaria
compreendido no alcance do tipo: o autor limitou-se a participar de uma
ao em que a prpria vtima se exps a perigo e, como as autocolocaes em perigo so atpicas, participar nelas no pode estar compreendido pelo alcance dos tipos de leses ou homicdio.
3. Heterocolocao em perigo consentida: neste grupo de casos no
a prpria pessoa quem se coloca dolosamente em perigo, mas se deixa
FRORFDUHPSHULJRSRURXWUHPWHQGRFRQVFLrQFLDGRULVFR([HPSOLquemos com dois casos colacionados por Roxin (2002, p. 367):
36

Daniela Carvalho Almeida da Costa

Exemplo 1: Apesar da tempestade, o fregus quer que o condutor de um barco faa com ele a travessia do Rio Memel. O condutor desaconselha a que se proceda a travessia, apontando para
os perigos nela envolvidos. O fregus insiste, o condutor acaba
correndo o risco, o barco afunda e o fregus afoga-se.
Exemplo 2: O passageiro, que deseja chegar a tempo em um
compromisso, ordena ao condutor que ultrapasse a velocidade
mxima permitida. Em virtude da velocidade elevada, acontece
um acidente, no qual o passageiro vem a falecer.

Apesar de boa parte de a doutrina tentar solucionar tais casos atravs


GDJXUDGRFRQVHQWLPHQWRGRIXWXURRIHQGLGRHVWHQmRVHPRVWUDXPFDminho vivel, haja vista que tal consentimento raramente existe uma vez
TXHDTXHOHTXHVHH[S{VDRULVFRFRVWXPDFRQDUTXHWXGRRFRUUHUiEHP
Tampouco seria vivel argumentar atravs da argumentao da violao
do dever de cuidado que, quase sempre, acontece nestes casos. Portanto,
Roxin entende que a pergunta correta seria HPTXHPHGLGDRPGHSURWHo do tipo compreende a heterocolocao em perigo consentida?
A resposta correta deve tomar os seguintes pressupostos como ponto de partida: o dano deve ser conseqncia do risco corrido e no de
outros erros adicionais; e a vtima deve ter a mesma responsabilidade
pelo fato comum que o autor. Para tanto, deve ela, como acontece na
autocolocao em perigo, conhecer o risco na mesma medida em que
o autor. Estando presentes tais pressupostos, ter a vtima assumido o
ULVFRHSRUWDQWRDLPSXWDomRFDUiH[FOXtGD
Em todas as situaes fticas colacionadas chega-se a uma concluso em comum: a causalidade est demonstrada, embora a imputaomRMXUtGLFDTXHH[FOXtGDSHORQmRSUHHQFKLPHQWRGRWLSRREMHWLYR
seja porque no houve a criao de um risco no permitido ou porque
tal risco no se realizou no resultado ou, ainda, porque o resultado no
se insere no mbito de alcance do tipo legal. Esse o grande avano
trazido com a teoria da imputao objetiva: no basta apenas que o
UHVXOWDGRWHQKDVLGRSUDWLFDGRSHORDJHQWHSDUDTXHVHSRVVDDUPDU
a sua tipicidade, passa a ser necessrio tambm que ele lhe possa ser
imputado juridicamente.

37

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

REFERNCIAS BIBLIOGRFICAS
FRANCO, Alberto Silva. Submisso de criana ou adolescente prostituio ou explorao sexual. Boletim IBCCRIM, n 109. So Paulo,
Dezembro, 2001, p. 3-5.
BITENCOURT, Cezar Roberto. Tratado de Direito Penal. Parte Especial. Vol. 4. So Paulo: Saraiva, 2004.
CAMARGO. Antonio Lus Chaves. Imputao objetiva e Direito Penal brasileiro. So Paulo: Cultural Paulista, 2001.
JAKOBS, Gunther. A Imputao objetiva no Direito Penal. Traduo Andr Lus Callegari. So Paulo: Revista dos Tribunais, 2000.
Saraiva, 1996.
PRADO, Luiz Regis. Curso de Direito Penal Brasileiro. Parte Especial. Vol. 3. 2 ed. JESUS, Damsio Evangelista. Direito Penal. Parte
Especial. Vol. 3. So Paulo: So Paulo: Revista dos Tribunais, 2002.
ROXIN, Claus. Funcionalismo e imputao objetiva no direito penal. Traduo e Introduo de Lus Greco. 3 ed. Rio de Janeiro: Renovar, 2002.
SCHUNEMANN, Bernd. Consideraciones sobre la teora de la imputacin objetiva. In: Temas actuales y permanentes del Derecho penal despus del milenio. Madrid: Editorial Tecnos, 2002, p. 70-96.
TAVARES, Juarez. Direito Penal da Negligncia: uma contribuio
teoria do crime culposo. 2 ed. Rio de Janeiro: Lmen Jris, 2003.

38

DO PRINCPIO QUANTUM VINDICATUM


EM PROPRIEDADE INDUSTRIAL
Denis Borges Barbosa1
Resumo:
Propriedade Intelectual como regime legal de direito estrito. Procedimento plenamente vinculado. A regra procedimental da congruncia;
A consagrao da regra de congruncia no direito da Propriedade Intelectual. As mutaes entre o reivindicado e o concedido.Os limites da
concesso e o escopo do direito. Estrito, no literal. O caso dos direitos
autorais. O caso das patentes. O caso das marcas. Em todos os casos:
proteo estrita ao reivindicado.
Palavras-chave: Propriedade intelectual - Congruncia - Quantum vindicatum.
Abstract:
Intellectual Property as strict right legal regime. A closedly controlled
procedure. The procedural rule of congruence; The consecration of
the rule of congruence of Intellectual Property law. The mutations
between claimed and granted. The limits of the grant and the scope of
the right. Strict, not literal. The case of copyright. The case of patents.
The case of the trademarks. In all cases, protection restricted to what
was claimed.
Key words: Intellectual Property. - The rule of congruence- Quantum
vindicatum.

Professor da PUC do Rio

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Discutimos neste estudo o princpio segundo o qual, nos direitos


de exclusiva de propriedade intelectual, obtidos atravs de pedido
autoridade estatal, a exclusiva s pode ser deferida nos limites do solicitado, e no alm.

PROPRIEDADE INTELECTUAL COMO REGIME


LEGAL DE DIREITO ESTRITO
Os direitos de propriedade industrial so monoplios constitucionalmente previstos (art. 5, inciso XXIX da CF 88), assegurados por
lei, que resultam na exclusividade do seu uso ou explorao pelo titular.
O prprio Supremo Tribunal Federal STF, em voto do Ministro Eros
Roberto Grau2, j destacou:
O monoplio (i) pode decorrer do lcito exerccio de uma vantagem competitiva ou (ii) ser institudo mediante lei. (...) J no
segundo caso (instituio de monoplio mediante lei, monoplio
legal), tem-se situao inversa: a o Estado exerce uma opo
poltica, em razo da qual o sistema jurdico atribui a determinado agente a faculdade do exerccio, com exclusividade, de uma
certa atividade econmica em sentido estrito. Estabelece-se artiFLDOPHQWH SHODOHL XPDPELHQWHLPSHUPHiYHOjOLYUHLQLFLDtiva; a ausncia de concorrncia total. Qualquer outro agente
econmico que se disponha a explorar a atividade monopolizada
estar impedido de faz-lo --- a lei no admite essa explorao.

Os monoplios legais dividem-se, por sua vez, em duas espcies: (i)


os que visam a impelir o agente econmico ao investimento e (ii) os que
instrumentam a atuao do Estado na economia.
Transitamos, quando daquele primeiro tipo de monoplio, pela seara
da chamada propriedade industrial: da e na proteo dos brevetos, marcas,
know-how etc. emerge autntico monoplio privado; ao detentor do direito
de propriedade industrial assegurada a exclusividade de sua explorao.
O Art. 5o, XXIX e demais direitos e interesses estipulados na Constituio Federal de 1988 determinam o teor da lei ordinria de proprie2

STF, ADI 3273/DF e ADI 3366/DF, Relator p/Acrdo Min. Eros Grau, DJ 02/03/07.

40

Denis Borges Barbosa

dade intelectual, estipulando as condies bsicas para a concesso de


patentes industriais, marcas e outros direitos, incluindo alguns dos requisitos a serem observados no procedimento administrativo pertinente.
A inobservncia de tais condies e, especialmente, dos princpios,
reverte a presuno, que juris tantum, de constitucionalidade e legalidade dos atos do poder publico. Para tanto, no caso em questo, deve-se
confrontar a norma e o procedimento administrativo com a Constituio, o que resulta na necessidade de interpretao.
Ora, se temos um monoplio legal que garante um direito de exclusiva ao seu detentor, estamos diante de uma restrio a livre iniciativa e
concorrncia, na medida em que os no detentores esto impedidos de
utilizar tal direito. Portanto, tal outorga estatal deve ser tratada e interpretada de forma restritiva.
/XLV5REHUWR%DUURVRDVVLPDUPD3:
Nesse contexto, no h dvida de que o monoplio concedido ao
titular da patente um privilgio atribudo pela ordem jurdica, que
excepciona os princpios fundamentais da ordem econmica previstos pela Constituio. Desse modo, sua interpretao deve ser estrita, no extensiva 4. Repita-se: o regime monopolstico que caracWHUL]DRSULYLOpJLRSDWHQWiULRMXVWLFDVHSRUXPFRQMXQWRGHUD]}HV
TXH VHUmR DSUHFLDGDV D VHJXLU PDV HP TXDOTXHU FDVR FRQJXUD
um regime excepcional e, portanto, s admite interpretao estrita 5.

Diogo de Figueiredo6, ao pronunciar-se sobre o tema, avalia que:

O privilgio patentrio deve ser interpretado estritamente, pois restringe a livre


iniciativa e a concorrncia:
4
[Nota do original] Carlos Maximiliano, Hermenutica e Aplicao do Direito, 1980,
pp. 227 e 234-237.
5
 >1RWDGRRULJLQDO@$LQWHUSUHWDomRHVWULWDGHQRUPDVGHH[FHomRpWHPDSDFtFRQD
jurisprudncia do Supremo Tribunal Federal: (...) A exceo prevista no 5 do art.
29 do ADCT ao disposto no inciso IX do art. 129 da parte permanente da ConstituiomR)HGHUDOGL]UHVSHLWRDSHQDVDRH[HUFtFLRGDDGYRFDFLDQRVFDVRVDOLHVSHFLFDdos, e, por ser norma de direito excepcional, s admite interpretao estrita, no
sendo aplicvel por analogia e, portanto, no indo alm dos casos nela expressos,
nem se estendendo para abarcar as conseqncias lgicas desses mesmos casos,
(...). (STF, ADIn. n 41/DF, Rel. Min. Moreira Alves, DJ 28.6.91)
6
A Ordem Econmica na Constituio de 1988, artigo publicado na Revista da Procuradoria Geral do Estado/RJ n 42, pg 59.
3

41

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

RVSULQFtSLRVTXHGHQHPOLEHUGDGHVSUHIHUHPDRVTXHDVFRQdicionam ou restringem; e os que atribuem poderes ao Estado,


cedem aos que reservam poderes aos indivduos, e os que reforam a ordem espontnea tm preferncia sobre os que a excepcionam (grifos da transcrio).

A liberdade, obviamente, de iniciativa e de informao, coarctadas pelos privilgios e direitos de exclusiva. A ordem espontnea o do
X[ROLYUHGDVLGpLDVHGDVFULDo}HVHGDGLVVHPLQDomRGDWHFQRORJLD2
ato do Estado que cumpre estabelecer peias o da concesso do direito
excepcional da propriedade intelectual.
E, como ensina Carlos Maximiliano7,
O Cdigo Civil [de 1916] explicitamente consolidou o preceito
clssico Exceptiones sunt strictissimae interpretationis (interpretam-se as excees estritissimamente) no art. 6 da antiga
Introduo, assim concebido: A lei que abre exceo a regras
JHUDLV RX UHVWULQJH GLUHLWRV Vy DEUDQJH RV FDVRV TXH HVSHFLca, dispositivo hoje consagrado no art. 2, 2, da vigente Lei
de Introduo ao Cdigo Civil [de 1916].

&RQWLQXD R SHQVDPHQWR DUPDQGR TXH LJXDO RULHQWDomR GHYH VHU


adotada para aquelas normas que visem concesso de um privilgio a
determinadas pessoas, pois:
o monoplio deve ser plenamente provado, no se presume;
e nos casos duvidosos, quando aplicados os processo de Hermenutica, a verdade no ressalta ntida, interpreta-se o insWUXPHQWRGHRXWRUJDRFLDOFRQWUDREHQHFLDGRHDIDYRUGR
Governo e do pblico.8

O que se visa, em cada caso material, obter a homoestase dos princpios, segundo sua pertinncia no sistema. Este equilbrio surge a interpretao das normas segundo os critrios da proteo da liberdade de iniciativa em face da restrio imposta pela propriedade intelectual; e segundo
o critrio tradicional da interpretao contida da norma excepcional.
7
8

Hermenutica e Aplicao do Direito, Ed. Forense, 18 ed., p. 225


Ob. cit., p. 232

42

Denis Borges Barbosa

UMA EQUAO DE DIREITO ESTRITO


Tivemos ocasio de assim notar, no tocante s patentes 9:
Todos esses elementos da equao manifestam uma coeso de
HTXLOtEULR H XPD EXVFD GH HFiFLD VRFLDO num modelo fechado. A patente, em nosso sistema constitucional, resulta de um
processo administrativo vinculado, em que no h lugar para a
manifestao volitiva do Estado quanto convenincia e oportunidade da concesso de cada privilgio singular 10.

Em nosso sistema, o direito a haver patente um direito subjetivo constitucional, que se incorpora ao patrimnio do autor do invento uma vez que se
FRQJXUHDKLSyWHVHGHLQFLGrQFLDDEVWUDtGDGRDUW;;,;GD&RQVWLWXLomR
(e dos demais princpios aplicveis da norma fundamental), e concretizada na
lei ordinria que realiza o comando constitucional 11. A origem da pretenso
constitucional, mas o seu contedo se conforma aos termos da lei ordinria 12.
Exatamente a mesma anlise se aplica ao sistema de marcas, igualmente fundado em pretenso radicada no texto constitucional, igual9

10

11

12

Atividade Inventiva, in BARBOSA, Denis Borges . A Propriedade Intelectual no


Sculo XXI - Estudos de Direito. Rio de Janeiro: Lumen Juris, 2008.
Como dissemos em Bases Constitucionais das Criaes Industriais, op. cit.; O procedimento administrativo de concesso do privilgio essencialmente declara a exisWrQFLDGRVSUHVVXSRVWRVGHVHQKDGRVQD&RQVWLWXLomRHFRUSRULFDGRVQDOHJLVODomR
ordinria. Como tal, o procedimento necessariamente vinculado, e nele no cabe
qualquer medida de discricionariedade. No pode o rgo pblico competente dar
patentes onde em sede constitucional se veda tal concesso, como, por exemplo, no caso de criaes abstratas, inclusive a de programas de computador em si
mesmos, nem pode aplicar critrios de convenincia e oportunidade. Se h direito
subjetivo constitucional, cabe ao ente pblico: - Examinar a existncia dos pressupostos;- Declarar-lhes a existncia;- Constituir o direito de exclusiva.
Idem, eadem: Numa metfora instrutiva, a clusula constitucional de propriedade industrial, em tenso com os demais princpios constitucionais relevantes, estabelece um cubo virtual (que levando ainda em conta os requisitos do Direito
Internacional relevante - se poderia denominar cubo de Kelsen, por evocao de
uma construo anloga do jurista austraco) no interior do qual a lei ordinria teria
espao-mais ou menos apertado para construir a poltica legislativa.
o que faz Pontes de Miranda notar nos seus Comentrios Constituio de 1969, v.
5, 550-559: Assim, no gozam do direito pblico subjetivo as invenes cujos meios
ou resultados forem contrrios ordem pblica (Supremo Tribunal Federal, 14 de abril
de 1915, sobre inveno de instrumento de jogo de azar; Decreto n 16.264, de 19 de
dezembro de 1923, art. 32), ou aos bons costumes, ou sade pblica.

43

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

mente dependendo de pedido, exame e concesso pela autoridade pblica, em procedimento plenamente vinculado.
Procedimento plenamente vinculado
Mais uma vez, aplica-se aqui s marcas o que j mencionei quanto
ao procedimento de patentes:
O princpio do procedimento vinculado das patentes
O direito obteno da patente nasce, no sistema constitucional
brasileiro, em sede constitucional, e cada um de seus requisitos se ancora na entretela da Carta de 1988. A lei de patentes
FRQJXUDRPRGHORFRQVWLWXFLRQDOGHYHQGRUHDOL]DU
o balanceamento dos interesses constitucionalmente protegidos.
O procedimento administrativo de concesso do privilgio essencialmente declara a existncia dos pressupostos desenhados
QD&RQVWLWXLomRHFRUSRULFDGRVQDOHJLVODomRRUGLQiULD&RPR
tal, o procedimento necessariamente vinculado, e nele no
cabe qualquer medida de discricionariedade.
No pode o rgo pblico competente dar patentes onde em sede
constitucional se veda tal concesso, como, por exemplo, no caso
de criaes abstratas, inclusive a de programas de computador em si
mesmos, nem pode aplicar critrios de convenincia e oportunidade.
Se h direito subjetivo constitucional, cabe ao ente pblico:
- Examinar a existncia dos pressupostos;
- Declarar-lhes a existncia;
- Constituir o direito de exclusiva.
Reversamente, na inexistncia dos pressupostos de concesso,
especialmente a falta de novidade e atividade inventiva, cabe
inexoravelmente ao INPI recusar o pedido.
Em um sem nmero de aspectos, o procedimento de exame de
patentes se acha jungido s regras do procedural due process of
law inserido no art. 5 LIV da Carta de 1988, que impe pleno direito de defesa. Pertinente, assim, o dispositivo da Lei do Processo Administrativo Federal (Lei n 9.784, 29 de janeiro de 1999):
$UW $$GPLQLVWUDomR 3~EOLFD REHGHFHUi GHQWUH RXWURV DRV
SULQFtSLRVGDOHJDOLGDGHQDOLGDGHPRWLYDomRUD]RDELOLGDGH
proporcionalidade, moralidade, ampla defesa, contraditrio,
VHJXUDQoDMXUtGLFDLQWHUHVVHS~EOLFRHHFLrQFLD
3DUiJUDIR~QLFR1RVSURFHVVRVDGPLQLVWUDWLYRVVHUmRREVHUYDdos, entre outros, os critrios de: (...)

44

Denis Borges Barbosa

VIII - observncia das formalidades essenciais garantia dos


direitos dos administrados; (...)
Portanto, sabendo-se que a concesso de um monoplio implicar a restrio de liberdade de iniciativa de terceiros, o procedimento administrativo dever obedecer aos princpios de publicidade dos atos administrativos, de ampla defesa e do contraditrio, todos contidos no princpio maior do devido processo legal.
Ele se materializa, por exemplo, na medida em que o depsito
GRSHGLGRGHSULYLOpJLRpSXEOLFDGRHPUHYLVWDRFLDODPGH
que terceiros interessados possam a ele se opor ou apresentar
VXEVtGLRV DR H[DPH GR LQYHQWR$QDO QRV WHUPRV GR DUW 
LV, da Constituio Federal, a tutela jurdica do direito defesa dever do Estado, qualquer que seja a funo que esteja
desempenhando13.
Alis, no se pode olvidar que o princpio da publicidade tem
guarida constitucional, tanto em matria processual, quanto administrativa, haja vista o teor dos artigos 93, IX e art. 137 caput da
Constituio Federal.

E, mais adiante:
Por tais caractersticas, se assegura sempre que as exclusivas
tecnolgicas sejam deferidas apenas aps procedimento admiQLVWUDWLYRGHFDUiWHUHVSHFLDO14. Assim relatamos em nosso Uma
Introduo Propriedade Intelectual, 2. Ed. 2003, Lumen Juris:
2 H[DPH WpFQLFR GR SHGLGR UHDOL]DGR SHOR ,13, SURFXUDUi
13

14

Jess Torres Pereira Jr., in O Direito de Defesa na Constituio de 1988, apud Jos dos
Santos Carvalho Filho, Manual de Direito Administrativo, Ed. Lumen Jris, 4 ed., p. 630
NETO, Diogo de Figueiredo Moreira. Curso de Direito Administrativo. Rio de Janeiro, 2002, p. 454-455, pareceria ter uma perspectiva mais restritiva do alcance
do direito administrativo em face da propriedade industrial: Em sede de Direito
Administrativo, interessa o exame das relaes do titular da propriedade intelectual
com o Estado, em carter de subordinao, relativamente ao sistema administrativo
de garantias, e, eventualmente, interveno econmica a que esto sujeitas. No
entanto, logo em seguida, falando do sistema de licenas compulsrias, o autor revela sua convico quanto ao potencial interesse pblico envolvido no instituto: Em
ambos os casos, como se observa, manifesta a prevalncia do interesse pblico
HVSHFtFRVREUHRSULYDGRRTXHMXVWLFDDLPSRVLomRGRUHJLPHHVSHFLDOVREUHD
riqueza econmica representada pela inveno patenteada. Todavia, se o interesse
pblico a tanto o exigir, o ordenamento poder assumir a forma radical de interveno dominial, procedendo-se desapropriao do privilgio pela Unio (art. 39).

45

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

avaliar a satisfao dos requisitos legais para a concesso da


patente. O procedimento multilateral e dialogal, importando em participao de todos interessados, e cooperao recproca entre o rgo pblico e o depositante. Findo o exame,
DSyVRVHYHQWXDLVPDQLIHVWDo}HVHUHFXUVRVDSDWHQWHpHQP
deferida ou recusada.

A REGRA PROCEDIMENTAL DA CONGRUNCIA


exatamente pela natureza do procedimento (sendo um monoplio, ou seja, um novo objeto de direito, com oponibilidade egra omnes) que se precisam garantir os interesses juridicamente protegidos
de terceiros. Com muito mais razo em se tratando de um procedimento estatal no qual se tutelam interesses no s do requerente, mas
de todos terceiros pertinentes acorre aqui a norma da FRQJUXrQFLD
dos pedidos.
No mbito processual (judicial e administrativo) vige o princpio
da correlao ou congruncia, consagrado no CPC (arts. 128 e 460),
que estipula a estrita observncia pelo julgador do pedido efetuado
pelas partes, sob pena de julgamento extra petita ou ultra petita conforme o caso15.
Ainda que se alegue a inexistncia de carter litigioso no procedimento
inicialmente instaurado perante o INPI (se que j no existe em face da autarquia), inegvel que o mesmo pode vir a ter tal natureza em face de terceiros, na medida em que estes podem se opor ao pedido inicialmente efetuado.
A consagrao da regra de congruncia no direito da Propriedade
Intelectual
A regra assente e incontroversa.
No magistrio do clssico par excellence, Eugene Pouillet, o pediGR[DDH[WHQVmRGRGLUHLWRHR[DGHWDOIRUPDTXHQmRSRVVDVHUUHLvindicado alm dos mesmos termos que se fez o depsito. Para o autor
francs, o depsito do pedido constituiria a manifestao de vontade do
depositante que, encontrando a declarao receptcia da lei que prev a
15

 ,eRDXWRUTXH[DQDSHWLomRLQLFLDORVOLPLWHVGDOLGHVHQGRTXHRMXOJDGRU
FDDGVWULWRDRSHGLGRMXQWDPHQWHFRPDFDXVDGHSHGLUVHQGROKHYHGDGRGHFLGLU
aqum (citra ou infra petita), fora (extra petita) ou alm (ultra petita) do que foi pedido, nos termos do artigo 460 do CPC. (STJ, REsp 658715, Rel. Min. Francisco
Falco, DJ 06/12/04).

46

Denis Borges Barbosa

SURWHomRGDVPDUFDV[DDH[WHQVmRGDH[FOXVLYLGDGHQRVOLPLWHVTXH
ele mesmo o depositante - pediu 16.
Quase um sculo depois, Paul Roubier aponta no ter mudado a regra:
/HGpS{WGRQQHjODPDUTXHXQFDUDFWqUHGH[LWpRXGHFHUWLWXGH
TXLpOLPLQHWRXWHVOHVGLIFXOWpVVXUOpWHQGXHGXGURLWjODPDUTXH
en effet, le dpt dtermine ltendue du droit de propriet. Cette
consquence du dpt empche, il est vrai, le dposant, comme on
le verra, de rien revendiquer au-del de ce qui a t dpos, cest
donc lui prciser exactement ce quil entend protger par le
dpt de sa marque ; mais dans ces limites la protection lgale
lui sera accorde pour toute ltendue prcise par le dpt 17.

Diz Pontes de Miranda, sobre o nosso direito:


4. EXTENSO DO DIREITO REAL DE PROPRIEDADE INDUSTRIAL.
- O depsito protege tudo que nle se compreende enquanto no se
GHFLGHGHVIDYRUjYHOPHQWHRSHGLGRVHDQDOVHGHQHJDRUHJLVWRDHFiFLDGHFODUDWyULDQHJDWLYDGDGHFLVmRDGPLQLVWUDWLYDDIDVWD
16

17

Pouillet, Eugne.Trait des Marques de Fabrique et de la Concurrence Dloyale En


7RXV*HQUHV3DULV,PSULPHXUVeGLWHXUVS/HGpS{W[H
ltendue du droit. Le dpt dtermine le droit du propritaire de la marque ; il en
[HOpWHQGXHGHWHOOHVRUWHTXHULHQQHSHXWrWUHUHYHQGLTXpDXGHOjGHVWHUPHVPrPHV
dans lesquels a t fait le dpt. La marque dpose constitue le contrat qui se forme
HQWUHOHGpSRVDQWHWODVRFLpWpHQWUHOHGpSRVDQWTXL[HOXLPrPHOpWHQGXHGHVRQ
domaine et la societ qui lui en assure la jouissance dans les limites quil a luimme
[pHV/RUVGRQFTXXQHDFWLRQHQFRQWUHIDoRQHVWHQJDJpHLOHVWWUqVLPSRUWDQWGH
FRQVXOWHU OH GpSRW HW GH[DPLQHU QRQ OH SURFqVYHUEDO GH GpS{W FHXYUH GX JUHIHU
essentiellement sujette contestation , mais la marque dpose elle-mme, laquelle,
on le verra (1), est la disposition de tous, soit au greffe du Tribunal de Commerce,
soit au Conservatoire des Arts et Mtiers, o chacun peut sen faire dlivrer copie. Du
dpt, en effet, il peut rsulter que le dposant a fait consister sa marque non dans tel
lment pris isolment, par exemple dans une dnomination particulre, mais dans un
ensemble de caractres divers, dont la runion seule forme sa propriet. II sensuivra
que le juge correctionnel pourra, devra mme parfois, au regard de la marque dpose,
renvoyer le prvenu de contrefaon, encore que limitation quil aura faite de certains
lments puisse, devant une autre juridiction, constituer une vritable concurrence
dloyale. Autre chose est la contrefaon dune marque, autre chose la concurrence
dloyale, et la rpression, dans les deux cas, est fort diffrente.
(1) V. Paris, 26 mars 1873, Peter Lawson, Pataille.73.83; Amiens, 21 juin 1873,
Peter Lawson, Pataille.73.378; Rej. 21 mai 1874, mme affaire, Pataille.74.153.
ROUBIER, Paul. LE DROIT DE LA PROPRIT INDUSTRIELLE. 22, Rue
_6RXIRW3$5,6  eGLWLRQV'X5HFXHLO6LUH\S

47

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

qualquer efeito que se atribuiu, no pretrito, ao depsito. O depsito


s protege o que nle se compreende. Qualquer indagao sobre
extenso do direito real do requerente h de ser feita no depsito, e
no alhures, inclusive no que se discutir antes ou depois.
O depsito que diz o que se considera a marca, quais os elementos caractersticos, quais os produtos ou artigos, que a marca se
destina, qual o gnero do negcio. A marca destinada a rdios no
protegida se aplicada a aparelhos de televiso, nem a vitrolas 18.

E no menos a jurisprudncia:
PROPRIEDADE INDUSTRIAL - Tutela antecipada deferida
3URLELomRGHXVRGHPDUFDJXUDWLYDQRIRUPDWRERFDEHLMR
/LEHUDomRSDUDUHSURGXomRGDPHVPDJXUDVHPSRUpPUHpetio do mesmo desenho tridimensional, que no caracteriza
reviso da ordem judicial anterior - Proteo restrita ao formato objeto de registro no INPI - Recolhimento dos produtos
MiGLVWULEXtGRVFRQWHQGRDJXUDUHFRQKHFLGDFRPRFRQWUDIHLWD
1HFHVVLGDGH3URYLGrQFLDTXHIDFLOLWDDYHULFDomRGRFXPprimento da determinao judicial e impede sua eventual burla
- Concesso, todavia, de prazo superior para a execuo da medida ante a exigidade daquele inicialmente deferido pelo juzo
a quo - Agravo parcialmente provido. (grifos nossos) (TJ/SP,
Relator: Galdino Toledo Jnior, Registrado em 12/09/2007).

AS MUTAES ENTRE O REIVINDICADO E O CONCEDIDO


Nos sistemas de Propriedade Intelectual cuja proteo depende de
procedimento administrativo de concesso (patentes, marcas, variedaGHVGHSODQWDVGHVHQKRLQGXVWULDOWRSRJUDDVGHFRPSXWDGRU RXUHJLPHDQFLODUGHFRQFHVVmR GDGRVFRQGHQFLDLVQRPHGHHPSUHVD GHVWD
feita, no se pode conceder mais do que foi originalmente postulado.
No entanto, uma das conseqncias inevitveis do procedimento
administrativo de concesso que ele possa no acolher a totalidade do
pretendido. Para adequar o pedido aos limites do que a lei autoriza con18

MIRANDA, Pontes de. Tratado de Direito Privado. So Paulo: Ed. Revista dos Tribunais, 1983, p 77-78.

48

Denis Borges Barbosa

ceder, a autoridade pode restringir, adequar, limitar, apostilar HQP


introduzir tais restries ao objeto do pedido quanto imponha o Direito,
num rito plenamente vinculado.
Assim, muito j se escreveu sobre o poder da administrao de restringir o inicialmente reivindicado pelo titular do pedido de patente 19,
e o pelo titular do pedido de marcas 20.
Assim, no se ter a todo tempo aquilo que foi reivindicado, pois s
ser concedido aquilo a que o reivindicante tenha direito; mas mesmo
que houvesse pretenses do requerente alm do pedido s se defere o
direito at o limite do pedido, e nunca alm.

OS LIMITES DA CONCESSO E O ESCOPO DO DIREITO


A exclusiva concedida, por todas as razes j indicadas, deve ser
interpretada estritamente; mas no literalmente:
Mas, enquanto se recompensa a inveno til, os direitos e o bemHVWDUGDFRPXQLGDGHGHYHPUD]RDYHOPHQWHVHUFRQVLGHUDGRVHHFD]PHQWHJXDUGDGRV3DUDHVVHVQVRVSUpUHTXLVLWRVGHREWHQomR
da patente tem de ser observados estritamente, e quando a patente
concedida, as limitaes ao seu exerccio devem ser aplicadas
tambm estritamente. (...) Uma vez a patente seja concedida:
a)deve-seinterpret-laestritamente[]21(traduolivre;grifosnossos)
19

20

21

Vide, em nosso Uma Introduo Propriedade Intelectual, 2. Ed., Lmen Jris,


RH[WHQVRWH[WRVREUHDPRGLFDomRGHUHLYLGLQDo}HVHRVOLPLWHVLPSRVWRV
pelo devido processo legal. Neste caso, o limite legal da mutao o anteriormente
descrito, mas as mutaes quanto ao inicialmente reivindicado seguem necessariamente os requisitos do devido processo legal quanto ao interesse de terceiros.
Vide Apostilmento em Direito de Marcas em nosso BARBOSA, Denis Borges, A
Propriedade Intelectual no Sculo XXI - Estudos de Direito. Rio de Janeiro: Lumen
Juris, 2008, p. 199 e seg. .
Sears, Roebuck & Co. V. Stiffel Co., 376 1964, tendo o Sr. Ministro Black como relator. Texto original: The grant of a patent is the grant of a statutory monopoly; indeed,
the grant of patents in England was an explicit exception to the statute of James I
prohibiting monopolies. Patents are not given as favors, as was the case of monopolies
given by the Tudor monarchs, but are meant to encourage invention by rewarding the
LQYHQWRUZLWKWKHULJKWOLPLWHGWRDWHUPRI\HDUV[HGE\WKHSDWHQWWRH[FOXGHRWKHUV
from the use of his invention. During that period of time no one may make, use, or sell
the patented product without the patentees authority. But in rewarding useful invention, the rights and welfare of the community must be fairly dealt with and effectually
guarded. To that end the prerequisites to obtaining a patent are strictly observed, and

49

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

ESTRITO, NO LITERAL
Ocorre, no entanto, que em cada direito de exclusiva, a proteo se
d ao bem imaterial circunstrito pelo ato concessivo, mas no exatamente literalidade do instrumento da concesso.

O CASO DOS DIREITOS AUTORAIS


A proteo dos direitos autorais se d sem qualquer interveno da
autoridade administrativa: a exclusiva eclode do simples ato de criao,
sem pedido, exame ou concesso. No obstante, o exemplo da proteo
autoral a mais fcil de se entender.
Protege-se a forma, no as idias e conceitos nsitos na obra, nem,
de outro lado, as aplicaes utilitrias da criao autoral 22. Mas a proteo da formaQmRVHUHVXPHjOLWHUDOLGDGHVXSHUFLDOGRWH[WRXPD
traduo no usar talvez nenhuma palavra ou construo gramatical
do original, mas nem por isso deixar de ser colhida pela exclusividade.
Pois o elemento protegido o bem imaterial, que transcende mesmo
forma protegida, sem dela exceder.

O CASO DAS PATENTES


No caso das patentes de inveno e modelo de utilidade, essa aplicao
estrita mas no literal se d atravs da chamada Doutrina da Equivalncia23:
Mas o alcance da reivindicao, necessariamente, no formal e literal24. Como em quase todos os campos do Direito

22
23

24

when the patent has issued the limitations on its exercise are equally strictly enforced.
To begin with, a genuine invention [...] must be demonstrated lest in the constant
demand for new appliances the heavy hand of tribute be laid on each slight technological advance in an art. Once the patent issues: [] it is strictly construed [].
Lei 9.610/98, art. 8.
BARBOSA, Denis Borges . Doutrina dos Equivalentes. In: Manoel J. Pereira dos
Santos, Wilson Jabour. (Org.). Criaes Industriais. So Paulo: Saraiva, 2006.
Graver Tank & Mfg. Co. v. Linde Air Products Co., 339 U.S. 605, 607 (1950).
Vide Festo (2002): It recognizes that words may not always be able to aptly

50

Denis Borges Barbosa

de Patentes, obrigatrio iniciar com o magistrio de Gama


Cerqueira:
Os elementos caractersticos da inveno, porm, devem ser examinados e apreciados de acrdo com a funo que desempenham
HQmRVRERVHXDVSHFWRPDWHULDO'RFRQWUiULRLOXVyULDVHULDD
SURWHomROHJDOSRLVEDVWDULDDVLPSOHVPRGLFDomRGHXPRXRXtro elemento, sem alterao substancial de sua funo, ou a sua
substituio por elemento equivalente, para isentar o infrator da
responsabilidade pela infrao. Este princpio aplica se a tdas as
espcies de inveno e particularmente importante quando se trata de invenes de processos. (CERQUEIRA, 1952, p.320)
&RPRRTXHURDXWRURPSUHFtSXRGRLQVWLWXWRpHYLWDUTXHD
literalidade de uma reivindicao impea que a patente seja utilizada adequadamente, promovendo o inventimento em criao
tecnolgica. A introduo de variaes irrelevantes ou cosmticas poderiam tornar a exclusividade inoperante, se no houvesse
aplicao substantiva no formal do privilgio25.

E mais adiante, apontando como se apura o que equivalente, mas


no literal:
Teste tripartite de equivalncia:
- o elemento acusado realiza substancialmente a mesma funo
que o elemento da reivindicao? (S) (+/-) (N)

25

convey the basis of an invention. It also recognizes that to permit imitation of a


patented invention which does not copy every literal detail would be to convert the
protection of the patent grant into a hollow and useless thing. Note-se, porm,
do que lembram Romuald Singer e Margarete Singer, , (1995, 69.02???): In Germany, certain circumstances can arise in which a court, dealing with the issue of
infringement, may nonetheless interpret claims exactly in accordance with their
wording, rather than permitting any extension to cover equivalents. This can occur
if, in the course of an infringement action, the patent is wholly, or in a divisible
area, identical with the prior art, but the defendant has not brought any action for
nullity before the German patents court.
Graver Tank & Mfg. Co. v. Linde Air Products Co., 339 U.S. 605, 607 (1950).: One
who seeks to pirate an invention, like one who seeks to pirate a copyrighted book
or play, may be expected to introduce minor variations to conceal and shelter the
piracy. Outright and forthright duplication is a dull and very rare type of infringement. To prohibit no other would place the inventor at the mercy of verbalism and
ZRXOGEHVXERUGLQDWLQJVXEVWDQFHWRIRUP,WZRXOGGHSULYHKLPRIWKHEHQHWRIKLV
invention and would foster concealment rather than disclosure of inventions, which
is one of the primary purposes of the patent system.

51

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

-realiza a funo substancialmente do mesmo modo que o elemento da reivindicao? (S) (+/-) (N)
- produz substancialmente o mesmo resultado que o elemento da
reivindicao? (S) (+/-) (N).

O CASO DAS MARCAS


2HOHPHQWRJXUDWLYRQRPLQDWLYRRXWULGLPHQVLRQDOSURWHJLGRQR
FHUWLFDGRGRUHJLVWURFRQJXUDRQ~FOHRGDSURWHomRGDPDUFDQRVHX
segmento de mercado pertinente.
No entanto, sendo a funo da marca a de distino e assinalamento, tambm aqui se protege no a literalidade, mas essa funo, nos
limites da exclusiva como concedida26:
$VVLPLQLFLHPRVDDQiOLVHSHODDUPDomRGHTXHDH[WHQVmRGD
proteo de um signo em face de outras marcas decorre:
Em primeiro lugar, da distintividade absoluta da marca-paradigma.
Quanto mais distintiva em si mesma, mais amplo o espectro de proteo em face de terceiros. Esta distintividade resulta de dois fatores:
1) O efeito da criao originria da marca
2) O efeito do investimento publicitrio
Em segundo lugar da distncia das marcas em comparao no tocante:
1) s atividade econmicas em relao s quais a marca utilizada (proximidade de mercados)
2) s relaes simblicas existentes entre as marcas em comparao.

EM TODOS OS CASOS: PROTEO ESTRITA


AO REIVINDICADO
No entanto, o efeito da exclusiva no exceder jamais o bem imaterial
protegido; nas hipteses, como a de marca tridimensional, em que a constituio da exclusiva depende de atuao da autoridade estatal, o pedido
[DDH[WHQVmRPi[LPDSRVVtYHO que o direito eventual possa vir a ter.
26

Da nossa Nota sobre a metodologia de confrontao de marcas, em BARBOSA,


Denis Borges, A Propriedade Intelectual no Sculo XXI - Estudos de Direito. Rio de
Janeiro: Lumen Juris, 2008.

52

Denis Borges Barbosa

Tomemos o exemplo de Pouillet 27: depositou-se o pedido de uma


marca constando de um pssaro aqutico, combinado com uma coroa
mural, letras iniciais entrelaadas e uma denominao... phospho-guaQR0DVRGHSyVLWRUHLYLQGLFDYDRVHOHPHQWRVJXUDWLYRVQmRHQXQciando a denominao. Julgada posteriormente a infrao da marca por
concorrente que indicava seu produto como sendo phospho-guano, no
se apurou qualquer violao28.

27

28

Op. Cit., loc. Cit.: Un exemple mettra cette marque en vidence et la fera bien
comprendre: Un fabricant dengrais avait dpos une marque compose dun
oiseau aquatique , combine avec une couronne murale, des lettres initiales entrelaces, et une dnomination, celle de phospho-guano. Le dpt revendiquait
expressment lensemble de ces caractres, sans attacher la moindre importance
la dnomination, qui , daprs les termes du dpt, semblait mme tre reconnue
pour ne pas appartenir privativement au dposant. Dautres fabricants de produits
similaires prirent leur tour cette dnomination, mais en lassociant, des lments absolument diffrents, en remplaant, par exemple, loiseau par des lions, et
en supprimant dailleurs la couronne murale. Iis se virent nanmoins pourssuivis
devant la juridiction correctionnelle raison de lemploi des mots phospho-guano
; mais ils opposrent avec raison les termes du dpt , et, sappuyant dune part
sur ce que ce dpt ne revendiquait pas la dnomination prise isolment, dautre
part, sur ce que lensemble des marques ne permettait aucune confusion, ils triomphrent de la prvention. Ctait justice (1). 112 bis. Jurisprudence. II a t jug
en ce sens : 1 que lemploi, par un fabricant rival, dun emblme analogue celui
appliqu prcdemment par un autre fabricant constitue, en pareille circonstance,
une usurpation de marque, encore bien quil ne soit pas la reproduction exacte de
lautre ; mais, pour que cette usurpation puisse donner lieu une action en justice,
il faut que le plaignant ait pralablement effectu le dpt de sa marque au sige
du tribunal de commerce de son domicile (Trib. Corr.du Havre, 30 mars 1857,
Rec. Du Havre. 57.1.59) ; 2 que la proprit dune marque doit tre restreint au
type dpos (Bordeaux, 9 aount 1865, Deniset Monnier, Pataille.66.430) ; 3 que
ODIRUPXOHDGRSWpHSDUOHJUHIHUGDQVOHSURFqVYHUEDOGHGpS{WTXLODUpGLJp
ne peut prvaloir contre les termes de la lgende joint au dpt (Trib. Corr. Seine,
27 fv. 1873, Laterrire, Pataille.73.294) ; 4 que, lorsquil rsulte dun acte de
dpt de marque que le dposant a entendu faire porter son droit privatif, non
sur la dnomination (dans lespce, phospho-guano) qui fait partie de la marque
, mais sur lensemble seulement des signes qui la composent, cest avec raison
que les juges du fait refusent de condammer comme contrefacteur un commerant qui, tout en employant la mme dnomination, la fait entrer dans lensemble
dune marque absolument diffrente (Rej. 30 dc. 1874, Goubeau et Goudenove,
Pataille. 75.314). V. Infr, n 121.
O Phospho-guano era um tipo de adubo, fabricado com guano do Peru e aditivos fosfatados. No se encontram mais exemplos da marca de 1854 descrita por
Pouillet, mas a usina em Poitou-Charentes, ostentando a denominao no proWHJLGD p WRPEDGD SHOR 3DWULP{QLR &XOWXUDO )UDQFrV 9LGH KWWSZZZLFNUFRP
VHDUFK"T SKRVSKR Z #1

53

DIREITOS FUNDAMENTAIS NO
ATENDIMENTO HOSPITALAR
Flvia Moreira Guimares Pessoa1
Resumo
O artigo analisa a necessidade de observncia dos direitos fundamentais
pelos Hospitais, quer da rede pblica, quanto da rede privada de sade,
DOX]GDWHRULDGDHFiFLDKRUL]RQWDOGRVGLUHLWRVIXQGDPHQWDLVIRFDQGR
no atendimento s parturientes e na Lei 11108/05.
Palavras-chave - GLUHLWRVIXQGDPHQWDLVHFiFLDSULYDGDDWHQGLPHQWR
hospitalar.
Abstract
The article examines the need for respect of fundamental rights by hospitals, public or private, through the theory of the horizontal effectiveness of rights, focusing on care for pregnant women and Law 11108/05.
Key Words - Fundamental rights, private effectiveness, health care

/EdZKhK
O presente trabalho tem por objetivo analisar a aplicao direta dos
direitos fundamentais nos ambientes hospitalares, em especial o princpio da dignidade da pessoa humana.
H que se assinalar, neste ponto, a importncia prtica do assunto,
tendo em vista o constante desrespeito aos direitos fundamentais no
interior de hospitais.
1RWHVHTXHDDQiOLVHQmRYLVDDYHULFDURGHVUHVSHLWRDRVGLUHLWRV
fundamentais decorrentes da ausncia de hospitais, precariedade de reFXUVRVGHFLrQFLDGHTXDQWLGDGHGHPpGLFRVLPHQVDVODVQRVVHUYLos pblicos de sade etc.
1

Professora Adjunto da Universidade Federal de Sergipe. Doutora em Direito Pblico. Mestre em Direito, Estado e Cidadania. . Juza do Trabalho (TRT 20 Regio)

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

3DUDFRQVWDWDUTXHWDLVGHFLrQFLDVIHUHPRPtQLPRH[LVWHQFLDOQmR
VHULDQHFHVViULRXPDUWLJRFLHQWtFR$RIHQVDDRPtQLPRGHGLJQLGDGH
humana to clara em tais casos que no h porque recorrer a qualquer
pensamento mais elaborado.
A questo deste artigo outra. No trata da precariedade do atendimento pblico de sade. Trata, isso sim, do desrespeito aos direitos
fundamentais mesmo nos hospitais particulares e conveniados, mesmo
nas hipteses dos ditos servios privados, sem qualquer vinculao ao
Sistema nico de Sade.
Uma das discusses mais atuais dentro do debate relativo publicizao do direito privado ou mesmo da superao da dicotomia entre
Direito Pblico e direito privado aquela relativa vinculao dos particulares aos direitos fundamentais. A questo se coloca tanto no sentiGRVHH[LVWHWDOYLQFXODomREHPFRPRUHVSRQGHQGRVHDUPDWLYDPHQWH
primeira indagao, em que medida se d tal vinculao.
Esse trabalho, portanto, volta-se anlise do tema, o que empreendido atravs da anlise: do conceito dos direitos fundamentais; do
princpio da dignidade da pessoa humana; das teorias sobre a vinculao dos particulares a direitos fundamentais; dos parmetros necessrio
para a aplicao dos direitos fundamentais e da aplicao dos direitos
fundamentais nos hospitais.
2DUWLJRQDOL]DFRPXPH[HPSORSUiWLFRGHGHVUHVSHLWRDRVGLUHLtos fundamentais relativo proibio de acompanhantes s parturientes,
determinada pela Lei 11108/05.

&/E/KK^/Z/dK&hEDEd/^
A conceituao do que sejam direitos fundamentais particularmente difcil, tendo em vista a ampliao e transformao dos direitos
IXQGDPHQWDLVGRKRPHPQRHQYROYHUKLVWyULFR$XPHQWDHVVDGLFXOdade, o fato de se empregarem vrias expresses para design-los, como
direitos naturais, direitos humanos, direitos pblicos subjetivos,
liberdades fundamentais 2 etc.
2

Consoante assinala Jos Afonso da Silva (2005, p. 55) a expresso direitos naturais
refere-se queles inerentes natureza do homem; direito inatos que cabem ao homem s pelo fato de ser homem. J direitos humanos a expresso preferida nos
documentos internacionais, sendo terminologia pouco usada na doutrina, salvo para

56

Flvia Moreira Guimares Pessoa

A expresso direitos fundamentais, consoante assinala Jos


$IRQVR GD 6LOYD  S   QmR VLJQLFD HVIHUD SULYDGD FRQWUDposta atividade pblica, mas sim limitao imposta pela soberania popular aos poderes constitudos do Estado que dela dependem.
'DGHQLomRH[SRVWDSHORDXWRUYHULFDVHVXDSRVLomRQRVHQWLGR
de limitar a expresso ao campo de abrangncia da proteo dos
particulares contra o Estado.
Uma noo mais atualizada dos direitos fundamentais, porm, conduz concluso de que estes representam a constitucionalizao dos
GLUHLWRVKXPDQRVTXHJR]DUDPGHDOWRJUDXGHMXVWLFDomRDRORQJRGD
histria e que so reconhecidos como condio para o exerccio dos demais direitos. Haveria, dessa forma, um contedo mnimo de direitos
fundamentais que caracterizam o direito de um Estado Democrtico
(SAMPAIO, 2006, p. 17).
Segundo Jos Afonso da Silva( 2005, p. 58), os direitos fundamentais teriam os seguintes caracteres: a) historicidade;b) imprescritibilidade; c) irrenunciabilidade. So, assim, os direitos fundamentais
histricos, o que rechaa qualquer fundamentao no direito natural.
So imprescritveis dada a sua natureza de direitos personalssimos de
QDWXUH]DHPJHUDOQmRSDWULPRQLDOVmRSRUPLUUHQXQFLiYHLVHPERUD
possam deixar de ser exercidos.
Numa perspectiva atual reconhecem-se os direitos fundamentais
como tendo uma dupla dimenso: subjetiva e objetiva. Em sua sigQLFDomR REMHWLYD RV GLUHLWRV IXQGDPHQWDLV UHSUHVHQWDP DV EDVHV GR
consenso sobre os valores de uma sociedade democrtica, ou seja, sua
funo a de sistematizar o contedo axiolgico objetivo do ordenamento democrtico escolhido pelos cidados (SAMPAIO, 2006, p. 34).
J em sua dimenso subjetiva, os direitos fundamentais tm a funo
de tutelar a liberdade, a autonomia e a segurana dos cidados, no s
em suas relaes com o Estado, mas em relao aos demais membros
da sociedade (SAMPAIO, 2006, P. 35).

referir-se aos direitos civis ou liberdades civis. Os direitos pblicos subjetivos constituem um conceito tcnico-jurdico do Estado Liberal, preso, como a concepo
direitos individuais, concepo individualista do homem (SILVA, 2005, p. 55).
Liberdades fundamentais ou liberdades pblicas so expresses ligadas concepo
dos direitos pblicos subjetivos e direitos individuais.

57

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

KWZ/E1W/K/'E/W^^K,hDE
Ressalta Canotilho (1989, p. 200) os princpios jurdicos consWLWXFLRQDLV SRGHP VHU FODVVLFDGRV HP D princpios jurdicos fundamentais, assim entendidos os princpios historicamente objectivados e
progressivamente introduzidos na conscincia jurdica geral e que encontram uma recepo expressa ou implcita no texto constitucional;
b) princpios polticos constitucionalmente conformadores, entendidos
como tais os princpios constitucionais que explicitam as valoraes
polticas fundamentais do legislador constituinte; c) princpios constitucionais impositivos, entendidos assim os princpios constitucionais
nos quais subsumem-se todos os princpios que no mbito da constituio dirigente impem aos rgos do Estado, sobretudo ao legislador, a
UHDOL]DomRGHQVHDH[HFXomRGHWDUHIDVG princpios-garantia, nos
quais includos outros princpios que visam instituir directa e imediatamente uma garantia dos cidados.
Os princpios constitucionais, em especial o da dignidade da pessoa
humana so considerados normas jurdicas, sendo dotados de coercitividade e de imperatividade ,submetendo todo o conjunto normativo
inferior s suas disposies expressas e aos desgnios dos valores consagrados em seu bojo.
A relao entre o princpio da dignidade da pessoa humana e os
direitos fundamentais pode ser apontada em cinco aspectos, bem deduzidos por Boldrini (2003, p.2). Num primeiro aspecto , segundo o autor,
a dignidade da pessoa humana pode ser vista como unidade de valor de
uma ordem constitucional e, principalmente, como unidade de valor
para os direitos fundamentais. Num segundo aspecto, como elemento
de habilitao de um sistema positivo dos direitos fundamentais, a proteo e a promoo da dignidade do homem sustenta e afere legitimidade a um Estado e a uma sociedade que tenham a pessoa humana como
P H FRPR IXQGDPHQWR Pi[LPRV Numa terceira acepo, a relao
entre direitos fundamentais e dignidade da pessoa humana seria uma
relao de praxis no interior terico da ordem constitucional. Num
quarto, tem-se a perspectiva da dignidade da pessoa humana como parmetro na deduo de direitos fundamentais implcitos, seguindo a
concepo de que a prpria dignidade consistiria um direito fundamental na medida em que se manifestasse stricto sensu3RUPWHPVHD
a perspectiva da dignidade da pessoa humana como limite e funo do

58

Flvia Moreira Guimares Pessoa

Estado e da sociedade, na dupla vertente de que tanto um quanto outro


devem respeitar e promover a dignidade.
O que importa ressaltar das acepes vislumbradas que o princpio da dignidade da pessoa humana pode ser visto tanto como fundaPHQWRTXDQWRSDUDGLJPDHPGRVGLUHLWRVIXQGDPHQWDLV

dKZ/^^KZs/Eh>KK^
PARTICULARES A DIREITOS FUNDAMENTAIS
Conforme visto, atualmente existe certa tendncia da doutrina em
DFHLWDUDHFiFLDSULYDGDGRVGLUHLWRVIXQGDPHQWDLVRTXHHQWUHWDQWR
QmRH[FOXHPDVFRQFHSo}HVTXHQHJDPDHFiFLDIUHQWHWHUFHLURV&RQtudo, em termos gerais, pode-se dizer que a grande discusso atual em
que medida ou intensidade se d essa vinculao dos particulares aos
direitos fundamentais, ou, conforme ressalta Alexy (2002, p. 511) as
questes a serem equacionadas so o como e o em que medida se
GiDHFiFLDGRVGLUHLWRVIXQGDPHQWDLVQDVUHODo}HVSULYDGDV
Dessa forma, para analisar tal questo, mister apontar-se as teorias
ou concepes sobre a vinculao dos particulares aos direitos fundamentais, o que se procede mediante a anlise de cinco teorias principais
TXH QHJDPDHFiFLDSHUDQWHWHUFHLURV DWULEXHPHFiFLDPHGLDWD
  DWULEXHP HFiFLD LPHGLDWD   IRUPXODP LPSXWDomR DR (VWDGR  
teoria integradora.
Como menciona Juan Maria Bilbao Ubillos (2003, p.299), as conFHSo}HVTXHQHJDPDHFiFLDIUHQWHDWHUFHLURVWrPDFRQYLFomRGHTXH
WDOHFiFLDSRGHVHUXPDHVSpFLHGHFDYDORGHWUyLDTXHGHVWUXDRVLVtema construdo sobre a base da autonomia privada. Com efeito, so
cada vez menos autores que negam a relevncia dos direitos fundamentais na esfera do direito privado, mas ainda h aqueles que consideram
desnecessria ou perigosa tal aplicao.
$WHRULDGDHFiFLDPHGLDWDRXHFiFLDLQGLUHWDIRLLQLFLDOPHQWHIRUmulada por Gnther Dring e recebeu apoio decisivo ao ser adotada pelo
Tribunal Constitucional Alemo no famoso caso Luth. Os postulados dessa teoria foram assim resumidos por Wilson Steinmetz (2004, p. 136-137):
1) as normas de direitos fundamentais produzem efeitos nas relaes entre
particulares por meio das normas e dos parmetros dogmticos, interpreWDWLYRVHDSOLFDWLYRVSUySULRVGRGLUHLWRSULYDGR DHFiFLDGHGLUHLWRV

59

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

fundamentais nas relaes entre particulares est condicionada mediao


concretizadora do legislador de direito privado, em primeiro planto, e do
juiz e Tribunal, em segundo plano; 3) ao legislador cabe o desenvolvimento
concretizante dos direitos fundamentais por meio da criao de regulaes
QRUPDWLYDVHVSHFtFDVTXHGHOLPLWHPRFRQWH~GRDVFRQGLo}HVGHH[HUFtcio e o alcance desses direitos nas relaes entre particulares; 4) ao juiz e
aos tribunais, ante o caso concreto e na anuncia de desenvolvimento legisODWLYRHVSHFtFRFRPSHWHGDUHFiFLDjVQRUPDVGHGLUHLWRVIXQGDPHQWDLV
por meio da interpretao e aplicao dos textos de normas imperativas de
direito privado, sobretudo daqueles textos que contm clausulas gerais3.
)L[DGRVWDLVSRQWRVSULQFLSDLVYHULFDVHTXHSDUDDWHRULDGDHccia mediata, os direitos fundamentais no incidem nas relaes entre
particulares como direitos subjetivos constitucionais, mas como normas objetivas de princpio ou como sistema de valores ou ordem obMHWLYDGHYDORUHV'HVVDPDQHLUDSRVVXHPXPDHFiFLDPRGXODGD
legislativamente ou segundo parmetros dogmticos interpretativos e
DSOLFDWLYRVHVSHFtFRVGRGLUHLWRSULYDGR
$ WHRULD GD HFiFLD LPHGLDWD RX GLUHWD SRU VHX WXUQR IRL LQLFLDOmente formulada por Hans Carl Nipperdey e adotada pela primeira vez,
segundo Wilson Steinmetz (2004, p. 164) pela Cmara Primeira do Tribunal Federal do Trabalho na Alemanha em 1964. Tal teoria tem redu]LGDLQXrQFLDQD$OHPDQKDFRQWXGRYHPVHGHVHQYROYHQGRQD,WiOLD
Portugal e sobretudo Espanha.
'DPHVPDIRUPDTXHDWHRULDGDHFiFLDPHGLDWDHVVDWHRULDWDPEpP
atribui aos direitos fundamentais uma dupla dimenso, objetiva e subjeWLYDHXPDHFiFLDRSHUDQWHHPWRGRRUGHQDPHQWRMXUtGLFR$GLIHUHQoD
EiVLFD HVWi QR IDWR GH D WHRULD GD HFiFLD LPHGLDWD SURSRU D DSOLFDomR
direta de normas de direitos fundamentais nas relaes entre particulares.
Wilson Steinmetz (2004, p. 168) resumiu as premissas bsicas desta
teorias: 1) as normas de direitos fundamentais conferem ao particular
uma posio jurdica oponvel no s ao Estado, mas tambm aos demais particulares; 2) os direitos fundamentais so e atuam como direi3

As clusulas gerais constituem em formulaes legais de carter genrico e abstrato,


com natureza de diretriz, cujos valores sero preenchidos pelo juiz na anlise do
caso concreto. Tm a funo de dotar o Cdigo de maior mobilidade, mitigando
regras mais rgidas. Ademais, tm funo de integrao dos diferentes princpios e
direitos adotados em nossa sociedade pluralista, consistindo na possibilidade de o
juiz aplicar a lei com ampla liberdade axiolgica, ponderando os interesses em conLWRQRFDVRFRQFUHWR7rPDLQGDIXQomRGHLQVWUXPHQWDOL]DUDVQRUPDVMXUtGLFDV
DRVQVWHOHRORJLFDPHQWHFRQVLGHUDGRVSHOROHJLVODGRU

60

Flvia Moreira Guimares Pessoa

tos subjetivos constitucionais, independentemente de serem pblicos


ou privados; 3) como direitos subjetivos constitucionais, a no ser que
D FRQVWLWXLomR HVWDEHOHoD GH IRUPD GLYHUVD RSHUDP HFiFLD LQGHSHQGHQWHPHQWHGDH[LVWrQFLDGHUHJXODo}HVOHJLVODWLYDVHVSHFtFDVRXGR
recurso interpretativo-aplicativo das clusulas gerais do direito privado.
A teoria da imputao ao Estado, desenvolvida por Jrgen Schwabe, aponta que tanto os problemas que a teoria dos direitos proteo
pretende resolver como o problema da vinculao aos particulares a
direitos fundamentais so explicados e resolvidos no marco terico dos
direitos fundamentais como direitos de defesa ante o Estado (STEINMETZ,2004, p. 175). Segundo Schwabe, toda leso de direito fundamental entre particulares deve ser imputada ao Estado, porque a leso,
em ltima anlise, resulta de uma permisso ou no proibio estatal.
A teoria integradora, por seu plano, prope um modelo em trs nveis
TXHLQWHJUDDVWUrVWHRULDVEiVLFDVWHRULDGDHFiFLDPHGLDWDWHRULDGDHFicia imediata e teoria da imputao. Foi desenvolvida por Alexy e possui
trs nveis: 1) o dos deveres do Estado; 2) o dos direitos ante o Estado e 3)
o das relaes jurdicas entre particulares (ALEXY, 2002, P. 516).
$WHRULDGDHFiFLDPHGLDWDSDUD$OH[\VLWXDVHQRQtYHOGRVGHveres do Estado. Os direitos ante o Estado situam-se no segundo nvel,
VHJXLQGRVHDWHRULDGH6FKZDEH2SDUWLFXODUHPFRQLWRFRPRXWUR
particular, tem o direito fundamental a que o judicirio leve em considerao os princpios fundamentais que apiam a sua posio. J no
WHUFHLURQtYHOVLWXDVHDHFiFLDLPHGLDWDGHGLUHLWRVIXQGDPHQWDLVQDV
relaes jurdicas entre particulares. Contudo, nos trs casos, resulta
XPD HFiFLD LPHGLDWD GRV GLUHLWRV IXQGDPHQWDLV XPD YH] TXH$OH[\
GHQHDHFiFLDLPHGLDWDFRPRVHQGRTXHSRUUD]}HVIXQGDPHQWDLVQD
relao cidado/cidado existem determinados direitos e no direitos,
liberdades e no liberdades, competncias e no competncias que, sem
essas razes, no existiriam(ALEXY, p. 521).

s/Eh>KK^WZd/h>Z^K^/Z/dK^
FUNDAMENTAIS NO DIREITO BRASILEIRO:

$SRQWDGDVDVWHRULDVUHODWLYDVjDSOLFDELOLGDGHGDVQRUPDV[DGRUDV
de direitos fundamentais nas relaes privadas, destaque-se a tendncia
61

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

jurisprudencial dos Tribunais brasileiros em aplicar diretamente os direitos fundamentais. Tal tendncia foi reforada pela deciso do STF,
nos autos do Recurso Extraordinrio 201.819/RJ, julgado em outubro
de 2005, atravs do voto divergente do Ministro Gilmar Mendes que
decidiu pela aplicao dos direitos fundamentais concernentes ao contraditrio, ao devido processo legal e ampla defesa ao processo de
excluso de scio de entidade4.
Conquanto a aplicabilidade dos direitos fundamentais nas relaes
privadas venha ganhando espao no cenrio jurdico nacional, o que importa deixar patente so os critrios para a referida aplicabilidade. Com
efeito, conforme ressalta Ingo Sarlet (2006, p. 400), o modo pelo qual se
opera a aplicao dos direitos fundamentais s relaes jurdicas entre os
particulares no uniforme, reclamando solues diferenciadas.
Neste aspecto, convm ressaltar que no julgamento do RE 201.819,
Acrdo j mencionado no incio desse item, o Ministro Gilmar FerUHLUD0HQGHVIRLHQIiWLFRDRDUPDUDQHFHVVLGDGHGHYHULFDomRGDV
peculiaridades da cada caso concreto, tanto assim que conclui a deciso
DUPDQGRTXHHVWDQGRFRQYHQFLGRSRUWDQWRGHTXHDVSDUWLFXODULGDdes do caso concreto legitimam a aplicabilidade dos direitos fundamentais referidos (...), peo vnia para divergir, parcialmente, da tese apresentada pela eminente relatora.
7DODSOLFDomRGLIHUHQFLDGDMXVWLFDVHSRUTXHHPUHDOLGDGHTXDQGRVH
pugna pela aplicabilidade dos direitos fundamentais nas relaes privadas
HVWiVH GLDQWH GH XP FRQLWR GH GLUHLWRV IXQGDPHQWDLV  3RU XP ODGR R
princpio da autonomia privada. Por outro, o princpio fundamental que se
requer a aplicao. A soluo, ento, seria a mesma dos diversos casos de
FRQLWRVHQWUHGLUHLWRVIXQGDPHQWDLVDSRQGHUDomRHPFDGDFDVRFRQFUHWR5.
 1HVVH FRQWH[WR PXLWR LPSRUWDQWH p D [DomR GH SDUkPHWURV RX
standards para o estabelecimento de pautas para os casos de coliso,
4

Interessante consultar a ntegra do Acrdo, que discorre sobre as diversas teorias,


bem como aponta o estgio atual de discusso da matria.
Nesse sentido, a posio de Ingo Sarlet (2006, p. 401): (...) no mbito da problePiWLFDGDYLQFXODomRGRVSDUWLFXODUHVDVKLSyWHVHGHXPFRQLWRHQWUHRVGLUHLWRV
fundamentais e o princpio da autonomia privada pressupe sempre uma anlise
WySLFRVLVWHPiWLFDFDOFDGDQDVFLUFXQVWkQFLDVHVSHFtFDVGRFDVRFRQFUHWRGHYHQGR
ser tratado de forma similar s hipteses de coliso entre direitos fundamentais de
diversos titulares, isto , buscando-se uma soluo norteada pela ponderao dos valores em pauta, almejando obter um equilbrio e concordncia prtica, caracterizada,
em ltima anlise, pelo no-sacrifcio completo de um dos direitos fundamentais,
bem como pela preservao, na medida do possvel, da essncia de cada um.

62

Flvia Moreira Guimares Pessoa

com o objetivo de se garantir a segurana jurdica6, j que, consoante


menciona Daniel Sarmento (2006, p. 271) a fundamentao jurdica das
GHFLV}HVMXGLFLDLVWHPVLGRGHFLHQWHVQHVVHSRQWR
Um dos fatores fundamentais ressaltado por Daniel Sarmento (2006,
p. 272) como elemento para a ponderao a existncia e o grau de desigualdade ftica entre os envolvidos. Dessa forma, quanto mais intensa
for a desigualdade, mais intensa ser a proteo do direito fundamental em
jogo. Consoante ressalta o autor , o princpio da igualdade material no
apenas permite, mas antes impe, na ordem jurdica brasileira, a proteo
das partes mais dbeis nas relaes privadas (SARMENTO, 2006, p. 274).
Outro fator destacado por Daniel Sarmento a autonomia do ator
privado, mesmo na hiptese de uma relao jurdica manifestamente assimtrica. que a autonomia privada constitui um valor essencial nos Estados Democrticos e tambm exprime uma importante
dimenso da idia de dignidade da pessoa humana (SARMENTO,
2006, p. 278). Contudo, nem todas as manifestaes da autonomia
privada dispem da mesma proteo constitucional com a mesma
intensidade. Nesse sentido, vale frisar a lio de Daniel Sarmento
(2006, p. 278) , no sentido de que na nossa ordem constitucional,
a tutela da autonomia privada, no que se refere ao que chamamos
6

a segurana jurdica que traz estabilidade s relaes sociais juridicamente tutelveis, em face da certeza a ela inerente. A segurana jurdica inibe o arbtrio e
a violncia e d amparo s relaes entre as pessoas e o Estado e entre as pessoas
entre si. De acordo com a concepo tradicional, a ordem essencial tanto vida
individual quanto vida coletiva. Segundo Theophilo Cavalcanti Filho (1964, p.
8), essa necessidade de ordem, que traz consigo a segurana, de tal modo profunda que tem todas as caractersticas de um fato espontneo e natural. Assinala
o autor que o objetivo primeiro do direito a exigncia de ordem e de segurana.
Aponta que da mesma maneira que o homem cria segurana, no que diz respeito
DRDPELHQWHQDWXUDODWUDYpVGRFRQKHFLPHQWRFLHQWtFRHGDWpFQLFDHVWDEHOHFH
atravs das normas uma certeza e segurana na sua vida de relaes, de modo
a permitir a vida em sociedade. (CAVALCANTI FILHO, 1964, P. 54). A perspectiva contempornea da segurana Jurdica aponta, por seu turno, sua dplice
natureza. Consoante lio de Almiro do Couto e Silva (2005, p.3), a segurana
MXUtGLFD VH UDPLFD HP GXDV SDUWHV $ SULPHLUD GH QDWXUH]D REMHWLYD p DTXHOD
que tradicionalmente envolve a questo dos limites retroatividade dos atos do
(VWDGRDWpPHVPRTXDQGRHVWHVVHTXDOLTXHPFRPRDWRVOHJLVODWLYRVRXVHMD
se refere proteo do direito adquirido, ato jurdico perfeito e coisa julgada. J
a perspectiva subjetiva da segurana jurdica volta-se idia da proteo conDQoD&RXWRH6LOYD S UHVVDOWDDLQGDTXHRVSULQFtSLRVGDVHJXUDQoDH
GDSURWHomRjFRQDQoDVmRHOHPHQWRVFRQVHUYDGRUHVLQVHULGRVQDRUGHPMXUtGLFD
destinados manuteno do status quo e a evitar que as pessoas sejam surpreenGLGDVSRUPRGLFDo}HVGRGLUHLWRSRVLWLYRRXQDFRQGXWDGR(VWDGRRTXHDFDED
provocando tenso com as tendncias modernizadoras do Estado.

63

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

de questes existenciais muito mais intensa do que a conferida s


decises de carter econmico-patrimonial, podendo a ordem jurdica
transigir muito mais com as restries liberdade contratual do que
com aquelas impostas a outras liberdades mais fundamentais, ligadas
s opes e projetos de vida de cada pessoa humana.
Conforme ressalta Daniel Sarmento, no campo das relaes econmicas, a essencialidade do bem um critrio importante na aferio
da intensidade conferida proteo autonomia privada. Desse modo,
quanto mais o bem envolvido na relao jurdica em discusso for
considerado essencial para a vida humana, maior ser a proteo do
direito fundamental em jogo e menor a tutela da autonomia privada
(SARMENTO, 2006, p. 278).
Outro ponto que a leso do direito fundamental pode decorrer
no apenas de um ato unilateral de outro agente privado, mas tambm de algum negcio bilateral, cuja validade dependa do consentimento formal do prprio afetado. Essa questo liga-se controvrsia sobre a validade da renncia ao exerccio de direitos fundamentais, existindo, nesse caso, dois limites a serem respeitados, os
quais foram bem expostos pelo autor: a vontade do titular do direito
deve ser autenticamente livre e a renncia do exerccio no pode
importar em leso ao princpio da dignidade da pessoa humana, nem
ao ncleo essencial dos direitos fundamentais do indivduo. (SARMENTO, 2006, p. 282).
Apontados alguns critrios para a ponderao de interesses no mbito da vinculao dos particulares aos direitos fundamentais, passa-se
anlise da aplicao dos direitos fundamentais no atendimento hospitalar.

W>/KK^/Z/dK^&hEDEd/^
NO ATENDIMENTO HOSPITALAR
3DUDYHULFDUVHDREULJDWRULHGDGHGHDSOLFDomRGRVGLUHLWRVIXQdamentais pelas entidades hospitalares, mesmo privadas, mister saOLHQWDU  TXH QRV KRVSLWDLV FD QtWLGR R  JUDX GH GHVLJXDOGDGH IiWLFD
entre os envolvidos.
O paciente aquele que chega para fazer o atendimento ou operao e no tem direito a voz nem nada. Na entrada da sala de cirurgia
despido de todos os seus bens e a partir da no tem o menor controle

64

Flvia Moreira Guimares Pessoa

do que ocorrer. Ntido, assim, que o grau de desigualdade impe a


necessidade de observncia dos direitos fundamentais como limite
discricionariedade dos estabelecimentos hospitalares.
Conforme foi visto no item anterior, quanto mais o bem envolvido
na relao jurdica em discusso for considerado essencial para a vida
humana, maior ser a proteo do direito fundamental em jogo e menor a tutela da autonomia privada. evidente, assim, que em hospitais,
onde se est em jogo a vida, integridade fsica e psquica dos pacientes,
devem ser observados os direitos fundamentais.
3RUPXPDQRWDVREUHDUHQ~QFLDVYH]HVFRPRSURWRFRORSDUD
se dar entrada em hospitais, exigida renncia prvia a direitos. ntido que essa renncia viciada, j que a vontade do titular do direito
no , neste caso, autenticamente livre , alm de importar em leso ao
princpio da dignidade da pessoa humana.

'h/^KE>h^K
h

Estabelece a lei 11.108/2005, em seu art. 19 J, que os servios
de sade do Sistema nico de Sade - SUS, da rede prpria ou conYHQLDGDFDPREULJDGRVDSHUPLWLUDSUHVHQoDMXQWRjSDUWXULHQWH
de um acompanhante durante todo o perodo de trabalho de parto,
parto e ps-parto imediato. Estabelece ainda o 1 do mesmo artigo
que o acompanhante de que trata o caput deste artigo ser indicado
pela parturiente.
primeira vista poderia parecer que o artigo se aplica unicamente
aos usurios do SUS, o que no pode prevalecer, uma vez que, conforme foi visto nos itens anteriores, existe a necessidade de observncia,
pelos hospitais, dos direitos fundamentais, de forma que impe-se a
aplicao da medida em todo o sistema pblico e privado de sade.
Veja-se que a situao dos pacientes atendidos pelo Sistema nico
de Sade mais grave, uma vez que em geral as parturientes tem medo
at de chorar ou gritar de dor do parto, tendo em vista que temem represlias das enfermeiras.
Tambm no tocante ao SUS, necessrio salientar o no fornecimento de anestesia em partos normais. Ainda que possam existir pes65

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

quisas apontando eventual carter positivo de tal procedimento,urge


salientar que em respeito aos direitos fundamentais basilares, em especial o da dignidade da pessoa humana, seria importante que o acesso
anestesia fosse uma opo da parturiente do sistema nico de sade.
Ainda no tocante aos hospitais que prestam atendimentos a convnios de sade e a particulares, necessrio observar, por bvio, o respeito, no apenas Lei 11108/2005, como tambm aos demais direitos
fundamentais, como o acesso informao sobre os medicamentos que
esto sendo prescritos, o respeito autonomia de vontade do paciente e
dignidade de sua existncia humana.

Z&ZE/^
ALEXY, Robert. Teoria de los Derechos fundamentales. Madrid:
Centro de Estudios Politicos Y constitucionales, 2002.
ANDRADE, Jos Carlos Vieira de. Os direitos, liberdades e garantias
no mbito das relaes entre particulares. In: SARLET, Ingo Wolfgang
(org.) Constituio, Direitos Fundamentais e Direito Privado. Porto
Alegre: Livraria do Advogado, 2003. p. 271-298.
BOLDRINI, Rodrigo Pires da Cunha. A proteo da dignidade da
pessoa humana como fundamentao constitucional do sistema
penal . Jus Navigandi, Teresina, ano 7, n. 66, jun. 2003. DisponYHOHPKWWSMXVXROFRPEUGRXWULQDWH[WRDVS"LG !$FHVVR
em: 24 dez. 2006.
CANOTILHO, Jos Joaquim Gomes. Direito Constitucional.
Coimbra: Almedina, 1989.

4.ed.

CANARIS, Claus-Wilhelm. Direitos fundamentais e direito privado. Trad. De Ingo Wolfgang Sarlet e Paulo Mota Pinto. Coimbra: Almedina, 2003.
CANOTILHO, Jos Joaquim Gomes. Dogmtica de direitos fundamentais e direito privado. In: SARLET, Ingo Wolfgang (org.) Constituio,
Direitos Fundamentais e Direito Privado. Porto Alegre: Livraria do
Advogado, 2003. p.339-357.
LOBO, Paulo Luiz Neto Lobo. Princpios de Direito de Famlia. Palestra apresentada no Ministrio Pblico do Estado de Sergipe. 2008.
66

Flvia Moreira Guimares Pessoa

SAMPAIO, Marlia de vila e Silva. Aplicao dos direitos fundamentais nas relaes entre particulares e a boa-f objetiva. Rio de
Janeiro: Lumen Juris, 2005.
SARMENTO, Daniel. A vinculao dos particulares aos direitos fundamentais no direito comparado e no Brasil In: BARROSO, Lus Roberto
(org). A nova interpretao constitucional: ponderao, direitos fundamentais e relaes privadas. Rio de Janeiro: Renovar, 2006, p. 193-284.
SARLET, Ingo Wolfgang. $HFiFLDGRVGLUHLWRVIXQGDPHQWDLV. 3 ed.
Porto Alegre: Livraria do Advogado, 2006.
SARMENTO, Daniel. Direitos fundamentais e relaes privadas.
Rio de Janeiro: Lumen Juris, 2004.
SILVA, Virglio Afonso. A constitucionalizao do direito: os direitos
fundamentais nas relaes entre particulares. So Paulo: Malheiros, 2005.
STEINMETZ, Wilson. A vinculao dos particulares a direitos fundamentais. So Paulo: Malheiros Ed., 2004.
TARTUCE, Flvio. Novos princpios do Direito de Famlia brasileiro. Jus Navigandi, Teresina, ano 10, n. 1069, 5 jun. 2006. Disponvel
HP KWWSMXVXROFRPEUGRXWULQDWH[WRDVS"LG ! $FHVVR HP
12 jun. 2009
UBILLOS, Juan Maria Bilbao. En que medida vinculan a los particulares los derechos fundamentales? In: SARLET, Ingo Wolfgang (org.)
Constituio, Direitos Fundamentais e Direito Privado. Porto Alegre: Livraria do Advogado, 2003. p.299-338.

67

ACUMULAO DE CARGOS PBLICOS E


O REGIME DE DEDICAO EXCLUSIVA
NO MBITO DAS UNIVERSIDADES
FEDERAIS BRASILEIRAS
Henrique Ribeiro Cardoso1
Resumo
O texto que se apresenta intenta analisar o regime de trabalho de dedicao exclusiva de professores universitrios no mbito das Universidades Federais brasileiras e sua compatibilidade com a garantia constitucional de acumulao de cargos pblicos. Busca interpretar, sempre
com orientao constitucional, as normas legais e infralegais aplicveis
j VROXomR GRV FRQLWRV TXH YHUVHP VREUH DFXPXODomR GH FDUJRV S~blicos, trazendo novos elementos de interpretao para o debate, colacionando ampla fonte jurisprudencial e recentes decises administrativas que devero pautar a atuao da Administrao Pblica na soluo
dos litgios. A nfase dada ser situao de acumulao de cargo de
Professor Universitrio em regime de dedicao exclusiva com o de
membro do Ministrio Pblico, podendo as concluses apresentadas ser
estendidas s demais situaes de acumulao lcita de cargos, pautadas
pela comprovao de efetiva compatibilidade de horrios.
Palavras-chave - Acumulao de cargos; professor universitrio; dedicao exclusiva; Ministrio Pblico.
Abstract
The text presented intends to analyze the regime of exclusive dedication
within the Federal Universities in Brazil and their compatibility with the
constitutional guarantee of accumulation of public positions. It pursue to
interpret, always with constitutional guidance, the statutory and regulatory
1

Doutor e Mestre em Direito, Estado e Cidadania pela Universidade Gama Filho


(UGF); Especialista em Direito Constitucional Processual (FAPESE/UFS); Professor do Programa de Ps-Graduao stricto sensu (PRODIR/UFS) e do curso de graGXDomR 'LUHLWR$GPLQLVWUDWLYRH)LORVRDGR'LUHLWR GD8QLYHUVLGDGH)HGHUDOGH
Sergipe (DDI/UFS); Primeiro Promotor de Justia da Fazenda Pblica em Sergipe
(MPSE). Email: henrique@ufs.br

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

SURYLVLRQVDSSOLFDEOHWRWKHVROXWLRQRIWKHFRQLFWVWKDWGHDOZLWKWKHDFFXPXODWLRQRISXEOLFRIFHVEULQJLQJIUHVKHOHPHQWVWRWKHGHEDWHFROOHFWLQJ
comprehensive source of leading cases and recent administrative decisions
that must guide the actions of the Public Administration in solving disputes. The emphasis will be given to the situation of a tenure-track Professor
in a Brazilian Federal Public University, in exclusive dedication work
UHJLPH LQ DGGLWLRQ WR WKH RIFH RI 3URVHFXWRU LQ 3XEOLF 0LQLVWU\7KH
conclusions may be extended to other situations of constitutional authorized accumulation, guided by proven compatibility of workload hours.
Key Words - Accumulation of positions; professor; exclusive dedication; prosecutors.

1. CONSIDERAES INICIAIS
A burocrtica Administrao Pblica brasileira enfrenta em seu coWLGLDQRRGHVDRGHDSOLFDUXPGLUHLWRSODVPDGRSRUGLYHUVDVIRQWHVGR
direito, de normas de origem constitucional a normas de ndole meramente administrativas, passando por normas emanadas pelo Judicirio,
este cada vez mais ativo.
Nesta miscelnea de princpios e de regras de direito, de variadas
fontes, o administrador dever pautar sua atuao pelo princpio da legalidade. Ocorre, entretanto, que na prtica quem atua em lides de
ndole administrativa vivencia isso o administrador prefere qualquer
ato administrativo normativo lei ou at mesmo Constituio.
Se no atacado atos administrativos gerais e abstratos a questo
no questionada diretamente por potenciais prejudicados, no varejo
atos administrativos individuais e concretos - o cidado se v obrigado
a defender seu direito, tolhido que por determinado ato de autoridade.
Da a crescente demanda por justia em Varas Cveis da Justia Federal
e em Varas Especializadas da Fazenda Pblica da Justia Comum, assoberbadas por demandas em face do Estado.
O texto que se apresenta versa sobre a aplicao indiscriminada e
LUUHHWLGDGHXPDWRDGPLQLVWUDWLYRQRUPDWLYRR'HFUHWR)HGHUDOQ
94.664/1987 - a situaes de acumulao de cargos constitucionalmenWHDVVHJXUDGDVJHUDQGRXPVHPQ~PHURGHFRQLWRVDWLQJLQGRGLUHLWRV
de cidados aptos ao exerccio de cargos pblicos relevantes.
0DLV HVSHFLFDPHQWH D VLWXDomR IXQFLRQDO GH FDQGLGDWRV DSURYDGRV
em concursos pblicos para os cargos de professor universitrio de Uni-

70

Henrique Ribeiro Cardoso

versidade Federal brasileira em regime de dedicao exclusiva, previsto no


edital do concurso, em situao de acumulao com o cargo de vereador,
ou com outro cargo de professor, ou com o cargo de Conselheiro do Tribunal de Contas, ou com o cargo de magistrado, ou ainda com o cargo de
Membro do Ministrio Pblico. Em razo da proximidade com o tema, o
enfoque maior ser o da situao do Membro do Ministrio Pblico.

2. CONSTITUCIONALIDADE DA ACUMULAO
DOS CARGOS PBLICOS
Para a correta compreenso da matria, cabe apontar as cinco regras
constitucionais que veiculam a possibilidade de acumulao lcita de
cargos pblicos:2
a) Regra geral
Art. 37. [...]
XVI - vedada a acumulao remunerada de cargos pblicos,
exceto, quando houver compatibilidade de horrios, observado em qualquer caso o disposto no inciso XI.
a) a de dois cargos de professor;
E DGHXPFDUJRGHSURIHVVRUFRPRXWURWpFQLFRRXFLHQWtFR
F DGHGRLVFDUJRVRXHPSUHJRVSULYDWLYRVGHSURVVLRQDLVGH
VD~GHFRPSURVV}HVUHJXODPHQWDGDV
E 5HJUDDSOLFiYHOD9HUHDGRUHV
Art. 38. Ao servidor pblico da administrao direta, autrquica
e fundacional, no exerccio de mandato eletivo, aplicam-se as
seguintes disposies:
II - investido no mandato de Prefeito, ser afastado do cargo,
emprego ou funo, sendo-lhe facultado optar pela sua remunerao;
III - investido no mandato de Vereador, havendo compatibilidade de horrios, perceber as vantagens de seu cargo, emprego ou funo, sem prejuzo da remunerao do cargo eletivo,
2

Alm das previses constantes no texto principal, h tambm a previso constante


no ADCT, que trata da acumulao de cargos de mdicos militares, prevendo, excepcionalmente, a acumulao de trs cargos um militar e outros dois civis.

71

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

e, no havendo compatibilidade, ser aplicada a norma do


inciso anterior;
F 5HJUDDSOLFiYHOD0HPEURVGR7ULEXQDOGH&RQWDV
Art. 73. O Tribunal de Contas da Unio, integrado por nove
Ministros, tem sede no Distrito Federal, quadro prprio de
pessoal e jurisdio em todo o territrio nacional, exercendo,
no que couber, as atribuies previstas no art. 96.
3 Os Ministros do Tribunal de Contas da Unio tero as
mesmas garantias, prerrogativas, impedimentos, vencimentos
e vantagens dos Ministros do Superior Tribunal de Justia,
aplicando-se-lhes, quanto aposentadoria e penso, as normas constantes do art. 40.
G 5HJUDDSOLFiYHOD0HPEURVGR3RGHU-XGLFLiULR
Art. 95. Os juzes gozam das seguintes garantias:
I - vitaliciedade, que, no primeiro grau, s ser adquirida aps
dois anos de exerccio,
Pargrafo nico. Aos juzes vedado:
I - exercer, ainda que em disponibilidade, outro cargo ou funo, salvo uma de magistrio;
H 5HJUDDSOLFiYHOD0HPEURVGR0LQLVWpULR3~EOLFR
Art. 127. O Ministrio Pblico instituio permanente, essencial funo jurisdicional do Estado, incumbindo-lhe a defesa da
ordem jurdica, do regime democrtico e dos interesses sociais e
individuais indisponveis.
Art. 128. O Ministrio Pblico abrange:
5 - Leis complementares da Unio e dos Estados, cuja
iniciativa facultada aos respectivos Procuradores-Gerais,
estabelecero a organizao, as atribuies e o estatuto de
cada Ministrio Pblico, observadas, relativamente a seus
membros:
II - as seguintes vedaes:
d) exercer, ainda que em disponibilidade, qualquer outra funo pblica, salvo uma de magistrio;
Nota-se que por razes construdas por cada um dos grupos de interesse representados na Assemblia Constituinte, a Constituio estabe72

Henrique Ribeiro Cardoso

leceu os casos e as condies para a acumulao de cargos. No h,


H[FHomRGRVSURVVLRQDLVGDVD~GHQHQKXPDGLVWLQomRHVVHQFLDOTXDQWR
aos casos de acumulao. A diversidade meramente tpica e de boa
tcnica legislativa, buscando ampliar o comando constitucional contido
na regra geral do art. 37, XVI. Desta forma, a regra geral da possibilidade
de acumulao vem no art. 37, XVI, e as regras especiais aplicveis a
categorias diversas de agentes polticos Vereadores, Membros dos Tribunais de Contas, Membros da Magistratura e Membros do Ministrio
Pblico - so estabelecidas nos respectivos Ttulos e Captulos acerca da
Organizao do Estado e da Organizao dos Poderes. As hipteses so
anlogas, como tambm as solues encontradas pelos Tribunais.
Fazendo uma releitura do conjunto de regras postas acima, sob a
tica da situao funcional constitucionalmente assegurada ao professor, pode-se extrair o seguinte comando: o professor pode acumular seu
cargo pblico com outro cargo pblico: a) de professor; b) tcnico ou
FLHQWtFRF GHYHUHDGRUG GHPHPEURGR7ULEXQDOGH&RQWDVH GH
PDJLVWUDGRRXI GHPHPEURGR0LQLVWpULR3~EOLFR
A razo para a permisso constitucional obvia: permitir que os
DOXQRV DSUHQGDP FRP SURIHVVRUHV TXH DWXHP HIHWLYDPHQWH QD iUHD GH
HQVLQR DVVRFLDQGR D WHRULD j SUiWLFD VHPSUH HP DWHQomR j IRUPDomR
DFDGrPLFDHSURVVLRQDOGRVDOXQRV. A par das exigncias de formao
acadmica graduao, especializao, mestrado e doutorado -, patente
a escolha posta pelo Constituinte, externada nas permisses de acumulao de cargos pblicos. Esclarea-se que no se trata de privilgio concedido a determinadas carreiras, mas sim de um permissivo para integrar o
ensino terico especialmente em cursos superiores ao prtico.
No estudo do Direito, no se pode esquecer que seu contedo eminentemente prtico uma cincia da razo prtica, no dizer de Alexy e
que busca respostas seguinte pergunta: O que devo ou devemos fazer no
caso concreto? Nesta linha de raciocnio, quem melhor do que um advogado
militante para lecionar recursos na disciplina de Direito Processual Civil?
Quem melhor do que um Juiz de Direito para lecionar os elementos de uma
sentena civil ou criminal? Quem melhor do que um Promotor de Justia
para lecionar os requisitos de validade de uma denncia? Foi este o sentir do
Constituinte; esta a vontade objetiva veiculada em normas constitucionais.
Embora a Constituio Federal seja clara, ainda assim, h, por vezes,
TXHVWLRQDPHQWRVOHYDGRVDRV7ULEXQDLVHVSHFLFDPHQWHSRUVHUYLGRUHVRX
agentes polticos que vem tolhido seu direito subjetivo acumulao de
cargos em hipteses expressamente autorizadas pela Constituio.
73

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

3.O SIGNIFICADO DA EXPRESSODEDICAO EXCLUSIVA


4XDO R VLJQLFDGR GD ORFXomR UHJLPH GH WUDEDOKR GH GHGLFDomR
exclusiva? H compatibilidade entre este regime e outros cargos cuja
acumulao esteja prevista constitucionalmente? O ordenamento jurdico e variadas fontes do direito respondem a estas perguntas.
Por dedicao exclusiva ou plena entende-se a vedao ao exerccio de outra atividade de magistrio alm da realizada no mbito da
respectiva Universidade Federal. O professor de uma Universidade Federal em regime de dedicao exclusiva somente poder lecionar na
respectiva Universidade Federal, no lhe sendo permitido vnculo trabalhista com qualquer outra instituio privada de ensino.3
Hely Lopes Meirelles quem melhor esclarece o real sentido da
locuo dedicao exclusiva, correntemente adotada pela Administrao Pblica:
A diferena entre o regime de tempo integral e o de dedicao
plena est em que, naquele, o servidor s pode trabalhar no
cargo ou na funo que exerce para a Administrao, sendo-lhe
YHGDGRRGHVHPSHQKRGHTXDOTXHURXWUDDWLYLGDGHSURVVLRQDO
pblica ou particular, ao passo que neste (regime de dedicao
SOHQD  R VHUYLGRU WUDEDOKDUi QD DWLYLGDGH SURVVLRQDO GH VHX
cargo ou de sua funo exclusivamente para a Administrao,
mas poder desempenhar atividade diversa da de seu cargo ou
de sua funo sem qualquer outro emprego particular ou pblico, desde que compatveis com o da dedicao plena. No
regime de tempo integral o servidor s poder ter um emprego; no de dedicao plena poder ter mais de um desde que
no desempenhe a atividade correspondente sua funo pEOLFDH[HUFLGDQHVWHUHJLPH([HPSOLFDQGRRSURIHVVRUHP
regime de tempo integral s poder exercer as atividades do
FDUJRHQHQKXPDRXWUDDWLYLGDGHSURVVLRQDOS~EOLFDRXSDUticular; RDGYRJDGRHPUHJLPHGHGHGLFDomRSOHQDVySRGHUi
exercer a advocacia para a Administrao da qual servidor,
PDVSRGHUiGHVHPSHQKDUDDWLYLGDGHGHPDJLVWpULRRXTXDO3

Conforme adiante se demonstrar, por expresso permissivo constitucional, h a possibilidade de acumulao de um cargo de professor em regime de dedicao exclusiva com outro cargo de professor, desde haja compatibilidade de horrios.

74

Henrique Ribeiro Cardoso

quer outra, para a Administrao (acumulao de cargos) ou


para particulares.4

Este entendimento doutrinrio SDFtFR no mbito da legislao federal. neste sentido que as carreiras da Administrao Pblica Federal
so organizadas. Como exemplos, o disposto na Lei n. 11.890/2008, que
em seus diversos artigos (3., 6, 10 c/c 17, 22, 31, 65, 100 e 133), ao disciplinarem o regime jurdico de carreiras federais, prevem a dedicao
exclusiva, permitindo o exerccio da atividade de magistrio, desde que
FRPSDWtYHOFRPRKRUiULRGHWUDEDOKR. Desta forma, esto em regime de
dedicao exclusiva os Procuradores da Fazenda Nacional, os Advogados da Unio, os Procuradores Federais, os Auditores Federais, os Gestores Governamentais, os Especialistas do Banco do Brasil, os Diplomatas,
os Analistas Tcnicos da SUSEP, os Analistas e Inspetores da CVM, os
integrantes de diversas carreiras do IPEA, e todos eles, em regime de
dedicao exclusiva, podem exercer o magistrio havendo compatibiliGDGHGHKRUiULRV. Est na lei! E nem h previso constitucional expressa,
para cada uma destas carreiras, que autorize tal acumulao de cargos.
De modo semelhante, a Lei n. 11.526/2007 permite, alm da acumulao de cargos efetivos, a acumulao de cargos em regime de dediFDomRH[FOXVLYDFRPFDUJRGHGLUHomR &' RXIXQomRJUDWLFDGD )* 
em Instituies Federais de Ensino art. 2., 1..
$QDOLVDQGRDVLWXDomRHVSHFtFDGRPHPEURGR0LQLVWpULR3~EOLFR
cujo exerccio cumulativo de atividade docente foi disciplinado pela
Resoluo n. 03/2005,5 pode-se trilhar o seguinte raciocnio: se a Resoluo n. 03 do CNMP permitiu o mais, estabelecendo como carga mxima de trabalho a prestao de 20 horas de efetivo trabalho em sala de
aula, sem limitar o nmero de vnculos com instituies de ensino, por
certo permite o menos - e este seu desiderato: a vinculao exclusiva
DXPD~QLFDLQVWLWXLomRGHHQVLQRVXSHULRUFRPFDUJDKRUiULDOLPLWDGD
DRPi[LPRGHKRUDVHPVDODGHDXOD.
4

MEIRELES, Hely Lopes. Direito Administrativo Brasileiro. 25. ed. Malheiros: So


Paulo, 2001, pp. 455-456.
Resoluo n. 03, de 16 de dezembro de 2005. Dispe sobre o acmulo do exerccio das funes ministeriais com o exerccio do magistrio por membros do
Ministrio Pbico da Unio e dos Estados. Art. 1. Ao membro dos Ministrios
Pblicos da Unio e dos Estados, ainda que em disponibilidade, defeso o exerccio
de outro cargo ou funo pblica, ressalvado o de magistrio, pblico ou particular,
SRUQRPi[LPR YLQWH KRUDVDXODVHPDQDLVFRQVLGHUDGDVFRPRWDLVDVHIHWLYDmente prestadas em sala de aula.

75

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

A Lei de Diretrizes e Bases da Educao Nacional Lei n.


9.394/1996 estabelece, em seu art. 52, III, que as Instituies de Ensino Superior devero ter um tero de seus docentes em regime de tempo
integral. Tal dispositivo foi regulamentado pelo Decreto n. 2.207/1997,
DUWVLJQLFD
3DUDRVQVGRLQFLVR,,,GRDUWGDLei n 9.394, de 1996,
entende-se por regime de trabalho em tempo integral aquele com
obrigao de prestar quarenta horas semanais de trabalho, na
mesma instituio, nele reservado o tempo de pelo menos vinte
horas semanais, destinado a estudos, pesquisa, trabalhos de extenso, planejamento e avaliao.

Em igual sentido, o vigente Decreto n. 5.773, de 09 de maio de 2006:


Art. 69. O exerccio de atividade docente na educao superior
no se sujeita inscrio do professor em rgo de regulamenWDomRSURVVLRQDO
Pargrafo nico. O regime de trabalho docente em tempo integral compreende a prestao de quarenta horas semanais de
trabalho na mesma instituio, nele reservado o tempo de pelo
menos vinte horas semanais para estudos, pesquisa, trabalhos
de extenso, planejamento e avaliao.

Tornando claro o disposto em Lei e em Regulamento: no mbito do


Ensino Superior Federal, o regime de 40 horas, com ou sem dedicao
exclusiva, implica em, no mximo, 20 horas efetivas em sala de aula.
Na prtica, o Chefe do Departamento de Direito de cada uma das
Universidades Federais que estabelece, caso a caso, as horas efetivamente prestadas em sala de aula, respeitados os limites mximo (20h) e
mnimo (12h) limites estes estabelecidos em normas internas das IES
(Instituies de Ensino Superior) federais.
Numa pequena digresso, e sob a tica da preservao do interesse
do Ministrio Pblico na delimitao da atividade de professor por um
de seus membros, estaria permitido que este fosse professor em cinco
faculdades, contanto que ministrasse quatro horas-aula dirias. Qual a
situao que melhor atenderia ao interesse do Ministrio Pblico: a)
uma nica atividade de magistrio, com o mnimo de 12 horas e o m76

Henrique Ribeiro Cardoso

ximo de 20 horas efetivas em sala de aula, em regime de dedicao


exclusiva a uma instituio de ensino superior federal, ou b) cinco diferentes vnculos empregatcios com o total de 20 horas em sala de aula?
Por certo, o sentido da norma impedir excessos, e no estimular a
pluralidade de vnculos. Este raciocnio est no sentido do que dispe a
Constituio, ao permitir uma nica funo de magistrio.

4. DA ILEGALIDADE E DA INCONSTITUCIONALIDADE
DO DECRETO N. 94.664/1987
O regime de trabalho de dedicao exclusiva previsto unicamente no regulamento aprovado pelo Decreto n. 94.664, de 23 de julho de
1987 anterior Constituio Federal de 1988, portanto. Estabelece
tal Decreto:
Art. 14 - O Professor da carreira do Magistrio Superior ser
submetido a um dos seguintes regimes de trabalho:
I - dedicao exclusiva, com obrigao de prestar 40 (quarenta)
horas semanais de trabalho em 2 (dois) turnos dirios, completos e impedimento do exerccio de outra atividade remunerada,
pblica ou privada;
II - tempo parcial de 20 (vinte) horas semanais de trabalho.
1 - No regime de dedicao exclusiva admitir-se-:
a) participao em rgos de deliberao coletiva relacionada
com as funes de Magistrio;
E SDUWLFLSDomRHPFRPLVV}HVMXOJDGRUDVRXYHULFDGRUDVUHODcionadas com o ensino ou a pesquisa;
c) percepo de direitos autorais ou correlatos;
d) colaborao espordica, remunerada ou no, em assuntos de
sua especialidade e devidamente autorizada pela instituio,
de acordo com as normas aprovadas pelo conselho superior
competente.

Tal regulamento, aprovado por decreto, como se pode depreender


GHVXDHPHQWDGLVS}HVREUHR3ODQRQLFRGH&ODVVLFDomRGH&DUJRV
e Empregos de que trata a Lei n. 7.596, de 10 de abril de 1987.
A primeira ilegalidade que macula o Decreto n. 94.664 patente: a
norma administrativa traz limitao no prevista, nem mesmo generica77

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

mente, na lei regulamentada. A questo do impedimento do exerccio de


outra atividade remunerada, pblica ou privada exorbita do comando
legal, restringindo direitos fundamentais, como o exerccio da liberdade
de ofcio ou mesmo o direito ocupao lcita de cargos pblicos.
Alm do excesso da norma regulamentar, que enseja o reconhecimento de sua ilegalidade j em seu nascedouro, h outra ilegalidade,
superveniente, que fulmina o referido decreto: a Lei n. 7.596, de 10 de
abril de 1987 foi revogada pela Lei n. 11.784, de 22 de setembro de
2008. Esta lei dispe, integralmente, sobre o Plano Geral de Cargos
e de Retribuio do Poder Executivo, incluindo expressamente uma
seo que disciplina a Carreira do Magistrio Superior:6
Lei n 11.784, de 22 de setembro de 2008.
Dispe sobre a reestruturao do Plano Geral de Cargos do Poder
Executivo - PGPE, de que trata a Lei no 11.357, de 19 de outubro
de 2006, do Plano Especial de Cargos da Cultura, de que trata a
Lei no 11.233, de 22 de dezembro de 2005, do Plano de Carreira
dos Cargos Tcnico-Administrativos em Educao, de que trata a
Lei no 11.091, de 12 de janeiro de 2005, GD&DUUHLUDGH0DJLVWprio Superior, de que trata a Lei no 7.596, de 10 de abril de 1987,
do Plano Especial de Cargos do Departamento de Polcia Federal,
de que trata a Lei no 10.682, de 28 de maio de 2003 [...].

A referida lei, em seu Captulo I, Das Carreiras e dos Cargos, trata, na Seo IV, 'D&DUUHLUDGR0DJLVWpULR6XSHULRU&06. No h
QRWH[WRGDOHLTXHWUDWDHVSHFLFDPHQWHGRWHPDcarreiras e cargos
GRPDJLVWpULRVXSHULRUQHQKXPDPHQomRjH[LVWrQFLDGHYHGDo}HV
ao regime de dedicao exclusiva do magistrio superior. A lei prev,
em seu anexo, os valores de cada um das trs parcelas que integram o
sistema remuneratrio do professor universitrio: YHQFLPHQWR EiVLFR
UHWULEXLomRSRUWLWXODomR57HJUDWLFDomRHVSHFtFDGRPDJLVWpULR
VXSHULRU*(0$61mRKiQDVHomRHVSHFtFDTXHWUDWDGRPDJLVWpULR
superior art. 18 a 24 -, tampouco em seus anexos, que estabelecem
 1R VHQWLGR GD UHYRJDomR GD /HL Q  H GR 'HFUHWR Q  FRQUDVH
artigo de Mauro Roberto Gomes de Mattos: Processo administrativo disciplinar e
enquadramento da improbidade administrativa: Revogao tcita dos dispositivos dos estatutos dos funcionrios pblicos federais, estaduais e municipais que
WLSLFDP D LPSURELGDGH JHQHULFDPHQWH. Disponvel em http://jus2.uol.com.br/
doutrina/texto.asp?id=6104, com acesso em 15 de maio de 2009.

78

Henrique Ribeiro Cardoso

valores relativos a cada uma das parcelas do sistema remuneratrio,


qualquer vedao ao exerccio de atividades jurdicas ao professores
em regime de dedicao exclusiva! A frmula impedimento do exerccio de outra atividade remunerada, pblica ou privada constante no
Decreto n. 94.664/87 foi abandonada e revogada, portanto - pela
legislao em vigor!
O Decreto n. 94.664, de 23 de julho de 1987, tornou-se um corpo
sem alma: perdeu seu embasamento legal. A lei a que regulamentava
foi revogada! Nem se venha argumentar que tal decreto possui fora de
lei, haja vista que se trata de mero decreto de execuo, e no do sempre
rechaado decreto autnomo, ou mesmo de Decreto-Lei, que fazia as
vezes, mutatis mutandi, da atual Medida Provisria na Carta Constitucional de 1967/1969.
2 3ODQR GH &DUJRV H GH 5HWULEXLomR HVWi LQWHJUDOPHQWH SUHYLVWR
na Lei n. 11.784/08HHPVHXVDQH[RVFRQIRUPHHVSHFLFDGRQRDUW
23 da referida Lei. As limitaes trazidas no Decreto n 94.664/87 no
foram adotadas pela lei revogadora. E, como por demais sabido, um
decreto de 1987 no pode, jamais, servir como norma administrativa
regulamentadora de uma lei de 2008! Ilegal qualquer limitao que
no prevista expressamente em lei; inconstitucional qualquer limitao
a direito individual que contrarie a Constituio Federal.7
O referido Decreto n. 94.664, de 23 de julho de 1987, no possui qualquer amparo constitucional na atual Carta. E mais: ainda que
derivasse de um esdrxulo poder normativo anterior promulgao
da Constituio Federal de 1988, alguma espcie de regulamento autnomo, teria sido expressamente revogado pelo disposto no Ato das
7

Neste sentido, da revogao da Lei n. 7.596/87, expresso o seguinte acrdo do


Tribunal Regional Federal da 5 Regio: Acrdo AC 407032/01/AL. EMENTA:
Processual Civil. Embargos de declarao. Omisso. Inexistncia. Rediscusso da
matria. Impossibilidade. Recurso improvido. 1. Os embargos de declarao consWLWXHPRPHLRHVSHFtFRGHTXHGLVS}HDSDUWHSDUDHVFRLPDUDVHQWHQoDRXDFyUGmR
GHIDOKDVTXHSRVVDPVHUGDQRVDVSDUDRFXPSULPHQWRGRMXOJDGRWHQGRFRPRnalidade completar a deciso omissa ou, ainda, aclar-la, dissipando assim obscuridades ou contradies. 2. Inexistncia de qualquer omisso no acrdo embargado.
Apreciao da matria pela E. 1 Turma que entendeu no ter o embargante direito ao reajuste da funo comissionada vinculada correo do vencimento pago
aos docentes titulares doutores com dedicao exclusiva em virtude de que a lei n
7.596/87, que disciplinava as funes comissionadas foi extinta pelas leis 8.216/91
e 8.168/91, as quais determinaram a converso das FCs em CDs e FGs. 3. Embargos de declarao conhecidos e improvidos. Desembargador Federal Rogrio Fialho
Moreira Dirio da Justia - 13/02/2009 - pgina: 333 - n 31, 2009.

79

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Disposies Constitucionais Transitrias. com absoluta clareza que


dispe a Carta Magna:
Art. 25. Ficam revogados, a partir de cento e oitenta dias da
promulgao da Constituio, sujeito este prazo a prorrogao por lei, todos os dispositivos legais que atribuam ou deleguem a rgo do Poder Executivo competncia assinalada
pela Constituio ao Congresso Nacional, especialmente no
que tange a:
I - ao normativa;

No demais repetir: o Decreto n. 94.664, de 23 de julho de 1987


simultaneamente ilegal e inconstitucional, por exceder ao comando
OHJDOSRUVHUHIHULUDXPDOHLMiUHYRJDGDHSRUUHVWULQJLUGLUHLWRDVVHgurado expressamente na Constituio.

5. DA SITUAO ESPECFICA DE ACUMULAO DE


CARGOS POR MEMBRO DO MINISTRIO PBLICO
Estabelece a Constituio Federal de 1988, em relao ao Ministrio Pblico, a seguinte regra sobre acumulao de cargos:
Art. 127. O Ministrio Pblico instituio permanente, essencial funo jurisdicional do Estado, incumbindo-lhe a defesa
da ordem jurdica, do regime democrtico e dos interesses sociais e individuais indisponveis.
5 - Leis complementares da Unio e dos Estados, cuja iniciativa facultada aos respectivos Procuradores-Gerais, estabelecero a organizao, as atribuies e o estatuto de cada Ministrio
Pblico, observadas, relativamente a seus membros:
II - as seguintes vedaes:
d) exercer, ainda que em disponibilidade, qualquer outra funo
pblica, salvo uma de magistrio;

A Constituio Federal no traz qualquer restrio acumulao


dos cargos de membro do Ministrio Pblico ou da Magistratura com o

80

Henrique Ribeiro Cardoso

de professor. expressa e auto-aplicvel ao permitir a acumulao de


um cargo pblico de magistrio. No exige, ademais, a comprovao
prvia e abstrata da compatibilidade de horrio.
Neste sentido, a deciso do Supremo Tribunal Federal na ADI n.
3126, em que se questionou a constitucionalidade da Resoluo n.
336 do Conselho da Justia Federal. A deciso liminar, exarada em
30/01/2004 pelo ministro Nelson Jobim, Vice-Presidente no exerccio
GD 3UHVLGrQFLD p H[SUHVVD DR DUPDU TXH $ TXHVWmR HVWi QR WHPSR
que o magistrado utiliza para o exerccio do magistrio vis a vis ao
tempo que restaria para as funes judicantes. Nos mesmos autos, em
R3OHQiULRGD([FHOVD&RUWHUPRXVHXHQWHQGLPHQWRConsiderou-se, no caso, que o objetivo da restrio constitucional o de impedir o exerccio da atividade de magistrio que se revele incompatvel
FRPRVDID]HUHVGDPDJLVWUDWXUD1HFHVVLGDGHGHVHDYDOLDUQRFDVR
concreto, se a atividade de magistrio inviabiliza o ofcio judicante.
No sentido de aclarar a norma e, mais precisamente, de afastar os
excessos de alguns membros do Ministrio Pblico dos Estados e da
Unio que assumiam compromissos excessivos no mbito do ensino
superior e de cursos preparatrios para concursos, em detrimento do
bom exerccio de suas atividades ministeriais, o Conselho Nacional do
Ministrio Pblico (CNMP), nico rgo competente para impor, no
kPELWR GR 0LQLVWpULR 3~EOLFR UHVWULo}HV j UHJUD YHLFXODGD QD &RQVtituio FederalGLVS{VFRPRMiHVSHFLFDGRDFLPD ROLPLWHPi[LPR
semanal de 20 (vinte) horas-aula, consideradas como tais as efetivamente prestadas em sala de aula. Toda e qualquer restrio ou embarao criado por instituies de ensino ou por normas que no as emanadas
pelo Conselho Nacional do Ministrio Pblico ou por leis de iniciativa
do respectivo Ministrio Pblico a que esteja vinculado o membro do
Parquet padecero do LQHJiYHOYtFLRGHLQFRQVWLWXFLRQDOLGDGH.
Com maior razo (a fortiori), uma Portaria do Reitor ou um Edital
de Concurso no mbito de uma Universidade Federal no pode fazer
WiEXODUDVDGD&RQVWLWXLomR)HGHUDO. Num Estado de Direito h uma
inegvel hierarquia de normas e em seu pice estar a Constituio Federal. Normas internas que estabeleam vagas para novos concursos de
Professor Universitrio em regime de trabalho de dedicao exclusiva no podem revogar a Constituio; no podem prevalecer em face
do disposto na Constituio Federal. Entendimento contrrio tornaria
sem efeito o direito constitucionalmente assegurado na Constituio,
que se refere especialmente acumulao de cargos pblicos.
81

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Tornando claras as assertivas apresentadas at o presente momento,


com a necessria sistematizao:
a) O Decreto n. 94.664/87 que prev o regime de dedicao
exclusiva no foi recepcionado pela Constituio Federal de
1988, no podendo produzir qualquer efeito; b) Qualquer norma
que restrinja ou embarace a atividade de magistrio por memEUR GR 0LQLVWpULR 3~EOLFR YHLFXODGD SRU OHL TXH QmR VHMD GH
LQLFLDWLYDSULYDWLYDGR0LQLVWpULR3~EOLFRRXDLQGDRULXQGDGR
&RQVHOKR1DFLRQDOGR0LQLVWpULR3~EOLFR, afronta a Carta Constitucional e dever ser refutada por vcio formal e material de
inconstitucionalidade, no podendo produzir qualquer efeito no
mbito do Ministrio Pblico. c) Editais de concurso pblico
para o provimento de cargo de professor universitrio, ao estabelecerem regime de dedicao exclusiva, no se sobrepem
Resoluo do CNMP, Lei Orgnica do Ministrio Pblico,
tampouco Constituio Federal, no podendo negar vigncia
ao Direito Constitucional de acumulao de cargos, expressamente assegurado ao Membro do Ministrio Pblico, independentemente do regime de trabalho.

6. JURISPRUDNCIA ACERCA ACUMULAO DOS


CARGOS COM PREVISO CONSTITUCIONAL
A jurisprudncia no destoa do que se sustenta neste estudo.8 H amplo lastro para embasar a legalidade da acumulao de cargos pblicos,
especialmente nas hipteses previstas constitucionalmente. Em questes
envolvendo restries devido dedicao exclusiva, lastrada no j referido ilegal e inconstitucional - Decreto n. 94.664, de 23 de julho
de 1987, o Supremo Tribunal Federal (STF) no chega a se pronunciar,
 +iJUDQGHGLFXOGDGHSUiWLFDQDFRPSDWLELOL]DomRGHFDUJRVGHSURIHVVRUHVHVSHcialmente na acumulao de cargos de professores de 1 e 2 graus de esferas distintas Federal, Estadual e Municipal -, ou ainda com cargos tcnicos destas mesmas
esferas, cada uma delas regida por regras prprias no que se refere aos regimes de
trabalho. Da a existncia de decises esparsas pela no cumulao, aplicveis unicamente aos casos concretamente apreciados pelo referido Juzo, de cargos de proIHVVRU$VGHFLV}HVUHHWHPDGLFXOGDGHSUiWLFDQDFRPSDWLELOL]DomRGRVKRUiULRV
no exerccio de cargos de professor de 1 e 2 graus.

82

Henrique Ribeiro Cardoso

vez que normas infralegais emanadas pela Administrao, a exemplo de


regulamentos de execuo, no se sujeitam ao controle de constitucionalidade concentrado pelo Supremo Tribunal Federal. O Superior Tribunal
de Justia , em regra, quem d a ltima palavra sobre o tema.
Ocorre que R6XSHULRU7ULEXQDOGH-XVWLoDMiVHPDQLIHVWRXFRQFOXVLvamente sobre o tema. Tal deciso embasa toda uma cadeia de decises
dos Tribunais Regionais Federais e de Juzes Federais. do Superior Tribunal de Justia (STJ) a deciso lder leading case - assim ementada:
RESP - CONSTITUCIONAL - ADMINISTRATIVO - PROFESSOR- CARGO CUMULAO - A HIERARQUIA
DAS NORMAS JURIDICAS AFASTA A VIGENCIA DE LEI
QUANDO CONTRASTAR COM A CARTA POLITICA. ESTA
ADMITE ACUMULAO DE DOIS CARGOS DE PROFESSOR, QUANDO HOUVER COMPATIBILIDADE DE HORARIOS (CF/1988, ART. 37, XVI, A). 2$78$/5(*,0('(
75$%$/+2 '(',&$d2(;&/86,9$ 3256,6212e
OBSTACULO. EVIDENTE, DEVERA CONFERIR A NECESSARIA ATENO AS DUAS DISCIPLINAS NO TOCANTE AO HORARIO. Ministro Luiz Vicente Cernicchiaro (STJ
- RESP 97551/PE DJ - Data: 25/08/1997)

7DO GHFLVmR YHP VHQGR UHDUPDGD SHOD UHIHULGD &RUWH 6XSHULRU 


STJ -, a exemplo da recente deciso:
DIREITO CONSTITUCIONAL. ADMINISTRATIVO. RECURSO ESPECIAL. SERVIDOR PBLICO FEDERAL. PROFESSOR UNIVERSITRIO. 5(*,0( '( '(',&$d2 (;&/8SIVA. APOSENTADORIA. CUMULAO COM OS PROVENTOS DE APOSENTADORIA ANTERIOR, EM CARGO ESTADUAL. ACUMULAO DE PROVENTOS. POSSIBILIDADE.
,1&203$7,%,/,'$'('(+255,2612&21),*85$'$.
RECURSO ESPECIAL CONHECIDO E IMPROVIDO.
1. Havendo compatibilidade de horrios, permitida a acumulao remunerada de um cargo de professor com outro tcnico ou
FLHQWtFRQRVWHUPRVGRDUWLQF;9,OHWUDEGD&RQVWLtuio Federal.
2. A recorrida aposentou-se no cargo de bilogo-tcnico cientFRQRTXDGURGHVHUYLGRUHVGR(VWDGRGR5LR*UDQGHGR6XO
83

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

antes de tomar posse no cargo de Professor Adjunto da UFRGS.


3. Assim, remanesceu atendido o requisito constitucional da
FRPSDWLELOLGDGH GH KRUiULRV XPD YH] TXH D UHFRUULGD MDPDLV
acumulou os referidos cargos pblicos, no tendo sido desatendida a regra constitucional de inacumulabilidade.
4. Recurso especial conhecido e improvido.
REsp 970368 / RS RECURSO ESPECIAL 2007/0170910-2.
Ministro ARNALDO ESTEVES LIMA, julgado em 16/09/2008

tambm do Superior Tribunal de Justia a seguinte deciso:


CONSTITUCIONAL. ADMINISTRATIVO. SERVIDOR
ANISTIADO. ACUMULAO DE CARGOS PBLICOS.
TECNOLOGISTA DO IBGE. PROFESSOR UNIVERSITRIO. 5(*,0( '( '(',&$d2 (;&/86,9$. ,1&203$7,%,/,'$'( '( +255,26 12 &21),*85$'$ 6(*85$1d$&21&(','$.
+DYHQGRFRPSDWLELOLGDGHGHKRUiULRVpSHUPLWLGDDDFXPXlao remunerada de um cargo de professor com outro tcnico
RXFLHQWtFRQRVWHUPRVGRDUWLQF;9,OHWUDEGD&RQVtituio Federal.
2. O IMPETRANTE foi admitido como Professor da UnB em
11/4/62. Foi demitido por razes polticas em 10/11/65. Por fora da Emenda Constitucional 26/85, foi anistiado e reintegrado
HPWHQGRVLGRLPHGLDWDPHQWHEHQHFLDGRFRPOLFHQoD
sem vencimentos at a data de sua aposentadoria nesse cargo,
em 14/4/92, que se deu sob o regime de dedicao exclusiva,
conforme Decreto 94.667/87. Nesse intervalo, foi admitido, em
17/10/72, no cargo de Tecnologista do IBGE, l permanecendo
at sua aposentadoria, ocorrida em 24/11/97.
3. Assim, remanesceu atendido o requisito constitucional da
compatibilidade de horrios, uma vez que, no perodo de acumulao na ativa, compreendido entre 1/7/88 e 14/4/92, o impetrante cumprira integralmente o horrio de trabalho referente
ao cargo de Tecnologista. Sequer foi, nesse perodo, remunerado
duplamente pelo errio.
4. Desse modo, porque no questionada a natureza tcnica do cargo
de Tecnologista, em que se deu a aposentadoria no IBGE, e porTXHQmRKRXYHDHIHWLYDLQFRPSDWLELOLGDGHGHKRUiULRVQmRVHWHP

84

Henrique Ribeiro Cardoso

como desatendida a exceo regra constitucional de inacumulabilidade, conforme art. 37, XVI, letra b, da Lei Fundamental.
5. Segurana concedida.
MS 11566 / DF MANDADO DE SEGURANA 2006/0052166-5

Em igual sentido, ressaltando a possibilidade de acumulao de cargos e de aposentadorias de professores, exigindo unicamente a compatibilidade de horrios, a mais recente deciso do Superior Tribunal de
Justia sobre o tema, em, 19/02/2009:
AGRAVO REGIMENTAL EM AGRAVO DE INSTRUMENTO. ADMINISTRATIVO. PROFESSOR. DEDICAO EXCLUSIVA. APOSENTADORIA NO CARGO ANTERIOR.
ACUMULAO DE CARGOS. POSSIBILIDADE.
1. A jurisprudncia deste Sodalcio entende pela possibilidade
de acumulao de dois cargos de professor, sendo o segundo de
dedicao exclusiva se o servidor j encontrar-se aposentado no
primeiro cargo.
2. Agravo regimental improvido.
AgRg no Ag. 1118050 / RS
AGRAVO REGIMENTAL NO AGRAVO DE INSTRUMENTO
2008/0248997-0

As decises parcialmente transcritas acima so paradigmticas ao


permitirem a acumulao de aposentadoria e de cargo pblico em razo
de VRPHQWH VHUHP DFXPXOiYHLV RV SURYHQWRV GH DSRVHQWDGRULD TXDQGR
RVFDUJRVIRUHPDFXPXOiYHLVHPDWLYLGDGH. Reconhecer a legalidade da
acumulao de proventos dos inativos reconhecer a legalidade de acumulao de vencimentos dos ativos! Neste sentido, o disposto na Constituio Federal e na Lei n. 8.112/90 Lei do Regime Jurdico nico:
CONSTITUIO FEDERAL DE 1988
Art. 40. Aos servidores titulares de cargos efetivos da Unio,
dos Estados, do Distrito Federal e dos Municpios, includas
suas autarquias e fundaes, assegurado regime de previdncia de carter contributivo e solidrio, mediante contribuio do
respectivo ente pblico, dos servidores ativos e inativos e dos
SHQVLRQLVWDVREVHUYDGRVFULWpULRVTXHSUHVHUYHPRHTXLOtEULRnanceiro e atuarial e o disposto neste artigo.

85

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

6 Ressalvadas as aposentadorias decorrentes dos cargos acumulveis na forma desta Constituio, vedada a percepo de mais de uma
aposentadoria conta do regime de previdncia previsto neste artigo.
LEI N. 8.112/90
Art. 118. Ressalvados os casos previstos na Constituio, vedada
a acumulao remunerada de cargos pblicos.
---------3 Considera-se acumulao proibida a percepo de vencimento
de cargo ou emprego pblico efetivo com proventos da inatividade, salvo quando os cargos de que decorram essas remuneraes forem acumulveis na atividade.
Os Tribunais Regionais Federais (TRFs) vem, neste mesmo sentir, decidindo acerca da legalidade da acumulao de cargos, em
regime de dedicao exclusiva, nas hipteses autorizadas constitucionalmente. Tome-se a seguinte deciso do TRF da 5. Regio, que
provocou a deciso lder do STJ (RESP 97551/PE DJ, de 25/08/1997)
sobre o tema:
EMENTA: CONSTITUCIONAL. ENSINO SUPERIOR. ACUMULAO DE DOIS CARGOS DE MAGISTRIO EM UMA
MESMA INSTITUIO. POSSIBILIDADE. INEXISTNCIA
DE VEDAO CONSTITUCIONAL. INTELIGNCIA DO
ART. 37, XVI, ALNEA A, DA CF.
- A Constituio Federal de 1988, bem como a anterior, ao permitir a acumulao de dois cargos de professor, no estabeleceu qualquer restrio, exceto com relao compatibilidade
de horrios (art. 37, inciso XVI, alnea a). Nada impede que
os dois cargos de magistrio sejam exercidos em uma mesma
instituio de ensino.
- A questo da compatibilizao dos horrios problema a ser
resolvido pela Universidade em momento posterior investidura.
- Provimento parcial da apelao para assegurar ao IMPETRANTE a reintegrao no cargo de Professor Adjunto, no Departamento de Economia da UFPE, independentemente da exonerao do cargo atualmente ocupado no mesmo departamento.
Apelao em Mandado de Segurana n 36.654 PE
Relator: Juiz Ridalvo Costa
Julgado em 16 de dezembro de 1993, por unanimidade.

86

Henrique Ribeiro Cardoso

De modo semelhante, ao tratar da possibilidade da acumulao de


cargos em regime de dedicao exclusiva com cargos em comisso ou
IXQo}HVJUDWLFDGDVGHFLGLXR75)GD5HJLmR
Relator: O SENHOR JUIZ HUGO MACHADO
Apelante: ASSOCIAO DOS DOCENTES DA ESCOLA
TCNICA FEDERAL DO CEAR
Apelada: ESCOLA TCNICA FEDERAL DO CEAR
Advogado: DR. FRANCISCO CLUDIO BEZERRA DE
QUEIROZ
EMENTA
&2167,78&,21$/($'0,1,675$7,920$*,67e5,25(*,0('('(',&$d2(;&/86,9$)81d(6*5$7,),&$'$6
1$'$,03('(48(2352)(6625(05(*,0('('(',&$d2(;&/86,9$(;(5d$)81d2*5$7,),&$'$
- APELAO PROVIDA.
ACRDO
Vistos e relatados os autos, em que so partes as acima indicadas, decide a 1 Turma do Tribunal Regional Federal da 5
Regio, por unanimidade, dar provimento apelao, na forma
GRUHODWyULRHQRWDVWDTXLJUiFDVFRQVWDQWHVGRVDXWRVTXHFDP
fazendo parte integrante do presente julgado.
Recife, 16 de maro de 1994 (data do julgamento).
JUIZ JOS MARIA LUCENA - Presidente
VOTO
O SENHOR JUIZ HUGO MACHADO (Relator): A questo que
se h de resolver reside em saber se um professor, em regime de
GHGLFDomRH[FOXVLYDSRGHH[HUFHUIXQomRJUDWLFDGD
O Juiz Federal entendeu que no, fundamentando assim o seu
entendimento:
O art. 37, inc. XVI, da CF vigente, diz que vedada a acumulao remunerada de cargos pblicos, exceto quando houver compatibilidade de horrios. Ora, no caso destes autos, no
existe compatibilidade de horrios. O servidor sujeito ao regime
de tempo integral e dedicao exclusiva obrigado a cumprir
a carga horria de 40 (quarenta) horas semanais e, alm disso,
dedicar-se to-somente aos misteres de seu cargo, emprego ou
funo. Logo, no lhe resta horrio disponvel para, legalmente,
H[HUFLWDUIXQomRJUDWLFDGD V 
87

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

1mRPHSDUHFHTXHVHMDDVVLP
2H[HUFtFLRGDGHQRPLQDGDIXQomRJUDWLFDGDpSRUQDWXUH]D
FXPXODWLYRFRPRH[HUFtFLRGHFDUJRVS~EOLFRV$OLiVDSUySULD
Constituio diz que os cargos em comisso e funes de conDQoDVHUmRH[HUFLGRVSUHIHUHQFLDOPHQWHSRUVHUYLGRUHVRFXSDQWHVGHFDUJRGHFDUUHLUDWpFQLFDRXSURVVLRQDOQRVFDVRVH
condies previstos em lei (art. 37, inc. V).
[...]
Dou provimento apelao para conceder a segurana.
como voto.

Este mesmo Tribunal, ao tratar da situao anloga de acumulao,


tambm permitida constitucionalmente, de cargo de vereador com o
de professor em regime de dedicao exclusiva, em deciso recente,
publicada em seu Boletim de Jurisprudncia n 4/2008, em 30 de abril
GHSSUHDUPRXVHXHQWHQGLPHQWR
CONSTITUCIONAL E ADMINISTRATIVO. ACUMULAO DE CARGOS VEREADOR - PROFESSOR EM REGIME DE TRABALHO DE DEDICAO EXCLUSIVA - COMPATIBILIDADE DE HORRIO POSSIBILIDADE.
EMENTA: CONSTITUCIONAL. ADMINISTRATIVO. ACUMULAO DE CARGOS. 9(5($'25352)(6625 (0
5(*,0( '( 75$%$/+2 '( '(',&$d2 (;&/86,9$
&203$7,%,/,'$'( '( +255,2 3266,%,/,'$'( $57
38, III, DA CEF/88. APLICABILIDADE.
- Trata-se de apelao da sentena que concedeu a segurana
pretendida por entender que, ocorrendo a existncia de compatibilidade de horrios, o servidor pblico, quando eleito vereador,
receber as vantagens de seu cargo, emprego ou funo, mas
sem prejuzo da remunerao do cargo eletivo.
- O art. 38, III, da Constituio Federal de 1988 estabelece que
possvel a acumulao de mandato eletivo de vereador com
outro cargo, funo ou emprego, desde que haja compatibilidade de horrio.
- No caso presente, o Impetrante exerce o mandato eletivo de
vereador no Municpio de Paraipaba/CE, sendo as sees ordinrias realizadas quinzenalmente s sextas-feiras, s 17:00 horas. Em relao ao exerccio de cargo de professor da UFC, a

88

Henrique Ribeiro Cardoso

carga horria semanal exercida na tera-feira e quinta-feira,


nos turnos manh e noite.
- 'LDQWH GRV KRUiULRV H[HUFLGRV SHOR ,PSHWUDQWH FRQVWDWDVH
que inexiste qualquer bice ao exerccio cumulativo do mandato eletivo de vereador e do cargo de professor em regime de
trabalho de dedicao exclusiva, uma vez que a nica restrio
imposta pela Constituio Federal para a mencionada acumuODomRpDLQFRPSDWLELOLGDGHGHKRUiULRVRTXHQmRRFRUUHXQR
presente caso.
- Acrescente-se, ainda, que as regras do regime de trabalho de
dedicao exclusiva previstas na Lei n 4.345/64 e no Decreto
n 94.664/87 devem ser interpretadas observando-se o regime
constitucional supramencionado, em razo da supremacia deste
sobre as demais normas.
$SHODomRHUHPHVVDRFLDOLPSURYLGDV
Apelao em Mandado de Segurana n 85.013-CE
(Processo n 2002.81.00.008235-5)
Relator: Desembargador Federal Marco Bruno Miranda Clementino
(Julgado em 29 de janeiro de 2008, por unanimidade)

De modo semelhante, vem decidindo o TRF da 2 Regio ao tratar


da acumulao de cargos de professor:
CONSTITUCIONAL E ADMINISTRATIVO - ENSINO SUPERIOR - PROFESSOR - DEDICAO EXCLUSIVA - CONVERSO DE REGIME DE TRABALHO - POSSIBILIDADE
- DECRETO N 94.664/87 (PLANO NICO DE CLASSIFICAO E RETRIBUIO DE CARGOS E EMPREGOS - LEI N
7.596, DE 10.04.1987) - ILEGALIDADE DA RESOLUO N
09/88 - ACUMULAO REMUNERADA DE CARGOS PBLICOS - COMPATIBILIDADE DE HORRIOS - ART. 37,
XVI, CF. 1. O Decreto n 94.664/87, que aprova o Plano nico
GH&ODVVLFDomRH5HWULEXLomRGH&DUJRVH(PSUHJRVGHTXHWUDta a Lei n 7.596, de 10 de abril de 1987, em seu art. 47, 3,
no elenca, como requisito para a concesso do afastamento do
docente, a obrigatoriedade de sua permanncia no mesmo regime
a que estava submetido quando do seu afastamento. ilegal, portanto, a condio prevista no art. 7 da Resoluo n 09/88 - CEP/

89

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

UFES, por extrapolar o Decreto em questo, quando sua verdadeira funo seria apenas a de regulamentar suas disposies. 2.
1mRpSRVVtYHOHPQRVVRRUGHQDPHQWRTXHXPYHtFXORQRUPDWLvo de ordem inferior altere ou extrapole uma norma que lhe seja
superior. 3. Sendo ilegal a condio, imposta pela Resoluo,
de manuteno do mesmo regime de trabalho da data do afastamento, no nem menos devida a indenizao prevista (tanto no
Decreto quanto na Resoluo), pois que no houve, na hiptese,
desrespeito norma pelo docente.  1mR Ki TXDOTXHU LQFRPpatibilidade entre o exerccio de atividade remunerada pblica
ou privada, e o exerccio do cargo de professor com dedicao
H[FOXVLYD,VWRRFRUUHSHORIDWRGDDJUDQWHLQFRQVWLWXFLRQDOLGDde da vedao imposta pelo Decreto n 94.664/87. 5. O nico
UHTXLVLWRH[LJLGRSHOD&DUWD0DJQDSDUDTXHSRVVDKDYHUDDFXmulao dos cargos enumerados pelas alneas do inciso XVI, do
DUWpDH[LVWrQFLDGHFRPSDWLELOLGDGHGHKRUiULRV2'HFUHWR
n 94.664/87 restringiu o disposto na Constituio ao impedir a
acumulao de cargos, que constitucionalmente assegurada,
quando o professor se encontra em regime de dedicao excluVLYD(VVDUHVWULomRp,1&2167,78&,21$/SRUQmRHVWDUSUHvista na Constituio Federal, bem como pelo fato de que limita
o exerccio de um direito nela assegurado. 6. Recurso adesivo
GR,03(75$17(LPSURYLGR$SHODomRGD8)(6HUHPHVVD
QHFHVViULDLPSURYLGDV6HQWHQoDPDQWLGD.
(TRF2 - Apelao em Mandado de Segurana - 67448 - Processo: 2001.50.01.000056-2 - UF: RJ - Relator: Desembargador
Federal FREDERICO GUEIROS - Sexta Turma Especializada
- DJU Data: 28/04/2008, p. 182)9

7. DA DOUTRINA SOBRE A ACUMULAO DE CARGOS


EM REGIME DE DEDICAO EXCLUSIVA
A doutrina nacional pouco se debrua sobre o tema. honrosa exceo, repercutindo as decises das cortes superiores, o estudo Da posVLELOLGDGHGHDFXPXODomRGHFDUJRS~EOLFRGHSURIHVVRUXQLYHUVLWiULR
9

De igual contedo, a deciso voto e acrdo no Agravo n. 16662008.02.01.0086529, tambm do TRF da 2 Regio, publicada em 15 de outubro de 2008.

90

Henrique Ribeiro Cardoso

em regime de dedicao exclusiva, com cargo de magistrado federal,


de autoria do Professor Doutor Alberto Nogueira Jnior.11 Sustenta o
autor em seu estudo:

10

Lcito, de todo modo, antecipar a concluso do argumento que


ser defendido ao longo deste trabalho: o regime de dedicao
exclusiva dos professores de instituies de ensino superior pblicas no impede a acumulao do cargo com outro de magistrado [...]
O regime de dedicao exclusiva nada mais do que um regime
GHWUDEDOKRQmRRXWURFDUJRHVSHFtFR>@
Tambm em sentido estrito, no regime de dedicao plena o
servidor poder ter mais de um emprego, ou de um empregador,
desde que diversos da funo pblica a que se dedica precipuamente; [...]
O regime de dedicao exclusiva dos professores de instituies
federais de ensino superior no impede a acumulao dos respectivos cargos com outro de magistrado.

10

NOGUEIRA JNIOR, Alberto. Da possibilidade de acumulao de cargo pblico


GHSURIHVVRUXQLYHUVLWiULRHPUHJLPHGHGHGLFDomRH[FOXVLYDFRPFDUJRGHPDJLVtrado federal. Disponvel em:

KWWSMXVXROFRPEUGRXWULQDWH[WRDVS"LG  S , com acesso em 15 de


maio de 2009.
Em sentido semelhante, leciona Mauro Roberto Gomes de Mattos: Nem a Constituio Federal, nem a Lei no. 8.112/90, ao tratarem da matria em seus artigos 118 a
120, ressalvam a impossibilidade de acumulao de cargos em razo da carga horria semanal, apenas estabelecem que os horrios devem ser compatveis, e que, se
a a acumulao de cargos a possibilidade de duas situaes jurdicas do servidor
(vnculo) perante o Poder Pblico, em horrios que sejam compatveis, entendendo-se por compatveis, os horrios conciliveis, aqueles que no prejudiquem a
regular prestao do necessrio servio pblico desempenhado pelo servidor, h
que concluir-se que deve prevalecer a interpretao de que cumprida integralmente
a freqncia de trabalho, h compatibilidade de horrio. [...] Por ltimo, h que se
recordar a deciso proferida pelo Pleno do Eg. STF, quando do julgamento da ADI
no. 3126, (Rel. Min. Gilmar Mendes, dec. p. maioria pub. DJU 06.5.2005), quando
decidiu-se que os magistrados, autorizados que esto diretamente pela Constituio
Federal, podem exercer dois ou mais cargos de magistrio, desde que haja a compatibilizao de horrios, que se resolve caso a caso, como dito pelo Exmo. Sr. Ministro
3UHVLGHQWH1pOVRQ-RELPTXDQGRGHGHFLVmROLPLQDUDRQDOUHIHUHQGDGDSHOR&ROHgiado maior. MATTOS, Mauro Roberto Gomes de. Lei n.. 8.112/90 Interpretada
e Comentada. 2. ed. Ed. Amrica Jurdica: Rio de Janeiro, 2006, pp. 584-585.

11

91

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

8. A NOVA NORMATIVA DA ADMINISTRAO PBLICA


FEDERAL:Ed'EKZEKW^Z,DW
Em 14 de setembro de 2010 o Ministrio do Planejamento, Oramento e Gesto (MPOG), atravs de sua Coordenao-Geral de Elaborao, Sistematizao e Aplicao das Normas emitiu a Nota Tcnica
n. 884/2010/CGNOR/DNOP/SRH/MP que, pautando o entendimento a ser adotado pela Administrao Pblica Federal, no sentido do
sustentado neste estudo, entendeu que a legalidade da acumulao de
cargos pblicos pauta-se, exclusivamente, pela comprovao da comSDWLELOLGDGHGHKRUiULRV.
Julgando uma situao concreta, de acumulao de um cargo de professor universitrio de Universidade Federal brasileira (UFRJ) com outro
cargo de professor (rede estadual de ensino, no Rio de Janeiro), extensvel
D WRGRV RV FDVRV DQiORJRV por fora do poder normativo conferido s
Notas Tcnicas do MPOG, consoante esclarece o art. 17, nico da Lei
n. 7923/89, o referido Ministrio manifestou-se nos seguintes termos:
Em que pese o disposto no Decreto supra [Decreto n 94.664, de
23 de julho de 1987], h de se ressaltar que a Constituio Federal
permite a acumulao de dois cargos de Professor, ou de um cargo
GH3URIHVVRUFRPRXWUR7pFQLFRRX&LHQWtFRFRQIRUPHSUHYLVWR
no inciso XVI do art. 37:
XVI - vedada a acumulao remunerada de cargos pblicos,
exceto, quando houver compatibilidade de horrios, observado
em qualquer caso o disposto no inciso XI.
(Redao dada pela Emenda Constitucional n 19, de 1998)
a) a de dois cargos de professor; (Includa pela Emenda Constitucional n 19, de 1998)
E DGHXPFDUJRGHSURIHVVRUFRPRXWURWpFQLFRRXFLHQWtFR
(Includa pela Emenda Constitucional n 19, de 1998)
F DGHGRLVFDUJRVRXHPSUHJRVSULYDWLYRVGHSURVVLRQDLVGH
VD~GH FRP SURVV}HV UHJXODPHQWDGDV 5HGDomR GDGD SHOD
Emenda Constitucional n 34, de 2001)
6. Dessa forma, deve-se considerar que a legislao infraconstitucional deve submeter-se Constituio, no podendo se sobreSXMDUDHVWD$VVLPYHULFDVHTXHDDFXPXODomRGHGRLVFDUJRV

92

Henrique Ribeiro Cardoso

de Professor permitida, sendo necessria, para tanto, a compatibilidade de horrios. Destaque-se que Constituio Federal
no apresenta qualquer restrio no que se refere ao regime de
trabalho de Dedicao Exclusiva - DE.
7. Quanto acumulao de cargos, em que um deles possui
regime de DE, convm colacionar entendimento manifestado
pelo Superior Tribunal de Justia STJ, em Recurso Especial n
97.551-PE (96.0035318-2):
RESP. CONSTITUCIONAL. ADMINISTRATIVO. PROFESSOR. CARGO. CUMULAO. A HIERARQUIA DAS NORMAS JURDICAS AFASTA A VIGNCIA DE LEI QUANDO
CONTRASTAR COM A CARTA POLTICA. ESTA ADMITE A CUMULAO DE DOIS CARGOS DE PROFESSOR,
QUANDO HOUVER COMPATIBILIDADE DE HORRIOS
(CF/1988, ART. 37, XV, A). O ATUAL REGIME DE TRABALHO (DEDICAO EXCLUSIVA), POR SI S, NO
OBSTCULO. EVIDENTE, DEVER CONFERIR A NECESSRIA ATENO S DUAS DISCIPLINAS NO TOCANTE AO HORRIO.
8. Destarte, tendo em vista o entendimento acima, observa-se
que, mesmo submetido ao regime de Dedicao Exclusiva, pode
o Professor acumular tal cargo com outro, desde que cumpra o
requisito constitucional da compatibilidade de horrios.
9. Nesse sentido, em relao ao caso em tela ponderando que
no h a carga horria do cargo estadual - caso a Universidade
Federal do Rio de Janeiro que o interessado cumpria a jornada de trabalho e exercia suas atribuies, mesmo acumulando o
cargo de Professor de 3 Grau com o cargo estadual, no haver
a incidncia de acumulao ilcita, pois permitida pela Constituio e, por conseguinte, no ser necessria a restituio dos
valores percebidos a ttulo de DE.

A Nota Tcnica n. 884/2010, com seu carter normativo, vinculou


toda a Administrao Pblica Federal em relao ao entendimento exposto acerca da legalidade da situao de acumulao de cargos.
93

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Todas as situaes de acumulao de cargos pblicos, comprovada


a compatibilidade de horrios, tornaram-se lcitas para a Administrao Pblica Federal. Todos os processos administrativos disciplinares
(PAD), instaurados com base em suposta acumulao ilegal de cargos
pblicos, devero ser julgados improcedentes, reconhecida a legalidade da situao jurdica pela prpria Administrao. Tal posicionamento,
para os que j se encontravam em regime de acumulao de cargos em 14
de setembro de 2010, GDWDGDHGLomRGDUHIHULGD1RWD7pFQLFD, LPXWivel para a Administrao. Ocorreu, no campo do Direito Administrativo
Disciplinar, analogicamente, a abolitio criminis do Direito Penal.
No mbito do Direito Administrativo, o Princpio da Segurana
Jurdica, pautado pela legalidade, amplamente aceito e prestigiado.
Acerca deste princpio, Jos Afonso da Silva esclarece:
Nos termos da Constituio a segurana jurdica pode ser entendida num sentido amplo e num sentido estrito. No primeiro,
ela assume o sentido geral de garantia, proteo, estabilidade de
situao ou pessoa em vrios campos, dependente do adjetivo
TXHDTXDOLFD(PVHQWLGRHVWULWRDVHJXUDQoDMXUtGLFDFRQVLVWH
na garantia de estabilidade e de certeza dos negcios jurdicos,
de sorte que as pessoas saibam de antemo que, uma vez envolvidas em determinada relao jurdica, este se mantm estvel,
PHVPRVHPRGLFDUDEDVHOHJDOVREDTXDOVHHVWDEHOHFHX 6,/VA, Jos Afonso da. Constituio e segurana jurdica. In: ROCHA, Crmen Lcia Antunes (Org.). Constituio e segurana
jurdica: direito adquirido, ato jurdico perfeito e coisa julgada.
Estudos em homenagem a Jos Paulo Seplveda Pertence. Belo
Horizonte: Frum, 2004)

Ainda tangente a este princpio, assegura Celso Antnio Bandeira de Mello:


Por fora mesmo deste princpio (conjugadamente com os da
presuno de legitimidade dos atos administrativos e da lealdade
HERDIp UPRXVHRFRUUHWRHQWHQGLPHQWRGHTXHDVRULHQWDo}HVUPDGDVSHOD$GPLQLVWUDomRHPGDGDPDWpULDQmRSRGHP
VHPSUpYLDHS~EOLFDQRWtFLDVHUPRGLFDGDVHPFDVRVFRQFUHWRVSDUDQVGHVDQFLRQDUDJUDYDUDVLWXDomRGRVDGPLQLVWUDGRV
ou denegar-lhes pretenses, de tal sorte que s se aplicam aos

94

Henrique Ribeiro Cardoso

casos ocorridos depois de tal notcia. [BANDEIRA DE MELO,


Celso Antnio. Curso de direito administrativo. 20. ed. So Paulo: Malheiros, 2006)

Neste pensar, Maria Sylvia Zanella di Pietro sustenta:


2SULQFtSLRVHMXVWLFDSHORIDWRGHVHUFRPXPQDHVIHUDDGPLQLVtrativa, haver mudana de interpretao de determinadas normas
legais, com a conseqente mudana de orientao, em carter normativo, afetando situaes j reconhecidas e consolidadas na vigncia de orientao anterior. Essa possibilidade de mudana de
orientao inevitvel, porm gera insegurana jurdica, pois os
interessados nunca sabem quando a sua situao ser passvel de
contestao pela prpria Administrao Pblica. Da a regra que
veda a aplicao retroativa. (DI PIETRO, Maria Sylvia Zanella.
Direito administrativo. 15. ed. So Paulo: Atlas, 2003)

Jos dos Santos Carvalho Filho traz algumas notas que clareiam o
princpio da segurana jurdica, que incide em sua inteireza na situao
em estudo:
Doutrina moderna, calcada inicialmente no direito alemo e depois adotada no direito comunitrio europeu, advoga o entendiPHQWRGHTXHDWXWHODGDFRQDQoDOHJtWLPDDEUDQJHLQFOXVLYH
o poder normativo da Administrao, e no apenas os atos de
natureza concreta por ela produzidos. Cuida-se de proteger expectativas dos indivduos oriundas da crena de que disciplinas
jurdico-administrativas so dotadas de certo grau de estabilidade. Semelhante tutela demanda dois requisitos: 1) a ruptura inesperada da disciplina vigente; 2) a imprevisibilidade das
PRGLFDo}HV (P WDLV KLSyWHVHV FDEH j$GPLQLVWUDomR DGRWDU
algumas solues para mitigar os efeitos das mudanas: uma delas a excluso do administrado do novo regime jurdico; outra,
o anncio de medidas transitrias ou de um perodo de vacatio;
outra, ainda, o direito do administrado a uma indenizao comSHQVDWyULDSHODTXHEUDGDFRQDQoDGHFRUUHQWHGHDOWHUDo}HVHP
atos normativos que acreditava slidos e permanentes. claro
que a matria est em fase de estudos e desenvolvimento, mas
LQHJDYHOPHQWHFRQVWLWXLXPDIRUPDGHSURWHJHUDFRQDQoDHDV

95

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

expectativas legtimas na estabilidade normativa, desejvel em


qualquer sistema jurdico. (CARVALHO FILHO, Jos dos Santos. 0DQXDOGH'LUHLWR$GPLQLVWUDWLYR18. ed. Rio de Janeiro:
Lmen Jris. 2007. p. 31)

Ocorreu inegvel reconhecimento pela Administrao Pblica Federal da legalidade da acumulao de cargos de Professor Universitrio
com outro cargo pblico, acumulvel nos termos da Constituio Federal, consubstanciado na referida Nota Tcnica n. 884/2010. oportuno
lembrar que os projetos apresentados pelo Governo Federal atravs do
MPOG para reestruturao da carreira de Magistrio Superior
das IES pblicas nestes anos de 2009, 2010 e 2011, ainda sem qualquer possibilidade de consenso entre o poder pblico e as entidades
de classe dos professores e das prprias IES federais, relativizam sobremaneira o rigor do regime de dedicao exclusiva, quando no propem sua pura e simples extino.
O regime de dedicao exclusiva, isto fato, no alcanou seus resultados esperados: no h uma vinculao automtica entre dedicao
exclusiva do professor e excelncia em sua atuao em atividades de
ensino, de pesquisa e de extenso ou em relao a qualquer outro ndice
de produo acadmica; e, por seu turno, a idealizada rgida limitao
ao exerccio de quaisquer atividades remuneradas a par da empreendida
no mbito das IES federais, estabelecidas no mal fadado Decreto n
94.664, de 23 de julho de 1987, no trouxe qualquer contrapartida em
WHUPRVGHWUDWDPHQWRGLJQRDRSURVVLRQDOGDHGXFDomRVXSHULRUVHQGR
na atualidade uma das categorias funcionais mais desprestigiadas, em
termos remuneratrios, da Administrao Pblica Federal.

9. CONCLUSES
Em sntese do que foi exposto linhas acima, as seguintes concluses
podem ser apresentadas:
A par de todos os argumentos postos neste breve estudo, a aplicao direta, em sua literalidade, da Constituio Federal, assegura a todo
brasileiro, aprovado em concurso pblico o direito posto no art. 37, I,
que estabelece que os cargos, empregos e funes pblicas so acessveis aos brasileiros que preencham os requisitos estabelecidos em lei,
expresso do direito fundamental garantido no art. 5., XIII, que prev ser
96

Henrique Ribeiro Cardoso

OLYUHRH[HUFtFLRGHTXDOTXHUWUDEDOKRRItFLRRXSURVVmRDWHQGLGDVDV
TXDOLFDo}HVSURVVLRQDLVTXHDOHLHVWDEHOHFHU$SURYDGRHPFRQFXUVR
pblico para o exerccio do cargo de Professor Universitrio, indepenGHQWHPHQWHGRUHJLPHGHWUDEDOKRSRVWRHPHGLWDOFRQJXUDVHLOHJDOH
abusiva qualquer restrio ou ameaa a este direito fundamental.
Doutrina e legislao, inclusive a federal, permitem que servidores
de diversas carreiras da Administrao Pblica Federal, em regime de
dedicao exclusiva (Procuradores da Fazenda Nacional, Advogados
da Unio, Procuradores Federais, Auditores Federais...) exeram atividade de magistrio;
2UHJLPHGHWUDEDOKRGHSURIHVVRUHPGHGLFDomRH[FOXVLYDVLJQLFD
a proibio de exerccio de outra atividade de professor, a par da exercida em IES Federal;
O Decreto n 94.664, de 23 de julho de 1987 perdeu sua base legal
com a revogao da Lei n. 7.596/87, no estando apto a produzir quaisquer efeitos jurdicos;
O Decreto n 94.664, de 23 de julho de 1987 no foi recepcionado
pela Constituio Federal por restringir direitos individuais assegurados constitucionalmente;
O Decreto n 94.664, de 23 de julho de 1987 no tem fora de lei,
no sendo fruto de delegao de poder normativo Administrao, prevalecendo o disposto no art. 25 do ADCT;
So anlogas as situaes dos membros do Ministrio Pblico,
dos Magistrados, dos professores, dos ocupantes de cargos tcnicos ou
FLHQWtFRVHGRV9HUHDGRUHVWRGRVDXWRUL]DGRVDFXPXODUHPVHXVUHVpectivos cargos com cargos de professor;
Os Tribunais Superiores e Regionais Federais so unssonos em
permitir a acumulao de cargos e dos vencimentos de ativos e proventos de inativos - prevalecendo a Constituio de 1988 sobre o Decreto n 94.664, de 1987;
A doutrina unssona ao compreender que o regime de dedicao
exclusiva no bice acumulao de cargos pblicos, em hipteses
expressamente previstas na Constituio;
A Nota Tcnica n. 884/2010/CGNOR/DNOP/SRH/MP, do MPOG,
com seu carter normativo, vinculou toda a Administrao Pblica Federal em relao ao entendimento exposto acerca da legalidade da situao de acumulao de cargos em regime de dedicao exclusiva, disciplinado e tornando indiscutvel para a Administrao todas as situaes
MiFRQVWLWXtGDVjpSRFDGHVXDHGLomRTXHFRQJXUHPDFXPXODomRGH
97

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

cargos pblicos de professor de Universidade Federal brasileira em


regime de Dedicao Exclusiva com demais cargos pblicos previstos
na Constituio Federal.
A Nota Tcnica n. 884/2010/CGNOR/DNOP/SRH/MP, do MPOG,
aplicada a processos administrativos disciplinares (PAD), impe a imSURFHGrQFLDGHTXDOTXHUVDQomRDGPLQLVWUDWLYDDRVVHUYLGRUHVIHGHUDLV
e o reconhecimento da legalidade de acumulao para os que j se encontravam em regime de acumulao de cargos em 14 de setembro de
2010. Ocorreu, no campo do Direito Administrativo Disciplinar, analogicamente, a abolitio criminis do Direito Penal.
O regime de trabalho de dedicao exclusiva no impedimento
acumulao de cargos, exigindo-se, nos casos previstos na Constituio, a compatibilidade de horrio;
Para a delimitao da situao de Membro do Ministrio Pblico ou
de Magistrado, em que no h a previso da compatibilidade de horrios na Constituio, h resolues do CNJ e do CNMP que disciplinam
os requisitos para acumulao dos cargos, havendo a necessidade de se
avaliar, caso a caso se a atividade de magistrio inviabiliza o ofcio da
Magistratura ou do Ministrio Pblico ADI n. 3.126/2005.

REFERNCIAS BIBLIOGRFICAS
BANDEIRA DE MELO, Celso Antnio. Curso de direito administrativo. 20. ed. So Paulo: Malheiros, 2006.
CARVALHO FILHO, Jos dos Santos. Manual de Direito Administrativo. 18. ed. Rio de Janeiro: Lmen Jris. 2007.
DI PIETRO, Maria Sylvia Zanella. Direito administrativo. 15. ed. So
Paulo: Atlas, 2003.
MEIRELES, Hely Lopes. Direito Administrativo Brasileiro. 25. ed.
So Paulo: Malheiros, 2001.
NOGUEIRA JNIOR, Alberto. Da possibilidade de acumulao de
cargo pblico de professor universitrio, em regime de dedicao
exclusiva, com cargo de magistrado federal. Disponvel em:
KWWSMXVXROFRPEUGRXWULQDWH[WRDVS"LG  S , com acesso
em 15 de maio de 2011.

98

Henrique Ribeiro Cardoso

MATTOS, Mauro Roberto Gomes de. Lei n.. 8.112/90 Interpretada


e Comentada. 2. ed. Rio de Janeiro: Amrica Jurdica, 2006.
SILVA, Jos Afonso da. Constituio e segurana jurdica. In: ROCHA,
Crmen Lcia Antunes (Org.). Constituio e segurana jurdica: direito adquirido, ato jurdico perfeito e coisa julgada. Estudos em homenagem a Jos Paulo Seplveda Pertence. Belo Horizonte: Frum, 2004.

99

DIREITO FUNDAMENTALAO
DESENVOLVIMENTO E O
MUNICPIO NA CF/88
Jussara Maria Moreno Jacintho1
Resumo
Este trabalho analisa o direito fundamental ao desenvolvimento de que
titular todo cidado brasileiro, violado quando o Municpio deixa de receber as transferncias de recursos constitucionalmente devidas, quando
devedor dos tributos federais, especialmente constribuies sociais.
Palavras-chaves - Direitos fundamentais; direito fundamental ao
desenvolvimento; municipalizao; transferncias de receitas, polticas pblicas.
Abstract
This study examines the fundamental right to development that holds
all Brazilian citizens, which is violated whenever the local government doesnt receive their revenues estabilished in the Federal Constitucional as a consequence of not paying federal taxes, especially
social contributions.
Key words - Fundamental rights, fundamental right to development;
transfering revenues, public policies, local government.

I. INTRODUO
Este trabalho pretende centrar seu estudo na contradio existente entre as normas jusfundamentais, que consagram direitos, os quais
apenas so efetivos quando concretizados e outros postulados constitucionais, apresentados como mecanismos de viabilizao do modelo
1

Professora Adjunta da Universidade Federal de Sergipe. Doutora em Direito Constitucional pela PUC/SP. Mestre em Direito da Cidade pela UERJ. Especialista em
Direito Civil pela FGV/RJ.Vice-Coordenadora da Graduao em Direito e Coordenadora em exerccio do Mestrado em Direito da UFS. Pesquisadora do NEIAP/UFS.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

econmico-poltico do pas, mas que acabam por impedir a concretizao daqueles.


,UHPRVSDUWLUHVSHFLFDPHQWHGRGLUHLWRIXQGDPHQWDODRGHVHQYROvimento, inscrito no art. 3, II, da CF/88, como um dos objetivos fundamentais da Repblica, seu delineamento conceitual e sua interao
com os princpios da municipalizao e do federalismo que orienta a
realizao de polticos pblicas,
2QRVVRWUDEDOKRYDLDQDOLVDURFRQLWRHQWUHRGLUHLWRVXEMHWLYR
ao desenvolvimento, de que titular todo indivduo e a coletividade,
previsto em tratados internacionais de direitos humanos e na Constituio Federal, em seu art.3,II e o princpio federativo, com nfase no subprincpio da municipalizao das aes governamentais e
SROtWLFDVS~EOLFDVFRQLWRHVVHOHYDGRDRSDUR[LVPRHPUD]mRGDV
restries impostas por dispositivos constitucionais especialmente
a do art. 160 -- que vedam o acesso aos recursos pblicos quando
ocorre inadimplncia por parte destes, por meio da no emisso de
FHUWLGmRQHJDWLYDGHGpELWRVFDORXSRVLWLYDFRPHIHLWRGHQHJDWLYD
documento hbil a autorizar o aporte dos referidos recursos, para
concluir que a prevalncia do art. 160 da CF/88 sobre o direito ao
desenvolvimento inconstitucional.
No item I tratamos do direito ao desenvolvimento, seu conceito e
sua titularidade; no item II e III, do princpio federativo e seus desdobramentos; no quarto item , discorremos brevemente sobre a federao e a municipalizao das polticas pblicas; No item V, tratamos da
obrigao estatal de garantir o desenvolvimento municipal. Passamos a
discorrer no item VI, sobre a teoria contratualista como fundamento do
poder estatal de representar politicamente a vontade do cidado, para
no item VII, fazer um breve comentrio sobre a LRF, a Lei n. 11.960/09
HRGLUHLWRDRGHVHQYROYLPHQWRSDUDDRQDOQRLWHP9,,,DSUHVHQWDU
as nossas concluses.

II. O DIREITO FUNDAMENTAL AO DESENVOLVIMENTO


DO CIDADO
A efetividade dos direitos fundamentais encontra toda gama de
obstculos, sejam os da falta de investimento puro e simples na sua
realizao, sejam no reconhecimento de que um direito dessa natureza

102

Jussara Maria Moreno Jacintho

submete-se a um regime jurdico especial, de forma a alcanar a sua


concretizao, sobretudo na sua interpretao e consequente aplicao
de normas jusfundamentais, no apenas pelos rgos da administrao,
assim como pelo aparelho judicial de 1 e 2 instncias, os quais no
tm se fundado na base antropolgica presente na Carta Poltica, para
superar os obstculos materiais e formais que, ou a prpria Constituio
oferece ou o faz a legislao infraconstitucional, na concretizao de
determinada gama de direitos fundamentais.
A interpretao contempornea, sobretudo a aplicao da Constituio que se pretende democrtica, impe uma mudana no seu eixo gravitacional, passando ela a ser ex parti populi, em detrimento do seu
vis hermenutico ex parti principii. 2A manuteno desse modelo
j superado de hermenutica constitucionalem que se privilegiava
seus aspectos formais em detrimentos do contedo da norma-- nada
mais faz que perpetuar violaes j histricas aos direitos fundamentais, mantendo o Estado na posio de grande violador dos direitos humanos, seno o maior.
O direito comparado, a doutrina ptria e ainda uma no consolidada
jurisprudncia nacional tem indicado o mtodo da ponderao de bens
HLQWHUHVVHVHPFRQLWRFRPRRPDLVDGHTXDGRDRVSURSyVLWRVFRQVtitucionais de prover ao destinatrio da norma a efetivao dos seus
direitos. Nada obstante os avanos expressivos na rea, na prtica h
DLQGDXPDUHWLFrQFLDVLJQLFDWLYDTXDQGRRVWDLVLQWHUHVVHVHPFRQLWRVmRGHSHVRYDORUHRULJHPPXLWRGLIHUHQFLDGDVHHVSHFLDOPHQWH
quando prestigiam os direitos da populao pobre, em detrimento dos
interesses do Estado.
notrio que os municpios brasileiros dependem de transferncias voluntrias e constitucionais3 muitos no tendo arrecadao
VLJQLFDWLYD RX VHTXHU SURMHWRV GH YLU D WrOD H R  LPSHGLPHQWR
para obteno de Certido Negativa de Dbito-CND tem impacto
maior que o que seria razovel supor. a certido negativa de dbitos, por conseguinte, o passaporte para a sustentabilidade da comuQD'HVWDGHSHQGHRDSRUWHGHUHFXUVRVWDOTXDODUPDR&71$
no captao dos recursos provenientes de convnios, transferncias
YROXQWiULDVHDQVDFDUUHWDXPVHPQ~PHURGHUHVWULo}HVHVHUYLoRV
Piovesan, Flvia. Direitos humanos e o direito constitucional internacional. So
Paulo: Max Limonad, 1997,p. 54.
3 Folha de So Paulo, edio do dia 11/05/2011. Pg.A8.

103

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

no prestados ao cidado. Deixa-se de atender o Municpe em todas as reas, desde sade at habitao. Um simples procedimento
mdico pode ser prejudicado, assim como podem ser subtrados aos
EHQHFLiULRVVHUYLoRVTXHYmRGHVGHDFRQVWUXomRGHEDQKHLURVGRmsticos at o calamento de ruas, passando pela construo de novas casas at o transporte escolar. Ou seja, o no recebimento de tais
transferncias condena o Municpe excluso de servios bsicos,
ao isolamento social e , por conseguinte, proliferao e manuteno dos nveis de misria do povo.
Sair dessa condio de pobreza e dependncia, que no privilgio
nosso, s por meio do reconhecimento de que todos temos direito aos mesmos nveis de desenvolvimento humano experimentados por outras naes.
O direito ao desenvolvimento est includo dentre os que pertencem terceira gerao/dimenso de direitos fundamentais, elencados
como um dos direitos de solidariedade.
Segundo documento da ONU, traduz-se como um direito humano
LQDOLHQiYHOHPYLUWXGHGRTXDOWRGDSHVVRDKXPDQDHWRGRVRV
povos esto habilitados a participar do desenvolvimento econmico, social, cultural e poltico, a ele contribuir e dele desfrutar,
no qual todos possam ser plenamente realizados.4

O direito ao desenvolvimento simultaneamente um direito individual fundamental e um direito difuso, oponvel ao Estado. Em seus
DVUWVHRFLWDGRGRFXPHQWRLQWHUQDFLRQDOUDWLFDVHXFRQWH~GR
Artigo 2.
A pessoa humana o sujeito central do desenvolvimento e deYHULDVHUSDUWLFLSDQWHDWLYRHEHQHFLiULRGRGLUHLWRDRGHVHQYROvimento.
...
Art. 8
1. Os Estados devem tomar , a nvel nacional, todas as medidas
QHFHVViULDVSDUDDUHDOL]DomRGRGLUHLWRDRGHVHQYROYLPHQWRH
devem assegurar inter alia, igualdade de oportunidade para toGRVHPVHXDFHVVRDRVUHFXUVRVEiVLFRVHGXFDomRVHUYLoRVGH
4

Art. 1 da Declarao da ONU sobre o Direito ao Desenvolvimento de 1986.

104

Jussara Maria Moreno Jacintho

sade, alimentao, habitao, emprego e distribuio equitaWLYDGHUHQGD0HGLGDVHIHWLYDVGHYHPVHUWRPDGDVSDUDDVVHgurar que as mulheres tenham um papel ativo no processo de
desenvolvimento. Reformas econmicas e sociais apropriadas
devem ser efetuadas com vistas erradicao de todas as injustias socais.
2. Os Estados devem encorajar a participao popular em todas
as esferas, como um fator importante no desenvolvimento e na
plena realizao de todos os direitos humanos.

A Resoluo 41/128 da Assemblia geral da ONU, por sua vez, entendeu o direito ao desenvolvimento como processo econmico, cultural, social e poltico abrangente, que visa ao constante incremento
do bem estar de toda a populao e de todos os indivduos com base
HP VXD SDUWLFLSDomR DWLYD OLYUH H VLJQLFDWLYD QR GHVHQYROYLPHQWR H
na distribuio justa dos benefcios da resultantes. Pela conjugao
dos dois conceitos v-se que o direito ao desenvolvimento encerra no
apenas o reconhecimento e a promoo das potencialidades imateriais
do ser humano em prol do aprimoramento da sua personalidade, assim
como a satisfao de suas necessidades materiais.
Tambm a Declarao Universal dos Direitos Humanos traz em seu
art 22 a seguinte disposio:
Toda pessoa, como membro da sociedade, tem direito segurana social e realizao, pelo esforo e recursos de cada Estado,
dos direitos econmicos, sociais e culturais indispensveis sua
dignidade e ao livre desenvolvimento de sua personalidade.

Muito embora a Declarao de Direitos Humanos no seja considerada norma imperativa, integra o jus cogens internacional e a agenda
tica a partir da qual os direitos humanos so perseguidos5.
Incontroverso, por conseguinte, que existe um direito subjetivo ao
desenvolvimento, de natureza fundamental, j inscrito em diplomas internacionais e como tal fazendo parte do nosso texto constitucional por
fora do art. 5, 3, introduzido pela Emenda Constitucional n. 45/ ao
5

Piovesan, Flvia. Direitos humanos e o direito constitucional internacional.So


Paulo:Ed. Max Limonad, 1997. P. 85.

105

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

qual combinado com os arts. 1,3 e 170 da CF, compem a base a partir
da qual se construir esse desenvolvimento, assim como deixa claro o
compromisso do Estado em formular polticas pblicas aptas a atingir
esse desiderato.
Destarte, a comunicao que hoje existe entre as ordens nacional e internacional, no que diz respeito aos direitos fundamentais
tornou-se mais fluida impondo a aplicao de direitos humanos
consagrados em tratados internacionais como postulados constitucionais, seja os que orientam a realizao de polticos pblicas,
seja o que concretiza direitos sociais e polticos, em um panorama
desenvolvimentista.6
A opo do Estado brasileiro est expresso em seus compromissos
declarados por meio das suas normas estruturantes, vazadas como princpios, distribudos ao longo do texto constitucional ou como objetivos
fundamentais da Repblica, veiculados como normas principiolgicas.

III . MUNICPIO BRASILEIRO E O DIREITO


FUNDAMENTAL AO DESENVOLVIMENTO
2FRPSURPLVVRUPDGRSRUVXDYH]FRQVXEVWDQFLRXVHHPXP
cuja concretizao depende de uma organizao poltico-administrativa tambm comprometida com esta realizao. As competncias materiais concernentes realizao das necessidades bsicas
da populao esto hoje concentradas no Municpio, razo pela qual
HVWH DVVXPLX XP SHUO GLIHUHQFLDGR QD QRVVD 5HS~EOLFD  DOpP
obviamente,do seu legado histrico7 -- em comparao com outros
modelos de federao existentes, destacando-se ainda como o ente
da federao em que todos moramos.
$TXLDFRPXQDGHWpPQmRDSHQDVDXWRQRPLDQDQFHLUDFRPRDGministrativa e poltica e , por excelncia, o espao fsico em que os
direitos fundamentais iro se concretizar. Na nossa estrutura federativa,
as competncias materiais aptas realizao das polticas pblicas voltadas efetivao do direito ao desenvolvimento, devem ser capitaneadas pelos municpios, em que pese este ente da federao no dispor,
6
7

Idem,ibidem. P. 73-103.
Leal, Vitor Nunes.Coronelismo enxada e voto.So Paulo:Editora Alfa-mega,
1975,5 edio, 276 p.

106

Jussara Maria Moreno Jacintho

com a mesma generosidade, dos benefcios de uma arrecadao nacional sempre crescente8.
$SULPD]LDGDGDDR0XQLFtSLREUDVLOHLURSRGHVHUFRQUPDGDDR
constatarmos no texto constitucional, todo um movimento de forma
a municipalizar os servios pblicos, assim como a prover mecanismos de controle da atuao do poder pblico a partir da organizao da sociedade em conselhos municipais, conquanto existam
os seus congneres estaduais e federal. Na esteira desse raciocnio,
SRGHPRVLGHQWLFDUXPDFDGDYH]PDLVSUHVHQWHFUHQoDGRVSRGHUHV
constitudos na imprescindibilidade de fortalecimento das comunas
de forma a otimizar polticas pblicas e aes governamentais dirigidas a atingir os desideratos constitucionais, pela concretizao dos
direitos da cidadania.
Tudo gira em torno da cidade, a organizao econmica do meio
rural, inclusive.
Em que pese ser o Municpio o locus preferencial por meio do qual
as aes governamentais e polticas pblicas de cunho essencialmente
social sero engendradas, certo que a repartio de competncias tributrias no o favoreceu, concentrando-se a melhor parte da receita da
resultante, na Unio e no Estado-membro.
No se fez isso por acaso, mas como um reconhecimento claro e
LQVRVPiYHOGHTXHRSDFWRIHGHUDWLYRQDFLRQDOHVWiIXQGDGRHPXPD
idia de que, nada obstante as competncias materiais estarem primordialmente a cargo do Municpio --pelo menos as que dizem respeito
polticas bsicas de sade, educao e assistncia social--estas apenas
se realizaro a medida em que a Unio e o Estado cumprirem a sua parWHPDQWHQGRXPX[RFRQWtQXRGHWUDQVIHUrQFLDVGHUHFXUVRV
Como contedo poltico dessa deciso temos ento que, ao tempo
em que se fortalece o poder das sociedades comunais, no se abre mo
de fortalecer o poder central, claro resqucio da forma centrfuga com
que foi construda a nossa federao, que teve como um dos seus resultados a velha frmula coronelista pautada pela troca de favores polticos, mantida acesa pelo sistema atual de repartio de rendas.
Para equilibrar essa distoro, a reforma tributria de 1967 criou o Fundo de Participao dos Municpios, a partir da necessidade j ento detecWDGDGHFRQWULEXLUSDUDDVREUHYLYrQFLDQDQFHLUDGR0XQLFtSLRHQDHVWHLUD
de um programa federal de transferncia de rendas institudo com a Cons8

Folha de so Paulo, ob. cit.p.08.

107

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

tituio de 1946.9$/HLQGHVHXWXUQRTXHGLVS}HVREUHQDQoDV
pblicas regulamentou as transferncias voluntrias e um sem nmeros de
diplomas legais regulamentam as vrias modalidades de transferncias de
recursos da Fazenda estadual e da Fazenda Nacional para os Municpios.
-iDUPRX&DQRWLOKRFRPWRGDSURSULHGDGHTXHD&RQVWLWXLomRpR
estatuto jurdico do poltico.10 Esta tem que ser interpretada, sobretuGRDSOLFDGDGHQWURGHXPDSHUVSHFWLYDGHIXQFLRQDOLGDGHGHHFiFLDH
de otimizao dos seus preceitos.
Decorre da o nosso entendimento segundo o qual o princpio federativo, com destaque para o subprincpio da municipalizao, deve
servir de instrumento concretizao do direito ao desenvolvimento do
qual titular todo muncipe brasileiro, no permitindo seja prejudicada
essa possibilidade, por qualquer outra razo que no a inexistncia de
recursos a serem repassados.

DO PRINCPIO FEDERATIVO E DA
MUNICIPALIZAO DAS POLTICAS PBLICAS
A Lei Fundamental uma unidade114XDOTXHUFRQLWRSRUYHQWXUD
existente aparente, encontrando a sua soluo no prprio sistema. A
interpretao constitucional orientada para a unidade constitucional
que permitir que princpios colidentes sejam harmonizados, em face
das situaes concretas, com o superdimensionamento de um e o subdimensionamento do outro, privilegiando casusticamente um em detrimento do outro, de forma a que os bens protegidos constitucionalmente
encontrem a sua mais apurada realizao.
A Constituio um sistema normativo aberto de princpios e regras, os quais representam as opes poltico-ideolgicas, sociais, econmicas, ticas,culturais etc da sociedade brasileira12. Ambas as espcies de normas tm idntica hierarquia, pois que so constitucionais,
conquanto tenham dimenso diversa. Os princpios so, por sua natu9

10

11
12

7ySLFRV HVSHFLDLV GH QDQoDV S~EOLFDV, p. 17, sem autor, disponvel no stio
WWW.tesouro.fazenda.gov.br.
Canotilho, J.J. Gomes. Curso de direito constitucional. Coimbra:Editora Almedina, 2003. p. 1133.
Bonavides, Paulo. Curso de direito constitucional. So Paulo:Malheiros, 1998. P. 229.
Idem, ibidem, p. 259. Canotilho, Ob.cit., p. 1085/1088.

108

Jussara Maria Moreno Jacintho

reza, basilares do sistema, alicerces do ordenamento e vocacionados


interpretao e integrao de todo o setor que estruturam, assim como vetores e razo de decidir da atividade jurisdicional13. Assumem tambm o
carter de normas de conduta que serviro como razo de decidir a lide.
As regras jurdicas, a seu turno, diferenciam-se dos princpios
HPUD]mRGDVXDGHQLWLYLGDGHHGDVXDYRFDomRFDVXtVWLFD2FRQLto entre essas se resolve pelos critrios da especialidade, cronologia e
hierarquia,ou seja, no campo da sua validade,1415 enquanto que a coliso de princpios se resolve pela tcnica da ponderao de bens, a
qual consiste em uma anlise dos valores/bens contrapostos na situao
FRQFUHWDHPTXHHPHUJLXRFRQLWR
A situao ora estudada tem, de um lado o Municpio , ente autnomo da federao, pessoa jurdica de direito pblico e de outro, rgos
da Administrao Pblica notadamente federal, responsveis por repasses, transferncias e realizao de convnios com os Municpios, visando a transferncia de receitas necessrias ao cumprimento da agenda do
governo central e do governo local.
&RPREHQHFLiULRFRQVWLWXFLRQDOGHVVHX[RGHGLQKHLURDSRSXODo de baixa renda, usuria dos sistemas de garantia de direitos. A comunidade local, sofre duramente os revezes de ms administraes sucessivas, que no apenas a espoliam, assim como a excluem do processo de
desenvolvimento que, lenta porm progressivamente, poderia estar usufruindo, em razo da opo poltico-jurdica da Unio, de descentralizao e municipalizao de servios pblicos disponibilizados populao
do pas, sobretudo a que se encontra em estado de vulnerabilidade social.
Vrios dispositivos constitucionais condensam um dos princpios
que orienta o pacto federativo brasileiro, qual seja, o de que as polticas
pblicas governamentais radicam a sua fora operacional na sua descentralizao/municipalizao, como forma de concretizar os objetivos
fundamentais da Repblica, dentre os quais sobressaem-se a cidadania
e a dignidade humana.
Na leitura dialtica que o texto constitucional impe, em que h
princpios e subprincpios concretizadores daqueles, h um direito subjetivo fundamental ao desenvolvimento, conforme vimos e este s pode
13

14
15

Sarmento, Daniel. Os princpios constitucionais e a ponderao de bens. In. Teoria


dos direitos fundamentais. Org. Ricardo Lobo Torres. Rio de Janeiro:Renovar,
2001. P. 35-94
Idem,ibidem,p. 251.
Sarmento, Daniel. Ob.Cit., p. 38-49.

109

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

ser concebido numa relao jurdica, em que sua contraparte o dever


jurdico de prover este desenvolvimento. Este, a cargo do Estado.
Este princpio ser concretizado apenas na medida em que as transIHUrQFLDVGHFRUUHQWHVRFRUUDPHPUD]mRGDGHSHQGrQFLDQDQFHLUDPXnicipal, conforme j explanado.
No entanto, essa obrigao estatal tem condicionantes, consoante
prescreve o art. 160 da CF/88:
Art. 160. vedada a reteno ou qualquer restrio entrega e
ao emprego dos recursos atribudos, nesta seo, aos Estados, ao
Distrito Federal e aos Municpios, nele compreendidos adicionais e acrscimos relativos a impostos:
Pargrafo nico. A vedao prevista neste artigo no impede a
Unio e os Estados de condicionarem a entrega de recursos:
Ao pagamento de seus Crditos, inclusive de suas autarquias;

O dispositivo retro transcrito tem natureza casustica, ou seja, est


na categoria das normas-regra. No entanto, no h como negar que toda
regra direta ou indiretamente, de forma prxima ou remota remete a um
princpio. Vislumbra-se ser a regra ali insculpida inspirada pelo princpio federativo, tanto quanto a municipalizao/descentralizao das
aes e polticas pblicas tambm o .
Ora, o princpio federativo inspira no apenas esta regra como tambm o subprincpio da municipalizao/descentralizao de polticas pblicas. No sistema dialtico de interpretao constitucional, v-se que a
regra do art. 160 tem ainda dimenso mais reduzida que o subprincpio
GD PXQLFLSDOL]DomR UHDUPDGR HP VHX caput, inclusive. Este ltimo,
reitere-se, s deixar de prevalecer se os Municpios deixarem de pagar
tais crditos (dos estados e da Unio),conforme a exceo do seu inciso.
1DFRQWUDIDFHGRFRQLWRWHPRVRGLUHLWRDRGHVHQYROYLPHQWRGH
natureza fundamental, inscrito na terceira gerao de direitos os de
solidariedade. Toda a base antroplgica da nossa Carta Maior est radiFDGDQRVLVWHPDGHGLUHLWRVIXQGDPHQWDLVQHODUPDGRUHLWHUDGRVSHOD
inscrio da cidadania e da dignidade humana e nos objetivos fundamentais da Repblica.
com base neste dispositivo e na legislao infraconstitucional que
rege a espcie o Cdigo Tributrio Nacional e a Lei n 8.212/9 , que
trata do regime previdencirio -- que os Municpios brasileiros, apesar
de terem sua fundamentalidade reconhecida pela CF/88 no obtm a
110

Jussara Maria Moreno Jacintho

to desejada Certido Negativa de Dbitos ou Positiva com Efeitos de


Negativa, documento hbil a abrir-lhe os cofres do estado e da Unio,
quando esto em dbito com esta.
Diante da vocao humanista-concretizadora da nossa Carta Poltica, no h como afastar o direito ao desenvolvimento do muncipe, para
fazer prevalecer a regra do art. 160, ainda que inspirada pelo propsito
de descentralizao das polticas pblicas. Desse modo, no pode esta
regra obnubilar o direito de toda aquela sociedade a ser atendida por
meio de servios de sade, educao, assistncia social, saneamento
bsico, habitao etc.
Negar o acesso a esse direito, no apenas afasta o indivduo das suas
possibilidades de exercer a sua cidadania, como ainda viola o prprio
princpio da municipalizao, porquanto as polticas de atendimento
populao so quase que integralmente custeadas por transferncia dos
Estados e da Unio.
De ver-se que o princpio da municipalizao/descentralizao , a
qual autoriza a posio do municpio como epicentro das aes governamentais e polticas pblicas tem ligao visceral com o direito ao
desenvolvimento, com o direito cidadania e dignidade humana.
De mais a mais, considerando o panorama apresentado, a negativa
em conceder a Certido negativa ou a Certido Positiva com efeitos de
Negativa de Dbito aos Municpios, diante da inadimplncia do Municpio, viola tais direitos, na medida em que pune o cidado e s raramente pune o mau gestor.

A OBRIGAO DO ESTADO DE GARANTIR


O DESENVOLVIMENTO MUNICIPAL
Em sendo assim, os princpios da Repblica, assim como seus objetivos, no podem ser afastados diante dos obstculos que se apresentam pela norma constitucional ou pela legislao infraconstitucional. A
vedao constitucional do art. 160, da CF/88, encontra sua expresso
legal nas prescries exaradas pelo Cdigo Tributrio Nacional e a Lei
de Responsabilidade Fiscal,que probem a emisso de Certido NegaWLYDGH'pELWRVVFDLVHPUD]mRGDLQDGLPSOrQFLDGR0XQLFtSLRQRUmas que, com muito maior razo, dado sua hierarquia inferior, devem
submeter-se mesma lgica j explanada.

111

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

No se pugna pela inadimplncia dos municpios, nem por uma


moratria municipal, mas pela criao de um caminho alternativo, caminho esse que, simultaneamente, autorize o recebimento pela Unio
de seus crditos, mas tambm que no alije o Municpio de cumprir
R VHX SDSHO FRQVWLWXFLRQDOPHQWH GHQLGR TXDO VHMD R GH IRPHQWDU
possibilidades de desenvolvimento, no apenas econmico e social,
sobretudo humano.
Como primeiro argumento, temos que a opo feita pelo cumprimento da letra fria da lei, sem considerao pelos princpios que a inspiram
inconstitucional, em razo do sistema de hierarquia das normas, porquanto as normas que sustentam a proibio de sua emisso so infraconstitucionais, quando todo o sistema constitucional labora no sentido de conferir ao Municpio competncias materiais, as quais apenas se realizaro
na medida em que os recursos federais e estaduais lhe forem repassados,
o que apenas acontece quando providos de CND. Como segundo, mas
no menos importante, tem-se que inconstitucional porque pune o cidado seja de que Municpio for, ao no permitir o exerccio de seu direito
constitucional ao desenvolvimento, mxime dignidade humana.
Ademais, tais legislaes, ao determinarem a no emisso de certido negativa de dbito ao contribuinte inadimplente, o faz tendo
como ratio for-lo a tornar-se adimplente e, dessa forma concretizar
DMXVWLoDVFDO1RHQWDQWRTXDQGRRFRPDQGRpDSOLFDGRDRVHQWHV
municipais, dois corolrios dessa regra exsurgem: o primeiro, relativo transcendncia da medida punitiva, uma vez que, ao impedir o
Municpio de ter a sua certido em razo da sua inadimplncia, no
apenas pune a pessoa jurdica de direito pblico interno, mas sobretudo o cidado, da ser inaplicvel a sustentao da proibio em relao s pessoas jurdicas de direito pblico; o segundo, tem relao
com a prpria natureza da regra, uma vez que a dvida impagvel e
o impedimento de emisso de CND ao invs de atuar como medida
sancionadora cuja ratio impulsionar o devedor inadimplente para
a situao de adimplncia, apenas a agrava mais ainda e tem como
nico resultado impedir o aporte de recursos constitucionalmente
comprometidos realizao de servios essenciais, fazendo com que
o Municpio deixe de realizar aes e prestar servios caros populaomRGHPDQHLUDTXHFRQVLJDSDJDURVUHIHULGRVDFRUGRVMiUPDGRV
com a Fazenda Nacional.
Na esfera municipal, no entanto, o efeito dessa negativa devastador
e, absolutamente inefetivo. Pois a negativa no impulsionar o Munic112

Jussara Maria Moreno Jacintho

pio a tornar-se adimplente, apenas o afastar mais ainda dessa condio.


Alm de, como j explanado, punir o cidado que mora no Municpio.
A soluo para a questo da inadimplncia no est nesta via, mas
na punio aos gestores responsveis pela m-gesto. E punio efetiva, rpida, contundente.
1RUPDMXUtGLFDHFD]pDTXHODTXHUHDOL]DRVQVVRFLDLVSROtticos, econmicos, culturais, ticos etc para os quais fora criada. Os
comandos que impedem a concesso da CND, quando aplicados aos
entes de direito pblico, notadamente quando em situao similar
GR5HTXHUHQWHVHFRQJXUDPFRPRLQHFD]HV1mRVHSRGHFRPSDUDU
um Municpio com uma pessoa fsica ou com uma pessoa jurdica de
direito privado, que podem criar alternativas quando se deparam na
mesma situao.

DA TEORIA CONTRATUALISTA DA FORMAO DO


ESTADO, NATUREZA JURDICA DA RELAO QUE
FUNDAMENTA O PODER DE REPRESENTAO POLTICA
O Estado coisa do povo e o povo no qualquer aglomerado
de homens reunido de forma qualquer, mas uma reunio de pessoas
associadas pelo acordo em observar a justia e por comunidade de interesses. Ccero.
O Estado conceitualmente explicado a partir de trs perspectivas cronologicamente ajustadas: a primeira, chamada de orJDQLFLVWD HPSUHVWD DR (VWDGR D JXUD GH XP RUJDQLVPR YLYR
para lhe dar consistncia. Segundo tal concepo, o Estado um
homem de grandes propores, com membros inseparveis de
sua totalidade e que gera suas caractersticas mais marcantes:
a dignidade, a unidade. Esta ltima determinando que o Estado
precede s suas partes -- os indivduos ou grupos de indivduos.
Essa concepo foi construda a partir da experincia grega. 16

A ltima concepo do Estado a formalista, Kelseniana, segundo a qual o Estado a sociedade politicamente organizada
16

Abbagnano, Nicola. Verbete Estado.

113

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

porque se constitui em ordem jurdica coercitiva. Na esteira do


pensamento kelseniano, o estado fundamentalmente forma de
Estado, estando a sua substncia se houver de fato, umasubordinada sua forma. 17
A concepo segunda, fundada no contratualismo, entende o Estado
DSDUWLUGHXPDQRomRGHVHQYROYLGDFRPRVOyVRIRVLOXPLQLVWDVGRVpculo VXII e XVIII, para quem o Estado obra humana, no tendo dignidade e caracteres para alm daqueles que no tenham sido conferidos
por quem o produzira. H, por conseguinte, um contrato, ao qual nos
submetemos todos e para cuja existncia delegamos aos nossos repreVHQWDQWHVSDUFHODGHQRVVDYRQWDGHDPGHTXHHVWHVQRVUHSUHVHQWHP
na formao da vontade poltica do Estado.
Ainda segundo essa concepo, o povo legtimo detentor do
poder poltico soberania exercitado pela representao escolhida ou, em determinadas circunstncias, diretamente. Essa a
expresso predominante no pargrafo nico do art. 1, da nossa
Constituio de 1988.
tambm noo essencial compreenso da estrutura poltico-jurdica do Estado brasileiro.
Estamos constitudos por meio de um instrumento jurdico de natureza contratual, por meio do qual se estabelecem deveres e obrigaes recprocas. Simultaneamente, estabelecem-se relaes jurdicas
aos moldes de uma representao entre o povo, detentor supremo da
soberania e os seus representantes, sejam eles ocupantes do Poder Legislativo, sejam eles ocupantes do Poder Executivo, indistintamente.
Essa delegao de vontade, ao se pautar pelo instituto da representao o faz considerando que ela limitada intrnseca e extrinsecamente: limitao interna em razo da prpria natureza da relao que
estabelece que poder de representao exercido pelo representante est
limitado pela liberdade que tem o cidado de atuar diretamente, seja
pelo exerccio dos seus direitos fundamentais, seja pelo exerccio da
sua liberdade de organizar-se politicamente e , extrinsecamente pela lei.
Tanto as limitaes intrnsecas ou extrnsecas tm, ambas , mecanismos jurisdicionais de se fazerem valer, comportando desde o mandado de segurana at a ao de improbidade dos agentes pblicos.
(QPDUHSUHVHQWDomRSUHVHQWHQRH[HUFtFLRGDIRUPDomRGDYRQWDde poltica do Estado se d sob critrios, um deles a da responsabilidade
17

Kelsen,Hans. Teoria do Estado e do Direito. So Paulo:Martins Fontes, 1999.p. 151.

114

Jussara Maria Moreno Jacintho

pessoal daquele que a exerce, exorbitando das suas prerrogativas e, especialmente, a responsabilizao quando o exerccio dessa representao prejudica o representado.
O instituto da representao tem existncia tanto no direito pblico quanto no privado. Estranhamente, com soluo muito mais equnime e adequada no direito privado que no direito pblico. Vejamos.
A representao que se d alm do que prev o contrato de mandato
JHUDXPDUHSHUFXVVmRGLULJLGDHVSHFLFDPHQWHDRUHSUHVHQWDQWHQDIRUma dos arts. 119 e 662 do Cdigo Civil.
No direito pblico, em que pese o regime jurdico-administrativo
ser principiolgico e os interesses de que tratam serem predominantemente de ordem pblica, a soluo alcanada diametralmente oposta,
sendo o mandante/eleitor/cidado responsabilizado pelos atos do manGDWiULRJHVWRUWDOFRPRVHDJXUDFRPDQHJDWLYDHPHPLWLUDFHUWLGmR
QHJDWLYDGHGpELWRVVFDLVDR0XQLFtSLRFXMRVJHVWRUHVQmRFXPSULUDP
HOPHQWHFRPDVVXDVREULJDo}HVVFDLV
Ora, em situaes semelhantes, a pessoa jurdica de direito priYDGRTXDQGRPXLWRpLPSHGLGDGHDWXDUVREDTXHODVXDLGHQWLFDo comercial, podendo constituir-se em uma outra qualquer e continuar as suas operaes. J o municpio, no pode lanar mo desse
expediente. Demais disso, os representantes da empresa privada poGHPVHUDWLQJLGRVSRUTXDQWRHPVLWXDo}HVGHPDOYHUVDomRQDQFHLra, podem ter seus bens pessoais indisponibilizados, aps processo
em que so asseguradas todas as garantias processuais e apenas com
o reconhecimento do cabimento do instrumento da desconsiderao
da pessoa jurdica.
Em relao s pessoas de direito pblico, seus gestores quase
nunca so punidos eficazmente, podendo se candidatar ao mesmo
cargo e terem seus mandatos preservados, ainda que gerenciem
mal o dinheiro pblico. E essa possibilidade existe, dentre outras
razes, porque o processo de prestao de contas e sua subseqente aprovao lento, moroso e excessivamente burocratizado.
Qualquer repercusso jurdica da advinda mais demorada ainda,
favorecendo a impunidade.
V-se j, numa anlise perfunctria, que o tratamento dado pessoa
jurdica de direito pblico fere a garantia da intranscendncia da pena,
quando carreia para o cidado/mandatrio e no para o mau gestor, reSHUFXVV}HVMXUtGLFDVGHQDWXUH]DJUDYRVDWDOTXDOVHFRQJXUDRQmR
recebimento de transferncias voluntrias do Estado e da Unio, com
115

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

as suas conseqncias nefastas -- quando h violao da sua delegao


de vontade, ou seja, do mandato conferido ao gestor.
Resta claro, por conseguinte, que considerando qualquer aspecto, a
no emisso de CND aos municpios inadimplentes, inconstitucional.
$QDOFRPRUHVXOWDGRGHVVDPHGLGDDFRPXQLGDGHORFDOpVHPSUHD
que sofre os efeitos da medida.

A LEI DE RESPONSABILIDADE FISCAL, A LEI


EK/Z/dKK^EsK>s/DEdK
Em um reconhecimento claro da lgica engendrada pela CF/88, o
art. 25, 3 da LRF18 excetua das limitaes ao repasse de recursos,
aqueles destinados sade, educao e assistncia social.
Nada obstante a previso legal neste sentido, a prtica comum
a sua inobservncia pelos rgos repassadores tanto estaduais quanto
IHGHUDLVHDWpPHVPRSHORVPXQLFtSLRVEHQHFLiULRV$QmRH[LVWrQFLD
de CND tem sido o maior obstculo a tais transferncias.
A situao grave dos municpios brasileiros tm sido alvo de moYLPHQWRVGLYHUVRVQRVHQWLGRGDH[LELOL]DomRGHVVDOLPLWDomRHDWpQR
sentido de aplicao do art. 25 da LRF.
18

Art. 25. Para efeito desta Lei Complementar, entende-se por transferncia voluntria a entrega de recursos correntes ou de capital a outro ente da Federao, a ttulo
GHFRRSHUDomRDX[tOLRRXDVVLVWrQFLDQDQFHLUDTXHQmRGHFRUUDGHGHWHUPLQDomR
constitucional, legal ou os destinados ao Sistema nico de Sade.
1o So exigncias para a realizao de transferncia voluntria, alm das estabelecidas na lei de diretrizes oramentrias:
...

,9FRPSURYDomRSRUSDUWHGREHQHFLiULRGH
D TXHVHDFKDHPGLDTXDQWRDRSDJDPHQWRGHWULEXWRVHPSUpVWLPRVHQDQFLDPHQtos devidos ao ente transferidor, bem como quanto prestao de contas de recursos
anteriormente dele recebidos;
b) cumprimento dos limites constitucionais relativos educao e sade;
...
3 3DUDQVGDDSOLFDomRGDVVDQo}HVGHVXVSHQVmRGHWUDQVIHUrQFLDVYROXQWiULDV
constantes desta Lei Complementar, excetuam-se aquelas relativas a aes de educao, sade e assistncia social.
o

116

Jussara Maria Moreno Jacintho

Numa tentativa de sanar o problema, foi editada a Lei n. 11. 960/09,


instituindo um novo parcelamento de 240 meses para os Municpios.
Acusada de eleitoreira, tem o mrito de tentar resolver o imbrglio pela
via da composio. No entanto, segundo seus dispositivos, o Municpio
LQDGLPSOHQWHSRGHWHUD&1'JDUDQWLGDVHUHFRQKHFHURGpELWR]HURV
parcelamentos ali recomendados.
Na prtica, tais parcelamentos tm sido apenas aceitos como forma de
obteno imediata de CND, porquanto a sua possibilidade de arcar com os
pagamentos tambm reduzido. Diga-se, ainda, em favor dos Municpios,
que estes muitas vezes reconhecem como dbitos o que no , de fato,
devido, ou que j foi considerado pela justia brasileira, como indevido,
ou aqueles sobre os quais se operaram a decadncia ou prescrio. Neste
SDUWLFXODUDQRYHOOHJLVODomRWURX[HXPGLVSRVLWLYRHVSHFtFRH[FOXLQGRGR
parc1elamento os dbitos prescritos ou inexistentes pela decadncia, ainda
que j confessados pelo Municpio, em parcelamentos anteriores.
Outro aspecto importante da novatio legis a garantia de que a
CND ser emitida no prazo de dois dias teis a partir da realizao do
parcelamento ali previsto. Regra til que vem bem a calhar diante da
VLWXDomRFDWDVWUyFDSRUTXHSDVVDR0XQLFtSLREUDVLOHLUR

CONCLUSO
&RQVLGHUDQGRDDUJXPHQWDomRGHVDGDDRORQJRGRWH[WRDOJXPDV
concluses podem ser tiradas:
O direito ao desenvolvimento um direito fundamental que engloba tanto a dimenso individual quanto difusa da sociedade;
Considerando essas duas vertentes, o direito ao desenvolvimento
faz parte do elenco de direitos fundamentais e est sob a proteo desse
regime constitucional;
O modelo brasileiro de federao consagra um pacto federativo em
que aos Municpios cabe assegurar o exerccio desse direito, ao tempo em
TXHFRPSHWHj8QLmRHDR(VWDGRPHPEURQDQFLiORV
Simultaneamente, cabe ao Municpio a competncia para realizar
polticas pblicas voltadas concretizao do direito fundamental ao
desenvolvimento.
O princpio constitucional da federao, que inspira a regra do art.
160 da CF/88, colide com o princpio que consagra o direito ao desenvol-

117

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

vimento e, desta coliso de princpios deve preponderar, no caso concreto, o direito ao desenvolvimento, em razo da base antropolgica em que
deve se fundar a aplicao da Constituio Federal.
Pela mesma razo, tambm deve prevalecer o direito fundamental
ao desenvolvimento, em detrimento das normas que condicionam o
recebimento de transferncias voluntrias emisso de CND ou CND(3RVTXDLVVmRLQFRQVWLWXFLRQDLVTXDQGRDSOLFDGRVFRPRPGHLPpedir a realizao de tais transferncias.
O gestor da coisa pblica o nico a ser responsabilizado pelo desmando com o dinheiro pblico. Ao impedir transferncias voluntrias,
a lei transfere a responsabilidade para o cidado e deixa impune o verdadeiro responsvel, que o gestor.

REFERNCIAS BIBLIOGRFICAS
ALEXY, Robert. Teoria de los derechos fundamentales.Madrid:Centro
de Estudios Politicos y Constitucionales, 2001.
BARBOSA, Ana Paula Costa. A Legitimao dos Princpios Constitucionais. Rio de Janeiro: Renovar, 2002.
BARCELLOS. Ana Paula de . $HFiFLDMXUtGLFDGRVSULQFtSLRVR
princpio da dignidade da dignidade.Rio de Janeiro:Renovar,2002.
BARROSO, Luis Roberto. )XQGDPHQWRVWHyULFRVHORVyFRVGR
novo direito constitucional brasileiro (Ps modernidade, teoria
crtica e ps positivismo). Salvador: Revista Dilogo Jurdico, v.
6, set. 2001.
GOMES CANOTILHO, J.J. , Direito constitucional e teoria da constituio. Coimbra:Almedina,2005.
LEAL, Vitor Nunes. Coronelismo, enxada e voto. So Paulo:Editora
Alfa- Omega, 5 Edio, 1975, 276 p.
PIOVESAN, Flvia. Direitos humanos e o direito constitucional internacional. So Paulo: Max Limonad, 1997.
ROTHEMBURG. Walther Claudius. Princpios constitucionais.: Sergio Antonio Fabris, 1998.
SARLET. Ingo wolfgang . Dignidade da Pessoa Humana e Direitos

118

Jussara Maria Moreno Jacintho

Fundamentais na Constituio de 1988. Porto Alegre: Livraria do advogado,2001.


______$ HFiFLD GRV GLUHLWRV IXQGDPHQWDLV Porto Alegre: Livraria
de Advogado, 2001.
SARMENTO, Daniel. Os princpios constitucionais e a ponderao
de bens. In: Torres, Ricardo Lobo (org). Tema dos direitos fundamntais. 2 ed. Rio de Janeiro:Renovar, 2001.

119

MEDIAO INTERDISCIPLINAR:
Um caminho vivel autocomposio
GRVFRQLWRVIDPLOLDUHV
Luciana Aboim Machado Gonalves da Silva*

Resumo:
$PHGLDomRFRQVWLWXLXPPHLRDXW{QRPRGHUHVROXomRGHFRQLWRVQR
qual o mediador um mero facilitador da comunicao, possibilitando
que as prprias partes autodeterminem o desfecho da controvrsia, de
modo a possibilitar uma maior satisfao e responsabilidade no cumSULPHQWRGRUHVXOWDGRQDODVVLPFRPRXPDHIHWLYDSDFLFDomRVRFLDO
visto que transforma o relacionamento.
Palavras-chavePHGLDomRUHVROXomRFRQLWRVSDFLFDomR
Abstract:
7KHPHGLDWLRQFRQVWLWXWHVDQDXWRQRPRXVZD\RIUHVROXWLRQRIFRQLFWVLQ
which the mediator is a facilitator of the communication, making possible
WKDWWKHRZQSDUWVDUULYHWKHFRQFOXVLRQRIWKHFRQLFWLQZD\WRPDNHSRVVLEOHDODUJHUVDWLVIDFWLRQDQGUHVSRQVLELOLW\LQWKHH[HFXWLRQRIWKHQDOUHVXOW
DVZHOODVDQHIIHFWLYHVRFLDOSDFLFDWLRQVHHQWKDWWUDQVIRUPVWKHUHODWLRQVKLS
KeywordsPHGLDWLRQUHVROXWLRQFRQLFWVSDFLFDWLRQ

* O presente artigo objeto de estudos realizados no projeto de pesquisa Mediao


LQWHUGLVFLSOLQDUXPFDPLQKRYLiYHOjDXWRFRPSRVLomRGRVFRQLWRVIDPLOLDUHVnanciando pelo CNPq (edital universal 2009).
Doutora em Direito do Trabalho pela Faculdade de Direito da Universidade de So
Paulo - USP. Ps-graduada em Direito do Trabalho; Ps-graduada em Direito Processual Civil; Mestre em Direito do Trabalho, todos pela Pontifcia Universidade
Catlica de So Paulo - PUC/SP. Ps-graduada em Derecho del Trabajo: descentralizacin productiva y dependencia laboral pela Universidad Buenos Aires - U.B.A.
Professora Adjunta do Departamento de Direito da Universidade Federal de Sergipe
UFS. Vice-coordenadora da ps-graduao stricto sensu (mestrado) em Direito da
Universidade Federal de Sergipe. Pesquisadora do Conselho Nacional de DesenvolYLPHQWR&LHQWtFRH7HFQROyJLFR&13T Membro da Cmara de Assessoramento
da Fundao de Apoio Pesquisa e Inovao Tecnolgica do Estado de Sergipe
FAPITEC. Membro da Asociacin Iberoamericana de Derecho de Trabajo y de
la Seguridad Social. Membro e diretora setorial (nordeste) do Instituto Latinoamericano de Derecho del Trabajo y de la Seguridad Social.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

INTRODUO
O arcabouo do Poder Judicirio somado a prticas judiciais aplicaGDVGHIRUPDFRQYHQFLRQDOQmRWrPGHPRQVWUDGRVXFLHQWHVSDUDDHIHWLYDHFpOHUHVROXomRGRVFRQLWRVLQWUDIDPLOLDUHVWDQJHQFLDQGRDSHQDV
parte dos problemas e no oferecendo condies para reconstruo da
convivncia familiar.
Em razo de os litigantes no relatarem os fatos na sua inteireza,
omitindo os dados que entendem inadequados defesa dos seus interesses, e de o processo judicial se contentar com a verdade formal, a
despeito de buscar a verdade real, a deciso judicial, muitas vezes, est
em descompasso com as reais necessidades das partes, implicando na
LQHFiFLDGRUHVXOWDGRSDUDUHVROXomRGDFRQWHQGD
Nota-se a existncia de um constante estmulo conciliao como mecanismo de desafogar o Judicirio e aumentar a estatstica do juzo sem,
contudo, pensar no ponto de vista das partes, vale dizer, sem tomar em conVLGHUDomRDHIHWLYDUHVROXomRGRFRQLWR1. Essa realidade vem desaguando
HPXPDFULVHGHFRQDQoDSRUSDUWHGRVFLGDGmRVQHVWHSRGHUHVWDWDO
Nesse caminho, Lilia Maia de Morais Sales2 assevera:
O que se percebe durante o processo judicial somente o dilogo
entre os advogados, juzes e promotores de justia, buscando uma
soluo para os problemas que se encontram nos autos processuais.
As partes, reais interessadas na questo, pouco so ouvidas, causando insatisfaes reprimidas que resultam em novas lides, mesmo
aps a deciso judicial daquele processo. A deciso judicial fundamenta-se exclusivamente no processo, seguindo a falsa mxima o
que no est nos autos no est no mundo. Dessa forma, em muitos casos, os reais problemas, os aspectos relevantes da questo no
so estudados. A deciso judicial, portanto, resta insatisfatria, diFXOWDQGRRVHXFXPSULPHQWRHDLQGDSURGX]LQGRPDLVLPSDVVHV

Diante disso, adveio, segundo lecionam Mauro Cappelletti e Bryant


Garth3, o movimento de acesso justia, tratando de analisar e procurar
1

2
3

Em outras palavras, pensa-se na conciliao como mecanismo clere de extino do


IHLWRHQmRFRPRLQVWUXPHQWRGHSDFLFDomRVRFLDOGRVFRQLWRV
-XVWLoDH0HGLDomRGH&RQLWRV, p. 65.
$FHVVRj-XVWLoD, passim.

122

Luciana Aboim Machado Gonalves da Silva

RVFDPLQKRVSDUDVXSHUDUDVGLFXOGDGHVRXREVWiFXORVTXHID]HPLQDcessveis para tanta gente o alcance da justia substancial.


Como salientam os supracitados autores4, h trs obstculos ou ondas
de acesso justia: o primeiro o obstculo econmico, isto , a pobreza
de muitas pessoas que pouco acesso tm informao e a representao
adequada; o segundo obstculo o organizacional, que se expressam nos
chamados direitos e interesses (de grupo) difusos ou coletivos, nos quais
ROLWLJDQWHLQGLYLGXDOVHULDRWLWXODUGHLQVLJQLFDQWHIUDJPHQWRGRGDQR
em questo; e o terceiro obstculo processual, no sentido de que o processo litigioso no Judicirio pode no ser o melhor caminho para ensejar
a vindicao efetiva de direitos, de maneira que mister se faz reais alternativas aos juzos ordinrios e aos procedimentos usuais.
Destarte, o presente artigo est profundamente envolvido nessa terceira onda, que centra sua ateno no conjunto geral de instituies
e mecanismos, pessoas e procedimentos utilizados para processar e
mesmo prevenir disputas nas sociedades modernas5, na qual se pode
inserir a mediao familiar interdisciplinar como efetivo instrumento
GHSDFLFDomRGRFRQLWRHDFHVVRjMXVWLoD

1. O SENTIDO E ALCANCE DA MEDIAO


0HGLDomRSURFHGHGRODWLPPHGLDUHTXHVLJQLFDDWRRXHIHLWR
de mediar, dividir ao meio, intercesso, interveno ou interposio.6
Adolfo Braga Neto7 apresenta o seguinte conceito de mediao:
0HGLDomRpXPDWpFQLFDQmRDGYHUVDULDOGHUHVROXomRGHFRQLtos, por intermdio da qual duas ou mais pessoas (fsicas, jurdicas, pblicas, etc.) recorrem a um especialista neutro, capacitado, que realiza reunies conjuntas e/ou separadas, com o intuito
de estimul-las a obter uma soluo consensual e satisfatria,
salvaguardando o bom relacionamento entre elas.
4
5
6

Ibidem, mesma pgina.


CAPPELLETTI, Mauro e GARTH, Bryant.$FHVVRj-XVWLoDp. 67-68.
Grande Dicionrio Larousse cultural da lngua portuguesa. So Paulo: Nova
cultural, 1999, p. 603.
2VDGYRJDGRVRVFRQLWRVHDPHGLDomR, p. 93. Apud SALES, Lilia Maia de Morais.
-XVWLoDH0HGLDomRGH&RQLWRVBelo Horizonte: Del Rey, 2004, p. 24.

123

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Para guida Arruda Barbosa8, a mediao constitui um mtodo fundamentado, terico, por meio do qual uma terceira pessoa, neutra e especialmente treinada, ensina os mediandos a despertarem seus recursos pessoais
SDUDTXHFRQVLJDPWUDQVIRUPDURFRQLWRHPRSRUWXQLGDGHGHFRQVWUXomR
GHRXWUDVDOWHUQDWLYDVSDUDRHQIUHQWDPHQWRRXDSUHYHQomRGHFRQLWRV
Nas palavras de Jean-Franois Six9, a mediao consiste em estabelecer ligaes onde elas ainda no foram feitas, suscitar o agir comunicacional onde no existe.
Vale ressaltar, ainda, as lies de Juan Carlos Vezzulla10:
$PHGLDomRpXPDWpFQLFDGHUHVROXomRGHFRQLWRVQmRDGYHUVDULDO
TXHVHPLPSRVLo}HVGHVHQWHQoDVRXODXGRVHFRPXPSURVVLRQDOGHvidamente formado, auxilia as partes a acharem seus verdadeiros interesses e preserv-los num acordo criativo onde as duas partes ganham.
Nessa senda, podemos dizer que mediao constitui um meio autnoPRGHUHVROXomRGHFRQLWRV11HPTXHDVSDUWHVVHDSUR[LPDPHUHHWHP
sobre as contendas, mediante a interveno de um terceiro (mediador) que
proporciona a comunicao dos dissidentes para que cheguem a uma deciso conjunta e a reconstruo do relacionamento, contemplando o futuro.
Embora a mediao se assemelhe a conciliao, com esta no se
confunde. Como sustenta Antnio Carlos de Arajo Cintra, Ada Pelllegrini Grinover e Cndido Rangel Dinamarco12: Distingue-se dela so8

10
11

12

0HGLDomR IDPLOLDU LQVWUXPHQWR WUDQVGLVFLSOLQDU HP SURO GD WUDQVIRUPDomR GRV


FRQLWRV GHFRUUHQWHV GDV UHODo}HV MXUtGLFDV FRQWURYHUVDV Dissertao (Mestrado
em Direito Civil) Faculdade de Direito da Universidade de So Paulo, So Paulo.
(Orientador Roberto Joo Elias), 2003 p. 54.
Dinmica da mediao. Traduo de guida Arruda Barbosa, Eliana Riberti
Nazareth e Giselle Groeninga. Belo Horizonte: Del Rey, 2001, p. 237.
0HGLDomRRio de Janeiro: Instituto Liberal, 1995, p. 15.
corrente na doutrina a assertiva de que a mediao constitui uma Alternative
Dispute Resolution ADR. Como bem leciona Mauro Cappelletti (Os mtodos
DOWHUQDWLYRV GH VROXomR GH FRQLWRV QR TXDGUR GH PRYLPHQWR XQLYHUVDO GH
acesso justia. Revista de Processo, So Paulo, ano 19, n. 74, abr.-jun., p.
82), designao Alternative Dispute Resolution (ADR) costuma-se atribuir
acepo estritamente tcnica, relativa sobretudo aos expedientes extrajudiciais
ou no judiciais GHVWLQDGRV D VROXFLRQDU FRQLWRV HPERUD HVWH QmR VHMD R
nico, cabendo ao operador do direito ocupar-se de maneira mais geral dos
expedientes judiciais ou no que tm emergido como alternativas aos tipos
RUGLQiULRVou tradicionais de procedimentos, atravs da implementao de uma
perspectiva mais ampla na anlise do quadro do movimento universal de acesso
justia. Assim sendo, impende considerar a mediao no apenas como meio
DOWHUQDWLYRPDVWDPEpPFRPRPHLRHVVHQFLDOGHUHVROXomRGHFRQLWRV
Teoria Geral do Processo. 22 ed. So Paulo: Malheiros, 2006, p.34.

124

Luciana Aboim Machado Gonalves da Silva

mente porque a conciliao busca, sobretudo, o acordo entre as partes,


HQTXDQWRDPHGLDomRREMHWLYDWUDEDOKDURFRQLWRVXUJLQGRRDFRUGR
como mera conseqncia.
A adeso tcnica mediadora deve se dar por genuno consentimento das partes; de igual modo, legtima deve ser a concordncia das
partes em aderir ao resultado obtido com a mediao.
Relevante, para uma mediao frutfera, o papel desempenhado
pelo mediador: terceiro que aproxima as partes dissidentes diminuindo as suas resistncias e as conduzem efetivamente a um dilogo
FRPDUHH[mRVREUHDVTXHVW}HVFRQWURYHUVDVLQIRUPDQGRDVVREUHDV
possibilidades disponveis para o tratamento da controvrsia e direcionando-as para autoconstruo de uma soluo justa.
)ULVDVHTXHQDPHGLDomRDUHVROXomRGRFRQLWRpGHFRPSHWrQFLD
das prprias partes, sendo o mediador um mero facilitador da comunicao. Apropriadas, nessa perspectiva, so as palavras de Lilia Maia
de Moraes Sales13:
As partes que decidiro todos os aspectos do problema sem
interveno do mediador, no sentido de induzir as respostas ou as
decises, mantendo a autonomia e controle das decises relacioQDGDVDRFRQLWR2PHGLDGRUIDFLOLWDDFRPXQLFDomRHVWLPXODR
GLiORJRDX[LOLDQDUHVROXomRGRVFRQLWRVPDVQmRGHFLGH

Destarte, a deciso ajustada, oriunda do procedimento de mediao,


por ser derivada da vontade livre e consciente - 14 das partes envolvidas,
LPSOLFDQDHIHWLYLGDGHGDUHVROXomRGRVFRQLWRVLQFOXVLYHGHXPDIRUma global, proporcionando a reconstruo do relacionamento.
de se ressaltar, ainda, que a atividade de mediao pode ser desenvolvida no mbito extrajudicial ou judicial, sendo esta parte do
sistema de administrao e distribuio de justia estatal. Fala-se,
hodiernamente, em mediao paraprocessual SDUD  DR ODGR GH 
pretendendo introduzir no mbito do Poder Judicirio a realizao
GHXPPpWRGRFRPSOHPHQWDUGHFRPSRVLomRGHFRQLWRV15
13
14

15

-XVWLoDH0HGLDomRGH&RQLWRVBelo Horizonte: Del Rey, 2004, p. 47.


Vale salientar, o mediador deve explicar, de incio, a responsabilidade absoluta
das partes pelo ajuste, de sorte que ele no pode sugerir solues ou oferecer
assessoramento legal.
Convm ressaltar, com Juan Carlos Vezzulla, que a mediao judicial no implica
a estatizao da deciso ajustada, remanescendo com sua caracterstica privada

125

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

2. VANTAGENS DA MEDIAO
Diversas so as vantagens que se aufere com a deciso ajustada por
meio da mediao, entre as quais podemos citar: resoluo real do conLWRSDFLFDomRVRFLDOSUHYHQomRGHIXWXUDVFRQWHQGDVLQFOXVmRVRFLDO
e reduo da violncia.
Na mediao as partes no discutem apenas fatos relativos lide,
trazendo baila outros problemas perifricos que, em princpio, no
HVWmR GLUHWDPHQWH UHODFLRQDGRV DR FRQLWR TXH DV SDUWHV LQLFLDOPHQWH
buscam resolver. nessa medida que a mediao proporciona uma reVROXomRUHDOGRFRQLWR, pois abrange a soluo de questes centrais e
VDWpOLWHVTXHDLJHPRUHODFLRQDPHQWRGDVSDUWHVGLVVLGHQWHV
&RPLVVRKiXPDSUHYHQomRGHIXWXURVFRQLWRVQDPHGLGDHPTXH
soluciona efetivamente a dissidncia, restabelecendo a comunicao e
transformando o relacionamento entre as partes, o que enseja a SDFLcao social.
nesse sentido que Lilia Maia de Morais Sales16 expe ser a mediao
preventiva, vale dizer, a mediao transformadora, posto que ultrapassa
RREMHWLYRGRDFRUGRHQWUHDVSDUWHVSDUDPRGLFDUDUHODomRHQWUHHODV
passando da relao de uma disputa para uma relao de colaborao, esWDEHOHFHQGRFRPXQLFDomRKDUP{QLFDPLWLJDQGRRVFRQLWRVIXWXURV
Assim, em um processo judicial, o fato de dar ganho de causa a
XPDSDUWHQmRVLJQLFDQHFHVVDULDPHQWHTXHRFRQLWRHVWHMDHIHWLYDPHQWHUHVROYLGRMiTXHPXLWDVYH]HVVHS}HPDSHQDVDOLGHMXGLFLDO
PDVQmRUHVROYHRFRQLWRHDVRXWUDVTXHVW}HVDHVWHFRUROiULDV
No se pode perder de vista que no existem ganhadores e perdedores na resoluo ajustada pela mediao, em razo de entre as partes no haver competio (os interesses convergem e no divergem);
costuma-se dizer que h uma relao ganha-ganha com o resultado
frutfero da mediao. No h, portanto, a lgica determinista binria
SHFXOLDUDVROXo}HVMXGLFLDLVGHFRQLWRVHPTXHVHSDUWHGDH[LVWrQFLD
de ganhadores e perdedores na deciso imposta pelo Estado.
Ademais, a mediao proporciona a incluso social, uma vez que

16

mesmo quando realizada no mbito judicial, pois o que ocorre nas sesses no se
tornar pblico nem constar nos registros judiciais, pertencendo exclusivamente s
partes. (0HGLDomRWHRULDHSUiWLFD*XLDSDUDXWLOL]DGRUHVHSURVVLRQDLVLisboa:
Agora Publicaes, 2001, p. 88.)
-XVWLoDH0HGLDomRGH&RQLWRV, p. 31-32.

126

Luciana Aboim Machado Gonalves da Silva

RIHUHFHDRVFLGDGmRVXPDSDUWLFLSDomRDWLYDQDUHVROXomRGHFRQLWRV
resultando no crescimento do sentimento de responsabilidade e de controle sobre os prprios problemas vivenciados.
Tambm, a mediao promove uma UHGXomRGDYLROrQFLDQDVRFLHdadeQDPHGLGDHPTXHSURPRYHDHIHWLYDUHVROXomRGRFRQLWR1DV
palavras de Luis Alberto Warat17:
Quando as sociedades esperam que outros, que o estado, resolva seus problemas, est dando um cheque em branco para a violncia. O outro, quando resolve nossos problemas sempre violento. Resolver pelo outro j em sim mesmo um ato violento.

Nesse panorama de vantagens por proporcionar uma resoluo diIHUHQFLDGDGHFRQLWRVDPHGLDomRWHPFRPRXPDGHVXDVPHWDVGDU


aos participantes a possibilidade de reorganizar o relacionamento. Com
isso, possibilita o alcance de uma sorte de evoluo moral ou transformao por meio do aprimoramento da autonomia (ou empoderamento, enquanto capacidade de decidir sobre os problemas da prpria
YLGD HGHLGHQWLFDomR FRPRFDSDFLGDGHGHUHFRQKHFHUHVLPSDWL]DU
com a condio alheia)18.

D/KK^^K:h^d/
Com vistas s vantagens da mediao e imprescindibilidade de
VH FRQFHEHU XPD UHVROXomR FpOHUH HFLHQWH VDWLVIDWyULD H SRQGHUDGD
das controvrsias na sociedade contempornea, caracterizada por uma
LQHJiYHOPXOWLSOLFDomRGHFRQLWRVLPSHQGHFRQVROLGDUXPDPXGDQoD
de mentalidade por parte dos operadores do direito e dos jurisdicionados para a adoo da mediaoLPSULPLQGRDVVLPHFiFLDDRGLUHLWR
fundamental de acesso justia.
Mauro Cappelletti e Bryant Garth19 salientam que a expresso
17

18

19

Surfando na pororoca: ofcio do mediador. MEZZAROBA, Orides; DAL


RI JNIOR, Arno; ROVER, Aires Jos; e MONTEIRO, Cludia Servilha.
Florianpolis: Fundao Boiteux, 2004, p. 217.
RISKIN, Leonard L. Compreendendo as orientaes, estratgias e tcnicas do
mediador: um mapa para os desnorteados. In: AZEVEDO, Andr Gomma de (org.).
Estudos em arbitragem, mediao e negociao. Braslia: Braslia Jurdica, 2002, p. 26.
$FHVVRj-XVWLoD7UDGXomR(OOHQ*UDFLH1RUWKHHW3RUWR$OHJUH6HUJLR$QWRQLR

127

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

acesso justiapGHGLItFLOGHQLomRPDVVHUYHSDUDGHWHUPLQDUGXDV
QDOLGDGHVEiVLFDVGRVLVWHPDMXUtGLFRVHULJXDOPHQWHDFHVVtYHODWRdos e produzir resultados que sejam individual e socialmente justos.
Cabe rememorar que acesso justia no tem o sentido de possibilidade de ingresso em juzo. preciso no confundir acesso justia com
DFHVVR DR -XGLFLiULR20 O acesso justia est umbilicalmente ligado
DRUHVXOWDGRGDVROXomRGRFRQLWRQRVHQWLGRGHYLDELOL]DUo acesso
ordem jurdica justa, vale dizer, efetivando a promoo da justia.
nesse sentido as lies de Antonio lvares da Silva21:
...o novo sistema integrado de resoluo de litgios deve ter, como
conseqncia, a promoo, pelo Estado, duma poltica pblica de
justia, que inclui os tribunais judiciais e que reconhece, tambm,
aos meios no judiciais legitimidade para dirimir litgios.

Nesse caminho, com vistas a implementao do acesso justia e a paulatina substituio da cultura de sentena pela cultura da
SDFLFDomR22, em 29 de novembro de 2010, adveio a Resoluo n.
125 do Conselho Nacional de Justia que, no pargrafo nico do art.
1, incumbe aos rgos judiciais oferecer a mediao como meio consensual de resoluo de controvrsias.
Promove-se, dessa feita, a existncia de um sistema pluriprocessual de
HQIUHQWDPHQWRGHFRQWURYpUVLDVFRQJXUDGRSHODSUHVHQoDQRRUGHQDPHQWR
GHGLYHUVRVPHFDQLVPRVGLIHUHQFLDGRVSDUDRWUDWDPHQWRGRVFRQLWRV23 .
Destarte, a mediao no visa extirpar com as atividades jurisdicionais, at porque nenhuma leso ou ameaa de direito pode ser subtrada
do Poder Judicirio (CF, art. 5, inc. XXXV), mas se destina a auxili-lo
QDWDUHIDGHUHVROXomRGHFRQLWRV+iSRUFRQVHJXLQWHXPDUHODomR
20

21

22

23

Fabris Editor, 1988, p. 8.


No se pode dizer que todo acesso justia passe necessariamente pelo acesso
jurisdioXPDYH]TXHH[LVWHPIRUPDVH[WUDMXGLFLDLVGHUHVROXomRGHFRQLWRV
$GHVMXULGLFL]DomRGRVFRQLWRVWUDEDOKLVWDVHRIXWXURGDMXVWLoDGRWUDEDOKRQR
Brasil. In: TEIXEIRA, Slvio de Figueiredo (Coord.). As garantias do cidado na
justia. So Paulo: Saraiva, 1993, p. 259.
WATANABE, Kazuo. $PHQWDOLGDGHHRVPHLRVDOWHUQDWLYRVGHVROXomRGHFRQLWRV
no Brasil. ,Q 0HGLDomR H JHUHQFLDPHQWR GR SURFHVVR UHYROXomR QD SUHVWDomR
MXULVGLFLRQDOJXLDSUiWLFRSDUDDLQVWDODomRGRVHWRUGHFRQFLOLDomRHPHGLDomR
GRINOVER, Ada Pellegrini; WATANABE, Kazuo; e LAGRASTA NETO, Caetano
(coord.). So Paulo: Atlas, 2008, p. 10.
TARTUCE, Fernanda. 0HGLDomRQRV&RQLWRV&LYLVSo Paulo: Mtodo, 2008, p. 87.

128

Luciana Aboim Machado Gonalves da Silva

de complementaridade no tocante prestao jurisdicional, mas no de


substituio em relao a ela.
Entrementes, no se pode perder de vista, como bem sustenta Giuseppe Chiovenda24, que a jurisdio deve ser reputada como uma atividaGHVHFXQGiULDVLJQLFDQGRRSRGHUHVWDWDODWULEXtGRDXPDGHWHUPLQDGD
autoridade para aplicar a norma ao fato concreto, visando composio
de lides em razo da inexistncia dessa resoluo de controvrsia ter
sido alcanada espontaneamente pelas partes.
A par disso, cumpre ter em considerao que em algumas controvrsias, pelas suas peculiaridades, a utilizao dos mtodos autocompositivos tem pertinncia para que haja uma reconstruo satisfatria da vida.
Em razo de nas relaes familiares o afeto e a proteo revelarem-se
FRPRSRQWRVQXFOHDUHVJHUDQGRHVSHFLFLGDGHVQRWUDWRGDVFRQWURYpUVLDVD
estas pertinentes, essencial disponibilizar elementos para que os membros da
famlia possam reforar tal instituio de maneira que as prprias partes supram
suas necessidades, sem precisar delegar a soluo de suas crises a terceiros.
Assim, havendo uma disputa na qual envolve sentimentos e co-responsabilidades parentais, bem como continuidade de relacionamento
no futuro, como via de regra acontece em querelas de famlias, de
grande relevo se valer da tcnica de mediao familiar interdisciplinar.
,VVRSRUTXHQDVHQWHQoDMXGLFLDODUHVROXomRGRFRQLWRUHSUHVHQWD
uma deciso imposta, de fora para dentro, enquanto que na mediao, a
VROXomRGRFRQLWRVXUJHGHGHQWURSDUDIRUDVHQGRDFHLWDSHORVHQYROvidos, uma vez que foram eles que buscaram.
Nesse sentido, Juliana Demarchi25 salienta que havendo preponderncia de aspectos interpessoais, o meio ideal de resoluo da controYpUVLDpDPHGLDomRMiTXHHVWDSULYLOHJLDDSDFLFDomRVRFLDOHQmR
necessariamente a concluso de um acordo formal. Enquanto o conciliador busca a celebrao do acordo, o mediador atua como facilitador
do dilogo, conduzindo as partes a um estado de cooperao.
A propsito, tambm, oportuno destacar tambm os esclios de Fernanda Tartuce26:
24

25

26

Instituies de Direito Processual Civil, Vol. II. 2 ed. So Paulo: Ed. Bookseller,
2000, p. 17-18.
7pFQLFDVGHFRQFLOLDomRHPHGLDomR,Q0HGLDomRHJHUHQFLDPHQWRGRSURFHVVR
UHYROXomRQDSUHVWDomRMXULVGLFLRQDOJXLDSUiWLFRSDUDDLQVWDODomRGRVHWRUGH
conciliao e mediao. GRINOVER, Ada Pellegrini; WATANABE, Kazuo; e
LAGRASTA NETO, Caetano (coord.). So Paulo: Atlas, 2008, p. 59.
0HGLDomRQRV&RQLWRV&LYLV, p. 208.

129

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

A mediao consiste na atividade de facilitar a comunicao entre as partes para propiciar que estas prprias possam,
visualizando melhor os meandros da situao controvertida,
protagonizar uma soluo consensual. A proposta da tcnica
proporcionar um outro ngulo de anlise aos envolvidos:
em vez de continuarem as partes enfocando suas posies, a
mediao propicia que elas voltem sua ateno para os verdadeiros interesses envolvidos. Como exemplo, imaginemos
uma discusso familiar sobre o valor da penso alimentcia:
RFRQLWRJHUDOPHQWHpPDUFDGRSHODVSRVLo}HVGHUHVLVWrQFLD
(do alimentante) e insistncia (da responsvel legal do alimentando) quanto a certo valor. Caso ambos, consensualmente, se comuniquem para formar o valor devido, listando as
despesas da criana e sua pertinncia, visualizaro cada gasto
e decidiro sobre sua realizao ou no. Tal situao permite
perceber que mais importante do que a simples posio de
cada um o melhor atendimento do interesse da criana.

4. A MEDIAO FAMILIAR INTERDISCIPLINAR


Fazendo um corte epistemolgico no tema mediao, focando as
relaes de direito de famlia, que envolvem sentimentos e direitos de
personalidade, a problemtica da legitimidade das decises judiciais na
UHVROXomRGRVFRQLWRVIDPLOLDUHVpQRWyULDVHQGRGHJUDQGHUHOHYRD
mediao familiar interdisciplinar.
Maria Helena Diniz27, citando Danile Ganancia, ensina que a mediao familiar tem o papel de conduzir que as prprias partes elaborem
acordos durveis que levem em conta as necessidades de cada um e
em particular das crianas em um esprito de co-responsabilidade parental. Leciona, ainda, que:
...a mediao procura transformar a crise familiar e a
falncia do casamento em uma relao estvel parental,
abrindo caminhos para uma reconstruo satisfatria da
27

Curso de Direito Civil Brasileiro: direito de famlia, vol. 5. 23 ed. rev., atual. e
ampl. de acordo com a Reforma do CPC e com o Projeto de Lei n. 276/2007. So
Paulo: Saraiva, 2008, p. 354.

130

Luciana Aboim Machado Gonalves da Silva

vida; para tanto, precisar ser aceita pelos protagonistas,


acatando a interveno do mediador, que ter a difcil tarefa de escutar os problemas, esclarecendo pontos controvertidos e restabelecendo o dilogo, ao fazer o cliente entender
que a separao judicial e o divrcio, na verdade, no dissolvem a famlia, uma vez que a reorganizam, mostrando
no s os novos papis desempenhados pelo pai e pela me,
voltados ao melhor interesse e ao bem-estar da criana e do
adolescente, como tambm a importncia da guarda compartilhada e da converso do direito de visita em direito de
FRQYLYrQFLDSDUDTXHDUHODomRHQWUHSDLVHOKRVVRIUDXP
aumento de qualidade, possibilitando um crescimento pessoal, voltado ao respeito humano e social, dignidade do ser
humano, liberdade e aos limites do conviver.
A mediao familiar interdisciplinar constitui um tema recente,
VHQGR UHOHYDQWHLQVWUXPHQWRGH SDFLFDomRVRFLDOTXH LQFXUVLRQD QRV
tQYLRVSHUFXUVRVGRVFRQLWRVIDPLOLDUHV
Cabe acentuar que por meio dessa tcnica de resoluo autocompositiva de contendas em seios familiares, o mediador promove a comunicao, restabelecendo um dilogo funcional entre os dissidentes, de
sorte a conseguir focar o real interesse das partes e eliminar resistncias
indevidas e despropositadas que, muitas vezes, so acarretadas por fatores subjetivos estranhos causa.
Nesse pensar, Maria Berenice Dias28DFHQWXDTXHDVHQWHQoDGLFLOPHQWHFRQVHJXHSDFLFDUDVSDUWHVQRVFRQLWRVIDPLOLDUHVDQDOQDV
causas em que esto envolvidos vnculos afetivos, h temores, queixas,
mgoas e sentimentos confusos de amor e dio. A resposta judicial
no apta a responder aos anseios daqueles que buscam muito mais
resgatar danos emocionais do que propriamente obter compensaes
econmicas. Esclarece, ainda, a autora que a mediao no propriamente um substitutivo da via judicial e, sim, um instrumento complePHQWDUTXHRSHUDSDUDTXDOLFDUDVGHFLV}HVMXULVGLFLRQDLVHWRUQiODV
YHUGDGHLUDPHQWHHFD]HV
A adoo da mediao familiar, portanto, conduz a um melhor
equacionamento das querelas relativas a direito de famlia, uma vez
que, por melhor que seja instrudo um processo, o juiz no conhece
28

0DQXDOGHGLUHLWRGDVIDPtOLDV 3 ed. So Paulo: RT, 2006, p. 73-74.

131

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

GHWDOKHVGDUHODomRFRQWURYHUWLGDHGLFLOPHQWHFKHJDUiDXPDVROXomR
satisfatria da controvrsia, possibilitando a reconstruo do relacionamento familiar sobre novo vis.
Cumpre elucidar que a anlise da mediao familiar requer uma
abordagem interdisciplinarWHQGRHPYLVWDTXHXPFRQLWRLQWUDIDPLliar envolve aspectos no apenas jurdicos, mas tambm sociolgicos,
SVLFROyJLFRVHORVyFRVHQWUHRXWURV
$VVLP HP VHQGR RV FRQLWRV IDPLOLDUHV XP IHQ{PHQR FRPSOH[R
UHYHODVHIXQGDPHQWDOSDUDVXDSDFLFDomRDFRQWULEXLomRGHSHUVSHFtivas diversas e complementares em relao questo jurdica.
Cabe trazer baila, mais uma vez, os ensinamentos de Fernanda
Tartuce29:
Ante a presena de tantos elementos sentimentais, exige-se dos
operadores do direito envolvidos no tratamento da controvrsia familiar, alm de uma sensibilidade mais acentuada, uma
IRUPDomRGLIHUHQFLDGDSDUDTXHSRVVDPOLGDUHFD]PHQWHFRP
DVSHUGDVHDVIUXVWUDo}HVGDVSHVVRDVTXDQGRGRPGHVHXV
projetos pessoais. A interdisciplinaridade revela-se, ento, necessria para a compreenso da situao dos indivduos: com
o aporte da psicanlise, da psicologia, da assistncia social e
da sociologia, podem ser melhor valoradas as questes sociais
e as condies psicolgicas das partes, bem como ser melhor
compreendida sua realidade.

Importa acentuar que no sculo passado (dcada de 70) Mauro Cappelletti30 j salientava a ocorrncia de uma perturbadora invaso, sem
precedentes, dos tradicionais domnios do direito por socilogos, antroplogos, economistas, cientistas polticos e psiclogos.
Nesse diapaso, a mediao familiar interdisciplinar constitui uma
IHUUDPHQWDGHUHVROXomRGHFRQLWRVGHUHOHYDQWHYDORUVRFLDOHMXUtGLFR
TXHFRPS}HGHIRUPDPDLVDGHTXDGDHHFD]DVFRQWURYpUVLDVIDPLOLDres, podendo, ou melhor, devendo a sociedade e o rgo judicante dela
se utilizar em primazia sentena de cunho autoritrio.

29
30

0HGLDomRQRV&RQLWRV&LYLV, p. 279.
$FHVVRj-XVWLoD7UDGXomR(OOHQ*UDFLH1RUWKHHW3RUWR$OHJUH6HUJLR$QWRQLR
Fabris Editor, 1988, p. 8.

132

Luciana Aboim Machado Gonalves da Silva

5. CONCLUSES
Em se tratando de relaes familiares que envolvem questes privadas, projetos de vida e, via de regra, a imprescindibilidade de reconstruo do relacionamento a mediao exerce um papel fundamental,
SHUPLWLQGRTXHVHUHGX]DPDVLQHFiFLDVLQHUHQWHVDGHFLV}HVLPSRVWDV
pelo Poder Judicirio, j que ao juiz faltam informaes essenciais, de
conhecimento apenas das partes dissidentes, para se chegar ao desideUDWRPDLRUGHSDFLFDomRGRFRQLWRFRPMXVWLoD
fundamental, para tanto, o papel do mediador, focalizando e destacando os pontos convergentes lide, de sorte a auxiliar na formao
de um consenso de forma macro - sem, entretanto, intervir diretamente
QHVWDUHVROXomRGRFRQLWRGHXPDPDQHLUDPDLVHFD]HPHQRVRQHrosa, evitando futuras demandas judiciais.

6. REFERNCIAS BIBLIOGRFICAS
BARBOSA, guida Arruda. Mediao familiar: instrumento transGLVFLSOLQDU HP SURO GD WUDQVIRUPDomR GRV FRQLWRV GHFRUUHQWHV GDV
relaes jurdicas controversas. Dissertao (Mestrado em Direito Civil) Faculdade de Direito da Universidade de So Paulo, So Paulo.
(Orientador Roberto Joo Elias), 2003.
CAPPELLETTI, Mauro. Os mtodos alternativos de soluo de conLWRVQRTXDGURGRPRYLPHQWRXQLYHUVDOGHDFHVVRjMXVWLoD. Revista
de Processo n 74, p. 82-97.
____e Bryant Garth. Acesso Justia. 7UDGXomR(OOHQ*UDFLH1RUWKHet. Porto Alegre: Sergio Antonio Fabris Editor, 1988.
CINTRA, Antnio Carlos de Arajo; GRINOVER, Ada Pelllegrini e
DINAMARCO, Cndido Rangel. Teoria Geral do Processo. 22 ed.
So Paulo: Malheiros, 2006.
CHIOVENDA, Giuseppe. Instituies de Direito Processual Civil,
Vol. II. 2 ed. So Paulo: Ed. Bookseller, 2000.
DEMARCHI, Juliana. Tcnicas de conciliao e mediao. In: Mediao e gerenciamento do processo: revoluo na prestao jurisdicional: guia prtico para a instalao do setor de conciliao e media133

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

o. GRINOVER, Ada Pellegrini; WATANABE, Kazuo; e LAGRASTA NETO, Caetano (coord.). So Paulo: Atlas, 2008.
DIAS, Maria Berenice. Manual de direito das famlias. 3 ed. So
Paulo: RT, 2006.
DINIZ,Maria Helena. Curso de Direito Civil Brasileiro: direito
de famlia, vol. 5. 23 ed. rev., atual. e ampl. de acordo com a
Reforma do CPC e com o Projeto de Lei n. 276/2007. So Paulo:
Saraiva, 2008.
FARIA, Jos Eduardo. O Sistema Brasileiro de Justia: experincia reFHQWHHIXWXURVGHVDRV(VWXGRV$YDQoDGRV863QS
FISS, Owen M. Um novo processo civil. So Paulo: RT, 2004.
GALANTER, Marc. Comparado a que? Avaliando a qualidade dos
mecanismos de soluo de disputas. Denver University Law Review,
n. 66, 1989, p. xi-xiv. Traduzido por Marcos Paulo Verssimo.
Grande Dicionrio Larousse cultural da lngua portuguesa. So Paulo: Nova cultural, 1999.
LORENTZ, Lutiana Nacur. Mtodos Extrajudiciais de Soluo de
&RQLWRV7UDEDOKLVWDV. So Paulo: LTr, 2002.
MENDONA, Angela Hara Buonomo. A reinveno da tradio do
uso da mediao. Revista de Arbitragem e Mediao. So Paulo: RT,
ano 1, n. 3, set.-dez., 2004.
MUSZKAT, Malvina E.; OLIVEIRA, Maria Coleta; UNBEHAUM,
Sandra e MUSZKAT, Susana. Mediao familiar transdisciplinar:
XPDPHWRGRORJLDGHWUDEDOKRHPVLWXDo}HVGHFRQLWRGHJrQHUR. So
Paulo: Summus, 2008.
RISKIN, Leonard L. Compreendendo as orientaes, estratgias e
tcnicas do mediador: um mapa para os desnorteados. In: AZEVEDO,
Andr Gomma de (org.). Estudos em arbitragem, mediao e negociao. Braslia: Braslia Jurdica, 2002.
SALES, Llia Maia de Morais. -XVWLoDH0HGLDomRGH&RQLWRV. Belo
Horizonte: Del Rey, 2003.
SILVA, Antonio lvares da. $GHVMXULGLFL]DomRGRVFRQLWRVWUDEDlhistas e o futuro da justia do trabalho no Brasil. In: TEIXEIRA,

134

Luciana Aboim Machado Gonalves da Silva

Slvio de Figueiredo (Coord.). As garantias do cidado na justia.


So Paulo: Saraiva, 1993.
SIX, Jean-Franois. Dinmica da mediao. Traduo de guida Arruda Barbosa, Eliana Riberti Nazareth e Giselle Groeninga. Belo Horizonte: Del Rey, 2001.
TARGA, Maria Ins de Cerqueira Csar. Mediao em Juzo. So Paulo: LTr, 2004.
TARTUCE, Fernanda. 0HGLDomRQRV&RQLWRV&LYLV. So Paulo: Mtodo, 2008.
VEZZULLA, Juan Carlos. Mediao. Rio de Janeiro: Instituto Liberal, 1995.
____.MediaoWHRULDHSUiWLFD*XLDSDUDXWLOL]DGRUHVHSURVVLRQDLV.
Lisboa: Agora Publicaes, 2001.
WARAT, Luis Alberto. Surfando na pororoca: ofcio do mediador.
MEZZAROBA, Orides; DAL RI JNIOR, Arno; ROVER, Aires Jos; e
MONTEIRO, Cludia Servilha. Florianpolis: Fundao Boiteux, 2004.
WATANABE, Kazuo. A mentalidade e os meios alternativos de soluomRGHFRQLWRVQR%UDVLO. In: Mediao e gerenciamento do processo: revoluo na prestao jurisdicional: guia prtico para a instalao do setor de conciliao e mediao. GRINOVER, Ada Pellegrini;
WATANABE, Kazuo; e LAGRASTA NETO, Caetano (coord.). So
Paulo: Atlas, 2008.

135

DIREITO E MSICA:
Dois caminhos e um s rumo1
Carla Eugenia Caldas Barros2
Resumo
Neste artigo, encantamentos e revelaes so abordados, em que se
colocam, frente a frente, a histria da msica e da histria do direito,
procurando-se uma sensibilidade nica. O fato que, se os seus caminhos so diferentes, o curso apenas um, porque aquele em que
diferentes metodologias so misturados com coerncias e imaginao,
colocando em paralelo, de um lado, o d, r, mi, f, sol, la, si e, de
outro lado, as evolues de conhecimentos e doutrinas jurdicas ao
longo do tempo. Em ambos, os emaranhados de idias, sons e sussurros
de vida culturalizada, explorados pelos seres humanos desde os primrdios at os tempos.
Palavras-chave: Msica e direito; Histria do direito e da msica; interpretaes metafricas.
Abstract
In this article, incantations and revelations are approached, in that is
put, in front to front, musics history and laws history, seeking unique
sensitivity. The fact is that, if their paths are different, the course is
only one, because is one in which different methodologies are mixed
with coherences and imagination, putting in parallel, on one side, the
do, re, mi, fa, sol, la, si and, on the other, the evolutions of knowledges
and legal doctrines over time. In both, the tangles of ideas, sounds and
whispers of life culturalized, exploited by humans since beginnings to
contemporary times.
Keywords: Music and right, History of music and right, metaphorical
interpretations.
1

Artigo elaborado com base na leitura da obra de Mnica Sette Lopes, Uma metfora: a msica e direito, publicada pela LTr Editora, So Paulo, 2006.
Professora da graduao e do mestrado em Direito da Universidade Federal de
Sergipe.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Mnica Sette Lopes observa que sua obra Uma metfora: msiFDHGLUHLWRIRLUHVXOWDGRGHXPDLQVLJQLFkQFLDHGHXPDPHWifora de Paulo Ribeiro Vilhena, a de que Savigny era o Bach do
direito. At que ponto possvel uma s inteligncia sobre o
direito e a msica, sobretudo quanto ao que tange os desenvolvimentos normativos e interpretativos que lhes dizem respeito, ao longo da histria? Respaldando-se em Merleau-Ponty,
a autora pondera que tais trnsitos, decerto, se restrinjam ao
exerccio de sinestesia, um exerccio da possibilidade de experimentar diversamente as impresses produzidas por duas fontes to incisivas da realidade humana3, em que se vislumbram
os impactos e as misturas de sensaes.

O Direito e a msica despontariam, ento, como inveno ou como


impulso para a reinveno da vida4, uma vez que o trnsito nas complexidades da msica e do direito suscitaria o espao e o tempo como
frutos da vocao e das revelaes criativas. A msica ordenaria em si
mesma o tempo, conjugando o som e o silncio. O direito, por sua vez,
certamente, organizaria e reconstruiria o tempo espao como sociais,
uma vez que seria possvel entend-lo, nos termos de Roland de Gand,
como forma social temporalmente estendida5.
No entendimento de Mnica Sette Lopes, a palavra interpretao
o elo entre direito e msica. Se, de um lado, subsiste a distino interpretativa entre msica e direito, h, de outro, uma consonncia integrativa na vocao de ambos para a expresso e na conexo com o
social pela interao com as coisas da vida6.
A autora, remetendo-se Antiguidade, busca a compreenso do relacionamento entre os seres no mundo, porque, no Ocidente, seu ponto
de maior expresso se originou entre os gregos. Segundo seus termos,
QHOHVDFRPSRVLomRPtWLFDOHYDjPDQLIHVWDomRSRpWLFDHHVWDjORVRD
como fonte de pensamento organizado7$VVLPRVSULPHLURVOyVRIRV
como os primeiros sons produzidos pelo homem, estariam ligados natureza que lhes era possvel experimentar, de onde surgiriam os primeiros
3
4
5
6
7

LTr, 2006, p. 13 (destaque no original).


Ibidem, p. 15.
Ibidem, p. 16.
Ibidem, p. 20.
Ibidem, p. 23.

138

Carla Eugenia Caldas Barros

instrumentos musicais e os ensaios para o entendimento da vida e da morte8. Destaca, nesse empenho, o deus grego Hermes, deus do comrcio,
dos ladres, mas tambm smbolo do intrprete. Ele ps as cordas de tripa no casco da tartaruga e produziu a lira o que permitiria a idia de que
a interpretao implica um trnsito gil por vrias passagens da vida9.
Sem dvida, interpretar diz respeito relao harmonia-desarmonia, j vez que envolve os processos de contextualizaes, descontextualizaes e recontextualizaes contnuas no tempo e no espao. Certamente, no dvida que a lei, numa anteviso de equilbrio-desequilbrio, distribui-organiza os valores absorvidos dos fatos e dos interesses
que em relao a eles se dispem, segundo critrios de apropriao que
devem avaliar desigualdades e antagonismos 10.
Dignas de nota so duas consideraes da autora. A primeira considera: a msica organiza-se segundo uma diviso de tempo e de espao:
RVODSVRVGHGXUDomRGRVVRQVHGDVSDXVDVHDHVSHFtFDSRVLomRGH
cada som-nota em relao a um determinado conjunto de notas. Ento,
a harmonia transitaria entre equilbrios e desequilbrios, submetendo-se
verso do intrprete que reelabora o seu sentido, que retoma, remonta a sincronia de sua diviso original11.
A segunda assevera: no direito, a norma submete-se verso do
intrprete que desloca o eixo da abstrao para a seara da concretude e
busca reencontrar as matrizes de tutela que a impregnaram na distribuio de medidas de interesse e de poder12. 2VIDWRVSXOVDULDPQDGHQLo de seu sentido jurdico, a partir da sentena, lugar em que a norma
GHQHRVFRQWRUQRVGHXPDVLWXDomRMXUtGLFDLQGLYLGXDOL]DGDHUHWRUQD
DRPRPHQWRGDGLYLVmRQXPDUHYLYHVFrQFLDGRFRQLWRRULJLQDO
Ressalta Mnica Sette Lopes que os gregos consideravam a msica
como fora voltada educao do homem e de seus espritos. Plato,
em A repblica, atentar-se-ia para essa questo, observando que ela
leva os indivduos a cumprir seu papel nos limites de suas aptides
e das necessidades da Cidade13, o que permite falar em sua conexo
FRPDLGpLDGHMXVWLoD(QPDP~VLFDWHULDXPDSRVLomRDPELYDOHQWH
8
9
10
11
12
13

Ibidem, idem.
Ibidem, p. 25-27.
Ibidem, p. 27 (destaques no original).
Ibidem, p. 28 (destaque no original).
Ibidem, idem.
Ibidem, p. 31.

139

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

no que tange justia, uma vez que, sendo a correta, ela moldaria a
alma dos homens de forma a que exercessem na cidade aquilo para que
seus espritos fossem talhados, inserindo-se no ponto de equilbrio conformador do justo14. Em contraponto, a msica imprpria seria fator
instabilizador das relaes, que implicaria a vigncia da injustia.
Aristteles, por seu lado, em A poltica, consideraria a msica como imitao dos sentimentos morais, na expresso de Lon
Duguit, isso com base, segundo o mesmo doutrinador, nas diferenas
intrnsecas na natureza dos diferentes acordes15. Por sinal, Aristteles
WHULD LGHQWLFDGR RXWUD SHUVSHFWLYD SDUD P~VLFD YLVXDOL]DQGRD WDPbm como apenas instrumento de prazer.
O fato que, com tempo, a msica perderia sua natureza puramente educativa, assumindo caractersticas plenamente pragmticas, como
mera diverso. Essa foi a conotao mais evidente com que a msica se
introduziu no mundo romano. Entretanto, ela no perderia, de todo, sua
natureza subjetiva. Pondera a autora que, entre dogma e zettica que
se podem observar as incurses do direito e da msica em Roma, a partir de suas conexes com os fenmenos que lhes eram contemporneos
e de suas projees para o futuro16.
Adiante, ressalta que a frmula, como repositrio concreto do poder disciplinador dos pretores e como manifestao de sua competncia
para dizer qual era o direito, um exemplo da expresso oral e recorre a Assier-Andrieu, para quem formular prescrever os limites das
aes humanas, estabelecer os marcos, no seio desses marcos, dar o
ritmo, marcar o compasso17.
Dessa forma, ela sinaliza para a permanncia no tempo da relao
entre direito e msica, quando aponta a questo da oralidade, uma
vez que essa oralidade nos remete relao entre hermenutica discursiva do direito e a interpretao sonora da msica. Ela destaca:
D WUDGLomR URPDQD SHOD IRUPXODomR RUDO GR SUHWRU LQXHQFLRX D
nomenclatura jurdica num intrincado jogo de aes ligadas ao soar
da justia, representando uma atuao em que a voz concreta do caso
tinha muita importncia18.
14
15
16
17
18

Ibidem, idem.
Ibidem, p. 32.
Ibidem, p. 37 (destaques no original).
Ibidem, idem.
Ibidem, idem.

140

Carla Eugenia Caldas Barros

Quase no apagar das luzes da Antiguidade, surgiu Santo Agostinho,


FRPREHPUHVVDOWD0{QLFD6HWWH/RSHVRDUWtFHGDLGHRORJLDFDWyOLFD
que marcou longo tempo da Idade Mdia e que interveio na formulao da msica e na consecuo do direito19. Defendia que o princpio
da justia e a msica deveriam estar a servio da vontade divina. Por
conseguinte, o religioso, enquanto recomendava aos indivduos cuidaGRVFRPDEHOH]DHRSRGHUGLVVLSDGRUGDP~VLFDSDUDTXHQmRFDVVHP
prisioneiros deles, ponderava que a justia no estaria, segundo Cabral
de Moncada, na natureza das coisas, nem na razo, nem na idia platnica, PDVXQLFDPHQWHQDYRQWDGHGLYLQD-XVWRpVLPSOHVPHQWHRTXH
Deus quer e s porque o quer 20.
&RQVRDQWHjDXWRUDDLQGDTXHDLQWHUSUHWDomRFRQVLJQDVVHLQXrQcia tcnica pertinente s fontes jurdicas clssicas, o texto religioso tinha
como antecedente necessrio o fato de trazer em seu contedo as verdades
da f 21. Em suma, a msica na Idade Mdia deveria ecoar como Deus
dizia, o mesmo ocorrendo com as leis, pois Deus moldava as palavras e
SURGX]LDDVSURYDVDWUDYpVGRVEHQHFLDGRVSHODJUDoDGHVXDHVFROKD
Chegando-se ao Renascimento, marcado pela redescoberta e valorizao da denominada Antiguidade Clssica, produziram-se rupturas
H[SUHVVLYDVTXHSHUPLWLUDPRDSDUHFLPHQWRGHYiULDVFRUUHQWHVORVyFDV HQWUH HODV R +XPDQLVPR R$QWURSRFHQWULVPR R 5DFLRQDOLVPR
e at as primeiras manifestaes hedonistas, que teria, no Marqus de
Sade (1740-1814), sua mais radical expresso. O fato que a retomada da cultura greco-romana, alterou a relao sagrado-natural, voltando o homem cena central das preocupaes. A esses fatores se soma
o avano da Cincia, que se desvinculou do dogmatismo religioso,
apoiando-se no instrumentalismo iniciado por Galileu.
vlido lembrar que o incio da Idade Moderna, tanto na msica
quanto no direito, foi marcado por profundas transformaes normaWLYDVHLQWHUSUHWDWLYDVHPRGLFRXLQFOXVLYHVHXVOFL. A pretendida
ordem do mundo e a natureza das coisas passaram a ser entendidas
no como frutos de um querer divino arbitrrio e inacessvel, mas
de sua prpria racionalidade, nica e inarredvel, o que, at mesmo,
validaria junto aos homens o poder soberano dos reis absolutos, dos
eleitos divinos, da hierarquia poltico-religiosa etc. De certo modo,
19
20
21

Ibidem, p. 39.
Ibidem, 39-40 (destaques no original).
Ibidem, p. 40 (destaques no original).

141

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

SRGHVHGL]HU'HXVHPYH]GRLQH[SOLFiYHOSDVVRXDSHUVRQLFDUD
prpria razo possvel aos homens e, por conseguinte, a justia aplicvel a eles e ao mundo.
Ento, a palavra, aquela que agente de justia, e sua interpretao emanariam no mais dos desgnios de Deus, para que os homens
a dissessem, mas dos prprios homens para que se dirigissem a Deus.
A piedade, que, a rigor, a devoo religiosa, deixa de ser um ato de
obedincia vontade divina, para ser ato de humilde aproximao
H JORULFDomR D 'HXV$ 5HIRUPD p TXH Gi PDLV FRQFUHWXGH D HVVH
aspecto. Lutero traduziu a Bblia no para que os homens apenas a
DWHQGHVVHPFRPPDLVHFiFLDPDVHVSHFLDOPHQWHSDUDTXHHOHVWDPbm a interpretassem e alcanassem a palavra com que pudessem
dirigir-se a Deus.
Situao semelhante ocorreu com a msica sacra. Com o advento
da Igreja Luterana, a msica, como a palavra, deixou de ser entendida como obra de motivao divina, tornando-se motivao do homem
SDUDGLULJLUVHD'HXV,VVRVHFRQVWDWDVHPGLFXOGDGHVHPYLVWDGRV
rgos de inmeras igrejas alems, onde, quinhentos anos atrs, Reincken, Bhn, Buxtehude e, sem dvida, Bach executaram composies
que at hoje surpreendem e elevam o esprito humano.
H, ainda, as Grandes Navegaes expandiram o mundo conhecido
pelos europeus, impondo, de um lado, novas concepes de territrio
e de domnio e promovendo, de outro, o crescimento dos centros urbanos, o que possibilitou focos centralizadores de poder que se sobrepuseram antiga organizao poltica medieval.
3DUD0{QLFD6HWWH/RSHVD[DomRGRVKRPHQVQDVFLGDGHVHR
aparecimento de focos centralizadores de poder promoveram o fortalecimento de uma ordem normativa que se expressou na lei ou no direito da cidade, consolidando a idia de um direito comum. Ademais,
segundo ela, os msicos inseriram-se nas atividades da cidade que
se desenvolviam e assumiram nelas funes pblicas. Ao tempo em
que exerciam papel importante durante as cerimnias e festividades
religiosas e laicas, tambm se ocupavam de outras funes, como a
de vigia, que inclua o toque de instrumento para anunciar incndio ou
a chegada de viajantes 22.
Essa poca mostra homens que ansiavam por segurana, face s
complexidades de um mundo que se tornava diferente, a caminho da
22

Ibidem, p. 61.

142

Carla Eugenia Caldas Barros

Modernidade. Como bem diz a autora, com vistas a essa segurana,


surgem tendncias para harmonizar e uniformizar os regramentos pertiQHQWHVDRGLUHLWRHjP~VLFD$PERVUHHWLULDPGHIRUPDSDUDOHODTXDQdo no conjunta, um ir e vir que seriam parcerias com os fatos, cujos
compassos seriam ditados pelo tempo. A Renascena foi profcua em
JUDQGHV REUDV FULDWLYDV UHH[R GD OLEHUGDGH TXH SDVVDYD D UHLQDU
QRV (VWDGRV FRP UHH[RV SURIXQGRV QDV REUDV GRV FRPSRVLWRUHV
nesse perodo que a dicotomia entre compositores e intrpretes se
consolidaria na msica. Quanto ao texto cravado na lei, diz a autora
TXHVHXVLQWpUSUHWHVVHULDPRVTXHRGHFRGLFDVVHPGHVFHUUDQGRR
para a vida concreta, citando como exemplos os advogados, os juzes
e os prprios destinatrios das normas23.
Uma das caractersticas do Renascimento, importante a quase reiterao, diz respeito s mudanas nas relaes do homem consigo mesmo
e com o mundo, passando ele a interpretar tudo ao seu redor em funo de si mesmo. Isso, no entanto, no teria contribudo para afast-lo
de Deus, uma vez que suas atividades continuaram destinadas aceitao de Deus, mas, com um novo requisito, o de serem acessveis e
agradveis a eles prprios, os homens. Em vista disso, a Reforma e a
&RQWUD5HIRUPDQmRVyGLYLGLUDPDIpPDVWDPEpPLQXHQFLDUDPGH
forma determinante, a msica e a teoria jurdica. Em suma, Grotius, um
jurista, e Lutero, que foi, inicialmente, sacerdote agostiniano, defenderam idias favorveis simplicidade das formas de propagao do
pensamento e da religiosidade, tornando-os acessveis a todos. Lutero
no s traduziu a Bblia para o alemo, mas tornou essa lngua comum
nas assemblias religiosas, em substituio ao latim. A ponte entre o
Barroco e o Racionalismo persistiria, em sede do direito, na evidncia
da exacerbada busca, pelo homem da poca, da certeza e da segurana.
Resolver-se-ia a inquietao da alma humana quando todos, indistintamente, fossem libertos por uma mesma lei24.
Com extrema maestria, a autora nos declina que o Absolutismo francs levou a natureza do direito msica. O poder, que era to presente
e to marcante na sociedade da poca, teria sua reproduo na msica:
o cantor de pera, pois, seria absoluto em seu espao para expressar a
liberdade. Para Carpeaux, diria o cantor: La musique cest moi!25.
23
24
25

Ibidem, p. 62-63.
Ibidem, 73-74.
Ibidem, p. 80.

143

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Os instrumentistas representariam, to-somente, o povo escondido nas


penumbras dos acordes e dos fatos da sociedade, embora guardassem
a verdade nos sons que produziam. Telemann e Bach representavam
vrios mundos em um s mundo, com vrios personagens contrapostos.
Buscaram sempre o novo em suas investigaes e miscigenaes de
possibilidades, pretendendo sempre uma harmonia nova e paradoxal.
Importa ressaltar que, apesar disso, os dois seguiram trilhas diferentes
e, em vista disso, esbarram-se em fronteiras diferentes, mas revelaram
a sua poca complexidades e possibilidades das profundas divergncias
que marcaram um s tempo e um s espao26.
Montesquieu, em O Esprito das leis, teria pensado o direito, concebendo-o como a dinmica de uma fuga bachiana. Bach, ao compor
suas msicas, desenvolvendo-se em idas e vindas, em pontos e contrapontos, prima-se na diversidade e na dinmica das vozes, ao construir-lhes harmonias, e no na inalterabilidade do mundo27.
O direito posto s aceito, se encontra condies favorveis para
a construo de uma base slida de referncia e de controle. Como
EHPDUPDDDXWRUDDOHLSDVVRXDVHUXPDSDODYUDPiJLFDDOJRTXH
diz, que dispe, que reza, na verso popularesca da expresso jurdica.
Quando a lei reza, ela revive e reescalona a mstica28.
A lei culminaria, ento, em ser no s a apresentao, mas tambm a
referncia da liberdade, enquanto o contrato seria a exteriorizao, o registro das vontades comuns, do querer de um, de outro e de todos. Antes,
QR&ODVVLFLVPRRGLUHLWRHDP~VLFDWHULDPUHJLVWUDGRRXUHHWLGRWRGDV
as ambivalncias do perodo. Em vista disso, todos deveriam entender a
linguagem, o que seria o instrumento modelador da regra, da norma, bem
FRPRGDP~VLFDGHYHQGRHVVDVHUXQLYHUVDOQmRVyQDGHVFRGLFDomR
GDOLQJXDJHPHVSHFtFDSDUDDJHUDOPDVWDPEpPDWUDYpVGHOD9ROWDD
DXWRUDQHVVHSRQWRDRSUREOHPDGDLQWHUSUHWDomRDRDUPDUTXHFRQVtruiu-se ento uma jaula mtrica para a msica e para a compreenso
do direito. O fato da vida e a posio do intrprete foram sensivelmente
afetados por esta tendncia a uma excessiva racionalizao29.
Como nos faz ver Mnica Sette Lopes, o inesperado sempre traz
surpresas e a idia esttica de que o direito s se conhece na lei se miti26
27
28
29

Ibidem, p. 82-83.
Ibidem, p. 83.
Ibidem, p. 86.
Ibidem, p. 87-89.

144

Carla Eugenia Caldas Barros

gou numa racionalizao quase inconteste, quando a realidade ftica j


apresentava outros meios de interpretao, impregnados de rudos, sons
GLVWLQWRVDRRXYLGRGRS~EOLFR(VSHFLFDPHQWHQDP~VLFDRIXQFLRnal deu lugar idia da arte pela arte e ela veio acompanhada de uma
especializao. A diferena existe: o ouvido do pblico que d rumo
a ela (Roland Cand) 30(QPpRKRPHPURPkQWLFRTXHSDVVDULDD
entender o esprito do povo e, ao mesmo tempo, a dimenso, o espao
do direito. Conseguiria aliar, unir a funo interpretativa, da msica e
do direito, em sua pessoa.
25RPDQWLVPRIRLRSHUtRGRGDDUPDomRGDVUDt]HVGRVLQGLYtGXRV
como nacionais. Certamente, no por outras razes, consolidaram-se
como Estados a Alemanha e a Itlia. Para Sette Lopes, os resgates dos
WHPSRVKLVWyULFRVWHULDPVHXVUHH[RVQDVLVWHPDWL]DomRGDVRULJHQV
Eis que o sonho romntico do presente vertia-se sobre as razes formadoras das tradies no direito e na msica. Seria no esprito do povo
que se atualizava o direito romano e se restabeleciam as memrias tradicionais e nacionalistas da msica31.
3RSXODUL]DQGRVHDP~VLFDXPDQRYDJXUDJDQKDULDGHVWDTXHD
do crtico musical, que passaria a exercer o papel de ponte entre o autor
e o pblico. Vigoraria, no sculo XIX, uma preocupao exacerbada
com a compreenso do que se divulgava. Isso impunha a necessidade
de explicaes sucessivas dos experts e, certamente, s vezes tambm
dos prprios autores, que se viam obrigados a sarem de seus hermetismos e entregarem-se ao pblico32.
Quanto ao problema central da interpretao, explica Mnica Sette
Lopes que o texto no seria idntico obra, vontade originria que
o gerou, ainda que se fale de partitura onde as marcaes pressupem
DLGHQWLFDomRGHXPDPHVPDOLQJXDJHPGHVLJQRVRXTXHVHIDOHGH
FyGLJRVHPTXHDVUHDOLGDGHVFRQRWDGDVMXULGLFDPHQWHXQLFDPVHQXP
sistema ou ainda dos conceitos, com que se procura reduzir os campos
de apreenso jurdica33.
(QPDSDUWLWXUDGHYHULDVHUDOJRIRUDGHODFDSD]GHFRQYHUWHU-se em som, retumbando seu contedo. Ela precisa de mos que toquem, de vozes que cantem, de ouvidos que ouam. Assim tambm a
30
31
32
33

Ibidem, p. 94.
Ibidem, p. 96.
Ibidem, p. 97-98.
Ibidem, p. 98.

145

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

norma s se realiza no encontro com a vida e com os ouvidos abertos


do intrprete34.
1RVpFXOR;,;QRWDDDXWRUDRVFRQLWRVXUEDQRVIRUDPH[SUHVV}HV
das angstias das lutas de classes e, tambm, da alma humana, projetandoVH 0DU[ H )UHXG FRPR JXUDV HPLQHQWHV GD pSRFD FLUFXQVWkQFLDV TXH
PXLWRLQXHQFLDUDPRVHQWHQGLPHQWRV&RPLVVRDYLGDGRGLUHLWRGHLxou o locus seguro do dogmatismo e ganhou a cena polivalente, mltipla,
valorativa do realismo sociolgico, psicolgico e lingstico 35. Como ela
UHVVDOWDDGLDQWHGHQLURVHQWLPHQWRMXUtGLFRQDSHUVSHFWLYDGHWRGRV
os momentos de criao normativa, seria um labirinto em que o operador
do direito mergulharia, uma vez que o psiquismo do juiz e do legislador
passou a ser absorvido com dado relevante na arquitetura do direito36.
O outro marco importante do sculo XIX foi o aparecimento do Positivismo, considerando como motor exclusivo da evoluo humana o cientiFLVPRRTXHDIHWRXRVDEHUMXUtGLFRGDpSRFDTXHSDVVDULDVHUHQWHQGLGR
como fruto dos mesmos mecanismos e instrumentos das Cincias Naturais.
Teria sido nesse perodo que se forjaram a Teoria Geral do Direito e as
vertentes dos positivismos, que tentavam consolidar, com seu dogmatismo,
as aquisies do tempo, a includa a contribuio do intrprete37.
No que se refere msica, a autora recorre a Jerome Frank, que se
atentou para as sinalizaes nas pautas musicais, que indicam nveis
de sonoridade, pretendendo-se nortes interpretativos. No caso, piano,
pianssimo, forte so algumas das inmeras referncias que podem ser
feitas. Atendo-se ainda a Jerome Frank, acrescenta: O realista americano pergunta-se, ento, como deveria ser tocada a lei e ele mesmo
responde: Play it with tenderness. Ela deve ser tocada suavemente38.
4XDQWRjVDQomRREVHUYDTXHHODpPDLVGRTXHDGHQLomRGHXP
Q~PHURRXGHXPYDORUQmRHVWiUHGX]LGDDXPDPHUDTXDQWLFDomR
uma vez que ela representa um elo ou um corte no processo de soluo
GR FRQLWR H LVWR agrega ou desagrega sob o prisma das partes e da
FRPXQLGDGHLQWHLUD$VDQomRVHULDHQPUHVXOWDGRGHXPDDWXDomR
contnua que no se resolve num ato nico39.
34
35
36
37
38
39

Ibidem, p. 99.
Ibidem, idem.
Ibidem, p. 100.
Ibidem, p. 102.
Ibidem, p. 103.
Ibidem, idem.

146

Carla Eugenia Caldas Barros

No sculo XX, marcado por grandes transformaes e incertezas, a


msica mais representaria um elo entre os fatos sociais dos perodos em
que elas surgiam. O fato que, ao longo desse sculo, a arte, ao desnudar a vida em praa pblica, teria promovido a idia de que tudo pode
estar disponvel e permitido. Por outro lado, a excessiva valorizao
GRFRQKHFLPHQWRHGRPHUFDGRUHHWLULDRDQVHLRKXPDQRSRUQRYRV
conceitos e novas maneiras de viver, implicando rupturas, busca do imprevisvel e inteiramente novo e, por conseguinte, novos parmetros
reguladores da vida pessoal e da coletiva.
No otimismo exacerbado do incio do sculo XX, percebe-se claraPHQWHRSUHGRPtQLRGDLGpLDGHTXHRSDVVDGRWLQKDTXHFDUULJRURVDmente, no passado, para permitir-se o inteiramente novo. Mnica Sette
Lopes apresenta, como representantes desse aspecto do incio do sculo
XX, Schoenberg, na msica, e Kelsen, no direito, ressaltando que eles
podem explicar muito do brilho inovador de pessoas que levaram seu
talento para a pesquisa e para perscrut-lo de novas faixas da vida em
vrias reas de expresso da criatividade humana40.
E acrescenta: Em Schoenberg e em Kelsen sobressaa a extrema
inclinao para uma abstrao minuciosa na base do conhecimento e
da expresso em suas respectivas reas, sempre fundados num rigor
que se sintonizava com o aprofundamento de suas composies41.
No entendimento de Mnica Sette Lopes, a tnica dos dois autores
IRL R ULJRU WpFQLFR $ WpFQLFD SHOD WpFQLFD DUPD (PLOLR %HWWL
citado pela autora42.
Por conseguinte, seria a perfeio tcnica a perspectiva perseguida
por Kelsen para explicar o direito. Adotando, em sua anlise, pureza
e perfeio metodolgica idnticas de Schoenberg na msica, teria
ele pretendido afastar, do direito, elementos intervenientes. Teria desenvolvido, ento, uma crtica s snteses em que se inseriam mtodos do
conhecimento e de inteleco jurdica exticos, seguindo padres estranhos natureza do direito. Aponta, todavia, que imprpria a idia de
que as posies de Kelsen e Schoenberg teriam sido premeditadas, uma
vez que suas propostas, respectivamente para o direito e para a msica,
seriam meros sinais dos tempos43.
40
41
42
43

Ibidem, p. 107.
Ibidem, idem.
Ibidem, p. 108.
Ibidem, 109-110.

147

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

A propsito, observa ainda que direito e msica amoldaram-se nos


anos da implantao nazista ao programa da autoridade. Por conseguinte, a msica e o direito teriam se tornado instrumentos de despotismo
e subjugao. Com isso, os termos escravizar e dominar assumiriam
uma acepo muito mais rudimentar do que as montagens tericas da
FRQFHSomRPDU[LVWDTXHRVGHQHFRPRIHQ{PHQRVYLQFXODGRVDRPRGR
de produo vigorante em cada tempo. Conclui a autora: No sistema
em que o poder tem um dono que mata percebe-se a fragilidade das noes de beleza (para a msica) e de Justia (para o direito) e, devido a
isso, a funcionalidade exacerba-se com vistas a sustentar o processo de
destruio e de extermnio a servio dos interesses dos que tem voz44.
Toma como exemplo, ento, a atual guerra no Iraque: nos capacetes dos jovens soldados americanos [...] ecoa um rock pesado que os
deixa nutridos de rancor para guerra. uma carga de violncia auditiva
que integra sua rao diria de alimento. E vale-se de observao de
Mrio de Andrade sobre a Segunda Guerra Mundial, cuja transcrio
valiosa: Mas que nunca o texto decide o valor das msicas polticas,
s por si. Ele s importa virilizado em melodia. O canto de guerra,
doloroso dizer, se inclui no gnero dos cantos de trabalho, pois so os
trabalhos da guerra que ele ajuda a levar. E a dinmica mais vibrante da
msica que decide45.
Admite-se uma distino entre msica popular e msica sria ou
HQWUHP~VLFDSRSXODUHP~VLFDHUXGLWDLQFOXVLYHVXDVUDPLFDo}HVWDLV
como atonalismo, dodecafonismo, experimentalismo, bolero, tango, rap
etc. Do mesmo modo, admissvel falar em direito vivo e direito erudito,
sem distingui-los, no entanto, segundo graus de qualidade. Pondera a autora: H um direito praticado e um direito srio e no se pode desprezar
esta face confusa do real (destaque no original). Portanto, teoria pura,
tridimensionalismo, retrica, tpica, linguagem, comunicao, sistema,
analogia so eixos de compreenso do direito no sculo XX, os quais
transitam entre si e recompem outras verses presas ao passado46.
1R%UDVLOHVSHFLFDPHQWHDWUDGLomRVHULDPDUFDGDSRUXPDIRUWH
tendncia miscigenao, em que experincias exticas seriam semSUHLQWURGX]LGDVHDVVLPLODGDVSDFLFDPHQWH(PGHFRUUrQFLDGLVVR
SDUDDDXWRUDVHDLPSODQWDomRGHXPDWHRULDFRQVWLWXLXPDGLFXOGD44
45
46

Ibidem, p. 112.
Ibidem, idem.
Ibidem, p. 114.

148

Carla Eugenia Caldas Barros

de geral para o conhecimento do direito, no caso brasileiro ela se torna mais avassaladora porque a composio do conhecimento no se
molda a partir da vivncia problemtica interna, mas pela apropriao
do produto da erudio montada sob angulao cultural e histrica
inteiramente diversa47.
&RPREHPDUPD0{QLFD6HWWH/RSHVRGLUHLWREUDVLOHLURLQYHVWH-se num universalismo que no pode produzir, uma vez que lhe falta
a circunstncia do espao-tempoHPTXHRVFRQLWRVDSDUHFHPHVmR
UHVROYLGRV RX QmR  VRE R HVSHFLDO UHH[R GH VXD WHVVLWXUD KLVWyULFD
(destaque no original). Destarte, conforme assegura a autora, o brasileiro recebe os elementos europeus, tanto na msica quanto no direito,
para reelabor-los. O fato que a tcnica e a teoria jurdica possuem
a condio de outros, so como frestas esquivas de uma realidade
apenas parcialmente arrostada48.
J se referindo atualidade, Mnica Sette Lopes atenta para os
despropsitos da denominada sociedade de consumo: O acesso
justia deixa de ser um instrumento de controle formalmente engendrado e se instala no varejo. A funcionalidade do direito tambm
DGHUH DR FRQVXPR  &RPR D P~VLFD R GLUHLWR HVWDULD FRQJXUDGR
como produto da indstria cultural, no mais importando, portanto,
VXDVXEVWkQFLDPDVDYLDELOLGDGHGRUHWRUQRQDQFHLURRTXHOKHGiD
FRQRWDomRGHPHUDPHUFDGRULD(QPRS~EOLFRpDSHQDVRRXWURODGR
das expectativas de venda 49.
Acrescenta que, na interpretao do direito, h o que se aceita e
h o que se esconde50. E h outros aspectos relevantes. Um deles o
da votao das leis, que atende o embate de foras representativas dos
vrios interesses antagnicos e no, certamente, as aspiraes da naomR2XWURpDH[LELOLGDGHGDOHLRXQRVWHUPRVGDDXWRUDVXDiUHDGH
PRELOLGDGHHQRUPHSDUDTXHHODWHQKDXPDHFiFLDPtQLPD(FRQWLnua: No bom falar que a recuperao do fato no processo constitui
uma fonte de incertezas. No bom falar que os tribunais tm histria e
que ela interfere no modo como administram seus servios. No bom
admitir que se possa encalhar no meio do caminho 51.
47
48
49
50
51

Ibidem, idem.
Ibidem, p. 115.
Ibidem, p. 119.
Ibidem, idem.
Ibidem, idem.

149

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Ressaltando que a indstria cultural impe a imitao da


imitao52, vale-se de um artigo de Caio Blinder, na revista Bravo,
para apontar o processo judicial como um espetculo, registrando a
descrio do jornalista sobre o arrebatamento de um canal de televiso
norte-americano, que transcendia larga o interesse de apenas informar, diante da possibilidade de serem transmitidos dois julgamentos
de grande repercusso: o de Michael Jackson e o de Saddam Hussein.
Em suma, mais valeriam a aparncia e a disperso visual que a
substncia, levando a importncia do fato e da arte ser consonante a
suas repercusses pblicas. Isso implicaria a prescindibilidade do
conhecimento adequado, pois a audincia no daqueles que sabem, mas simplesmente dos que vem, daqueles que se colocam
passivamente como senhores da inrcia que lhes reserva apenas a
plena aptido para o consumo53.

PEQUENO PSFCIO
A vida precisa de harmonizao e uma das formas de alcan-la,
lastreada em A repblica, de Plato, fundamenta-se na idia de que as
pessoas deveriam ser educadas para o uso da msica certa e da ginstica certa para que desenvolvessem suas aptides. Dizia Plato, que a
educao pela msica capital, porque o ritmo e a harmonia penetram
fundo na alma e afetam-na mais fortemente, trazendo consigo a perfeio e tornando aquela perfeita, se houver sido educado?
Essa idia platnica no deixa de estar relacionada ao objetivo
de dar a conhecer o direito pela msica. Em muitas oportunidades, a
msica utilizada como instrumento para se alcanar a justia. vlido considerar que a experincia musical no uma nota isolada,
mas as relaes harmnicas entre notas, pausas, silncio e ritmos
estabelecidos ao longo do trabalho do compositor. Ipsis literis, podemos ter essa mesma concluso em relao ao direito. Ele no surge e
nem feito de um nico momento. Para chegar a aplicao efetiva da
-XVWLoDTXHpRPPDLRUGRGLUHLWRHWDSDVH[LVWHPGHQWURGHXP
mesmo fenmeno.
52
53

Ibidem, p. 120.
Ibidem, p. 121.

150

Carla Eugenia Caldas Barros

Diz Monica Sette Lopes, em Imagens da justia54, que a palavra na


dimenso, s vezes, potica da expresso musical, portanto, vetor das
VHQVDo}HV DSHUFHSomRGRLPDJLQiULRFROHWLYR HPWRUQRGRVFRQLWRV
e constitui modo de interpretar a vida tal como faz o direito.
2HQVLQRMXUtGLFRQDYHUVmRGHVWLQDGDjIRUPDomRGHSURVVLRQDLV
deve considerar o marco epistemolgico de difuso do conhecimento
como uma questo essencial. No existe espao somente para questes
meramente conceituais. Logo, o ensino jurdico precisa ceder espao
a novas leituras, novos olhares, novos saberes, para a visibilidade de
vrios campos da ao humana, para a conquista de seus objetivos.
Como diz ainda Monica Sette Lopes, preciso formar os alunos
para diversidade e para a mobilidade com a qual se d a realizao da
esfera dogmtica, que apenas uma das linhas conformadoras do direito, ainda que seja um ponto insupervel55.
7XGR VLJQLFD TXH GHYHPRV ODQoDU PmR GRV YiULRV LQVWUXPHQWRV
facilitadores do processo aprendizagem, atravs de recursos variados.
$P~VLFDEUDVLOHLUDHPHVSHFLDOpIpUWLOHPSHUVRQLFDURFRWLGLDQR
os fatos do momento e, por isso, um manancial da expresso humana
em seus mais variados tons. A msica um veculo para a apresentao
do direito como uma instituio, como uma realidade.
2UiGLRVHPG~YLGDpXPPHLRGHFRPXQLFDomRHFD]TXHDWLQJH
as almas. E, muitas vezes, compe um ambiente de forma mais amena
GRTXHRXWURVPHLRVGHFRPXQLFDomRRTXHSHUPLWHGHIRUPDHFD]
no apenas a difuso da informao, mas sua assimilao e a to necessria produo do conhecimento, em outras palavras, fazer a inteligncia sobre a informao transmitida. Sintonizar o direito nas ondas do
rdio um modo de faz-lo soar, de faz-lo dispersar-se naturalmente
e ao acaso, de faz-lo entrar nos ouvidos das pessoas como algo que
pertence a todos e se faz por todos56, diz Mnica Sette Lopes.
^
0{QLFD6HWWH/RSHVpPLQHLUDWHPGRXWRUDGRHP)LORVRDGR'LUHLWRp
professora de graduao e de ps-graduao da Faculdade de Direito da
8)0*RQGHOHFLRQD+LVWyULDH)LORVRDGR'LUHLWRH7HRULDGR0pWRGR
Jurdico. Estuda violo e canto e juza titular da 12 Vara do Trabalho
54
55
56

LTr, 2010, p. 176.


Ibidem, p. 179.
LTr, 2006, p. 142.

151

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

de Belo Horizonte Publicou outras obras como: A conveno coletiva e


sua fora vinculante (LTR, 1998), A equidade e os poderes do juiz (Del
Rey, 1993) e Imagens da Justia (LTR, 2010), alm de vrios artigos.
O estudo da obra em que se fundamentou este artigo integra a
atividade de extenso aprovado pelo PIBIX, da graduao e do
mestrado em Direito da UFS, desenvolvida pela autora deste artigo, intitulada Direito na msica, em parceria com o Ncleo
de Msica da UFS, coordenado pelo prof. Christian Lisboa.

152

Mrcio Granconato

O PACTO DE NO-CONCORRNCIA NO
DIREITO DO TRABALHO PORTUGUS
Mrcio Granconato1
Resumo:
A liberdade de trabalho essencial ao Direito do Trabalho e a clusula
de no-concorrncia prevista no Cdigo do Trabalho de Portugal uma
forma vlida de se opor a ela. Tal oposio deve ser feita com base nos
parmetros contidos no artigo 136. desse texto legal, observando-se
requisitos como a durao temporal razovel da abstinncia, a forma
escrita e o pagamento de indenizao compensatria ao trabalhador.
Uma vez descumprida a clusula pelo empregador, o empregado estar
livre para trabalhar na concorrncia; caso o trabalhador a desrespeite,
ento dever devolver a indenizao recebida e ainda poder ser condenado a ressarcir os prejuzos que causou.
Palavras-chave: Liberdade de trabalho. Clusula de no-concorrncia.
Abstract:
Freedom to work is essential to the Labor Law and the clause of non-competition provision in the Labor Code of Portugal is a valid way to oppose
it. Such opposition should be based on parameters contained in article 136
of that statute, observing requirements like reasonable length of time of
abstinence, writing form and payment of compensatory damages to the employee. Once breached the clause by the employer, the employee is free to
works in competition; if the employee disregards, then should return the
award and can be ordered to make reparation for the damage of he caused.
Keywords: Freedom of work. Clause of non-competition.
1

Juiz do Trabalho Titular da Vara do Trabalho de Itaquaquecetuba/SP; Ps-graduado em Direito do Trabalho pela FMU/SP; Mestre em Direito do Trabalho pela PUC/
SP; Especialista em Direito do Trabalho pela Faculdade de Direito da Universidade
de Lisboa (Instituto de Direito do Trabalho), Portugal; aluno do Curso de DoctoraGR6REUH(VWXGLRVGH'HUHFKRV6RFLDOHV3DUD0DJLVWUDGRVGH7UDEDMRGH%UDVLO,
promovido pela 8QLYHUVLGDGGH&DVWLOOD/D0DQFKD, Espanha, em parceria com a
ANAMATRA Associao Nacional dos Magistrados Trabalhistas; Coordenador e
Professor do Curso de Ps-Graduao em Direito e Processo do Trabalho da Escola
Paulista de Direito EPD, em So Paulo.

153

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

1. INTRODUO
A liberdade de trabalho resultado de grandes lutas sociais ocorridas nos sculos passados e ainda hoje causa preocupao, porque a escravido e muitas outras formas de opresso do capital sobre o trabalho
sobrevivem apesar de tantos avanos obtidos nesse campo.
Essa liberdade um dos fundamentos do Direito do Trabalho. Sem
ela, tal ramo do Direito no existiria ou subsistiria com expressivas diFXOGDGHVHOLPLWDo}HVeSRULVVRTXHTXDOTXHUDPHDoDGLULJLGDFRQWUD
ela deve ser cuidadosamente avaliada. Em ltima anlise, seu desresSHLWRSRGHS{UHPULVFRDHFiFLDGR'LUHLWRGR7UDEDOKRHDVVLPD
existncia digna em sociedade.
Dentro desse contexto, a anlise das clusulas de limitao da liberdade de trabalho, de que so espcie os pactos de no-concorrncia
TXH DTXL VHUmR DERUGDGRV DJXUDVH GH JUDQGH LPSRUWkQFLD SDUD D
sociedade em geral e em especial para o jurista. Ajustes dessa natureza podem representar um golpe liberdade de trabalho e causar
desequilbrios de tal monta que importariam num retrocesso social de
conseqncias incalculveis.
A Consolidao das Leis do Trabalho silencia sobre a matria e isso
maximiza a utilizao do direito estrangeiro na abordagem do tema2,
tornando o estudo aqui proposto de grande relevncia para a resoluo
de questes trabalhistas nacionais dessa natureza.
com vistas nesse objetivo que ser analisado o pacto de no-concorrncia na forma prevista pelo art. 136. do Cdigo do Trabalho
de Portugal, cujo texto foi recentemente revisto pela Lei n. 7, de 12
de fevereiro de 2009. A abordagem do assunto ser feita com base na
legislao portuguesa e sempre que se julgar pertinente haver remisVmRjVQRUPDVOHJDLVQDFLRQDLVDPGHTXHHVWHWUDEDOKRVHMDRPDLV
proveitoso possvel.

 2DUWGD&/7GLVS}HRVHJXLQWH$VDXWRULGDGHVDGPLQLVWUDWLYDVHD-XVWLoDGR
Trabalho, na falta de disposies legais ou contratuais, decidiro, conforme o caso,
SHODMXULVSUXGrQFLDSRUDQDORJLDSRUHTLGDGHHRXWURVSULQFtSLRVHQRUPDVJHUDLV
de direito, principalmente do direito do trabalho, e, ainda, de acordo com os usos
e costumes, o direito comparado, mas sempre de maneira que nenhum interesse
de classe ou particular prevalea sobre o interesse pblico. Pargrafo nico - O
GLUHLWRFRPXPVHUiIRQWHVXEVLGLiULDGRGLUHLWRGRWUDEDOKRQDTXLORHPTXHQmRIRU
incompatvel com os princpios fundamentais deste.

154

Mrcio Granconato

2. A LIBERDADE DE TRABALHO
Durante muito tempo o trabalho foi visto como algo degradante e
afeto a escravos e a pessoas de baixa classe social. Expresses como
tripaliare e lavoro, de onde advm as palavras trabalho e labor, respectivamente, davam-lhe a conotao de sofrimento e fadiga. Tambm
nomes como operarius e proletarius LPSULPLDPXPVLJQLFDGRGHJUDGDQWHjJXUDGRWUDEDOKDGRU
Para a sociedade moderna, porm, o trabalho um bem necessrio e til, pois significa progresso econmico, cientfico e social
e, portanto, mais riqueza e bem-estar. O desenvolvimento dos povos trouxe consigo a necessria valorizao do trabalho humano.
Um dos pilares que sustenta a valorizao do trabalho a liberdade. O trabalhador moderno acima de tudo um homem livre
para contratar, apesar de sua inseparvel necessidade econmica.
De fato, a liberdade chega a ser a pea chave de todo o Direito do
Trabalho e no se limita apenas contratao, mas tambm a outros
aspectos da vida da relao laboral. Assim que so invlidos os
pactos pelos quais o trabalhador se compromete a trabalhar de forma
vitalcia e, por outro lado, detm poderes para extinguir seu contrato
de trabalho a qualquer momento.
No por outro motivo que a Constituio da Repblica Portuguesa, em seu art. 47., n. 1, dispe que WRGRVWrPRGLUHLWRGHHVFROKHU
OLYUHPHQWH D SURVVmR RX R JpQHUR GH WUDEDOKR VDOYDV DV UHVWULo}HV
legais impostas pelo interesse colectivo ou inerentes sua prpria capacidade 3. Essa regra consagra o princpio da liberdade de trabalho e
complementada pelo art. 136., n. 1, do Cdigo do Trabalho de Portugal, de acordo com o qual pQXODDFOiXVXODGHFRQWUDWRGHWUDEDOKR
3

Seguindo esse mesmo objetivo, o art. 58. da Constituio Portuguesa trata do direito ao trabalho nos seguintes termos:
7RGRVWrPGLUHLWRDRWUDEDOKR
2. Para assegurar o direito ao trabalho, incumbe ao Estado promover:
a) A execuo de polticas de pleno emprego;
E $LJXDOGDGHGHRSRUWXQLGDGHVQDHVFROKDGDSURVVmRRXJpQHURGHWUDEDOKR
e condies para que no seja vedado ou limitado, em funo do sexo, o acesso a
TXDLVTXHUFDUJRVWUDEDOKRRXFDWHJRULDVSURVVLRQDLV
F $IRUPDomRFXOWXUDOHWpFQLFDHDYDORUL]DomRSURVVLRQDOGRVWUDEDOKDGRUHV

155

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

ou de instrumento de regulamentao colectiva de trabalho que, por


qualquer forma, possa prejudicar o exerccio da liberdade de trabalho
aps a cessao do contrato.
( QHVVH SRQWR D &RQVWLWXLomR GR %UDVLO QmR FD DWUiV H DSRQWD R
seguinte em seu art. 5., XIII: livre o exerccio de qualquer trabalho,
RItFLRRXSURVVmRDWHQGLGDVDVTXDOLFDo}HVSURVVLRQDLVTXHDOHL
estabelecer. E mais: o texto constitucional brasileiro ainda reza que o
trabalho um direito social protegido e d vrias garantias ao trabalhador visando melhoria da sua condio (artigos 6. e 7.).
Acontece que a liberdade de trabalho, que, como visto, entre seus
muitos desdobramentos, autoriza o empregado a desvincular-se do empregador sempre e como quiser, pode sofrer restries. Na legislao
portuguesa, elas se encontram nos artigos 136. e 137. do Cdigo do
Trabalho4, que tratam, respectivamente, dos pactos de no-concorrncia
e de permanncia. No primeiro caso, o empregado tem sua atividade
laboral cerceada aps o trmino do contrato, como ser estudado mais
DGLDQWH QR VHJXQGR HOH FD REULJDGR D SUHVWDU VHUYLoRV DR VHX HPpregador durante certo prazo. Tambm a doutrina fala na possibilidade
existir ajustes prevendo a prestao de servios exclusivos a um dado
empregador: so os chamados pactos de exclusividade.
Para o desenvolvimento deste trabalho interessa o estudo dos pactos
de no-concorrncia, cuja previso legal, como j foi dito antes, est
contida no art. 136. do Cdigo do Trabalho de Portugal.

KWdKEKKEKZZE/WZs/^dK
NO CDIGO DO TRABALHO DE PORTUGAL
O pacto de no-concorrncia uma forma de limitao da liberdade
de trabalho que est inserida no art. 136. do Cdigo do Trabalho Portugus nos seguintes termos:
4

O art. 138. do Cdigo do Trabalho de Portugal ainda dispe que nulo qualquer
acordo entre empregadores no sentido de limitar a admisso de trabalhadores que a
eles tenham prestado servio, assegurando assim tambm a liberdade de trabalho.
Veja-se o texto legal: nulo o acordo entre empregadores, nomeadamente em
FOiXVXODGHFRQWUDWRGHXWLOL]DomRGHWUDEDOKRWHPSRUiULRTXHSURtEDDDGPLVVmR
de trabalhador que a eles preste ou tenha prestado trabalho, bem como obrigue, em
caso de admisso, ao pagamento de uma indemnizao.

156

Mrcio Granconato

1 nula a clusula de contrato de trabalho e de instrumento


de regulamentao colectiva de trabalho que, por qualquer forma,
possa prejudicar o exerccio da liberdade de trabalho aps a cessao do contrato.
2 lcita a limitao da actividade do trabalhador durante o
perodo mximo de dois anos subsequentes cessao do contrato de trabalho, nas seguintes condies:
a) Constar de acordo escrito, nomeadamente de contrato de trabalho ou de revogao deste;
b) Tratar-se de actividade cujo exerccio possa causar prejuzo
ao empregador;
c) Atribuir ao trabalhador, durante o perodo de limitao da
actividade, uma compensao que pode ser reduzida equitativamente quando o empregador tiver realizado despesas avultadas
FRPDVXDIRUPDomRSURVVLRQDO
3 Em caso de despedimento declarado ilcito ou de resoluo
com justa causa pelo trabalhador com fundamento em acto ilcito do empregador, a compensao a que se refere a alnea c) do
nmero anterior elevada at ao valor da retribuio base data
da cessao do contrato, sob pena de no poder ser invocada a limitao da actividade prevista na clusula de no concorrncia.
4 So deduzidas do montante da compensao referida no
nmero anterior as importncias auferidas pelo trabalhador no
H[HUFtFLRGHRXWUDDFWLYLGDGHSURVVLRQDOLQLFLDGDDSyVDFHVVDo do contrato de trabalho, at ao valor decorrente da aplicao
da alnea c) do n. 2.
5 Tratando-se de trabalhador afecto ao exerccio de activiGDGHFXMDQDWXUH]DVXSRQKDHVSHFLDOUHODomRGHFRQDQoDRX
com acesso a informao particularmente sensvel no plano
da concorrncia, a limitao a que se refere o n. 2 pode durar
at trs anos.

Como se v, a norma em questo autoriza a ocorrncia de um ajuste


que impede o trabalhador de exercer de forma irrestrita sua liberdade de
WUDEDOKRFRPSHQVDQGRRQDQFHLUDPHQWHSRULVVR
A doutrina portuguesa majoritria aponta que esse tipo de pacto
no viola o art. 47. da Constituio de Portugal, porque to somenWHFULDXPDUHVWULomRWUDQVLWyULDHMXVWLFDGDjOLEHUGDGHGHWUDEDOKRH
HVFROKDGHSURVVmRID]HQGRRGHIRUPDUHODWLYDQDPHGLGDHPTXH
157

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

nada impede que o trabalhador atue em outra atividade, que exera sua
SURVVmRHPHPSUHVDTXHQmRVHMDFRQFRUUHQWHGHVHXH[HPSUHJDGRU
ou desvincule-se do ajuste desde que promova a correspondente compensao dos prejuzos que causar5.
E o que autoriza essa restrio provisria e relativa a possibilidade
de o ex-empregado vir a causar prejuzos ao antigo empregador devido aos
conhecimentos adquiridos na poca de vigncia do contrato de trabalho.
Em tais casos, o trabalhador pode vir a ser no apenas um aliado da concorrncia, mas um aliado privilegiado em razo das informaes que possui.
No exame de validade dessa espcie de clusula, como no poderia
deixar de ser, necessrio se faz avaliar a sua conformidade com a lei,
sempre com vistas na razoabilidade que deve orientar o intrprete. o
que ser feito a seguir, ressaltando-se desde j que todas as condies
do art. 136., n. 2, do Cdigo do Trabalho so cumulativas.


O prazo de durao do pacto de no-concorrncia previsto na legislao portuguesa de dois anos, contados aps a cessao do contrato
de trabalho, seja qual for a sua causa.
A norma em comento aceita que esse ajuste seja por tempo maior
nos casos em que a atividade do empregado exija uma relao de
FRQDQoDDFLPDGDTXHODFRPXPEHPFRPRQDVKLSyWHVHVHPTXHR
trabalhador se encontre investido de uma funo que lhe d acesso
a informaes especiais e que possam colocar em risco de maior
extenso o negcio do antigo empregador frente concorrncia (art.
136., n. 5).
A validade dessa estipulao pode sofrer ataques nos casos em que
h desproporo entre o tempo de durao do contrato de trabalho e o
de abstinncia, ainda que respeitado o prazo legal. So casos como o
5

Isso ocorreria nos termos do art. 81., n. 2, do Cdigo Civil de Portugal:


$UW /LPLWDomRYROXQWiULDGRVGLUHLWRVGHSHUVRQDOLGDGH 
7RGDDOLPLWDomRYROXQWiULDDRH[HUFtFLRGRVGLUHLWRVGHSHUVRQDOLGDGHpQXOD
VHIRUFRQWUiULDDRVSULQFtSLRVGDRUGHPS~EOLFD
$OLPLWDomRYROXQWiULDTXDQGROHJDOpVHPSUHUHYRJiYHODLQGDTXHFRPREULJDo de indemnizar os prejuzos causados s legtimas expectativas da outra parte.

158

Mrcio Granconato

do empregado que se vincula ao empregador por apenas alguns meses e


assina um pacto de no-concorrncia de dois anos ou mais6, por exemplo. Nessas hipteses extremas, necessrio se faz um exame acurado
GRFDVRFRQFUHWRDPGHTXHYHULTXHVHKRXYHRXQmRRQHFHVViULR
equilbrio entre as obrigaes das partes contratantes.
Tambm pode ser questionada a validade da clusula em razo da sua
durao nos casos em que o tempo do ajuste ultrapassa o mximo legal,
como na hiptese de o trabalhador se obrigar a uma inatividade permanente. Essa espcie de clusula impediria a recolocao do empregado, tendo
em vista sua formao e experincia, atentando contra a liberdade de trabalho. Para esses casos, o Cdigo do Trabalho tem uma sada bastante razoYHOTXHLPSRUWDQDDSOLFDomRGHVHXDUWGHDFRUGRFRPRTXDOFDULD
restabelecido o prazo de dois anos (ou de trs, se for ocaso) autorizado7.

D
O Cdigo do Trabalho permite que o pacto de no-concorrncia
YHQKDDVHUUPDGRQRLQtFLRQDYLJrQFLDRXQDFHVVDomRGRFRQtrato de trabalho, mas sempre de forma escrita (art. 136., n. 2, a)).
2VDMXVWHVUPDGRVQRPRPHQWRGDFHOHEUDomRGRFRQWUDWRGHWUDbalho merecem maior cuidado no exame de sua validade. De fato, na
admisso o trabalhador muitas vezes tem sua capacidade negocial reduzida ou at suprimida, de tal modo que aceita qualquer tipo de clusula que lhe apresentada para obter o novo emprego. Nesses casos
possvel que o empregador estabelea regras menos favorveis ao
6

Analisando este aspecto do art. 21.2 do Estatuto de los Trabajadores espanhol, que
trata da absteno competitiva ps-contratual, assim se posicionam Carlos Molero
Manglano et ali: puede constituir abuso de derecho el extender la obligacin de
QRFRPSHWrQFLDSRUXQDGXUDFLyQVXSHULRUDODGHOSUySLRFRQWUDWRGHOTXHWUDHVX
FDXVD 676-GH&DWDOXxDGHGHRFWXEUHGH \UHVSHFWRDXQFRQWUDWRHYHWXDO
GHPHVHVFRQSDFWRGHDxRV 676GHGHQRYLHPEUHGH (in Manual de
Derecho del Trabajo, Thonsom Civitas, 2007, p. 330).
Art. 121. (Invalidade parcial de contrato de trabalho)
1 A nulidade ou a anulao parcial no determina a invalidade de todo o contrato de trabalho, salvo quando se mostre que este no teria sido celebrado sem a
parte viciada.
$FOiXVXODGHFRQWUDWRGHWUDEDOKRTXHYLROHQRUPDLPSHUDWLYDFRQVLGHUDVH
substituda por esta.

159

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

empregado, de sorte que no basta apenas o consentimento deste para


a validade da clusula, mas tambm a anlise das condies em que ela
IRLUPDGDHVHKRXYHDQHFHVViULDSURSRUomRHQWUHDVREULJDo}HVGDV
partes contratantes.
-iTXDQGRDFOiXVXODpUPDGDGXUDQWHDVXDYLJrQFLDRXQDFHVVDo do contrato os problemas diminuem e se restringem na maioria dos
casos abordagem que envolve o preenchimento dos demais requisitos
previstos em lei.
Como dito acima, a lei ainda exige que o pacto de no-concorrncia
seja feito por escrito. Trata-se de uma forma prevista em lei e que deve
ser observada sob pena de nulidade do ajuste.
Com efeito, a exigncia legal de que a clusula de no-concorrncia
tenha forma escrita sugere mais do que num primeiro momento possa
SDUHFHU(VVHUHTXLVLWRWHPHQWUHWDQWDVRXWUDVQDOLGDGHVRREMHWLYRGH
assegurar ao empregado os reais contornos do ajuste, deixando-o a par
do alcance da obrigao a que se comprometeu.
por isso que essa clusula deve fazer meno expressa quantia
devida na resciso contratual a ttulo de compensao pelo perodo de
OLPLWDomRGDDWLYLGDGH RXDRPHQRVFRQWHUFULWpULRVSDUDVXD[DomR 
ao prazo de sua durao, s atividades proibidas e tudo o mais que for
necessrio para que o pactuado possa vir a ser compreendido e cumprido pelas partes sem quaisquer dvidas.
Omitir essas informaes e deix-las em aberto, para serem decididas unilateralmente pelo empregador, como normalmente ocorre em
casos semelhantes, importaria em verdadeiro desequilbrio na relao
contratual, causaria uma vinculao independentemente da contrapartida e, assim, omitiria elementos essenciais validade do ajuste. No
possvel deixar a execuo do acordo ao arbtrio de uma das partes,
ainda mais quando ela a economicamente mais forte.

W
O pacto de no-concorrncia um modo de impedir eventual atividade concorrencial que o ex-empregado queira desenvolver, de forma
autnoma ou por conta alheia, aps o trmino do contrato de trabalho.
Essa atividade concorrencial impedida porque poder causar danos ao antigo patro, danos esses eminentemente econmicos e que po-

160

Mrcio Granconato

dem ocorrer por desvio da clientela, utilizao de conhecimentos tcnicos, divulgao dos planos empresariais futuros, etc.
Em razo do que foi visto no pargrafo anterior, a restrio da atividade do trabalhador a toda e qualquer regio somente admissvel
quando esse tambm seja o mbito de atuao do antigo empregador. Se
os concorrentes esto em todo lugar, ento se autoriza a restrio ampla;
FDVRHOHVVHOLPLWHPDXPHVSDoRJHRJUiFRUHGX]LGRHQWmRpHYLGHQWH
TXHDHVWHWDPEpPFDUiDGVWULWDDHFiFLDGRDMXVWH(QWHQGHUGHIRUPD
diferente importaria em subverso da verdadeira inteno da norma legal
e, assim em verdadeiro atentado liberdade de trabalho consagrada na
Constituio de Portugal (e Brasileira) e no prprio Cdigo do Trabalho.
Outro ponto que merece destaque que o Cdigo do Trabalho
no exige que os danos ocorram. O art. 136., n. 2, b), fala em
atividade que possa causar prejuzo ao ex-empregador, ou seja, o
importante que haja a probabilidade de ocorrncia do dano caso o
trabalho seja realizado na concorrncia, por conta prpria ou alheia.
Assim, a possibilidade de dano, ainda que sem a sua caracterizao,
MipVXFLHQWHSDUDTXHDFOiXVXODGDQmRFRQFRUUrQFLDVHMDYiOLGDH
possa ser acionada uma vez violada.
Da se extrai que no so todos os tipos de atividades junto ao concorrente que podem ser proibidas, mas apenas aquelas que possam causar prejuzos ao anterior empregador. Nada impediria um vendedor, por
exemplo, de passar a atuar como mecnico de uma empresa concorrente, porque nesse caso no haveria, em tese, possibilidade de prejuzo: as
empresas concorrem entre si, mas o empregado atua em setor no qual
no pode causar prejuzos em razo dos conhecimentos que adquiriu
junto antiga entidade patronal.
Em suma, para que esse possvel prejuzo venha a surgir, basta que
o ex-empregado se coloque numa situao de poder caus-lo, seja presWDQGRDVXDDWLYLGDGHSURVVLRQDOGHIRUPDDXW{QRPDQRPHVPRUDPR
de atividade da antiga entidade patronal, seja por trabalhar numa funo
relevante junto a uma empresa que detm interesse direto na implementao e desenvolvimento de atividade econmica concorrente com a
exercida pelo anterior empregador.
eVyDVVLPTXHRSDFWRGHQmRFRQFRUUrQFLDVHMXVWLFDFDVRFRQWUiULRVXD[DomRQmRWHUiIXQGDPHQWRFDSD]GHVXVWHQWiORHQmRSDVsar de um capricho do empregador, insustentvel frente liberdade de
trabalho consagrada no texto constitucional e mesmo no caput do art.
136. do Cdigo do Trabalho.
161

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe


Outro requisito exigido para a validade do pacto de no-concorrnFLDFRUUHVSRQGHj[DomRGHXPDFRPSHQVDomRQDQFHLUDDRHPSUHJDdo durante o perodo de limitao de sua atividade.
Entre todos os requisitos listados pelo Cdigo do Trabalho, talvez
HVVH VHMD R GH PDLRU LPSRUWkQFLD H R TXH PHOKRU MXVWLTXH D UHVWULo liberdade de trabalho imposta pelo pacto de no-concorrncia.
que por meio dessa compensao que tem natureza indenizatria
o empregado encontra um meio de subsistncia durante o perodo
de limitao de sua atividade. Presume-se que o trabalhador mais
EHPUHPXQHUDGRTXDQGRDWXDHPVXDSURVVmRHGHQWURGRUDPRHP
que detm experincia, de tal forma que o pacto de no-concorrncia
traz consigo outro nus que precisa ser compensado, que a provvel
diminuio de rendimentos. Da, pois, a relevncia desse valor a ser
pago por ocasio do rompimento do contrato de trabalho, sendo certo
que o montante devido poder ser satisfeito de uma nica vez ou em
prestaes, dependendo do ajuste.
Como j foi visto no subitem 3.2 supra, o valor dessa quantia ou a
frmula para sua apurao deve estar expressamente previsto no pacto
de no-concorrncia. E tanto isso verdade, que o art. 136., n. 2, c),
do Cdigo do Trabalho prev a possibilidade de uma reduo equitativa
dessa quantia quando o empregador houver despendido grandes somas
FRPDIRUPDomRSURVVLRQDOGRH[HPSUHJDGR2UDFRPRVHULDSRVVtvel estabelecer uma reduo equitativa de um valor desconhecido?
bvio, portanto, que esse requisito a incluso do valor da compensao devida ou de critrios para seu clculo imprescindvel para a
validade do ajuste8. No outra a opinio de Rita Canas da Silva9, que
merece transcrio in verbis:

Nesse sentido tambm a doutrina espanhola: Respecto a la cuanta de dicha compensacin, que es indemnizatoria (no cotiza a Seguridade Social pero tributa) y
QRVDODULDOpVWDKDGHVHUMDGDHQHOPRPHQWRGHOSDFWRRELHQVHxDODUHQpVWH
claramente los mdulos necesarios para su concrecin posterior. Una absoluta indeterminacin en esta matria conducira a la nulidade del pacto ab origine, sin
que fuera posible una subsanacin posterior por l rgano jurisdiccional, mediante
un pronunciamiento constitutivo. (Carlos Molero Manglano et ali, Manual de Derecho del Trabajo, Thonsom Civitas, 2007, p. 329).
O pacto de no concorrncia, Revista de Direito e de Estudos Sociais, n. 4.

162

Mrcio Granconato

A falta de estipulao do montante compensatrio determina a


nulidade do pacto, uma vez que a compensao e, em concreto, o seu montante ou o critrio de determinao elemento
essencial do acordo.
3HOD LQFHUWH]D FULDGD TXDQWR DR IXWXUR SURVVLRQDO GR WUDEDlhador e indeterminao das conseqncias que uma deciso
de desvinculao poderia acarretar, consideramos duvidosa a
admissibilidade de pactos que prevejam uma obrigao de no
concorrncia ps-contratual caso tal venha a ser determinado
pelo empregador, sujeitos, portanto, a condio unicamente dependente da vontade do empregador, no momento da cessao
do contrato de trabalho. Tambm, neste caso, o empregador alcanaria, sem custos, a limitao da liberdade de desvinculao
do trabalhador na pendncia do contrato de trabalho.
Na ausncia de estipulao expressa, no se pode concluir
que o pagamento de determinado montante, pelo empregador,
em contrapartida de qualquer outro dever assumido pelo trabalhador ou em cumprimento de prestao de outra natureza
pelo empregador (por exemplo, complementao de reforma)
satisfaz este requisito.

Outra questo que precisa ser enfrentada aqui diz respeito ao valor
GDFRPSHQVDomRQDQFHLUDGHYLGDSHORH[HPSUHJDGRU(ODQmRSUHFLVD
corresponder ao salrio recebido pelo empregado no momento da resciso10PDVWDPEpPQmRSRGHWHUXPYDORUtQPRLQFDSD]GHFRPSHQVDU
o prejuzo sofrido com a limitao da atividade. De fato, o valor da
compensao deve guardar proporo entre o perodo de inatividade
previsto no ajuste e o salrio recebido durante a vigncia do contrato de
trabalho, ou seja, deve haver harmonia entre as obrigaes das partes e
o necessrio resguardo da dignidade do trabalhador.
Para que a compensao seja digna, a doutrina revela que um bom
FULWpULRSDUDVXD[DomRHQYROYHSUHVWDomRHTXLYDOHQWHD FLQTHQ10

Tanto verdade que a compensao no precisa corresponder ao salrio do empregado, que o art. 136., n. 3, do Cdigo do Trabalho, reza que no caso de despedimento declarado ilcito ou de resoluo do contrato por justa causa pelo trabalhador,
o montante de compensao elevado at ao equivalente retribuio base devida
no momento da resciso do contrato (observada a previso do n. 4 desse mesmo artigo), sob pena de no poder ser invocada a clusula de no-concorrncia. Por outro
lado, bvio que o valor dessa compensao poder ser maior do que o salrio do
trabalhador, pois assim tambm estaria compensando-o condignamente.

163

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

ta por cento) do valor do salrio mensal por ms de inatividade, referindo-se a exemplos extrados da Alemanha e da Dinamarca, sob pena de
FDUFRPSURPHWLGDDVXEVLVWrQFLDGRH[HPSUHJDGR11.

4. EFEITOS DO DESCUMPRIMENTO DO PACTO


Caso o pacto de no-concorrncia venha a ser descumprido pelo
HPSUHJDGRUTXHSRGHUiID]rORDRGHL[DUGHSDJDUDFRPSHQVDomRnanceira a que se obrigou ou por no aument-la corretamente nos casos de ter dado justa causa para a resciso contratual ou realizar um
despedimento declarado ilcito (art. 136., n. 3, do Cdigo do Trabalho), ento o ex-empregado estar livre para trabalhar em qualquer ouWUDHPSUHVDFRQFRUUHQWHRXQmRHHPTXDOTXHUDWLYLGDGHSURVVLRQDO
Nesses casos, a clusula de no-concorrncia no poder ser invocada.
O ajuizamento de ao judicial por parte do empregado em busca do
restabelecimento de referida clusula tambm poder ocorrer, hiptese
em que a compensao poder ser deferida e o trabalhador dever permanecer obrigado limitao prevista no ajuste inicial. Nada impede,
ainda, que o empregado exija uma reparao alternativa em razo dos
prejuzos sofridos durante o contrato de emprego. Explica-se: em funo de tal clusula o trabalhador muitas vezes se v tolhido na liberdade
 1D6XpFLDHVVHYDORUp[DGRHP VHVVHQWDSRUFHQWR GRVDOiULRSDJRjGDWDGD
cessao do contrato de trabalho. A esse respeito, a doutrina espanhola citada anteriormente tambm se manifesta com grande acerto. Veja-se: Los critrios de refeUHQFLDTXHGHEHQJXLDUDODVSDUWHVHPODMDFLyQGHODFXDQWtDVRQSULQFLSDOPHQWH
HOVDOiULRSHUFLELGRSRUHOHPSOHDGR\ODGXUDFLyQWHPSRUDOGHOSDFWR1RREVWDQWH
ODFRPSHQVDFLyQHFRQyPLFDQRWLHQHSRUTXpWHQHUFRPROtPLWHPtQLPRHOVDOiULRQL
HVWLSXODUVHHQIXQFLyQGHOVDODULREDVH'HEHUiDWHQGHUVHDODVFLUFXQVWDQFLDVFRQcretas del pacto y la limitacin de actividade parcial o absoluta que se establezca en
HOPLVPRWUDWiQGRVHHQWRGRFDVRGHXQDFDQWLGDGGLJQD/DMXULVSUXGHQFLDVLJXH
un criterio de proporcionalidad o equilibrio de intereses, en cuya virtud hay que conjugar la cantidad que se paga en concepto de indemnizacin con otras circunstancias
que puedan ser relevantes, muy especialmente la relacin entre duracin del contrato
y duracin de la obligacin de no competencia; as, se han considerado abusivas las
FOiXVXODVLPSXHVWDVSRUDOJXQDVHPSUHVDVTXHWUDVXQFRQWUDWRHQSUiFWLFDVGHWUHV
PHVHVMDQXQSHUtRGRGHQRFRPSHWHQFLDGHGRVDxRV\FRQFDQWLGDGHVDGHPiVQR
HOHYDGDV 676-GHOD&RPXQLGDG9DOHQFLDQDGHGHRFWXEUHGH (PSULQFLSLR
\FRQPHURFDUiFWHUDSUR[LPDWLYRFDEHVHxDODUTXHXQDFRPSHQVDFLyQTXHHTXLYDOJD
DOSRURPiVGHODUHWULEXFLyQWRWDORDOPHQRVGHODUHWULEXFLyQMDFDEH
considerarla adecuada (Carlos Molero Manglano et ali, Manual de Derecho del
Trabajo, Thonsom Civitas, 2007, pp. 329-330).

11

164

Mrcio Granconato

de escolha de um novo e melhor posto de trabalho durante a vigncia


do contrato de trabalho, de tal sorte que o descumprimento do pacto de
QmRFRQFRUUrQFLDDRQDOIUXVWUDULDXPDDPSODJDPDGHH[SHFWDWLYDV
deixando para trs prejuzos que devem ser reparados.
Caso o empregado venha a desrespeitar o ajuste entabulado com seu
antigo empregador, ento duas conseqncias podero advir: primeiro,
RHPSUHJDGRSRGHUiUHVWLWXLUDFRPSHQVDomRQDQFHLUDTXHUHFHEHXQD
resciso contratual, na medida em que seu pagamento no foi acompanhado da correspondente contrapartida, que dizia respeito inatividade;
segundo, poder haver a reparao dos efetivos prejuzos causados com
a atividade do ex-empregado em situao de concorrncia12.
Como no fcil apurar o valor do prejuzo causado pelo ex-empregado, convm que o pacto de no-concorrncia contenha
clusula penal prevendo o valor devido pelo trabalhador para o caso
de seu descumprimento.
'HIDWRDVLPSOHVGHYROXomRGDFRPSHQVDomRQDQFHLUDUHFHELGD
no faria ressarcimento de qualquer prejuzo sofrido pela empresa e
sequer penalizaria o empregado faltoso. A aplicao do art. 81., n. 2,
do Cdigo Civil de Portugal mostra-se oportuna nesses casos, pois o
LGHDO UHSDUDWyULR LPSRUWD QD GHYROXomR GD FRPSHQVDomR QDQFHLUD H
no pagamento da indenizao correspondente aos prejuzos causados
antiga entidade patronal ou, no lugar desta indenizao, de uma multa
prevista no ajuste.

5. CONCLUSES
1. A Consolidao das Leis do Trabalho no contm dispositivo
que trate do pacto de no-concorrncia, mas seu art. 8. autoriza o
uso do direito estrangeiro nos casos de omisso do legislador. Isso faz
12

O professor Pedro Romano Martinez, da Universidade de Lisboa, acrescenta o seguinte: 'RSDFWRGHQmRFRQFRUUrQFLDQmRGHFRUUHDLQYDOLGDGHGHXPFRQWUDWRGH


trabalho que venha a ser celebrado em sua violao; nos termos gerais, o incumSULPHQWRGRSDFWRGHQmRFRQFRUUrQFLDFRQVWLWXLXPIDFWRJHUDGRUGHUHVSRQVDELOLdade civil contratual em relao ao trabalhador faltoso (arts. 798. e ss. Do CC) e,
eventualmente, de responsabilidade civil delitual com respeito empresa que tiver
FRQWUDWDGR HVVH WUDEDOKDGRU FDVR VH DGPLWD D HFiFLD H[WHUQD GDV REULJDo}HV H
estejam preenchidos os pressupostos da responsabilidade do terceiro cmplice. (in
Direito do Trabalho, Almedina, 2005, pp. 619-620).

165

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

com que o estudo da matria luz do Direito do Trabalho Portugus


ganhe relevncia para a resoluo de questes trabalhistas nacionais
dessa natureza;
2. O pacto de no-concorrncia previsto no art. 136. do Cdigo
do Trabalho de Portugal um meio legtimo de restrio da liberdade
de trabalho. Por meio dele, cria-se uma restrio parcial, transitria e
MXVWLFDGDjOLEHUGDGHGHWUDEDOKRHHVFROKDGHSURVVmR
3. Essa modalidade de ajuste, quando observados os requisitos que
os cercam e critrios de razoabilidade, no ofende a liberdade de trabalho na forma preconizada pela Constituio Federal Portuguesa e,
assim, no abala a estrutura do Direito do Trabalho;
4. Para que essa restrio seja vlida, necessrio que as partes,
como em qualquer negcio jurdico, pactuem-na livremente;
5. Outro requisito de validade diz respeito durao da obrigao
de no trabalhar em atividade concorrente e extenso espacial da
clusula. Ela deve ser proporcional ao tempo de trabalho junto ao ex-empregador, no pode ser pactuada por perodo superior ao permitido
em lei (dois ou trs anos, conforme o caso) e pode alcanar todo lugar
em que estiver a concorrncia;
6. A formalidade mais um item exigido pelo art. 136. do Cdigo
do Trabalho de Portugal para validade do pacto de no-concorrncia. O
ajuste deve ser feito por escrito e conter o maior nmero de informaes
acerca das obrigaes das partes contratantes, sob pena de nulidade;
7. O prejuzo potencial ao ex-empregador condio necessria
SDUD TXH D FOiXVXOD GH QmRFRQFRUUrQFLD VH MXVWLTXH FDVR FRQWUiULR
no passar de um ato atentatrio liberdade de trabalho;
2YDORUGDFRPSHQVDomRQDQFHLUDSHODDEVWLQrQFLDGHYHSHUPLtir a existncia digna do trabalhador. Um critrio razovel seria a sua
[DomRQRLPSRUWHPtQLPRFRUUHVSRQGHQWHDGRVDOiULRPHQVDOSRU
ms de inatividade;
9. Empregador e empregado podem desrespeitar o pacto de noFRQFRUUrQFLD 1R SULPHLUR FDVR R HPSUHJDGR FD GHVREULJDGR GR
cumprimento da clusula, pode exigir o seu cumprimento ou, ainda,
pedir uma compensao por prejuzos sofridos na vigncia do ajuste;
no segundo caso, o empregador pode exigir a devoluo da compenVDomRQDQFHLUDTXHSDJRXHRUHVVDUFLPHQWRGRVSUHMXt]RVTXHVRIUHX
VHQGRTXHHVWDKLSyWHVHDFRQVHOKDD[DomRGHXPDSHQDQRSDFWRGH
no-concorrncia.

166

Mrcio Granconato

6. REFERNCIAS BIBLIOGRFICAS
BARROS, Alice Monteiro de. Curso de direito do trabalho. 2. ed.
rev. amp. So Paulo: LTr, 2006.
FERNANDES, Antonio de Lemos Monteiro. Noes fundamentais de
direito do trabalho. 2. ed. Coimbra: Almedina, 1976.
FERNANDES, Antnio Monteiro. Direito do trabalho. 11. ed. Coimbra: Almedina, 2001.
MANGLANO, Carlos Molero et al. Manual de derecho del trabajo.
7. ed. Navarra: Thomson Civitas, 2007.
MARTINEZ, Jos Antnio. Cdigo do trabalho. Comentrio a todos
os artigos e sua articulao com a legislao anterior. Lisboa: Livros
do Brasil, 2004.
MARTINEZ, Pedro Romano. Direito do trabalho. 4. ed. Coimbra:
Almedina, 2006
MELGAR, Anfredo Montoya. Derecho del trabajo. 28. ed. Madrid:
Tecnos, 2007.
NETO, Ablio. Cdigo do trabalho e legislao conexa anotados.
Coimbra: Coimbra, 2003.
OLIVEIRA, Oris de. A excluso de concorrncia no contrato de emprego. So Paulo: LTr, 2005.
RAMALHO, Maria do Rosrio Palma. Direito do trabalho, partes I e
II. Coimbra: Almedina, 2006.
SILVA, Rita Canas da. O pacto de no concorrncia. Revista de direito
e de estudos sociais. Lisboa: Verbo Postal, n. 4: 283-305, 2004.
XAVIER, Bernardo da Gama Lobo. Curso de direito do trabalho. 2.
ed. atual. Lisboa: Verbo Postal, 2001.

167

THE DEVELOPMENT OF SYNDICALISM IN


BRAZIL AND THE CONVENTION 87 OF THE
ILO CONSTRAINTS AND CHALLENGES1
Otavio Augusto Reis de Sousa2
)DQV+RZOLQ3URWHVWDV-XGJH'HFLGHV;PHQ$UHQW+XPDQ
-XGJH-XGLWK%DU]LOD\KXGGOHGODWHODVW\HDUZLWKDWHOHSDWKLFSURIHVsor and a cast of mutants to ponder an age-old question: What does it
PHDQWREHKXPDQ":DOO6WUHHW-RXUQDO-DQXDU\

1. INTRODUCTION
In order to address the main concern of this brief paper we
choose to start by an enigmatic decision of the U.S. Court of International Trade, in New York, that examined a very sensitive matter:
If the X-men were to be considered human or not, do to their unique
features or abilities.
In the 30 pages decision after six years of litigation it was decided
that they should not be considered humans. The case appears on its
face to be a tax matter, if the plastic artifacts imported from China
were ruled human Toy Biz Inc. one of Marvels subsidiaries would
EHVXEMHFWWRUDWHIRUWR\VLQVWHDGRIWKHLPSRUWGXWLHVIRU
dolls, for the majority of imports during the 1990s, involving substantial amount of money.
The main reason for litigation, the US tariff code, at the time deQHGKXPDQJXUHVDVGROOVZKLOHWR\VZRXOGLPSO\DUHSUHVHQWDWLRQ
of animals or creatures3
In law, creating and enforcing a distinction that chooses between
two different approaches to the same reality is hardly an easy task.
1

Trabaho apresentado no Graduate Seminar inLlaw and Society Law 502, na University of
Victoria ao Prof. Judy Fudge

Professor do Mestrado em Direito da UFS


Wall Street Journal, January 20, 2003 article by Neil King Jr. online:

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

The problem lies on the fact that more often than we would like
ZHQGRXUVHOYHVLQZKDWFDQEHGHVFULEHGDVEOXUUHGERXQGDULHV4.
These blurred boundaries involve the simple but awkward perception
that within the spectrum of colors between White and Black5 one can
QGDQLQQLWHVKDGRZRIJUD\WKDWLVKDUGWRFODVVLI\
The reason we choose the opening quote, as we will see, is deeply attached
to our subject of study in this paper: the trade union movement in Brazil.
To understand the constraints or ways it is shaped by internal law and
to identify points of collision to the convention 87 of the International
Labor Organization (ILO) will be the main concern of this brief essay.
We will not discuss here if Brazil should ratify convention 87, that
will be the essence of our thesis in a future Ph.D. essay. Nor will we
even suggest a broader concept to the idea of freedom of association
than the one endorsed by the ILO6 that is for us clearly narrow. These
two issues will be addressed in a proper form and time, as they demand
a much broader word limit than is aloud in this essay.
To address the two important concerns above, we will draw on the
particular experience in the trade unions that Brazil has. We will also
point out the different paths in which important issues, concerning freedom of association, are up held in Brazilian Labour Law7.
We will suggest during the essay that the unique nature of Brazilian
trade unions can only be understood as a hybrid being, a mutant, but
nevertheless a valid and unique form of trade unionism.

1.1 dhK
Political and Legal Framework.
As the new movie8 in the X-men series, the Brazilian trade unions
are themselves unique creatures9.
Rebecca Johnson. Blurred boundaries: a double-voice dialogue on regulatory regimes and embodied space. Law Text Culture. Vol. 9. 2005.
5
 ,QRSWLFV:KLWHLVGHQHGDV
6
 :HZLOOVWXG\IUHHGRPRIDVVRFLDWLRQDVWKH,/2'LJHVWRIFLDOO\XQGHUVWDQGVLW
7
 :HZLOOVWXG\%UD]LOLDQWUDGHXQLRQVDVDQLQVLGHU:HGHDOZLWKWKHVSHFLFOHJLVlation as a Judge in a Brazilian Labour Court since 1996 and as a University Professor since 1999.
8
Wolverine Origins. In the theatres on May 12009 explains the life of the most
popular X-men Wolverine Who is, for the record, Canadian.
9
We use the term between comas to indicate strong disagreement with the court decision.
4

170

Otavio Augusto Reis de Sousa

To understand the trade union movement in Brazil we have to address the formation of unions and labour law in Brazil10.
Until 1888, while in Europe industrialization was strong and labour
movements and industrial rights were the epicenter of a social and legal
debate, Brazil was still embedded in slavery.
Only in 1888 with the Lei Aurea was slavery banned in permanent term from Brazil after two previous minor attempts11.
In the beginning of the 20th century Brazil could hardly be described
as a industrialized country.
The reality at the time was a country struggling to get free from a
GHSHQGHQF\RQDVLQJOHDJULFXOWXUDOJRRGUVWVXJDUFDQHWKDQFRIIHH
In this framework President Getulio Vargas in the 1930s rose to
power with a populist discourse, proclaiming himself the father of
the poor. In 1937, through revolution, the dictatorship of Vargas was
implemented. Vargas amended the Constitution and shuttled down the
congress, giving him-self power to legislate.
Precisely in 1942, the Brazilian version of a labour code (CLT)12
was published, being in effect from 1943.
It is important to stress that the CLT is still the basic legal norm in
Brazilian labour system, with some adjustments made by the new Brazilian constitution of 1988.
The legal system designed by the internal law (CLT) to address
trade unions was as restrict as it could be. This is because it followed
WKHXQGHQLDEOHSHUFHSWLRQRIWKHLQKHUHQWFRQLFWEHWZHHQDQHIIHFWLYH
syndicalism and a dictatorship of the right wing.
One of many curious turns of the design system, since nationalism
was emphasized at the time, was that the right to strike was forbidden,
10

11

12

The historic background draws on Irany Ferrari e Amauri Mascaro Nascimento


Histria do Trabalho,Q+LVWyULDGR7UDEDOKRGR'LUHLWRGR7UDEDOKRHGD-XVWLa do Trabalho. (So Paulo: LTr, 1998); Otvio Augusto Reis de Sousa: Nova Teoria Geral do Direito do Trabalho. (So Paulo: LTR., 2002) 1- e Direito e Processo do
Trabalho. (Rio de Janeiro: Forense, 2008); Mozart Victor Russomano. Princpios
Gerais de Direito Sindical. Rio de Janeiro, Forense, 1997; Francisco Antonio de
Oliveira, Who is Singing LInternationale Again? A Brazilian Illustration (London:
Boaventura de Sousa Santos ed., 2004) 321-351.
Previous legislation liberate slaves older than 60 years old and newborns, with no
social effect.
The Consolidation of Labour Law is not a code in the true meaning but a systematic
reunion of the most important norms at that time(1943), with few innovations, but
LWODFNVWKHIRUPDOFRPSOH[LW\DQGLQWHUQDOFRKHUHQFHRIDFRGLFDWLRQ

171

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

by article 27 of the Constitution of 1937 as an anti-social manifestation.


The trade unions had to be previously recognized by the State Authority
through the Ministry of Labor, Industry and Commerce. The recognition act was completely discretionary.
,QDGGLWLRQDVHWRINH\SULQFLSOHVZDVHVWDEOLVKHGUVWZRUNHUV
could only have one union in the same geographic base and the base
could not be smaller than a municipality; second the unions would
be sustained by an indirect state contribution, obtained by taxation of 1
day of salary of each worker in Brazil in March of each year that was
divided among unions, federations and confederations recognized by
state; third the labour issues that the worker as employers failed to
resolve were subject to compulsory judicial arbitration.
7KHUVWUHGHPRFUDWL]DWLRQRI%UD]LOZDVLPSOHPHQWHGLQDIter Vargas left power, but until today Brazil relies on the same basic
industrial law, the CLT.
In the 1970s, as with much of the South American countries, Brazil
was again a dictatorship. However, the major point for Brazil was with
the new Constitution of 1988, which once again re-democratize Brazil,
and successfully cut off part of the State intervention over trade unions.
Substantial changes were implemented, the most relevant was the
possibility of the existence of trade unions without the need of the State
compliance and authorization, according to article 8 from Brazilian
Constitution.13 The same provision proscribes State intervention or dissolution of trade unions, revoking the contrary provisions of the CLT.
The right to strike is explicitly recognize by article 9 of the constitution and regulated afterward by the Law 7889/89.
Despite important legislative changes, the norms regarding trade
unions in Brazil still collide with convention 87 of the ILO.

1. 2. ^&
Considering the legal and political framework discussed above, it
is important to stress that unionization was a sociological endeavor and
that the evolution regarding labour law and therefore was one of its most
LPSRUWDQWDVSHFWVIUHHGRPRIDVVRFLDWLRQLVWLHGWRWKHZD\WKHVSHFLF
country industrialized and internalized the capitalist mode of production.
13

Article 8:

172

Otavio Augusto Reis de Sousa

One concept has to be made clear, wage labour14 is a capitalist reality created by the industrial revolution and re-enforced by the law
on a daily basis and not, as ideology sometimes suggests a universal
concept, therefore it evolved differently in each country and culture15.
Unionism, as a social process, is typical of the industrial revolution
and the perception of the existence of class struggle. Capitalism was
structured over three main ideas: generalized production of commodiWLHVSURGXFWLRQRIFRPPRGLWLHVIRUSURWDQGZDJHODERXU16.
The third is wage labour and in order to make it possible capitalists
deprived the worker from propriety, since the enclosure of land in England, but through a process of primitive accumulation that is still an
on going process in the developing countries. The modern form it takes
in our days in Brazil is privatization. In essence, the violence is inherent
of capitalism and necessary to extract and concentrate private propriety
with the capitalists and oppressing the majority of population that are
deprived and are forced to sell the only commodity they have, labour,
in order to be included in the economy.17
Wage labour is the visible face of labour as a commodity, and if
14

15

16

17

The usual form associated as wage labour is the employment relation that can not be
confused with work. Despite the fact that during the 20th century employment has
come to be treated as synonym for work, these terms are not equivalent. EmployPHQWLVDPHUHVXEVHWRIWKHEURDGHUGRPDLQRIZRUNLWHPHUJHGDVDVSHFLFOHJDO
category in England in the 19th century to specify the rights and obligations that comprised a bilateral labour market contract. Work, by contrast, captures a much broader
range of productive activity, including the labour of small independent producers and
women in the household Judy Fudge and Eric Tucker. Law, Industrial Relations
and the State. Pluralism or Fragmentation? The Twentieth-Century Employment Law
Regime in Canada in Labour/Le Travail, 46, (Fall 2000), 251/306 at 251.
Ulrich Bech, A thousand Worlds of Insecure Work LQ%UDYH1HZ:RUOG(Cambridge:
2000) 92-109 . Talk of Brazilianization sets aside any assumption that the establishment of the western work society (omissis)is a universal process. For industrialization does not stipulate any particular social or political accompaniment; neither
the structure of income and employment, nor the mobility and regulation of labour,
nor the organization of interest, has to be of a certain kind for the industrialization
SURFHVVWRRFFXU5DWKHUWKHVHDVSHFWVZLOOGHSHQGXSRQWKHVSHFLFFXOWXUDOFRQGLtions and the actors involved The article draw on the so called brazilianization
of Europe, in reverse euro-centrism, denied by the author. The cultural premises are
ZHOOIRXQGHGGHVSLWHWKHXQGHQLDEOHSUHMXGLFHLQWKHZD\WKHDQDO\VHVRZDQGWKH
LPSRUWDQWREMHFWLRQWKDWPRVWRIOEUD]LOLDQODZVUHJDUGLQJH[LELOLW\RYHULQGXVWULDO
relations were copied from european norms, particularly from spain.
Alfredo Saad-Filho, Anti-Capitalism a Marxist Introduction (London, Pluto
Press, 2003) 30.
See

173

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

capitalism is based upon the primitive accumulation by dispossession,


even Marxist ideas, of the distinction between free and unfree labour
would have inevitable shortcomings.
7KHUVWDQWHFHGHQWVRIXQLRQLVPLQ%UD]LORFFXUUHGLQE\WKH
so-called Ligas Operarias de Socorros Mutuos (Multiple Assistance
Workers Gatherings) but since then real development has started, after
WKHHQGRIVODYHU\E\XQLRQVRIDJULFXOWXUDOZRUNHUV7KHUVWRIWKHVH
was legally recognized in 190318. This led to a natural development
since Brazil, as we showed previously, was at the time mainly a rural
economy. Urban unions were formally allowed in 190719.
7KHXQLRQPRYHPHQWLQ%UD]LOZDVKHDYLO\LQXHQFHGLQWKHEHJLQning from the strong process of immigration.20
The settlement of European immigrants21 in the Southeast, particularly in the far South of Brazil, changed the actual face of the population
in the three Southern provinces. The provinces now are for the majority
white and have preserved much of their original culture, including the
immigrants particular political views of the world, but is important to
remember that most of them were anarchists.
Even with the arrival of new immigrants after the Second World
War, there were mostly Italians, but by this time, there were even immigrants from Japan. The unionism in Brazil, after the foundation of the
Communist Party in 1922, took a different political curve. The Marxist
XQLRQLVPEHFDPHPRUHLQXHQWLDODVVWDWHGE\2OLYHLUDWKHRQO\FRPpetitor to communist-oriented unionism ended up being the Getulista
labor movement.22
In the 1970s brazil went though the economic miracle with interQDOZHDOWKJURZLQJDWUDWHVQHDUD\HDUXQGHUWKHPLOLWDU\UHJLPH
The contemporary syndicalism in Brazil was formed, or re-born, in
the context of our real industrial revolution that only took place in the
1970s, mainly during the military regime 1964-1984.
Decreto 979/1903
Decreto 1637/1907
20
 ,QWKHEHJLQQLQJRIWKHFHQWXU\%UD]LOZDVRRGHGE\LPPLJUDQWVIURP,WDO\6SDLQ
and Portugal.: the presence of anarchism and anarchy-syndicalism in the South and
6RXWKZHVWRXULVKHGLQDSUHVHFRQGLQGXVWULDOUHYROXWLRQHQYLURQPHQW)UDQFLVFR
Antonio de Oliveira, Who is Singing LInternationale Again? A Brazilian Illustration (London: Boaventura de Sousa Santos ed., 2004) at 334.
21
Brazil has the largest italian population outside of Italy. See ---------------------22
Francisco Antonio, supra note 18 at 334.
18
19

174

Otavio Augusto Reis de Sousa

The major settlement of the most important auto-maker at the time


(Volkswagen, Fiat, GM and Ford) in the cities surrounding Sao Paulo
area (the ABC region23).
Sao Bernardo was the birthplace of the most important union in Brazilian syndicalism, the Metalworkers Union. The importance of this union is
evidenced in the fact that the current president of Brazil, Luis Inacio Lula
GD6LOYDZDVSUHYLRXVO\WKHPRVWLQXHQWLDOOHDGHURIWKLVWUDGHXQLRQ
During the dictatorship a important process of political change
faced syndicalism and left behind the communism political view.24 The
country moved forward in a de-ideologization process of acceptance
of capitalism and as the Fordist agreement, alienation of labour in exchange for better wages as described in by Braverman: In this move
(Henry Fords payment of a U$5,00 daily wage) can be seen a second
element in the adjustment of workers to increasingly unpopular jobs.
Conceding higher relative wages for a shrinking proportion of workers
in order to guarantee uninterrupted production was to become, after
the Second World War, a widespread feature of corporate labor policy,
especially after it was adopted by union leadership.
The re-born syndicalism escaped the legal framework, forming two
major alliances at the national level. Besides the unions, federations and
FRQIHGHUDWLRQVWKDWZHUHERXQGE\WKHODZWRGHQLWLRQVE\SURIHVVLRQV
or sectors a spontaneous movement emerged forming the most powerful
feature of Brazilian unionism called centrais. Two major centrais
emerge CUT (Central Unica dos Trabalhadores) and CGT (Central Geral dos Trabalhadores). Their existence was not a legal phenomena but
a social one, they were not tied to the concepts of professions or sectors,
they reunited unions from a variety of sectors, from auto-makers to agricultural workers, their main difference was ideological.
7KHUVWRQH &87 ZDVHVVHQWLDOO\OHIWZLQJwith strong ties to the
landless social movement and to the Workers Party. In essence, CUT
was until 2004 opposed to the state political project towards, labour
and the economy that aligned with the neo-liberal movement. The CGT
was, at least until 2004, less political but inclined to a unionism the
recalled the Getulism project of the 1930s and essentially, not opposed
to the established state power.
23
24

Three cities named the ABC region: Santo Andr, Sao Bernardo and Sao Caetano.
In our days communist view minority inside (CUT) and in its political counterpart
the workers Party.

175

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

After the workers party rose to power, the boundaries were not as
clear. The presidential election of 2004 and the re-election of 2008 set
the major central in a dilemma. CUT s discourse was based on a
radical opposition to state power. How can it be preserved after the
workers party achieve the Presidency?
CUTs new ideological project for the future is unclear.
The new trend is for the legal reception in 2008 of the centrais in
the legal framework of the industrial relations regime. The new law25
GHQHVFHQWUDLVDVDUHXQLRQRIPRUHWKDQXQLRQVVSOLWDPRQJDW
least 3 different regions of Brazil26, in at least 5 different economic sectors. And the most astonishing piece of the new legislation requires that
WKHFHQWUDOUHSUHVHQWDWOHDVWRIWKHZRUNHUVLQ%UD]LO$VLWFXUUHQWO\
is, the legal framework explicitly avoids creation of new centrais and
secures the monopoly of CUT and CGT.
Law 11.648/2008 only avoids fragmentation in the higher level of
trade unions structure27 (centrais) The unions at the base level have beFRPHWRRODUJHGXULQJWKHODVWYHGHFDGHVDQGDUHIRUWKHPDMRULW\
ZHDN7KHQXPEHUVDUHQRWFRQUPDEOHEXWUHFRUGVIURPWKH0LQLVWU\
of Labour show the existence of over 20,000 different unions in Brazil
and this number is undoubtedly increasing.
As in the rest of the word the levels of active participation is decreasing in unionism but the growing number of unions is easily explained
E\WKHLQGLUHFWSXEOLFQDQFLQJRIXQLRQVWKHVRFDOOHGLPSRVWRVLQdical (union taxation).
6KDGHVRI*UD\EHWZHHQ%ODFNDQG:KLWHRUDVZHGHQHGLWHDUOLHU
our trade union system is a mutant system, empowered by norms from
two opposite systems (Brazilian internal and contradictory law and fractions of the 87 and 9828 conventions) and irreducible to just one of then.
And the questions persist:
Should we change Brazilian trade unions legal system to make it
look more European and let it live?
Law 11.648/2008
 %UD]LOKDVYHGLIIHUHQWJHRJUDSKLFUHJLRQV
27
Brazil has 4 levels: unions, federations, confederations and centrais.
28
 %UD]LOUDWLHGLQFRQYHQWLRQEXWWKH,/2KDVPDGHREVHUYDWLRQVDERXWWKH
failure in compliance with some important aspects, such as the existence of compulsory settlement of collective disputes by labour courts. See Brazilian Constitution
- article 114,2 and 3.
25
26

176

Otavio Augusto Reis de Sousa

Or, perhaps worse, at least for a long time Marvel fan, should the
mutant system (of Brazilian trade unions) be terminated, to protect the
humans (the legal systems that follow convention 87 and therefore are
not abominations)?

KEsEd/KEE&ZKDK&^^K/d/KEd,
HUMAN PERSPECTIVE OF TRADE UNIONS AND THE MUTANT
KhEdZWZdZ/>EKZDd/sKDWZ/^KE
Freedom of Association cannot be studied in the context of this paper without a brief explanation of convention 87 and the idea of core
labour rights.
The development of freedom of association is rooted in two main
documents, both from 1948. Convention 87 and the Universal DeclaraWLRQRI+XPDQ5LJKWVGHVSLWHWKHIDFWWKH\ZHUHQRWWKHUVWRQHVWR
address the issue as stated by Swepston29:
The inclusion of this principle in the universal Declaration
had been preceded less by its inclusion in three important ILO
LQVWUXPHQWV7KHUVWRIWKHVHLVWKH,/2&RQVWLWXWLRQ:KHQ
in 1944 the ILO adopted the Declaration of Philadelphia, the
second of these fundamental texts, and in 1946 incorporated
it into the Constitution, it reaffirmed freedom of association
The third of these fundamental texts was the freedom of Association and Protection of the Right to Organize Convention,
1948(No 87)

The development of freedom of association also led the United Nations, in 1966, to codify the principles laid down in the declaration
in two seminal text: the International Covenant of Civil and Political
Rights, and the International Covenant of Economic, Social and Cultural Rights. Both Covenants came into force ten years later, once they
KDGUHFHLYHGDVXIFLHQWQXPEHURIUDWLFDWLRQV30.
29

30

Lee Swepston. Human rights Law and freedom of association: Development through
ILO supervision, International Labour Review, Vol. 137 (1998), no2, 169-184 at 170.
Ibid. at 172.

177

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

7KLVHOGHYROYHGPRUHUHFHQWO\ZLWKWKHQHZFRQFHSWRIFRUHODbour rights, when in 1998 Mundlak31 summarized the idea in a few


words core labour rights distinguish the right of freedom from forced
labour, the prohibition of child labour, and the guarantees of freedom
of association and gender equality in the labour market from the other
labour standards promulgated by the ILO.
The so called core labour rights that we address in other chapter
of our on going thesis are strongly criticized by the reductionist list
of rights and by critics both inside and outside the ILO. Engaged in
complement with the decent work agenda it seeks to complement
the short-list with three other pillars, namely promoting widespread
access to jobs and income, strengthening social protection, and strengthening social dialogue32
The international legal framework is intertwined with Regional instruments33, which also protect the concept of freedom of association.
Brazils freedom of association is also upheld at the regional level by
the American Convention on Human Rights (Pact of San Jose, 1969),
ZKLFKLQDUWLFOHDPSOLHGWKHLGHDRI)UHHGRPRI$VVRFLDWLRQDIUming that no one should be compelled to belong to a trade union.
Is easy to realise that freedom of association is a concept, rooted
and recognized in most of the occidental world and for a growing number of scholars it is attached to the human rights agenda,34 but what does
freedom of association means to the ILO?
We are forced to recognize that far from a comprehensive concept
of freedom of association,35 convention 87, from the ILO, sustained a
liberal concept that could be a double edged sword36 in countries with
a powerful labour movement37.
Guy Mundllak, The right to work the Value of Work ----------------------at 348.
Ibid. at 349.
33
For other examples see in for Europe The European Convention on Human Rights
(1950) and The European Social Charter (1961).
34
See Guy Mundllak, supra note 29 and Lee Swepston supra note 27.
35
 $SUREOHPDGGUHVVHGLQDSUHYLRXVFKDSWHURQRXUWKHVLVDV\HWVWLOOXQGHQHG
EXWWKDWVKRXOGEHGHQHLQDZD\WRVWUHQJWKWKHODERXUPRYHPHQWLQVWHDGRI
weakening it.
36
Teri L. Caraway, Freedom of Association: Battering ram or Trojan horse?, Review
of International and Political Economy, 13:2, May 2006: 210-232 at 212.
37
The case study in the article is Argentina but we think it applies, to Brazil as well,
since the two legal systems have in this matter many similar provisions..
31
32

178

Otavio Augusto Reis de Sousa

Convention 87 attempts to impose a competitive relation between


unions that might collide in Brazil with the strongest form of syndicalism we have, the centrais and have the adverse, and opposite outcome of weakening the trade union system.
As Caraway explains: This liberal interpretation of freedom of association views freedom as a market for unions in which entry barriers, competition, and equality of treatment must be respect. A regulatory environment of free competition, however, has potentially negative effects on the power of unions. Low membership requirements and
multi-unionism at the plant level facilitate fragmentation.38
7KH,/2GHQLWLRQIRXQGLQFRQYHQWLRQLVFRPSULVHGRIVRPH
essential components. First, it emphasizes the workers and employers
right to establish their organizations, and join organization of their own
choosing (article two); to control the internal affairs of this organization
free from State interference or dissolution, with a few exceptions (articles three and four); and that the acquisition of legal personality should
not be subject to conditions in a way that restricts articles two, three or
four (article seven).
The Brazilian legal system partially rejects some of the concepts
described above. The Brazilian Constitution (B.C.) of 1988 embraces
the right to constitute unions, but does not recognize multi-unionism;
on the contrary it imposes a trade union monopoly. Article 8, II, of the
B.C. prohibits the creation of more than one trade union representing
workers or employers in the same territorial area, which cannot be
smaller than the area of a municipality. .
7KHLQKHUHQWFRQLFWLVLQHYLWDEOH
According to the Digest of Decisions of the Committee on Freedom
of Association39 the respect of the principle demands two constraints.
First: internal law should not demand an overwhelming number of
members to create a trade union40. Since the Brazilian legislation, after
the 1988 Constitution, does not demand a certain amount of workers,
this interpretation is not problematic.
However, the second constraint is more appealing. According to paUDJUDSKFRPELQHGZLWKSDUDJUDSKRIWKH'LJHVWXQLFDWLRQRI
Caraway, supra note 34 at 219.
 7KH'LJHVWUHHFWVWKHRIFLDOSRVLWLRQRIWKH,/2UHJDUGLQJWKHLPSOHPHQWRI&RQvention 87.
40
The Digest suggests that 20 members, for example, is an acceptable number, but
100 is excessive (paragraph 254).
38
39

179

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

the trade unions movement imposed through state intervention by legislative means runs counter to the principle embodied in Articles 2 and 11.
Brazils legislation imposes a monopoly over trade unions, it could
EHDUJXHGWKDWWKHUDWLFDWLRQRILVLPSRVVLEOHXQOHVV%UD]LOUHPRYHV
the Constitutional provision of article 8, II.
Nonetheless the question persists even though Brazilian authorities
have signed the intention to comply - should Brazil change this constitutive feature of internal trade unionism?
Historically, the outcome of the provision was to avoid a even greater fragmentation on the base of trade unions, since the strongest part
of the trade unions movement in Brazil is the centrais and it is not the
UVWVHFRQGRUWKLUGOHYHOV XQLRQVIHGHUDWLRQVDQGFRQIHGHUDWLRQV ZH
explained earlier. To enforce the interpretation of freedom of association would cause an increase in the number of unions in Brazil (which
are already overwhelming) and result in deeper fragmentation and weakening of the system.41
$QRWKHUGLIIHUHQFHKDVWREHDGGUHVVHG%UD]LOUDWLHGWKHSDFWRI
San Jose and therefore the Brazilian Constitution in addition to containing the right to join a trade union, also recognizes the negative counterpart42DIUPLQJWKDWQRRQHVKRXOGEHFRPSHOOHGWREHORQJWRDWUDGH
union. The note is very important because in systems like Brazil, trade
union security clauses43 and practices are void. In this frameworks, the
IRUFHIXOXQLFDWLRQRIWKHWUDGHXQLRQPRYHPHQWEHFDPHLQFUHDVLQJO\
important since unions are deprived from any coercive means of being
representative and increasing their numbers, among workers, such as
the popular North American use of closed shop clauses.
The second differential constitutive of Brazils Legal System over
trade unions is the existence of a compulsory trade union tax, also
referred to in article 8 or the Brazilian Constitution. This system of
QDQFLDOVXSSRUWRYHUWUDGHXQLRQV44 collides with article three and to
WKHZKROHLGHDRIQDQFLDOLQGHSHQGHQFHUHJDUGLQJWKHVWDWH$V/HH
Swepston explains:
41

42

43
44

For a glimpse of a similar system (Argentina) colliding with the interpretation held
by ILO regarding freedom of association, see also Caraway, supra note 34 at 224.
The convention 87 does not recognize the right not to join a trade union, which
remains under internal law.
Such as closed shop, or yellow dogs.
CLT article -------

180

Otavio Augusto Reis de Sousa

&RQFHUQLQJ QDQFLDO DGPLQLVWUDWLRQ WKH FRPPLWWHH RI )UHHdom of Association has stated thatprovisions which give the
authorities the right to restrict the freedom of a trade union to
administer and use its funds as it wishes for normal and lawful
trade unions purposes, are incompatible with the principles
ZKLFKSUHVXSSRVHQDQFLDOLQGHSHQGHQFH45

In Brazil the state has the role of partially managing this compulsory
trade union tax. This state management is not compatible with convention 87, but once more, creates a new perspective, since the tax is a way to
strengthen the trade union system. It involves a highly debated question
in contemporary syndicalism, how to sustain trade unions in a global reality where the number of members and union representatives is declining.

CONCLUSION
Brazilian reports to the ILO suggest future reforms in the trade
union system. The union reform before 2004 and the election and re-election of president Lula was strongly supported by the major power
in Brazil trade unionism (CUT).46
After the failure of the National Labour Forum, which was established in 2004, and in which we participated47 the reforms did not deveORSHGDVH[SHFWHGDQGQRVLJQLFDQWFKDQJHVZHUHLPSOHPHQWHG
Brazil remains not in compliance with Convention 87, but the
DQDO\VHVRIWKHSDUWLFXODUZD\ZHDGGUHVVXQLRQQDQFLQJRUHYHQPXOti-unionism, can be in some ways helpful, particularly, in countries with
45
46

47

Swepston supra note 27 at 185.


CUT changed the original position in order not to address the themes anymore after
it conquered state power with its political arm workers party. For the original
political discourse see Roberto Veras, Metalworkers, the Strike Festival and the
possibilities of a National Collective Contract in Another Production is possible
(London: Boaventura de Sousa Santos ed, 2004) 352-380. See also Mozart Victor
Russomano. Princpios Gerais de Direito Sindical. Rio de Janeiro, Forense, 1997.
The National Forum of Labour held discussion in each province over the most important and contemporary issues in Brazilian Industrial relations law, with scholar,
workers, employers and State Authorities. After that the Executive proposed legislaWLYHFKDQJHVPRVWRIWKHPQHYHULPSOHPHQWHG:HSDUWLFLSDWHGLQWKHUVWURXQGRI
debates held by the ministry of labour in Sergipe lecturing over globalization and
how it impacts Brazilian Labour Law.

181

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

an insipient degree of trade union development. The example of Brazil


UHJDUGLQJXQLRQQDQFLQJLVDSSOLFDEOHHYHQLQGHYHORSHGFRXQWULHV
We are not talking about Brazilianization of the West48 but asserting that in comparative law studies, in some extent, borrowing is
often creative.49
:HSUHGLFWWKDWVRPHFRQFHSWVDVWKH%UD]LOLDQZD\RIQDQFLQJ
unions, can be transported to English legal soil or other soils as legal
irritant or a healthy infusion with potential to trigger whole series
of new and unexpected events in the process of internalizing the transferred norms.
0D\EHWKH%UD]LOLDQZD\UHJDUGLQJWKHWZRFRQLFWLQJDVSHFWVUHferred to above, can be transported and internalized in a different and
creative way by the ILO instead of the other way around, with focus on
empowering the trade union movement.
To do so, with have to be able to accept diversity and not to attempt
to create sameness.50 In comparative law, similarity is not a necessity
for fruitful cross-fertilization. 51
Not only legal evolution but also human evolution was made by
disagreement and diversity. Acknowledgment of diversity is therefore
essential in our path to a more human system of industrial relations and
syndicalism, but also being able to accept difference and to embrace it.
To answer the initial question posed at the beginning of this paper,
instead of been frightened, or belligerent with the other the mutant
- we should embrace the concept that in the end there is always an imSRUWDQWDQGRYHUZKHOPLQJVLPLODULW\WKDWGHQHVKXPDQLW\
The mere fact of having extraordinary and unnaturalpower as Judge Judith Barzilay described52, or even the ability to easily heal and have
 7KH QHJDWLYH ZD\ WKH ZRUG LV GHQHG DQG WKH ZKROH IUDPHZRUN GUDZ E\ 8OULFK
Beck supra note 13 ignore the concept of legal irritant see Andrew Harding and
Esin Orucu, Comparative Law in the 21st Century (London: 13-03-09
49
Teubner at 12.
50
Orucu supra note 46 at 12.
51
The question is posed by Orucu supra note 46 at 16 and we anticipated the answer.
52
 7KH FRQLFW EHWZHHQ PXWDQWV DQG QRUPDO KXPDQV LV RIWHQ FRPSDUHG WR FRQLFWV
experienced by minority groups in America such as Jews, African American. Also,
on an individual level, a number of X-Men serve as metaphorical function as their
powers illustrates points about the nature of the outsider. Do to the nature of this
quote based on comic books we draw this ideas from the controversial wikipedia.
Is important to realize that the same dynamic referred above applies to the political
FRQLFWEHWZHHQWKH* GHYHORSHGFRXQWULHV [* GHYHORSLQJFRXQWULHV 'H48

182

Otavio Augusto Reis de Sousa

indestructible claws as Wolverine, or telepathic power as Professor Xavier


is not the only factor in determining someones humanity, the overwhelming fact is that the mutants have a distinctive individual personality.53
We will not try to innovate the most ancient question of what deQHVKXPDQLW\54 But we can be certain that our humanity does not lie
on our physical form or abilities. Our humanity lies in another nonVXSHUFLDOFRPSRQHQW\HWWREHGHQHG
The X men are hated, feared and despised collectively by
humanity for no other reason than that they are mutants. So what
we have here, intended or not, is a book that is about racism,
bigotry and prejudice55

In the end of the day, X-men and Developing countries, as Brazil,


DUHHQJDJHGLQWKHVDPHJKWWU\LQJWREHDFFHSWHGZLWKRXWGHQ\LQJ
who they are.
THE END

REFERENCES
Bech, Ulrich A thousand Worlds of Insecure Work in Brave New
World. (Cambridge: 2000) 92-109
Caraway, Teri L., Freedom of Association: Battering ram or Trojan horse?,
Review of International and Political Economy, 13:2, May 2006: 210-232
Fudge, Judy and Eric Tucker. Law, Industrial Relations and the State.
Pluralism or Fragmentation? The Twentieth-Century Employment Law
Regime in Canada in Labour/Le Travail, 46, (Fall 2000), 251/306 at 251.
Harding, Andrew and Esin Orucu, Comparative Law in the 21st Century
(London: 13-03-09
veloping countries are often described and treated in the political arena as barbaric
and their cultural differences are most of the time ignored in international forums.
53
Wall Street Journal, January 20, 2003 article by Neil King Jr. online:
54
 :HOHDYHWRWKHUHDGHUWKHWDVNRIQGLQJRXWZKDWGHQHVKXPDQLW\WKDWPLJKW
take a lifetime.
55
Uncanny X-men, from the writer Chris Claremont 1981.

183

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Johnson, Rebecca. Blurred boundaries: a double-voice dialogue on regulatory regimes and embodied space. Law Text Culture. Vol. 9. 2005.
Mascaro Nascimento, Amauri e Irany Ferrari Histria do Trabalho.
In: Histria do Trabalho, do Direito do Trabalho e da Justia do
Trabalho. (So Paulo: LTr, 1998)
Mundllak, Guy The right to work the Value of Work.
Oliveira, Francisco Antonio de, Who is Singing LInternationale
Again? A Brazilian Illustration (London: Boaventura de Sousa Santos
ed., 2004) 321-351.
Russomano, Mozart Victor. Princpios Gerais de Direito Sindical. Rio
de Janeiro, Forense, 1997
Saad-Filho, Alfredo, Anti-Capitalism a Marxist Introduction (London, Pluto Press, 2003)
Sousa, Otavio Augusto Reis de, Direito e Processo do Trabalho. (Rio
de Janeiro: Forense, 2008).
Sousa, Otavio Augusto Reis de, Nova Teoria Geral do Direito do
Trabalho. (So Paulo: LTR., 2002)
Swepston, Lee. Human rights Law and freedom of association: Development through ILO supervision, International Labour Review, Vol.
137 (1998), no2, 169-184
Veras, Roberto, Metalworkers, the Strike Festival and the possibilities of a National Collective Contract in Another Production is possible
(London: Boaventura de Sousa Santos ed, 2004) 352-380.
Wall Street Journal, January 20, 2003 article by Neil King Jr. online:

184

TEORIA DOS BENS E A ESSENCIALIDADE


DOS MEDICAMENTOS:
A funcionalizao da propriedade em
prol dos valores existenciais
Pedro Marcos Nunes Barbosa1
Resumo: O artigo analisa (e prope) releitura Teoria dos Bens, de
modo a funcionalizar os direitos das propriedades em prol dos valores
existenciais.
Palavras-chave: Direitos fundamentais, propriedades, valores existenciais.
Abstract: The article examines property rights as a path to the realization towards constitutional rights.
Key Words: Fundamental rights, property rights, moral rights.

1. INTRODUO
No presente trabalho ser abordada a teoria clssica dos bens, bem
como as vicissitudes histricas que levaram a tutela da propriedade
FRQYLYHUHFRQLWDUFRPRXWURVGLUHLWRVGHLJXDORXPDLRULPSRUWkQFLD
Um tanto distante do direito de propriedade LQYLROiYHOHVDJUDGR tal como
propunha a Declarao dos Direitos do Homem e Cidado de 1789, o direito
real por excelncia sofre mitigaes distintas de um ar sacro e invencvel.
Aps o captulo que cuida do vis proprietrio - enquanto ttulo ao
invs de funo -, ser enfrentada a divergncia existente entre titulares
e no titulares, alm do direito ao patrimnio mnimo dos ltimos em
especial no que cuida do polmico tema da sade pblica.
Nesse sentido, ser avaliada a jurisprudncia que cuida dos embates
entre partes privadas, e dos particulares para com os entes pblicos.
1

Mestrando em Direito Civil pela Universidade do Estado do Rio de Janeiro, Especialista em Propriedade Intelectual pela PUC/RJ, Professor e Coordenador da Ps-Graduao em Propriedade Intelectual da PUC/RJ, advogado associado do escritrio Denis Borges Barbosa.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Ato contnuo ser enfocada a relao das patentes para com o direito de acesso, os abusos cometidos pelos titulares, e os remdios existentes para que tantos embates judiciais sejam adequadamente resolvidos.
3RUPUHODFLRQDUHPRVRVDVSHFWRVSURSULHWiULRVHPFRQVRQkQFLD
com os valores existenciais almejando uma ponderao pertinente de
direitos hoje contrapostos.

2. UM POUCO DE HISTRIA
A viso clssica da propriedade abrangia o senhor feudal com o
objeto de sua riqueza: gigantescos latifndios onde os vassalos e vilos
exerciam sua atividades. A corvia era a contraprestao dada ao dono
do feudo pela proteo e uso da gleba2.
Com o advento da revoluo francesa, O indivduo [se torna] proSULHWiULRGHVXDSUySULDSHVVRDHWHPFDSDFLGDGHGHDJLULQGHSHQGHQWH
GRVRXWURV(VVDDXWRQRPLDVLJQLFDOLEHUGDGHGHDJLUOLEHUGDGHFRQIXQGHVH HQWmR FRP SURSULHGDGH 6HU SURSULHWiULR VLJQLFD VHU OLYUH
-XVWLFDVHDSURSULHGDGHQDOLEHUGDGHHDOLEHUGDGHQDSURSULHGDGH3.
3RUWDQWRQmRVHUWLWXODUSURSULHWiULRVLJQLFDYDVHUH[FOXtGRGHVXD
plena liberdade. Os derradeiros ideais iluministas egalit et fraternit
factualmente -jamais saram do imaginrio. Na prtica, tal constatao
resulta na seguinte concluso:
quem pode ter sujeito de direito, mas somente ser sujeito na
medida em que tenhaeDSURSULHGDGHTXHTXDOLFDRVXMHLWR
2VQmRSURSULHWiULRV DSHVDUGHSRGHUHPDRVROKRVGRGLUHLWR
VrOR VmRFRPRDXVHQWHVGDRUGHPMXUtGLFDYHUGDGHLURVIDQWDVPDVjOX]GRGLD1HVVHVTXDGUDQWHVWXGRDLQGDVHUHGX]DLQgressar nesse foro privilegiado do sujeito de direito: aquele que
tem bens, patrimnio sob si, compra, vende, pode testar e at
contrai npcias. Para estes, o mundo do direito articulado sob
as vestes da teoria do direito civil; para os demais, o limbo4.
2
3

KOSHIBA, Luiz. Histria do Brasil. 7. ed. So Paulo: Atual Editora, 1996, p. 4


CORTIANO, Eroulths Junior. O Discurso Jurdico da Propriedade seus Rupturas: Uma Anlise do Ensino do Direito de Propriedade. Rio de Janeiro; Editora
Renovar, 2002, p.91.
idem p. 121.

186

Pedro Marcos Nunes Barbosa

Mas no desenvolvimento dos ordenamentos jurdicos, tal tica se


tornou insustentvel, pela excluso da grande maioria dos destinatrios.
HART preceituava que apenas um sistema igualitrio faculta a manuteno de uma estrutura jurdica:
Se o sistema for justo e assegurar genuinamente os interesses
vitais de todos aqueles de quem pede obedincia, pode conquistar e manter a lealdade da maior parte, durante a maior parte do tempo, e ser consequentemente estvel. Pelo contrrio,
pode ser um sistema estreito e exclusivista, administrando segundo os interesses do grupo dominante, e pode tornar-se continuamente mais repressivo e instvel, com a ameaa latente de
revolta. Entre estes dois extremos, podem encontrar-se vrias
combinaes destas atitudes para com o direito, frequentemente no mesmo indivduo5.

Na prtica, os no titulares passaram de uma atitude passiva, conformista, para uma luta social em busca de seu lugar ao sol, de sua
terra, posse, de seus bens6, de sua cidadania7.
Assim, temos hoje uma perspectiva distinta da clssica viso proprietria da sociedade, ainda que a integrao completa dos destinatrios do ordenamento parea algo utpico.

3. TEORIA DOS BENS: 


8.
A teoria dos bens abrange parte considervel do direito civil, basicamente incidente sobre os direitos reais, mas, hoje, tambm, defende-se sua aplicao sobre os direitos obrigacionais.
5
6

HART, Herbert L. A. O Conceito de Direito, p. 218.


Entre outros grupos destacamos a atuao nem sempre republicana do Movimento
dos Sem Terra: http://www.mst.org.br/especiais/9, acessado em 08.09.2009, s 14:23.
FACHIN, Luiz Edson. Teoria Crtica do Direito Civil. Ed. Renovar, Rio de Janeiro, 2003, p. 3: O sujeito ativamente cidado e passivamente sbito.
Completando a assertiva de Eroulths Cortiano Junior, Luiz Edson Fachin arrebata:
Se o direito de propriedade deve ser individual, o seu exerccio deve ser social, in
op cite p. 66.

187

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Em que pese existncia dessa subdiviso clssica, a doutrina


bem aponta sua atual e inescusvel aproximao9. Tal convergncia
tambm pode ser apurada tendo em vista a importncia dada ao princpio da boa-f objetiva, perpassando eventuais contraentes, para
a realizao do que foi pactuado, enquanto objetivada a segurana
jurdica10.
Mas a concepo vetusta da propriedade enquanto algo abstrato,
GHSRGHULQGHQtYHOOKHJDUDQWLXSRUPXLWRWHPSRDSRVVLELOLGDGH
continua e sua ilimitada permanncia.
A propagao ideolgica de que a legislao dever ter como escopo normas abstratas11, acabou por sepultar o exerccio da igualdade
material perante sujeitos to desiguais.
Os princpios da solidariedade, a presso por medidas que atingissem a igualdade material, bem como o reconhecimento recproco
da subjetividade social em face da subjetividade abstrata, permitiram que [fosse] expressa uma nova realidade econmica, prinFLSDOPHQWH QR TXH WRFD j GLVWULEXLomR GH UHQGD j DVVLVWrQFLD jV
classes desfavorecidas e ao uso no egostico dos bens, renovan9

10

11

PERLINGIERI, Pietro. 3HUVGR'LUHLWR&LYLOIntroduo ao Direito Civil Constitucional. Editora Renovar; Rio de Janeiro, 2007, P. 204: As situaes reais no
se reduzem ao exclusivo dever genrico de absteno por parte de terceiros; elas,
especialmente aquelas limitadas de gozo, caracterizam-se pela presena de obriJDo}HVHVSHFtFDVLQWHJUDWLYDV1mRH[LVWHSRUWDQWRXPDSUHFLVDVHSDUDomRHQWUH
situaes creditrias e reais: frequentemente situaes obrigacionais integram-se
com interesses mais amplos e constituem situaes complexas.
pRSULQFtSLRGDERDIpREMHWLYDQmRMiDIXQomRVRFLDOGRFRQWUDWRRIXQGDPHQWR
para a proteo do crdito em face de terceiros: (...) o princpio da boa-f objetiva, informado pela solidariedade constitucional, por no se limitar ao domnio do
contrato, alcana todos os titulares de situaes jurdicas subjetivas patrimoniais,
vinculando-os ao respeito de posies contratuais, suas ou de terceiros. Por isso
mesmo, fundamenta-se na boa-f objetiva a proteo do crdito em face de terceiros. 1RWDVVREUHDIXQomRVRFLDOGRVFRQWUDWRV. in TEPEDINO, Gustavo Jos
Mendes. e FACHIN, Luiz Edson. O direito e o tempo: embates jurdicos e utopias
contemporneas. Rio de Janeiro: Renovar, 2008.
importante frisar que os mitos do carter abstrato e do vis neutro da Lei foram
rechaados pela doutrina: Pecam as teorias que se julgam neutras, desprovidas
GH TXDOTXHU YDORU QR FRUSR GH VXD DQiOLVH VREUH XP GHWHUPLQDGR REMHWR SRLV D
LQWHQomRGHQHXWUDOLGDGHpHPVLGRWDGDGHXPYDORUORVyFRXPDHVFROKDTXHVH
verdadeira em si, no necessitaria construir-se em oposio ao privilgio: a neutralidade analtica impossvel, bem como, paradoxalmente, a inteno de neutralidaGHpVHPG~YLGDXPYDORUVRFLDOGRWDGRGHXPDQDOLGDGHGHTXHRSHQVDPHQWR
jurdico no deve encontrar fundamento na empiria social, mas to somente na
OyJLFDFLHQWtFD. FACHIN, Luiz Edson. Estatuto Jurdico do Patrimnio Mnimo. Ed. Renovar, Rio de Janeiro, 2006, p. 35.

188

Pedro Marcos Nunes Barbosa

do, assim, os institutos jurdicos da propriedade e da autonomia


contratual12.
A lei abstrata apenas se revela justa para os detentores do status
quo dominante, motivando a indiferena e a manuteno dos desagregados da luz proprietria.
O que permitiu o declnio do imprio patrimonialista ilimitado foi
o crescimento da perspectiva social dos institutos13. Falemos j em
funo14 ao invs de privilegiarmos as estruturas, tal como se falssemos em Luhmann ao invs de focarmos em Parsons.
No entanto, a tradio patrimonialista estabeleceu uma relao unilateral de poder no qual a sociedade sempre se via obrigada para com
os proprietrios, mas os ltimos nenhuma (ou quase) comutatividade
deveriam oferecer15.
Nesse diapaso, mesmo o discurso acerca da aposio do direito de
propriedade dentro do rol dos direitos fundamentais, no artigo XVII da
'HFODUDomR8QLYHUVDOGRV'LUHLWRV+XPDQRVQmRVLJQLFDGL]HUTXHHOH
existe - e persiste - sozinho.
Tampoco debe olvidarse que el ejercicio de los derechos fundamentales ya reconocidos no es ilimitado, sino que puede ser restringido en defensa de la dignidad, la seguridad, la libertad o la simple
convivencia social16.
Por tanto, as vicisitudes decorrentes das alteraes dos standards
sociais e legais podem ser bem observados na atual Teoria dos Bens.

12
13

14

15

16

CORTIANO, Eroulths Junior, p. 140.


$IXQomRVRFLDOVLJQLFDUXSWXUDGRGLVFXUVRSURSULHWiULRQDPHGLGDHPTXHHQIUHQWDQGR
DDEVWUDomRGHVHXPRGHORUHPHWHRRSHUDGRUGRGLUHLWRSDUDDQiOLVHGDVLWXDomRFRQFUHWD
HPTXHVHLQVHUHFDGDVLWXDomRSURSULHWiULD in CORTIANO, Eroulths Junior, p. 150.
espera-se a compreenso de que o patrimnio individual no apenas fruto das
RSRUWXQLGDGHVLQGLYLGXDLVPDVDOJRTXHpDQWHVGHQLGRSHORFROHWLYRGRWDGRGH
um sentido social, in FACHIN, Luiz Edson. Estatuto Jurdico do Patrimnio
Mnimo. Ed. Renovar, Rio de Janeiro, 2006, p39.
FACHIN, Luiz Edson. Teoria Crtica do Direito Civil. Ed. Renovar, Rio de Janeiro, 2003, p. 103: Para o direito de propriedade e as pessoas nele relacionadas,
R VLVWHPD HQFRQWURX D REULJDomR SDVVLYD XQLYHUVDO SRUTXH QmR Ki UHODomR HQWUH
SURSULHWiULRHDFRLVDTXHpRREMHWRGDVXDDSURSULDomR.
FERNNDEZ, Eusebio, p. 80.

189

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

4. PATRIMNIO MNIMO: E


DE
17.
O fato de termos hoje a primazia18 do existencial sobre o patrimonial no implica no decrscimo da importncia do segundo. Ele apenas
teve sua funo alterada, de modo a comportar um meio ao pleno deVHQYROYLPHQWRGRSULPHLURVHPFRQWXGRVLJQLFDUTXHRH[LVWHQFLDO
prescinda completamente dos bens materiais.
A existncia plural daqueles desprovidos de qualquer patrimnio material, alguns at carentes de um mnimo de privacidade19, trouxe uma constatao de que no vivemos um momento de crise, mas uma crise do momento.
A constatao diria de que a sociedade se enriqueceu de personagens prximas a Macunamas e Macabas trouxe a irrefutvel indagao: Como garantir um patrimnio mnimo?
Alem de garantias ao direito de propriedade, a sociedade tambm
clama ao direito de acesso aos bens tutelados, alem de seu uso em prol
das relaes familiares20.
A proteo dignidade humana e o propsito da reduo das desigualdades exigem a proteo do excludo, e esta proteo leva disFXVVmRGDDFHVVLELOLGDGHDRVEHQV1HVVDHVWHLUDSDVVDVHDHQWHQGHU
TXHHVVHGLUHLWRVXEMHWLYRWHPGHVWLQDWiULRVQRFRQMXQWRGDVRFLHGDGH
de modo que o direito de propriedade tambm comea a ser um direito
propriedade21.
17
18

19

20

21

LISPECTOR, Clarice. A hora da estrela. Rio de Janeiro: Rocco, 1998, p. 71.


Tal primazia tambm notada no campo da responsabilidade civil: O dano causado
a bens materiais h de ser, em tudo e por tudo, diferenciado e de menor importncia
do que o dano (injusto) causado pessoa humana, MORAES, Maria Celina Bodin
de. Danos Pessoa Humana: uma leitura civil-constitucional dos danos morais.
Editora Renovar; Rio de Janeiro, 2003, p.163.
Como os moradores de rua que no optaram pela falta de privacidade, ao contrrio
de participantes de reality shows que dispem voluntariamente sobre tal valor
existencial.
O patrimnio, por sua vez, somente relevante para proporcionar aos familiares
as melhores condies de desenvolvimento de suas relaes familiares e sociais, em
harmonia, em respeito e em solidariedade, permitindo que cada um possa, com a
colaborao de todos, atingir o ideal de felicidade e de bem-estar social. GAMA,
Guilherme Calmon Nogueira da. Princpios Constitucionais de Direito de Famlia. So Paulo: Editora Atlas, 2008, p. 128.
idem, p. 153.

190

Pedro Marcos Nunes Barbosa

O direito deve ser usado como moto promocional aos seus destinatrios, dentro da viso utilitarista de Bentham cujo critrio de justia
determinado pelo que produz a maior satisfao ou a maior felicidade
ao maior nmero de cidados. Isso liga o direito a objetivos sociais
SUiWLFRV H FRQFUHWRV XPD YH] TXH R REMHWLYR GD OHJLVODomR GHYH VHU
sempre o de satisfazer o maior nmero de pessoas22.
Assim divergem entre si a antiquada viso patrimonial em oposio
a necessidade de integrao social, a dignidade da pessoa humana excluda de patrimnio.
No Brasil, no h espao para aqueles que defendem uma aplicao
apenas vertical dos direitos fundamentais, pois a GHQLomR FRQcreta do objeto dos direitos a prestaes e da sua possvel vinculao
(direta e/ou indireta) na esfera das relaes privadas exige em primeira
linha uma ponderao entre a proteo da dignidade da pessoa humaQDHGRPtQLPRH[LVWHQFLDO RXGRQ~FOHRHVVHQFLDOTXDQGRQmRLGrQWLco ao contedo em dignidade) dos direitos e prestaes, por um lado, e
da autonomia privada ou outros bens fundamentais, por outro23.
Portanto, mesmo longe de uma relao entre particular e Estado, os
primeiros devem exercer suas atividades, e usar suas propriedades em
benefcio de seus pares, na aplicao integral dos valores fundamentais
de modo horizontal.
No tpico subseqente, avaliaremos a relao do direito de acesso
aos medicamentos como garantia ao patrimnio mnimo da pessoa humana: direito vida.

4.1W
Como uma soluo hbil ao direito de acesso, Eroulths Cortiano prope a utilizao dos instrumentos de direito administrativo tal como a
desapropriao no apenas nas hipteses de sano ao titular do direito24.
22

23

24

ARNAUD, Andr-Jean e M Jos Farias Dulce. Introduo Anlise Sociolgica


dos Sistemas Jurdicos. Rio de Janeiro; Editora Renovar, 2000, p. 62.
SARLET, Ingo Wolfgang. $LQXrQFLDGRVGLUHLWRVIXQGDPHQWDLVQRGLUHLWRSULYDdo: o caso brasileiro, p. 140-141.
Disso se deduz que institutos de direito administrativo, como a desapropriao,
OX]GD&RQVWLWXLomRQmRVmRPDLVXWLOL]iYHLVVRPHQWHFRPRPGHDVVHJXUDUDIXQomRVRFLDOGHSURGXomRGDSURSULHGDGHPDVWDPEpPFRPRPGHWRUQDUDFHVVtYHO
a todos a propriedade privada, Eroulths Cortiano Junior, p. 154.

191

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

6HJXQGR TXDOTXHU QRomR DFHLWiYHO GH GLUHLWRV KXPDQRV [a manuteno do modelo proprietrio] requer igualdade do direito mera
VXEVLVWrQFLDItVLFDUHTXHULJXDOGDGHGRGLUHLWRDRVPHLRVGHYLGDHDRV
meios de trabalho que toda sociedade capaz de propiciar conforme
seu grau de domnio sobre a natureza.
Portanto, a prpria natureza dos seres humanos requer dois tipos de
propriedade individual. O primeiro, a propriedade dos meios de vida, a
posse de coisas materiais. Trata-se necessariamente de uma propriedade
H[FOXVLYDHXSUHFLVRWHURGLUHLWRGHH[FOXLUYRFrGHPLQKDVURXSDVGH
minha refeio, de minha escova de dente e do meu leito25.
Eros Grau, por sua vez, entende que, na hiptese de descumprimento da funo social por parte do proprietrio, o caso no seria de
desapropriao, mas de perdimento do bem26.
O patrimnio mnimo, portanto, tal como ocorre com o bem de famlia, no representa uma limitao ao credito ou ao direito de propriedade,
mas apenas retira a sobrevivncia do devedor ao voluntarismo do credor27.
A jurisprudncia tambm tem ponderado acerca da maior importncia do direito de acesso a medicamentos diante de valores patrimoniais
tais como a vontade descrita no testamento:
3UHWHQVmRGHEHQHFLRDWLQJLGRSHORYtUXVGD$,'6HHPHVWDJLR
avanado da doena, de liberar-se o gravame, alienando-se o bem
HDSOLFDQGRRQXPHUiULRGDtGHXHQWHQRWUDWDPHQWRGHVXDVD~GH
$SURWHomRGREHQHFLRTXHHUDDYRQWDGHGDWHVWDGRUDGHL[DULD
GHRFRUUHUVHLPSRVVLELOLWDGRGHYHQGHURLPyYHOJUDYDGRFDVVH
ele reduzindo misria, sem recursos para minorar-lhe os sofrimentos nos ltimos tempos de vida. Compatibilizao, no caso,
da regra do art. 1676 do CC, com a do art. 5 da Lei de Introduo
do mesmo ordenamento e com a interpretao teleolgica da clusula. Deferimento do pedido, com depsito do produto da venda
em caderneta de poupana disposio do Juzo, liberando-se
gradualmente o numerrio para custeio do tratamento.
Tribunal de Justia do Estado do Rio de Janeiro, AI 1948/94
RJ, 5 Cmara Cvel. julgado em 14295 Rel. Ds. Humberto de Mendona Manes.
25
26
27

Eroulths Cortiano Junior, p. 155.


Eroulths Cortiano Junior, p. 158.
FACHIN, p. 67.

192

Pedro Marcos Nunes Barbosa

$FRQFOXVmRDWLQJLGDSHOR7ULEXQDOXPLQHQVHQmRSRGHULDWHUVLGR
outra, posto que o cumprimento do testamento toma a priori o bem
HVWDUGREHQHFLiULRHWDOVySRGHVHGDUFRPHOHYLYR
2XWUDIRQWHLQFHVVDQWHGHFRQLWRHQWUHSDUWLFXODUHVpRGDREULJDtoriedade das farmcias alienarem medicamentos aos idosos, em decorrncia de legislao estadual:
$d2&,9,/3%/,&$/(,(67$'8$/1DIREITO
SADE. DESCONTO PARA IDOSOS NA COMPRA DE MEDICAMENTOS. 1. Smula n 58 deste Tribunal. Deciso agravada conWUiULDjOHL$omRGLUHWDGHLQFRQVWLWXFLRQDOLGDGHSHUDQWHR67)TXH
teve a liminar indeferida e ainda no teve o mrito julgado. Assim, a
referida Lei Estadual constitucional e deve ser aplicada.3. Direito
vida que deve sempre preponderar face ao da livre iniciativa
Tribunal de Justia do Estado do Rio de Janeiro, 6 Cmara Cvel, Ds. Benedicto Abicair, AI 2009.002.03090, DJ 19.02.2009

Numa outra senda, j no abrangendo apenas os particulares, temos


que os entes federativos solidariamente detm a obrigao de fornecer acesso aos frmacos essenciais vida do administrado, ainda que tal
medicamento no esteja presente na listagem do SUS.
7DLVMXOJDGRVUHHWHPRSDSHOSUHSRQGHUDQWHGRSRGHUS~EOLFRQD
disponibilizao de bens essenciais, de modo a permitir a dignidade da
pessoa humana atravs da sobrevivncia do cidado.
1RTXHVHUHIHUHHVSHFLFDPHQWHDRVSRUWDGRUHVGRYtUXV
HIV, dispe o artigo 1 da Lei n 9.313/96 que os portadores
GR+,9 YtUXVGDLPXQRGHFLrQFLDKXPDQD HGRHQWHVGH$,'6
6tQGURPHGD,PXQRGHFLrQFLD$GTXLULGD UHFHEHUmRJUDWXLtamente, do Sistema nico de Sade, toda a medicao necesViULDDVHXWUDWDPHQWR 
4. Embora o medicamento ora pretendido (KALETRA) no
esteja inserido nas recomendaes do Ministrio da Sade,
fundamental que o fornecimento gratuito deve abranger
toda medicao necessria ao tratamento dos soropositivos,
VLJQLFDQGRTXHQmRVyVmRGHYLGRVRVUHPpGLRVSDGURQL]DGRV
pelo Ministrio da Sade, como todos aqueles que porventura
sejam necessrios s particularidades de cada paciente.

193

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

2VH[DPHVHPHGLFDPHQWRVQHFHVViULRVVmRDLQGDLQGHWHUPLnados, estando, pois, ligados ao quadro evolutivo da doena,


sendo cabvel na espcie a formulao de pedido genrico, a
teor do disposto inciso II do artigo 286 do CPC.
TRF 2 Regio AC n 2001.51.01.020530-7, 8 Turma Especializada, unnime, Rel. Juiz Federal Guilherme Calmon
Nogueira da Gama, DJU 20.04.2005, p. 423/424.

O precedente supra labora com o pensamento de que o Estado no


pode gerir, de modo negativo, com a vida de seus sditos. Assim, tal
como a proibio genrica da pena de morte, no pode o ente pblico por ao, ou omisso, dispor sobre a existncia de um cidado28.
Quando a determinao in limine do no resolve a questo, o Poder
Judicirio tem utilizado de medidas extremas para o cumprimento da
deciso ignorada pelo Poder Executivo, sem que isso implique numa
violao constitucional ao patrimnio oramentrio.
FORNECIMENTO DE MEDICAMENTO SEQUESTRO DE
DINHEIRO PUBLICO POSSIBILIDADE PRINCIPIO DA DIGNIDADE DA PESSOA HUMANADIREITO AVIDA E A SAUDE
$*5$92 '( ,167580(172 MEDICAMENTOS. Autora
SRUWDGRUDGHPHQLQJHRPDSDUDVHODU6HTHVWURGHYHUEDS~EOLca. Possibilidade. O seqestro de verba pblica para compra de
medicamentos essenciais vida da Autora, ora agravada, no
afronta o disposto nos artigos 730 do Cdigo de Processo Civil e
100 da Constituio Federal. Muito pelo contrrio, atende aos
Princpios Constitucionais da Dignidade da Pessoa Humana e
do Direito Sade e Vida, sendo certo que no confronto com
o Princpio da Impenhorabilidade dos Bens Pblicos h que se
aplicar os primeiros.$*5$92,03529,'2
Tribunal de Justica do Estado do Rio de Janeiro, 15 Cmara Cvel, Ds. Celso Ferreira Filho, AC 200800215797, DJ 09.09.2008.

Tal entendimento se encontra convergente com o artigo 25 da Declarao Universal dos Direitos Humanos. Todo homem tem direito a um
padro de vida capaz de assegurar a si e a sua famlia sade e bem-estar.
 (VSHFLFDPHQWHVREUHDSHQDGHPRUWHSHUWLQHQWHVVmRRVSHQVDPHQWRVGH%2%BIO, Norberto. Era dos direitos. Rio de Janeiro: Campus, 2004, p. 162.

28

194

Pedro Marcos Nunes Barbosa

Destarte, podemos concluir que na relao entre proprietrios ou


entre aquele que almeja ser titular do direito de permanecer vivo e o
Estado, a Carta da Repblica assegura a prevalncia da existncia digna.

4.2 W
Ingo Sarlet bem aventa uma hiptese clara de primazia do direito de
acesso a medicamentos, sade, numa hiptese contratual: Um dos casos
dignos de nota refere-se ao reconhecimento, por parte dos tribunais, da
obrigao de empresas gestoras de planos de sade privados arcarem com
RSDJDPHQWRGHWUDWDPHQWRVQmRSUHYLVWRVQDVFOiXVXODVGRFRQWUDWR29.
Precedentes30UHFHQWHVGR7ULEXQDLV(VWDGXDLVEHPUHHWHPDVWHQdncias pretorianas de alcanar obrigaes paralelas, ainda que no expressamente previstas nos contratos:

SEGURO SADE FORNECIMENTO DE MEDICAMENTO


TRATAMENTO QUIMIOTERAPICO CDC PRINCPIO DA
DIGNIDADE DA PESSOA HUMANA
Agravo. Deciso que concedeu a tutela antecipada para determinar
29

30

SARLET, Ingo Wolfgang. $LQXrQFLDGRVGLUHLWRVIXQGDPHQWDLVQRGLUHLWRSULYDdo: o caso brasileiro, p. 140-141.


Pretenso da agravante de que seja reformada a deciso agravada, por entender
TXHRFRQWUDWRFHOHEUDGRQmRSUHYrDREULJDomRGHIRUQHFHUPHGLFDPHQWRSDUDD
UHDOL]DomRGHH[DPHPpGLFR2UHPpGLRHPGLVFXVVmRQDGDPDLVpGRTXHXPDWR
SUHSDUDWyULRSDUDDUHDOL]DomRGRH[DPHVHQGRSDUWHGRSURFHGLPHQWR pelo que
deve ter seu custo coberto pela agravante.
Tribunal de Justica do Estado do Rio de Janeiro, 12 Cmara Cvel, Ds. Nanci
Mahfuz, AC 200500216814, DJ 18.11.2008.
Se o contrato mantido entre as partes no exclui, expressamente, a cobertura
para a patologia, deve a seguradora fornecer o tratamento atravs de medicamento, ainda que sem internao hospitalar, quando este ministrado em associao
ao tratamento indicado.
Tribunal de Justia do Estado do Rio Grande do Sul, 6 Cmara Cvel, Ds,
Liege Puricelli Pires, 08.06.2009.
Os contratos de plano de sade podem estabelecer as doenas alvos da cobertura,
mas no podem limitar o tipo de tratamento a ser alcanado ao paciente.
Tribunal de Justia do Estado do Rio Grande do Sul, 5 Cmara Cvel, Ds,
Leo Lima, 25.03.2009.

195

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

ao Plano de Sade o fornecimento de medicamento essencial ao trataPHQWR TXLPLRWHUiSLFR 5HFXUVR GD 81,0(' VXVWHQWDQGR TXH LQH[LVWH
qualquer previso legal ou contratual a respeito do fornecimento dos
medicamentos solicitados e demais procedimentos ao tratamento mdico
da paciente. Desprovimento. (...) $XVrQFLDGHGHPRQVWUDomRGHSUHMXt]R
ante a possibilidade de regresso contra o Estado, que a Agravante sustenta ter o exclusivo dever de fornecimento dos medicamentos, enquanto
que a falta do remdio representa para o consumidor a diferena entre a
YLGDHDPRUWHSHORTXHDSUHYDOrQFLDGDFOiXVXODUHVWULWLYDLPSRUWDHP
desequilbrio contratual.
Tribunal de Justica do Estado do Rio de Janeiro, 13 Cmara Cvel,
Ds. Azevedo Pinto, AC 200800222515, DJ 01.10.2008.
Teresa Negreiros ao tangenciar o paradigma da essencialidade sugere uma distino quanto exegese contratual, especialmente quando
KiGHXPODGREHQVVXSpUXRVHGHRXWUREHQVIXQGDPHQWDLV
No primeiro caso, em hiptese de disputa, a disciplina dever ser
mais liberal, ao contrrio da segunda, onde ser sujeita a um regime
de carter tutelar31. A legislao consumerista (CDC) tambm denota a
preocupao do legislador nas hipteses de trato farmacutico: o artigo
76, V, imputa como agravante dos crimes contra o consumidor aquele
que envolver medicamento.
Portanto, a misso do intrprete a ponderao adequada sobre os
YDORUHV MXUtGLFRV FRQLWDQWHV SRLV a imposio de solidariedade, se
excessiva, anula a liberdade; a liberdade desmedida incompatvel
com a solidariedade32.

5. A PROPRIEDADEINTELECTUALEO ACESSO A MEDICAMENTOS


Aps uma abordagem crtica do enfrentamento da propriedade comum e a essencialidade dos medicamentos de cunho humano, o pre31

32

NEGREIROS, Teresa. Teoria do contrato novos paradigmas. Rio de Janeiro:


Renovar, 2 Edio, 2006, p. 31 e 32. Logo em seguida a autora continua: DFODVVLcao dos bens segundo o criterio da utilidade existencial incorpora-se, por esta via
ao direito contratual, fornecendo parmetros para a hierarquizao concreta dos
valores individualistas e solidaristas que coexistem na ordem social e econmica
HVWDEHOHFLGDSHOR7H[WR0DLRU, p. 39.
MORAES, Maria Celina Bodin de. &RQVWLWXLomRH'LUHLWR&LYLOWHQGrQFLDRio de
Janeiro: PUC-Rio, Revista do Departamento de Direitos, p. 109.

196

Pedro Marcos Nunes Barbosa

sente captulo explicitar a forma com a qual a tutela da propriedade


industrial afeta, diretamente, o acesso aos frmacos.
Numa viso concreta da propriedade intelectual no que pertinente
ao acesso a medicamentos, temos de um lado a patente de inveno, e, de
RXWURRFRQVXPLGRUQDO DOpPGDSUySULDFRQFRUUrQFLD 
'HVWDUWHVHUiSHUFHELGDDUHODomRFRQLWXRVDHQWUHRGLUHLWRGH
excluir e a necessidade de incluir33, bem como os remdios existentes no ordenamento jurdico para permitir a convivncia de ambos
os valores.
&RPRSURSRVWDQDODOPHMDVHIRUPXODUKLSyWHVHVRQGHRWLWXORGH
exclusiva no poder ser oponvel, seja pela hierarquia dos valores em
questo, ou seja pela onerosidade excessiva daquele que carece do uso
da tecnologia em questo.

5.1 WW
Antes de tangenciar as peculiaridades da licena compulsria, principal medida existente ao combate das situaes extremas que violam
o acesso dos frmacos patenteados, se faz mister tecer algumas linhas
acerca do direito de patente, sobre a qual recair a licena obrigatria.
Em nosso sentir, h uma equivocada difuso do direito de exclusiva
nos moldes clssico-liberal-patrimonialista, voltado conduta voluntariosa de seu titular.
Temos que a patente no concede propriedade ao titular, pois, como
bem alerta a doutrina: 1mRREVWDQWHRVLPSOHVIDWRGHHPSUHJDUDOHLD
expresso propriedade nem sempre autoriza a concluir que seja essa a
natureza que atribui ao direito imaterial, no s porque a denominao
SRGHVHUXVDGDVHPLQWHQomRGHGHQLURGLUHLWRFRPRWDPEpPSRUTXHDFLrQFLDMXUtGLFDHYROXLHDFRQFHSomROHJDOKRMHDGRWDGDSRGHP
amanh, ser tida como errnea, passando-se a considerar inexata e
desapropriada a denominao da lei 34.
33

34

$GHQLomRGDWLWXODULGDGHOHYDHPFRQWDDIDVWDURVRXWURVFRPDTXHODYLVmRFOiVsica de que o fato que se passa direito do titular nico e exclusivo, o que, evidenWHPHQWHHVWiVXSHUDGR+RMHRGLUHLWRVHPRVWUDHPUHODomRDRXWURSDUDRSHUDU
um juzo de incluso e respeito. Da porque a marca em objeto da relao jurdica
e no em objeto de direito, FACHIN, Luiz Edson. Teoria Crtica do Direito Civil.
Ed. Renovar, Rio de Janeiro; 2003, p. 160.
CERQUEIRA, Joo da Gama. Tratado da propriedade industrial. So Paulo: Saraiva, 1946, Vol I, p. 90.

197

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Num simples confronto do artigo 1.228 do Cdigo civil junto ao artigo 42 da Lei 9.279/96, temos que a Lei de Propriedade Industrial (doravante LPI) concede direitos bem mais restritivos do que aqueles conferidos na forma clssica do direito real de propriedade. No h necessariamente o direito de usar ou gozar, mas h o dever de faz-lo35.
Assim, temos que a patente se aproximaria do conceito de concesso monopolista, como, v.g, o fornecimento de energia: A concesso
de servio pblico um contrato plurilateral de natureza organizacional e associativa, por meio da qual a prestao de um servio
publico temporariamente delegada pelo Estado a um sujeito priYDGRTXHDVVXPHVHXGHVHPSHQKRGLUHWDPHQWHHPIDFHGRVXVXiULRV
mas sob controle estatal e da sociedade civil, mediante remunerao
extrada do empreendimento, ainda que custeada parcialmente por
recursos pblicos36.
No entanto, parte majoritria da doutrina e da jurisprudncia vislumbram as patentes como uma espcie do gnero propriedade37.
Neste vis, os juristas apontam: 1mRH[LVWHDVVLPXPD~QLFDSURSULHGDGHQmRH[LVWHXPDQRomRUtJLGDGHQLGDGHSURSULHGDGH,VWRVLJQLFDTXHQmRpPDLVSRVVtYHOGLVFRUUHUDFHUFDGDXQLGDGHGRGRPtQLR
QmRpSRVVtYHOVXVWHQWDUTXHDSURSULHGDGHpFRQFHLWRXQLWiULRVtQWHVHGH
TXDLVTXHUSRGHUHVGHJR]RHGLVSRVLomRTXHQmRKiSURSULHGDGHVHQmR
existem aqueles poderes; que se existem aqueles poderes, existe proprieGDGHTXHVHIDOWDXPVyGDTXHOHVSRGHUHVpGHGXYLGDUGDH[LVWrQFLDGR
direito de propriedade. A verdade que hoje no existe mais a unidade do
domnio, em boa parte conhecimento preciso no s dos interpretes
mas tambm do legislador que existe uma pluralidade de domnios38.
Dentro da viso predominante, um dos lastros de sua estrutura o
exerccio observando a funo social: O direito de propriedade, que
35

36

37

38

Trechos extrados da obra A Proteo dos Dados de Testes Sigilosos Submetidos


Regulao Estatal. Revista Criao. II ed. Rio de Janeiro: Lumen Juris, 2009, p.
213-254, BARBOSA, Pedro Marcos Nunes Barbosa.
JUSTEN FILHO, Maral. Curso de Direito Administrativo. So Paulo: Editora Saraiva, 2005, pg.501.
Vide Pontes de Miranda - Tratado de direito privado parte especial. So Paulo:
RT, 1983, Tomo XVI, 4 edio, 2 Tiragem, p. 193, e precedente do Tribunal Regional Federal da 2 Regio, 2 Turma Especializada, AI 2008.02.01.000078-7, Des.
Messod Azulay Neto, publicado no DJ do dia 18.03.2008.
CORTIANO, Eroulths Junior. O Discurso Jurdico da Propriedade seus Rupturas:
Uma Anlise do Ensino do Direito de Propriedade. Rio de Janeiro; Editora Renovar, 2002, p. 160.

198

Pedro Marcos Nunes Barbosa

se assegura em toda sua plenitude, para que possa seu titular dispor
da coisa livremente, fruindo-a a seu bel-prazer ou alienando quando
lhe aprouver, sofre restries advindas do respeito a direitos alheios ou
fundados no prprio interesse coletivo, em face dos princpios jurdicos
que transforma a propriedade numa funo social39.
Portanto, o que caracteriza a patente como uma forma de uso social da propriedade o fato de que um direito limitado por sua funo: ele existe enquanto socialmente til40.
Se h severas criticas a viso do privilegio de inveno como direito de
propriedade, tambm h aqueles que consignam a inexistncia de um modelo nico do instituto, sendo o mesmo grande gnero de muitas espcies.
Dessa forma, ainda que tenhamos o aludido direito como propriedade, a licena compulsria, como veremos a seguir, serve exatamente
como garantia funo social da patente.

5.2 >

Antes de adentrarmos a seara das licenas obrigatrias, uma viso
sistemtica constitucional nos parece til compreenso do instituto
que labora com o vis necessidade social versus interesse privado41.
Na observncia do axioma da supremacia do interesse pblico42
h alguns institutos no ordenamento jurdico ptrio que se assemelham
ao instituto objeto do estudo:
* Requisio (artigo 5, XXV da CF) - O apossamento consiste numa atuao material, por meio da qual a AdministraomR3~EOLFDVHLQYHVWHVLFDPHQWHQRXVRHIUXLomRGDFRLVD

39

40

41

42

Tribunal de Justia do Estado do Rio de Janeiro, 2 Cmara Cvel, Apelao Cvel


de n 2001.001.14417, julgado em 27 de novembro de 2001.
BARBOSA, Denis Borges. Uma introduo propriedade intelectual. Rio de Janeiro: Lumen Juris, 2003, pg. 499.
O trecho seguinte foi parcialmente inserido no artigo 8PDYLVmRSURSHGrXWLFDGR
OLFHQFLDPHQWRFRPSXOVyULRGHSDWHQWHVIDUPDFrXWLFDV, no prelo, de BARBOSA, Pedro Marcos Nunes.
A maioria reconhece a necessidade de subordinar o princpio manchesteriano de
DXWRQRPLDGDYRQWDGHiUHOHYkQFLDGREHPS~EOLFR, FACHIN, Luiz Edson. Teoria
Crtica do Direito Civil. Ed. Renovar, Rio de Janeiro, 2003, p. 2.

199

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

que poder ser mvel ou imvel43.


* Emprstimos Compulsrios (artigo 154 da CF) A unio
SRGHUiLQVWLWXLU,,QDLPLQrQFLDRXQRFDVRGHJXHUUDH[WHUna, impostos extraordinrios, compreendidos ou no em sua
FRPSHWrQFLDWULEXWiULDRVTXDLVVHUmRVXSULPLGRVJUDGDWLYDmente, cessadas as causas de sua criao.
* Expropriao (artigo 243 da CF) As glebas de qualquer
UHJLmRGRSDtVRQGHIRUHPORFDOL]DGDVFXOWXUDVLOHJDLVGHSODQWDV
SVLFRWUySLFDVVHUmRLPHGLDWDPHQWHH[SURSULDGDVHHVSHFLFDPHQte destinadas ao assentamento de colonos, para o cultivo de proGXWRVDOLPHQWtFLRVHPHGLFDPHQWRVVHPTXDOTXHULQGHQL]DomRDR
SURSULHWiULRHVHPSUHMXt]RGHRXWUDVVDQo}HVSUHYLVWDVHPOHL
* Desapropriao (artigo 184 da CF) Compete Unio
desapropriar por interesse social (...) mediante prvia e justa
LQGHQL]DomR

Entre os institutos ora consignados, a licena compulsria se assemelharia mais com a desapropriao, pois h a devida retribuio
pecuniria. No entanto, como discorreremos abaixo, o titular da tecnologia no perde a posse de seu bem, suprimindo-se, to somente, a
exclusividade ao direito.
A licena compulsria vem a resolver um problema prtico: a concorrncia entre o titular da patente e do licenciado compulsrio minorar os preos dos produtos farmacuticos44.
No entanto, o Brasil tem uma parca histria no uso de um mecanismo to hbil ao problema crnico dos medicamentos.
Na prtica, o problema da judicializao excessiva dos pleitos que
visam acesso aos medicamentos poderia ser resolvido com a expedio
de algumas licenas compulsrias.
Contudo, inovando na histria nacional, atravs da Portaria
886/2007 do Ministrio da Sade, foi objeto de licena obrigatria, recentemente, o medicamento Efavirenz.
43

44

JUSTEN FILHO, Maral. Curso de Direito Administrativo. So Paulo: Editora Saraiva, 2005, pg.417.
'DtVXUJHRSUREOHPDGRDFHVVR3RUTXHKiXPDJUDQGHTXDQWLGDGHGHLQGLYtGXRVTXH
no tem possibilidades de pagar o preo que se estipula por bens essenciais. Deste modo,
DOyJLFDGRPHUFDGRSURYRFDXPDH[FOXVmRTXHUHGXQGDLQWROHUiYHOSDUDRVYDORUHVMXUtdicos. LORENZETTI, Ricardo Luis. Fundamentos do direito privado, 1998, p. 99.

200

Pedro Marcos Nunes Barbosa

Segundo dados do SUS, o Efavirenz medicamento importado


mais utilizado na terapia anti-retroviral. Atualmente 38% dos pacienWHVXWLOL]DPHVVHPHGLFDPHQWR(VWLPDVHTXHDWpRQDOGH
mil, das 200 mil pessoas em terapia anti-retroviral estaro usando esse
IiUPDFR$OpPGLVVRDSURJUDPDomRGHFRPSUDSDUDVRPHQWH
do Efavirenz 600mg, ao custo atual (US$ 1,59/comprimido) equivale a
US$ 42.930.000, ou seja, cerca de US$ 580 por paciente/ano45.
1RHQWDQWRRSUHoRSUDWLFDGRSHOD0(5&.HUDPDLRUTXH
era estipulado em outros pases, como a Tailndia. Aps longa negociaomRFRPRWLWXODUDSURSRVWDGHUHGXomRGHGRYDORUMXQWRFRPD
necessidade pblica envolvida resultaram no licenciamento compulsULRFRPRSDJDPHQWRGHHPUR\DOWLHV
Com tal licena, estima-se que o valor economizado pelo Estado
atinja a marca de US$236.852.000,00.
Tal constatao no importa numa mera anlise econmica do
direito46 s avessas, mas sim na apurao de que o direito do dono da
patente pode e em alguns casos deve ser mitigado de modo a garantir valores existenciais dos no proprietrios.

5.3 as farmcias magistrais


As normas atinentes propriedade industrial no se limitam a cuidar apenas das licenas obrigatrias no que diz respeito aos direitos
de terceiros.
No dispositivo seguinte aos direitos do titular do privilgio de inveno, a LPI47 prev - em seu artigo 43 - diversos casos onde o direito
de excluir no incidir.
Numa das hipteses cuidou o legislador de retirar do escopo da
patente a incidncia dos medicamentos preparados pelas farmcias
de manipulao. Tal exceo tem como fundamento a necessidade de
45

46

47

http://portal.saude.gov.br/portal/aplicacoes/noticias/noticias_detalhe.cfm?co_seq_
QRWLFLD , acessado em 20.04.2008, s 19:29.
Tal perspectiva, prescindindo da credibilidade dos resultados aplicativos, criWLFiYHOHPVLFRPRPHWRGRORJLDSHODVXDXQLODWHUDOLGDGHHSHODVXEVWDQFLDOIXQo individualista, materialista e conservadora certamente em contraste com a
legalidade constitucional: o mercado no critrio autnomo de legitimidade,
in PERLINGIERI, Pietro Luigi. O direito civil na legalidade constitucional. Rio de
Janeiro: Renovar, 2008, p. 106.
Lei 9.279/96.

201

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

elaborao personalizada do frmaco cada cliente, de modo que, diferentemente daquele fabricado em escala industrial, no haveria uma
concorrncia direta entre o dono da patente e o dono da farmcia.
A mens legis foi de permitir a oponibilidade patentria apenas queles que podem ser legitimamente excludos do acesso concorrncia.
Tal questo j foi objeto de percuciente anlise pelo Poder Judicirio:
De um lado, inegvel a proteo constitucional aos direitos
do titular de patente; de outro, deve ser prestigiado e preservado,
pela sua alta relevncia social, o direito constitucional sade e
o acesso aos instrumentos que lhe asseguram. O legislador ordinrio previu a atividade das farmcias de manipulao, que so
instrumento relevante de acesso personalizado a medicamentos.
3DUD HVVH P LQVWLWXLX H[FHomR DR SULYLOpJLR FRQFHGLGR DR WLtular de patente, mediante a excluso do regime de proteo,
a atividade desenvolvida nesse seguimento. Trata-se, pois, de
limitao imposta ao direito de propriedade do titular de patente,
motivada, repita-se, por razes de sade pblica, de alta relevncia social. (...) Diante desses dispositivos, de ordem pblica,
no se pode conferir s patentes da segunda agravada o efeito
de impedir as farmcias de manipulao e seus fornecedores de
comercializarem as substncias objeto do privilgio.

Tribunal Regional Federal da 2 Regio, 2 Turma Especializada,


Ds. Andr Fontes, AI 2008.02.01.015342-7, 15.10.2008.
O interesse pblico sempre pender para o direito ao acesso do que
pela simples tutela propriedade. Contudo, movimentos corriqueiros por
parte dos titulares de patente tm vedado o livre desenvolvimento das
farmcias magistrais, no que tange a importao dos princpios ativos48.

5.4 WEs/^
Outro instituto concebido pelo legislador de modo a conciliar os interesses dos titulares com os da sociedade foi a introduo do dispositivo
legal (artigo 229-C) na Lei 9.279/96, que outorgou a necessidade de oitiva
48

 &RPRH[HPSORGHWDODWXDomRGHVWDFDPRVDPHGLGDDMXL]DGDSHOD6DQR$YHQWLV
nos autos de n. 2008.61.19.006267-8, perante a 1 Vara Federal de Guarulhos.

202

Pedro Marcos Nunes Barbosa

da ANVISA antes da concesso patentria peculiar matria farmacutica.


Tal previso foi extremamente impugnada pelos titulares de pedidos de patente, que no queriam uma dupla anlise de mrito no procedimento concessrio.
Contudo, o Judicirio tem se posicionado de modo a garantir o interesse pblico ao acesso, ao revs do interesse privado da patente.
No h como dissociar do interesse social a sade pblica, englobando todas as polticas pblicas empreendidas nessa rea,
dentre as quais as polticas de acesso aos medicamentos por
parte das coletividades mais desfavorecidas da populao. A
ANVISA TEM ATRIBUIO LEGAL PARA EXAMINAR OS
PEDIDOS DE PATENTE DE PROCESSOS E PRODUTOS
FARMACUTICOS SUBMETIDOS AO INPISRUVHU$JrQFLD
destinada a zelar pela adequada concesso de patentes no setor
de remdios, prevenindo prejuzos s polticas governamentais de
sade decorrentes de patentes irregularmente concedidas.
Tribunal Regional Federal da 2 Regio, 1 Turma Especializada,
JC. Mrcia Helena Nunes, AMS 2004.51.01.513854-7, 15.17.2008.

Portanto, conclu-se que o ordenamento pertinente propriedade


industrial segue atenta a matriz constitucional de estabelecer, apenas
em casos excepcionais um bice a livre concorrncia no que tange os
medicamentos.
Tal como nas previses afeitas ao direito ordinrio de proprieGDGHQDVHDUDGRVEHQVLPDWHULDLVRSRGHUS~EOLFRGHYHVFDOL]DURXVR
adequado dos poderes privados de modo a garantir o equilbrio desejado para com o interesse pblico.

5.5 W: 
A mera existente de uma patente concedida faz com que seu titular
costumeiramente abuse do seu direito de excluir: um preo fora da
realidade da prpria necessidade de lucrar.
Com o advento dos genricos no Brasil49DPpGLDGRSUHoRQDOGR
SURGXWRREMHWRGHXPDSDWHQWHH[SLUDGDFRVWXPDFDLUQRPtQLPR
razo pela qual se faz mister indagar acerca do lucro obtido pelos donos
49

Lei 9.787/99.

203

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

de patente e seus efeitos nefastos perante o direito de acesso.


Trazemos baila alguns exemplos50 de patentes em vigor, seu objeto, e seu preo disponvel ao consumidor:
PI 1101036-3, medicamento ALIMTA usado no tratamento de
Cncer de Pulmo, ao custo de R$6.824,59.
PI 1100090-2, medicamento TRACLEER usado no tratamento
de Hipertenso Arterial Pulmonar, ao custo de R$14.653,00.
PI 1100238-7, medicamento que trata de Acromegalia, ao custo
de R$7.410,33.

A primeira concluso que se atinge ao analisar os valores envolviGRVpRIDWRGRSURGXWRHVWDUQDVSUDWHOHLUDVQmRVLJQLFDKDYHUUHDO


disponibilidade ao consumo.
No se cuida aqui de produtos fungveis, ou de algo que se admite
outra tecnologia, razo pela qual o paciente poder, apenas, escolher
entre vida e morte, sendo que a primeira lhe ser imposta a um custo
alto, e, na maioria das vezes, simplesmente inatingvel per se.
Provavelmente, em grande parte dos casos, nem mesmo o Estado
poder arcar com a despesa para possibilitar o acesso aos cidados.
Dessa forma, uma sada possvel para no excluirmos queles que
QmRSRVVDPDGTXLULUXPIiUPDFRYLWDORXPXPLFDUWRWDOPHQWHRRUoDmento do Estado, seria estabelecer um paradigma de no incidncia da
patente alm dos preceitos do artigo 43 da Lei 9.279/96.
Contudo, o carter taxativo do referido artigo defendido com
unhas e dentes por parte da doutrina51, que se baseia entre outros
fundamentos no artigo 13 do Acordo TRIPS52.
Por outro lado, a melhor doutrina consigna que Tratando-se de
50

51

52

Tais informaes esto disponveis no stio: http://www.consultaremedios.com.br/,


acessado em 08.09.2009 s 17:01.
Como regra geral, uma vez que o artigo acima trata de excees aos legtimos
direitos do titular da patente, suas disposies devem ser interpretadas de modo restrito, in, DANNEMANN. Comentrios Lei da propriedade industrial e correlatos.
Rio de Janeiro: Renovar, 2001, p. 106
Os Membros restringiro as limitaes ou excees aos direitos exclusivos a deterPLQDGRVFDVRVHVSHFLDLVTXHQmRFRQLWHPFRPDH[SORUDomRQRUPDOGDREUDHQmR
SUHMXGLTXHPLQMXVWLFDYHOPHQWHRVLQWHUHVVHVOHJtWLPRVGRWLWXODUGRGLUHLWR

204

Pedro Marcos Nunes Barbosa

restries a uma norma excepcional, como a das patentes, as limitaes so interpretadas extensamente, ou melhor, com toda a dimenso
QHFHVViULDSDUDLPSOHPHQWDURVLQWHUHVVHVTXHSUHWHQGHPWXWHODU53.
Subscrevemos a viso segundo a qual o rol do artigo 43 da Lei
9.279/96 meramente enumerativa; e, para a satisfao de um ncleo
de direitos indisponveis como a sade pblica e a dignidade da pessoa
humana, tal como as exigncias da Lei 1060/50, deveria ser estabelecido - na ponderao casustica entre princpios - uma inoponibilidade da
patente queles que no podem pagar por seu objeto.
Tal medida no prejudicaria em demasia o dono da patente, mesmo
porque a pessoa em questo no faz parte de sua clientela, mas carece
imediatamente do acesso a tecnologia.
Certamente tal soluo no agradar os amantes da economia enquanWRIRQWHLQXHQWHGDVQRUPDVPDVDproteo dos direitos por vezes
UHTXHUGHFLV}HVTXHGRSRQWRGHYLVWDGDHFRQRPLDVmRLQHFLHQWHV54.
6H R GLUHLWR GH SDWHQWH QmR VLJQLFD HP VL TXDOTXHU DEXVR VHX
exerccio monopolstico de modo a ultrajar preos um avilte sociedade, carecendo de coibio pelo Estado, ou ponderao casustica pela
inaplicabilidade pelo Poder Judicirio.

6. CONCLUSO
Conclumos com as palavras de CORTIANO segundo o qual a
FRPSUHHQVmRGRGLUHLWRGHSURSULHGDGHSDVVDSRUVDEHURTXHHVWiVHQdo oculto, e que no pode ser exposto por conta das prprias limitaes
do discurso. Essa a perspectiva que deve ser usada pelo professor e
pelo aluno: tentar desvendar o que no se mostra. Onde se fala em proSULHWiULRHQFRQWUDURQmRSURSULHWiULRTXDQGRVHFXLGDGDSURSULHGDde, visualizar as propriedades; no momento em que se alude tutela da
propriedade, pensar as tutelas de acosse propriedade55.
A clssica teoria dos bens hoje inaplicvel posto que foi parida de cos-

53

54

55

BARBOSA, Denis Borges. Uma introduo propriedade intelectual. Rio de Janeiro: Lmen Jris, 2003, p. 484.
in PERLINGIERI, Pietro Luigi. O direito civil na legalidade constitucional. Rio
de Janeiro: Renovar, 2008, p. 106.
Eroulths, p. 262.

205

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

tas para o presente56, e, para remediarmos os aviltes histricos aos valores


da personalidade e defendermos o Direito, preciso renov-lo57, interpretando-o em prol do interesse comutativo entre a seara privada e a pblica.
Portanto, a propriedade industrial pode ser um dos instrumentos
hbeis ao direito de acesso, seja pelo uso da licena compulsria, pela
aplicao das excees aos direitos de patente, ou pelo meio mais raro:
a oponibilidade comedida por parte de seu titular.

7. BIBLIOGRAFIA
ARNAUD, Andr-Jean e M Jos Farias Dulce. Introduo Anlise Sociolgica dos Sistemas Jurdicos. Rio de Janeiro; Editora Renovar, 2000.
BARBOSA, Denis Borges. Uma introduo propriedade intelectual. Rio de Janeiro: Lumen Juris, 2003.
BARBOSA, Pedro Marcos Nunes Barbosa. A Proteo dos Dados de
Testes Sigilosos Submetidos Regulao Estatal. Revista Criao. II
ed. Rio de Janeiro: Lumen Juris, 2009.
BOBBIO, Norberto. Era dos direitos. Rio de Janeiro: Campus, 2004.
CORTIANO, Eroulths Junior. O Discurso Jurdico da Propriedade
seus Rupturas: Uma Anlise do Ensino do Direito de Propriedade. Rio
de Janeiro; Editora Renovar, 2002.
FACHIN, Luiz Edson. Teoria Crtica do Direito Civil. Ed. Renovar,
Rio de Janeiro, 2003.
__________. Estatuto Jurdico do Patrimnio Mnimo. Ed. Renovar, Rio de Janeiro, 2006
GAMA, Guilherme Calmon Nogueira da. Princpios Constitucionais
de Direito de Famlia. So Paulo: Editora Atlas, 2008.
HART, Herbert L. A. O Conceito de Direito.
JUSTEN FILHO, Maral. Curso de Direito Administrativo. So Paulo: Editora Saraiva, 2005.
KOSHIBA, Luiz. Histria do Brasil. 7. ed. So Paulo: Atual Editora,
1996, p. 4
56

57

FACHIN, Luiz Edson. Teoria Crtica do Direito Civil. Ed. Renovar, Rio de Janeiro; 2003, p. 11.
Idem, p. 321.

206

Pedro Marcos Nunes Barbosa

LISPECTOR, Clarice. A hora da estrela. Rio de Janeiro: Rocco, 1998.


MORAES, Maria Celina Bodin de. Constituio e Direito Civil:
tendncia. Rio de Janeiro: PUC-Rio, Revista do Departamento de
Direitos.
_________. Danos Pessoa Humana: uma leitura civil-constitucional
dos danos morais. Editora Renovar; Rio de Janeiro, 2003.
PERLINGIERI, Pietro. 3HUVGR'LUHLWR&LYLO,QWURGXomRDR'LUHLWR
Civil Constitucional. Editora Renovar; Rio de Janeiro, 2007.
________. O direito civil na legalidade constitucional. Rio de Janeiro: Renovar, 2008.
SARLET, Ingo Wolfgang. $LQXrQFLDGRVGLUHLWRVIXQGDPHQWDLVQR
direito privado: o caso brasileiro, Coimbra: Almedina, 2007.
TEPEDINO, Gustavo Jos Mendes. e FACHIN, Luiz Edson. O direito
e o tempo: embates jurdicos e utopias contemporneas. Rio de Janeiro:
Renovar, 2008.

207

ESTADO CONSTITUCIONAL
E PARTIDOS POLTICOS:
Sistemas e crises
Ubirajara Coelho Neto1
Resumo:Essenciais democracia representativa, at h pouco tempo, a
existncia dos partidos polticos desenvolveu-se fora da Constituio e
mesmo das leis. As tipologias dos sistemas partidrios so examinadas
VREGLYHUVDVSHUVSHFWLYDVVHQGRTXHQRSUHVHQWHWUDEDOKRFDUHPRVUHVWULWRVDRDVSHFWRQXPpULFRXWLOL]DQGRDFODVVLFDomRGRVVLVWHPDVSDUWLdrios em unipartidarismo, bipartidarismo e pluripartidarismo. Estudaremos os principais atores polticos na Democracia participativa, quais
sejam os partidos polticos e os diversos grupos de presso (associaes,
reunies, lobbies, sindicatos); alm do que, torna-se imprescindvel a
anlise da nova atuao popular por meio dos mecanismos de democracia semidireta e uma reformulao no mecanismo de atuao partidria.
Palavras-chave:Democracia representativa; partidos polticos; grupos de presso.
Abstract:Essential to representative democracy until recently, the existence of political parties developed outside of the Brazilian Constitution,
and even of the Law. The typology for party systems is examined under
various perspectives, although the present work keeps its scope limited
WRWKHDVSHFWRIQXPEHUVWKURXJKWKHXVHRIWKHFODVVLFDWLRQRIV\VWHPV
into single-party, two-party and multi-party systems. The main political actors within the participative Democracy are studied regardless of
parties or pressure groups (associations, committees, lobbying, unions);
moreover, the vital analysis of the new popular action via semi-direct
democracy means, and a reform in the mechanisms of party action.
Key Words:Representative democracy; political parties; pressure groups.

Professor Adjunto da Universidade Federal de Sergipe (Graduao e Mestrado).


Especialista em Direito Constitucional (UFMG), Mestre em Direito Constitucional
(UFMG) e Doutor em Direito Constitucional (UFMG). Ex. Professor adjunto da
UFRN, da UFT e da UFMG. Avaliador Institucional e de Cursos do MEC/INEP.

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

1. INTRODUO
$GLFXOGDGHGHH[HUFHURJRYHUQRGLUHWDPHQWHSHORSRYRWRUQDLPSUHVcindvel a existncia de representante para que possa govern-lo. Alienando
parte de sua liberdade, coloca-se, o povo, administrao de seus escolhidos.
Considerados hoje como essenciais democracia representativa,
at h pouco tempo, a existncia dos partidos polticos desenvolveu-se
fora da Constituio e mesmo das leis, desde que os textos constitucionais escritos e as leis os ignoravam.
O exame dos partidos polticos est ligado ao dos regimes contemporneos, desde que guardam estreita relao com os sistemas
partidrios, que podem variar em funo do nmero de partidos que
compem o processo.
As tipologias dos sistemas partidrios so examinadas sob diversas
SHUVSHFWLYDVVHQGRTXHQRSUHVHQWHWUDEDOKRFDUHPRVUHVWULWRVDRDVSHFWRQXPpULFRXWLOL]DQGRDFODVVLFDomRGRVVLVWHPDVSDUWLGiULRVHP
unipartidarismo, bipartidarismo e pluripartidarismo.
No se pode tratar da democracia contempornea, democracia social, democracia de massas, democracia representativa, sem aludir aos
partidos polticos, intermedirios entre a nao e a representao. At
hoje no se descobriu maneira melhor de dar representao ao povo
seno atravs dos partidos polticos.
A evoluo coordenada pela necessidade histrica de maior proximidade e participao popular na tomada das decises polticas torna necessrio o estudo dos principais atores polticos na Democracia
participativa, quais sejam os partidos polticos e os diversos grupos de
presso (associaes, reunies, lobbies, sindicatos); alm do que, torna-se imprescindvel a anlise da nova atuao popular por meio dos mecanismos de democracia semidireta e uma reformulao no mecanismo
de atuao partidria.
No Brasil no h tradio partidria, seja pelo exagerado personalismo que domina a vida poltica brasileira e a dos prprios partidos, levando ao desapreo pelos programas e diretrizes partidrias, seja pelo acentuado regionalismo que tem servido de base e orientado a sua formao.
Analisaremos diversos ngulos diferentes da relao do dinheiro e
da poltica, ou seja, um dos assuntos mais importantes da democracia,
das suas qualidades e das possibilidades da reproduo de uma frmula
que permita a expresso e a coexistncia de uma sociedade complexa.

210

Ubirajara Coelho Neto

A nossa principal inteno demonstrar at onde possvel perceber


os riscos existentes na competio democrtica que os partidos inevitavelmente enfrentam como seus grandes agentes, quase sempre prisioneiros do mercado ou, at mesmo, de grupos de interesse que opera margem da legalidade. que os partidos precisam urgentemente de proteo
GDVSUHVV}HVLQFRUSRUDGDVRXLOHJDLVDGYLQGDVGDVXDGHSHQGrQFLDQDQceira com centros ou grupos de poder econmico, social ou institucional.

2. ESTADO CONSTITUCIONAL E PARTIDOS POLTICOS


O problema de governar por representantes surge do princpio de
que cada um possui aspiraes sobre as caractersticas dos governantes.
Como as preferncias no so totalmente discrepantes entre os indivduos, aparecem grupos que se organizam em torno de determinadas
ideias. Essas ideias so postas a averiguao dos governados. Se essas
FRUUHQWHVORVyFDVIRUHPFRPSDWtYHLVFRPVXDVDVSLUDo}HVGDPDLRria, eleger-se- um representante ligado aquele grupo. O representante
do povo est escolhido. A funo do partido poltico est nascida.2
So considerados como produto dos costumes e da tradio, fruto
da experincia da nao e no resultado da ao formal de qualquer
autoridade legalmente constituda.
Segundo ORLANDO DE CARVALHO, os partidos polticos:
s aparecem nas Constituies no meado do sculo XX. Na Constituio de Weimar, de 1919, h referncia apenas representao
proporcional dos partidos. Na Itlia de 1946, h trs artigos sobre
os partidos polticos, mas uma novidade. Estamos diante de coisa
nova nas instituies do Estado Moderno. De maneira que os partidos polticos se apresentam hoje como indispensveis ao Estado
democrtico moderno e integram a estrutura do poder. (...).3

A legislao brasileira, no que se refere aos partidos polticos, vistos sob a perspectiva do Direito Constitucional moderno, apresenta-se
como precursora.
2
3

COELHO NETO, Ubirajara. Estado Constitucional e Partidos polticos.


CARVALHO, Orlando. Os Partidos Polticos e a legitimao do processo poltico
brasileiro, p. 61.

211

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

preciso que saibamos colocar os partidos polticos dentro dos regimes polticos democrticos, para que eles sejam representativos das foras
SROtWLFDVPRGHUQDV1mRGHYHPSHUGHUDLQXrQFLDQDVJUDQGHVWUDQVIRUPDes que esto surgindo, nem deixar que os grupos de presso e de interesses ocupem os seus lugares, pela omisso e desajustes dos mesmos.
Os partidos polticos so considerados como essenciais democracia
representativa, desde que so elementos fundamentais na dinmica de
sua estrutura jurdico-poltica. Constituem um dos fenmenos mais caractersticos dos Estados modernos.

2.1 C
Para que a representao possa bem servir a democracia h de ser sempre atual. Tal atualidade dependeria de uma renovao dos representantes a
todo o instante? No, porque h um novo objeto, de validade comprovada,
de tornar a representao uma situao sempre legal: os partidos polticos.
$TXLHVWDPRVWUDWDQGRGDUHSUHVHQWDomRHPVHQWLGRHVSHFtFRTXDO
seja a representao que depende de eleio.
Dentro da verdadeira democracia tm os polticos de fundar partidos
que estejam em comunho permanente com o povo. S assim, sentindo o
povo dia a dia os lideres polticos, atravs dos partidos, podero servir
'HPRFUDFLDSURMHWDQGRQDiUHDHVSHFtFDGDDWXDomRGRVUHSUHVHQWDQWHV
do povo os anseios renovados das diversas camadas sociais.
Nas palavras de SAHID MALUF,
FRXGHPRQVWUDGRTXHRVLVWHPDGHPRFUiWLFRUHSUHVHQWDWLYR
consiste, formal e substancialmente, numa organizao estatal
fundada na existncia de partidos polticos, considerados como
rgos de coordenao e manifestao da vontade popular, visto
que todo poder emana do povo e em seu nome ser exercido.4

Nas palavras de JOS AFONSO DA SILVA, o partido poltico


uma forma de agremiao de um grupo social que se prope organizar,
FRRUGHQDU H LQVWUXPHQWDU D YRQWDGH SRSXODU FRP R P GH DVVXPLU R
poder para realizar seu programa de governo.5
Segundo PIETRO VIRGA, so associaes de pessoas com uma
4
5

MALUF, Sahid. Teoria Geral do Estado, p. 303.


SILVA, Jos Afonso da. Curso de Direito Constitucional Positivo, p. 397.

212

Ubirajara Coelho Neto

ideologia ou interesses comuns, que, mediante uma organizao estYHO 3DUWHL$SSDUDW PLUDPH[HUFHULQXrQFLDVREUHDGHWHUPLQDomRGD
orientao poltica do pas.6 A funo dos partidos polticos tem dois
aspectos principais: a) a organizao do eleitorado com o propsito de
obter uma maioria; b) a manuteno de uma conexo contnua e responsvel entre os representantes e os comcios de uma eleio a outra.
Para JOS AFONSO DA SILVA,
a doutrina, no geral, admite que os partidos tm por funo
fundamental organizar a vontade popular e exprimi-la na busca
de poder, visando a aplicao de seu programa de governo. Por
isso, todo partido poltico deveria estruturar-se vista de uma
LGHRORJLDGHQLGDHFRPXPSURJUDPDGHDomRGHVWLQDGRjVDWLVfao dos interesses do povo.7

Desde meados do sculo XVII quando surgiram os dois grandes


partidos ingleses, que os mesmos ocuparam alternadamente o governo
britnico at meados do sculo XIX, a cincia poltica ignorou a existncia dos partidos polticos. Tal que em 1850 nenhum outro pas
do mundo, com exceo dos Estados Unidos e Inglaterra conhecia
partidos polticos no sentido moderno da palavra: havia tendncia de
opinies, clube popular, associaes de pensamentos, grupos parlamentares, porm no partidos propriamente ditos. Acontece que os
partidos polticos no se desenvolveram seno quando se estabeleceu
de maneira duradoura o regime representativo e o seu progresso foi
paralelo ao da ideia democrtica.
No atual desenvolvimento da cincia poltica no mais possvel discutir a funo essencialssima que os partidos polticos cumprem na democracia representativa, cuja dinmica requer indispensavelmente a existncia
HRIXQFLRQDPHQWRGDTXHOHVDWpPHVPRDSRQWRGHMXVWLFDUDTXDOLFDomR
de governo de partidos que alguns costumam atribuir hoje democracia.
6HJXQGR.(/6(1DGHPRFUDFLDVLJQLFDLGHQWLGDGHGHGLULJHQtes e dirigidos, do sujeito e objeto (povo) do poder, do Estado, e governo do povo para o povo. E como h uma distino ntida entre a
SDUFHOD GR SRYR VHP RSLQLmR QHP FULWpULR SUySULR REHGHFH D LQXncia de outros que inspirem uma direo ao processo de formao
6
7

VIRGA, Pietro. Libert Giuridica e Diritti Fondamentali, p. 243.


SILVA, Jos Afonso da. Curso de Direito Constitucional Positivo, p. 404.

213

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

da vontade coletiva. Tal investigao conduz ao descobrimento dos


partidos polticos. A democracia moderna descansa sobre os partidos
SROtWLFRVFXMDVLJQLFDomRFUHVFHFRPRIRUWDOHFLPHQWRSURJUHVVLYR
do princpio democrtico.
A existncia dos partidos polticos resulta da mesma essncia das
instituies democrticas. A democracia supe a diversidade de opinies com relao a poltica que o Estado dever seguir.
A representao poltica e a eleio no Estado constitucional pressupe a existncia de partidos polticos no pas e a possibilidade da
constituio de partidos polticos, livres e iguais, na vida poltica nacional um dos cnones fundamentais do regime constitucional. Em todo
o Estado h necessariamente diversidade de tendncias, de interesses,
de opinies sobre os assuntos do Estado, sobre as medidas legislativas,
DGPLQLVWUDWLYDVHQDQFHLUDVDDGRWDUFRPRWDPEpPHPJHUDOTXDQWRj
orientao poltica do governo.
Para OLIVEIRA BARACHO,
os partidos polticos so considerados como essenciais democracia representativa, desde que so elementos fundamentais na
dinmica de usa estrutura jurdico-poltica. Constituem um dos
fenmenos mais caractersticos dos Estados modernos.8

2.2 Z
A defesa de um Estado Democrtico pretende, precipuamente,
afastar a tendncia humana ao autoritarismo e concentrao de poder.
Como ensina VERGOTTINI, o estado autoritrio, em breve sntese,
caracteriza-se pela concentrao no exerccio do poder, prescindindo
do consenso dos governados e repudiando o sistema de organizao
liberal, principalmente a separao das funes do poder e as garantias individuais.9
DUVERGER, ao analisar a complexidade da conceituao da DePRFUDFLDQRVDSRQWDTXHDGHQLomRPDLVVLPSOHVHPDLVUHDOLVWDGH
democracia: regime em que os governantes so escolhidos pelos governados; por intermdio de eleies honestas e livres.10
8
9
10

BARACHO, Jos Alfredo de Oliveira. Teoria Geral dos Partidos Polticos, p. 22.
VERGOTTINI, Giuseppe de. Diritto Costituzionale Comparato, p. 589.
DUVERGER, Maurice. Os partidos polticos, p. 387.

214

Ubirajara Coelho Neto

Destaca FERREIRA FILHO que, de fato:


D'HPRFUDFLDQRSODQRSROtWLFRTXHpDPi[LPDLGHQWLFDo dos governantes e dos governados, implica num estatuto do
poder. Um estatuto tal que os governantes sejam a imagem dos
governados, para a seguir concluir que a Democracia, como
Proteu, muda freqentemente de aparncia. Quem tentar examiQiODQRSRUPHQRUQDPDLRUSDUWHGDVYH]HVFDUiGHVQRUWHDGR
Depois de haver consagrado tantos captulos Democracia, ei-la
que retorna com uma nova roupagem.11

2(VWDGR'HPRFUiWLFRGH'LUHLWRTXHVLJQLFDDH[LJrQFLDGHUHJHU-se por normas democrticas, com eleies livres, peridicas e pelo povo,
bem como o respeito das autoridades pblicas aos direitos e garantias
fundamentais, proclamado no caput do artigo 1 da Constituio da
Repblica Federativa do Brasil, que, adotou, igualmente, no seu pargraIR~QLFRRGHQRPLQDGRSULQFtSLRGHPRFUiWLFRDRDUPDUTXH7RGRR
poder emana do povo, que o exerce por meio de representantes eleitos ou
diretamente, nos termos desta Constituio, para mais adiante, em seu
artigo 14 proclamar que a soberania popular ser exercida pelo sufrgio
universal e pelo voto direto e secreto, com valor igual para todos, e, nos
termos da lei, mediante: plebiscito; referendo; iniciativa popular.
CANOTILHO e MOREIRA informam o alcance do princpio democrtico, dizendo que:
A articulao das duas dimenses do princpio democrtico justiFDDVXDFRPSUHHQVmRFRPRXPSULQFtSLRQRUPDWLYRPXOWLIRUPH
Tal como a organizao da economia aponta, no plano constitucional, para um sistema econmico complexo, tambm a conformao do princpio democrtico se caracteriza tendo em conta a
sua estrutura pluridimensional. Primeiramente, a democracia surge
como um processo de democratizao, entendido como processo
de aprofundamento democrtico da ordem poltica, econmica,
social e cultural. Depois, o princpio democrtico recolhe as duas
dimenses historicamente consideradas como antiticas: por um
11

FERREIRA FILHO, Manoel Gonalves. Os partidos polticos nas constituies dePRFUiWLFDVS&RQIHULUDLQGDVREUHDGHQLomRGHGHPRFUDFLD&$**,$12


Mnica Herman Salem. Sistemas eleitorais X representao poltica, p. 09.

215

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

lado, acolhe os mais importantes elementos da WHRULDGHPRFUiWLFD-representativa (rgos representativos, eleies peridicas, pluralismo partidrio, separao de poderes); por outro lado, d guarida a
algumas das exigncias fundamentais da teoria participativa (alargamento do princpio democrtico a diferentes aspectos da vida
econmica, social e cultural, incorporao da participao popular
directa, reconhecimento de partidos e associaes como relevantes
agentes de dinamizao democrtica, etc.).12

&RPRpSRVVtYHOYHULFDUDSDUWLUGR'LUHLWR&RQVWLWXFLRQDOPRGHUnamente a soberania popular exercida em regra por meio da Democracia Representativa, sem, contudo descuidar-se da Democracia Participativa, uma vez que so vrios os mecanismos de participao mais intensa
do cidado nas decises governamentais (plebiscito, referendo, iniciativa
popular), bem como so consagrados mecanismos que favorecem a existncia de vrios grupos de presso (direito de reunio, direito de associao, direito de petio, direito de sindicalizao).13
&$5/-)5,('5,&+GHQHDUHSUHVHQWDomRSROtWLFDFRPRVHQGR
RSURFHVVRSRUPHLRGRTXDODLQXrQFLDGHWRGDDFLGDGDQLD
ou parte dela, sobre a ao governamental, se exerce, com sua
aprovao expressa e em seu nome, por um pequeno nmero de
pessoas, com efeitos obrigatrios para os representados.14

Ressalte-se, porm, que a representao poltica no deve ser meramente terica, pois uma Democracia autntica e real exige efetiva participao popular nas decises governamentais, e, em especial, na escolha
de seus representantes. 0LVWHU se faz a adequao de mecanismos que
DPSOLHPDHFiFLDGDUHSUHVHQWDWLYLGDGHVHMDPSUHYHQWLYRVDSDUWLUGH
um maior interesse do cidado nas eleies, sejam repressivos, por meio
de prticas de democracia semidireta, pois, como adverte DALLARI,
... a crise da democracia representativa pode gerar regimes autoritrios, pois se o povo no tem participao direta nas decises polti12
13

14

CANOTILHO, J. J. Gomes e MOREIRA, Vital. Fundamentos da constituio, p. 195.


Como salienta Dalmo Dallari, a atividade de governo essencialmente poltica e
s por inconscincia ou demagogia que algum, participando de um governo, pode
DUPDUVHDSROtWLFR O renascer do direito, p. 93).
FRIEDRICH, Carls J. Gobierno Constitucional Y Democracia, p. 16 e segs.

216

Ubirajara Coelho Neto

cas e se, alm disso, no se interessa pela escolha dos que iro decidir
HPVHXQRPHLVVRSDUHFHVLJQLFDUTXHRSRYRQmRGHVHMDYLYHUHP
regime democrtico, preferindo submeter-se ao governo de um grupo
que atinja os postos polticos por outros meios que no as eleies.15

^
Segundo FVILA RIBEIRO, o exame dos partidos polticos est
ligado ao dos regimes contemporneos, desde que guardam estreita relao com os sistemas partidrios, que variam em funo do nmero de
partidos que compem o processo.16
As tipologias dos sistemas partidrios so examinadas sob diversas
perspectivas, sendo que para o presente estudo usaremos apenas a que diz
respeito ao nmero de partidos.
Para OLIVEIRA BARACHO,
PXLWDVGDVFODVVLFDo}HVGRVVLVWHPDVSDUWLGiULRVDFRPRGDP-se a trs sistemas: pluripartidarismo, bipartidarismo e unipartidarismo. Mas convm salientar que dentro destas frmulas
ocorrem outras denominaes como sistema de bipartidarismo
puro, sistema de partidarismo imperfeito, sistema de multipartidarismo com partido dominante.17

Em virtude da proposta acima apresentada, trs so os sistemas partidrios. O sistema de partido nico, que inerente ao Estado autoritrio moderno; sistema de dois partidos ou bipartidarismo; e sistema de
vrios partidos, ou pluripartidarismo.
H um consenso geral de que o Estado constitucional supe um dos
dois ltimos sistemas de partidos.

^
O sistema de partido nico ou unipartidarismo, no parece compatvel com a democracia, que um regime de discusso, de dilogo e de
15
16
17

DALLARI, Dalmo de Abreu. O renascer do direito, p. 131.


RIBEIRO, Fvila. Direito Eleitoral, p. 230.
BARACHO, Jos Alfredo de Oliveira. Regimes polticos, p. 243.

217

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

diversidade; no pode seno servir ditadura de uma maioria, a mido


mais aparente que real e para ns a democracia puramente majoritria,
ou oriental, ou massiva, como se costuma dizer, no democracia.
O sistema de partido nico s encontra clima institucional possvel
para a sua existncia e operao dentro da concepo do estado autoritrio ou desptico, e chegou a seu apogeu no perodo compreendido
entre as duas grandes guerras mundiais. Como adverte DUVERGER
geralmente se considera o partido nico como a grande inovao poltica do sculo XX18, o que institui um erro. De fato se a ditadura
velha como o mundo, a ditadura partidria apoiada em um partido
constitui um sistema novo.
Na Europa foi a Rssia o primeiro pas que levou a prtica o sistema do partido nico em 1917; a Turquia, em 1919; a Itlia (perodo
Fascista) em 1919; a Alemanha em 1919 (Partido Nacional Socialista);
Portugal (Unio Nacional) em 1933; a Espanha, com a Falange.

^
Descartado o sistema unipartidrio, no plano do Estado constitucional unicamente cabe discutir as vantagens e inconvenincias do bipartidarismo e do pluripartidarismo.
Para DUVERGER,
RELSDUWLGDULVPRVXSULPHRVFRQLWRVVHFXQGiULRVOHYDQGRWRdas as oposies a exprimirem-se no quadro de um antagonismo
fundamental, ao passo que o multipartidarismo aumenta os conLWRVVHFXQGiULRVHIUDFLRQDRVJUDQGHVDQWDJRQLVPRV19

Segundo GIOVANNI SARTORI, tomado por seu valor aparente:


o pluralismo partidrio indica simplesmente a existncia de mais
de um partido; mais a conotao a de que os partidos no plural
so o produto do pluralismo. Mas o fato de que a legitimao e o
funcionamento normal do pluralismo partidrio se baseia na aceitao do pluralismo tout court, sem adjetivos, continua sendo um
fator secundrio. No contribui para explicar, entre outras coisas,
por que os sistemas partidrios se desenvolveram de uma deter18
19

DUVERGER, Maurice. Introduo Poltica, p. 107.


DUVERGER, Maurice. Introduo Poltica, p. 109.

218

Ubirajara Coelho Neto

minada maneira, nem o papel que o sistema partidrio chegou a


desempenhar dentro do sistema poltico geral.20

A realidade que nesta matria, como de vista em todas as demais


GD FLrQFLD SROtWLFD QmR FDEHP DUPDo}HV JHQpULFDV H FRQFOXGHQWHV
pois o que pode parecer exato ou conveniente para uma nao em um
momento determinado, pode no s-lo para outro pas ou para este mesmo Estado em outro instante de seu futuro histrico.
2V IDWRUHV JHRJUiFRV UDFLDLV SROtWLFRV KLVWyULFRV HFRQ{PLFRV
VRFLROyJLFRVHWFSRGHPLQXLUGHFLVLYDPHQWHHPXPRXRXWURVHQWLGR
Se bem que a existncia e a operao de dois partidos fortes e orgnicos, como ocorre nos Estados Unidos e na Inglaterra, impressiona muito favoravelmente, desde o ponto de vista das transcendentais funes
que incumbem a operaes partidrias como verdadeiros instrumentos
de governo, cabe no deixar de ter em conta a necessidade de que possam operar outros partidos, de modo que a diversidade de opinies e
WHQGrQFLDVSRVVDPUHHWLUPDLVHOPHQWHQDGLQkPLFDLQVWLWXFLRQDO+i
de assinalar-se, por outra parte, que o sistema de dois partidos, cujos expoentes tpicos so os pases anglo-saxes, na realidade no se d com o
mximo de pureza, j que nos Estados Unidos e Inglaterra, ao lado dos
grandes partidos, atuam outros ainda de importncia muito desigual.

^
Inobstante o desconhecimento total que por longo tempo adotou o
direito positivo com relao aos partidos polticos, eles vingaram como
realidade sociolgica.
Para XIFRAS HERAS, O partido se manifesta sempre como uma orJDQL]DomRGHXPJUXSRVRFLDOTXHVHSURS}HLQXLUQDRULHQWDomRSROtWLFD21
1RSODQRVRFLROyJLFRHVVDRUJDQL]DomRGHQVSROtWLFRVUPRXVH
no meado do sculo XIX. O legislador do Estado Liberal prefere ignor-la, reputando-a como um fenmeno extra constitucional, ainda que
no Direito Constitucional encontrasse sua base de sustentao como
forma de exerccio da liberdade de associao.
A sociedade uma necessidade natural do homem, e derivada da sua
natureza social, conforme j sustentava ARISTTELES no IV sculo a.C.
20
21

SARTORI, Giovanni. 3DUWLGRVH6LVWHPDV3DUWLGiULRV, p. 39.


HERAS, Jorge Xifras. Curso de Direito Constitucional, p. 202.

219

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

S um bruto ou um Deus dizia isto , algo menor ou algo mais que um


homem pode existir fora da convenincia social. E esse carter necessrio
da sociedade aparece corroborado pelo fato histrico, s que ainda em pocas mais remotas se encontram agrupaes humanas, as mais rudimentares
e imperfeitas possveis, porm agrupaes e nunca indivduos isolados.
7DOREVHUYDomRpVXFLHQWHSDUDFRPSUHHQGHURDSDUHFLPHQWRGDV
DVVRFLDo}HVSURVVLRQDLVFXOWXUDLVGHVSRUWLYDVHRTXHLQWHUHVVDDJRUD
as associaes polticas, de que se originaram os partidos polticos.
A existncia dos partidos explica-se, ento, no como anomalia ou
enfermidade dos povos, mas, ao contrrio, pela natural diversidade de
ideias, sentimentos e interesses que dividem aos homens em toda a sociedade culta e civilizada.
No entanto, as Constituies liberais sequer se referiam ao partido
poltico, realidade sociolgica inevitvel como vimos. Ao redor delas
formou-se verdadeira conspirao do silncio. Perdurava, por conseguinte, no fundo de todas essas omisses o ressentimento pregado por
ROUSSEAU a respeito dos partidos.
Antes que se operasse a transio de nossos dias (a crescente valori]DomRGRVSDUWLGRVFRPRRPDLVVLJQLFDWLYRHYHQWRQDIXQomRGRVPHFDnismos democrticos contemporneos), os partidos polticos constituam
ento apenas um fenmeno sociolgico, desprovido de contedo jurdico.
Os partidos, como instituies extralegais pertencem ainda a uma
concepo de democracia contra a qual eles bracejam ou inertem e que
vem a ser a democracia liberal. O lugar dos partidos polticos, porm
no Estado social, na democracia de massas, aonde chegam plenitude
do seu poder e reconhecimento jurdico.
Negar, porm acolhimento constitucional aos partidos polticos nos
VLVWHPDV FRQWHPSRUkQHRV VLJQLFD VLPSOHVPHQWH VHJXQGR .(/6(1
fechar os olhos realidade.
Com efeito, o surto constitucional do primeiro ps-guerra quebrou o tabu
segundo o qual as constituies no deveriam referir-se aos partidos polticos.
Doravante, o que temos visto o legislador constituinte variar
daquela posio de indiferena aos partidos para sancionar corajosamente a nova realidade poltico-partidria como realidade constituFLRQDO2VSDUWLGRVVHWRUQDPFDGDYH]PDLVLQVWLWXLo}HVRFLDLVTXH
recebem subsdios de agncias governamentais e se convertem, pois,
em rgos do poder estatal.
Na Inglaterra, por mais paradoxal que seja, pois tal pas foi o pioneiro
da organizao partidria, das democracias que mais retardadas se apre220

Ubirajara Coelho Neto

sentam ainda no reconhecimento legal daquelas organizaes, visto que ali,


conforme assinala FIELDS, citado por BONAVIDES, nenhum ato do Parlamento ou deciso judicial mencionou jamais o nome dos partidos polticos,
entidade, por conseguinte destitudas de direitos e obrigaes legais.22
&RPRGHVWDFD67$55GLVWDPXLWRGHIDODUVHFODUDPHQWHGHQLGR
o status legal dos partidos polticos nos Estados Unidos. Por um lado,
encontramos um vasto corpo legislativo e jurisprudencial que verdadeiramente erige a agrupao partidria em um ramo do governo. Por outro
lado sua situao parecida com a imperante na Inglaterra, com os partidos polticos praticamente sem regulamentao, salvo o disposto por leis
encaminhadas a controlar as agrupaes subversivas, tendo em vista ainda coibir fraudes e abusos nas convenes e eleies, bem como tolher
a perverso do sufrgio pelo suborno eleitoral. que a Constituio no
menciona direta nem indiretamente os partidos polticos; seus fundadores no previam a ulterior existncia dos partidos polticos.
1RHQWDQWRYHULFDVHTXHIRLGDGRDRSDUWLGRSROtWLFRQDWRWDOLGDGH
das constituies recentes um status legal indiscutvel.
$&RQVWLWXLomREUDVLOHLUDGHFRQVDJURXGHQLWLYDPHQWHRVLVtema democrtico do pluripartidarismo, assegurando a liberdade de
criao, fuso, incorporao e extino de partidos polticos. Os limites
dessa liberdade situam-se no resguardo da soberania nacional, do regime democrtico, do pluralismo e dos direitos fundamentais da pessoa
humana (art. 17, da CF/88).
Os partidos polticos adquirem personalidade jurdica na forma da
lei civil, e registraro seus estatutos no Tribunal Superior Eleitoral (art.
17, 2, da CF/88).
Isto posto, no resta dvida sobre a natureza institucional dos partidos. O Cdigo Eleitoral de 1950 j declarava os partidos polticos como
pessoas jurdicas de direito pblico interno, dando-lhes j personalidade jurdica desde o seu registro pelo Tribunal Superior Eleitoral.
Atualmente, a Lei n. 9.096, de 19 de setembro de 1995, que dispe
sobre partidos polticos e regulamenta os arts. 17 e 14, 3, inciso V, da
Constituio Federal de 1988, transformou o partido poltico em pessoa
jurdica de direito privado, destinado a assegurar, no interesse do regime democrtico, a autenticidade do sistema representativo e a defender
RVGLUHLWRVIXQGDPHQWDLVGHQLGRVQD&RQVWLWXLomR)HGHUDO23
22
23

BONAVIDES, Paulo. Direitos Polticos e Partidos Polticos.


Cdigo Eleitoral. p. 118 e ss.

221

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

(VWDSRVLomRpD~QLFDTXHQmRHQWUDHPFRQLWRFRPDUHDOLGDGH
sociolgica subjacente. De fato o partido deve ser considerado como
instituio. O seu ato de criao instaura uma situao permanente
que fonte de direitos e obrigaes, de relaes jurdicas diversas,
VXVFHWtYHLV GH YDULDomR SRLV QmR VmR GHWHUPLQDGDV GHQLWLYDPHQWH
(VVH DWR Gi RULJHP D XP RUJDQLVPR FRP XP P GLVWLQWR TXH QmR
se confunde com os interesses de seus membros considerados como
indivduos, o que permite subordinar os direitos e os interesses priYDGRVDRVQVTXHRRUJDQLVPRVHSURS}HDDWLQJLU(PDLVIRUWLFD
um poder de direo comum s Assembleias e ao corpo eleitoral que
talvez a principal das funes que os partidos polticos exercem,
segundo HAURIOU.24
Do ponto de vista jurdico o partido se apresenta, portanto, como
Instituio. Os estudos a respeito dos partidos no devem de forma alJXPDFDUUHVWULWRjGLVFLSOLQDMXUtGLFDPDVWDPEpPDSRQWDURVVHXV
pontos de contato com os motivos que determinam o seu surgimento.
$VPRGLFDo}HVSDUWLGiULDVQmRSRGHPH[FOXLUQHPDVSHUVSHFWLYDVMXrdicas, nem as polticas, nem mesmo as sociais.
A institucionalizao de qualquer sistema partidrio no deve conter-se, apenas, dentro de suas caractersticas formais. Representando as
bases eleitorais diferenciadas, os quadros partidrios tm de acompanhar o dinamismo social, para que possam responder as aspiraes da
sociedade contempornea.
3RUPpSUHFLVRTXHVDLEDPRVLQVHULURVSDUWLGRVGHQWURGRVUHgimes polticos democrticos, para que eles sejam representativos das
foras polticas modernas. No devem de maneira alguma perder a inXrQFLDTXHH[HUFHPQDVJUDQGHVWUDQVIRUPDo}HVTXHHVWmRVXUJLQGR
nem mesmo deixar que os grupos de presso e de interesses ocupem os
seus lugares, pela omisso e desajuste dos mesmos.


Diferentemente do Estado Liberal, onde o Poder Legislativo enquanto detentor da vontade geral do povo predominava dentre os
demais poderes, a partir do Estado Social, o Poder Executivo vem
assumindo, cada vez mais, o papel de grande empreendedor das polticas governamentais, relegando a um segundo plano o Parlamento
24

HAURIOU, Andr. Derecho Constitucional e Instituies Polticas.

222

Ubirajara Coelho Neto

e, consequentemente, os partidos polticos, e fazendo surgir, com


mais fora e vitalidade, por absoluta necessidade, outros atores da
competio poltica.
Assim, a ideia bsica do Estado Liberal, onde a crena da soberania popular e da representao poltica permaneciam intocveis,
como instrumentos infalveis da participao da sociedade no poder,
foi afastada pela chegada do Estado Social, como bem salientado por
COMPARATO, demonstrando, claramente, que diante das grandes
transformaes socioeconmicas, os representantes do povo muito
pouco decidem e os que decidem carecem de grande representatividade poltica.25
O problema central da representao poltica, portanto, acaba por
consistir na impossibilidade de aferir-se compatibilidade entre a vontade popular e a vontade expressa pela maioria parlamentar.
Dentre outras importantes causas, poder-se-ia apontar trs primordiais
para esse distanciamento entre representantes e representados: o desvirtuamento da proporcionalidade parlamentar, o total desligamento do parlamentar com seu partido poltico e a ausncia de regulamentao na atuao dos grupos de presso perante o Parlamento.26
A crise representativa demonstra uma maior necessidade de reaproximao do povo com o governo, ou seja, dos representados com os
representantes.27
A reaproximao do povo com o governo traz novamente tona
o combate entre as ideias de representante-delegado e representanteGXFLiULR$SULPHLUDLGHLDFRQVLVWHQRPDQGDWRLPSHUDWLYRGHIHQGLGR
por ROSSEAU, apontando que a soberania:
no pode ser representada, pela mesma razo que no pode ser
alheada. Consiste essencialmente na vontade geral, e esta vontade no se representa. a mesma ou outra, e nisto no h
termo mdio. Os deputados do povo no so, pois, nem podem
COMPARATO, Fbio Konder HODOL%UDVLOVRFLHGDGHGHPRFUiWLFD, p. 398.
 0DXULFH'XYHUJHUHPUHODomRjUHSUHVHQWDomRSROtWLFDDUPDTXHRSUREOHPD
fundamental consiste em medir o grau de exatido da representao, isto , o grau
de coincidncia entre a opinio pblica e a sua expresso parlamentar (Os partidos polticos, p. 406).
27
Dalmo de Abreu Dallari faz consciente anlise da crise do Estado e crise de Governo:
O renascer do direito, p. 96 e segs. Conferir, ainda, sobre a crise e deformao do sistema representativo: SILVA, Jos Afonso da. Perspectivas do direito pblico, p. 145.
25

26

223

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

ser seus representantes, so simplesmente seus comissrios que


QmRHVWmRDSWRVDFRQFOXLUGHQLWLYDPHQWH7RGDOHLTXHRSRYR
SHVVRDOPHQWHQmRUHWLFRXpQXODHQmRpXPDOHL2SRYRLQJOrV
pensa ser livre e engana-se. No o seno durante a eleio dos
membros do Parlamento. Uma vez estes eleitos, torna-se escravo e nada mais . Nos curtos momentos de sua liberdade, o uso
que dela faz bem merece que a perca.28

A Segunda consiste na ideia de mera representao, com caractersWLFDVEHPGHQLGDVFRPRUHVVDOWDGRSRU%2%%,2


as democracias representativas que conhecemos so democracias
nas quais por representante entende-se uma pessoa que tem duas caractersticas bem estabelecidas: a) na medida em que goza da conDQoDGRFRUSRHOHLWRUDOXPDYH]HOHLWRQmRpPDLVUHVSRQViYHOSHrante os prprios eleitores e seu mandato, portanto, no revogvel;
b) no responsvel diretamente perante os seus eleitores exatamente porque convocado a tutelar os interesses gerais da sociedade
civil e no os interesses particulares desta ou daquela categoria.29

1HVVHVHQWLGR'$//$5,DUPDTXH
indispensvel que se queira, efetivamente, melhorar o sistema
representativo. Como evidente, a manuteno de falhas e dos
vcios aumenta o descrdito dos corpos representativos e o conseqente desinteresse popular pelas eleies.30

A crise no sistema representativo faz com que haja o crescimento


das reivindicaes pela desburocratizao das prticas e das organizaes da representao poltica, para que os processos decisrios tendam
a uma maior informalidade e participao da vontade geral. Paralelamente a essa crise das instituies polticas, desenvolve-se uma grave
28
29
30

ROUSSEAU, Jean-Jacques. O contrato social, p. 105.


BOBBIO, Norberto. O futuro da democracia, p. 42.
Nesse mesmo sentido salienta Mnica Caggiano, ao analisar a representao poltiFDDUPDQGRKDYHUQHFHVVLGDGHGHQRYDDERUGDJHPGDPHFkQLFDUHSUHVHQWDWLYD
agora j no mais quanto a tica do veculo, mas colocando sob mira precisa e direta
as tcnicas utilizadas no mbito do processo pelo qual o povo intervm no jogo poltico, selecionando e indicando seus representantes (CAGGIANO, Mnica Herman
Salem. Sistemas eleitorais & representao poltica, p. 02).

224

Ubirajara Coelho Neto

e sria crise das formas de trabalho, da organizao econmica, das


relaes dos vrios setores do capital, do sistema empresarial, do sistema sindical, do papel do Estado no sistema produtivo. Essas ideias
somadas acabam por desaguar, inexoravelmente, na crise dos partidos,
do engrandecimento dos movimentos sociais e no neocorporativismo.
A crise partidria caracteriza-se, basicamente, pela incapacidade
GRV SDUWLGRV HP OWUDU DV GHPDQGDV H UHFODPRV VRFLDLV H WUDQVIRUm-las em decises polticas. Conforme j ressaltado, a crescente
presena do Estado na ordem econmica e o crescimento da burocracia estatal terminaram por fazer dos partidos meros indicadores
de burocratas para a ocupao de cargos de relevncia e no mais
verdadeiros defensores dos ideais populares pelos quais seus representantes foram eleitos.
Desta forma, o partido poltico deixa de constituir-se no nico, e
talvez deixe tambm de constituir-se no mais importante, coletor das
aspiraes populares e direcionador das decises polticas do Estado.
Em virtude disso, FRIEDRICH, aps analisar inmeras formas de
representao poltica, aponta seus diversos problemas e conclui pela necessidade de uma reformulao na ideia de fundar a democracia na representao poltica territorial - representantes/representados - entendendo necessria uma maior participao popular, por meio de grupos de presso.31
A partir do declnio do sistema representativo poltico, surgem diversos grupos de participao poltica que, juntamente com os partidos
polticos, tornam-se importantes atores da competio, pois, como lembra CAGGIANO que,
RTXHVHEXVFDKRMHQDUHDOLGDGHpDLGHQWLFDomRPi[LPDHQtre sujeitos e titulares do poder, porquanto nos moldes democrticos deve restar assegurado aos prprios governados o exerccio
do poder poltico.32

A ausncia de correspondncia da Democracia meramente representativa aos anseios populares, portanto, abriu caminho para a democracia
participativa, onde os grupos de presso surgem para exigir seu espao no
cenrio do exerccio do poder poltico.
31
32

FRIEDRICH, Carls J. Gobierno Constitucional Y Democracia, p. 16 e segs.


CAGGIANO, Mnica Herman Salem. Sistemas eleitorais & representao poltica,
p. 06.

225

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

Na democracia participativa inevitvel a ideia de existncia de


grupos de presso que passam a dividir com os partidos polticos a participao no processo decisional. Essa maior participao eleva os custos da democracia, por provocar a politizao dos diversos segmentos
sociais, porm diminui os riscos externos da deciso ser afastada por
ausncia de legitimidade popular.
Portanto, a partir da crise enfrentada pelo sistema representativo,
bem como pela acentuada substituio do Estado Liberal pelo Estado
Social, deixa o partido poltico de ser o nico ator nas decises governamentais, passando a atuar paralelamente com as associaes gerais,
DVDVVRFLDo}HVHVSHFLFDPHQWHFRPQDOLGDGHVSROtWLFDV lobbies), os
grupos institucionais (sindicatos), os grupos annimos e a prpria imprensa. A par desse ingresso da democracia participativa na tomada
de decises governamentais, valorizam-se os instrumentos de participao mais direta do povo nas decises polticas, revitalizando-se os
institutos do plebiscito, referendo e iniciativa popular de lei.
(VVDFRQVWDWDomRpFRQUPDGDSRU)%$',$DROHPEUDUTXH
j h algum tempo, os cientistas da poltica vm dispensando
ateno cada vez com maior freqncia e com um maior coQKHFLPHQWRGRDVVXQWRjLQXrQFLDTXHDVIRUoDVHFRQ{PLFDV
sociais, espirituais organizadas vem exercendo sobre todos os
regimes polticos, na sua atividade legislativa e governamental,
mas em especial sobre os regimes de democracia pluralista. Em
anos recentes, houve uma proliferao de estudos sobre essa
questo, em particular nos pases anglo-saxnicos e na Frana,
para concluir que a cada ambiente histrico, cultural, econmico e social ou institucional, correspondem - segundo SARTORI
- grupos de presso que, em certo sentido, sero nicos, isto ,
correspondero aos sistemas em que operam.33



A Constituio Federal regulamentou os partidos polticos, como


instrumentos necessrios e importantes para preservao do Estado
33

BADIA, F. Partidos - grupos de presso, p. 21.

226

Ubirajara Coelho Neto

'HPRFUiWLFR GH 'LUHLWR DUPDQGR D OLEHUGDGH GH FULDomR IXVmR LQcorporao e extino de partidos polticos, resguardados a soberania
nacional, o regime democrtico, o pluripartidarismo, os direitos fundamentais da pessoa humana e observados os preceitos de carter nacioQDO SURLELomR GH UHFHELPHQWR GH UHFXUVRV QDQFHLURV GH HQWLGDGH RX
governo estrangeiros ou de subordinao a estes; prestao de contas
Justia Eleitoral e funcionamento parlamentar de acordo com a lei.34
A necessidade de organizao de partidos polticos surge com a
perspectiva de racionalizao do poder, que, conforme salienta FERREIRA FILHO, ,
segundo MIRKINE-GUTZVICH, o pai da expresso, um
esforo para enfermer dans le rseau du droit crit lensemble
de la vie politique, concluindo que foi ela, inicialmente, uma
tentativa de suprir, por meio de regras jurdicas, a ausncia das
condies necessrias ao desenvolvimento da Democracia.35

Os partidos polticos so instrumentos necessrios e importantes


para preservao do Estado Democrtico de Direito, devendo o ordenamento jurdico consagrar plena liberdade de criao, organizao, funcionamento e extino.36
Porm, a crise do sistema representativo encontra-se umbilicalmente ligada crise dos partidos, pois, conforme salienta REALE JNIOR:
34

35

36

Raul Machado Horta, ao analisar historicamente a importncia do surgimento dos


Partidos Polticos, recorda que o funcionamento do regime de governo fortemente
LQXHQFLDGRSHODDWXDomRGRVSDUWLGRVSROtWLFRVHPXLWDVYH]HVHVVDLQXrQFLDDOWHUDDV
regras jurdicas que estruturam o regime nas normas constitucionais... A emergncia
do Partido Poltico deslocou o centro das decises no regime parlamentar. Mathiot
assinalou que o elemento essencial do parlamentarismo continental europeu, como no
regime parlamentar, de modo geral, reside na responsabilidade do Governo perante
a Cmara, enquanto no parlamentarismo britnico a atuao dos Partidos Polticos
PRGLFRXDUHODomRSDUDWRUQDUDUHVSRQVDELOLGDGHSROtWLFDGHQDWXUH]DHOHLWRUDOHQmR
apenas parlamentar (Estudos de direito constitucional, p. 704).
FERREIRA FILHO, Manoel G.. 2VSDUWLGRVSROtWLFRVQDVFRQVWLWXLo}HVGHPRFUiticas, p. 21.
Ensina Manoel Gonalves Ferreira Filho que conseqncia lgica da concepo
molecular da Democracia, a liberdade de criao dos partidos consagrada pela
ordem constitucional democrtica..... Adotam assim a tese pluralista, considerando
que a possvel fragmentao da vontade poltica do povo um mal menos grave do
que a sua apropriao por um grupo, que logo degenerar em oligarquia (Os partiGRVSROtWLFRVQDVFRQVWLWXLo}HVGHPRFUiWLFDV, p. 114).

227

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

enquanto na Europa vive-se a crise da democracia dos partidos,


partidos de massa que se revelam incapazes de satisfatoriamente
aglutinar os segmentos sociais, de se fazerem intrpretes das aspiraes concretas, veculos imprprios para efetiva participao poltica, no Brasil mister iniciar a obra da ligao entre a Sociedade
Civil e o Estado pelo fortalecimento dos partidos polticos.37

A Democracia de partidos, portanto, apresenta diversos problemas


que devem ser solucionados e adequados aos novos mtodos polticos,
desde a prpria existncia de democracia interna at a prpria imposio majoritria de suas ideias em respeito aos direitos da minoria.38
Os partidos polticos e o prprio jogo democrtico, portanto, enquanto instrumentos de formao e expresso da vontade poltica poSXODUGHYHPVRIUHUDOJXQVDSULPRUDPHQWRVVHPSUHFRPDQDOLGDGH
j ressaltada de aproximao da vontade do povo quela expressa pelo
Parlamento.
Esse aprimoramento inicial deve surgir em relao s regras de participao partidria e acesso disputa de cargos eletivos, uma vez que
nossa Constituio Federal somente permite a elegibilidade por meio
GHOLDomRSDUWLGiULD39
DALMO DALLARI refora os defensores da necessidade de uma
reforma poltica urgente, acrescentando que:
o interesse popular s vir com a melhoria do sistema de escolha dos representantes. E para que isso ocorra indispensvel
um debate amplo e sem condicionamentos prvios, para que da
SUySULDUHDOLGDGHEURWHPVROXo}HVGHQDGDDGLDQWDQGRD[DomR
WHyULFDHDUWLFLDOGHSUHFHLWRVHGLUHWUL]HVPXLWRERQVHPWHVH
mas completamente desligados da realidade.40
37
38

39

40

REALE JR, Miguel. Casos de Direito Constitucional, p. 113.


Antonio DAntena salienta a necessidade de tutelarem-se os interesses polticos da
PLQRULDQRVLVWHPDPDMRULWiULRDUPDQGRLQFOXVLYHDVXEVWLWXLomRGDH[SUHVVmR
princpio majoritrio pela expresso princpio majoritrio-minoritrio (Il PrinFLSLR'HPRFUDWLFR1HO6LVWHPD'HL3ULQFLSL&RVWLWX]LRQDOL. Perspectivas ConstituFLRQDLV1RVDQRVGDFRQVWLWXLomRGH, p. 446).
O sistema eleitoral brasileiro na atualidade analisado por Clmerson Merlin Clve
(Temas de direito constitucional, p. 91).
DALLARI, Dalmo de Abreu. O renascer do direito, p. 132. Conferir, ainda,
sobre a necessidade de uma Reforma urgente: TEMER, Michel. Constituio e
poltica, p. 32.

228

Ubirajara Coelho Neto

DUVERGER nos aponta alguns problemas relacionados demoFUDFLDGHSDUWLGRVDUPDQGRTXH


DHVWUXWXUDLQWHUQDGRVSDUWLGRVSRGHPRGLFDUPXLWRSURIXQdamente, esse estado de coisas. Os partidos de quadros, que
QmRWHPEDVHQDQFHLUDVyOLGDHYLYHPHPSHUSpWXDVGLFXOGDdes de dinheiro, so sempre sensveis aos candidatos que cusWHLDPRVJDVWRVGDFDPSDQKDRFLDOPHQWHRSDUWLGRHVFROKH
o candidato; praticamente, a investidura se obtm sem granGHVGLFXOGDGHV2JUDXGHFHQWUDOL]DomRGRSDUWLGRH[HUFH
LJXDOPHQWHLQXrQFLDVREUHDOLEHUGDGHGDVFDQGLGDWXUDV(P
partidos descentralizados, os candidatos so escolhidos no esFDOmRORFDOSRUGLUHWyULRVTXHVRIUHPIDFLOPHQWHDLQXrQFLD
das personalidades da terra; nos partidos centralizados, em que
a direo nacional aprova as candidaturas, a investidura partidria se obtm menos facilmente.41

Essa maior democracia interna nos partidos polticos evitaria a indesejada proliferao partidria, com a criao de inmeros partidos sem
qualquer mensagem ideolgica ou social, simplesmente como meras
legendas de aluguel, que ao invs de fortalecerem a Democracia acabam por fragiliz-la e ridiculariz-la perante o eleitorado.42
Essa fragilizao da Democracia, em virtude da proliferao partidria,
WDPEpPpVDOLHQWDGDSRU'$//$5,DRYHULFDURSUHVVXSRVWRGHTXH
cada partido poltico representa um diferente ponto de vista
quanto a aspectos bsicos da organizao social ou quanto
orientao poltica do Estado, e, logo aps, concluir que intil do ponto de vista poltico, e sem qualquer autenticidade, um
sistema de partidos que, alm de no serem veculos de ideias e
aspiraes, so muito semelhantes entre si e no tm qualquer
41
42

DUVERGER, Maurice. Os partidos polticos, p. 393.


A multiplicao partidria criticada por Ferreira Filho da seguinte forma: Na
verdade, salvo casos excepcionais de partidos programticos, o partido visto no
Brasil como um instrumento, e nada mais do que isso, para a conquista do poder, ou,
talvez, mais precisamente, para o acesso ao poder. Aquele que pretende alcan-lo,
elegendo-se governador, ou Presidente da Repblica, entra para um dos grandes, o
que o mais das vezes se tornaram grandes por terem sido o partido do governo ou o
partido da oposio em visas de se tornar governo. (O parlamentarismo, p. 83).

229

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

LQWHUIHUrQFLDQDVPRGLFDo}HVGDHVWUXWXUDVRFLDOHPXLWRPHQRV
na composio e orientao do Governo.43

Concordamos, pois, com a crtica feita por FERREIRA FILHO, em


UHODomRjPXOWLSOLFDomRLQQLWDGRVSDUWLGRVDRH[SRUTXHDVGHPRFUDFLDV
QmR SUHWHQGHP FRQWXGR HVWLPXODU D PXOWLSOLFDomR LQQLWD GRV
pequenos partidos. Ao mesmo tempo em que deixam a porta aberta formao de novos partidos correspondendo a novas ideias,
a novas necessidades, tentam impedir a constituio de pequenas
faces, de pequenos grupos inexpressivos, mas, por vezes, perigosos. De fato, tais grupos so mais facilmente corrompidos pelo
GLQKHLURRXFRQTXLVWDGRVSRUXPDFDPDULOKDGRTXHGHXHPLQterferncias indevidas no processo de formao da vontade geral.
Em si mesma, a multiplicidade dos partidos um obstculo ao
funcionamento do regime parlamentar, pois, se nenhum dos partidos tem a maioria absoluta, os governos so necessariamente de
coalizo e, em conseqncia, quase tbios e instveis.44

Relacionados esses problemas de organizao partidria, retorna-se


ideia da necessidade de equacionamento de um dos grandes problemas da
democracia representativa: a ausncia de regulamentao na atuao dos
grupos de presso perante o Parlamento e outros rgos do Governo. O
citado problema representa to grave perigo democracia representativa
e aos partidos polticos que ser tratado em tpico autnomo.


Impotncia e abandono por parte dos partidos polticos, caracterizando
uma crise na democracia representativa, fazem com que os diversos grupos
sociais se dirijam direta ou indiretamente aos governantes para exigir destes uma determinada posio poltica ou poltico-legislativa ou para opor-se a j adotada, criando-se os denominados grupos de presso.
Dessa forma, esses grupos de interesse ou de promoo passam
por um crescimento quantitativo e qualitativo surpreendente, pois todo
43
44

DALLARI, Dalmo de Abreu. O renascer do direito, p. 134.


FERREIRA FILHO, Manoel Gonalves. 2VSDUWLGRVSROtWLFRVQDVFRQVWLWXLo}HVGHPRFUiticas, p. 114.

230

Ubirajara Coelho Neto

grupo social que se veja prejudicado em seus objetivos corporativos,


e abandonados em razo do distanciamento de seus representantes no
Parlamento, passa a procurar mecanismos, nem sempre legais ou moUDOPHQWHDFHLWiYHLVSDUDLQXHQFLDUGLUHWDPHQWHDV,QVWLWXLo}HVGR(VWDGRRXLQGLUHWDPHQWHDRSLQLmRS~EOLFDSDUDTXHLVVRUHLWDQDVGHFLses governamentais. Obviamente, os procedimentos de presso sero
mais ou menos variados, dependendo do tipo de meios de participao
QDYLGDS~EOLFDH[LVWHQWHVGDTXDOLFDomRGRVLQWHJUDQWHVGRJUXSRGH
SUHVVmRHGHVXDVLWXDomRHFRQ{PLFDQDQFHLUD
Esse fenmeno tornou-se mais latente porque os recentes e modernos interesses sociais so pouco amoldveis nas arcaicas estruturas partidrias tradicionais.
Importante salientarmos alguns fatores sociais que contribuem para
D FULVH SDUWLGiULD WDLV FRPR SHUGD GH FHQWUDOLGDGH GR FRQLWR HQWUH
trabalho e capital; excessiva fragmentao dos interesses sociais; fenmenos das agremiaes transitrias; perda da centralidade do circuito
governo-parlamento como itinerrio das decises polticas; reduo da
poltica econmica poltica conjuntural e de manobra monetria; acabaram por inspirar o surgimento e fortalecimento de diversos grupos de
interesse, de promoo e de presso.
Surgem, nesse contexto, os movimentos sociais que congregam vrios segmentos heterogneos da populao, passando a constiturem-se
formas de mobilizao que ocorrem fora do espao dos partidos polticos, das associaes e dos sindicatos.
Dessa forma, ocupam um espao poltico prprio, diverso dos tradicionalmente ocupados pelos demais atores da competio poltica,
utilizando-se de antigos e tradicionais direitos constitucionalmente consagrados: direito de reunio, direito de associao, direito de petio e
direito de sindicalizao.
Importante a observao de BADIA, para quem:
os grupos de interesse e de promoo crescem cada dia mais.
Ora, todo grupo de interesse ou de promoo que veja prejudicada
a sua razo de ser e seus objetivos por causa de extra-limitaes
do poder pblico ou da prepotncia de outros grupos de sua espcie, e que no ache meios adequados de participao poltica e
social para defender os seus interesses e as suas causas, ver-se-
REULJDGRDLQXHQFLDUGLUHWDPHQWHVREUHDVLQVWLWXLo}HVGR(VWDGR
SDUD VDOYDJXDUGDU VHXV REMHWLYRV SUySULRV RX HQWmR LQXHQFLDU
231

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

indiretamente sobre a opinio pblica, tornando-se dessa forma e circunstancialmente - um grupo de presso. Os procedimentos
de presso sero mais ou menos variados, dependendo do tipo de
maior de participao na vida pblica existentes.45

Ressalte-se, porm, que o grande problema dos movimentos sociais


reside na ausncia de mecanismos internos para aceitao de oposio
s ideias da maioria. Essa ausncia para reconhecer posies divergentes talvez seja a maior diferena entre os movimentos sociais e a representao poltica tradicional.46
Alm disso, as condutas e decises corporativas esto livres das
presses do processo eleitoral e da responsabilidade institucional das
decises polticas. Os arranjos corporativos implicam numa troca de
benefcios entre governo e as elites organizadas corporativamente. Essa
compensao de vantagens envolve, de um lado, a prestao de servios
estatais de natureza social, de outro, os crditos, subsdios. Atendem-se, com essa troca de benefcios, duas exigncias: legitimao poltica
mediante os servios pblicos e reproduo do capital atravs da gesto
poltica da economia.
1RFDVRGRVSDUWLGRVSROtWLFRVKiSRVVLELOLGDGHGH[DomRGDUHVSRQsabilidade de seus representantes, porm na democracia participativa exisWHJUDQGHGLFXOGDGHHPUHVSRQVDELOL]DURVGHPDLVDWRUHVGDFRPSHWLomR
HHPHVSHFLDORVJUXSRVGHSUHVVmR9HULFDVHSRLVXPDDXVrQFLDGHYLsibilidade. Necessrio, portanto, a regulamentao da atuao dos demais
atores da competio poltica, para que a tomada das decises possa se dar
em um quadro de maior visibilidade e transparncia.
A ampliao do cenrio poltico aceita a participao de atores inviVtYHLVRXVHMDTXHDFDEDPWHQGRLQXrQFLDQRSURFHVVRGHFLVyULRGDV
JUDQGHVTXHVW}HVSROtWLFRLQVWLWXFLRQDLVGRSDtVPDVVHPVHLGHQWLFDUR
que gera a total ausncia de responsabilidade. esse o grande problema
dos lobbiesSRLVVmRJUXSRVSURVVLRQDOL]DGRVTXHDWXDPQRVEDVWLGRres do poder, sem qualquer regulamentao e sem responsabilidade pelas
SUHVV}HVFDPXDGDVTXHH[HUFHP(VVHVJUXSRVDSHVDUGHHVWDUHPSRU
detrs de diversas decises polticas, no assumem qualquer responsabilidade por elas, sendo, pois, atores invisveis.
45
46

BADIA, F. Partidos - grupos de presso, p. 19.


Conferir: NATALE, Hugo E. Alvarez. Contribucion al estudio de los grupos de
interes, p. 32.

232

Ubirajara Coelho Neto

Os partidos polticos pretendem conquistar e exercer o poder, enquanto


RVJUXSRVGHSUHVVmRQmRWHQWDPLVVRSRLVSURFXUDPH[HUFHUXPDLQXrQcia sobre os poderes pblicos, em benefcio prprio, mas no substitu-los.
Diferentemente dos partidos polticos que so organizaes prprias de regimes democrticos ou que querem parecer-se democrticos,
os grupos de presso - em sua acepo mais lata - podem ser encontrados em todos os regimes (socialistas, democratas, totalitrios, etc.), em
todas as pocas.
Os grupos de presso agem por meio de dupla ao: a) presso direta
sobre o poder poltico; b) presso indireta sobre a opinio pblica.
A presso indireta exercida sobre o pblico e sobre os governantes,
sempre atentos opinio pblica. A opinio condiciona o comportamento dos governantes, especialmente nos regimes de democracia pluralista.
Todo o poder, independentemente do regime poltico, leva em considerao a opinio pblica. Nesse sentido, o interesse demonstrado pelos
grupos de presso em obter as simpatias da opinio pblica, pois, agindo
sobre o pblico pode-se agir diretamente sobre o poder.
2VJUXSRVGHSUHVVmRSRGHPVHUFODVVLFDGRVHPD JUXSRVGHPDVsa - so aqueles baseados no nmero; b) grupos de quadros - so aqueles
baseados no no nmero, mas sim na qualidade; e, c) escritrios ou orgaQL]Do}HVVmRRVJUXSRVGHSUHVVmRTXHVHGHGLFDPSURVVLRQDOPHQWHD
realizao de campanhas pblicas.
No raro os grupos de presso esto enxertados nos partidos. No
dizer de BONAVIDES, sua atividade introduz na ordem constitucional
um elemento novo de poder, que no se acha nos textos, e sem o qual o
VLVWHPDSDUWLGiULRSHORPHQRVFDULDLQWHOLJtYHO47
Referente a essa interpretao, PASQUINO vislumbra trs situaes:
D 2VJUXSRVGHSUHVVmRFRQWURODPRSDUWLGRQmRVyFRPRQDQciamento de campanha, mas chegando a escolher os dirigentes e
determinando a poltica a seguir, o que engessa a atuao partidria, impedindo combinaes que busquem um apoio mais amplo;
b) Os grupos de presso so dominados pelos partidos, o que
os impede de articularem autonomamente as questes atuais da
sociedade, ideologizando suas aes e diminuindo, assim, sua
capacidade de fazer compromissos, e
c) Existe identidade de interesses entre alguns grupos e alguns
47

BONAVIDES, Paulo. &LrQFLD3ROtWLFD, p. 429.

233

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

partidos sobre temas importantes, mas jamais sobre os temas politicamente relevantes, mesmo porque os programas partidrios
no so redutveis a to-somente as presses de grupos.48

'
A ao dos grupos sobre o processo poltico, conforme salienta ARAGO,
no um fato recente na histria da humanidade, pois os sistemas polticos da
antiguidade j o conheciam. Citando KARL DEUTSCH, o autor relembra que
os antigos reinos nos vales dos rios da ndia, Mesopotmia e Egito permitiram
dois grupos de presso: guerreiros e sacerdotes; os guerreiros pretendiam
tornar-se nobres o os sacerdotes aspiravam ser proprietrios de terras.49
Seria um erro evidente considerarmos o fenmeno dos grupos de
presso como sendo privativo do sculo XX, pois o sculo XIX oferece exemplos relevantes de presses. O que acontece que, no seio do
Welfare State aumentou enormemente a esfera de competncia dos poderes pblicos, que traz consigo a natural conseqncia da progressiva
dependncia dos governados e de seus interesses no processo decisrio
poltico. Da o aumento, em progresso aritmtica em alguns casos, em
outros geomtrica do nmero de grupos de presso que tentam defender
LQXLQGRRVVHXVLQWHUHVVHVSHUDQWHR(VWDGRRXDWUDYpVGR(VWDGR
Como salientado por LASSALLE50, os fatores reais do poder que
DWXDPQRVHLRGHFDGDVRFLHGDGHVmRHVVDIRUoDDWLYDHHFD]TXHLQIRUma todas as leis e instituies jurdicas vigentes, determinando que no
possam ser, em substncia, a no ser tal como elas so. A seguir o autor
indica vrios fatores reais do poder: Monarquia, aristocracia, a grande
burguesia, os banqueiros, a pequena burguesia e a classe operria. Por
PDUPDTXH(VVHpHPVtQWHVHHPHVVrQFLDD&RQVWLWXLomRGHXP
pas: a soma dos fatores reais do poder que regem uma nao.
Ocorre, entretanto, que esses fatores reais de poder, ao perceberem a ineFLHQWHUHSUHVHQWDWLYLGDGHSRSXODUGRVSDUWLGRVSROtWLFRVHFRQVHTXHQWHPHQte, dos parlamentares, acabam por organizarem-se em grupos de presso.
&RQIRUPHVHYHULFDKLVWRULFDPHQWHDDWXDomRRUJDQL]DGDGHJUXpos de presso sobre o Poder Legislativo no Brasil comprovada desde
RVpFXORSDVVDGRSRLVFRPRVDOLHQWDGRSRU6$1726DRH[HPSOLFDU
48
49
50

PASQUINO, Gianfranco. Grupos de Presso. p. 565.


ARAGO, Murillo. Grupos de presso no congresso nacional, p. 18.
LASSALLE, Ferdinand. 2TXHpD&RQVWLWXLomR"(VVrQFLDGDFRQVWLWXLomR.

234

Ubirajara Coelho Neto

os grupos de presso, a Associao Comercial da Bahia, entidade fundada em 1811, atuou em defesa de diversos interesses de seus associados junto ao Congresso Nacional durante a Primeira Repblica.51
HUGO NATALE, por sua vez, argumenta que a preponderncia dos grupos de presso e de poder constituem uma herana das intrigas de palcio.52
Na doutrina nacional, importante salientarmos a conceituao de
BONAVIDES53 e NUSDEO54. Para o primeiro, grupo de presso se deQHSHORH[HUFtFLRGHLQXrQFLDVREUHRSRGHUSROtWLFRSDUDHYHQWXDO
obteno de uma determinao da medida do governo que lhe favorea
os interesses, enquanto para o segundo, grupos de presso seriam deQLGRVFRPRTXDOTXHUFRQMXQWRGHSHVVRDVRXHQWLGDGHVTXHSURFXUD
obter normas, dispositivos e respectivas interpretaes, bem como medidas de um modo geral favorvel aos seus intentos.
Relembre-se o discurso do Vice-Presidente MARCO MACIEL, ento
Senador da Repblica, pronunciado em 21 de setembro de 1984, no SenaGR)HGHUDOGHQLQGRDRULJHPGRWHUPRlobby:
a atuao dos grupos de presso junto aos Poderes Executivo, Legislativo, Judicirio e aos Partidos Polticos conhecida,
como se sabe, segundo a expresso inglesa lobbyVLJQLFDQGR
as antecmaras ou ante-salas das reparties ou edifcios utilizados originalmente pelos representantes de tais organizaes
como locais onde desenvolviam, preferencialmente, o exerccio
de seus trabalhos. Do vocbulo derivaram lobbysts, que designa
pessoas que se dedicam quela atividade e lobbuyng, que exprime o procedimento dessa atividade.55

>

So visveis as ligaes entre grupos de presso e partidos polticos
QR%UDVLO2VJUDQGHVJUXSRVHFRQ{PLFRVQmRVyDSRLDPHQDQFLDPD
51
52
53
54
55

SANTOS, Mrio Augusto. Associao Comercial da Bahia na Primeira Repblica.


NATALE, Hugo E. Alvarez. Contribucion al estudio de los grupos de interes, p. 17.
BONAVIDES, Paulo. &LrQFLDSROtWLFD, p. 19.
NUSDEO, Fbio. O direito econmico e os grupos de presso.
MACIEL, Marco. Grupos de presso e lobby.

235

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

maioria dos partidos, como tm parlamentares e dirigentes partidrios


sados dos seus quadros. Exemplos mais claros so a Confederao Nacional da Indstria, a Federao das Indstrias de So Paulo e as associaes ruralistas, como a recentemente ressurgida Unio Democrtica
Brasileira, bem como as grandes empreiteiras nacionais, Odebrecht,
Andrade Gutierrez, entre outras.56
Os movimentos de trabalhadores, por sua vez, utilizam, no plano poltico, os partidos cujos parlamentares tenham sido apoiados eleitoralmente pelos sindicatos e entidades de trabalhadores ou partidos que possuem vinculao com reas sindicais, de acordo com o seguinte esquema:
a) PT Partido dos Trabalhadores: CUT Central nica dos Trabalhadores;
b) PMDB Partido do Movimento Democrtico Brasileiro: CGT
Confederao Geral dos Trabalhadores e CGT II Central Geral
dos Trabalhadores;
c) PTB Partido Trabalhista Brasileiro: CGT Confederao Geral
dos Trabalhadores e USI Unio Sindical Independente;
d) PDT Partido Democrtico Trabalhista: CGT Confederao
Geral dos Trabalhadores e CGT II Central Geral dos Trabalhadores.57

Z
NATALE expe com muita propriedade o fato de que um grupo ter
a pretenso de impor seu interesse privado ao interesse pblico e geral da
sociedade no uma novidade na histria, nem um perigo. O que uma
novidade e importa um grave perigo, que efetive essa pretenso por
meio da utilizao de tcnicas de domnio e de quebramento.58
Portanto, uma boa maneira de controle sobre os meios utilizados
pelos grupos de presso a de, uma vez reconhecida a justia de seus
interesses e das suas pretenses particulares, estabelecer os meios e ins56

57
58

No tangente participao das empreiteiras no trato com os parlamentares, vejam-se os episdios da Comisso Parlamentar de Inqurito da corrupo, dos anes do
2UoDPHQWRTXHUHYHODOLJDo}HVGD&RQVWUXWRUD2GHEUHFKWQDQFLDQGRFDPSDQKDV
de quase todos os partidos.
ARAGO, Murillo. *UXSRVGH3UHVVmRQR&RQJUHVVR1DFLRQDO. p. 53.
NATALE, Hugo E. Alvarez. Contribucion al estudio de los grupos de interes, p. 17.

236

Ubirajara Coelho Neto

tituies atravs dos quais estes possam defender seus legtimos interesses e causas, de forma legal e transparente.
Alm disso, importante realarmos que a reestruturao dos partidos polticos, a descentralizao do poder, a efetividade das formas democrticas semi-diretas e a democracia participativa so outros meios
de fortalecimento institucional da Democracia e da representatividade
popular, e, consequentemente, de enfraquecimento sensvel dos grupos
invisveis de poder no cenrio poltico.
A Reforma Poltica do Estado obrigatoriamente deve estar centrada
na necessidade de maior proximidade da vontade popular com a vontade expressa pelo Parlamento, para o aprimoramento e fortalecimento
da Democracia.
Desta forma, a edio de uma legislao eleitoral mais rgida que gaUDQWDPDLRUWUDQVSDUrQFLDQRQDQFLDPHQWRHDWXDomRGRVSDUWLGRVSROtWLFRV
e dos grupos de presso essencial para o fortalecimento da Democracia.
$SHVDU GDV GLFXOGDGHV GR VLVWHPD UHSUHVHQWDWLYR H GRV FRPSOLcadores naturais existentes da dinmica democrtica, no podemos
deixar de salientar que permanecem os partidos polticos em posio
de extrema relevncia no cenrio decisional brasileiro, pois enquanto
GHWHQWRUHVGDDWLYLGDGHOHJLIHUDQWHVmRRV~QLFRVTXHLQXHQFLDGRVRX
no por demais grupos de interesses, de promoo e de presso - efeWLYDPHQWHDFDEDPSRUWRPDUGHFLV}HVGHQLWLYDVTXHYLQFXODPWRGDD
sociedade por meio de leis.
A organizao e regulamentao dos partidos polticos e sua participao da democracia representativa, permite uma maior alternncia do Poder e democratizao das decises, com respeito e voz aos
direitos das minorias. Alm disso, o controle e responsabilizao das
decises polticas dos partidos apresentam-se mais plausvel com a
necessria transparncia e visibilidade do sistema democrtico, diferentemente do que ocorre com diversos grupos de presso que, sob
o manto do anonimato e articulaes de bastidores, tornam-se atores
LQYLVtYHLV GR FHQiULR SROtWLFR GH JUDQGH LQXrQFLD PDV WRWDOPHQWH
irresponsveis politicamente.

3. EVOLUO DOS PARTIDOS POLTICOS NO BRASIL


Os partidos polticos no Brasil foram institucionalizados com a
Constituio de 1946, dizendo BONAVIDES:
237

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

que no andaria exagerado quem datasse dessa Constituio a


existncia verdadeira do partido poltico em nosso pas, existncia
que comea com o advento dos partidos nacionais. Os cem anos
antecedentes viram apenas agremiao que, luz dos conceitos
contemporneos, relativos organizao e funcionamento dos
SDUWLGRVGLFLOPHQWHSRGHULDPUHFHEHURQRPHSDUWLGiULR59

Durante o imprio o partido conservador e o liberal no possuam


outra funo a no ser a de chegar ao poder.
Os liberais do Imprio exprimiam na sociedade os interesses urbanos
da burguesia comercial, o idealismo dos bacharis, o reformismo progressista das classes sem compromissos diretos com a escravido e o feudo.
Os conservadores eram o partido da ordem, o ncleo das elites satisfeitas e reacionrias.
Porm no havia um liame que diferenciava esses partidos, chegando-se a dizer que no havia nada mais conservador que um liberal no
poder; e nada mais liberal que um conservador no poder.
Em 1870, no meio de uma crise que afetava os partidos conservador e
OLEHUDOTXHYLQKDGHVGHRPGDJXHUUDGR3DUDJXDLpODQoDGRRSURJUDPD
UHSXEOLFDQR&RPDVFULVHVGRQDOGR,PSpULRS{VVHWHUPRjH[LVWrQFLD
dos dois grandes partidos da poca: o Conservador e o Republicano.
Aps a proclamao da repblica, houve um retrocesso. Com o federalismo, passou a existir uma maior descentralizao. As oligarquias
estaduais queriam o antipartidarismo nacional, e dessa maneira governaram o pas por quase meio sculo.
(P  XPD UHYROXomR S{V P DR DQWLJR VLVWHPD HOHLWRUDO &RPHoDYDXPDQRYDHUDSDUDDDUPDomRGRVSDUWLGRVSROtWLFRQR%UDVLO
Com a Constituio de 1934, houve um enfraquecimento dos partidos
estaduais. No havia a denominao de partidos polticos pela Constituio, mas entendia-se por vezes.
O progresso conseguido com a Constituio de 34 foi arrebentado com a Constituio do Estado Novo. Extinguiram-se os partidos polticos, nem mesmo o partido nico existia. Com a queda do
nazi-facismo europeu, veio a redemocratizao do pas e com esta a
Constituio de 1946, que conservou as conquistas de nosso segundo
&yGLJR(OHLWRUDOEDL[DGRQRQDOGDGLWDGXUDTXDQGRHVWDJXLQDYDVH
para a democracia.
59

BONAVIDES, Paulo. &LrQFLD3ROtWLFD, p. 470.

238

Ubirajara Coelho Neto

As conquistas da Constituio de 1946, que foi a primeira a reconhecer os partidos polticos, foram sufocadas com a revolta de 1964.
Instituiu-se com esta Constituio o bipartidarismo, mas o que havia
era um partido da situao que absolvia o da oposio, que no era to
oposio assim. Com a redemocratizao, eleito em 1985 um presiGHQWHFLYLOeRPGRUHJLPHPLOLWDUTXHYHLRSDUDVXSULPLUXPDFULVH
institucional criada com a sada de JNIO QUADROS e se transformou numa mancha negra na histria poltica brasileira.
Com a Constituio de 1988, livre a criao, fuso, incorporao
e extino de partidos polticos, resguardados a soberania nacional, o
regime democrtico, o pluripartidarismo, os direitos fundamentais da
pessoa humana, diz no seu art. 17.
No amadurecido o bastante para ter partidos fortes e estveis, o
Brasil v uma oscilao partidria no cenrio nacional. A ideologia
partidria no, por vezes, corresponde ideologia dos integrantes, que
usam o partido para galgar o poder. Outras vezes a ideologia do partido
guina-se contrria a de seus partidrios.
Para uma melhor compreenso da matria, dividiremos a evoluo
histrica partidria no Brasil segundo a gide de cada Constituio vigente na poca, visando com isso dar um aspecto lgico e didtico.
A Carta de 1988 mantm e amplia as diretrizes das Constituies
anteriores, relativa aos direitos fundamentais, objeto de ttulo prprio,
que se desdobra em captulos dedicados sucessivamente aos Direitos e
Deveres Individuais e Coletivos, aos Direitos Sociais, da Nacionalidade, dos Direitos Polticos e dos Partidos Polticos.60
livre a formao de partidos polticos, de carter nacional, segundo os requisitos que a lei estabelecer.
A Justia Eleitoral, rgo integrante do Poder Judicirio, supervisiona e coordena o processo eleitoral e a existncia e funcionamento
dos partidos polticos, que perante ele devem-se registrar.
O princpio da pluralidade partidria, amplamente garantido no processo de restaurao democrtica, de que a nova Constituio representa o pice, vem facilitando a disperso de correntes partidrias.
Permanece a proibio do recebimento de recursos financeiros
de entidade ou governo estrangeiros ou de subordinao a estes,
ficando os mesmos obrigados a prestarem suas contas Justia
Eleitoral.
60

TCITO, Caio. Constituies Brasileiras: 1988, p. 28-29.

239

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

eDVVHJXUDGDDRVSDUWLGRVSROtWLFRVDXWRQRPLDSDUDGHQLUVXDHVtrutura interna, organizao e funcionamento, devendo seus estatutos


HVWDEHOHFHUQRUPDVGHGHOLGDGHHGLVFLSOLQDSDUWLGiULD
Os partidos polticos, aps adquirirem personalidade jurdica, na forma da lei civil, registraro seus estatutos no Tribunal Superior Eleitoral e
tero direito a recursos do fundo partidrio e acesso gratuito ao rdio e
televiso, na forma da lei.61
$YLJHQWH&RQVWLWXLomRGHQLXRVFRPRSHVVRDMXUtGLFDGHGLUHLWR
privado, ao teor do art. 17, 2. Adquirem personalidade na forma da
lei civil porque so pessoas jurdicas de direito privado, devendo, pois,
registrar-se no Registro Civil de Pessoas Jurdicas, segundo o disposto
na Lei dos Registros Pblicos62, depois disso que seus estatutos sero
levados a registro no TSE.
Tm os partidos polticos direito a recursos do fundo partidrio para a
realizao de qualquer servio, trabalho ou empreendimento da agremiao, e acesso gratuito ao rdio e televiso, na forma da lei (art. 17, 3).63
1R%UDVLOFRPRPFRPSXOVyULRGRELSDUWLGDULVPRHPGH]HPEUR
de 1979, a Arena e o MDB foram extintos por uma lei que deu um prazo
de 180 dias para a organizao de novos partidos. O resultado foi que
o Pas saltou para uma situao em que, de 1982 a 1994, nada menos
TXHSDUWLGRVDSDUHFHUDPQDFHQDSROtWLFD'HVVHVJXUDYDPHP
1995, como partidos devidamente legalizados e s 18 tinham represenWDQWHVQR&RQJUHVVR$SHQDVDOFDQoDUDPDPDUFDGHGRVYRWRVQDV
eleies de 1994. Hoje, 27 partidos tm registro no TSE.
Na verdade, no Brasil, a democracia competitiva s foi efetivamente exercida no perodo 1946/64 poca da UDN, do PSD e do
PTB e no perodo ps-1985. Partidos polticos precisam de tempo
para sua maturao. Durante a transio democrtica, o Pas chegou
a ter grandes partidos que no participaram de nenhuma eleio,
como o caso do extinto PP, que atuou em 1980/81 e depois foi incorporado ao PMDB. Aps a redemocratizao, poucos foram os
partidos que conseguiram alcanar algum grau de insero social. A
maioria das legendas no tem qualquer identidade e s tem vida nas
campanhas eleitorais. H tambm o caso dos partidos relmpagos,
criados para dar sustentao a projetos polticos individuais, como
61
62
63

MORAES, Alexandre. Direito Constitucional, p. 259.


BRASIL. Lei n. 6.015. Art. 114.
CARVALHO, Kildare Gonalves. 'LUHLWR&RQVWLWXFLRQDO'LGiWLFR, p. 260.

240

Ubirajara Coelho Neto

o PRN, fundado por COLLOR, em 1989, e o PRS de HLIO GARCIA, em 1990.


A fragmentao partidria no Brasil s no leva polarizao, que
em outros pases costuma ser sinnimo de crise e instabilidade, devido
ausncia de divises ideolgicas srias entre os partidos. O que se v
no Pas so arremedos de partidos com registro provisrio, criados sob
o argumento da liberdade de expresso e organizao.
Na opinio dos estudiosos, preciso tornar a criao de partidos
DOJR PDLV VpULR GLFXOWDQGR D SUROLIHUDomR GH OHJHQGDV TXH DFDEDP
servindo a outros propsitos que no o de serem agremiaes polticas
representativas de interesses existentes no seio da sociedade. A Lei n
9.096, de 1995, prev a clusula de desempenho para que um partido
possa ter representao no Congresso a partir das eleies de 2010,
mas h quem defenda que a vigncia desse dispositivo poderia ser antecipada j para o pleito de 2002.
A legislao partidria no Brasil considerada rigorosa e minuciosa
FRPUHODomRjVH[LJrQFLDVSDUDTXHXPSDUWLGRFRQVLJDUHJLVWURGHQLWLvo e, ao mesmo tempo, excessivamente liberal no tocante ao acesso dos
partidos ao Parlamento e aos recursos polticos, como fundo partidrio
e programas na TV. Mas, na prtica, as exigncias estabelecidas pela
legislao tm sido, muitas vezes, simplesmente ignoradas. O exemplo
GDVHOHLo}HVGHpVLJQLFDWLYR1DTXHOHDQRDOHJLVODomRH[LJLD
que, para ter representao na Cmara dos Deputados, um partido neFHVVLWDYDREWHU FLQFRSRUFHQWR GRVYRWRVGLVWULEXtGRVSRUQRYH
(VWDGRVFRPRPtQLPRGH WUrVSRUFHQWR HPFDGDXPGHOHV6H
fosse aplicada, a lei deixaria de fora do Congresso, partidos como o
PDT, o PTB e o PT, e o Pas voltaria ao bipartidarismo. Mais uma vez,
prevaleceu o jeitinho brasileiro.
preciso criar barreiras que impeam a proliferao de pequenos
partidos. Diversas democracias adotam a chamada clusula de excluso
ou clusula de barreira, estabelecendo o limite mnimo de votos que
pode ser nacional ou regional que um partido precisa alcanar para ter
direito a representao parlamentar. O exemplo mais conhecido o da
Alemanha, onde, para ter acesso Cmara dos Deputados (Bundestag),
DOHJHQGDSUHFLVDUHFHEHUSHORPHQRV FLQFRSRUFHQWR GRVYRWRV
1D*UpFLDHVVHSDWDPDUpDLQGDPDLRU GH]HVVHWHSRUFHQWR SDUD
RVSDUWLGRVH WULQWDSRUFHQWR SDUDDVFROLJDo}HV$WXDOPHQWHQR
Brasil, o nico instrumento que funciona como uma espcie de clusula
de excluso o quociente partidrio, que impede que um candidato,
241

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

mesmo que bem votado, seja eleito caso seu partido ou coligao no
alcance determinada quantidade de votos.
As eleies de 1998 deixaram uma lio que vem sendo repetida h
anos, mas, at hoje, no foi bem assimilada pela elite poltica do Pas. a
necessidade de se promover uma ampla reforma poltica, capaz de fortalecer as instituies democrticas e reforar a importncia do exerccio da
cidadania e a legitimidade dos mandatos conquistados pelo voto.
Cientistas polticos e socilogos so unnimes ao enxergar, no atual quadro
partidrio, marcado pela proliferao de legendas, e na ausncia de uma legislao eleitoral duradoura, um risco estabilizao da democracia brasileira.
O primeiro passo para que a reforma poltica fosse feita democraticamente e contribui-se para o fortalecimento das instituies polticas
seria fazer com que o debate extrapola-se as paredes do Congresso e das
Casas Legislativas, o que infelizmente no foi feito.
Certamente, no passa pela cabea da imensa maioria dos eleitores que, em outros pases democrticos, a escolha dos representantes
do povo possa acontecer mediante procedimentos completamente diferentes daqueles adotados no Brasil. Quem sabe, por exemplo, que
em Israel e na Holanda os parlamentares, ao invs de representar um
estado ou distrito, representam todo o pas? Ou que na maioria das
democracias o eleitor no escolhe candidatos individuais, mas vota em
listas previamente preparadas pelos partidos? Ou que na Frana os deputados so eleitos em dois turnos e na Alemanha um partido s poder
WHUUHSUHVHQWDQWHVQR3DUODPHQWRVHUHFHEHUSHORPHQRVGRWRWDO
dos votos? Ou, ainda, que na Sua um eleitor pode votar em vrios
nomes de diferentes partidos ou dar dois votos no mesmo candidato?
Ou que na Itlia uma parte dos votos apurada nos estados e outra
nacionalmente? Ou que na Inglaterra apenas o candidato majoritrio
de cada distrito eleito?
Como se v, democracia no algo que dependa de uma frmula
HVSHFtFD +i XPD JUDQGH YDULHGDGH GH PRGRV GH VH GHWHUPLQDU D
preferncia eleitoral e a vontade dos cidados, transformando-as em
poder parlamentar. E cada um deles leva a um resultado diferente. A
RSomRSRUXPRXRXWURPRGHORpUHH[RGDHVWUXWXUDVRFLDOGRJUDX
de maturidade do eleitorado, do interesse pelo processo poltico e,
FODURGRVFRQLWRVHQWUHDVGLYHUVDVIDFo}HVGDHOLWHSROtWLFDGR3DtV
H seis anos, o Senado constituiu uma comisso para estudar a reforma poltica, que j tem alguns projetos prontos e privilegiam alguns
itens da pauta.
242

Ubirajara Coelho Neto

4. CONCLUSO
A reforma poltica do Estado necessita, pois, de uma maior democratizao nos quadros partidrios, possibilitando o acesso e disputa
igualitrios a todos aqueles que pretendam disputar cargos eletivos.
A Cincia Poltica e a Teoria Constitucional tm-se debruado sobre
HVWHWHPDQDPHGLGDHPTXHRVJUXSDPHQWRVLQXHQFLDPDVUHODo}HV
reais de poder numa sociedade, vrias vezes de forma determinante,
embora quase nunca de maneira institucionalizada.
O aperfeioamento da Democracia deve buscar a necessria visibiliGDGHQDDWXDomRSROtWLFDHDUHVSRQVDELOLGDGHSHODLQXrQFLDQDWRPDGD
de decises, no somente em relao aos partidos polticos, mas tambm
em relao aos grupos de presso. A regulamentao seria o conjunto
mnimo de interesses comuns, incluindo especialmente interesse comum
de buscar o fair play entre os interesses privados e particulares.
Entendemos que os partidos polticos so organismos vitais dos
sistemas de representao plural e, consequentemente, entidades de
autntico interesse pblico, cuja existncia merece ser sustentada com
capitais pblicos, no existindo solues mgicas nem verdades absolutas em matria eleitoral.
A importncia alcanada pelos partidos para a vida e a reproduo
do Estado democrtico. Eles adquiriram a ateno neste ponto, porque
o dinheiro dos partidos no s representa uma questo excelente para
as quantidades implcitas ou para suas fontes de origem, mas porque os
partidos tornaram-se a espinha do Estado democrtico.
Que o dinheiro na poltica tenha um manejo transparente e que propicie uma competio aberta e livre, sem contrapesos, conveniente a
todos os partidos e aos regimes que lhes do sustento.

BIBLIOGRAFIA
ARAGO, Murillo. Grupos de Presso no Congresso Nacional. So
Paulo: Maltese, 1994.
BADIA, F. Partidos - Grupos de Presso. Braslia: Instituto Tancredo
Neves, 1987.
BARACHO, Jos Alfredo de Oliveira. Regimes Polticos. So Paulo:
Resenha Universitria, 1977.
243

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

BARACHO, Jos Alfredo de Oliveira. Teoria Geral dos Partidos Polticos. Belo Horizonte: Revista Brasileira de Estudos Polticos, s/d.
BOBBIO, Norberto. O Futuro da Democracia: uma defesa das regras
do jogo. Rio de Janeiro: Paz e Terra, 1989.
BONAVIDES, Paulo. Cincia Poltica. So Paulo: Malheiros, 1999.
BONAVIDES, Paulo. Direitos Polticos e Partidos Polticos. 2. ed.,
Rio de Janeiro: Ed. Fundao Getlio Vargas, 1977.
BRASIL. Lei n. 6.015, de 31.12.1973. Dispe sobre os Registros Pblicos e d outras providncias. Braslia: DOU, 2 de janeiro de 1974.
CAGGIANO, Mnica Herman Salem. Sistemas Eleitorais & Representao Poltica. So Paulo: Tese de Doutorado da Faculdade de Direito da Universidade de So Paulo, 1997.
CANOTILHO, J. J. Gomes e MOREIRA, Vital. Fundamentos da
Constituio. Coimbra: Almedina, 1991.
CARVALHO, Orlando. Os Partidos Polticos e a legitimao do
processo poltico brasileiro. Revista de Informao Legislativa, Braslia, n. 64, out./dez., 1979.
CARVALHO, Kildare Gonalves. Direito Constitucional Didtico. 6.
ed., rev. e atual., Belo Horizonte: Del Rey, 1999.
CLVE, Clmerson Merlin. Temas de Direito Constitucional. So
Paulo: Acadmica, 1993.
CDIGO ELEITORAL. Organizadora: Norma Murad; Coordenadora:
Sandra Julien Miranda. So Paulo: Rideel, 2000.
COELHO NETO, Ubirajara. Estado Constitucional e Partidos polticos 0RQRJUDDGH0HVWUDGR )DFXOGDGHGH'LUHLWRGD8)0*
COMPARATO, Fbio Konder et. al. Brasil Sociedade Democrtica.
Rio de Janeiro: Jos Olympio, 1985.
DANTENA, Antonio. Il Principio Democratico nel Sistema dei
Principi Costituzionali. Perspectivas Constitucionais - Nos 20 anos
da Constituio de 1976. Organizao: Jorge Miranda. v. 1, Coimbra:
Almedina, 1996.
DALLARI, Dalmo de Abreu. O Renascer do Direito. 2. ed., Saraiva, 1996.
244

Ubirajara Coelho Neto

DUVERGER, Maurice. Introduo Poltica. Lisboa: Estdios Cor,


1972, Traduo de Mrio Delgado.
DUVERGER, Maurice. Os Partidos Polticos. Rio de Janeiro: Zahar
editores, 1970.
FERREIRA FILHO, Manoel Gonalves. O Parlamentarismo. Saraiva, 1993.
FERREIRA FILHO, Manoel Gonalves. Os Partidos Polticos nas
Constituies Democrticas. Belo Horizonte: Universidade de Minas Gerais - edio da Revista brasileira de estudos polticos, 1966.
FRIEDRICH, Carls J. Gobierno Constitucional Y Democracia. Madrid: Instituto de Estudos Polticos, 1975.
HAURIOU, Andr. Derecho Constitucional e Instituciones Polticas. Barcelona: Editora Ariel, Traduccin Castellana de Jos Antonio Gonzales, 1980.
HERAS, Jorge Xifras. Curso de Direito Constitucional. 2. ed., Tomo
II, Barcelona: Casa Editorial, 1957.
HORTA, Raul Machado Horta. Estudos de Direito Constitucional.
Belo Horizonte: Del Rey, 1995.
LASSALLE, Ferdinand. O que a Constituio? Essncia da Constituio. 3. ed., Rio de Janeiro: Liber Juris, 1995.
MACIEL, Marco. Grupos de Presso e Lobby. Braslia: Senado Federal, 1984.
MALUF, Sahid. Teoria Geral do Estado. 23. ed., So Paulo: Saraiva, 1995.
MORAES, Alexandre. Direito Constitucional. 10. ed., So Paulo:
Atlas, 2001.
NATALE, Hugo E. Alvarez. Contribucion al estudio de los grupos de
interes. Buenos Aires: Abeledo-Perrot, 1976.
NUSDEO, Fbio. O Direito Econmico e os Grupos de Presso. Revista de Direito Mercantil, n 31- 1978.
PASQUINO, Gianfranco. Grupos de Presso. In: BOBBIO, Norberto.
REALE JR, Miguel. Casos de Direito Constitucional. So Paulo: RT, 1992.
RIBEIRO, Fvila. Direito Eleitoral. Rio de Janeiro: Forense, 1976.
ROUSSEAU, Jean-Jacques. O Contrato Social. Rio de Janeiro: Ediouro,
1995. Traduo Antnio de P. Machado.
245

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

SANTOS, Mrio Augusto. Associao Comercial da Bahia na Primeira Repblica. Um Grupo de Presso. 2. ed., Salvador: ACB, 1991.
SARTORI, Giovanni. Partidos e Sistemas Partidrios. Traduo de
Waltensir Dutra, Braslia: Ed. Brasileira, 1982.
SILVA, Jos Afonso da. Curso de Direito Constitucional Positivo. 19.
ed., So Paulo: Malheiros, 2001.
SILVA, Jos Afonso da. Perspectivas do Direito Pblico. Coordenao: Carmem Lcia Antunes Rocha, Belo Horizonte: Del Rey, 1995.
TCITO, Caio. Constituies Brasileiras: 1988. Braslia: Senado Federal
e Ministrio da Cincia e Tecnologia, Centro de Estudos Estratgicos, 1999.
TEMER, Michel. Constituio e Poltica. So Paulo: Malheiros, 1994.
VERGOTTINI, Giuseppe de. Diritto Costituzionale Comparato. Padova: Cedam, 1981.
VIRGA, Pietro. Libert Giuridica e Diritti Fondamentali. Milo:
Dott. A. Giuffr, 1947.
SILVA, Luciana Aboim Machado Gonalves da. Termo de Ajuste de
Conduta. So Paulo: LTr, 2004.

246

Resenhas

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

GONALVES DA SILVA, Luciana Aboim Machado. Termo de Ajuste


de Conduta. So Paulo: LTr, 2004.

A Lei n. 7.347/85 (art. 5, 6) traz a previso do instituto do termo


de ajustamento de conduta - TAC. Suas origens, no entanto, remontam
j/HLQTXHRFODVVLFRXFRPRWtWXORH[HFXWLYRH[WUDMXGLFLDO
natureza jurdica esta, inclusive, que prevalece atualmente no mago
da doutrina majoritria. Firmado entre o empregador e um dos rgos
pblicos legitimados para propor a ao civil pblica, indigitado instiWXWRpJXUDMXUtGLFDGHJUDQGHUHOHYkQFLDHSRUYH]HVH[WUHPDPHQWH
QHFHVViULDSDUDVROXFLRQDUFRQLWRVPHWDLQGLYLGXDLVeSRUPHLRGR
termo de ajuste de conduta que as partes envolvidas, pautadas pelo
princpio da razoabilidade, conseguem atingir uma convergncia, determinando o modo, lugar e prazo para que o inquirido possa adequar
sua conduta, previamente interposio de Ao Civil Pblica. Nesse
diapaso, a Prof. Dra. Luciana Aboim Machado Gonalves da Silva,
traz em sua obra Termo de Ajuste de Conduta, importantes pontos a
UHVSHLWRGHVVDJXUDMXUtGLFD
Pois bem, no que toca a legitimidade para ajuizamento da Ao Civil
Pblica, a Lei n. 7.347/85 determina que esta concorrente e disjuntiva,
ou seja, todos os legitimados so independentes para promover a referida ao, bem como prev que os rgos pblicos legitimados podero
tomar o termo de ajuste de conduta do inquirido. Mas, cedio que o
Ministrio Pblico o rgo mais bem aparelhado para tais misteres. A
obra em estudo traz baila a interpretao da expresso rgos pblicos legitimados contida no art. 5, 6, da citada Lei n. 7.347/85, advogando a aplicao do brocardo jurdico onde a lei no distingue, no
pode o intrprete distinguir, de modo que, como a lei cabalmente disWLQJXLXHTXDOLFRXGHS~EOLFRVRVyUJmRVOHJLWLPDGRVSDUDR7$&QmR
h como admitir a legitimidade da associao sindical, embora a autora
critique tal limitao legislativa legitimidade, com vista ao princpio
da coerncia e harmonia, inclusive com o texto constitucional (CF/88,
art. 8, III). Levanta-se, ainda, a ausncia de previso do Distrito Federal
no referido rol, o que fora devidamente suprimido pela Lei n. 8.078/90.
A propositura da ao civil pblica, conforme citado acima, concorrente e disjuntiva. Normalmente referida ao precedida de inqurito civil ou procedimento investigatrio prvio, sendo o primeiro exclusivo do Ministrio Pblico e previsto no art. 129, III da CF/88, bem como
no art. 10 da Lei n. 7.347/85. Destarte, o termo de ajuste de conduta

248

Resenhas

ocorrer no mbito desses dois institutos acima mencionados. Embora o


procedimento de investigao prvia tenha sofrido crticas por parte da
doutrina, uma vez que seus objetivos convergiriam para os do inqurito
civil, havendo uma coincidncia entre ambos, salutar esclarecer que referido procedimento no elimina o inqurito civil, sendo mais uma forma
de que dispe o Ministrio Pblico para viabilizar o TAC, e, alm disso,
o nico meio de que detm os outros legitimados feitura do termo.
No tocante aos requisitos do termo de ajustamento de conduta, vislumbra-se ser imprescindvel (para que obtenha a fora executiva) conter obrigao certa e determinada, alm das cominaes cabveis, bem
como a legitimidade do rgo tomador, a espontaneidade do inquirido,
a clareza das disposies e a reparao total dos danos. Nesse diapaso,
alguns autores argumentam pela necessidade de homologao do termo
por parte do Ministrio Pblico do Trabalho, quando o mesmo for tomado por outros dos co-legitimados, o que discordado pela obra em
estudo. Para tal, a autora traz trs fortes argumentos. A priori, no h na
lei nenhuma exigncia nesse sentido; segundo, o fato de vir tona um
7$&LQVXFLHQWHRXPDOIHLWRQmRVHUiREVWiFXORSDUDHYHQWXDOSURSRVLWXUDGDDomRFLYLOS~EOLFDSHORVRXWURVOHJLWLPDGRVHSRUPQmRVH
pode olvidar que no termo de ajuste de conduta no h que se falar em
direitos disponveis, podendo inclusive ser impugnado mediante ao
anulatria se houver violao dos mesmos.
Nesse ponto da obra a autora traz tona o contedo do termo de
ajustamento de conduta, esclarecendo que o TAC sempre fora tomado
mediante um compromisso do inquirido em obrigaes de fazer ou no
fazer alguma coisa, mas que atualmente atingiu maior contorno uma vez
que abrange tambm obrigaes de dar. Salutar mencionar que a reparao do dano, em forma de indenizao ter dois destinos, dependendo
do tipo de direito atingido: se individuais homogneos destinar-se- ao
empregado, no entanto, se direitos difusos ou coletivos, ao FAT.
Outro aspecto importante de que no se pode olvidar o fato de
que o termo de ajuste de conduta no se confunde com o instituto da
transao. Nesta ltima h, entre outros aspectos diferentes em relao
ao termo, concesses recprocas, dubiedade em relao ao direito e possibilidade de dispor do mesmo. J no termo de ajuste de conduta no h
concesses recprocas (uma vez que o infrator se obriga a ajustar a sua
conduta, pois esta transgride a lei e no possvel a imediata reparao
da leso), a obrigao objeto do termo de ajuste certa e determinada e
o direito indisponvel.
249

DIK

Revista do Mestrado em Direito da Universidade Federal de Sergipe

bem de ver que existe celeuma na doutrina quanto natureza


jurdica da cominao contida no termo de ajuste de conduta, teria ela
natureza de clusula penal ou de astreinte? Nesse sentido, o art. 11 da
Lei n. 7.347/85 vaticina que ser aplicada uma multa diria. Ora, apesar
de, numa primeira interpretao, pensar-se que se trataria de clusula
SHQDOpFRPPXLWRDQFRTXHDREUDRUDHPHVWXGRGHIHQGHTXHHP
verdade trata-se de astreinte. Para tanto, traz valiosos argumentos que
SDVVDPRVDFLWDUDLQGDTXHVXSHUFLDOPHQWHTXDLVVHMDPDPXOWDDSUHVHQWDFDUiWHUFRHUFLWLYRQmRFRQJXUDQGRLQGHQL]DomR VHQGRLQFOXVLve possvel sua cumulao com esta), mas sim uma presso econmica
insuportvel, que estimula o inquirido a cumprir a obrigao ora prometida; da mesma forma, a astreinte contida no TAC, diferentemente da
clusula penal no precisa obedecer o limite mximo do valor da condenao, no se aplicando aqui a Orientao Jurisprudencial n. 54 da
Seo de Dissdios Individuais do Tribunal Superior do Trabalho, alm
GLVVRRYDORUGDDVWUHLQWHSRGHVHUPRGLFDGRSHORSUySULRPDJLVWUDGR
TXDQGRHVWHYHULTXHTXHVHWRUQRXH[FHVVLYRRXLQVXFLHQWH
Interessante mencionar que existe uma linha de pensamento que entende ser a astreinte aplicvel apenas obrigao de fazer e no fazer,
e no aplicvel quando se tratar de obrigao de dar. Observa-se que a
excelente obra ora em anlise refuta tal entendimento, advogando que,
primeiramente no se pode despender ao art. 11 da Lei n. 7.347/85 apenas
o mais pobre dos mtodos interpretativos, que o gramatical; no mais, o
art. 5, 6, da indigitada lei no fazer qualquer diferena entre as obriJDo}HVDSHQDVWUD]HQGRDH[SUHVVmRFRPLQDo}HVSRUPQmRVHSRGH
restringir o xito do termo de ajuste, no aplicando uma sano apenas
por se tratar de obrigao de dar, pois o bem maior tutelado a paz social.
7DQWRpDVVLPTXHRWHUPRGHDMXVWHGHFRQGXWDDSUHVHQWDXPDVLJQLFDWLYD
vantagem, qual seja, a celeridade de obteno da adequao do inquirido,
sem que os ofendidos precisem enfrentar a morosidade do judicirio, logo,
sem que haja a propositura da ao civil pblica, atravs do TAC as partes
tm a oportunidade de se comporem alcanando o bem comum.
Uma vez tomado o termo de ajustamento de conduta, mister obserYDUTXHRyUJmROHJLWLPDGRTXHRFHOHEURXGHYHUiVFDOL]DURVHXHIHtivo cumprimento, o que no obsta a Delegacia Regional do Trabalho
de tambm faz-lo. Nesse diapaso, levanta-se a discusso sobre a possibilidade ou no de o termo de ajustamento de conduta ser executado
na Justia Laboral. Havia trs diferentes correntes a respeito do tema,
sendo que, corretamente, prevaleceu a que entende plenamente possvel
250

Resenhas

a execuo do TAC pela justia especializada, nesse sentido, inclusive,


o art. 876 da CLT.
Embora indigitado dispositivo legal traga em seu texto apenas os terPRVGHDMXVWHGHFRQGXWDUPDGRVSHOR0LQLVWpULR3~EOLFRHPREHGLrQcia ao princpio do acesso justia, no se pode olvidar dos outros rgos
S~EOLFRVOHJLWLPDGRVSDUDWRPDUR7$&/RJRWDQWRRWHUPRUPDGRFRP
R0LQLVWpULR3~EOLFRTXDQWRRUPDGRFRPRVRXWURVOHJLWLPDGRVFRQVtituem ttulos executivos extrajudiciais, que trazem em seu bojo a vantagem de evitar que as partes enfrentem uma ao judicial para que tenham
seus direitos resguardados, podendo da mesma forma ser executados na
Justia do Trabalho. Tal execuo poder ser de duas formas: tratando-se
o compromisso de obrigao de dar a execuo ser por quantia certa, j
YHUVDQGRVREUHREULJDomRGHID]HURXQmRID]HUDH[HFXomRVHUiHVSHFtFD
3RUPDREUDHPDSUHoRWUD]jEDLODDTXHVWmRGDFRPSHWrQFLD
Resta claro que se o termo de ajuste de conduta se refere a direitos
trabalhistas metaindividuais ser a Justia Juslaboral a competente para
execut-lo, conforme disposto no art. 114 da CF/88, sendo mais precisamente competente uma das varas do trabalho, e no do Tribunal,
como querem alguns, uma vez que no de pode confundir ao civil
pblica com dissdio coletivo.
J quanto competncia para a execuo da cominao imposta no
termo de compromisso h quem entenda que deveria ser da Procuradoria da Fazenda Nacional, junto a Justia Federal. Tal entendimento, no
entanto, tornou-se obsoleto com o advento da emenda constitucional n.
GH3DUDRXWUDSDUWHGDGRXWULQDFRPDTXDOVHOLDDDXWRUD
a competncia para execuo das cominaes impostas nos termos de
compromisso da Justia Especializada, uma vez que elas tm carter
acessrio, devendo ser executadas no mesmo juzo da obrigao principal, o que, inclusive obedece ao princpio da segurana jurdica.
/RJRYHULFDVHTXHDH[FHOHQWHREUDRUDHPHVWXGRpGHH[WUHPD
importncia para aqueles que querem conhecer e se aprofundar no tema
termo de ajuste de conduta, instituto jurdico de relevante importncia
quando se fala em direitos metaindividuais e instrumento de convergncia das partes envolvidas em busca da paz social, concretizando os prinFtSLRVGDFHOHULGDGHGDHFRQRPLDGRDFHVVRjMXVWLoDHGDHFLrQFLD
Anna Catharina Fraga Machado, advogada, consultora jurdica e especialista em Direito e Processo do Trabalho pela Universidade Cndido Mendes de
Ribeiro Preto/SP.
251

NORMAS PARA PUBLICAO

^
a. Os artigos podem ser enviados diretamente ao e-mail institucional da revista ou atravs do conselho editorial. Artigos enviados
sero submetidos a 2 pareceristas.
b. So aceitos de artigos, resenhas, debates em portugus, francs,
ingls, italiano e espanhol.
c. O conselho editorial pode aceitar ou no os trabalhos submetidos
HWDPEpPVXJHULUPRGLFDo}HVDRVDXWRUHVSDUDDGHTXDURVWUDbalhos s normas da revista.

E
a. Os artigos devero ter ttulo, centrado na pgina; abaixo, direita, nome do autor; segue-se esquerda o resumo de trs a quatro linhas, e abaixo dele, as palavras-chave ( at cinco) ; abaixo
do resumo em portugus, deve ser colocado o abstract e as key
words; informaes sobre vinculao institucional e dados acadmicos do autor devem constar em nota de rodap na primeira
SiJLQDQRQDOGRDUWLJRDEDL[RGD~OWLPDOLQKDGHYHUiFRQVWDU
o e-mail do autor.
b. Os artigos, resenhas, e demais escritos deverao seguir as normas
da ABNT.
c. Solicita-se que as notas sejam colocadas no rodap da pgina
DELEOLRJUDDFRPSOHWDSRGHDSDUHFHUQRQDOGRWUDEDOKRHP
ordem alfabtica de sobrenomes.
d. A digitao deve ser em Word for Windows 97 ou superior com
fonte em Times New Roman 12.
e. Os ttulos de obras e nomes de revistas devem aparecer em itlico
ou negrito.
f. Nas resenhas, o cabealho dever conter o sobrenome do autor
em caixa alta, o nome em letras normais, o ttulo da obra em
itlico, local de edio, editora, data e eventualmente nmero de
pginas ou edio.

PUBLISHING NORMS


a. The papers can be directly sent to the institutional e-mail of or
through the editorial commission. The articles will be analyzed
by two referees.
b. The review accepts papers and reviews in Portuguese, French,
English, Italian and Spanish.
F 7KHVFLHQWLFFRPPLWWHHFDQDFFHSWRUQRWWKHDUWLFOHVVXEPLWWHG
DV ZHOO DV VXJJHVW VRPH PRGLFDWLRQV WR DGDSW WKH WH[W WR WKH
review norms.

^'
a. The article have to contain title, centered on the page; below, at the
right, the name of the author; besides, the abstract between three
RUIRXUOLQHVDQGDIWHUWKDWWKHNH\ZRUGV RQO\YH 5LJKWXQGHU
the abstract in Portugese it must be put the abstract and keywords
in English. The institutional and academic information must be in
WKHDUWLFOHLQWKHIRRWQRWHLQWKHUVWSDJH$WWKHHQGRIWKHSDSHU
below the last line, it must contain the authors e-mail;
b. The articles, reviews and other writings have to follow ABNTs
guidance;
c. It is asked that the notes have to be put in the pages footnote; the
entire bibliography may be at the end of the paper, in alphabetic
order of the last names;
d. The paper has to be typed in Word for Windows 97 or superior in
12-point, Times New Roman font.
e. The works titles and journals names must be or in italics or
in bold;
f. On the reviews, the heading must contain the authors last name
FDSLWDOL]HG WKH UVW QDPH ZULWWHQ QRUPDOO\ WKH ZRUNV WLWOH LQ
italics, editions city, publisher, date and the number of pages
eventually or edition.