Sie sind auf Seite 1von 12

The Cherry Creek News

& central denver dispatch Lowry


News p12
With News of the Heart of Denver
Hilltop • Belcaro • Bonnie Brae • Glendale • Country Club • Cherry Creek
Volume 11 Issue 4  April 2010
Bicycle share comes to
Denver in a big way
The community benefit grant will sup-
by the Cherry Creek News port Denver Bike Sharing, the non-
Getting around Denver alterna- profit organization that owns and oper-
tively just go a whole lot easier and ates the program. In addition, Kaiser
healthier. Permanente, the state’s largest non-
When the system launches on profit health plan, will provide in-kind
Earth Day, April 22, Denver B-cycle support, expertise and resources for
will feature more than 375 bicycles research and evaluation, community

Donna Lynne, DrPH, president, Kaiser Permanente Colorado (left) and Denver Lowry Steam Plant Re-Energized
Mayor John Hickenlooper special to the Cherry Creek News benefit as planting 9 acres of trees each
and worksite outreach, and volunteer year, or, not driving 76,000 miles each
at 38-40 stations around downtown Lowry’s Steam Plant neighbor-
support for special projects. year in a typical gas-powered vehicle.
Denver, Cherry Creek North, and hood has taken an additional step to
“We are very excited to be a part Over the anticipated 40 year life of
the University of Denver campus. By generate renewable energy, support
of this ground-breaking program that these systems, the benefit is the same
the end of June, Denver B-Cycle will Colorado’s New Energy Economy and
promotes a healthy lifestyle and an as planting 360 acres of trees (20% of
feature 50 stations and 500 bicycles. help achieve the national goal of more
active mode of transportation for our Lowry’s entire area), or, not driving
From running errands to commuting energy independence.
city’s residents and employers,” said 3,040,000 miles.
to work, Denver B-cycle is a quick, Seven Steam Plant homeowners
Donna Lynne, DrPH, president, Kaiser  The Steam Plant Loft building now
easy and healthy way to get around and the Steam Plant Lofts HOA have
Permanente Colorado. “With metro generates the most renewable energy
the city. installed solar power systems totaling
Denver ranking as the third-fittest city of any building in the entire 1,800 acre
Kaiser Permanente’s three-year 48.81KW of power. Those systems pro-
in the United States, it is the perfect Lowry Community.
$450,000 sponsorship is a critical dis- duce the same annual environmental   The award winning Steam
play of confidence in the long term see BIKING on page 5 Plant building was Lowry’s original
promise of the Denver B-cycle system.
Fix your roof before its too late— “PowerHouse”, but generated ener-
gy using coal-fired boilers. The Steam
deadlines approaching for storm claims see SOLAR on page 4
With 2009 gone with the turning of Vandalism, Fire and Tree Damages;
Inside the
U.S. POSTAGE

the calendar, its hardly forgotten. The Stains on Interior Ceilings and Walls.
DENVER, CO
PRSRT STD

PERMIT NO.

*** TIME SENSITIVE MATERIAL *** POSTMASTER PLEASE DELIVER BY APRIL 26

year was one of the worst for severe Possible cause: Roof leaks from hail
Cherry Creek
PAID

353

storms in memory, with serious hail- impacts to the shingles witch put hair
storms leaving their wake in May, June line cracks and make bruises to the
and July, including storms powerful
enough to damage homes and storm-
shingles; 
  Missing Shingles. Possible cause:
News &
water systems.
What many homeowners don’t
Wind damage to the roof;  Damaged
Screens and Cracked or Broken
Central Denver
know, is that storm damage is covered
by your homeowners policy, but only
Windows. Possible cause: Hail Damage
or Vandalism;  Dark, dirty-looking Dispatch
if you act quickly. So while leaks and areas on your roof. Possible causes:
the like may be slow in appearing, Environmental pollutants; vegetation,
you have to be quick to report it to the fungus or algae growth; loss of granules •Getting Fit, part 4
insurance company, and just as quick due to age of shingles;  Excessive ener-
to fix damage before it causes real, per- gy costs.  Possible cause: Insufficient page 3
manent damage to your home. attic ventilation causes heating/cool-
There are companies that specialize ing systems to run excessively. • Recession real, not mental
in both detecting and repairing storm A good roofer will meet with a rep-
page 2
Central Denver Dispatch

damage. Many roofers are effectively resentative of your insurance compa-


insurance restoration specialists, and ny, and negotiate for you. Even if you
they know how to get your insurance don’t think you have storm damage, a •Locks for Cancer page 11
company to recognize your issues, and quality roofer can inspect your home,
Denver, CO 80246

how to fix them as well. from the roof. Since most insurance
P.O. Box 460142

Here’s a short check-list of how to require that you make a claim within • Parenting coach
tell if your home has suffered storm one year, you need to act quickly, as
damage:  Leakage in Attic after Driving our last major storm was in July.
page 12
Rain.   Possible causes: Roof shingle Find a quality roofing com-
damaged by hail;  Dented or Cracked • Tesla’s remarkable coupe
Siding, Fascia, Window Wraps and pany—
Go to theCherryCreekNews.com Crossover page 14
Gutters.  Possible cause: Hail damage,
Page 2 Cherry Creek News & Central Denver Dispatch April 2010

Opinion and Comment Opinion and Comment

Recession real, not mental The Last (Sad) Laughs


John Hickenlooper, Denver Mayor and Real Estate, the FIRE sectors, which How much longer will America’s ever added more than 10.3 million jobs in
frequently add little value to the over- ‘gravest recession’ last? Of course, no one three years.
and candidate for Govenor said a while
all economy, far overshadow the pro- knows for sure, but a table produced by Economists can debate which single
back “a recession like this really is the Bureau of Labor Statistics, which since ‘lever’ can best add millions of jobs a
driven by people’s mental state.” ductive sectors of the economy. And,
energy has become dangerously vola- 1939 has tracked the changes in non-farm year for the next several years but, to
But let’s get this clear. This is no jobs as reported in its monthly Employer date, we have used almost none of the
mental recession. And no, I’m not talk- tile, vulnerable to speculation, while its
fundamentals worsen. Health care was Survey, offers a very cautionary note. arrows in the nation’s job recovery quiver.
ing about the bad politics of missing From its post-Great Depression base Meanwhile 18 to 20% of America’s work-
the real pain and suffering in millions the fastest growing part of the econo-
my for most of the last decade, while of 29.2 million, America added 109.6 ers have been unemployed or extremely
of households, and the unemployment million non-farm jobs until reaching the underemployed for 27 months. The levers
rate, which is nominally ten percent, manufacturing shriveled. Making stuff
peak figure of 138.8 million in 2007. Since which we have ignored most consistently
and shows no likelihood of meaning- is now a smaller part of the economy
December 2007, when this Great Recession are programs modeled after FDR’s Works
fully abating in short term. Things are than government. Can America live
started, non-farm payrolls have declined Progress Administration which from 1938
tough for lots of Colorado families, with less than 15% of GDP attributed by 11.2 million, and employment overall through 1940 employed 5.8 million job-
as there are ample reminders in every to making stuff? And less than 10% of has declined by 13.0 million jobs. less Americans. That’s roughly 17% of the
economic report. the jobs? Replacing these millions of jobs and then entire non-farm workforce, a figure
No, this recession is very, very struc- This is not good news. And it cer- adding the 140,000 a month needed in comparable to the task confronting our
tural. The mayor probably doesn’t read tainly isn’t mental. It’s structural. The order to keep pace with growth in the nation today.
our newspapers, but many remember way our economy is structured is out labor force must be our nation’s highest This White House and this Congress
our series “Apex and Foundation,” of whack, disadvantages the middle priority. And yet, sadly, it isn’t. seem intent on proving that history
two years ago. Or our reporting on the class and working families and limits The White House and Congress seem repeats itself, first as tragedy and then
collapse of the auction rate securities opportunities. It concentrates wealth wildly disconnected from the jobs crisis, as farce. Their initial jobs programs have
market, which presaged the financial in a few hands, in a few sectors, and perhaps because they spend so much been ‘missing in action’, and their use of
collapse ten months later, in the fall pushes the consequences of reckless time aiming a strobe light on health care phantom ‘jobs saved’ versus ‘real jobs not
of 2008. The news since then has been financial risk broadly, and weighs upon reform, Iraqi elections, a new START created’ is beyond misleading.
future generations. treaty, financial industry reform, climate Like the “unemployables” of the
loud and clear. The economy shows few
If we fail to understand the real ori- change, an amended No Child Left Behind, Great Depression before FDR came along,
long-term prospects for strong growth. Afghanistan and a balanced budget. America’s jobless today face the cruel-
And as the effects of the Obama stimu- gins of our economic distress we can’t
create policies to address them, and we The BLS non-farm payroll table offers est of choices: hunger, homelessness and
lus package, now a year old, fade, there a focused summary of job creation in declining heath. Their anxiety and anger
is not enough private sector growth to can’t budget with an eye to future.
It means that Congressional the past and a strong sense of what may are growing as their hope fades.
sustain a job producing recovery. As be possible in the future: America’s best But the jobless are not completely des-
the Federal Reserve ends its role as the Democrats who fought to limit the size
of the Obama stimulus couldn’t do three-year job creation total was 10.3 mil- titute in a democracy. They still own their
principal buyer of home mortgages, lion, which occurred from 1997 to 1999; votes which can be ‘spent’ on election
and home-buying tax credits conclude, basic arithmetic (output gap - stimulus
its second best effort produced 9.4 mil- days -- or not. Given their sheer numbers,
we risk another leg down on home size > 0). It means that we continue
lion jobs, 2004-2006; and the third-best the jobless can determine the outcome
values, crippling the principle asset of to pursue economic objectives that
performance was 7.7 million new jobs, of any election. Their decision to go vote
millions of American families. We are don’t create wealth, and don’t spread it 1984-1986. -- or to boycott an election -- make them a
in a “limp-home” mode, yet where we broadly enough to leverage that wealth But America needs to find at least 11.2 power block to be courted and convinced
are heading is as yet unclear. into improving the lives of all people. to 13.0 million jobs right now just to get that “jobs, jobs, jobs” is more that cheap
Mayor Hickenlooper might have It means that we are clueless when it us back to December 2007’s employment political rhetoric.
missed all those columns by Paul comes to the economy. level, which itself was no great shakes, If the BLS total non-farm payroll his-
Krugman in the New York Times and The sooner we can face up to the and 22 million new jobs if we want to tory is any indication, the jobless will have
the comments of Elizabeth Warren, consequences of failures to regulate have, as morally we should, near full real at least three election cycles - 2010, 2012
chairperson of the Congressional finance, the off-shoring of manufac- employment. For every month we delay and 2014 - to spend those votes, and then,
Oversight Panel for the TARP pro- turing, the metastasizing of a bubble further, the total increases by 140,000 jobs, as embittered as they will be, theirs will be
gram. But myriad voices, including the economy and the failure of monetary if measured over three years, would total ‘the last (sad) laughs’.
hearings on the economic collapse, the policy over the last twenty years, the a further 5.0 million jobs. Rick Sloan is the Acting Executive
sooner we can restore America’s prom- Yet not once in seven decades have we Director of “Ur Union of Unemployed.”
testimony of Ben Bernanke, or remarks
before the Congress by Alan Greenspan ise. And Colorado’s.
describe a not pretty picture of the
future. FIVE SMART THINGS YOU CAN
Let’s get some economic basics SAY ABOUT THE ECONOMY:
down. Wages are flat for a decade,
adjusted for inflation. We have had 1) Our economy should be about
bubbles in equities, commodities (think creating value. Value creation equals
oil) and housing. All three have sapped job creation and economic growth.
the productive strength of our economy.
Worse, yet productivity has become 2) Economic regulation should place
decoupled from wages. Workers can do speculation in its rightful place in the
more, make more, innovate, but they regime of economic activity. Trading BC.qxd 11/24/04 5:09 PM Page 1
won’t be compensated more, on the markets create winners and losers with
whole. Our economy has become dan- every trade, but we can’t subsidize los-
gerously unbalanced (google “Apex ers and over reward winners.
and Foundation”). Finance, Insurance
3) We’ve got to get health care and
energy right if we are to be competitive
Full Circle Wellness
as a state and a nation. The rest of the
'$!%%
Acupuncture • Herbal 
Medicine • Massage Therapy
developed world is ahead of us in both '#'!&'$$!
areas. Preserving the middle class is as
much about these two critical areas as Runners • Cyclists • Skiers
anything else.
*(%&$ 
4) Making stuff matters. Adding Full Circle Wellness center can help your
 %& $ (!'#
value to raw material is the tap root
of economic activity. The other sectors athletic performance...
!($   
 
matter, but at the end of the day, add- For performance enhancement, speed recovery times,
)))'$ '#'!&'$"
Additions & Renovations ing value is what makes everything decrease healing times, achilles, rotator cuff, plantar fasciitis,
else possible. Acupuncture is your answer.
Kitchens
Bathrooms 5) We can’t get the jobs problem
Sports medicine acupuncture and massage
Basements fixed unless we are intellectually hon- therapy works!
Porches / Pergolas / Decks est about the rest of our challenges. We
didn’t dig this hole in a day, and there’s
no miracle waiting to rescue us now.
3 03- 250 -59 11 But we can fix this by being smart, bold
and persistent.
Rachael Rose MS, LAc.
Anne Carruth, LAc, M.S.
—Guerin Lee Green
the Cherry Creek News 303-480-0080
Owned & operated in North 2931 W. 23rd Avenue
Denver www.FullCircleAcupuncture.com photo by Jeff Navarro
April 2010 Cherry Creek News & Central Denver Dispatch Page 3

OMG. PLANNED PARENTHOOD IS OFFERING

GYT 10 STD* testing on


$

April 23rd & 27th


S.
GET YOURSELF TESTED! AT ALL OF OUR HEALTH CENTER

Call 1.800.230.PLAN or
visit pprm.org for the health
center nearest you.

* This applies to gonorrhea/chlamydia tests and HIV


pprm.org
tests. Coupons cannot be used and some additional
fees may apply.

Getting fit in 2010: Models of fielding tree and shrub care


fitness llc.
by Guerin Lee Green
What is fitness? effect, that high levels of endurance
That is an extremely difficult ques-
tion. The core of the difficulty lies in
training will interfere with putting on
muscle, pretty much without regard to
ISA certified arborist
the adaptable nature of the human the time spent in a weight room. The licensed and insured
body. The body adapts to the demands Olympic weight lifter, in the 170-lb class
we place upon it in widely differing will have tremendous power, lifting expert tree trimming, tree
ways— and it even responds to obesity three times their body weight, coupled
and starvation (anorexia) in divergent with great flexibility, but not the showy removal, shrub pruning, and
manners. Anorexics, when they add
weight, are so metabolically screwed
muscles of a body builder (women
Olympic weight lifters can lift 2.5 times tree planting
up that almost all the weight they add
is fat— their bodies won’t put on lean
their body weight). The bodybuilder
might compete with 6% body fat, and for a free estimate
muscle mass, a strange survival mecha-
nism that makes the disease even more
eat five thousand calories daily. Look at
the Olympic sprinter, the human stick
gabe @ 303 667 5004
fieldingtreeandshrubcare.com
difficult to treat. And the obese can of dynamite, or an athletic NBA player,
have a very hard time adding lean the very definition of explosive power.
muscle mass that would speed their Or the master yoga practitioner, who
metabolism, because the adipose (fat combines non-explosive strength with Eleven years in the business, Gabe Fielding is a personal
tissue) they have in abundance is meta- great balance and supreme flexibility. arborist that knows your trees.
bolically inert. Which of these models, or archetypes
Consider some models: The elite represent fitness?
Spring is a great time to take care of your trees!
endurance athlete, who trains to com- Each of the models above represent
pete in events of a duration longer than an extreme adaptation of the human
thirty minutes, turns their body into a form to repeated stress. In each case, Take care of your trees, give Gabe a call today
highly efficient-fat burning machine. the body will change its form, rewire its
It’s a well-documented “interference” see FITNESS on page 4

URBAN LIVING AT ITS BEST!!!


! ! Do You want ...
CLOSE to Everything - Downtown, City Park, Restaurant Row?
to be
a cool NEIGHBORHOOD with big trees, beautiful homes and great neighbors?
ROOFTOP DECKS with KILLER VIEWS of the City and Mountains?
DUMBWAITERS that make multilevel living and entertaining a pleasure?

Visit us at stjamesrow.com pa
broadway

rk CITY
av

St James Row
in historic San Rafael
SIX STUNNING TOWN HOMES
3 Bed 4 Bath | 2600 - 3400 sqft | $679K - $850K
e

17th ave restaurant row


PARK

timeless architecture | designer finishes | dumbwaiters


2200 Emerson Denver CO rooftop decks | deck houses | wet bars colfax

Lindsey Wiseman Jim Wiseman

303.859.3864 303.250.8091
!
Page 4 Cherry Creek News & Central Denver Dispatch April 2010

Defining fitness
continued from page 3 This less extreme HIT method may
nervous system and adjust its metabo-
work well for people (the older, less
lism to meet particular demands. The
fit, and slightly overweight among
body will even convert fast twitch
us) whose doctors might have worries
muscle fibers to slow twitch, and vice
about them exercising “all-out.” We
versa. That adaptation to stress is ulti-
have known for years that repeated
mately the measure of fitness.
moderate long-term exercise tunes up
Recent research says that muscles
fuel and oxygen delivery to muscles
actually determine how the body uses
and aids the removal of waste prod-
fat. Muscle energy levels affect the cre-
ucts. Exercise also improves the way
ation of proteins that instruct the body
muscles use the oxygen to burn the
how to use the fatty acids we consume.
fuel in mitochondria, the microscopic
It’s another argument as to why exer-
power station of cells.
cise matters far more than diet.
Running or cycling for hours a week
Making it personal
widens the network of vessels supply-
I’ve been trying the Tabata intervals
ing muscle cells and also boosts the
mentioned last month (check it out on-
numbers of mitochondria in them so
line at northdenvernews.com). They
that a person can carry out activities of
are definitely trying— I hit a peak heart
daily living more effectively and with-
rate of 187 BPM while doing them.
out strain, and crucially with less risk
I don’t know if they have had a big
of a heart attack, stroke or diabetes.”
impact yet. I’ve been trying a Suunto
But the traditional approach to exer-
TC6 watch and heart monitor during
cise is time consuming. Martin Gibala
some of my workouts, which is inter-
and his team have shown that the same Detox Your Body for Spring
esting. I’ll have more about that next
month.
results can be obtained in far less time Inside & Out!
with brief spurts of higher-intensity
As I suggested last month, go to

C l i n q u e D e Lav i t a ’ s E l i t e
exercise.
Youtube.com and search for Tabata to
Keeping it personal, that 225-pound
get some examples— I’ve been doing

Detox
bench press goal is looking better. I lift-
dumbbell thrusters, perhaps the goofi-
ed 320lb. on a flat bench press machine
est named exercise ever.

Spa
at the end of a workout last week. Now,
Research from McMaster University
in Canada has broadened the argument
for interval training. “The authors have
that isn’t the same as actually bench-
pressing that weight, as the machine :: Spring Cleanse Packages ::
$70 5
provides some leverage, plus moves
already shown with young healthy
only in a single plane, so you don’t  Colon Hydrotherapy Treatment

college students that this produces the

$12
have to stabilize the bar. So while I’m
same physical benefits as convention-
still well short of my goal, I’m clearly  Cellulite Elimination Body Wrap

al long-duration endurance training, in
stronger. I have made personal bests
despite taking much less time (and using the Alpha 2010 System PLUS Cherry Creek
in back and tricep exercises as well,
amazingly, actually doing less exer-
cise!). However, their previous work
which is both gratifying and encourag- Microdermabrasion Facial Treatment East
ing. I’m hoping to easily bench press
used a relatively extreme set-up that
over 200lb by my 43rd birthday this 9925 S. Niagara St. Suite 310 :: Denver, CO 80224
involved “all out” pedaling on a spe-
month. I also saw my inspiration this
cialized laboratory bicycle. The new Call for more Information :: 303-780-0003 or 303-472-3554
past month, a fairly ordinary looking
study used a standard stationary bicy- w w w. E l i t e D e t o x S p a . c o m
guy who I judged to be a few years
cle and a workload that was still above
older, and maybe an inch taller than I.
most people’s comfort zone —about
Bespectacled, without showy muscles,
95% of maximum heart rate — but only
he incline pressed 175lb easily, about
about half of what can be achieved
20 times. ***
when people sprint at an all-out pace.

Solar key at Lowry


redevelopment
continued from page 1 and support for renewable energy,
Plant’s renovation and renewable energy efficiency and electronics recy-
energy systems symbolize Lowry’s cling. Numerous other Lowry hom-
transition to a “green” community. eowners have decided to install solar
The Steam Plant’s initial 10KW solar power systems since 2007, making
power system was the first phase of Lowry one of Metro-Denver’s leading
the Lowry Energy Initiative. renewable energy communities.
The Steam Plant’s solar energy sys- If you are interested in “green”
tems and many other energy events improvements for your home, office
throughout the Lowry community or school, please contact Greenprint
since 2007 have been important cata- Denver greenprint@denvergov.org
lysts to raise community awareness
April 2010 Cherry Creek News & Central Denver Dispatch Page 5

Biking around Denver now a


shared affair
continued from page ONE out a bike from one of the many Denver
place to help pave the way for more B-stations and return it to a B-station
Americans to lead active and healthy near your final destination.
lifestyle. We are proud to support such “Denver is the ideal city with its 350
an innovative program that aligns with miles of trails and 300 days of sunshine
our nonprofit mission to build healthier to launch the nation’s first city-wide
communities.” bike sharing program,” Denver Mayor
Conditions: PreͲ & PostͲ
Users can sign up for 7-day ($20), John Hickenlooper said. “Denver Tendonitis Surgery
30-day ($30) or annual memberships B-cycle will offer our residents and
Rehab:
($65) online. Users can also purchase visitors an alternative form of pub- Muscle Strains

the $5 24-hour membership at the lic transportation that eases conges- Bursitis
Joint
Replacement
B-cycle station with his/her credit card. tion on our roadways and promotes
Discounts are offered for students and sustainability. We are very grateful to Plantar
Fasciitis
Ligament
Reconstruction
seniors. With membership, every time Kaiser Permanente for its support of
a member checks out a B-cycle from Denver B-cycle and encourage others Ligament
Sprains
Fractures

a station, the first 30 minutes is no to embrace this new era of fun, sustain- Arthroscopies
charge. Escalating usage fee charges able and healthy transportation.” Neck Pain
Osteotomies
apply for longer rides. Simply check Back Pain

The Preference of Civility


Laminectomies
Joint
Instabilities
Discectomies
by Lucía Guzman Our kids understand bullying. Sports Injuries
There is something wonderful Bullying is aggressive behavior that is Spinal Fusion

about these two quotes: “All poli-


Arthritic
intentional and is repeated over time. Conditions
tics is local,” in the words of former Bullying can take many forms, such
Speaker of the House Tip O’Neil, and, as physical bullying; teasing or name-
Incontinence

“All politics is personal,” attributed to calling; intimidation using gestures or


House Speaker Nancy Pelosi. These social exclusion; and sending insulting
statements articulate the essence of messages by mail or e-mail. When slowing down is the last thing you want to do,
the political process. An issue may How can we, as adults, teach our
be debated and legislated in DC or in children that these behaviors are unac-
Active Motion is your preeminent choice.
Colorado’s Capitol, but it is lived out ceptable, and then go out onto the
in our homes and our communities. streets and become bullies ourselves, 1325 S. Colorado Boulevard, Building B, Suite 206
In our recent national dialogue or watch as someone else does and Denver, CO 80206 303Ͳ394Ͳ3356
about health care, many citizens have do nothing to stop it? How can we
taken action by showing up at rallies, support a political leader who is a www.activemotionpt.com
writing letters, mak- bully? We cannot. Kids
ing phone calls, talk- are smart, and they see Attention You Deserve...Results You Desire
ing with their neigh- our actions and inac-
bors and reading the tions and learn from
paper to learn more them. As the old say- For FirstͲTime Clients, MENTION THIS AD & Receive
about the issues. This ing goes, our actions A FREE Gift Card for YOUR FIRST VISIT!
citizen engagement speak more loudly
should be acknowl- than our words.
edged and celebrat- Discourse and
ed. debate are the
However, there American way. While
is another side to debate has often been
the engagement that violent and ugly, the We debate in kitchens while mak- of disrespect from my colleagues or
is less positive. It is current bi-partisan ing dinner for the family; we discuss fellow citizens. One of the best ways
disturbing. Name rancor weakens us. issues in community meetings as we to stop bullying is to publicly address
calling, disruption, The late David Foster prepare to give thanks for what we and denounce it.
disrespect, the spread Wallace argued that have. Discussion brings us together Being a representative of the people
of un-truths, threats today’s political shills, and allows us to hear each other. The is a position that carries many respon-
of violence and threats of inaction strict partisanship and shallow think- words I hear today are pulling people sibilities. I welcome the privilege to
are bullying tactics – and should be ing “alters democratic discourse from apart, closing doors – not opening represent you and will bring to the
swiftly confronted and stopped. Rocks a ‘battle of ideas’ to a battle of sales them. office the deep respect and honor that
thrown through windows, slanderous pitches for ideas.” As a candidate, I pledge to partici- it deserves. I will also work with my
name calling, violent words and dis- I agree. I come from a culture of pate in an open dialogue throughout colleagues to build a collegial body
torted pictures of political leaders, and debaters as a Latina, a woman and a the race and while in office, if elected. I that deserves your respect – one that
threats have become commonplace in pastor. Taking on ideas, examining all pledge to hear from and listen to voic- debates issues and examines ideas,
this discourse. It is a destructive and sides of the issue and arguing for a es from many sides of each debate. I in the end creating laws that support
ugly turn of events, and one we the particular path is part of my DNA. But also pledge to not stand idly by if I see and nurture the American Dream for
people should not tolerate. Incivility in I also learned to do this with respect. bullying actions or hear a discourse every citizen.
our public dialogue must stop.

ADD

ADHD

TRAUMATIC BRAIN INJURY

ANXIETY

For more information please contact:


Kerri Honaker, LPC, Clinic Director LEARNING DISABILITY

303-417-1797 | KHonaker@neuroAgility.com
www.neuroAgility.com ASPERGERS
Kerri Honaker, M.S., M.A., LPC
Earle Shugerman, MD
2501 Walnut Street, Suite 205, Boulder, CO 80302
3773 Cherry Creek Way,
495 Uinta No Dr/Suite
Suite120,
690W/ Denver
Denver, COCO/ 80209
80230 ATHLETES

TALENTED AND GIFTED


We accept most major credit cards. Insurance coverage may apply
Page 6 Cherry Creek News & Central Denver Dispatch April 2010

Secrets of successful women


and quieting self-doubt
By Angela Sasseville, MA, LPC, NCC want to spend the next 40 years of their
He wasn’t sure how long it had lives together.
been going on but he felt as though his Little did he realize that every part-
wife was drifting further and further ner has undeniable and legitimate emo-
away from him. Many of their interac- tional needs that only their spouse can
tions now seemed cordial and perfectly meet. In other words, he wasn’t being
uneventful. But what had happened “whiny”, as she had once accused him
to the chemistry? And when had she of being. He was ready for their rela-
stopped becoming enthused about tionship to evolve and become stron-
spending time with him? She seemed ger, more connected.
so indifferent about his presence now. Reconnecting with your partner can
He could recall a time, back before be difficult and complex. Why stumble
Medical • Surgical • Cosmetic through it alone when you can enlist

&
the kids were born, when he felt closer
to her. Life was lighter then, easi- the help of a relationship expert who
er. Connecting with her was fun. knows the terrain and can guide you
is pleased to announce
Our board certified physicians offer
He missed that light-hearted sense of towards the destination that you both
being in sync with one another, of want?
the opening
the most of their treatments
current new practice
and being happy to see one another at the
end of the day.
Flourish Counseling specializes in
strengthening adults and couples. Angela’s
procedures available to ensure that Their sex life had become quiet monthly articles highlight common and
in the Lowry area.
you get the best results.
and dull these days as well. He had
waited patiently when their physical
prevalent issues and are never written about
anyone in particular. For more information
intimacy decreased for months when on therapeutic support call 303-455-3767
each of the kids was born. Inside his or go to www.FlourishCounseling.com.
mind he fumed, but she isn’t pregnant
now so why did she think a marriage
without sex was acceptable? It was
becoming increasingly frustrating to

Dr. Alexandra Theriault try to resolve the issue. The tension in


their bedroom had been going on for
so long that a nonphysical relationship
had become their new norm.
There were moments in which he
secretly wondered if she was having an
affair. At least that would explain why
her focus was always on something
else, he thought. She assured him she
simply had a lot of work to do that
pulled her away from home. He didn’t
know what to believe. Yet the longer
their disconnection from one another
continued, the more peripheral he felt
in her life, and the more fragile the
marriage felt to him.
He dreaded bringing this stuff up to
her. He was no relationship expert and
sometimes he struggled to find a way
to spit out what was bothering him.
Other times he just felt pissed when
she ignored him! But he knew that
this wasn’t a way that anybody would

For Breaking News


Dr. Juliann Wallner
Treatment for:
Throughout the Month, Visit
www.theCherryCreekNews.com
• Acne • Aging Skin • Eczema • Hair Loss
• Hyperhidrosis (Excessive Sweating)
• Skin Infections • Lesion and Cyst Removal
• Melanoma • Nail Disorders
Lowry Apex Dermatology Office
• Nail Fungus • Pigmentation Disorders

Trust In Stellar!
• Rashes of All Types • Psoriasis
will be open November 2, 2005.
• Scalp Conditions • Scars and Keloids
• Skin Cancer

Plus Cosmetic Dermatology l


Specia
Spring
• Botox • Juvederm • Radiesse
Featuring Interior & Exterior Painting Kitchen & Bath Specialists

• Obagi 125
• MD Rampart Way • Latisse Faux Finishes & Mural Art Basement Finish
Forte • Prevage Stain & Finish Work Exterior Carpentry
Suite 220 Stucco Repair & Coating Systems Window Replacement

130 Rampart
Denver, Way
CO 80230
Wallpaper Removal Tile Installation
Drywall Repair & Texture

Suite 250
303.795.2030
$400 off all Painting Services minimum $1,000 or
10% off Labor on all Interior Home Remodeling minimum $2,000.
In Lowry Coupon cannot be combined with other offers.

303.261.1525 720-981-STAR (7827)


www.StellarPaintingAndRemodeling.com
April 2010 Cherry Creek News & Central Denver Dispatch Page 7

The benefits of strength training 


By James Thompson, physician tected which results in a decreased 
assistant, Denver Health risk of sustaining an injury as well as
increased flexibility. With this, balance

When people think of strength train-
ing they think of some over-muscular and coordination can also be increased, 
brute. In actuality, you don’t have to decreasing the risk of falling especially 
look that way to attain the benefits of in older individuals.
strength training. In addition, strength training can 
The benefits of strength training reduce the effects of osteoporosis by
can be felt in just the first few weeks increasing bone density, essentially 
of beginning a workout program. making bones stronger. 
Working out focusing on the same And of course, once you are in a
regular exercise regimen you will be

body part two or three times a week
can have a positive effect on a per- able to sleep much better decreasing 
son’s energy level. This gives the par- the risk of insomnia which in turn 
ticipant the ability to increase or keep decreases the risk of heart disease,
their independence while being able obesity, cancer and diabetes. 
to perform activities of daily living Some key points to strength train- 
easier, and can give an athlete better ing include the following: 
performance in their sport. As you A strength training program lasting
grow stronger you will not get tired 20 to 30 minutes a session, two to three 
as quickly. times a week is all that one needs to
In addition to accomplishing tasks attain these benefits.
with greater ease, the strength trained Resting a day or two between work-
individual is able to control their outs is essential to let your muscles
weight by being able to burn more recover.
calories. This is due to muscle hyper- A proper diet, including eating the 
trophy (an increase in muscle mass) right amount of protein, is essential 
which requires more energy when at for building muscles. An appointment 
rest. with a registered dietician would be
Improvement in physical appear- very beneficial if one has doubts about 
ance and sense of well-being are com- their nutrient intake. 
mon characteristics in strength trained If you have any concerns with your
health then an appointment with your

people and can actually lessen the
severity of depression. primary care physician is a great place 
Due to muscle hypertrophy with to start before beginning an exercise 
strength training, joints are better pro- program.

7th Annual Five Points Jazz Line- 


up Announced  
Join DOCA and the Five Points com-
munity in celebrating the history, cul- Five Points Plaza
ture and MUSIC of the Five Points 2:00 PM Dr. Tone & The Notes
neighborhood during the 7th Annual 4:15 PM Manuel Molina
Five Points Jazz Festival. This FREE 5:45 PM Willie Houston and Advertise in the Cherry Creek News from
event takes place on Saturday, May 22 the Blues Prowlers
from 1:00 p.m. to 8:00 p.m. along Welton
just $89/month
Street in Historic Five Points. The festi- Crossroads – Pianorama
1:00 PM Jeff Jenkins & Eric
val has it all: 13 bands on 5 stages; food
and arts vendors; activities for kids; Gunnison No other paper delivers Cherry Creek North, Lowry,
engaging talks about jazz history; and 2:30 PM Ellyn Rucker & Vlad Hilltop, Country Club, Bonnie Brae and the Polo
free museum days! Take the RTD Light Girshevich Grounds DIRECTLY BY MAIL every month.
Rail line D to get there; a shuttle is avail- 4:00 PM Purnell Steen & Hank
able to get you around the festival. It’s Troy
sure to be “Cool, Crazy and Hot!”
KUVO In-Studio
11:00 AM Five Points Jazz Legacy
Combo
1:00 PM Leonard Barrett, Jr.

KUVO Main Stage


1:00 PM Legacy Jazz Orchestra
3:15 PM City Park Jazz
4:45 PM Five Points Jazz Festival
Tribute Award Presentations
5:15 PM Cleo Parker Robinson
Dance
6:00 PM Elevation Jazz Orchestra

small business
accountants!
-full charge bookkeeping
- payroll
-sales tax

Be ready for tax time!


QuickBooks® experts
law & equity ltd
www.lawandequityltd.com
4450 tennyson st.
720.201.4975

established 1996
Page 8 Cherry Creek News & Central Denver Dispatch April 2010

Cyndeth Allison Redwine Piano Tuning


I have had thoughts like this
Denver Notions before, about how all beings fit into Musician’s Ear
the universe on their own scales,
Every autumn elm bugs invade sink, as if he knew his way.
blind to fractals larger and smaller
the house. Just a few – ten or twenty. As I watch him go, I say, as usual,
– atoms or galaxies. Here is a living
Friends are taken aback, but to me, “Die!”
example.
that’s a livable number; when I lived The next day at breakfast I am star-
Bug walks back along the lower
in the country, hundreds ing absently in the direction
side of the handle. It’s as if his job Artist’s Touch
would darken my picture Bugged of my big-bellied samovar.
is to measure every millimeter of
window to the point where Movement catches my eye.
I couldn’t see out. My bug is climbing patient-
my kitchen. Perhaps he cannot leave
until he has fulfilled his purpose and
$80 Piano Tuning
As winter draws on, I begin to ly up the shiny side.
find their little Halloween-colored Attention drawn, I really look at
made his report.
Bemused, I watch his progress. I
$25 OFF!
carcasses. I’m always relieved when the urn. I see that it reflects the whole
the last are gone. For all that I don’t room, as if it were a surreal stage set
forget to say, “Die!” *** Call Mike Redwine
fight the invasion, I am not happy – a cross between Escher and Dali. 303-818-6316
about sharing space with them. Distorted by the curved side, the
This year, all winter long and cupboards and stove bulge large, the
-Offer ends May 31-
into spring, one surviving insect has door is a mere slit, center stage, back.
stalked my kitchen. For days at a Those lines you always draw to show
time, he will disappear, then he reap- perspective, wide apart at the bottom,
pears on the counter, on the floor. narrowing as they rise up the paper,
Every time I see him, I say, “Die!” are clearly marked – where floor joins
I can’t imagine that he wants to cabinets, where counter joins wall –
live like this, in a hot house, far away but are wavy and softened.
from sun and wind and fresh green Bug reaches the top, traverses the
Your neighborhood Nostalgic cupcake bakery
things to eat. I can’t imagine that he lid, goes back along the handle in the offering 30 flavors daily.
wants to live at all, solitary, like an front, as if he were a stagehand on a
old man in a nursing home, all of catwalk adjusting lights for the next
whose friends have long since died. performance. He makes me think
Yet I do not put him out in the about proportion in a different way. Voted best cupcake store in Denver 2009 –
snowy yard where he could come to To that bug my house is as vast as Editors choice 5280 Magazine
a natural end. And when I find him New York City, my kitchen as big as Voted best cupcake and chocolate butter cream
legs up on the far side of the kitchen a neighborhood. These spaces must - Cupcake Challenge 2009 – Gabby Gourmet
from his usual haunt by the window, I be invisible to him by their sheer
flip him over gently, and inquire how volume, while the shining, distorted
on earth he ended up on his back. I stage kitchen is only a few sizes
ask if he walked all the way around too big. If he were on that stage, he Free Delivery (limited area)
the counter, or whether he flew. He would be able to understand its form 1st and Adams in Cherry Creek (129 Adams Street)
does not answer, but limps away, gait in a way he cannot that of the larger 303-322-CAKE
dignified, almost huffy, toward the room.
www.bigfatcupcake.com

%U R NH U D J H IR U %X \H U V
D Q G 6H O O H U V6L Q FH    
66\UDFXVH6WUHHW +XPEROGW6WUHHW +ROO\6WUHHW ()DLUPRXQW'U

%UDGIRUG5HDO(VWDWH
2IIHULQJ5HQWDO
0DQDJHPHQW6HUYLFHV
   
6XQ¿OOHG KRPH ZLWK EDPERR ÀRRUV YDXOWHG FHLOLQJ 4XDLQWEXQJDORZRQVROLGEORFNFORVHWR:DVK3DUN 7KH DLU\ PDLQ ÀRRU RSHQV WR D SULYDWH EDFN\DUG Z )DQWDVWLF KRPH LQ /RZU\ 9DXOWHG FHLOLQJV GUDPDWLF %UDGIRUG5HDO(VWDWH

FXVWRP EXLOWLQV JDV ¿UHSODFH  RSHQ ÀRRU SODQ 5HFHQWO\8SGDWHGNLWFKHQDQGEDWKPDNHWKLVKRPH SRQG JUHDW IRU HQWHUWDLQLQJ 7KH VHFOXGHG PDVWHU UDGLXV VWDLUFDVH JUPW NLWFKHQ Z LVODQG  HDWLQJ
2SHQ *RXUPHW NLWFKHQ Z 66 DSSOLDQFHV  JUDQLWH OLYDEOHQRZZLWKGHYHORSPHQWSRWHQWLDOLQWKHIXWXUH VXLWH KDV D SULYDWH EDOFRQ\  SF EDWK 2I¿FH RQ VSDFH)RUPDOGLQLQJUPOJPDVWHUVXLWHIXOO\¿QLVKHG
0DVWHUVXLWHZEDOFRQ\ ODQGVFDSHGEDFN\DUG 6T)WORW JUHDWDFFHVVWROLJKWUDLO'RQ¶W0LVV PDLQIRUZRUNLQJDWKRPH PHGLDURRPLQEDVHPHQW EVPWZKLJKFHLOLQJV7RQVRIVSDFHJUHDWEDFN\DUG
-RUGDQD/HERZLW] %UDG/HZLV 3DXO+HEHQVWUHLW -RUGDQD/HERZLW]

ZZZ % U DGI R U G5HDO(VWDWHFRP   WK 6WUHHW'HQYHU 



April 2010 Cherry Creek News & Central Denver Dispatch Page 9

Fran Schroeder
Denver Icons
1936 on the old foundations
St. Elizabeth of Hungary is a Catholic by the May Bonfils Trust. The
community composed of both Roman and friary is decorated by a colon-
Byzantine Rites under the nade, Stations of
authority of the Ordinary of the the Cross, and a
Archdiocese of Denver. Saint shrine to St. Francis.
The Roman Rite Mass is cel- Elizabeth After more than a century
ebrated at 9am every Sunday, and of service to Colorado, the New
has over 300 families and single of Jersey Franciscans left in 1983.
participants. The Byzantine Rite
Divine Liturgy is celebrated every
Hungary The Capuchins, another order of
Franciscans, took over the parish
Sunday at 12:00pm. The liturgy is duties. In later years the parish
in English and follows the Russian tradition. became a mission of Holy Ghost parish with
HISTORY the Vincentian priests as caretakers.
St. Elizabeth’s
began in 1878
with a handful
of German fami-
lies who lived on
the west bank of 53"$* ,3*4,3*45&/ 5)&."5$).",&340',3*4,&//:$0//&$5*0/4
Cherry Creek.
Nine years later
'BMM*O-PWF
the Franciscans
5IFQSFNJFSNBUDINBLJOHTFSWJDFGPS$PMPSBEPµTUPQTJOHMFT

from New
$"--6450%":'03"13*7"5&$0/46-5"5*0/"5

Jersey accepted KRIS KENNY CONNECTIONS


care of the par- Very personal matchmaking.
www.kriskennyconnections.com
ish from Bishop
Machebeuf. The
#06-%&3%&/7&37"*-

present church,
1IPUPDPVSUFTZPG-BVSB%PNCSPXTLJ1IPUPHSBQIZXXXMBVSBEPNCSPXTLJDPN]8BSESPCFDPVSUFTZPG4XBOL#PVUJRVF

Homesitter - Available to live in


dedicated in
1898, is the sec-
ond building. It
became famous
in Colorado his-
tory when Fr. Leo
Heinrich, then In the event of an emergency! Will take
care of your home & pets.
pastor, was assas-
sinated while
distributing Holy
Communion at
early morning Bus. Consultant, handyman. Great local References
720-980-8989
Mass on February
23, 1908.
In the 1960s,
after the Second
Vatican Council ruglobal@gmail.com
introduced sweeping changes in Catholic lit- St. Elizabeth’s was turned over to the
urgy, the church interior was completely reno- Archdiocese of Denver in the 1990s. In 1999
vated to its present form. The beautiful stained the community of SS Cryil and Methodious
glass windows were installed at that time. Russian Catholic Byzantine Community was
Next to the church is the friary, rebuilt in added.*** Central Denver
Dispatch & Cherry Creek
News
P.O. Box 460142, DENVER, Colorado 80246
Phone: 303.458.7541

• The Central Denver Dispatch & Cherry Creek News


is published MONTHLY free of charge to its readers. It
is mailed to more than 8000 residences in Denver, and
nearly 300 area businesses.
• The Central Denver Dispatch welcomes news releases,
calendar events, photos and letters.
• Send releases and other information to
submit@thecherrycreeknews.com
We do not accept press releases or calendar materials
by fax.
More advertising information, along with additional
editorial content, can be found on-line at:
www.thecherrycreeknews.com
Letters to the editor must be signed. We reserve the right to
edit letters and other contributions for space. Publisher assumes
no responsibility for return of unsolicited manuscripts or art. We
attempt to verify all matters of fact but hold contributors liable
for the content, accuracy and fairness of such contributions.
The Cherry Creek News is a legal, independent newspaper
of general circulation in Hilltop, Crestmoor, Belcaro, Bonnie
Brae, Glendale, Virginia Vale, Cherry Creek, Lowry and
surrounding neighborhoods.
For advertising information, call 303.458.7541. Discounted rates
for new advertisers with special promotions.
Guerin Lee Green, Publisher and Editor
Page 10 Cherry Creek News & Central Denver Dispatch April 2010

Owning fixed income in various


interest rate environments Finally. Doors That Match the
There’s been growing concern about
the possibility of rising interest rates.
priate. However, owning too many long-
term bonds can increase your portfolio’s Style and Quality of Your Home.
While no one can predict what interest interest rate risk, because bond prices
rates might do, it’s important to under- will tend to decline as interest rates rise.
stand how rising rates might affect your Maturities offer different trade-offs
fixed-income investments. Then you can and can work together to help balance
better prepare your portfolio today for out swings in price and income in your
the possibility of rising rates at some portfolio. This relationship can be illus-
point down the road. trated with a teeter-totter. The farther
For much of the past 30 years, bond you move toward the ends of the teeter-
rates have generally declined. In fact, totter, the more you swing up and down.
it’s been awhile since bonds have been Similarly, the longer the bond’s maturity,
through a rising rate environment: the more its price can change. As you
• The last instance of rising bond shorten the maturi- ties of your fixed-
interest rates occurred from October income investments, the price swings
1998 to January 2000. tend to decrease. There are other bond
• The last multiyear period of rising features that may affect this relation-
bond rates took place from 1976 to 1981. ship, including call features and credit
As a result, you may not be familiar quality.
with or have forgotten what it feels like Price declines due to rising interest
to be in that type of environment. We rates are separate from declines due to
believe there is little near-term risk of concerns about credit quality. With cred-
rates rising significantly due to current it quality issues, there’s a greater risk
economic weakness and lack of inflation- the bond issuer might not make regular
ary pressures. Therefore, there is nothing interest payments or repay principal
immediate that should cause you to at maturity. Remember, at some point
anticipate plummeting bond prices. a bond’s price will go down – maybe
Bond Prices and Interest Rates quite a
Most investors own bonds for the bit – but that’s usually due to inter-
income they provide as well as the est rate changes and not credit quality
diversification benefits when combined concerns. Even prices of U.S. Treasury
with stocks. However, you enjoy those bonds change due to changes in interest
benefits only if you continue to own rates.
the bonds. In general, you shouldn’t The first step is to discuss your fixed-
sell your bonds just because their prices income investments with your financial Quality Door Replacement
have fallen due to rising interest rates. advisor. Together you can determine Service For Your Home
Don’t sell based on price changes what, if any, changes should be consid-
– Bond prices will rise and fall – some- ered. Remember, the trade- off for the
times considerably – due to changing higher income that longer-term bonds
interest rates. Price declines are a normal provide is greater price volatility. The Call or visit our website to schedule
part of owning bonds. But remember, reverse is also true: Shorter-term bonds a complimentary design consultation
even if a bond’s price changes, its inter- will have less dramatic price swings,
est payments stay the same. In addition,
you can expect to receive your principal
but you receive less income. Make sure
you are aware of the risks and prepared (866) 322-8312
back at maturity, assuming the issuer for any potential consequences. If your www.transitionsbytrustile.com
doesn’t default. Selling prior to maturity portfolio is properly balanced based on
only ensures you lock in your loss. your needs and risk preferences, and
Understanding interest rate risk – interest rates rise in the future, you may
With short-term fixed- income invest- not need to adjust it after bond and bond Replace Your Doors
ments at historically low rates, more fund values have already declined. In Three Easy Steps!
investors have been buying longer-term Contact Eric Jasper at the Highlands
bonds with higher rates to get more Edward Jones office at 303-458-6655, to Complimentary in-home
income. That’s not necessarily a bad schedule a review to discuss opportunities to design consultation, at
idea, and in some cases it may be appro- help move your retirement forward.*** your convenience
Fast and accurate
measurement using
cutting edge technology
Painted doors installed
in one day – with no mess

Achieve Dramatic
Results in Your Home
• Unlimited style options for
every taste and design need
• Sharp architectural details
and crisp clean lines
• Solid construction with
superior sound control

Receive $1000 off your


order of 10 or more doors*
*Must schedule design consultation within seven days and order by April 23rd, 2010
April 2010 Cherry Creek News & Central Denver Dispatch Page 11

World War II vet shaves locks for


childhood cancer research
At an age when many are stepping nearly seven decades later.
back, World War II vet Glen Spaur After the war, Spaur went on LA for
is stepping up. Joining with others, photography school, but found his way Over 30 yrs experience in treating veins and
and raising money from his Denver into the food and beverage industry. He Board Certified in Phlebology.
neighbors, Spaur shaved his hair high setup grocery stores for Safeway, worked EXPERT TOTAL VEIN CARE:
before after
and tight for St. Baldrick’s foundation, for Gallo wines, sold heavy equipment • Spider Veins • Large Blue Veins (Varicose Veins)
the largest funder for childhood cancer and then worked for Budweiser. Along • Swollen or Discolored Legs • Leg Ulcers, Lymphedema
research grants outside the U.S. govern- the way, he lived in Seattle, Portland,
ment, more than $12 million in 2009 married, divorced and remarried. The WE USE THE MOST ADVANCED TREATMENTS:
venous Laser Treatment for Varicose Veins
• Endovenous
(Less side effects and downtime)
• Ambulatory Phlebectomy
FREE
Consultations before after
• Laser Spider Vein Treatment
• Sclerotherapy 303.355.4772 ✓Insurance Accepted
V E I N & AE
A E S TH
T H E T IC
I C CEN TTER
ER OF DE
DENNVV ER a
att LA FON TAI N E A EST
TA IN HE TIC S
ESTHETICS
Ken Oleszek, MD Renald Bernard, Board Certified Phlebologist
2774 East 2nd Avenue • Cherry Creek • Denver, Colorado • 303.355.4772
w w w .Vei n Cen t er Den ver .com
3ȢMǣӰǑOȠ3ȪOȪӮ
ӭ̢ƯΝOȺέ ΝӅS
7ǑMȪͩҿ̢OȺ
Spring
3ȢMǣӰǑOȠ3ȪOȪӮ
ӭ̢ƯΝOȺέ
8Ȣ͝͝Oɺ1BD͕BHɚ ΝӅS
Glen Spaur with neighbors Gabriel and Todd Daily
&ӱSǑөBHǑ͸[ǣ
Romance! ǣHSFǑӂH̢̐˪ΝSU̙Ⱥ 
8Ȣ͝͝Oɺ1BD͕BHɚ
ǣHSFǑӂH̢̐˪ΝSU̙Ⱥ
alone. St. Baldricks’s raises a substan- retired teamster returned to Denver after
)ͽ͝JEBӲT
$ΝӅѻMɚ1BD͕BHɚ )ͽ͝JEBӲT Wellness Center & Spa
tial part of its funds from supporters, his working days concluded. Like so
who contribute on behalf of volunteers many Colorado boys of his generation, (̢̐$ȪSҿ̢mDǑUɚ
$̙ɂ͛ΝӅӂΝӅSǑNǣ[̢OH
$̙ɂ͛ΝӅӂΝӅSǑNǣ[̢OH
who shave their heads. he still loves the outdoors, hunting and
For Spaur, who raised some $1500, fishing. ͳȪӮMΕDǑҿJΝ͸ǑOȠ 
ͳȪӮMΕDǑҿJΝ͸ǑOȠ
%Ȣ̢͝WȪSFȠӭ̢Ư'MΝXȪST
its part of a long story. In 1933, his When it came time to raise money ̉PǑUǑҿJΝ͸DȪͩUȪS
̉PǑUǑҿJΝ͸DȪͩUȪS
father brought his family to Colorado for St. Baldrick’s, he sent out 53 letters,
from Nebraska. They settled in Lyons,
but by 1937 his father had died. Spaur
and pitched the venture on his Facebook
page, and asked his church for help.


graduated from high school in 1942, and In twenty years in Denver on Julian 
ǑOȪXTѵ̢̢҅ӂD΍ͨ
ǑOȪXTѵ̢̢҅ӂD΍ͨ
like so many of his generation, enlisted Street, Spaur, dressed in a naval avia-
in World War II immediately. He fol- tors flight jacket, is full of life’s lessons 8Ư"WȺ
8Ư"WȺ
ǑOȪXTѵ̢̢҅ӂD΍ͨ
ȒMΕD͕TFǚґӂέ4̙Ȫ҅JEǑ͸

lowed brother, a Pearl Harbor survivor and passions. “I’ve had one sensational %ȪͩWȪS $0
8Ư"WȺ
of the California, into the Navy. Spaur life. I don’t think I’d change anything I ȒMΕD͕TFǚґӂέ4̙Ȫ҅JEǑ͸

won his wings, becoming plane Captain have ever done.” He rattles off his three
at just 19. Flying DC3 to carry supplies daughters, seven grand daughters, one
to frontline troops in the Pacific, he grandson, with great grand child on the
bounced along makeshift runways on way. Rec Center site secured— Church in
islands he scarcely could have imagined
back in Colorado. For 3.5 years, he flew
Of his fundraising, he says “I have
never done something that I so much
the City site purchase complete
out of Australia, and placed he says he appreciate” as the support he’s received The City of Denver finalized its pur- and Recreation, are meeting with area
loved, but doesn’t want to return to for the St. Baldrick’s. chase of the Church in the City site on neighborhood organizations and East
March 9, 2010. High school representatives to determine
More evidence for talking to The land, located at 1530 Josephine
Street, was acquired for $6 million and
interim uses for the property.
In 2006, Denver Parks and Recreation
your baby will be the future home of the central
Denver recreation center. Numerous cen-
completed a Recreation Center Needs
Assessment, which identified Capitol Hill
Staff and tone groups saw exactly the same trally-located sites were considered for and Stapleton as two areas not served by
Northwestern University research- pictures for exactly the same amount of the central Denver recreation center, with a recreation center. In 2007, both loca-
ers have found that even before infants time, those who heard words formed the Church in the City eventually being tions were included in the Better Denver
begin to speak, words play an important the category fish; those who heard identified as the most feasible after sev- Bond package that was passed by Denver
role in their cognition. For 3-month-old tones did not. eral public meetings. voters.
infants, words influence performance "For infants as young as three The purchase includes approximate- Voters specifically approved $11 mil-
in a cognitive task in a way that goes months of age, words exert a special ly 2.56 acres, which will eventually be lion in bond funding for land purchase,
beyond the influence of other kinds of influence that supports the ability to developed into a recreation center and planning and design of a new recreation
sounds, including musical tones. form a category," said Hespos, associ- may also allow for additional retail pos- center in central Denver. A portion of the
The research by Alissa Ferry, ate professor of psychology and one sibilities. In the interim, Denver Parks bond funds remaining after acquisition
Susan Hespos and Sandra Waxman of the authors of the study. These find- and Recreation will fence off the site for will be used toward demolition of the
in the psychology department in the ings offer the earliest evidence to date safety during the assessment process, current building and planning of the new
Weinberg College of Arts and Sciences, for a link between words and object which will last a few months. Denver center. Separate funds must be raised for
will appear in the March/April edition categories." City Councilmembers Jeanne Robb and construction of the facility.
of the journal Child Development. In Participants included 46 healthy, Carla Madison, along with Denver Parks —City of Denver
the study, infants who heard words full-term infants, from 2 to 4 months
provided evidence of categorization, of age. Half of the infants within each
while infants who heard tone sequenc- age bracket were randomly assigned to R CLU
es did not. the word group. All infants in the lan- FO $
Three-month-old infants were guage group were from families where
NK
CASH

shown a series of pictures of fish that English was the predominant language
ERS

were paired with words or beeps. spoken in the home. The remaining $
Infants in the word group were told, infants were in the tone group. $
for example, "Look at the toma!" –-- a "We suspect that human speech,
made-up word for fish, as they viewed and perhaps especially infant-directed EXTRA DOLLARS FOR YOUR OLD BLINDS & SHADES
each picture. Other infants heard a speech, engenders in young infants a
series of beeps carefully matched to the kind of attention to the surrounding
labeling phrases for tone and duration. objects that promotes categorization," Replace your old blinds with new energy efficient
Then infants were shown a picture said Waxman, a co-author and profes- Hunter Douglas blinds & shades and receive an
of a new fish and a dinosaur side-by- sor of psychology. "We proposed that additional $10 per window off our SALE price!
side as the researchers measured how over time, this general attentional effect Pictured: Duette® Architella® honeycomb shades reduce energy loss by up to 50%.
long they looked at each picture. If would become more refined, as infants
the infants formed the category, they begin to cull individual words from FAMILY OWNED FOR OVER 40 YEARS
would look longer at one picture than fluent speech, to distinguish among
the other.
The results, say the authors, were
individual words and kinds of words,
and to map those words to mean-
303-355-4223
striking. The researchers found that
although infants who heard in the word
ing."*** 2438 East 6th Avenue
YOUR EXPERTS IN ENERGY EFFICIENT WINDOWS SINCE 1979!
Lowry News
Cherry Creek News & Central Denver Dispatch

Interested in a Small Landscaping Sue Weinstein


Grant? Denver's Parenting Coach
The Lowry Community Master participation you have had over the Tantrums are inevitable as the help them strategize when needed. Teach
Association is awarding grants for past 15 years.  The conversion of a for- weather, by mastering de-escalation and them a technique or two like breathing
landscape-related projects. The intent mer military base to a thriving commu- methods for teaching self-soothing to or taking space to calm their bodies
of the Landscape Grant Program is to nity could not have been accomplished your (sometimes) explosive child is a down when they have gotten frustrated,
redirect funds into the community for without a team effort that involves key parenting skill. angry, or anxious. You can
landscape and other outdoor beauti- thousands of people.  The LRA appre- There are many model for them, or help
fication projects that will benefit the ciates the engineers, masons, heavy things to pay atten-
Handling them try it the first few
quality of life for people who live and equipment operators, land developers, tion to before your Tantrums times. “I see you get very
work at Lowry. employees, home builders, merchants, child explodes— his upset and end up throw-
Landscape Grants will only be con- sod layers, land planners, home buy- temperament, her nap ing your books around
sidered for common-area property that ers, architects, boards and committee time, transitions, crowds, and numerous whenever you start your math home-
is owned by the Master Association, the members, employers, governmental other triggers that you know set your work. We don’t throw books at home or
City of Denver, HOA sub-associations, officials and everyone who spells out child off. But what quick methods work at school. I have an idea, how about we
or property owned by a non-profit the success of Lowry.     We hope you best when trying to help your child calm try some other ways, like breathing, to
organization. Requests for landscape enjoy reminiscing and maybe learning down when the inevitable occurs? How help you calm down instead. Here I will
grants associated with private resi- some new facts as you go through the can you teach your child to self-soothe demonstrate for you”. Teach a relaxation
dences or for-profit businesses will not book.  in the midst of escalation? breathing method, or encourage your
be considered.  If you would like to place an order, For young children, a parent must child to take some space and very short
At a minimum, landscape projects please fill out the form below and realize (after they are calmed down breaks to keep the frustration manage-
must address issues like improving send a check  made out to the Lowry themselves) first and foremost, that able. Reinforce the new behavior when-
landscape beauty, conserving water, Redevelopment Authority to 555 Uinta their child is having a tantrum for a ever they make an effort to use it.
enhancing recreational areas, preserv- Way Denver, Colorado 80230.  Pre-sales reason or a need—even if it is a reason Other quick techniques to soothe may
ing Lowry history, or promoting out- order deadline is March 18, 2010.  The the parent dislikes or disapproves of. come in handy in the midst of a tantrum
door safety. cost is $50 each that must be paid by Find out what the reason is and address or an explosive bout of emotions: physi-
Grants are awarded twice a year in the ordering deadline.  Don’t miss out.  your child’s feelings empathetically. For cal activity, change of scenery (inside to
amounts ranging from $250 to $2,500. This will be the final printing so get example, “I know you want to stay at outside or vice versa), tactile or sensory
The LCMA values collaborative efforts your order in now.  A sample book will the park and you are enjoying yourself, play/activity (warm bath, cold towel
and strongly favors applications that be on display at the LRA office. but I gave you a five minute warning around the neck, using clay). Sometimes
clearly demonstrate how they serve the Oleanna  and now we have to go home and cook these are just enough to take down the
Lowry community. To download the From master playwright David dinner otherwise we will get hungry”. intensity of the emotion for your child
grant application, visit www.lowrylink. Mamet comes an embittered power Or, “I am sorry play time is over and just a notch, enough for you to try some
com and click on the LCMA tab. struggle between a college professor you are disappointed, but we can come other techniques or even distract your
Applications are due on April 21st and his seemingly innocent young back another day when we have more child when appropriate.
or October 1st. female student. What starts as a simple time and you can stay longer. I know The idea for all these steps is to
As the LRA completes the redevel- miscommunication quickly spirals out you will enjoy that.” A simple feel- help soothe or calm your child first
opment activities and approaches the of control leaving all to wonder who ing statement like this helps identify and not to be punitive. Once the inten-
sunset of the organization the staff cre- decides where the lines between favor- and reflect for your child his feelings. sity and stress of the situation has been
ated a “Lowry Story Book” a pictorial itism, sexual harassment, and assault Children cannot learn to regulate feel- lowered, then you could intervene to
journey of the creation of the Lowry really lie, and what happens when the ings until they can clearly identify them help teach, use positive discipline, or
community is available for sale. two parties disagree?  As the lines of in themselves. We help teach them how encourage them to get through what
 We are so proud of what Lowry has communication break down and then to identify and regulate when we use they are struggling with. We must lower
become and your part in forming this are obliterated altogether a single ques- empathetic statements. the intensity of the situation and work
wonderful community.  There are so tion remains-- once the line is crossed, Once you think you understand towards teaching our kids to learn how
many elements that contribute to the can you go back? what you child needs, and empathize to handle intense emotions themselves
unique character of Lowry.  We want with her, sometimes an added level of without harming themselves or others.
to leave behind this memento of our John Hand Theater attention like getting down at eye level, We are there to teach our children how
appreciation and respect for the history In the Colorado Free University and looking your child right in the face to handle their distress, not punish them
of Lowry and show some of the fun Campus while calmly addressing her feelings/ for feeling it.
times, challenges and hard work that 7653 E. 1st Place needs helps your child to feel connected Susan Weinstein MA, MSW, LCSW, The
took place. We also want to show what Denver, Colorado 80230 and understood. Sometimes, this simple Denver Parenting Coach, for more information.
exists today that will stand as a legacy Runs April 9 - May 8 tactic is the beginning or just enough to The Denver Parenting Coach provides free par-
of how this community went from Fridays and Saturdays @ 7:30 help defuse the child’s frustration and enting consultations and presentations please
vision to reality. 2 Sundays, 4/18 & 5/2 @ 6:30 stop further escalation. call 720.240.7070 or visit the website theden-
  Call 303-562-3232 for reservations Monitor you child’s emotions and verparentingcoach.com for more information.
Thank you for whatever form of

Learning struggles?
We can help.
Guaranteed!

www.learningrx.com/denver-cherry-creek
(303) 284-6105
88 Steele Street, Suite 50
Denver, CO 80206

50
S ome kids struggle through school. Homework is frustrating. Focusing is difficult. Grades are

% *
disappointing. And it seems no matter how much harder they try, the problem persists. But if you act now,
it doesn’t have to be that way forever.

LearningRx specializes in helping students overcome learning struggles. Our program starts
with a personalized “Cognitive Skills Assessment” that pinpoints deficient learning skills. Then, we customize a
12 to 24 week program to strengthen your child’s deficient skills.

If your son or daughter has weak cognitive skills, no amount of tutoring, medication or trying harder will
COGNITIVE SKILLS TEST
off
achieve the results that LearningRx brain training can. The potential for good grades, a positive attitude (Regularly $199)
and long-term success exists in every child. Unlock your child’s learning potential today! Expires 3/31/2010

Das könnte Ihnen auch gefallen