Sie sind auf Seite 1von 556

Philipp Christen

Rolf Jaussi
Roger Benoit

Biochemie und
Molekularbiologie
Eine Einfhrung in 40 Lerneinheiten

Biochemie und Molekularbiologie

Philipp Christen
Rolf Jaussi
Roger Benoit

Biochemie und
Molekularbiologie
Eine Einfhrung in 40 Lerneinheiten

Philipp Christen
Biochemisches Institut
Universitt Zrich
Zrich, Schweiz

Rolf Jaussi, Roger Benoit


Paul Scherrer Institut
Villigen, Schweiz

ISBN978-3-662-46429-8ISBN978-3-662-46430-4 (eBook)
DOI10.1007/978-3-662-46430-4
Die Deutsche Nationalbibliothek verzeichnet diese Publikation in der Deutschen Nationalbibliografie;
detaillierte bibliografische Daten sind im Internet ber http://dnb.d-nb.de abrufbar.
Springer Spektrum
Springer-Verlag Berlin Heidelberg 2016
Das Werk einschlielich aller seiner Teile ist urheberrechtlich geschtzt. Jede Verwertung, die nicht ausdrcklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung des Verlags. Das gilt insbesondere fr Vervielfltigungen, Bearbeitungen, bersetzungen, Mikroverfilmungen und die Einspeicherung
und Verarbeitung in elektronischen Systemen.
Die Wiedergabe von Gebrauchsnamen, Handelsnamen, Warenbezeichnungen usw. in diesem Werk berechtigt
auch ohne besondere Kennzeichnung nicht zu der Annahme, dass solche Namen im Sinne der Warenzeichenund Markenschutz-Gesetzgebung als frei zu betrachten wren und daher von jedermann benutzt werden
drfen.
Der Verlag, die Autoren und die Herausgeber gehen davon aus, dass die Angaben und Informationen in diesem
Werk zum Zeitpunkt der Verffentlichung vollstndig und korrekt sind. Weder der Verlag noch die Autoren oder
die Herausgeber bernehmen, ausdrcklich oder implizit, Gewhr fr den Inhalt des Werkes, etwaige Fehler
oder uerungen.
Gedruckt auf surefreiem und chlorfrei gebleichtem Papier.
Springer-Verlag GmbH Berlin Heidelberg ist Teil der Fachverlagsgruppe Springer Science+Business Media
(www.springer.com)

Vorwort
Dieses Buch eignet sich fr Studierende, welche die molekularen Grundlagen des Lebens kennenlernen mchten. Grundkenntnisse der Chemie werden vorausgesetzt; hingegen werden im
Gebiet der Biochemie und Molekularbiologie neu aufkommende Begriffe ausreichend erklrt.
Wir haben herausfordernde Tiefe statt Vollstndigkeit angestrebt und manches, z.B. gewisse
Aspekte des Stoffwechsels, vereinfacht dargestellt. Die Chemie des Lebens ist ein beraus
spannendes und auch weites Feld; wir haben versucht, die Leserin/den Leser nicht nur lauter
Bume, sondern auch den Wald sehen zu lassen.
Das Buch ist in sechs Teile mit zunehmend komplexeren Themen gegliedert:
I Die Molekle des Lebens (Proteine, Enzyme, DNA, RNA, Membranen; Kap.17),
II Molekulare Genetik (Replikation, Transkription, Translation; Kap.812),
III Stoffwechsel (Synthese, Abbau, Energiegewinnung; Kap.1321),
IV Molekulare Zellbiologie (zellulre Prozesse; Kap.2227),
V Molekulare Physiologie (organismische Prozesse; Kap.2836),
VI Methoden (Analytik, Strukturbestimmung, Gentechnik; Kap.3740).
Um den Ansprchen einer breiten Leserschaft aus Medizin, Naturwissenschaften und Biotechnologie zu gengen, werden die Biochemie und Molekularbiologie in 40Kapiteln mglichst
umfassend dargestellt. Wir empfehlen, vorab die ersten sieben Kapitel ber die biologischen
Makromolekle, die molekularen Maschinen, welche das Leben ermglichen, zu lesen. Die
Auswahl der weiteren, in sich weitgehend geschlossenen Kapitel kann der Studienrichtung
und den persnlichen Interessen angepasst werden: Die modulartigen Kapitel erlauben eine
-la-carte Lektre des Buches.
Die Biochemie/Molekularbiologie ist eine experimentelle Wissenschaft. Der Erkenntnisgewinn geht Hand in Hand mit den verfgbaren experimentellen Mglichkeiten. Die wichtigsten biochemischen und gentechnischen Methoden, einschlielich der Hochdurchsatztechniken und der Omik-Wissenschaften, sind daher gesondert in den letzten vier Kapiteln
vorgestellt. Diese Hervorhebung der Methoden ist auch begrndet durch die Entwicklung
biologisch orientierter Ingenieurwissenschaften. Die Inhalte mit spezifisch medizinischem
Bezug (Krankheiten, Krankheitserreger, Antibiotika, Zytostatika, Alkaloide, Ernhrung des
Menschen, Gendiagnostik u.v.a.m.) sind in einem zustzlichen Sachverzeichnis aufgelistet.
Eine Website ergnzt das Buch: ber einen QR-Code oder die Webadresse sind Moleklstrukturen, Animationen, EM-Bilder, weiterfhrende Literatur sowie Kurzzusammenfassungen
(Merkstze) und Multiple-Choice-Kontrollfragen abrufbar.
Der Lektorin Frau Stefanie Wolf danken wir fr ihre kompetente Untersttzung und die angenehme Zusammenarbeit. Ein Dankeschn geht auch an unsere Kollegen Prof. Dr. sc. nat.
Heinz Gehring, Prof. Dr. med. Eric Berger und Prof. Dr. med. Enrico Maroni, die Teile des
Buches kritisch gelesen haben. Wir danken auch Dr. sc. nat. Alvar D. Gossert, Dr. phil. Guido
Capitani, Dr. sc. nat. Takashi Ishikawa und Dr. sc. nat. Elisabeth Mller fr ihre Mithilfe beim

VI

Vorwort

Abfassen der Unterkapitel zur magnetischen Kernresonanz, Rntgenkristallographie und


Elektronenmikroskopie.
Den Leserinnen und Lesern sind wir dankbar fr Kommentare, Korrekturen und Verbesserungsvorschlge zum Buch und zur Website.
Philipp Christen, Rolf Jaussi, Roger Benoit
Zrich, im September2015

http://www.springer.com/?SGWID=0-102-2-1514742-0

VII

Abkrzungsverzeichnis
Abkrzungen fr Aminosuren Abb.2.4
Basen, Nucleotide Tab.7.2
Genetischer Code Tab.10.1
ACE
ACTH
ADH

Angiotensin-converting enzyme
Adrenocorticotropes Hormon,
Corticotropin
antidiuretisches Hormon, Vasopressin

Bacterial artificial chromosome


BAC
BH4 Tetrahydrobiopterin
bp Basenpaare
CAM
Cell adhesion molecule
cyclisches3, 5-Adenosinmonophosphat
cAMP
CAP Katabolit-Aktivatorprotein
komplementre DNA, copy DNA
cDNA
cGMP
cyclisches3, 5-Guanosinmonophosphat
CoA
Coenzym A
COX Cyclooxygenase
d desoxyDa Dalton
DAG Diacylglycerol
DNA Desoxyribonucleinsure
dsDNA
doppelstrngige DNA
EF Elongationsfaktor
ELISA
Enzyme-linked immunosorbent assay
ER
Endoplasmatisches Retikulum
FAD Flavin-adenin-dinucleotid
FH2 Dihydrofolsure
FH4 Tetrahydrofolsure
N-Formylmethionin
fMet
FMN Flavinmononucleotid
GABA gamma-Aminobutyrat
(gamma-Aminobutyric acid)
N-Acetylglucosamin
GlcNAc
GSH
reduziertes Glutathion
oxidiertes Glutathion
GSSG
HDL
High-density lipoprotein
humanes Immundefizienzvirus
HIV
HMG-CoA 3-Hydroxy-3-methylglutaryl-CoA
hnRNA
heterogene nuclere Ribonucleinsure
HPLC Hochdruck-Flssigkeitschromatographie
Hsp Hitzeschockprotein
IF Initiationsfaktor
Ig
Immunglobin (z.B. IgG)
IL Interleukin
IMP Inosinmonophosphat
IP3 Inositol-1,4,5-trisphosphat
IPTG Isopropylthiogalactosid

kDa Kilodalton
LDL

Low-density lipoprotein

MHC
Major histocompatibility complex
miRNA
micro RNA
Mr
relative Moleklmasse
mRNA Messenger-Ribonucleinsure
NAD+ Nicotinamid-adenin-dinucleotid
reduziertes Nicotinamid-adeninNADH
dinucleotid
NADP+ Nicotinamid-adenin-dinucleotidphosphat
NADPH reduziertes Nicotinamid-adenindinucleotidphosphat
NMP Nucleosidmonophosphat
mit beliebiger Base
Nuclear magnetic resonance
NMR
PAGE Polyacrylamid-Gelelektrophorese
PCR Polymerase-Kettenreaktion
PEP Phosphoenolpyruvat
Pi
anorganisches (inorganic) Phosphat
PLP Pyridoxal-5-phosphat
PPi
Diphosphat (anorganisches),
Pyrophosphat
PrP
Prion Protein
Q Ubichinon
RNA Ribonucleinsure
Reactive oxygen species
ROS
(reaktive Sauerstoffderivate)
ribosomale Ribonucleinsure
rRNA
Rubisco Ribulose-1,5-bisphosphat-Carboxylase/
Oxygenase
SAM
SDS
siRNA
SNP
snRNA
snRNP
SRP
ssDNA

S-Adenosylmethionin
Sodium dodecylsulfate, Natriumlaurylsulfat
small interfering RNA
Single nucleotide polymorphism
small nuclear RNA
small nuclear Ribonucleoprotein
Signal recognition particle
einstrngige DNA (single-stranded DNA)

TDP Thiamindiphosphat
TF Transkriptionsfaktor
TRH Thyroliberin
tRNA transfer-Ribonucleinsure
VLDL

Very-low-density lipoproteins

YAC

Yeast artificial chromosome

Quellenangaben
Die folgenden Abbildungen sind mit Genehmigung der Autoren bzw. der Verlage aus den
genannten Quellen bernommen worden bzw. sind als Vorlagen fr Umzeichnungen benutzt worden.
Abschn.

Abb.

Quelle

2.5

Sichelzelle

Lffler, G. und Petrides, P.E. (2003) Biochemie & Pathobiochemie, 7.Auflage,


Springer-Verlag, Berlin, S.347, Abb.11.20

3.3

Abb.3.3

ibd. S.74, Abb.3.22

23.3

Abb.23.2

ibd. S.199, Abb.6.27b

30.3

Abb.30.1

ibd. S.1033, Abb.33.1

30.3

Abb.30.2

ibd. S.1037, Abb.33.5

3.3

Abb.3.6

Creighton, T.E. (1993) Proteins, 2nded., Freeman, New York,


S.230, Abb.6.21

11.4

Abb.11.4

Hgele, K. and Kalisch, W.-E. (1980) Chromosoma79, 7583, Springer-Verlag,


Berlin, S.77, Abb.1c

40.5

Abb.40.3

Tucker, C.L., Gera, J.F. and Uetz, P. (2001) Trends Cell Biol.11, 102106, Elsevier,
Amsterdam, S.102, Abb.1

IX

Inhaltsverzeichnis

I
1
1.1
1.2
1.3
1.4
1.5
1.6

Die Molekle des Lebens


Biomolekle und ihre Wechselwirkungen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Ph. Christen, R. Jaussi, R. Benoit
Die Entstehung des Lebens. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Gre biologischer Strukturen, Geschwindigkeit biologischer Vorgnge
und molekulare Zusammensetzung der lebenden Materie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4
Wechselwirkungen zwischenBiomoleklen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
Wasser und hydrophober Effekt. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8
Molekulare Erkennung. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10
Fluss von Materie und Energie, energetische Koppelung von Reaktionen. . . . . . . . . . . . . . . 12

Kovalente Struktur der Proteine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17

2.1
2.2
2.3
2.4
2.5

Ph. Christen, R. Jaussi, R. Benoit


Bauprinzip der Proteine. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Gre und Gestalt der Proteine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 18
Aminosuren, die Bausteine der Proteine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 20
Ionisationszustnde von Aminosuren und Proteinen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Aminosurezusammensetzung und Aminosuresequenzen von Proteinen. . . . . . . . . . . . . 24

Raumstruktur der Proteine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29

Ph. Christen, R. Jaussi, R. Benoit


3.1
Stabilisierung der Raumstruktur . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
3.2 Sekundrstruktur . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
3.3 Tertirstruktur . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
3.4
uere Gestalt und Quartrstruktur. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 34
3.5
Dynamik und funktionsgebundene Strukturnderungen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35
3.6 Denaturierung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 36
3.7 Faltungswege. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
3.8 Proteinfehlfaltung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38
3.9 Faserproteine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39

4 Enzyme . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 43
Ph. Christen, R. Jaussi, R. Benoit
4.1
Allgemeine Eigenschaften der Enzyme. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 44
4.2
Katalyse und Aktivierungsenergie. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 45
4.3 Enzymkinetik . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 46
4.4
Struktur der aktiven Stelle, Wirkungsmechanismen von Enzymen. . . . . . . . . . . . . . . . . . . . . . 51
4.5
Beispiele von Enzymmechanismen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53
4.6
Regulation der Enzymaktivitt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 55

Inhaltsverzeichnis

Polysaccharide und Oligosaccharide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61

Ph. Christen, R. Jaussi, R. Benoit


5.1 Reservehomoglykane. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 62
5.2 Strukturhomoglykane. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63
5.3 Heteroglykane . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64

Lipide und biologische Membranen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 69

Ph. Christen, R. Jaussi, R. Benoit


6.1 Fettsuren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70
6.2
Triacylglycerole und Wachse . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 70
6.3
Phospholipide und Glykolipide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 72
6.4
Nichtverseifbare Lipide: Steroide, Terpene und Eicosanoide. . . . . . . . . . . . . . . . . . . . . . . . . . . . 73
6.5
Biologische Membranen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 76
6.6 Membranproteine. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79
6.7
Durchlssigkeit biologischer Membranen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79

7 Nucleinsuren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 81
Ph. Christen, R. Jaussi, R. Benoit
7.1
Struktur und Funktion der Nucleinsuren, bersicht . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82
7.2 Mononucleotide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 82
7.3 Nucleinsuren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85
7.4 Chromosomen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 89

II

Molekulare Genetik

Replikation, Reparatur und Rekombination der DNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . 95

8.1
8.2
8.3
8.4

Ph. Christen, R. Jaussi, R. Benoit


DNA-Replikation bei Prokaryonten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96
DNA-Replikation bei Eukaryonten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 100
DNA-Schden und Reparatursysteme . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102
Genetische Rekombination. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105

Transkription: Biosynthese der RNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107

Ph. Christen, R. Jaussi, R. Benoit


9.1 Initiation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108
9.2
Elongation und Termination . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111
9.3
Modifikationen des primren Transkriptionsprodukts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 111
9.4
Spleien (Splicing). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 113
9.5
Synthese der tRNA und rRNA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115

10

Translation: bersetzung des Gens ins Phn. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117

10.1
10.2
10.3

Ph. Christen, R. Jaussi, R. Benoit


Der genetische Code . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118
Proteinsynthese, bersicht. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120
Bildung der Aminoacyl-tRNA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120

XI
Inhaltsverzeichnis

10.4
10.5

Initiation, Elongation, Termination . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 123


Hemmstoffe der Proteinsynthese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 126

11

Regulation der Genexpression . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 127

11.1
11.2
11.3
11.4

Ph. Christen, R. Jaussi, R. Benoit


Regulation der Transkription bei Prokaryonten: Operon. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 128
Regulation der Transkription bei Eukaryonten: Transkriptionsfaktoren. . . . . . . . . . . . . . . . 130
Posttranskriptionale Regulation der Genexpression. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133
Epigenetische Regulation und Vererbung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135

12

Plasmide, Viren, Viroide und Prionen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 139

Ph. Christen, R. Jaussi, R. Benoit


12.1 Plasmide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 140
12.2 Viren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 144
12.3
Tumorviren und Onkogene. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 147
12.4
Subvirale pathogene Agenzien: Viroide und Prionen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 149

III Stoffwechsel
13

Grundstzliches zum Stoffwechsel. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 153

13.1
13.2
13.3
13.4

Ph. Christen, R. Jaussi, R. Benoit


Experimentelle Untersuchung des Stoffwechsels. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 154
bersicht ber den Stoffwechsel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 156
Verwendung des im Katabolismus gebildeten ATP . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 158
Regulation des Stoffwechsels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 159

14

Glykolyse und Citratzyklus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161

14.1
14.2
14.3

Ph. Christen, R. Jaussi, R. Benoit


Glykolytischer Abbauweg. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
Von Pyruvat zu Acetyl-CoA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 168
Abbau von Acetyl-CoA im Citratzyklus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171

15
15.1
15.2
15.3
15.4
15.5
15.6

ATP-Synthese in Mitochondrien. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 177


Ph. Christen, R. Jaussi, R. Benoit
Organisation der Atmungskette. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 179
Redoxkomponenten der Atmungskette(FMN, FAD, FeS-Zentren, Ubichinon,
Cytochrome) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 179
Chemiosmotischer Mechanismus der oxidativen Phosphorylierung. . . . . . . . . . . . . . . . . . . 183
Transport von Reduktionsquivalenten vom Cytosol in die Mitochondrien. . . . . . . . . . . . 186
ATP-Bilanz des oxidativen Abbaus von Glucose. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 188
Regulation der mitochondrialen ATP-Synthese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 188

XII

Inhaltsverzeichnis

16

Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg . . . . . . . . 193

Ph. Christen, R. Jaussi, R. Benoit


16.1 Gluconeogenese . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 194
16.2
Abbau und Aufbau von Glykogen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 197
16.3
Stoffwechsel der Disaccharide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 204
16.4 Pentosephosphatweg. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 206

17

Stoffwechsel der Fettsuren und Lipide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 209

Ph. Christen, R. Jaussi, R. Benoit


17.1
-Oxidation von Fettsuren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 210
17.2 Fettsuresynthese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 213
17.3 Ketonkrper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217
17.4
Synthese und Abbau der Triacylglycerole. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 218
17.5
Stoffwechsel der Phospholipide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220
17.6
Stoffwechsel von Cholesterol . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 220

18

Stoffwechsel der Proteine und Aminosuren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 225

Ph. Christen, R. Jaussi, R. Benoit


18.1
Abbau von Proteinen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 226
18.2
Abbau der Aminosuren: Weg des Stickstoffs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 228
18.3
Abbau der Aminosuren: Weg des Kohlenstoffs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 232
18.4
Strungen im Abbau der Aminosuren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 237
18.5
Synthese der Aminosuren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 238
18.6 C1-Stoffwechsel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 239
18.7
Synthese von Kreatin und Porphyrinen aus Aminosuren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 243

19

Stoffwechsel der Purin- und Pyrimidinnucleotide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 247

19.1
19.2
19.3
19.4
19.5

Ph. Christen, R. Jaussi, R. Benoit


Synthese der Purinnucleotide; Wiederverwertung von Purinbasen. . . . . . . . . . . . . . . . . . . . 248
Synthese der Pyrimidinnucleotide; Wiederverwertung von Pyrimidinnucleosiden. . . . . 250
Regulation der Nucleotidsynthese . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 251
Synthese der Desoxyribonucleotide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 251
Abbau der Nucleinsuren und Nucleotide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 255

20 Photosynthese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 259
Ph. Christen, R. Jaussi, R. Benoit
20.1 Chloroplasten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 260
20.2
Komponenten und Organisation des Photosyntheseapparats . . . . . . . . . . . . . . . . . . . . . . . . . 261
20.3 Chlorophyll . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 262
20.4
Lichtgetriebene Reduktion von NADP+ und Synthese von ATP. . . . . . . . . . . . . . . . . . . . . . . . . 262
20.5
Synthese von Kohlenhydrat aus CO2. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 266

21

Besonderheiten des Stoffwechsels von Pflanzen und Bakterien . . . . . . . . . . . . . . . 269

21.1
21.2
21.3

Ph. Christen, R. Jaussi, R. Benoit


Stickstoff-Assimilation aus N2 und Nitrat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 270
Schwefel-Assimilation aus Sulfat . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 272
Transport- und Speicherformenvon Kohlenhydraten, Lipiden und Proteinen
bei Pflanzen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 273

XIII
Inhaltsverzeichnis

21.4
Sekundrstoffwechsel der Pflanzen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 274
21.5 Phytohormone. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 276
21.6
Stoffwechselwege in Bakterien. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 277

IV

Molekulare Zellbiologie

22

Zellkompartimente und Proteinsortierung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 283

22.1
22.2
22.3
22.4
22.5
22.6
22.7
22.8
22.9

Ph. Christen, R. Jaussi, R. Benoit


Kompartimenthnliche Strukturen in Bakterien. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 285
Kompartimente der Eukaryontenzellen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 285
Mechanismen des intrazellulren Proteintransports. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 287
Proteintransport im Golgi-Apparat. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 290
Proteintransport zwischen Golgi-Apparat, Zelloberflche und Lysosomen. . . . . . . . . . . . . 290
Proteinglykosylierung whrend Transport durch ER und Golgi-Apparat . . . . . . . . . . . . . . . 291
Import von Proteinen in Mitochondrien, Chloroplasten und Peroxisomen. . . . . . . . . . . . . 292
Pfrtner-kontrollierter Transport (Gated transport) durch die Kernhlle . . . . . . . . . . . . . . . 294
Kontrolle der Faltung und der Lokalisierung von Proteinendurch molekulare
Chaperone und Proteasomen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 295

23

Cytoskelett und molekulare Motoren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 297

Ph. Christen, R. Jaussi, R. Benoit


23.1 Actinfilamente . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 298
23.2 Mikrotubuli . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 299
23.3 Intermedirfilamente . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301
23.4
Motorproteine fr den intrazellulren Transport . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 303

24

Zellzyklus; Kontrolle von Zellwachstum und Zelltod. . . . . . . . . . . . . . . . . . . . . . . . . . . . 305

24.1
24.2
24.3
24.4
24.5
24.6

Ph. Christen, R. Jaussi, R. Benoit


Konzept des Zellzyklus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 306
Mitosen und Meiosen whrend des Lebenszyklus der Organismen. . . . . . . . . . . . . . . . . . . . 307
Maschinerie des Zellzyklus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 308
Wachstumskontrolle und Tumorbildung. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 309
Kontrolle der Bereitschaft zur Teilung: Checkpoints . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 312
Apoptose, programmierter Zelltod. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 313

25

Zelladhsion, Zellkontakte und extrazellulre Matrix . . . . . . . . . . . . . . . . . . . . . . . . . . 315

25.1
25.2
25.3
25.4

Ph. Christen, R. Jaussi, R. Benoit


Stabile Zell-Zell- und Zell-Matrix-Kontakte . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 316
Kurzlebige Zell-Zell-Wechselwirkungen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 318
Extrazellulre Matrix (ECM). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 319
Pflanzliche Zellwand: Papier und Holz. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 321

26

Stoffaustausch durch Membranen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 323

26.1
26.2

Ph. Christen, R. Jaussi, R. Benoit


Grundstzliches zum Membrantransport. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 324
Mechanismus der Na+/K+-Pumpe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 325

XIV

Inhaltsverzeichnis

26.3
26.4
26.5
26.6

Symport- und Antiport-Systeme. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 326


Passiver Transport, erleichterte Diffusion. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 326
Ionenkanle, chemisches und elektrisches Membranpotenzial . . . . . . . . . . . . . . . . . . . . . . . . 327
Transzellulrer Transport. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 328

27

Rezeptoren und Signaltransduktion. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 331

27.4
27.5
27.6
27.7

Ph. Christen, R. Jaussi, R. Benoit


Grundstzliches zur Signaltransduktion. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 332
Rezeptoren an der Zelloberflche: G-Protein-gekoppelte Rezeptoren (GPCR). . . . . . . . . . 334
Rezeptoren an der Zelloberflche: Rezeptoren mit enzymatisch aktiver
cytosolischer Domne. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 336
Rezeptoren an der Zelloberflche: proteolytisch aktivierte Rezeptoren. . . . . . . . . . . . . . . . 340
Rezeptoren im Zellinnern . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 341
bermittlungsmodule leiten die Signale vom Rezeptor zum spezifischen Effektor. . . . . 341
Signaltransduktion in Pflanzen und Pilzen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 342

Molekulare Physiologie

28

Hormone und Mediatoren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 347

27.1
27.2
27.3

Ph. Christen, R. Jaussi, R. Benoit


28.1
Hierarchie der Hormondrsen; Struktur, Regelkreise und Halbwertszeit der Hormone . . 348
28.2
Hormone von Hypothalamus und Hypophyse. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 349
28.3
Hormone der Nebenniere: Catecholamine; Cortisol und Aldosteron. . . . . . . . . . . . . . . . . . . 352
28.4
Erythropoietin und Calcitriol aus der Niere; Renin-Angiotensin-Aldosteron-System . . . 353
28.5 Sexualhormone . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 354
28.6
Kontrolle des Grundumsatzes durch Schilddrsenhormone; Regulation des
Calcium- und Phosphathaushalts durch Parathyrin, Calcitriol und Calcitonin . . . . . . . . . . 356
28.7
Kontrolle der Blutzuckerkonzentration durch Insulin und Glucagon. . . . . . . . . . . . . . . . . . . 358
28.8
Mediatoren (Gewebehormone): Signalstoffe geringer Reichweite . . . . . . . . . . . . . . . . . . . . . 358
28.9
Hormone wirbelloser Tiere . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 361
28.10 Botenstoffe zwischen Individuen: Pheromone und von Bakterien sezernierte
Signalstoffe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 362

29

Neurotransmitter; Photo-, Geruchs- und Geschmacksrezeptoren;


Chemotaxis bei Eukaryonten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 363
Ph. Christen, R. Jaussi, R. Benoit

29.1 Neurotransmitter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 364


29.2
Photorezeptoren des Auges. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 369
29.3
Geruchs- und Geschmacksrezeptoren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 372
29.4
Chemotaxis bei Eukaryonten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 373

30

Bewegungsapparat: Muskeln, Bindegewebe und Knochen. . . . . . . . . . . . . . . . . . . . . 375

30.1
30.2
30.3

Ph. Christen, R. Jaussi, R. Benoit


Vergleich der verschiedenen Muskeltypen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 376
Dickes Myosinfilament, dnnes Actinfilament. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 377
Entwicklung von Zugkraft im Sarkomer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 377

XV
Inhaltsverzeichnis

30.4
30.5
30.6

Regulation der Muskelkontraktion durch Calciumionen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 379


Bereitstellung von ATP im Muskel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 382
Bindegewebe, Knochen und Zhne. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 383

31

Enzymatische Schutzmechanismen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 387

31.1
31.2
31.3

Ph. Christen, R. Jaussi, R. Benoit


Blutgerinnung und Fibrinolyse. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 388
Biotransformationen (Entgiftungsreaktionen). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 393
Schutz gegen reaktive Sauerstoffderivate (Reactive oxygen species ROS). . . . . . . . . . . . . . . 395

32 Immunsystem. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 399
32.1
32.2
32.3
32.4
32.5
32.6

Ph. Christen, R. Jaussi, R. Benoit


Angeborene Immunitt . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 400
Adaptive Immunitt: Antikrper aus B-Zellen und zellulre Abwehr mit T-Zellen . . . . . . 402
Klonale Selektion der B-Zellen und T-Zellen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403
Synthese, Struktur und Antigenbindung der Antikrper. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 404
Cytotoxische T-Zellen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 410
Immuntoleranz und Autoimmunkrankheiten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 410

33

Stoffaufnahme und Ausscheidung. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 413

33.1
33.2
33.3
33.4

Ph. Christen, R. Jaussi, R. Benoit


Verdauung und Resorption. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 414
Transport von O2 und CO2 im Blut . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 419
Ausscheidung von Stoffwechselendprodukten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 422
Wasser-, Elektrolyt- und Sure-Basen-Haushalt. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 424

34

Organstoffwechsel und Lipidtransport im Blut . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 431

34.1
34.2
34.3
34.4

Ph. Christen, R. Jaussi, R. Benoit


Stoffwechselleistungen der Organe in Resorptions- und Postresorptionsphase. . . . . . . . 432
Anpassung des Stoffwechsels an Hungerzustand. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 435
Diabetes mellitus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 436
Lipidtransport und Lipoproteine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 438

35

Biochemische Aspekte der menschlichen Ernhrung . . . . . . . . . . . . . . . . . . . . . . . . . . . 445

Ph. Christen, R. Jaussi, R. Benoit


35.1
Bedarf an Brennstoffen und Baustoffen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 446
35.2 Hauptnhrstoffe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 448
35.3 Vitamine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 452
35.4
Elektrolyte, Mineralstoffe und Spurenelemente . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 461
35.5 Nahrungsmittel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 463

36

Zelldifferenzierung, Regeneration und Altern; Systembiologie


und Synthetische Biologie. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 467
Ph. Christen, R. Jaussi, R. Benoit

36.1
Zelldifferenzierung und Ontogenese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 468
36.2
Regeneration von Organen und Extremitten. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 470
36.3 Alterungsvorgnge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 471
36.4 Systembiologie. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 472

XVI

Inhaltsverzeichnis

36.5
36.6

Synthetische Biologie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 474


Genomik, Proteomik, Transkriptomik, Interaktomik, Metabolomik und Mikrobiomik. . . 474

VI Methoden
37

Trennverfahren und allgemeine Analysemethoden . . . . . . . . . . . . . . . . . . . . . . . . . . . . 479

Ph. Christen, R. Jaussi, R. Benoit


37.1 Zentrifugation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 480
37.2 Chromatographie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 482
37.3 Elektrophorese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 484
37.4 Spektroskopie. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 486
37.5 Massenspektrometrie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 489
37.6
Isotopenmarkierung, Radionuclide. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 489
37.7
Monoklonale Antikrper . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 490
37.8 pH-Puffer. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 490

38 Proteinanalytik . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 493
Ph. Christen, R. Jaussi, R. Benoit
Bestimmung der Aminosurezusammensetzung und Sequenzanalyse von Proteinen. . . 494
Analyse der 3D-Struktur von Makromoleklen durch Rntgenkristallographie. . . . . . . . 494
Analyse der 3D-Struktur von Makromoleklen durch magnetische
Kernresonanz (NMR). . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 497
38.4 Elektronenmikroskopie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 497
38.5
Untersuchung posttranslationaler Modifikationen von Proteinen . . . . . . . . . . . . . . . . . . . . . 499
38.6
Untersuchung von Protein-Ligand-Wechselwirkungen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 499

38.1
38.2
38.3

39 Gentechnik. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501
Ph. Christen, R. Jaussi, R. Benoit
Werkzeuge der Gentechnik: Restriktionsenzyme und andere Nucleasen; Ligasen,
DNA-Polymerasen und Rekombinationsenzyme. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502
39.2
Plasmide als Vektoren (Genfhren) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 504
39.3
Viren als Vektoren; Gentherapieversuche. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 504
39.4
Knstliche Chromosomen als Vektoren. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505
39.5
Polymerase chain reaction PCR. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505
39.6
Genbanken: cDNA und genomische DNA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 508
39.7
Bestimmung der Nucleotidsequenz von DNA. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 510
39.8
Southern, Northern und Western blotting. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 511
39.9
Expression rekombinanter Proteine und RNAs. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 512
39.10 Gezielte und zufllige Mutagenese. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 514
39.11 Prsentation von Genprodukten auf Bakteriophagen(Phage display)
oder Ribosomen (Ribosome display); gerichtete molekulare Evolution. . . . . . . . . . . . . . . . . 515
39.12 Klonierung von Zellen und Organismen; transgene Organismen . . . . . . . . . . . . . . . . . . . . . . 516
39.1

XVII
Inhaltsverzeichnis

40
40.1
40.2
40.3
40.4
40.5
40.6

Genomik, Proteomik, Bioinformatik, Datenbanken. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 519


Ph. Christen, R. Jaussi, R. Benoit
Genomanalyse und Gendiagnostik. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 520
Modulare DNA-Rekombination. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 521
Mikrochips zur Quantifizierung von mRNA und Proteinen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 522
Proteomik: 2D-Gelelektrophorese, Massenspektrometrie und Mikrochips. . . . . . . . . . . . . 522
Kartierung von Protein-Protein-Wechselwirkungen mit der Two-hybrid-Technik;
Interaktom. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 522
Datenbanken und Computerprogramme. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 524

Serviceteil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 527
Verzeichnis der Themen mit spezifisch medizinischem Bezug. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 528
Sachverzeichnis. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 531

Die Molekle
des Lebens
Kapitel 1

Biomolekle und ihre Wechselwirkungen 3


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 2

Kovalente Struktur der Proteine 17


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 3

Raumstruktur der Proteine 29


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 4

Enzyme43
Ph. Christen, R. Jaussi, R. Benoit

Kapitel 5

Polysaccharide und Oligosaccharide 61


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 6

Lipide und biologische Membranen 69


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 7

Nucleinsuren81
Ph. Christen, R. Jaussi, R. Benoit

Biomolekle
und ihre Wechselwirkungen
Ph. Christen, R. Jaussi, R. Benoit
1.1

Die Entstehung des Lebens 4

1.2

Gre biologischer Strukturen, Geschwindigkeit


biologischer Vorgngeund molekulare
Zusammensetzung der lebenden Materie 4

1.3

Wechselwirkungen zwischenBiomoleklen6

1.4

Wasser und hydrophober Effekt 8

1.5

Molekulare Erkennung10

1.6

Fluss von Materie und Energie, energetische


Koppelung von Reaktionen 12

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_1, Springer-Verlag Berlin Heidelberg 2016

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 1 Biomolekle und ihre Wechselwirkungen

Das Leben ist im Wasser entstanden, und Wasser


ist der quantitativ wichtigste Bestandteil aller Lebewesen. Wasser ist das Lsungsmittel, in welchem
die molekularen Lebensvorgnge ablaufen. Die
Trockensubstanz der Zellen besteht vorwiegend
aus biologischen Makromoleklen (ausnahmslos Polymere aus einfachen Bausteinen: Proteine,
Nucleinsuren, Oligo- und Polysaccharide) und
Lipiden; niedermolekulare Verbindungen und anorganische Ionen bilden einen wesentlich geringeren Anteil. Das Zusammenspiel der Biomolekle
wird in erster Linie durch nichtkovalente Wechselwirkungen und hydrophobe Effekte vermittelt.

Nucleinsuren sind die Trger der genetischen Information; Proteine sind die molekularen Maschinen, welche den Phnotyp, das Erscheinungsbild
der Organismen, erstellen und in Gang halten.
Ein hochkomplexes regulatorisches Netzwerk
steuert die mannigfaltigen Lebensvorgnge. Die
Lebewesen sind thermodynamisch offene Systeme, die nicht im Gleichgewicht mit ihrer Umgebung stehen. Sie beziehen Energie von auen,
um ihre hohe innere Ordnung herzustellen und
zu erhalten. Die molekularen Grundzge einfacher
Bakterien und menschlicher Zellen sind einander
bemerkenswert hnlich.
1.1

Die Entstehung des Lebens

Die Vorfahren der heutigen Zellen und Lebewesen haben sich im Wasser entwickelt Wahr-

scheinlich schon vor 4000Millionen Jahren sind


im Laufe der chemischen Evolution aus Vorstufen Aminosuren, Pyrimidinbasen, Purinbasen
und Zucker entstanden. Aus diesen Bausteinen
bildeten sich Proteine und Nucleinsuren, welche
die zwei Grundfunktionen des Lebens wahrnehmen konnten: zum einen den Stoffwechsel durch
Katalyse bestimmter Reaktionen, zum andern die
Speicherung genetischer Information. Eine Lipidmembran ermglichte die Anreicherung von
Biomoleklen und wird zur Bildung der ersten
Zellen gefhrt haben. Wenn auch verschiedene
Hypothesen zur Entstehung des Lebens bestehen,
so scheint es doch klar, dass auf der Erde eine einzige, einheitliche Form von Leben existiert mit
Nucleinsuren aufgebaut aus fnf verschiedenen

Nucleotiden, Proteinen aus 20 verschiedenen Aminosuren und einem nahezu universell gltigen genetischen Code.
Stoffwechsel
Gesamtheit der chemischen Umsetzungen in
einem Organismus, liefert chemische Energie,
baut Zellsubstanz auf und ab.

Gemeinsame Urzellen haben sich zu den Zellen


der heutigen Organismen entwickelt. Die biologische Evolution beruht einerseits auf Vernderungen der genetischen Information und andererseits
auf der Selektion genetischer Merkmale, welche
die Fortpflanzung des Trgers am besten sichert.
Grundstzlich sind die einfachen, kleinen Prokaryonten und die sehr viel komplexeren und auch
greren Zellen der Eukaryonten zu unterscheiden
(.Abb.1.1).

Im Zellinnern herrscht ein makromolekulares


Gedrnge (Macromolecular crowding) Die in ho-

her Konzentration vorhandenen Makromolekle


(300400mg/mL im Cytoplasma von E. coli) verringern das fr Makromolekle zugngliche Volumen
der zellinternen Flssigkeit: Die makromolekulare
Verdrngung erhht die effektive Konzentration der
Makromolekle und erleichtert damit die Bildung
von Multiproteinkomplexen und Nucleinsure-Proteinkomplexen.
1.2

Gre biologischer Strukturen,


Geschwindigkeit biologischer
Vorgngeund molekulare
Zusammensetzung der
lebenden Materie

Grenvergleich biologischer Strukturen:


Lnge bzw. Durchmesser
C-C-Bindung

0,15nm

H2O-Molekl

0,4nm

Hmoglobin

6,4nm

Mitochondrien

0,52m

Bakterien

0,53m

Erythrozyt (Mensch)

78m

Eukaryontische Zelle

1050m

5
1.2 Gre biologischer Strukturen, Geschwindigkeit biologischer Vorgnge

.. Abb.1.1 Prokaryontische und eukaryontische Zellen. Eukaryontische Zellen sind nicht nur viel grer als Bakterienzellen,
sondern enthalten auch durch Membranen abgegrenzte Zellorganellen. Bei Prokaryonten fehlt diese intrazellulre Kompartimentierung. Zum Grenvergleich: Mitochondrien sind etwa so gro wie eine Bakterienzelle. Die bakterielle und pflanzliche
Zellwand sowie die extrazellulre Matrix bei Tieren sind einander entsprechende von den Zellen sezernierte Bestandteile,
welche den Zellen und Geweben Formstabilitt verleihen

Lngeneinheiten
1mm=10 m=10 nm=10 ngstrm ()
Auf dem Durchmesser eines menschlichen Erythrozyten (78m) lassen sich etwa 1200Hmoglobinmolekle nebeneinander aufreihen.
3

Die Geschwindigkeiten biologischer Vorgnge


sind sehr verschieden Die meisten enzym-

katalysierten Reaktionen laufen innerhalb von


Millisekunden ab. Noch schneller, im Nano- bis
Mikrosekundenbereich stattfindend, sind Konformationsnderungen von Moleklen, die ohne
nderung kovalenter Bindungen durch Drehung
von Moleklteilen um Einfachbindungen zustande
kommen. Der langsamste biologische Vorgang ist

die Evolution der Lebewesen, ein Vorgang, der, wie


angenommen wird, vor ber 4000Millionen Jahren begonnen hat und noch heute andauert. Homo
sapiens ist erst etwa vor einem Zwanzigtausendstel
der Gesamtdauer der biologischen Evolution aufgetaucht.
Die lebende Materie besteht aus 23 verschiedenen
Elementen Von den insgesamt ber 90Elementen

der Erdkruste sind nur 23 als unbedingt notwendige


Bestandteile von Lebewesen nachgewiesen:
Hauptelemente

C, H, O, N, P, S
(95% der Trockenmasse)

Ionische Elemente

Na+, K+, Mg2+, Ca2+; Cl

Spurenelemente

Fe, Zn, Cu, Mn, Co, Mo, I, F, Se,


Cr, Si, Ni

Kapitel 1 Biomolekle und ihre Wechselwirkungen

Assoziate von Makromoleklen, welche durch


nichtkovalente Wechselwirkungen zusammengehalten werden und durch spontane, nichtkatalysierte
Selbstorganisation (Self-assembly) entstehen. Mit
zunehmender Moleklmasse nimmt die Vielfalt der
Biomolekle zu (.Tab.1.1).

1
2
3

Photosynthese
,

1.3 Wechselwirkungen

zwischenBiomoleklen

5
6

Drei Typen nichtkovalenter Bindungen, auch als


Sekundrbindungen bezeichnet, fhren zu intramolekularen Wechselwirkungen zwischen den verschiedenen Teilen biologischer Makromolekle und
zwischen den Biomoleklen untereinander.

7
8
9
10
11
12
13
14
15
16
17
18
19
20

200 000 Jahren

Die Strke elektrostatischer Anziehung/Abstoung zwischen geladenen Gruppen hngt


vom Medium ab Die dabei wirksame Kraft P ist
gegeben durch das Coulomb-Gesetz:

PD
Die Hauptelemente sind die Bausteine der organischen Verbindungen, insbesondere der biologischen
Makromolekle. Die ionischen Elemente kommen
nur als Ionen vor; vier anorganischen Kationen
steht Chlorid als einziges elementares anorganisches Anion gegenber (wichtige nichtelementare
anorganische Anionen sind anorganisches Phosphat
HPO42 und Hydrogencarbonat HCO3). Die Spurenelemente erhielten ihren Namen in den Anfngen der analytischen Chemie, als diese in geringen
Mengen vorkommenden Elemente nur in Spuren
festgestellt, aber noch nicht quantitativ bestimmt
werden konnten.

Alle biologischen Makromolekle (Nucleinsuren, Proteine, Polysaccharide) sind Polymere


aus wenigen relativ einfach gebauten Bausteinen

Die Makromolekle sind echte Molekle, d.h. alle


ihre Atome werden durch kovalente Bindungen
(Elektronenpaarbindungen) zusammengehalten.
Die Synthese der Makromolekle aus Vorstufen
und der Abbau der Makromolekle bentigen Enzyme als Katalysatoren. Im Gegensatz dazu sind
die supramolekularen Strukturen (z.B. Multiproteinkomplexe, Ribosomen oder Mitochondrien)

q1  q2
D  r2

P, Kraft; q, elektrische Ladung; r, Abstand der Ladungen; D, Relative Dielektrizittskonstante (Permittivitt) des Mediums
Im Vakuum ist D=1; in Wasser sind die elektrostatischen Wechselwirkungen sehr stark abgeschwcht
(D=80). Im Innern von Makromoleklen wie Proteinen entspricht der Wert der Dielektrizittskonstante jedoch nahezu demjenigen im Vakuum. Die
Anziehung zwischen entgegengesetzt geladenen
Gruppen von Moleklen fhrt zur Ionenpaar-Bindung oder Salzbrcke.
Wasserstoffbindungen (H-Bindungen, Hydrogen bonds) knnen sich zwischen geladenen oder
ungeladenen polaren Gruppen ausbilden Ein

gemeinsames H-Atom bildet dabei eine Brcke zwischen zwei anderen Atomen. Das Atom, welches das
Wasserstoffatom strker bindet, wird als Wasserstoffdonor bezeichnet. Das andere Atom, welches
das Wasserstoffatom ber ein freies Elektronenpaar
bindet, ist der Wasserstoffakzeptor. Die wichtigsten Donoren sind O- oder N-Atome in HO- oder
HN-Gruppen, Akzeptoren sind O- oder N-Atome:

7
1.3 Wechselwirkungen zwischenBiomoleklen

.. Tab.1.1 Molekulare Zusammensetzung lebender Organismen


Bakterienzelle (E. coli)
Anzahl verschiedener
Molekle
Wasser

Erwachsener Mensch
Anteil in %
der Gesamtmasse

Anteil in %
der Gesamtmasse

70

60

Anorganische Ionen

20

Zucker und Vorlufer

250

Aminosuren und Vorlufer

100

0,4

Nucleotide und Vorlufer

100

0,4

Lipide
Andere niedermolekulare Verbindungen
Makromolekle

50
300
3000

1,5

15

0,2
25

20

In Bakterienzellen sind Proteine, RNA, DNA und Polysaccharide im Massenverhltnis von 15 : 6 : 1 : 2 vertreten.

gegenseitigen sterischen Behinderung (Behinderung durch Raumbeanspruchung) von Teilen eines Molekls zugrunde und schrnkt die Zahl der
Konformationen ein, welche ein Molekl annehmen
kann. Befinden sich zwei Atome im Abstand ihrer
Van-der-Waals-Radien, halten sich Anziehung und
Abstoung die Waage:
Die Bindungsenergie betrgt maximal ein Zehntel
derjenigen einer kovalenten Bindung (.Tab.1.2).
In wsseriger Lsung konkurrieren zudem die
Wassermolekle um die Donoren und Akzeptoren,
die H-Bindungen werden dadurch massiv abgeschwcht. Eine H-Bindung ist am strksten, wenn
Donor, Wasserstoffatom und Akzeptor auf einer Geraden liegen. H-Bindungen sind deshalb gerichtete
Krfte und bestimmen magebend die Form vieler
biologischer Strukturen.
Van-der-Waals-Krfte werden nur wirksam bei
sehr kleinen Abstnden zwischen zwei Atomen

Sie beruhen auf der elektrostatischen Anziehung


zwischen permanenten oder induzierten Dipolen.
Van-der-Waals-Krfte sind schwcher als Ionenpaar-Bindungen und H-Bindungen. Wenn zwei
Atome sich sehr nahe kommen, stoen sie sich
gegenseitig krftig ab. Diese Abstoung liegt der

Van-der-Waals-Radien

Die nichtkovalenten Wechselwirkungen sind


sehr viel schwcher als kovalente Bindungen
(.Tab.1.2); insbesondere ist eine einzelne Vander-Waals-Bindung zwischen einem Paar von Atomen mit 4kJ/mol nur wenig strker als die mittlere
thermische Energie von Moleklen bei Raumtemperatur (2,5kJ/mol).

Kapitel 1 Biomolekle und ihre Wechselwirkungen

.. Tab.1.2 Kovalente Bindungen und nichtkovalente Wechselwirkungen


Bindungstyp

2
3
4
5

Lnge (nm)

0,15

350

350

Ionenpaar-Bindung

0,25

250

10

Wasserstoffbindung

0,30

15

Van-der-Waals-Anziehung

0,35

1.4

Wasser ist ein unbedingt notwendiger Bestandteil


der lebenden Substanz Wasser ist das Lsungs-

11
12
13
14
15
16
17
18
19
20

In H2O

Kovalente Bindung

10

Im Vakuum

Die Bindungslnge entspricht dem Abstand der Mittelpunkte der beteiligten Atome, bei der Wasserstoffbindung des
Donor- und Akzeptoratoms. Die Bindungsenergie ist die Energie, die notwendig ist, um eine Bindung zu spalten. Die
angegebenen Werte sind Richtwerte, die Bindungsenergie hngt von den beteiligten Atomen ab.

Bindungsenergie (kJ/mol)

Wasser und hydrophober Effekt

mittel, in dem sich alle biochemischen Vorgnge


abspielen; Wasser ist zudem Reaktionspartner bei
vielen biochemischen Reaktionen; Wasser liegt dem
hydrophoben Effekt zugrunde und ist damit wesentlich mitverantwortlich fr die Ausbildung aller
greren biologischen Strukturen.
Die biologisch wichtigen Eigenschaften des
Wassers sind:
Hohe Kohrenz (starke intermolekulare Wechselwirkungen durch H-Bindungen), die sich
im hohen Schmelz- und Siedepunkt wie auch
der hohen Oberflchenspannung manifestiert
(z.B. im Vergleich mit dem hnlich gebauten,
bei physiologischen Temperatur- und Druckverhltnissen gasfrmigen H2S).
Hohe Dielektrizittskonstante: Die polaren
Wassermolekle schwchen die elektrostatischen Wechselwirkungen zwischen Ionen ab
und erleichtern die Trennung entgegengesetzter
Ladungen, z.B. die Dissoziation von Salzen in
Ionen oder die Deprotonierung von Suren.
Ionenpaar-Bindungen und H-Bindungen sind
in wsseriger Lsung abgeschwcht (.Tab.1.2).

Diese Eigenschaften lassen sich durch den Bau des


H2O-Molekls erklren. Das H2O-Molekl ist zwar
elektrisch neutral, aber durch die ungleichmige
Verteilung der Bindungselektronen decken sich die
positiven und negativen Ladungsschwerpunkte nicht:

Der Dipolcharakter des H2O-Molekls ermglicht


die Ausbildung von H-Bindungen von H2O-Moleklen untereinander sowie mit anderen polaren
Verbindungen. In Eis bilden die Wassermolekle
ein Kristallgitter, wobei jedes O-Atom zwei H-Bindungen eingeht. Die zwei kovalent gebundenen
H-Atome und die H-Atome der H-Bindungen sind
tetraedrisch angeordnet:

9
1.4 Wasser und hydrophober Effekt

Die Struktur von flssigem Wasser bei 37C ist ein


im Bereich von ps (1012s) sich stetig nderndes
dreidimensionales Netzwerk von Wassermoleklen, die ber kurzlebige H-Bindungen miteinander
zusammenhngen.
Die Fhigkeit von Verbindungen, mit H2O-Moleklen H-Bindungen einzugehen, bestimmt
deren Wasserlslichkeit Zu den hydrophilen
Verbindungen gehren ionische bzw. ionisierbare

Verbindungen (Salze, Suren, Basen) und Verbindungen mit Heteroatomen (O, N, S). Ionen oder
geladene Gruppen haben eine starke Tendenz, sich
mit Wasserdipolen, d.h. mit einem Hydratmantel,
zu umgeben (Beispiele: Aminosuren, Proteine,
Nucleotide). Die Ionisierung wird, sofern dabei
eine Ladungstrennung stattfindet, durch die hohe
Dielektrizittskonstante des Wassers begnstigt.
Verbindungen mit Heteroatomen haben hnliche
Dipoleigenschaften wie H2O; man nennt sie deshalb polare Verbindungen (Beispiele: Zucker, Alkohole). Auch sie gehen H-Bindungen mit H2O ein
und sind gut wasserlslich:

dungen und Gruppen ist auf diesen Effekt zurckzufhren.


Amphiphile Verbindungen (griech. amphi, beiderseits) besitzen sowohl polare (hydrophile) Gruppen als auch apolare (hydrophobe, lipophile) Teile
und zeigen geringe echte Wasserlslichkeit.

Seifen (Alkalisalze lngerkettiger Fettsuren) bilden in Wasser keine echte Lsung, in der Einzelmolekle von H2O umgeben sind. Seifen bilden
eine trbe Suspension von Mizellen (.Abb.1.2).
Die Struktur der Mizelle entspricht einem Kompromiss zwischen der Wasserlslichkeit der ionisierten Carboxylatgruppen und der Unlslichkeit
der apolaren Kohlenwasserstoffketten in Wasser.
Diese Lslichkeitseigenschaften der amphiphilen
Verbindung in Wasser fhren zu einer definierten
Orientierung der Molekle und damit zur Ausbildung einer supramolekularen Struktur, die vorwiegend durch hydrophobe Effekte stabilisiert wird.

Hydrophobe Effekte sind durch Wasser bedingte Assoziationseffekte apolarer Molekle oder
Gruppen Die Wassermolekle, welche apolare

Hydrophobe (lipophile) Verbindungen besitzen

keine geladenen oder polaren Gruppen; sie sind


apolar (unpolar) und knnen keine H-Bindungen
eingehen. H2O-Molekle bilden daher um hydrophobe Molekle oder Gruppen eine kfigartige
Struktur, die durch H-Bindungen zusammengehalten wird und sich ber mehrere Schichten von
H2O-Moleklen erstrecken kann. Diese Kfig
struktur (Klathrat) entspricht einem Zustand hherer Ordnung, d.h. niedrigerer Entropie, und ist
daher energetisch ungnstig (Abschn.1.6). Die
geringe Wasserlslichkeit hydrophober Verbin-

Molekle umgeben, befinden sich in einem Zustand


hherer Ordnung als die sonstigen Wassermolekle,
da ihre Mglichkeiten, H-Bindungen auszubilden,
weniger zahlreich sind. Lagern sich die apolaren
Molekle zu einem Aggregat zusammen, verringern
sie ihre Kontaktflche zum Wasser (.Abb.1.2). Die
Freiheitsgrade der Wassermolekle werden dadurch
vermehrt: Ein thermodynamisch gnstigerer Zustand niedrigerer Ordnung (hherer Entropie) wird
erreicht. Hydrophobe Effekte sind nicht auf gegenseitige Anziehung der apolaren Molekle, sondern
auf deren Ausschluss durch die aneinanderhaftenden
H2O-Molekle zurckzufhren. Ohne Wasser gibt
es keine hydrophoben Effekte! Die nderung der
freien Energie G (Abschn.1.6) fr die berfhrung eines apolaren Molekls der Gre von Cyclohexan aus seiner flssigen Phase in eine wsserige
Lsung betrgt 25kJ/mol (6kcal/mol).

10

Kapitel 1 Biomolekle und ihre Wechselwirkungen

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.1.2 Stearat-Mizelle in Wasser. Stearat-Anionen (CH3(CH2)14COO) lagern sich zu supramolekularen Assoziaten zusammen. Die hydrophoben (lipophilen) Kohlenwasserstoffketten werden vom Wasser ausgeschlossen und lagern sich aneinander.
Die negativ geladenen Carboxylatgruppen treten in Kontakt mit H2O-Dipolen. Hydrophobe Effekte stabilisieren die Seifenmizelle: Der Entropiegewinn der H2O-Molekle berwiegt den Entropieverlust der Fettsure-Anionen

Hydrophobe Effekte stabilisieren fast alle biologischen Strukturen Zusammen mit den ande-

ren Sekundrbindungen, insbesondere den H-Bindungen, sind hydrophobe Effekte verantwortlich fr


die Stabilisierung aller greren biologischen Strukturen wie Proteine, Ribosomen oder Membranen
im wsserigen Milieu der Zelle. Diese Stabilisierung
durch leicht lsbare nichtkovalente Wechselwirkungen verschafft den biologischen Makromoleklen
konformationelle Flexibilitt. Fr viele biologische
Makromolekle, insbesondere fr Proteine, sind
Konformationsnderungen eine Grundlage ihrer
Wirkungsweise.
1.5

Molekulare Erkennung

Alle biologischen Vorgnge beruhen auf spezifischen intermolekularen Wechselwirkungen

Wie treffen Molekle aufeinander? In einer Lsung


bewegen sich die Molekle durch Diffusion. Kollisionen mit anderen Moleklen fhren zu einem
statistischen Diffusionsweg, wodurch die Wegzeit
proportional zum Quadrat der Luftlinien-Distanz
zwischen Start und Ziel wird (doppelte Distanz

braucht vierfache Zeit). Fr die kurzen Distanzen


innerhalb einer Zelle ist die Diffusion eine durchaus
gengend schnelle Art der Fortbewegung. Ein Molekl der Gre von ATP braucht nur 0,2s, um ber
10m, den Durchmesser einer kleinen tierischen
Zelle, zu diffundieren.
Eine Zufallskollision zwischen zwei Moleklen, z.B. zwei Proteinen oder einem Makromolekl und einer niedermolekularen Verbindung,
kann zur unmittelbaren Bildung eines Komplexes
fhren. Die Geschwindigkeit der Komplexbildung
wird in diesem Fall durch die Geschwindigkeit der
Diffusion bestimmt (diffusionslimitierte Komplex
bildung). Die Komplexbildung ist langsamer, falls
die Molekle in einer gewissen Orientierung oder
Konformation aufeinandertreffen mssen, um einen Komplex bilden zu knnen, d.h. wenn nicht
jede Kollision zur Bildung eines Komplexes fhrt.
Sind sich die beiden Molekle mit ihren strukturell komplementren Oberflchen gengend nahe
gekommen, werden nichtkovalente Wechselwirkungen wirksam. Der entstandene Komplex bleibt
bestehen, bis die statistischen thermischen Bewegungen der Molekle und Moleklteile zu seiner
Dissoziation fhren.

11
1.5Molekulare Erkennung

keitskonstante k1 und der Assoziationsgeschwindigkeitskonstante k1:


k1

AB A C B
k1

Geschwindigkeit der Dissoziation

vdiss D k1 AB


.. Abb.1.3 Strukturelle Komplementaritt und Bildung eines
Komplexes zwischen zwei Moleklen. Die intermolekularen
Wechselwirkungen sind schwach und von geringer Reichweite. Ein Komplex ist umso stabiler, je mehr solcher Bindungen
bestehen. Nur bei genauer struktureller Komplementaritt
der beiden Bindungspartner kann sich die maximale Anzahl
von Bindungen ausbilden

Geschwindigkeit der Assoziation

vass D k1 AB
Im Gleichgewicht ist

vdiss D vass

k1 AB D k1 AB


k1
AB
D Kd
D
AB
k1

Konzentration/Moleklzahl
Eine Konzentration einer Verbindung von
1M in einer Sugerzelle mit einem Volumen
von 2nL entspricht 1200Millionen Moleklen
dieser Verbindung in der Zelle.

Strukturelle Komplementaritt ist ein fundamentales Prinzip der Organisation der lebenden
Materie Proteinmolekle unterscheiden sich

voneinander aufgrund ihrer verschiedenen Oberflchenbeschaffenheit sehr scharf in ihrer Wechselwirkung mit anderen Moleklen. Diese biologische
Spezifitt wird durch strukturelle Komplementaritt verwirklicht (.Abb.1.3). Strukturelle Komplementaritt ist verantwortlich fr die spezifische
Bindung von Substratmoleklen an Enzyme, von
Hormonen an Rezeptoren oder von Antigenen an
Antikrper und fhrt zur Einlagerung von Proteinen in supramolekulare Strukturen bei der Biogenese von Zellmembranen oder Viren. Auf struktureller Komplementaritt beruht die molekulare
Arbeitsteilung und Spezialisierung.
Bei den
Nucleinsuren sichert die Paarung komplementrer
Basen die Weitergabe der genetischen Information.

Die Bindungsgleichgewichtskonstante ist ein


Ma fr die Stabilitt eines Komplexes Die Dissoziationsgleichgewichtskonstante Kd entspricht

dem Quotienten der Dissoziationsgeschwindig-

Unterschiede in der Stabilitt von Komplexen sind


zumeist auf Unterschiede in der Geschwindigkeit
ihrer Dissoziation zurckzufhren. Die reziproke
Gleichgewichtskonstante wird als Bindungsgleichgewichtskonstante oder Assoziationskonstante
Kass=1/Kd bezeichnet.
Gebruchliche Einheiten
k1

s1

k1

M1s1

Kd

Kass

M 1

Je hher die Bindungsgleichgewichtskonstante Kass


ist, d.h. je niedriger die Dissoziationskonstante
Kd eines Komplexes AB ist, umso strker ist die
Bindung zwischen A und B, d.h. umso grere
Anteile der Molekle A und B liegen im Gleichgewicht als Komplex vor (Rechenbeispiel Enzym-Inhibitor-Komplex; .Tab.1.3). Die Kd-Werte
fr Komplexe zwischen Biomoleklen liegen im
Bereich von 103M bis 1012M, sie entsprechen
Bindungsenergien von 1872kJ/mol, welche z.B.
durch 4 bis 17H-Bindungen zustande kommen
knnten.

Kapitel 1 Biomolekle und ihre Wechselwirkungen

12

.. Tab.1.3 Komplexbildung und Dissoziationsgleichgewichtskonstante Kd, Rechenbeispiel fr Bildung von Enzym-Inhibitor-Komplexa

Enzym-Inhibitor-Komplex:

3
4
5

E + I EI
E
=1
Falls [I] = Kd, ist EI

d.h. die Hlfte des Enzyms liegt als EI-Komplex vor

Falls Kd= 105 M und [I] = 103 M,

ist EIE  D

8
9
10
11
12
13
14
15
16
17
18
19
20

1
100

d.h. 100/101 oder 99% des gesamten Enzyms liegen als EI-Komplex vor.
Die Dissoziationskonstante Kd bestimmt bei gegebener Konzentration des ungebundenen Liganden das Verhltnis
der Konzentrationen von freiem und ligandiertem Protein. Als Ligand wird die, i.d.R. niedermolekulare, Verbindung
bezeichnet, die durch ein Makromolekl, i.d.R. ein Protein, gebunden wird.

a

6
7

10-5
10-3

Die gegenseitige Erkennung von Moleklen


folgt statistischen Gesetzmigkeiten und verluft deshalb nicht ohne Fehler Ein Enzymmole-

kl wird gelegentlich auch ein Molekl binden, das


seinem spezifischen Substrat hnlich ist, selbst wenn
dessen Bindungsgleichgewichtskonstante kleiner
ist als diejenige des Substrats. Das Enzymmolekl
akzeptiert u.U. ein solches Pseudosubstrat, wenn
auch seltener als das spezifische Substrat. Fr eine
Reihe wichtiger Vorgnge, wie die Weitergabe der
genetischen Information oder die Umsetzung der
genetischen Information in die Proteinstruktur, hat
die Zelle daher Korrekturmechanismen entwickelt,
die eingefhrte Fehler beheben.
Konsequenzen von Fehlern
Fr die Zellen bedeuten Irrtmer, welche
durch ihre molekulare Maschinerie begangen
werden, im besten Fall eine Verschwendung
chemischer Energie, im schlimmsten Fall
Zelltod oder unkontrollierte Zellvermehrung.
Ohne Fehler im Kopieren der DNA (und ohne
Spontanmutationen) htte indessen die biologische Evolution nicht stattgefunden.

1.6

Fluss von Materie und Energie,


energetische Koppelung
von Reaktionen

Der zweite Hauptsatz der Thermodynamik besagt,


dass in einem geschlossenen System die Entropie

nur zunehmen kann. Die Entropie ist ein Ma fr


die Wahrscheinlichkeit des Zustands eines Systems
und damit ein Ma fr die Unordnung des Systems.
Lebende Organismen besitzen einen sehr hohen
Grad von Ordnung, der nach dem Tod verschwindet. Wenn Organismen wachsen, vergrern sie
den Bereich hoher Ordnung. Wie lassen sich die
Lebensvorgnge mit dem zweiten Hauptsatz vereinbaren?
Organismen existieren fern vom Gleichgewichtszustand, sie sind offene Systeme, die Energie
aus der Umgebung beziehen und Wrme in die Umgebung abgeben Die zugefhrte Energie erlaubt

den Nichtgleichgewichtszustand der belebten Natur


aufrecht zu erhalten. Die primre Energiequelle der
belebten Natur auf der Erde ist die Sonnenstrahlung.
Photosynthetisierende Zellen (hhere Pflanzen,
Grnalgen, Cyanobakterien) verwandeln die elektromagnetische Energie des Sonnenlichts in chemische Energie, d.h. in Energie chemischer Bindungen:

Lichtenergie C CO2 C H2 O !

Zucker C O2

Chemotrophe Zellen (Tiere) benutzen die chemi-

sche Energie der von photosynthetisierenden Zellen


aufgebauten Verbindungen. Durch oxidativen Abbau wird direkt verwertbare chemische Energie in
Form von ATP (Adenosintriphosphat) gewonnen:

Zucker u. a. Verbindungen
C O2 C ADP C Pi !
CO2 C H2 O C ATP

13
1.6 Fluss von Materie und Energie, energetische Koppelung von Reaktionen

Der Kohlenstoff durchluft damit einen Kreislauf


zwischen photosynthetisierenden und oxidierenden
chemotrophen Zellen.

Die in ATP steckende chemische Energie wird


verwendet, um Vorgnge anzutreiben, die sonst
aus energetischen Grnden nicht ablaufen wrden Dazu gehren z.B. die Synthese zellulrer

Makromolekle, der Transport von Moleklen und


Ionen durch Membranen gegen ein Konzentrationsgeflle oder die Leistung mechanischer Arbeit. Es
sind Vorgnge dieser Art, welche den hohen Grad
von Ordnung in Zellen und Organismen aufbauen
und erhalten.
Freie Energie und Gleichgewicht Eine Reaktionslsung, die weder Stoff noch Wrme mit der Umwelt austauscht, besitzt eine bestimmte freie Energie,
die von den Konzentrationen der Reaktanten abhngt und sich daher im Laufe einer Reaktion ndert:

ACB CCD
Die freie Energie G ist definiert als

G D H  T  S;
wobei H die Enthalpie (Innere Energie + pV), T
die absolute Temperatur, S die Entropie und p der
Druck und V das Volumen ist.
Beim Umsatz von 1mol A und B in C und D,
bei gegebenen Konzentrationen der Reaktanten und
isothermen sowie isobaren Bedingungen, ndert
sich die freie Energie des Systems um G, wobei

von G und nicht von G entscheidet, in welcher


Richtung eine Reaktion ablaufen kann:
Falls G<0, handelt es sich bei der Reaktion von
A+B nach C+D um eine exergonische Reaktion. Eine Nettoreaktion A+B nach C+D fhrt
in Richtung Gleichgewicht und ist mglich.
Falls G=0, befindet sich das System im
C  D 
Gleichgewicht, d.h. A  B =K
Es findet keine Nettoreaktion statt.
Falls G>0, ist die Reaktion von A+B nach
C+D endergonisch. Eine endergonische Reaktion fhrt vom Gleichgewicht weg und kann
nur dann ablaufen, wenn sie mit einer exergonischen Reaktion gekoppelt ist. Die Rckreaktion
von C+D nach A+B kann hingegen ablaufen,
sie fhrt zur Erreichung des Gleichgewichts.

--

Numerischer Zusammenhang
Numerischer Zusammenhang zwischen K, der
Reaktionsgleichgewichtskonstanten, und G
(bei 25C) fr die Reaktion A+B C+D (1kJ
= 0,24kcal):
G (kJ/mol)

K=[C][D]
[A][B] im Gleichgewicht

18

0,001

12

0,01

6 (1.4kcal/mol)

0,1

10

12

100

18

1000

G ist eine Zustandsfunktion Der Wert von G

G D H  T  S
G lsst sich berechnen aus G, der nderung der
freien Energie bei Standardbedingungen, und den
Konzentrationen der Reaktanten:

G D G C RT ln

CD
AB

G ist bestimmt durch die Gleichgewichtskonstante K; G kann je nach dem Verhltnis der Konzentrationen der Reaktanten grer, gleich oder
kleiner sein als G Wenn die Konzentrationen

von Produkten und Edukten 1M (1mol/L) sind


(Standardbedingungen), ist G=G. Der Wert

ist nur abhngig vom Anfangs- und Endzustand des


Systems; der Weg, ber den das System vom Anfangs- in den Endzustand gelangt, ist hierfr ohne
Bedeutung. Fr die Werte von G und G spielt
es keine Rolle, ob z.B. Glucose mit Sauerstoff als
Oxidationsmittel direkt zu CO2 und H2O verbrannt
wird oder ob im Organismus aus Glucose ber eine
lange Reihe aufeinanderfolgender enzymkatalysierter Reaktionen die gleichen Produkte entstehen.
Biomolekle sind thermodynamisch labil, jedoch kinetisch stabil G gibt nur an, in welcher

Richtung die Reaktion ablaufen kann. ber die Geschwindigkeit der Reaktion wird nichts ausgesagt.
Alle biochemischen Reaktionen und Vorgnge sind

14

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 1 Biomolekle und ihre Wechselwirkungen

entweder von sich aus exergonisch oder an exergonische Reaktionen gekoppelt. Die thermodynamischen Voraussetzungen, dass die Reaktionen ablaufen knnten, sind demnach erfllt. Dennoch laufen
sie spontan nicht oder nur sehr langsam ab. Glucose
zum Beispiel ist in Gegenwart von Luftsauerstoff stabil; ihr Abbau kann erst mit messbarer Geschwindigkeit ablaufen, wenn er durch Erhhung der
Temperatur oder durch Katalysatoren beschleunigt
wird (Verbrennung der Glucose in der Flamme bzw.
enzymkatalysierter Abbau der Glucose im Organismus). Die allermeisten biochemischen Reaktionen
laufen nur dann mit messbarer Geschwindigkeit ab,
wenn sie durch Enzyme katalysiert werden. Ohne
Enzyme sind die Biomolekle kinetisch stabil.
In der Biochemie gelten besondere thermodynamische Standardbedingungen Die Stan-

dardbedingungen der Chemie (Konzentrationen


1M=1mol/L) entsprechen nicht den physiologischen Bedingungen. Zur Vereinfachung sind besondere biochemische Standardbedingungen
definiert worden:
Alle biochemischen Reaktionen laufen in wsseriger Lsung ab; auerdem nimmt Wasser an manchen Reaktionen teil. Fr die Standardbedingungen
der Biochemie gilt deshalb:

H2 O D 55 M

.1 L Wasser enthlt 55 mol H2 O/

Protonen nehmen an vielen Reaktionen teil, z.B.:


C
ATP4 C H2 O ! ADP3 C HPO2
4 CH :

Eine Wasserstoffionenkonzentration von 1M entspricht einem pH-Wert von Null und ist damit weit
entfernt von physiologischen Bedingungen. Man
definiert deshalb fr die biochemischen Standardbedingungen:

HC  D 107 M .pH 7/
Zur Berechnung von G und G unter biochemischen Standardbedingungen werden demnach eine
Wasserkonzentration von 55M und eine Wasserstoffionenkonzentration von 107M je mit dem
Wert1 in die Gleichungen eingesetzt. Wenn mit diesen Werten gerechnet wird, werden andere Werte fr

G und G erhalten, die mit G bzw. G bezeichnet werden ( : Rechenbeispiel zu G und G).

Energetische Koppelung bringt endergonische Reaktionen zum Ablaufen Wir betrachten

als Beispiel eine Reaktion, die aus zwei Teilreaktionen besteht:


zz Teilreaktion1

G0 D 5 kJ=mol

ABCC

ist unter den vorliegenden Bedingungen (Konzentrationen der Reaktanten) endergonisch; es kann
keine Nettoreaktion von A nach B+C ablaufen;
zz Teilreaktion2

BD

G0 D 8 kJ=mol

ist exergonisch und kann als Nettoreaktion ablaufen;


zz Die Gesamtreaktion

ACCD

G0 D 3 kJ=mol

ist exergonisch. Sie wird ablaufen, obwohl sie eine


endergonische Teilreaktion einschliet. Die beiden
Teilreaktionen sind miteinander gekoppelt ber das
gemeinsame Zwischenprodukt B.
Eine Reaktion mit stark negativem G (Gleichgewicht stark auf Seite der Produkte; Teilreaktion2
im obigen Beispiel) wird als energieliefernde Reaktion bezeichnet, wenn sie durch energetische
Koppelung eine Reaktion, welche von selbst nicht
ablaufen kann (Teilreaktion1), ermglicht.
Eine Verbindung, welche eine groe Tendenz hat,
eine Gruppe auf ein Akzeptormolekl zu bertragen,
wird in der biochemischen Terminologie als energiereiche Verbindung bezeichnet. Das Gleichgewicht
der Reaktion einer energiereichen Verbindung mit
einem Akzeptor liegt stark auf Seiten der Produkte;
die energiereiche Verbindung hat ein hohes Gruppenbertragungspotenzial. Beim Vergleich der
verschiedenen energiereichen Verbindungen wird
Wasser als Akzeptor gewhlt, d.h. es werden die
G-Werte der Hydrolyse miteinander verglichen.
ATP (Adenosintriphosphat) ist der wichtigste
Energiebertrger in der Zelle und der Prototyp ei-

15
1.6 Fluss von Materie und Energie, energetische Koppelung von Reaktionen

ner energiereichen Verbindung. Die G-Werte fr


die Hydrolyse der zwei Phosphorsureanhydridbindungen weisen diese als energiereiche Bindungen
aus. Die Phosphorsureesterbindung ist dagegen
nicht energiereich:
ATP + H2O ADP + Pi

ADP + H2O AMP + Pi

G = 30kJ/mol = 7,3kcal/
mol (bei pH 7,0, 25C).
Unter physiologischen Be
dingungen betrgt G der
ATP-Hydrolyse ungefhr
50kJ/mol.
G = 30kJ/mol = 7,3kcal/mol

AMP + H2O Adenosin + Pi G = 14kJ/mol = 3,4kcal/mol

.. Tab.1.4 Freie Energie der Hydrolyse von ATP im


Vergleich mit der Hydrolyse anderer Verbindungena

G(kJ/mol)
Phosphoenolpyruvat

60

3-Phosphoglyceroylphosphat

54

Kreatinphosphat

43

ATP (ADP+Pi)

35

ATP (AMP+PPi)

37

Pyrophosphat (anorgan.
Diphosphat) PPi

33

Acetyl-Coenzym A

35

Aminoacyl-tRNA

35

Uridindiphosphat-Glucose

30

N -Formyltetrahydrofolat

26

Alanyl-Glycin

17

Glucose-6-phosphat

14

10

G entspricht der nderung der freien Energie bei


Hydrolyse unter biochemischen Standardbedingungen bei 25C. ATP nimmt im Vergleich mit anderen
Verbindungen eine Mittelstellung ein.

ATP besitzt somit zwei energiereiche Bindungen,


d.h. Bindungen, deren hydrolytische Spaltung ein
stark negatives G aufweist. Energiereiche Bindungen werden in der biochemischen Literatur
hufig mit einer Tilde~bezeichnet. Ein G von
30kJ/mol entspricht einer Gleichgewichtskonstante K=105, d.h. das Gleichgewicht liegt um diesen Faktor auf Seite der Produkte:

ADPPi 
D K0 D 105
ATPH2 O
d.h. 1nM ATP und 55M H2O stehen mit je 10mM
ADP und Pi im Gleichgewicht (Zu beachten: 55M
H2O wird mit dem Wert1 in die Gleichung eingesetzt.)
Ein Vergleich mit anderen Verbindungen mit
hohem Phosphatgruppenbertragungspotenzial
sowie weiteren energiereichen Verbindungen zeigt,
dass der G-Wert von ATP eine Mittelstellung einnimmt (.Tab.1.4), die ATP zum generellen bertrger chemischer Energie in der Zelle prdestiniert.
In der Zelle liegt ATP in einer Konzentration von

16

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 1 Biomolekle und ihre Wechselwirkungen

110mM als Mg2+ ATP-Komplex vor. Das positiv

geladene Mg2+-Ion schirmt die negativen Ladungen


der Phosphatgruppen des ATP ab.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514842-0
1.1 Die Entstehung des Lebens
1.2 Gre biologischer Strukturen, Geschwindigkeit biologischer Vorgnge und molekulare Zusammensetzung der lebenden
Materie
1.3 Wechselwirkungen zwischen Biomoleklen
1.4 Wasser und hydrophober Effekt
1.5 Molekulare Erkennung
1.6 Fluss von Materie und Energie, energetische Koppelung von Reaktionen
Weiterfhrende Literatur

17

Kovalente Struktur
der Proteine
Ph. Christen, R. Jaussi, R. Benoit

2.1

Bauprinzip der Proteine 18

2.2

Gre und Gestalt der Proteine 18

2.3

Aminosuren, die Bausteine der Proteine 20

2.4

Ionisationszustnde von Aminosuren und Proteinen 22

2.5

Aminosurezusammensetzung und
Aminosuresequenzen von Proteinen 24

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_2, Springer-Verlag Berlin Heidelberg 2016

18

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 2 Kovalente Struktur der Proteine

Im Jahr 1838 fand Gerardus Mulder N-haltige


Stoffe, die in den Geweben quantitativ vorherrschten, und gab diesen den Namen Proteine (griech.
proteion, die erste Stelle). Die Bezeichnung ist auch
im qualitativen Sinn gerechtfertigt: Proteine sind die
wichtigsten und vielfltigsten Struktur- und Funktionstrger der Zelle.
Proteine sind unverzweigte Polymere aus 20
verschiedenen L-Aminosuren (das achirale Glycin mitgezhlt), die durch Peptidbindungen miteinander verknpft sind. Die Nucleotidsequenz der
DNA bestimmt die Abfolge der Aminosurereste
lngs der Polypeptidkette; die Aminosuresequenz
bestimmt ihrerseits die rumliche Struktur des Proteins. Die meisten Polypeptidketten, die in der Zelle
synthetisiert werden, besitzen einige hundert Aminosurereste und eine Moleklmasse zwischen 10
und 100kDa. Viele Proteine bestehen aus mehreren
Polypeptidketten (Untereinheiten), die durch nichtkovalente Wechselwirkungen zusammengehalten
werden. Die ersten grndlichen Untersuchungen
von Proteinen wurden an Hhnereiwei durchgefhrt; Proteine werden deshalb im Deutschen auch
als Eiweie bezeichnet.
2.1

Bauprinzip der Proteine

Proteine sind lineare Polymere von 20 verschiedenen Aminosuren Die Aminosuren sind durch
Peptidbindungen miteinander verknpft; in diesen

Sureamidbindungen ist die -Carboxylgruppe einer Aminosure mit der -Aminogruppe der nchsten Aminosure verbunden (.Abb.2.1). Dieses
Bauprinzip ergibt eine groe Zahl von Kombinationsmglichkeiten. Aus 20 verschiedenen Bausteinen lassen sich 203=8000 verschiedene Tripeptide synthetisieren. Bei einem kleinen Protein mit
100Aminosureresten bestehen 20100=1,2710130
Mglichkeiten (geschtzte Anzahl von Atomen im
Universum 1079). Allerdings wrden nur sehr wenige dieser Polypeptidketten eine stabile definierte
dreidimensionale Struktur einnehmen knnen und
damit als funktionelles Protein brauchbar sein.
Die periodische Abfolge von C-Atomen und
Peptidbindungen wird als Hauptkette des Peptids
oder Proteins bezeichnet; daran hngen in wechselnder Folge die verschiedenartigen Seitenketten.

Die Aminosuresequenz der Proteine ist genetisch bestimmt Die kovalente Struktur eines

Proteins, d.h. die Abfolge der Aminosuren lngs


der Polypeptidkette, wird auch als Primrstruktur
bezeichnet. Die Polypeptidkette faltet sich spontan
zu einer definierten, fr ein bestimmtes Protein spezifischen dreidimensionalen Struktur. Die Faltung
der Polypeptidkette im Raum (Kettenkonformation, 3D-Struktur) wird durch die Primrstruktur

bestimmt und ist damit indirekt ebenfalls genetisch


festgelegt. Die 3D-Struktur wird durch nichtkovalente Bindungen und hydrophobe Effekte stabilisiert. Besonders bei extrazellulren Proteinen tragen
auch Disulfidbindungen zur Stabilisierung bei. Die
fr ein bestimmtes Protein typische Faltungsform
wird als dessen native Struktur bezeichnet. Nur native Proteine sind biologisch aktiv. Infolge der definierten Raumstruktur knnen sich reine Proteine in
ein Kristallgitter einfgen.
Die meisten Proteine haben eine sehr hnliche elementare Zusammensetzung:
C

53

21

16

03

Massen-%

Der Stickstoffanteil von 16% ist von Protein zu Protein recht konstant und kann deshalb zur quantitativen Bestimmung von Proteinen benutzt werden.
Die Proteine knnen eingeteilt werden in einfache Proteine, welche aus einer oder mehreren
Polypeptidketten bestehen, und zusammengesetzte Proteine, welche auerdem eine Nichtproteinkomponente, d.h. ein Metallion oder eine niedermolekulare organische Verbindung, enthalten
(.Tab.2.1). Diese prosthetische Gruppe ist durch
kovalente oder nichtkovalente Bindungen fest an
das Protein gebunden. Sie ist notwendig fr die biologische Aktivitt des Proteins. Zudem ist sie verantwortlich fr die charakteristische Farbe einiger
Proteine. Proteine selbst sind farblos.
2.2

Gre und Gestalt der Proteine

Die Moleklmassen der Proteine liegen im Bereich


von 101000kDa. Ein Protein besitzt im Gegensatz
zu einem Peptid eine definierte 3D-Struktur. Fr die
Abgrenzung zwischen Protein und Peptid spielt demnach die Moleklmasse primr keine Rolle. Wohl ist

19
2.2 Gre und Gestalt der Proteine

.. Abb.2.1 Struktur eines Tripeptids. Die drei Aminosuren


besitzen je eine -NH2-Gruppe und eine -COOH-Gruppe;
sie unterscheiden sich jedoch in ihrer Seitenkette (R1R3).
Die -Carboxylgruppe der vorangehenden Aminosure
bildet eine Amidbindung (Peptidbindung) mit der -Aminogruppe der nchstfolgenden Aminosure. Je nach Anzahl
der Aminosurereste bezeichnet man das entstehende
Molekl als Dipeptid, Tripeptid, Tetra-, ... Polypeptid. Der
Ladungszustand ionisierbarer Gruppen ist in dieser Darstellung nicht bercksichtigt

.. Tab.2.1 Proteine mit prosthetischen Gruppen


Beispiel

Zugehrige prosthetische
Gruppe

Massenanteil der prosthetischen Gruppe (%)

Gewisse Enzyme

Coenzym

<1

Metallenzyme

Metallion

<1

Hmoglobin

Hm

Lipoproteine

Apo-Lipoproteine

Lipid

80

Glykoproteine

1-Glykoprotein

Kohlenhydrat

40

Phosphoproteine

Casein (in Milch)

Phosphat

Cofaktor-abhngige
Proteine

aber die Tendenz zu eindeutiger Raumstruktur umso


grer, je hher die Moleklmasse ist. Die meisten
in der Natur vorkommenden Polypeptidketten von
ber 10kDa besitzen eine definierte Raumstruktur
und sind demnach den Proteinen zuzuzhlen.
Anzahl As-reste in Protein
Durchschnittliche Moleklmasse eines
Aminosurerests=120Da; Moleklmasse des
Proteins/120Anzahl Aminosurereste

Viele Proteine sind aus mehreren Untereinheiten


zusammengesetzt Die lngsten Polypeptidketten

besitzen ber 1000Aminosurereste. Die meisten


Polypeptidketten sind krzer. Proteine mit Moleklmassen>50kDa bestehen oft aus mehr als einer
Polypeptidkette. Man unterscheidet monomere
Proteine mit einer Polypeptidkette und oligomere
Proteine, die aus mehreren Polypeptidketten aufgebaut sind. Die Untereinheiten oligomerer Proteine
werden durch nichtkovalente Wechselwirkungen
zusammengehalten.

Als Makromolekle unterscheiden sich Proteine


von niedermolekularen Substanzen in ihrem Verhalten gegenber Membranen. Viele biologische
und knstliche Membranen lassen Wasser und
niedermolekulare Stoffe durchtreten, sind aber fr
groe Molekle wie Proteine undurchlssig. Dieses
Verhalten wird bei der Dialyse und der Ultrafiltration genutzt.
Dialyse
Eine semipermeable Membran mit Poren von
etwa 2nm, die kleine Molekle und Ionen
durchlsst, Proteine aber zurckhlt, dient
dazu, Proteinlsungen von niedermolekularen
Substanzen zu befreien. Auf dem gleichen
Prinzip beruht die Hmodialyse in der
knstlichen Niere. Dabei wird ungerinnbar
gemachtes Blut gegen eine Elektrolytlsung
mit physiologischer Zusammensetzung dialysiert. Harnpflichtige Stoffe werden entfernt;
Blutzellen und Blutproteine werden zurckgehalten.

Kapitel 2 Kovalente Struktur der Proteine

20

1
2

.. Abb.2.3 Kollagen als Beispiel eines Faserproteins. Drei


Kollagen-Polypeptidketten winden sich umeinander zu
einer Tripelhelix. Die Tripelhelices lagern sich wiederum
aneinander, um kollagene Fasern zu bilden. Kollagen ist der
wichtigste extrazellulre Bestandteil des Bindegewebes und
der organischen Grundsubstanz des Knochens. Der gezeigte
Abschnitt einer Kollagentripelhelix ist 11,4nm lang und entspricht 4% der 300nm langen Kollagentripelhelix

3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Protein

Produkt

Haarkeratin

Wollfasern

Kollagen
.. Abb.2.2 Hmoglobin als Beispiel eines oligomeren
Proteins aus globulren Untereinheiten. Hmoglobin ist ein
Tetramer aus zwei - und zwei -Untereinheiten. Je ein -Globinmolekl (141 minosurereste) und ein -Globinmolekl
(146Reste) bilden ein Dimer; zwei dieser Dimere bilden ein
()2-Tetramer, das Hmoglobin A. Jede Untereinheit besitzt
als prosthetische Gruppe ein Hm-Molekl (in Blau), welches
je ein O2-Molekl binden kann

Die Proteine knnen in zwei groe Klassen eingeteilt werden:


Globulre Proteine: Die Polypeptidketten sind

zu kompakten, annhernd kugeligen Formen


gefaltet (.Abb.2.2). Globulre Proteine sind
zum groen Teil gut wasserlslich und haben
uerst vielfltige Funktionen.
Fibrillre Proteine (Faserproteine) bilden
langgestreckte Strukturen (meist aus vielen
aneinandergelagerten Polypeptidketten), sind
meist wasserunlslich und haben mechanische
Funktionen (.Abb.2.3). Faserproteine sind
vielfach in Produkten enthalten, die praktische
Verwendung finden :

Seidenfibroin

2.3

im Bindegewebe
der Haut

Leder

als organische
Grundsubstanz
des Knochens

Gelatine,
Tischlerleim
Seidenfasern

Aminosuren, die Bausteine


der Proteine

Proteine sind ausschlielich aus L-Aminosuren


(und Glycin) aufgebaut Die strukturelle und

funktionelle Vielfalt der Proteine beruht auf den


Eigenschaften der 20 verschiedenen in Proteinen
vorkommenden Aminosuren. Alle -Aminosuren
knnen formal als Derivate des Glycins aufgefasst
werden, in welchen ein H-Atom am -Kohlenstoffatom durch einen spezifischen Rest (Seitenkette) substituiert ist. Dabei wird C zum chiralen
Zentrum. AlleL-Aminosuren mit Ausnahme von
L-Cystein gehren zur S-Reihe im R/S-System. Die
Aminosuren knnen nach der Art ihrer Seitenketten geordnet werden (.Abb.2.4) .

.. Abb.2.4 Die 20 proteinogenen Aminosuren.


Die Dreibuchstaben- und Einbuchstabenabkrzungen sind angegeben.
Der gezeigte Ladungszustand der ionisierbaren Gruppen gilt fr pH7. Das zentrale C-Atom wird als C bezeichnet (s. die Formel
von Glycin) und trgt die sogenannte -Amino- und -Carboxylatgruppe. Die weiteren Atome werden fortlaufend mit griechischen Buchstaben bezeichnet (s. Formel von Lysin). Die Aminosuren sind nach der Art ihrer Seitenketten (in Blau) geordnet:
1.Glycin besitzt keine Seitenkette und ist daher nicht chiral.
2.Aminosuren mit hydrophober Seitenkette. Die Seitenketten bestehen aus Kohlenwasserstoffketten ohne reaktive Gruppen.
3.Saure Aminosuren (Monoaminodicarbonsuren). Die negativen Ladungen von Proteinen befinden sich auf diesen Aminosureresten.
4.Basische Aminosuren. Diese Aminosurereste tragen die positiven Ladungen von Proteinen.
5.Aminosuren mit polarer Gruppe in der Seitenkette. Diese Aminosurereste knnen H-Bindungen eingehen.
Die Aminosuren ohne geladene Gruppe in der Seitenkette heien neutrale Aminosuren

21
2.3 Aminosuren, die Bausteine der Proteine

22

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 2 Kovalente Struktur der Proteine

Chirale Medikamente
Die belebte Natur ist nicht nur bezglich
Aminosuren enantiomerspezifisch: Die
natrlich vorkommenden Zucker und deren
Derivate gehren ausschlielich der D-Reihe
an. Enzyme und Rezeptoren reagieren i.d.R.
nur mit dem einen Enantiomer einer chiralen
Verbindung. Die chemische Synthese eines
Medikaments liefert jedoch zumeist das
Razemat. Die Enantiomere unterscheiden sich
sehr oft ganz wesentlich in ihrem pharmakologischen Verhalten. Das bekannteste Beispiel
ist das frher als Schlafmittel eingesetzte
Thalidomid: In den ersten drei Monaten einer
Schwangerschaft eingenommen, fhrt es
beim Kind zu schweren Fehlbildungen der
Extremitten. Verantwortlich scheint das
S-Enantiomer zu sein, das nicht nur bei der
chemischen Synthese entsteht, sondern
auch im Organismus aus dem R-Enantiomer
gebildet wird.

Gewisse Aminosuren zeichnen sich durch besondere Eigenschaften aus: Glycin kann wegen
seiner geringen Raumbeanspruchung besonders
gut in die Raumstruktur von Proteinen eingebaut
und nicht leicht durch einen anderen Aminosurerest ersetzt werden. Die aromatischen Aminosuren (Trp, Tyr, Phe) sind verantwortlich fr das
Absorptionsmaximum der Proteine bei 280nm
(Abschn.37.4; ). Prolin besitzt anstelle einer primren eine sekundre Aminogruppe.
Durch den Ringschluss zwischen Seitenkette und
-Aminogruppe wird die freie Drehbarkeit der
N-C-Bindung stark eingeschrnkt mit wichtigen
Konsequenzen bei der Faltung einer Polypeptidkette. Die schwefelhaltige Aminosure Methionin
ist die einzige Aminosure mit einer langen ungeladenen und unverzweigten Seitenkette. Zwei Cysteinreste mit ihren Sulfhydrylgruppen knnen zu
einem Cystinrest oxidiert werden, dessen Disulfidbindung (Disulfidbrcke) zwei Polypeptidketten
oder verschiedene Abschnitte einer Polypeptidkette verbindet:

Asparagin und Glutamin besitzen eine Sureamidgruppe. Das eng benachbarte O-Atom beeinflusst

durch seine Elektronegativitt das freie Elektronenpaar am N-Atom, welches dadurch nicht mehr wie
bei den Aminen zur Protonenbindung zur Verfgung steht. Die Amidgruppen von Asn und Gln
sind somit polar aber nicht mehr basisch. Auer
den 20Standardaminosuren kommen in einigen
Proteinen noch weitere Aminosuren vor, die nicht
in der DNA codiert sind, sondern im fertiggestellten
Protein durch chemische Modifikation von Standardaminosuren entstehen (posttranslationale
Modifikation).
2.4

Ionisationszustnde von
Aminosuren und Proteinen

Alle Aminosuren sind in wsserigem Milieu ionisiert und knnen als Sure (Protonendonor)
und auch als Base (Protonenakzeptor) reagieren Substanzen, welche sowohl saure als auch
basische Eigenschaften aufweisen, werden als Ampholyte (amphotere Elektrolyte) bezeichnet. Die

Protonierung und Deprotonierung der Aminosuren und damit deren Ladungszustand hngen
vom pH-Wert der Lsung ab. Am einfachsten sind
diese Verhltnisse bei den neutralen Aminosuren,
die nur zwei ionisierbare Gruppen, nmlich die
-Aminogruppe und die -Carboxylgruppe, aufweisen (.Abb.2.5).

23
2.4 Ionisationszustnde von Aminosuren und Proteinen

.. Abb.2.5Sure-Base-
Titration von Aminosuren.
Bei einer Aminosure mit
einer ionisierbaren Gruppe
in der Seitenkette kommt
zu den zwei Titrationsstufen von -Carboxyl-Gruppe und -Aminogruppe,
wie sie sich bei Alanin
finden, noch eine dritte
Titrationsstufe dazu

Darstellung von Aminosuren

A 
;
HA
die Henderson-Hasselbalch-Puffergleichung:
pH D pKa C log

Diese nichtionisierte Form einer Aminosure


kommt in wsseriger Lsung bei keinem pHWert vor. Gelegentlich wird diese Darstellung
der Einfachheit halber besonders bei Besprechungen des Stoffwechsels verwendet.

Die Ionisation einer Gruppe (z.B. AH A+H+)


wird durch das Massenwirkungsgesetz beschrieben:

[HC   A 
D Ka ; wobei Ka
HA
die Suredissoziationskonstante darstellt.
Logarithmieren gibt

A 
logH  C log
D log Ka
HA
C

Wird log [H+] = pH und log Ka = pKa gesetzt,


ergibt sich

A 

A 

Wenn pH = pKa, ist log [AH] = 0, d.h. [AH] = 1, d.h.


je die Hlfte der Molekle liegt in protonierter bzw.
deprotonierter Form vor.
Bei einem bestimmten pH-Wert der Lsung einer Aminosure liegen, auer dem Zwitterion, die
anionische und kationische Form in gleicher Konzentration vor (.Abb.2.5). Die gemittelte Nettoladung ist in diesem Fall gleich Null. Dieser pH-Wert
wird als isoelektrischer Punkt pI der Aminosure
bezeichnet und entspricht dem arithmetischen Mittel der pKa-Werte:

pI D

pK1 C pK2
2

Die Ladungseigenschaften der Proteine leiten


sich von den Ladungseigenschaften ihrer Seitenketten ab Die Amidgruppe (Peptidbindung

-CO-NH-) ist elektrisch neutral und hat weder basische noch saure Eigenschaften; nur die -Aminogruppe und -Carboxylgruppe an den Enden der
Kette tragen zur Ladung eines Polypeptids bei. Die

Kapitel 2 Kovalente Struktur der Proteine

24

1
2
3
4
5
6

Ladung der Seitenketten wird nach Magabe ihrer


pKa-Werte durch den pH-Wert der Lsung bestimmt. Die pKa-Werte in einem Protein entsprechen zumeist nicht den Werten in freien Aminosuren, da sie von der Mikroumgebung beeinflusst
werden (.Tab.2.2). Abhngig vom pH-Wert der
Lsung kann die Gesamtladung von Proteinen positiv, negativ oder auch null sein. Demnach weisen
auch Proteine einen isoelektrischen Punkt auf. Die

pH-Titrationskurve eines Proteins entspricht der


Summe der Titrationskurven aller ionisierbaren
Gruppen. Bei vielen Proteinen zeigt sie deren v.a.
durch Histidinreste (pKa = 67) bedingte Pufferwirkung im physiologischen pH-Bereich. Proteine sind
wichtige Puffer in Zellen und im Blut.
Proteine knnen aufgrund ihres isoelektrischen
Punktes in saure, neutrale und basische Proteine
eingeteilt werden.

Beispiel

pI

Ladung bei pH7

Saure Proteine

pI<7

Pepsin

2,9

stark negativ

Aminosurenzusammensetzung
viel Asp und Glu

Neutrale Proteine

pI7

Hmoglobin

7,1

gleichviel saure und basische


Aminosuren

Basische Proteine

pI>7

Histone

10,8

stark positiv

viel Lys und Arg

7
8
9
10
11
12
13
14
15
16
17
18
19
20

2.5 Aminosurezusammensetzung

und Aminosuresequenzen
von Proteinen

Die Aminosureanalyse (Abschn.38.1) hat fr


die Untersuchung von Proteinen etwa die gleiche
Bedeutung wie die Elementaranalyse niedermolekularer Verbindungen in der Chemie. Die durchschnittliche Hufigkeit, mit welcher die verschiedenen Aminosuren in Proteinen vorkommen,
variiert recht stark: Leucin kommt siebenmal hufiger vor als Tryptophan.
Aminosuren in Proteinen
Durchschnittliche Hufigkeit (%)
Gly

7,5

Cys

1,7

Ala

8,3

Trp

1,3

Val

6,6

Tyr

3,2

Leu

9,0

Asn

4,4

Ile

5,2

Gln

4,0

Met

2,4

Asp

5,3

Phe

3,9

Glu

6,2

Pro

5,1

Lys

5,7

Ser

6,9

Arg

5,7

Thr

5,8

His

2,2

}
}

11,5
11.4

Die Aminosurezusammensetzung ist ein spezifisches Merkmal fr ein bestimmtes Protein. Im


Allgemeinen ist jedoch keine direkte Beziehung
zwischen Aminosurezusammensetzung und der
rumlichen Struktur oder Funktion des Proteins

ersichtlich. Nur in gewissen Extremfllen hngt die


Struktur und Funktion klar vom Vorhandensein eines groen Anteils bestimmter Aminosurereste ab:
Histone kommen im Chromatin des Zellkerns
vor. Es sind basische Proteine mit einem hohen
Gehalt an Lysin- und Argininresten, die an die
negativ geladenen Phosphatgruppen der DNA
binden.
Kollagen ist ein Faserprotein des Bindegewebes, welches langgestreckte Tripelhelices bildet,
deren Struktur durch den hohen Gehalt an
Glycin, Prolin, Hydroxyprolin und Hydroxylysin ermglicht wird. Hydroxyprolin und
Hydroxylysin entstehen durch posttranslationale Modifikation und kommen ganz selten in
anderen Proteinen vor. Ihre Hydroxylgruppen
dienen als Ansatzpunkte fr kovalente Quervernetzungen (Abschn.30.6).
Keratine sind ebenfalls Faserproteine und
bilden die Haare und andere Hautanhangsgebilde wie Ngel, Hufe oder Hrner. Die
Keratine enthalten sehr viele Disulfidbindungen, welche die einzelnen Polypeptidketten
zusammenhalten, und damit bis zu 10%
Schwefel (Abschn.3.9). Der typische Geruch
versengter Haare ist auf SO2 zurckzufhren.

Proteine mit gleicher Zusammensetzung aber ungleicher Sequenz der Aminosuren sind nicht identisch Die erste Sequenzbestimmung mittels chemi-

schen Abbaus war die von Insulin, einem Protein aus

25
2.5 Aminosurezusammensetzung und Aminosuresequenzen von Proteinen

.. Tab.2.2 pKa-Werte ionisierbarer Gruppen in Proteinen


pKa in freier
Aminosure

3.9
4.1
12.5
10.5
6.0
10.7
10.5

zwei Peptidketten mit insgesamt 51Aminosureresten. Frederick Sanger arbeitete zehn Jahre (194555)
an der Sequenzierung von Insulin. Auch heute dauert
die direkte Bestimmung der Aminosuresequenz
eines Proteins noch einige Monate. Die Nucleotidsequenz der entsprechenden DNA kann jedoch viel
rascher bestimmt werden (Abschn.39.7); mit Hilfe
des genetischen Codes kann daraus die Aminosuresequenz abgeleitet werden. Dabei ist zu beachten,
dass posttranslationale Modifikationen einzelner
Aminosurereste und proteolytische Abspaltung von
Teilen der Polypeptidkette die Primrstruktur eines
Proteins weiter verndern knnen.
Nomenklatur Aminosuresequenz

---

Beispiel eines Pentapeptids:


Alanyl-Seryl-Isoleucyl-Phenylalanyl-Lysin
Ala-Ser-Ile-Phe-Lys
ASIFK
Sequenz wird vom NH2-Terminus zum
COOH-Terminus (entspricht der Richtung
der Biosynthese) angegeben,
Peptid wird als Acylderivat der C-terminalen Aminosure bezeichnet,
Aminosuresequenzen von Proteinen
werden ausschlielich mit den Dreibuchstaben- oder Einbuchstabenabkrzungen
angegeben (.Abb.2.4).

Vergleich der Aminosuresequenzen von Proteinen Aus Sequenzvergleichen kann die molekulare Evolution von Proteinen rekonstruiert

werden. Beim Vergleich der Sequenzen verwandter


Proteine, z.B. von Myoglobin und Hmoglobin,
werden deren einzelne Aminosurereste miteinander so ausgerichtet, dass sich der grtmgliche
Grad von Sequenzidentitt ergibt (.Abb.2.6). Eine
offensichtliche hnlichkeit in der Aminosuresequenz (Identitt > 30%) wird als Sequenzhomologie bezeichnet. Sie ist die Folge des gemeinsamen
evolutionren Ursprungs dieser Proteine. Oft ergibt
sich das klare Bild einer Homologie erst, wenn in
den ausgerichteten Sequenzen bestimmte Positionen freigelassen werden. Diese Lcken existieren
in Wirklichkeit nicht. Sie sind blo Zeuge davon,
dass im Laufe der Evolution an diesen Positionen
Aminosuren eliminiert (Deletion) oder zustzlich
eingeschoben (Insertion) worden sind.
Nach Genduplikation, d.h. Verdoppelung eines
Gens, knnen aus einem gemeinsamen Vorfahren
zwei Proteine entstehen, die sich gesondert fr die
Erfllung je einer bestimmten Funktion spezialisieren. Auf diese Weise knnen Proteinfamilien entstehen, deren Mitglieder bei hnlicher 3D-Struktur
unterschiedliche Funktionen ausben. Ein Beispiel
ist die durch mehrfache Genduplikationen ermglichte Entwicklung von Myoglobin und verschiedenen Hmoglobinketten (, , , , , ).
Aus Sequenzvergleichen lassen sich phylogenetische Stammbume ableiten Sequenzverglei-

26

1
2
3
4
5
6
7
8
9
10
11
12
13

Kapitel 2 Kovalente Struktur der Proteine

1
Myoglobin

10

20

30

40

G-LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPET

Hmoglobin V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT

.. Abb.2.6 Vergleich der Aminosuresequenzen von Myoglobin sowie der - und -Kette des Hmoglobins des Menschen.
Diese Proteine binden reversibel Sauerstoff. Die Abbildung zeigt nur die ersten 40Aminosurereste der Polypeptidketten, die je
nach Protein 141 bis 153Reste lang sind. Mit Strichen sind Deletionen angegeben.
Blau: Invariante Position (identische Aminosurereste in allen drei Sequenzen). Nhere Betrachtung zeigt, dass die Hmoglobin
- und -Ketten nher miteinander verwandt sind als mit Myoglobin.
Grau: Position mit konservativen Substitutionen (verschiedene aber einander hnliche Aminosurereste, d.h. der gleichen
Gruppe gem .Abb.2.4 zugehrig).
Wei: Variable Position (Aminosurereste gehren verschiedenen Gruppen von Aminosuren an)

che von Proteinen (.Abb.2.7) haben ergeben, dass


die Sequenzhnlichkeit eines gegebenen Proteins in
verschiedenen Spezies mit zunehmender phylogenetischer Distanz abnimmt (ermittelt durch pal
ontologische Untersuchungen). Die nderungsgeschwindigkeit bleibt fr ein gegebenes Protein ber
Jahrmillionen ungefhr konstant: Die Proteinuhr
tickt gleichmig. Die nderungsgeschwindigkeit
variiert jedoch von Protein zu Protein (.Tab.2.3).

fen; die fehlende oder mangelhafte Katalyse der


entsprechenden Reaktion fhrt zu einer Stoffwechselkrankheit. Nicht nur defekte Enzyme, sondern
auch andere funktionsuntchtige Proteine sind als
Ursache hereditrer Krankheiten bekannt. Zum
Beispiel liegen ein ungengend funktionierender
Chloridkanal der cystischen Fibrose (Mucoviscidose) und Kollagendefekte gewissen Krankheiten
des Bindegewebes zugrunde.

dermaen verndert werden, dass es seiner biologischen Funktion nicht mehr gengt. Schon der
Austausch eines einzigen Aminosurerests kann
eine vererbbare Krankheit verursachen. Bei vielen
Erbkrankheiten ist ein bestimmtes Enzym betrof-

ist in Position6 ein Glu durch Val ersetzt worden.


Der Austausch des negativ geladenen Glu durch das
hydrophobe Val fhrt zur Aggregation von desoxygeniertem HbS. Es bilden sich HbS-Filamente aus,

Erbkrankheiten sind molekulare Krankheiten


Ein Protein kann durch Mutation seiner DNA

Eine eingehend untersuchte molekulare


Krankheit ist die Sichelzellanmie des Menschen
In der -Kette des Sichelzell-Hmoglobins (HbS)

14
15
16
17
18
19
20

.. Abb.2.7 Phylogenetischer Stammbaum abgeleitet aus Vergleichen der


Cytochrom c-Sequenzen. Die Verzweigungspunkte entsprechen einem
gemeinsamen Vorfahren der daraus
hervorgehenden evolutionren
Linien. Die Zahlen geben die Anzahl
der zwischen den Verzweigungspunkten bzw. den angegebenen Spezies
vorgefundenen Unterschiede in den
Aminosuresequenzen an

27
2.5 Aminosurezusammensetzung und Aminosuresequenzen von Proteinen

.. Tab.2.3 nderungsgeschwindigkeit verschiedener Proteine whrend der Evolution. Ein Protein verhlt sich umso
konservativer je kritischer seine physiologische Funktion ist
Protein

Zeit, in der eine von 100Aminosuren


substituiert wurde (Millionen Jahre)

Funktion des Proteins

Histone (H3 und H4)

300400

Beteiligt an der Packung der DNA im


Chromatin

Cytochrom c

20

Beteiligt an der Atmungskette

Hmoglobin

O2-Transport

Fibrinopeptide

Verhindern Aggregation des Fibrinogens,


werden bei Gerinnung abgespalten, ohne
eine weitere Funktion zu haben

die sich durch den ganzen Erythrozyten erstrecken


und diesen zur Sichelzelle deformieren.
Die Sichelzellen behindern die Blutzirkulation
in den Kapillaren. Gewebeschden durch Hypoxie
sind die Folge. Zudem besteht eine hmolytische
Anmie, da die Lebensdauer der Erythrozyten auf
60Tage, die Hlfte der normalen Lebensdauer, herabgesetzt ist. Homozygote HbS-Kranke sterben
frhzeitig. Heterozygote Trger zeigen eine erhhte
Resistenz gegen Malaria. Aus diesem Grund hat sich
das HbS-Gen im tropischen Afrika und anderen
Malaria-Gebieten verbreitet.

Hufigste Erbkrankheiten
Die hufigsten monogenen (auf Vernderung
eines einzigen Gens zurckzufhrenden) Erbkrankheiten sind der Glucose-6-Phosphat-Dehydrogenase-Mangel (hmolytische Anmie
durch Mangel an reduziertem Glutathion in den
Erythrozyten; Abschn.16.4), die Thalassmie
(Mittelmeeranmie durch fehlerhaftes Spleien
der Globin-Pr-mRNA; Abschn.9.4) und die
Sichelzellanmie.

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514743-0
2.1
2.2
2.3
2.4

Bauprinzip der Proteine


Grsse und Gestalt der Proteine
Aminosuren, die Bausteine der Proteine
Ionisationszustnde von Aminosuren
und Proteinen
2.5 Aminosurezusammensetzung und
Aminosuresequenzen von Proteinen
Weiterfhrende Literatur

29

Raumstruktur der Proteine


Ph. Christen, R. Jaussi, R. Benoit

3.1

Stabilisierung der Raumstruktur 30

3.2

Sekundrstruktur31

3.3

Tertirstruktur31

3.4

uere Gestalt und Quartrstruktur 34

3.5

Dynamik und funktionsgebundene


Strukturnderungen35

3.6

Denaturierung36

3.7

Faltungswege37

3.8

Proteinfehlfaltung38

3.9

Faserproteine39

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_3, Springer-Verlag Berlin Heidelberg 2016

30

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 3 Raumstruktur der Proteine

Proteine sind dreidimensionale Gebilde. Sie sind


nur in ihrer genau definierten gefalteten Form,
der nativen Konformation, biologisch aktiv. Die
3D-Struktur eines Proteins entspricht einem Energieminimum; die Faltung der Polypeptidkette
erfolgt durch spontane Selbstorganisation. Die
3D-Struktur kann durch Rntgen-Kristallanalyse
oder anhand der magnetischen Kernresonanz
(NMR) bestimmt werden. Die in Proteinen erkennbaren strukturellen Muster sind periodische
Sekundrstrukturen (-Helix, -Faltblatt), die aperiodische Tertirstruktur (rumliche Organisation
der gesamten Polypeptidkette) und die Quartrstruktur (Aufbau aus Untereinheiten). Globulre
Proteine haben eine mizellenartige Struktur (innen hydrophob, auen hydrophil) und sind daher
gut wasserlslich, Faserproteine sind dagegen
wasserunlsliche Assoziate. Die Genabschnitte fr
Proteinfaltungseinheiten (Domnen) sind whrend
der Evolution in manchen Fllen verdoppelt worden
und haben nach Rekombination sowie Mutation zu
Proteinen mit neuen Eigenschaften gefhrt. Strukturelle Komplementaritt zwischen der Bindungsstelle von Proteinen und ihren Bindungspartnern
(Liganden) wie RNA, DNA, anderen Proteinen
sowie niedermolekularen Verbindungen fhrt zur
hohen Spezifitt der biologischen Wechselwirkungen zugrunde. Molekulare Chaperone wirken der
Fehlfaltung von Proteinen entgegen. Aggregierende
fehlgefaltete Proteine liegen manchen neurodegenerativen Krankheiten zugrunde.
Native Konformation
Die eindeutig definierte 3D-Struktur, welche
das Protein im lebenden Organismus aufweist
und mit welcher es die gleiche biologische
Aktivitt wie im Organismus besitzt.

3.1 Stabilisierung

der Raumstruktur

Proteine falten spontan zu ihrer nativen 3D-Struktur Der intramolekulare Vorgang kommt zustande

durch Wechselwirkungen zwischen verschiedenen,


in der Sequenz oft weit auseinanderliegenden Abschnitten der Polypeptidkette. An diesen Wech-

selwirkungen sind sowohl die Hauptkette als auch


die Seitenketten beteiligt. Es gibt zwei Gruppen faltungsbestimmender Faktoren:
Stereochemische Eigenschaften der Kette
(Raumbeanspruchung der einzelnen Gruppen,
Drehbarkeit um Bindungen),
Wechselwirkungen zwischen den einzelnen
Kettenabschnitten, welche die Faltung stabilisieren.

Am wichtigsten sind nichtkovalente Sekundrbindungen: Hydrophobe Effekte apolarer Gruppen, H-Bindungen zwischen polaren Gruppen,
Van-der-Waals-Wechselwirkungen, elektrostatische Wechselwirkungen zwischen geladenen
Gruppen. Besonders bei extrazellulren Proteinen
kommen noch intramolekulare Disulfidbrcken
dazu.
Die 3D-Struktur wird bestimmt durch das Zusammenspiel von zwei entgegengesetzten Tendenzen Die Hauptkette mit ihrer regelmigen
Struktur frdert die Tendenz zu regelmigen
Faltungsmustern, whrend die Seitenketten mit
ihren unregelmigen Strukturen fr unregelmige Faltungsmuster verantwortlich sind. Die Proteinstruktur ist hierarchisch organisiert:
Definition

Verantwortliche
Wechselwirkungen

Primrstruktur

Aminosure
sequenz

Peptidbindungen

Sekundrstruktur

Abschnitte regelmiger Faltung


(-Helix, -Faltblatt,
-Schleife)

Wasserstoffbindungen
zwischen Amidgruppen der Hauptkette

Tertirstruktur

Rumliche Gesamtstruktur einer


Polypeptidkette
bestehend aus
Sekundrstruktur
elementen und
unregelmig
gefalteten Abschnitten

Hydrophobe Effekte,
Wasserstoffbindungen
zwischen:
Amidgruppen der
Hauptkette
Amidgruppen der
Hauptkette und
polaren Gruppen
von Seitenketten
polaren Gruppen
von Seitenketten
Salzbindungen
zwischen geladenen
Gruppen*
Disulfidbrcken*
(* nicht in allen Proteinen vorkommend)

31
3.3Tertirstruktur

Definition

Verantwortliche
Wechselwirkungen

Domne

Globulr gefalteter
Abschnitt einer
lngeren Polypeptidkette; faltet sich
i.d.R. unabhngig
von den weiteren
Domnen des
Proteins. Oft Trger
einer bestimmten
Funktion

Gleiche Wechselwirkungen wie fr


Tertirstruktur

Quartrstruktur

Zusammenlagerung von zwei oder


mehr Polypeptidketten (Untereinheiten) mit eigener
Tertirstruktur zu
einem stabilen
oligomeren Proteinmolekl

Gleiche Wechselwirkungen wie


fr Tertirstruktur

3.2 Sekundrstruktur
Die Peptidbindung ist ein planares Resonanzsystem Die Geometrie der Peptidbindung und

deren chemische Eigenschaften bestimmen die


Ausbildung von Sekundrstrukturen. Die Peptidbindung (Amidbindung) kann durch zwei mesomere Grenzstrukturen beschrieben werden. Sowohl
O-Bindung als auch die C
N-Bindung entdie C
sprechen partiellen Doppelbindungen; die Peptidbindung ist ein Resonanzhybrid:

Sterische Konsequenz: Durch den partiellen


N-Bindung
Doppelbindungscharakter der C
wird deren freie Drehbarkeit eingeschrnkt.
Die Peptidbindung wird planar. Die Peptidkette kann als eine Reihe planarer Strukturen,
welche durch substituierte Methylengruppen
(-CHR-) voneinander getrennt sind, beschrieben werden (.Abb.3.1).
Chemische Konsequenz: Die Elektronendelokalisation fhrt zu Partialladungen am O- und

.. Abb.3.1 Geometrie der Peptidbindung. Freie Drehbarkeit


besteht nur um die mit Pfeilen bezeichneten Einfachbindungen. Alle sechs Atome liegen in der gleichen Ebene. NC
gibt die Richtung der Peptidkette vom Aminoende (N) zum
Carboxylende (C) an. Die Seitenketten sind mit R bezeichnet

N-Atom der Peptidbindung. Das partiell negativ geladene O-Atom wird zum nucleophilen
H-Akzeptor mit erhhter Tendenz, H-Bindungen einzugehen. Das partiell positiv geladene
N-Atom wird weniger nucleophil und damit
zum H-Donor.
Die -Helix und das -Faltblatt sind die wichtigsten Sekundrstrukturen Beide Strukturen

entsprechen folgenden Bedingungen: Planaritt


der Peptidbindung, maximale Anzahl von H-Bindungen zwischen den Amidbindungen (eine
H-Bindung pro Aminosurerest) sowie optimale
Lngen und Winkel fr H-Bindungen. -Helices
(.Abb.3.2) und -Faltbltter (.Abb.3.3) kommen
sowohl in globulren Proteinen als auch in Faserproteinen vor. Sterische Konflikte von Seitenketten
oder Hauptkette fhren zum Abbruch der regelmigen Struktur.

Weitere Sekundrstrukturen haben besondere strukturelle Aufgaben Die -Schleife


(-Turn) kommt in kompakten globulren Proteinen

bei Richtungsnderungen der Polypeptidkette um


fast 180 vor (.Abb.3.4). Neben der -Helix finden
sich in Proteinen die -Helix und die Kollagen-Tripelhelix (Abschn.3.9).
3.3 Tertirstruktur

Als Tertirstruktur wird die rumliche Anordnung


der gesamten Polypeptidkette bezeichnet. Sie wird
stabilisiert durch Wechselwirkungen zwischen Ami-

Kapitel 3 Raumstruktur der Proteine

32

C
O

R1

R2

3
R3

4
5

R4

nosureresten, die in der Sequenz weit voneinander


entfernt sein knnen.

R5

R6

R7

R8

10
R9

11

R10

12
R11

13

R2
R5

16
17
18

C
R1

C
C

19
20

R4

Information ber die Tertirstruktur lsst sich


nur durch experimentelle Messungen gewinnen

Die Raumstruktur lsst sich derzeit nicht aus der


Aminosuresequenz ableiten; die Wechselwirkungen der Seitenketten sind zu komplex, um rechnerisch gnzlich erfasst zu werden. Die umfassendste
Methode zur Bestimmung der Raumstruktur ist die
Rntgenkristallographie. Die Struktur kleinerer
Proteine lsst sich auch durch Messung der magnetischen Kernresonanz (NMR, Nuclear magnetic
resonance) bestimmen (Abschn.38.2, 38.3). Die
mit der Rntgenkristallanalyse theoretisch erreichbare Auflsung liegt bei 0,1nm (1 ) und lsst die
Position einzelner Atome ermitteln. Anhand zahlreicher Proteine konnte gezeigt werden, dass die
durch Kristallanalyse ermittelte Struktur derjenigen
in Lsung sehr hnlich ist.
Gewisse Bauprinzipien sind allen globulren
Proteinen gemeinsam Die Gesamtfaltung der Polypeptidkette globulrer Proteine (Tertirstruktur)
ist meist hochgradig aperiodisch.

14
15

.. Abb.3.2 -Helix. Die Peptidkette ist schraubenartig (helical)


rechtshndig (rechtsgngig) aufgewunden. Bei einer rechtshndigen Helix windet sich die Polypeptidkette, wenn lngs
der Helixachse in NC-Richtung gesehen (im Bild von oben
nach unten), im Uhrzeigersinn um die Schraubenachse (kleines
Bild). Die H-Bindungen innerhalb der -Helix stehen annhernd
parallel zur Helixachse. Die CO-Gruppe des Aminosurerests i
bildet jeweils eine H-Bindung mit der NH-Gruppe des Rests i+4.
Die Ebenen der Peptidbindungen sind parallel zur Lngsachse
der Helix angeordnet. Die Helix bildet eine kantige Struktur mit
den C-Atomen in den Ecken (kleines Bild). Auf eine Windung
kommen 3,6Aminosurereste. Die Ganghhe ist 0,54nm (5,4).
Die Seitenketten (R1R5) sind radial nach auen orientiert. Die
gegenseitige sterische Behinderung ist dadurch minimiert

R3

Unter den Aminosuren gibt es Helix-Bildner


und Helix-Brecher bzw. Faltblatt-Bildner und
Faltblatt-Brecher. Insbesondere Prolin mit seiner
sekundren Aminogruppe unterbricht regelmige
Kettenkonformationen (.Abb.3.5). Die Packungsdichte im Inneren von Proteinmoleklen ist sehr
hoch; etwa des Gesamtvolumens werden durch
Atome des Proteins mit ihren Van-der-Waals-Radien eingenommen (.Abb.3.6). Nur sehr wenige
H2O-Molekle sind im Innern von Proteinen zu
finden. Auf der Auenseite der Proteinmolekle
finden sich bevorzugt polare, hydrophile Aminosurereste, die mit Wassermoleklen interagieren

33
3.3Tertirstruktur

i+3

i+2

i+1
i
.. Abb.3.4 -Schleife. Die CO-Gruppe des Restes i eines Polypeptids bildet eine H-Bindung zur NH-Gruppe des Restes i+3.
Die Peptidkette ndert dadurch ihre Richtung um fast 180

.. Abb.3.3 -Faltblatt. Ein -Faltblatt entsteht durch Aneinanderlagern mehrerer Polypeptidketten oder verschiedener
Abschnitte einer Kette. NC und C N geben die Richtung
der Peptidkette an. Die fast vollstndig gestreckten Peptidketten sind antiparallel () oder parallel () angeordnet. Die
H-Bindungen zwischen den verschiedenen Ketten stehen
senkrecht zur Kettenrichtung. Zwischen zwei Ketten besteht
pro Aminosurerest eine H-Bindung. Die planaren Amidgruppen (Peptidbindungen) der Strnge bilden eine Zickzack-Ebene, ein Faltblatt. Die Seitenketten befinden sich alternierend
ber oder unter der Faltblattebene; sie sind hier weggelassen

und verantwortlich sind fr die gute Wasserlslichkeit globulrer Proteine (Abschn.1.4). Die apolaren, hydrophoben Aminosurereste hingegen
vermeiden den Kontakt mit Wasser (hydrophober
Effekt) und finden sich vorwiegend im Innern des
Proteins. Der Kompromiss beider Tendenzen fhrt
zur mizellenhnlichen Raumstruktur der Proteine
(.Abb.3.6).
In der gesamten Biosphre kommen schtzungsweise 100010000 verschiedene Faltungs-

.. Abb.3.5 Prolinrest in Peptidkette: Seitenkette und Hauptkette bilden eine kovalente Ringstruktur. Die Drehbarkeit
um die N-C-Bindung ist dadurch aufgehoben und das
N-Atom kann keine H-Bindung eingehen. Dadurch bildet
ein Prolinrest eine ausreichende (aber nicht notwendige)
Voraussetzung fr den Abbruch einer regelmigen Struktur.
Tatschlich findet sich in der Tertirstruktur von Proteinen
hufig am Ende von Helixabschnitten und -Strngen ein
Prolinrest. Das Gleichgewicht einer X-Pro-Bindung in einem
Peptid ohne definierte Konformation liegt bei 80% des
trans-Isomers. In manchen Proteinen liegen jedoch einige der
X-Pro-Bindungen permanent in der cis-Form vor. R bezeichnet
C der benachbarten Aminosurereste

muster von Proteinen vor (die Zahl der Folds hngt


von den angewandten Differenzierungskriterien
ab); auf jeden Fall ist die Anzahl der Faltungsmuster
wesentlich kleiner als die Anzahl der Proteine mit
verschiedener Funktion. Gewisse Faltungsmuster
sind weit verbreitet und werden bei Proteinen angetroffen, die ganz verschiedene Funktionen erfllen
und in Sequenzvergleichen keinerlei hnlichkeit
erkennen lassen.
Hydrophobe Effekte stabilisieren die 3D-Struktur von Proteinen Hydrophobe Effekte tragen am

meisten zur Stabilisierung der rumlichen Struktur

34

Kapitel 3 Raumstruktur der Proteine

Grere Proteine sind aus Domnen aufgebaut Polypeptide mit mehr als200Aminosu-

reresten falten meist in zwei oder mehrere voneinander unabhngige Faltungseinheiten, in Domnen.
Hufig knnen Multidomnen-Proteine durch limitierte Proteolyse in Domnen zerlegt werden,
ohne den Faltungsmodus der einzelnen Domnen
wesentlich zu verndern. In manchen Fllen haben die verschiedenen Domnen eines Proteins
verschiedene Funktionen. Im Laufe der Evolution
scheinen viele Proteine modular aus verschiedenen
Domnen aufgebaut worden zu sein.

2
3
4
5
6

3.4

7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.3.6 Schnitt durch ein Proteinmolekl. Drei im


Abstand von 0,1nm aufeinanderfolgende Schnitte mitten
durch Flavodoxin sind gezeigt (Flavodoxin ist ein elektronenbertragendes Protein stickstofffixierender Bakterien
von 20kDa). Zwei Strukturmerkmale sind ersichtlich: die
dichte Packung der Polypeptidkette im Innern des Proteins,
die nur fr einzelne Wassermolekle Platz lsst, und das
apolare Innere (apolare Aminosurereste in Blau) umgeben
von einer polaren Hlle (polare Aminosurereste in Grau).
Die prosthetische Gruppe Flavinmononucleotid (FMN) ist
gestrichelt angegeben

der Proteine bei. Als ungerichtete Krfte bestimmen sie jedoch nur in geringem Mae den Faltungsmodus der Polypeptidkette.
Die H-Bindungen hingegen sind gerichtete
Krfte und damit die wichtigsten strukturbestimmenden Wechselwirkungen. Alle polaren Gruppen
von Hauptkette und Seitenketten im Proteininnern
sind in H-Bindungen einbezogen. Zur Stabilisierung der Proteinstruktur tragen H-Bindungen
hingegen wenig bei: In der ungefalteten Polypeptidkette bilden die polaren Gruppen H-Bindungen
mit H2O-Moleklen, und die Go-Werte fr die
Bildung einer H-Bindung mit einem H2O-Molekl
und mit einer polaren Gruppe im gefalteten Protein
sind etwa gleich. Hingegen wrde das Fehlen einer
H-Bindung einer polaren Gruppe im Innern des
gefalteten Proteins die Struktur des Proteins destabilisieren. Fr die Stabilitt des Proteins ist es daher
wichtig, dass alle diese Gruppen in intramolekularen H-Bindungen engagiert sind.

uere Gestalt
und Quartrstruktur

Strukturelle Komplementaritt fhrt zu biologischer Spezifitt Ein gegebenes Protein bindet

aufgrund seiner spezifischen Oberflchenbeschaffenheit selektiv nur diejenigen Molekle, welche


przis in seine Liganden-Bindungsstelle passen.
Die intermolekularen Krfte sind schwach und von
geringer Reichweite. Nur bei struktureller Komplementaritt knnen diese schwachen Krfte zusammenwirken und zu einer starken, spezifischen
Bindung zwischen Protein und Ligand fhren
(.Abb.1.3). Strukturelle Komplementaritt ist
die Grundlage fr die molekulare Arbeitsteilung
und damit fr die supramolekulare und zellulre
Spezialisierung. Das Beibehalten der Tertirstruktur im Verlauf der Evolution der einzelnen Proteine
beruht auf der Invarianz oder der konservativen
Substitution der Aminosurereste (.Abb.2.6),
welche die Struktur und Funktion des Proteins
bestimmen.
Die meisten Proteine bestehen aus mehreren
Untereinheiten Man unterscheidet zwei Typen
solcher Assoziate: Viele globulre Proteine sind

Oligomere aus wenigen Untereinheiten (Dimer,


Tetramer), die ein geschlossenes Assoziat bilden. Voraussetzung fr die Bildung oligomerer
Proteine sind rumlich komplementre Kontaktflchen. Quartrstrukturen entstehen durch Selbst
organisation; die Untereinheiten werden durch
Sekundrbindungen zusammengehalten (hydrophobe Effekte, H-Bindungen, elektrostatische
Wechselwirkungen; Disulfidbrcken nur in ein-

35
3.5 Dynamik und funktionsgebundene Strukturnderungen

zelnen Fllen). Am wichtigsten sind die hydrophoben Effekte. Das Hmoglobin zum Beispiel ist ein
()2 Tetramer aus zwei Paaren von Untereinheiten
hnlicher Tertirstruktur. Die Kontaktflchen der
Untereinheiten sind abgesttigt, sobald sie sich zu
einem Tetramer zusammengeschlossen haben. Das
monomere Myoglobin besitzt dagegen eine durchgehend polare Hlle.

In der Zelle bilden Proteine groe funktionelle


Komplexe Eine Eukaryontenzelle synthetisiert

etwa 10000 verschiedene Proteine in unterschiedlicher Kopienzahl und enthlt insgesamt ungefhr
109Proteinmolekle. Die meisten Proteinmolekle
sind in nichtkovalente Komplexe mit anderen Proteinmoleklen engagiert. Die Gre der funktionellen Proteinkomplexe ist variabel und wird im
Durchschnitt auf etwa 10 Proteine pro Komplex
geschtzt. Grere Komplexe sind beispielsweise
die Proteasomen mit mindestens 64Proteinmoleklen oder die eukaryontischen Ribosomen mit etwa
85Proteinmoleklen sowie 4rRNA-Moleklen.
Faserproteine (fibrillre Proteine) bilden
wasserunlsliche polymere Assoziate, die aus vielen Ketten bestehen. Die Assoziierung der Fasern
sttigt die Kontaktflchen nicht ab: Es bildet sich
ein offenes Assoziat, dessen Gre nicht genau
definiert ist.

3.5 Dynamik

und funktionsgebundene
Strukturnderungen

Proteine sind dynamische Strukturen Teile des

Gesamtproteins, d.h. einzelne Atome, Gruppen,


Aminosurereste, Schlaufen der Polypeptidkette
und auch grere Teile wie Domnen, bewegen
sich innerhalb sehr enger Grenzen im Picosekunden-Bereich (1ps=1012s). Ausgehend von der
3D-Struktur knnen mit aufwndigen Computer-untersttzten Rechnungen die Bewegungen aller Atome eines Makromolekls ermittelt werden
(Molekldynamik). Die durch Rntgenkristallanalyse bestimmte Struktur eines Proteins entspricht
einer ber die Zeit gemittelten Struktur, die angibt,
in welcher Position sich dessen Atome bevorzugt
aufhalten (.Abb.38.3).
Proteine knnen ihre Konformation ndern

Viele Proteine ndern ihre Struktur innerhalb


festgelegter Grenzen bei der Erfllung ihrer Funktion. Das Protein geht dabei von einer definierten
Struktur in eine andere definierte Struktur ber.
Bei manchen Enzymen lst das Binden des Substrats eine Konformationsnderung aus. Hufig
bewegen sich dabei zwei Domnen um ein verbindendes scharnierartiges Gelenk und schlieen
die Furche der aktiven Stelle. Liganden-induzierte
Konformationsnderungen regulieren die Aktivitt von Enzymen und anderen Proteinen, sie
liegen auch der biologischen Signalbermittlung
zugrunde.
Konformationsnderung
nderung der Struktur durch Drehung bestimmter Gruppen um Bindungsachsen ohne
nderung der kovalenten Struktur.

Auch unstrukturierte Proteine und Domnen


kommen in der Natur vor (Intrinsically disordered proteins) Der betreffende Abschnitt der Po-

Faserprotein

lypeptidkette faltet sich erst zu einer definierten


3D-Struktur, wenn das Protein mit einem anderen
Protein oder auch einer Nucleinsure in spezifische Wechselwirkung tritt. Beispielsweise nehmen
einige Transkriptionsfaktoren erst beim Binden an
die DNA eine bestimmte geordnete Struktur an.

Kapitel 3 Raumstruktur der Proteine

36

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.3.7 Reversible Denaturierung eines Proteins. Bei der Renaturierung faltet sich die Polypeptidkette in die native Konformation zurck, so dass sich wieder die richtigen Disulfidbindungen bilden knnen. Bei oligomeren Proteinen wird sich auch
die Quartrstruktur spontan zurckbilden. Die Primrstruktur eines Proteins enthlt offenbar alle Informationen zur Ausbildung
der nativen 3D-Struktur. Christian Anfinsen publizierte 1961 dieses klassische Experiment der Proteinchemie

3.6 Denaturierung

Von den funktionsgebundenen Konformationsnderungen sind weitergehende Strukturnderungen zu unterscheiden, welche durch unspezifische
uere Einflsse hervorgerufen werden und zum
Verlust der nativen Konformation fhren. Die
meisten globulren Proteine sind nicht sehr stabil.
Die freie Energie, die zur Aufhebung der definierten
3D-Struktur einer Domne von 150Aminosureresten notwendig ist, betrgt nur 0,10,4kJ/mol pro
Aminosurerest, d.h. 1560kJ/mol fr die ganze
Domne (Energiewerte der Sekundrbindungen;
.Tab.1.2).
Ein Protein denaturiert, sobald die native Konformation nicht mehr die stabilste ist, d.h. unter
Bedingungen, die entweder die destabilisierenden Krfte verstrken oder die stabilisierenden
Effekte schwchen:
Hitzeeinwirkung: Die verstrkte thermische

Bewegung von Teilen des Proteins lst die


stabilisierenden Sekundrbindungen (Beispiel:
Gerinnung von Hhnereiwei beim Kochen).
Organische Lsungsmittel (z.B. Aceton, Ethanol) und Detergenzien (z.B. Seifen, Dodecylsulfat) lagern sich an hydrophobe Seitenketten
und interferieren mit den proteinstabilisierenden hydrophoben Effekten.
Extreme pH-Werte (Suren, Basen) verndern
den Ladungszustand ionisierbarer Gruppen und
damit deren H-Bindungen und Salzbindungen.

Harnstoff und Guanidiniumsalze in hoher


Konzentration (8M bzw. 6M) kompetieren als polare Substanzen mit den polaren
Gruppen des Proteins um die Bildung von
H-Bindungen; zudem stren die beiden
Denaturierungsmittel die geordnete Wasserstruktur und vermindern dadurch hydrophobe Effekte.
Kontakt mit Grenzflchen kann durch
Spreiten der Proteinmolekle ebenfalls deren
Denaturierung bewirken (Beispiel: Die Haut
auf erhitzter Milch besteht aus denaturierten
Milchproteinen).

Die Denaturierung von Proteinen ist oft reversibel Die native Struktur kann sich spontan zurck-

bilden, sobald die Bedingungen wiederhergestellt


sind, unter denen die native Form die stabilste ist
(.Abb.3.7).

Bei der Denaturierung geht der geordnete


biologisch aktive Faltungsmodus in ungeordnete, biologisch inaktive Faltungsformen ber
Das Ausma der Strukturnderung variiert

stark von Protein zu Protein und ist abhngig von


den Denaturierungsbedingungen. Im Extremfall
kommt es zur vlligen Entfaltung der Kette. Wenn
ein Protein keine definierte rumliche Organisation mehr aufweist, spricht man von einem Zufallsknuel (statistisches Knuel, Random coil),
das eine unendliche Anzahl isomerer Formen aufweist.

37
3.7Faltungswege

Die Denaturierung hat wichtige Konsequenzen:


Verlust der biologischen Aktivitt: Ein

Protein ist nur in seiner nativen Konformation


aktiv.
Herabgesetzte Lslichkeit: Die Denaturierung hebt die mizellre Struktur des Proteins
auf. Hydrophobe Segmente der Polypeptidkette werden exponiert und fhren zur
Bildung intermolekularer Aggregate. Denaturierte Proteine fallen deswegen hufig aus.
Erhhte Empfindlichkeit gegen Proteasen:
Eine denaturierte Polypeptidkette kann leichter in die aktive Stelle eines eiweispaltenden
Enzyms eingepasst werden.

Die Proteindenaturierung ist von physiologischer


und praktischer Bedeutung Die Labilitt dena-

turierter Proteine gegenber proteolytischen Enzymen ist wichtig fr den fortwhrenden Umsatz von
Zellproteinen. Die Denaturierung der Nahrungsproteine durch Kochen oder Braten sowie durch
die Salzsure im Magensaft erleichtert deren Verdauung. Bei der Sterilisation und der Anwendung
gewisser Desinfektionsmittel werden Mikroorganismen abgettet durch Denaturierung ihrer Proteine
und Zerstrung ihrer Membranen.
3.7 Faltungswege

Wie erlangen Polypeptidketten ihre native


3D-Struktur? Untersuchungen der Faltung naszierender Polypeptidketten in der Zelle wie auch von
renaturierenden isolierten Proteinen im Reagenzglas zeigten, dass der Weg zum gefalteten Protein
ber bestimmte Zwischenstufen fhrt. Der spezifische Faltungsweg eines Proteins kommt dadurch
zustande, dass nur ein Teil der zunchst entstehenden Teilstrukturen stabil genug ist, um zu berdauern, bis sich durch Bildung weiterer Teilstrukturen die stabile Gesamtstruktur ausbilden kann.
Die Bildung von Teilstrukturen mit einer gewissen
Stabilitt schrnkt die Zahl der mglichen Konformationen whrend des Faltungsvorgangs rasch
ein. Bei der Renaturierung vollstndig denaturierter Proteine sind als Zwischenprodukte die Molten

globules zu beobachten. In diesen geschmolze-

nen globulren Proteinformen haben sich die Sekundrstrukturelemente (-Helices, -Faltbltter)


innerhalb von Millisekunden bereits ausgebildet,
doch ist deren gegenseitige Anordnung noch nicht
fixiert. Kleinere Proteine und Domnen knnen
ihre native 3D-Struktur innerhalb von Millisekunden bis Sekunden erlangen.

Besondere Enzyme und molekulare Chaperone untersttzen die in-vivo Faltung von
Proteinen Die Protein-Disulfidisomerase kata-

lysiert die Verschiebung von Disulfidbindungen


in einem Proteinmolekl, so dass sich diejenigen
Disulfidbrcken beschleunigt bilden, welche der
nativen 3D-Struktur des Proteins entsprechen.
Die Peptidyl-Prolylisomerase beschleunigt die
cis-trans-Isomerisierung von Peptidbindungen, in
welche Prolinreste einbezogen sind (.Abb.3.5).
Cyclosporin und Cyclophilin
Das Immunsuppressivum Cyclosporin ist ein
Inhibitor der Peptidyl-Prolylisomerase, die
auch als Cyclophilin bezeichnet wird. Die immunsuppressive Wirkung ist jedoch nicht auf
die Hemmung dieses Enzyms zurckzufhren;
der Cyclophilin-Cyclosporin-Komplex hemmt
indirekt die Aktivierung von T-Lymphozyten.

Molekulare Chaperone (Hitzeschockproteine) un-

tersttzen die Proteinfaltung. Sie binden vorbergehend kurze apolare Segmente noch nicht gefalteter
oder teilweise wieder entfalteter Polypeptidketten
und verhindern deren Aggregation. Gewisse Chaperone besitzen Disaggrease-Aktivitt und entwirren
fehlgefaltete und aggregierte Proteinmolekle. Das
Chaperonsystem der Zelle schtzt deren Proteine
gegen Stressbedingungen (erhhte Temperatur, reaktive Sauerstoffderivate, O2-Mangel, ionisierende
Strahlung, Schwermetalle). Chaperone sind auch
an der aktiven Translokation von Proteinen durch
Membranen beteiligt. Die meisten Chaperone verbrauchen ATP bei der Ausbung ihrer Funktion.
Zu den molekularen Chaperonen gehren die Hitzeschockproteine70 (Hsp70 mit 70kDa), Hsp90
(neben Chaperonfunktion auch Teil des Steroidrezeptors; Abschn.27.5) und Hsp100.

38

Kapitel 3 Raumstruktur der Proteine

.. Tab.3.1 Proteinfehlfaltungskrankheiten mit


Funktionsverlust des mutierten Proteins

Krankheit

Betroffenes Protein

Cystische Fibrose (Strung des Chloridtransports in Epithelzellen)

Protein eines Chloridkanals (meist Deletion


von Phe508; autosomal-
rezessiv)

Marfan-Syndrom
(Bindegewebskrankheit,
besonders elastische
Fasern betroffen)

Fibrillin (diverse Mutationen; autosomal-dominant)

Morbus Gaucher (die


hufigste lysosomale
Speicherkrankheit)

Glucosylceramidase
(>400Mutationen bekannt; autosomal-rezessiv)

4
5
6
7
8
9
10
11
12
13
14
15
16
17
18

Terminologie
Chaperon (frz.): In vergangenen Zeiten eine
erwachsene Person, welche junge Leute bei
gesellschaftlichen Anlssen begleitete, um
unerwnschte Kontakte zu verhindern.
Hitzeschockproteine Hsp: Auch als Stress
proteine bezeichnet; werden bei Hitze oder
anderen zellschdigenden Einwirkungen durch
erhhte Transkription vermehrt gebildet; sind
zum grten Teil auch unter Normalbedingungen als molekulare Chaperone wirksam.

Die Chaperonine bilden einen Behlter aus zwei


heptameren Ringen von Hsp60, in welchem partiell gefaltete kleinere Proteine oder Domnen vor
Wechselwirkungen mit apolaren Segmenten anderer Polypeptidketten geschtzt sind und korrekt
falten knnen.
Falls sich Proteinmolekle auch mit Hilfe der
Chaperone nicht korrekt falten (etwa 30% der
neusynthetisierten Proteinmolekle zumeist aufgrund von Transkriptions- oder Translationsfehlern), werden sie gezielt durch Proteasomen abgebaut (Abschn.18.1).

19

3.8 Proteinfehlfaltung

20

Die Fehlfaltung gewisser Proteine kann Krankheiten verursachen Bei manchen Erbkrankhei-

ten fhrt eine mutationsbedingte Deletion oder


Substitution eines Aminosurerests zu Fehlfaltung und raschem Abbau des betroffenen Proteins
(.Tab.3.1).

Bei Amyloidosen bilden fehlgefaltete Proteine unlsliche Aggregate Bei einer Reihe

wichtiger Krankheiten sind die Chaperone und


der zellulre Mechanismus zum gezielten Abbau
fehlgefalteter Proteine offensichtlich berfordert.
Gewisse fehlgefaltete Proteine lagern sich zu Fibrillen mit -Faltblatt-Struktur und diese zu greren
Aggregaten zusammen. Die zumeist extrazellulren Aggregate werden als Amyloid bezeichnet, da
sie sich mit Iod hnlich wie Strkekrner frben
(amylum lat., Strke). Unter besonderen experimentellen Bedingungen nehmen viele Proteine
-Faltblattstruktur an und bilden Amyloid. Die
Krankheiten mit Amyloidablagerungen (Plaques)
werden in systemische (mehrere Organe betreffend) und lokalisierte Amyloidosen eingeteilt.
Beispiele systemischer Amyloidosen sind die Amyloid-A-Amyloidose (Ablagerung von Akute-Phase-Proteinen bei chronischen entzndlich-rheumatischen Erkrankungen, die L-Ketten-Amyloidose
(Ablagerung im berschuss produzierter L-Ketten
von Immunglobulin; Abschn.32.4) oder die familir auftretende Amyloidose mit Transthyretin,
einem Transportprotein im Blut fr Schilddrsenhormone und Retinol.
Bei neurodegenerativen Krankheiten ist die
Amyloidablagerung auf gewisse Regionen des
Zentralnervensystems begrenzt Diese Krank-

heiten des Gehirns oder Rckenmarks entstehen


offenbar nicht durch den Aktivittsverlust eines
Proteins sondern eher durch die zellschdigende
Wirkung aggregierter fehlgefalteter Proteinmolekle. Die Krankheiten schreiten unaufhaltsam fort;
die Patienten knnen derzeit nur symptomatisch
behandelt werden (.Tab.3.2). Die Frage, wie aggregierte Proteine die Zellen schdigen, ist noch
ungelst. Mglicherweise schdigen die Proteinaggregate bestimmte Zellbestandteile wie Membranen
oder Mitochondrien.
Prionkrankheiten sind bertragbare Proteinfehlfaltungskrankheiten Fehlgefaltetes

Prionprotein, ein hydrophobes Membranglykoprotein mit 208Aminosureresten, fhrt zu den


Prionkrankheiten wie Scrapie bei Schafen, der

39
3.9Faserproteine

.. Tab.3.2 Neurodegenerative Krankheiten mit Amyloidbildung


Krankheit

Betroffene Zellen

Amyloid-bildendes Protein

Alzheimer-Krankheit (hufigste Ursache


einer Demenz)

Cholinerge Neuronen

-Amyloid (A42, Teil des Amyloid-


Vorluferproteins), tau()-Protein
(ein mikrotubuli-assoziiertes Protein;
Abschn.23.2)

Parkinson-Krankheit mit Lewy-


Krperchen

Dopaminerge Neuronen

-Synuclein, Ubiquitin und weitere


Proteine

Amyotrophe Lateralsklerose (seltene,


familire, autosomal-dominante Form)

Motoneuronen

Superoxiddismutase und andere Proteine

Huntington-Krankheit
(autosomal-dominant)

Neuronen in Basalganglien
und Cortex

Huntingtin mit zu langen Polyglutamin-


Repeats (>40Gln)

Creutzfeld-Jakob-Krankheit (seltene, familire, autosomal-dominante Formen)

Neuronen

Prionprotein (Gendefekt)

bovinen spongiformen Enzephalopathie (BSE,


Rinderwahnsinn) und der bertragbaren Form
der Creutzfeldt-Jakob-Krankheit des Menschen.
Aggregate fehlgefalteter Prionmolekle wirken als
Erreger: Sie veranlassen nach Infektion eines Organismus weitere Prionmolekle, ebenfalls eine
ausgedehnte -Faltblattstruktur anzunehmen und
weiter zu Fibrillen und amyloiden Plaques zu aggregieren. Das bertragende Agens wird als Prion
(Pri-on Proteinaceous infectious particle) bezeichnet
(Abschn.12.4).
3.9 Faserproteine

Die langen Polypeptidketten der Faserproteine


zeigen viel Sekundrstruktur und wenig Tertirstruktur. Sie sind Teil der Gerstwerke, die Zellen,
Gewebe und Organismen zusammenhalten. Die
Lngsachsen der Faserproteine verlaufen annhernd parallel in Faserrichtung. Die 3D-Strukturen
der Faserproteine sind nicht so gut bekannt wie diejenigen der globulren Proteine, da Faserproteine
nicht kristallisiert werden knnen.

Die Hautanhnge hherer Vertebraten, wie


Haare, Ngel, Hufe und Hrner bestehen aus
-Keratin Das Grundelement dieses Faserproteins

besteht aus zwei -Helices, welche sich schraubenartig umeinander winden (Coiled coil, Doppelwendel; .Abb.3.8; vgl. Leucin-Zipper, Abschn.11.2).
Die einzelnen Dimere assoziieren ber ihre glo-

bulren Kopfdomnen zu Protofilamenten; die


Protofilamente bilden Mikrofibrillen, welche zu
Makrofibrillen zusammentreten, die ihrerseits die
(abgestorbenen) Haarzellen ausfllen. Zahlreiche
Disulfidbrcken verbinden die Coiled coils in den
Protofilamenten und Mikrofibrillen. Diese kovalenten Vernetzungen liegen der Unlslichkeit und der
Reifestigkeit von -Keratin zugrunde.
Dauerwellen
Bei der Bildung von Dauerwellen werden
die Disulfidbrcken im -Keratin des Haars
zunchst reduktiv gespalten. Darauf wird das
Haar mechanisch verformt, z.B. in Locken
aufgerollt. Die nachfolgende Wiederherstellung oxidativer Bedingungen fhrt zur Bildung
neuer Disulfidbrcken, welche die Locken
stabilisieren.

Bei feuchter Hitze und unter Spaltung nur weniger


Disulfidbrcken knnen -Keratinfasern auf mehr
als das Doppelte ihrer Lnge gestreckt werden. Die
-Helices gehen dabei in eine -Faltblattstruktur
ber. -Keratin, wie es z.B. in Vogelfedern zu finden
ist, zeigt schon in seiner nativen Form -Struktur.
Seidenfibroin, das Protein der von Insekten und
Spinnen produzierten Seide besteht aus antiparallelen -Faltblttern. In der Aminosuresequenz findet
sich hufig die Hexamer-Wiederholung (Gly-SerGly-Ala-Gly-Ala).

40

1
2
3
4
5
6

Kapitel 3 Raumstruktur der Proteine

.. Abb.3.8 Coiled coil: Zwei -Helices sind umeinander


gewickelt und bilden eine Doppelschraube. aDie Doppelschraubenstruktur ergibt sich aus der Aminosuresequenz
des -Keratins. In einer repetitiven Struktur von sieben Resten
a-b-c-d-e-f-g finden sich in Positionen a und d vorwiegend
apolare Reste (amphipathische -Helix: eine Seite apolar, andere Seite polar). Bei der Bildung einer -Helix (mit 3,6Resten
pro Windung) finden sich die apolaren Reste in jeder zweiten
Windung auf der gleichen Seite der Helix bereinander aufgereiht. bDer sich dabei ergebende hydrophobe Lngsstreifen
assoziiert mit dem hydrophoben Streifen einer zweiten -Helix der gleicher Art, indem sich die hydrophoben Seitenketten
reiverschlussartig ineinander verzahnen (Leucine zipper). Die
kleine Diskrepanz von (3+4) /2=3,5Resten der durchschnittlichen Position der apolaren Reste mit den 3,6Resten pro
Windung der -Helix fhrt dazu, dass die zwei -Helices nicht
in gestreckter Form, sondern als Doppelschraube assoziieren

7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.3.9Ausschnitt
aus einer elastischen
Faser. Quervernetzungen
sind in Blau angegeben.
Unter mechanischem Zug
kommen apolare Regionen der Polypeptidketten
in Kontakt mit Wasser. Bei
Nachlassen des Zuges
relaxiert die Faser in den
energetisch gnstigeren,
verkrzten Zustand

41
3.9Faserproteine

Kollagen ist bei Vertebraten das am hufigsten vorkommende Protein Es ist im Extrazellu-

lrraum aller Gewebe zu finden als Teil des Bindegewebes (Abschn.30.6). Ein Einzelmolekl des
Kollagens besteht aus drei Polypeptidketten, welche
je eine steile Helix bilden und sich zu einer nur im
Kollagen zu findenden Superhelix, der Kollagen-Tripelhelix, umeinander winden (.Abb.2.3).
Die elastischen Fasern des Bindegewebes bestehen aus Elastin und Fibrillin Elastische Fasern

finden sich besonders reichlich im Lungengewebe,


den Wnden der groen Arterien und im Nackenband von Wiederkuern. Sie sind aufgebaut aus einem Gerst von Fibrillin-Mikrofibrillen und darin
eingelagertem Elastin. Die Aminosuresequenz des
Elastins ist wie beim Kollagen (Abschn.30.6) sehr
typisch: ein Drittel Glycin, ber ein Drittel hydrophobe Aminosuren (Ala, Val, Leu, Ile) und viel
Pro, sehr wenig Hydroxy-Pro, kein Hydroxy-Lys.
Die Quervernetzungen zwischen den Polypeptidketten sind dieselben wie im Kollagen. Typisch fr
das Elastin sind zudem vierfache Quervernetzungen
vom Typ des Desmosins. Die elastischen Eigenschaften beruhen wahrscheinlich darauf, dass eine
Dehnung der Faser apolare Reste des Elastins in
Kontakt mit Wasser bringt und bei Wegfallen des
Zugs hydrophobe Effekte die Relaxation zum Ausgangszustand antreiben (.Abb.3.9).

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514848-0
3.1 Stabilisierung der Raumstruktur
3.2 Sekundrstruktur
3.3 Tertirstruktur
3.4 uere Gestalt und Quartrstruktur
3.5 Dynamik und funktionsgebundene
Strukturnderungen
3.6 Denaturierung
3.7 Faltungswege
3.8 Proteinfehlfaltung
3.9 Faserproteine
Weiterfhrende Literatur

43

Enzyme
Ph. Christen, R. Jaussi, R. Benoit

4.1

Allgemeine Eigenschaften der Enzyme 44

4.2

Katalyse und Aktivierungsenergie 45

4.3

Enzymkinetik46

4.4

Struktur der aktiven Stelle, Wirkungsmechanismen


von Enzymen51

4.5

Beispiele von Enzymmechanismen 53

4.6

Regulation der Enzymaktivitt 55

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_4, Springer-Verlag Berlin Heidelberg 2016

44

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 4Enzyme

Enzyme sind katalytisch wirksame Proteine. Die


Stoffwechselwege in den Zellen setzen sich aus vielen verschiedenen Einzelschritten zusammen, von
denen jeder durch ein besonderes Enzym katalysiert wird. Ohne Enzyme laufen die allermeisten
biochemischen Reaktionen unmessbar langsam ab.
Eine Zelle von Escherichia coli enthlt etwa 1000 verschiedene Enzyme, eukaryontische Zellen ein Vielfaches davon. Enzyme beschleunigen die Einstellung
des Gleichgewichts zwischen Substrat und Produkt,
ohne die Lage des Gleichgewichts zu verndern.
Enzyme zeigen hohe Substrat- und Reaktionsspezifitt. Ein Enzym wird durch die Reaktion nicht verbraucht, es durchluft einen Kreisprozess, aus dem
es unverndert hervorgeht. Enzyme wurden frher
auch als Fermente bezeichnet (Fermentum lat., das
Agens, welches die alkoholische Grung auslst).
Proteinseitenketten und prosthetische Gruppen
(Coenzyme und Metallionen) binden das Substrat
an die aktive Stelle des Enzyms; ihre Wechselwirkungen mit dem Substrat fhren dazu, dass das Substrat innerhalb von Millisekunden in das Produkt
bergefhrt wird. Die Michaelis-Menten-Gleichung
beschreibt die Abhngigkeit der Geschwindigkeit
einer enzymkatalysierten Reaktion von der Substratkonzentration (Sttigungskurve). Die Reaktionsgeschwindigkeits-Temperatur (RGT-)Regel gilt
auch fr Enzymreaktionen.
Allosterische Regulationsmechanismen und
kovalente Modifikationen steuern den Stoffwechsel und verknpfen ihn mit vielen weiteren
zellulren Vorgngen zu einem regulatorischen
Netzwerk.
Enzyme finden vielfltige praktische Verwendung, die vom Zusatz bioaktiver Waschmittel,
ber klinisch-chemische Analytik bis zu Enzymreaktoren fr industrielle Synthesezwecke reicht.
4.1

Allgemeine Eigenschaften
der Enzyme

Enzyme sind substratspezifisch und reaktionsspezifisch Ein gegebenes Enzym akzeptiert nur

eine bestimmte Verbindung als Substrat und katalysiert nur eine bestimmte Reaktion des Substrats. Dank der hohen katalytischen Effizienz der

Enzyme knnen die Stoffwechselreaktionen bei


vergleichsweise niedriger Temperatur, im neutralen pH-Bereich und bei niedrigen Substratkonzentrationen (MmM) ablaufen. Die katalytische
Aktivitt eines Enzyms wird reguliert durch die
Konzentration seines Substrats und in manchen
Fllen durch besondere regulatorisch wirksame
Substanzen. Die Enzyme sind monomere oder oligomere globulre Proteine, viele von ihnen enthalten auch Nichtproteinbestandteile (prosthetische
Gruppen).
Es werden sechs verschiedene Klassen von Enzymen unterschieden :
1. Oxido-Reduktasen katalysieren Oxidationsund Reduktionsvorgnge (H- bzw. Elektronenbertragung). Beispiele: Dehydrogenasen
mit NAD+ oder NADPH+ als Elektronenakzeptor.
2. Transferasen bertragen eine Gruppe von Substrat1 auf Substrat2. Beispiel: Aminotransferasen (Transaminasen; .Abb.4.8).
3. Hydrolasen spalten Bindungen hydrolytisch.
Dazu gehren u.a. Esterasen, Glykosidasen und
Proteasen (synonym: Proteinasen).
4. Lyasen lagern Gruppen an Doppelbindungen
oder entfernen Gruppen aus ihren Substraten
unter Bildung von Doppelbindungen (nichthydrolytische Spaltung); Beispiel Fructose-1,6-bisphosphat-Aldolase (Abschn.14.1).
5. Isomerasen katalysieren Isomerisierungen.
Beispiel: Triosephosphat-Isomerase (Abschn.14.1).
6. Ligasen katalysieren die Bildung von Bindungen unter gleichzeitiger Spaltung von ATP. Beispiel: Aminoacyl-t-RNA-Synthetasen.
Alle Enzyme haben dreiteilige systematische
Namen:
Substrat(e)

Reaktionsklasse

Endsilbe -ase

L-Lactat:NAD-

oxidoreduct

ase

Nummerncode der Enzyme Commission EC1.1.1.27


(Klasse/Subklasse/Subsubklasse/individuelle Nummer).
Manche Enzyme besitzen Trivialnamen: Lactatdehydrogenase (obiges Beispiel), DNA-Polymerase,
Pepsin, Thrombin.

45
4.2 Katalyse und Aktivierungsenergie

Terminologie
Isoenzyme: Enzyme, welche in der gleichen
Spezies (nicht unbedingt im gleichen Individuum) die gleiche Reaktion katalysieren, sich
jedoch genetisch bedingt in ihrer Aminosuresequenz unterscheiden.
Mgliche Typen von Isoenzymen sind:
Enzyme mit separaten Genen. Beispiel:
Glutamat-Oxalacetat-Transaminase; in
jedem Individuum kommen zwei Iso
enzyme vor, eines in den Mitochondrien,
ein anderes im Cytosol.
Genetische Varianten (multiple Allele).
Beim Menschen sind ber 50Varianten
der Glucose-6-phosphat-Dehydrogenase
gefunden worden.
Oligomere Enzyme aus verschiedenen
genetischen Varianten von Untereinheiten. Die Lactatdehydrogenase ist z.B. ein
Tetramer. Die Zellen synthetisieren sowohl
H-(Herz-) als auch M-(Muskel-)Untereinheiten. In gewissen Geweben kommen alle
fnf mglichen Isoenzyme (H4, H3M, H2M2,
HM3, M4) nebeneinander vor.

Das Enzym durchluft mit dem Substrat einen


Kreisprozess Der Enzym-Substrat-Komplex
ES bildet sich, indem das Substrat S an die aktive
Stelle bindet, die in einer Furche an der Oberflche des Enzyms E liegt. Das Substrat wird primr

durch nichtkovalente Krfte gebunden (H-Bindungen, Salzbindungen, Van-der-Waals-Krfte


und hydrophobe Effekte). Die Struktur der aktiven
Stelle ist derjenigen des Substrats komplementr (der berhmte Chemiker Emil Fischer hat die
Substratspezifitt von Enzymen mit dem Bild von
Schloss und Schlssel beschrieben). In der Phase
des Bindungswechsels wird ES in den Enzym-Produkt-Komplex EP umgewandelt:
P

EP

ES

Wechselwirkungen zwischen der aktiven Stelle und


dem Substrat, zu denen bei gewissen Enzymen auch
eine vorbergehende kovalente Bindung gehrt,
fhren dazu, dass die Reaktion ESEP viel schneller abluft (1061012-mal) als die nichtkatalysierte
Reaktion SP. Die Dissoziation des EP-Komplexes
schliet den Kreis. Das Enzymmolekl ist darauf bereit, den Zyklus mit einem weiteren Substratmolekl
erneut zu durchlaufen. Alle Teilreaktionen sind im
Prinzip umkehrbar. Der katalytische Zyklus wird
von den meisten Enzymen innerhalb weniger Millisekunden durchlaufen.
Das Binden des Substrats verndert die Konformation sowohl des Enzyms als auch des Substrats.
Die substratinduzierte Konformationsnderung des
Enzyms wird als induzierte Anpassung (Induced fit)
bezeichnet. Sie trgt zur besseren Erkennung des Substrats bei: Nur Verbindungen, welche die Anpassung
induzieren, werden zu Produkt umgesetzt, bloes
Binden an die aktive Stelle gengt nicht. Bei manchen
Enzymen fhrt das Binden des Substrats dazu, dass
die Furche der aktiven Stelle aus einer offenen in eine
geschlossene Form bergeht. Das Substrat gelangt dadurch in eine weitgehend wasserfreie Umgebung, in
der elektrostatische Wechselwirkungen verstrkt und
Nebenreaktionen mit Wasser ausgeschlossen sind.
4.2 Katalyse

und Aktivierungsenergie

Sowohl eine Erhhung der Temperatur als auch Katalysatoren beschleunigen chemische Reaktionen.
Dieser Sachverhalt lsst sich mit der Theorie des
bergangszustands beschreiben.

Die Aktivierungsenergie bestimmt die Geschwindigkeit einer Reaktion Ein Substratmole-

kl muss, um in Produkt umgewandelt zu werden,


einen aktivierten Zustand durchlaufen. Dieser bergangszustand hat eine hhere freie Energie als der
Ausgangszustand, die Differenz wird als freie Aktivierungsenergie bezeichnet (.Abb.4.1). In der enzymkatalysierten Reaktion ist die Aktivierungsenergie fr die Hin- und Rckreaktion um den gleichen
Betrag herabgesetzt: Hin- und Rckreaktion werden
um den gleichen Faktor beschleunigt. Die Lage des
Gleichgewichts zwischen S und P ist gegeben durch
die Differenz der freien Energie .G0 / von S und

46

Kapitel 4Enzyme

1
2
3
4
5

Reaktionskoordinate

6
7
8

.. Abb.4.1 Aktivierungsenergie und


Reaktionsgeschwindigkeit. Die Reaktion
SP verluft umso schneller, je mehr
S-Molekle eine freie Energie aufweisen,
die gleich oder hher ist als diejenige des
bergangszustandes. Die Energieverteilung in einer Moleklpopulation bei
bestimmter Temperatur T ist gegeben
durch die Boltzmann-Verteilung. Eine
Temperaturerhhung um T verschiebt
die Boltzmann-Verteilung zu hheren
Energien der S-Molekle. Ein Enzym
hingegen erffnet einen neuen Reaktionsweg ESEP, welcher ber einen
bergangszustand mit niedrigerer freier
Energie verluft. In beiden Fllen besitzt
ein grerer Anteil der Moleklpopulation
eine freie Energie, die gleich oder hher
ist als diejenige des bergangszustandes
der Reaktion SP, d.h. in beiden Fllen
verluft die Reaktion schneller

9
10
11
12
13
14
15
16
17
18
19
20

P; das Enzym ndert daran nichts. Die Aktivierungs


energie einer enzymatischen Reaktion wird durch das
jeweilige Enzym und nicht durch den Typ der Reaktion oder das Substrat bestimmt. Sie liegt im Bereich
von 2080kJ/mol (520kcal/mol, d.h. im Bereich der
Energie von Ionenpaarbindungen; .Tab.1.2). Die reaktionsbeschleunigende Wirkung eines Enzyms wird
als dessen katalytische Aktivitt bezeichnet.
Definitionen
Einheit (U) der Enzymaktivitt: 1 mol
Substrat/min (bei 25C und definierten, wenn
mglich optimalen Reaktionsbedingungen).
Spezifische Aktivitt: U/mg Protein (ein Ma
fr die Reinheit eines Enzymprparats); U/mL
Blutserum oder Blutplasma (in der klinischen
Chemie gebruchliche Angabe).
Molekulare Aktivitt (Wechselzahl, Turnover
number): mol Substrat/(mol Enzyms). Fr
die meisten Enzyme liegt der Wert im Bereich
von 103105s1; mit dieser Frequenz durchluft
ein Enzymmolekl den katalytischen Zyklus.

Die Enzymaktivitt lsst sich aus der Zeit-UmsatzKurve bestimmen In einem Reaktionsansatz wird

die Geschwindigkeit in der Anfangsphase der Reaktion nach Zugabe des Enzyms bestimmt; zu diesem
Zeitpunkt ist noch kein bzw. wenig P vorhanden
und es findet daher praktisch keine Rckreaktion
(E+S ESE+P) statt (.Abb.4.2).
4.3 Enzymkinetik

Die Enzymkinetik untersucht die Abhngigkeit der


Reaktionsgeschwindigkeit von den Reaktionsbedingungen: Konzentration des Enzyms, des Substrats
und von Inhibitoren oder Aktivatoren; Temperatur;
pH-Wert.
Fr die folgende Besprechung sollen drei Voraussetzungen erfllt sein: Mit Geschwindigkeit v
ist die Anfangsgeschwindigkeit gemeint; [S] [E];
Einsubstratreaktion. Die abgeleiteten Beziehungen
lassen sich auch auf Zweisubstrat-Reaktionen anwenden, indem eine dermaen hohe Konzentration
des zweiten Substrats gewhlt wird, dass sie wh-

47
4.3Enzymkinetik

kurve, die sich asymptotisch einem Maximalwert


nhert, beschreibt allgemein das Binden eines Liganden an ein Protein (z.B. von O2 an Myoglobin
oder eines Hormons an seinen Rezeptor). In analoger Weise beschreibt die Michaelis-Menten-GleiS
chung v D KVmmax
die Abhngigkeit der GeschwinCS
digkeit v einer enzymkatalysierten Reaktion von der
Substratkonzentration.

.. Abb.4.2 Bestimmung der Aktivitt eines Enzyms aus der


Zeit-Umsatzkurve. Die Anfangsgeschwindigkeit der Reaktion
v=d[P]
=d[S]
ist gleich der Neigung der Tangente an die
dt
dt
Zeit-Umsatzkurve zur Zeit Null: v=d[P]
=tgt=o. Das Ermitteln
dt
der Zeit-Umsatzkurve ist einfach, wenn sich Substrat und
Produkt in ihren Absorptionsspektren unterscheiden. Das ist
zum Beispiel der Fall beim Cosubstrat NAD+/NADH (Abschn.14.1; .Abb.14.2)

rend der Reaktion praktisch nicht verndert wird


und als Konstante in die Gleichungen eingeht.

Die Geschwindigkeit ist eine lineare Funktion


der Enzymkonzentration Die meisten enzymka-

talysierten Reaktionen laufen ohne Enzym unmessbar langsam ab: bei [E]=0 ist v=0. Die Geschwindigkeit nimmt mit steigender Enzymkonzentration
linear zu.

Ableitung der Michaelis-Menten-Gleichung 

Eine enzymkatalysierte Reaktion lsst sich


vereinfacht durch die folgende Gleichung
darstellen:
k1

k2

E C S ES ! E C P
k1

wobeik1, k1 und k2 die Reaktionsgeschwindigkeitskonstanten der jeweiligen Reaktionsschritte darstellen.


Falls sich ES in einem Fliegleichgewicht (stationrer Zustand, Steady state) befindet, d.h.
mit gleicher Geschwindigkeit gebildet und
verbraucht wird, gilt
k1 ES D k1 ES C k2 ES oder
ES
k1 C k2
D
ES
k1

Der Quotient der Geschwindigkeitskonstanten wird als Michaelis-Menten-Konstante Km


definiert:

Die Michaelis-Menten-Gleichung beschreibt die


Abhngigkeit der Geschwindigkeit von der Substratkonzentration Eine hyperbolische Sttigungs-

Km D

k1 C k2
k1

Kapitel 4Enzyme

48

Aus

Reaktion 2.Ordnung:

ES
D Km und E D E0   ES ,
ES

wobei [E0] die Gesamtkonzentration des Enzyms ist, ergibt sich

Km
E0   ES
D
oder
ES
S
E0 
Km
S
ES
D
C 1 oder
D
ES
S
E0 
Km C S

5
6

Die Geschwindigkeit der Reaktion ist

vD

Die maximale Geschwindigkeit Vmax wird


erreicht, wenn alles Enzym als ES-Komplex
vorliegt: Vmax=k2 [E0].
Demnach ist

9
10

v
ES
Vmax S
S
D
oder v D
D
Vmax
E0 
Km C S
Km C S

11
12
13
14
15
16
17
18
19
20

dP
D k2 ES
dt

Aus der Michaelis-Menten-Gleichung ergibt sich,


dass die Reaktion bei niedriger Substratkonzentration gem einer Kinetik erster Ordnung und bei
hoher Substratkonzentration gem einer Kinetik
nullter Ordnung abluft:

[S]  Km : v  S .Kinetik 1. Ordnung/


[S]  Km : v = Vmax .Kinetik 0. Ordnung/
Terminologie
Reaktion 0.Ordnung: AB
vD

dB
Dk
dt

Reaktion 1.Ordnung: AB
dB
vD
D kA A t D A0  ekt
dt

vD

A+BC

dC
D kAB
dt

Km hat die Dimension einer Konzentration und entspricht der Substratkonzentration, bei welcher die
halbe Maximalgeschwindigkeit erreicht wird. Die
Maximalgeschwindigkeit Vmax wird erreicht, wenn
das Enzym mit Substrat gesttigt ist, d.h. wenn bei
[S]Km alle Enzymmolekle als ES-Komplex vorD Kd , d.h.
liegen. Falls k2k1, wird Km D kk1
1
der Wert von Km entspricht dem Wert der Dissoziationskonstanten des ES-Komplexes. Bei der Mehrzahl der Enzyme ist dies der Fall.
v, [S] und Km
S D Km

vD

1
2

S D 20 Km

vD

20
21

S D 10 Km

vD

Vmax

10
11

Vmax D 91 % von Vmax

Vmax D 95 % von Vmax

Eine Erniedrigung von Km bewirkt, dass bei gegebener Substratkonzentration die Geschwindigkeit der
Reaktion zunimmt, d.h. die Ausntzung des Substrats verbessert wird (.Abb.4.3). Km kann daher
als reziprokes Ma der Affinitt des Enzyms fr
ein bestimmtes Substrat bezeichnet werden. Die KmWerte der meisten Enzyme liegen zwischen 0,01 bis
1mM. In vielen Fllen liegt der Km-Wert im Bereich
der Konzentration des jeweiligen Substrats in der
Zelle. Enzyme arbeiten demnach in der Zelle nicht
unter Sttigungsbedingungen.

Bestimmung von Vmax und Km 


Experimentelle Messung von v=f([S])
gem .Abb.4.3 und rechnergesttztes
Angleichen der Kurve (Curve fitting).
Alternative: Grafische Auswertung der
Daten durch Linearisierung der Michaelis-
Menten-Gleichung nach Lineweaver-Burk:

1
Km
1
1
C

D
v
Vmax
Vmax S
1
1
wird dabei eine lineare Funktion von
:
v
S

49
4.3Enzymkinetik

k=f(T)
Die Temperaturabhngigkeit einer chemischen (auch enzymkatalysierten) Reaktion ist
gegeben durch
kB  T G =RT
kD
,
e
h


Die Reaktionsgeschwindigkeit nimmt bei Erhhung der Temperatur exponentiell zu Bei

erhhter Temperatur verschiebt sich die Boltzmann-Verteilung: Ein grerer Anteil der ES-Komplexe besitzt eine freie Energie, die gleich gro oder
grer ist als die Aktivierungsenergie, die Reaktion
luft schneller ab (.Abb.4.1). Die Reaktionsgeschwindigkeits-Temperatur-Regel (RGT-Regel) gilt
als grobe Faustregel auch fr Enzyme: Eine Temperaturerhhung um 10C verdoppelt die Reaktionsgeschwindigkeit (.Abb.4.4). Bei Temperaturen,
die hher sind als die blichen Umgebungstemperaturen des Organismus bzw. dessen Krpertemperatur, werden die Enzyme jedoch denaturiert und
damit inaktiviert.

.. Abb.4.3Km als reziprokes Ma der


"Affinitt" eines Enzyms fr dessen Substrat. Die Ausntzung des Substrats wird
verbessert unabhngig davon, ob der erniedrigte Km-Wert auf eine Erhhung von
k1 oder eine Erniedrigung von k-1 oder k2
zurckzufhren ist. Je niedriger Km, umso
hher ist bei gegebener Substratkonzentration die Geschwindigkeit

wobei k die Reaktionsgeschwindigkeitskonstante, kB die Boltzmann-Konstante, T die absolute Temperatur, h die Planck-Konstante, G
die Aktivierungsenergie und R die allgemeine
Gaskonstante darstellt. Die damit verwandte
Arrhenius-Gleichung lnk=lnAEa/RT zeigt,
dass lnk eine lineare Funktion von 1/T ist. A ist
eine Konstante, welche den maximal mglichen Wert der Geschwindigkeitskonstante
bei Ea=0 angibt (1013s1 bei 25C); Ea ist die
Aktivierungsenergie.

Die Temperaturabhngigkeit biologischer Vorgnge


ist von praktischer Bedeutung: Khlschrnke, Khlrume und Khlketten sind in der Lebensmittelbranche aber auch in der biologischen Forschung und
Technik nicht mehr wegzudenken. Im Winterschlaf
gewisser Tiere und bei der knstlichen Hibernation
von Patienten werden die Stoffwechselreaktionen verlangsamt und dadurch der Bedarf an Nhrstoffen und
Sauerstoff herabgesetzt. Umgekehrt beschleunigen
Fieber oder Hyperthermie den Stoffwechsel.

50

Kapitel 4Enzyme

.. Abb.4.4 Temperaturabhngigkeit der Geschwindigkeit enzymatischer Reaktionen. Die angegebene


Kurve entspricht einem Temperaturkoeffizienten von
2 (bei einer Temperaturerhhung von 10C verdoppelt sich die Reaktionsgeschwindigkeit). Oberhalb
einer gewissen Temperatur wird das Enzym rasch
denaturiert und damit inaktiviert. Bei berschreiten
der Denaturierungstemperatur lsst sich deshalb die
Geschwindigkeit der enzymkatalysierten Reaktion
nicht mehr messen

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15

Aktivatoren und Inhibitoren knnen die Aktivitt von Enzymen verndern Verbindungen,

welche die Geschwindigkeit einer enzymkatalysierten Reaktion beschleunigen oder verlangsamen,


jedoch weder Substrat noch Produkt der Reaktion
sind, werden als Aktivatoren bzw. Inhibitoren des
Enzyms bezeichnet. Es sind wesentlich mehr Inhibitoren als Aktivatoren bekannt. Inhibitoren hemmen
das Enzym, ohne es zu denaturieren.
Reversible Inhibitoren bilden einen Enzym-Inhibitor-Adsorptionskomplex. Ein reversibler kompetitiver Inhibitor und das Substrat knnen nicht gleichzeitig an das Enzym binden. In der
Gegenwart eines kompetitiven Inhibitors wird ein
hherer Wert von Km gemessen. Bei erhhter Substratkonzentration wird jedoch der gleiche Wert
von Vmax wie in der nichtgehemmten Reaktion erreicht:

Ein reversibler nichtkompetitiver Inhibitor bindet


unabhngig vom Substrat an das Enzym. In der Gegenwart eines nichtkompetitiven Inhibitors wird ein
niedrigerer Wert von Vmax gemessen, der Km-Wert
bleibt unverndert; die Hemmwirkung uert sich
wie eine Erniedrigung der Enzymkonzentration:

16
17
18
19
20

Der einfachste Aktivator und Inhibitor von Enzymen ist das H+-Ion Die katalytische Aktivitt

jedes Enzyms ist vom Ladungszustand ionisierbarer Gruppen des Enzyms, insbesondere an dessen
aktiver Stelle, und des Substrats abhngig. Der Ladungszustand dieser Gruppen hngt vom pH-Wert
ab. Das pH-Optimum der meisten Enzyme liegt im
physiologischen pH-Bereich oder in dessen Nhe
(.Abb.4.5). Es kann scharf begrenzt sein oder sich
ber mehrere pH-Einheiten erstrecken.

51
4.4 Struktur der aktiven Stelle, Wirkungsmechanismen von Enzymen

Mit spezifischen Inhibitoren knnen Enzyme


gezielt gehemmt werden H+-Ionen wirken auf

alle Enzyme. Von besonderem Interesse sind jedoch


spezifische Wirkstoffe, welche ausschlielich ein bestimmtes Enzym hemmen. Substratanaloge, d.h.
Verbindungen mit substrathnlicher Struktur, binden an die aktive Stelle und verhindern damit das
Binden des Substrats. Das klassische Beispiel hierfr
ist die kompetitive Hemmung der Succinat-Dehydrogenase durch Malonat. Malonat mit seinen beiden
Carboxylatgruppen bindet anstelle von Succinat an
die aktive Stelle, kann jedoch nicht dehydrogeniert
werden, da wegen der fehlenden Methylengruppe
keine Doppelbindung eingefhrt werden kann:

Succinat

Die bisher beschriebenen spezifischen Enzyminhibitoren binden reversibel an ihr Zielenzym. Irreversible Inhibitoren, die kovalent an das Enzym
binden, wirken in der Regel strker und lnger anhaltend. Affinittsreagenzien bestehen aus zwei
Teilen: einem Substratanalogen, welches spezifisch
an die aktive Stelle des Zielenzyms bindet, und einer
reaktiven Gruppe, welche das Enzym an der aktiven
Stelle chemisch modifiziert und dadurch inaktiviert.
Mechanismus-aktivierte Inhibitoren (kcat-Inhibitoren) sind Substratanaloge, die von selbst nicht reak-

tiv sind, jedoch durch die katalytische Wirkung des


Enzyms in eine reaktive Form bergefhrt werden.
Sie nutzen nicht nur die Bindungsspezifitt, sondern auch die Reaktionsspezifitt des betroffenen
Enzyms, um dieses gezielt zu hemmen.
Zahlreiche Medikamente und auch Pestizide
sind spezifische Enzyminhibitoren Hierzu einige
Beispiele:
Acetylsalicylsure (Aspirin) und andere
nichtsteroidale Antiphlogistika und Throm-

.. Abb.4.5 pH-Aktivittskurve eines Enzyms. Im einfachsten


Fall entspricht jeder der flankierenden Kurvenste der Titrationskurve einer fr die Aktivitt kritischen ionisierbaren Gruppe. Die gezeigte Kurve knnte einem Enzym entsprechen, in
welchem ein bestimmter Histidinrest mit pKa6,5 deprotoniert
und ein Lysinrest mit pKa8,5 protoniert sein muss, damit das
Enzym katalytisch aktiv ist

bozytenaggregationshemmer hemmen die


Cyclooxygenase, die Prostaglandine und
Thromboxane produziert (Abschn.28.8).
Hemmstoffe des Angiotensin-converting
enzyme (ACE-Inhibitoren) dienen zur Behandlung von Bluthochdruck (Abschn.28.4).
Das Antibiotikum Penicillin ist ein kcat-Inhibitor der Transpeptidase, welche das Murein,
einen essenziellen Bestandteil der bakteriellen
Zellwand, synthetisiert (Abschn.5.3).
Medizinisch wichtige Substratanaloge sind
auch die Sulfonamide und die Folsureantagonisten, welche als Bakteriostatika und Zytostatika eingesetzt werden (Abschn.19.4).
Organophosphate hemmen die Acetylcholinesterase und wirken als Nervengifte
(Abschn.29.1). Gewisse Derivate werden als
Insektizide verwendet.

4.4

Struktur der aktiven Stelle,


Wirkungsmechanismen
von Enzymen

Fr das Binden des Substrats und die Katalyse des


Bindungswechsels sind Gruppen an der aktiven
Stelle verantwortlich:
Proteinseitenketten, welche mit dem Substrat eine nichtkovalente Bindung eingehen,

Kapitel 4Enzyme

52

1
2
3
4
5
6
7
8
9
10

Protonen aufnehmen oder abgeben oder


als Nucleophil das Substrat vorbergehend
kovalent binden. An der Bindung der zumeist
anionischen Substrate ist sehr hufig die
Guanidiniumgruppe von Arg beteiligt. Weitere
Beispiele fr funktionelle Gruppen an aktiven
Stellen sind die Imidazolgruppe von His, die
SH-Gruppe von Cys, die OH-Gruppe von Ser,
die Carboxylgruppe von Asp und Glu sowie
die -Aminogruppe von Lys.
Prosthetische Gruppen (Nichtproteinbestandteile), die bei sehr vielen Enzymen die aktive
Stelle mit chemischen Eigenschaften, z.B. Redoxaktivitt, ausstatten, welche mit Proteinseitenketten allein nicht hervorzubringen wren:
Coenzyme, im Vergleich zu den Proteinseitenketten kompliziert gebaute organische
Verbindungen, in vielen Fllen aus einem
Vitamin gebildet,
Metallionen, Zn2+, Fe2+, Cu2+ u.a.m. durch
Chelatbindung ans so genannte Metallenzym gebunden.

philen Angriff einer Gruppe der aktiven Stelle des


Enzyms auf das Substrat kommt es zu einer kovalenten Bindung. Die damit elektrophil gewordene
katalytische Gruppe zieht Elektronen aus dem Reaktionszentrum ab und erleichtert so die Spaltung von
Bindungen im Substrat. Zum Abschluss der Reaktion wird die katalytische Gruppe wieder eliminiert.
Die Reaktionsmechanismen von Chymotrypsin
(.Abb.4.7) und der pyridoxalphosphat-abhngigen Enzyme geben hierfr Beispiele (.Abb.4.9).

Terminologie

11

Holo
enzym

12

aktiv

Apoenzym
(Protein)
inaktiv

prosthetische
Gruppe
(Coenzym/
Metallion)
sehr wenig aktiv

Das Binden an die aktive Stelle verformt das


Substrat in Richtung Struktur des bergangszustandes Ein Teil der freien Bindungsenergie

des Substrats (G der Bildung des ES-Komplexes)


wird aufgewendet, um das Substrat strukturell dem
bergangszustand anzunhern. Die Wechselwirkungen mit der aktiven Stelle fhren dazu, dass
Bindungswinkel, Bindungslngen, aber auch die
Elektronenverteilung im Substrat dem bergangszustand angeglichen werden. Dabei ist zu beachten, dass elektrostatische Wechselwirkungen in der
praktisch wasserfreien aktiven Stelle wesentlich
strker sind als im Wasser. Experimentelle Befunde
belegen die Wirksamkeit dieses Mechanismus der
Enzymwirkung:
Nichtenzymatische Reaktionen laufen schneller
ab, wenn die Struktur des Reaktanten der Struktur des bergangszustandes angenhert ist:

13
14
15
16
17
18
19
20

Wechselwirkungen zwischen Enzym und Substrat


beschleunigen die Reaktion Der Beitrag der im

Folgenden aufgefhrten Mechanismen zum katalytischen Effekt ist von Enzym zu Enzym verschieden; viele Enzyme benutzen nur einen Teil dieser
Mechanismen.
Ionisierbare Gruppen der aktiven Stelle wirken als H+-Donoren oder H+-Akzeptoren Viele

Reaktionen werden durch H+- oder OH-Ionen beschleunigt; wenn Brnstedtsche Suren und Basen
die Reaktion katalysieren, spricht man von allgemeiner Sure-Basenkatalyse (z.B. Chymotrypsin;
.Abb.4.7). In manchen Enzymen bernimmt ein
Metallion an der aktiven Stelle die Rolle einer Lewis-Sure, d.h. eines Elektronenpaarakzeptors.
Gewisse Enzyme bilden vorbergehend eine
kovalente Bindung zum Substrat Durch nucleo

Stabile Analoge des (hypothetischen) bergangszustandes werden vom Enzym strker


gebunden als das Substrat und das Produkt.
Antikrper gegen Analoge des bergangszustandes knnen katalytische Wirkung aufweisen (katalytische Antikrper).

Enzyme verwandeln intermolekulare Reaktionen


in quasi-intramolekulare Reaktionen Die meis-

ten enzymkatalysierten Reaktionen sind mehrmolekulare Reaktionen, welche aus statistischen Grnden langsam sind. Durch Bildung des ES-Komplexes
werden alle Reaktanten (Substrat 1+Substrat 2+ka-

53
4.5 Beispiele von Enzymmechanismen

.. Abb.4.6 Katalyse durch Proximitt.


Vergleich der Geschwindigkeiten der
imidazol-katalysierten Hydrolyse von
Phenylacetat-Ester als intermolekulare und
intramolekulare Reaktion, d.h. damit bei
gleichen Konzentrationen von Ester und
Ester-Imidazol die intermolekulare Reaktion
gleich schnell abluft wie die intramolekulare Reaktion, msste die Konzentration von
Imidazol 30M sein. Bei der intramolekularen
Reaktion betrgt demnach die effektive
Konzentration von Imidazol 30M

Intermolekular

Intramolekular

Vinter = kinter [Ester] [Imidazol]

Vintra = kintra [Ester-Imidazol]

kintra
= 30 M
kinter

talytische Gruppen des Enzyms) Teil ein und desselben Komplexes. Nichtenzymatische Modellreaktionen zeigen, dass dieser entropische Effekt (Katalyse
durch Proximitt) zur Reaktionsbeschleunigung
beitragen kann (.Abb.4.6). Als weiterer entropischer Effekt der Bildung des ES-Komplexes werden
die Reaktanten optimal gegeneinander orientiert,
indem ihre relative Beweglichkeit eingeschrnkt
wird (Katalyse durch Orientierung).
4.5

Beispiele von
Enzymmechanismen

Serinproteasen: besonders reaktiver Serinrest an


der aktiven Stelle Eine gut untersuchte Serinprotease ist das Chymotrypsin, ein Verdauungsenzym

aus dem Pankreas, welches Peptidbindungen hydrolytisch spaltet. Sein Reaktionsmechanismus ist

aus chemischen und strukturellen Daten abgeleitet


worden (.Abb.4.7). Die OH-Gruppe von Ser195
ist ungewhnlich nucleophil durch Wechselwirkungen mit His57 und Asp102, sie geht vorbergehend eine kovalente Bindung mit dem Acylrest
ein. Aufgrund seiner Reaktivitt wird Ser195 spezifisch durch Diisopropylfluorophosphat und andere
Alkylphosphate (Organophosphate) alkyliert. Auf
hnliche Weise wird die Acetylcholinesterase an
cholinergen Synapsen irreversibel gehemmt (Abschn.29.1).
Ein Serinrest mit analoger Funktion und Reaktivitt findet sich auch bei anderen Serinproteasen.
Mit Ausnahme des Subtilisins haben sich alle Serinproteasen in .Tab.4.1 aufgrund hnlicher Aminosuresequenzen und 3D-Strukturen als zueinander
homolog erwiesen. Obwohl Subtilisin offenbar nicht
vom gleichen Proteinvorfahren abstammt, besitzt es
an der aktiven Stelle die gleichen drei katalytischen

54

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 4Enzyme

.. Abb.4.7Kovalente
Katalyse der Hydrolyse von
Peptidbindungen durch
Chymotrypsin. Nach dem
gleichen Mechanismus
hydrolysiert das Enzym auch
Esterbindungen knstlicher
Substrate

55
4.6 Regulation der Enzymaktivitt

.. Tab.4.1Serinproteasen
Enzym

Vorkommen und Funktion

Chymotrypsin

Pankreas: Eiweiverdauung

Trypsin

do.

Elastase

do.

Thrombin

Blutplasma: Blutgerinnung

Plasmin
(Fibrinolysin)

Blutplasma: Auflsung
von Fibringerinnseln

Komplement C1

Blutplasma: Zell-Lyse
bei Immunreaktion

Subtilisin

Bacillus subtilis und andere Bacillus-Spezies, durch Plasmid codiert,


wird sezerniert. Verwendung in
bioaktiven Waschmitteln

Aminosurereste in gleicher rumlicher Anordnung: Durch konvergente molekulare Evolution


ist aus verschiedenen Ursprngen der gleiche katalytische Mechanismus entwickelt worden.

Pyridoxalphosphat-abhngige Enzyme katalysieren mannigfaltige Reaktionen von Aminosuren


Pyridoxalphosphat (PLP), ein Derivat von Vitamin

B6 (Pyridoxol, Pyridoxin), ist prosthetische Gruppe


vieler Enzyme im Stoffwechsel von Aminosuren
(.Abb.4.8). Alle Reaktionen von Aminosuren, die
von PLP-abhngigen Enzymen katalysiert werden,
sind auch mit PLP allein mglich. In diesem Fall laufen jedoch alle Reaktionen gleichzeitig nebeneinander und wesentlich langsamer ab. Die enzymatischen
und auch nichtenzymatischen Reaktionen fhren
ausnahmslos ber eine gemeinsame Zwischenverbindung (.Abb.4.9). Die PLP-abhngigen Enzyme zeigen angesichts der vielfltigen nichtenzymatischen
und enzymatischen Reaktionen sehr eindrcklich,
dass der Proteinteil des Enzyms (Apoenzym) verantwortlich ist fr die Substratspezifitt, die Reaktionsspezifitt und den hohen Beschleunigungseffekt.
4.6

Regulation der Enzymaktivitt

Die wechselnde Zufuhr von Nhrstoffen und der


wechselnde Bedarf an chemischer Energie oder
an bestimmten Stoffwechselprodukten verlangen

eine entsprechende Anpassung des Stoffwechsels.


Grundstzlich bestehen hierfr zwei Mglichkeiten:
nderung der Enzymkonzentration durch
nderung der Geschwindigkeit von Synthese
oder Abbau (langsam einsetzender Effekt;
Kap.11),
nderung der Aktivitt der in der Zelle vorhandenen Enzyme (unverzglich einsetzender
Effekt). Im Folgenden werden die allgemeinen
molekularen Grundlagen hierzu besprochen.

Die Substratkonzentration reguliert die Geschwindigkeit einer Stoffwechselreaktion In der

Zelle liegen die Konzentrationen der meisten Stoffwechselzwischenprodukte im Bereich der Km-Werte
der Enzyme. Die Geschwindigkeit der enzymkatalytischen Umsetzung des Substrats ist deshalb von
der Substratkonzentration abhngig (.Abb.4.3). Es
ergibt sich damit ein einfacher Mechanismus zur
Stabilisierung der Fliegleichgewichte des Stoffwechsels: Bei niedrigerer Konzentration wird das
Substrat langsamer und bei hherer Konzentration
schneller umgesetzt.
Enzyme mit sigmoider Kinetik (Kooperativitt) reagieren besonders empfindlich auf Vernderungen der Substratkonzentration- Eine

Reihe von Enzymreaktionen folgen nicht der Michaelis-Menten-Gleichung. Die Auftragung der
Reaktionsgeschwindigkeit als Funktion der Substratkonzentration ergibt eine S-frmige Kurve
(.Abb.4.10). Diese sigmoide Kinetik findet sich
nur bei oligomeren Enzymen, sie ist auf die Kooperativitt (gegenseitige Beeinflussung) der aktiven
Stellen zurckzufhren: Binden des Substrats an
die aktive Stelle einer Untereinheit erhht die Affinitt der noch unbesetzten Stellen auf den anderen
Untereinheiten (.Abb.4.11). Kooperativitt fhrt
zu einem empfindlicheren Ansprechen des Sttigungsgrades auf die Ligandenkonzentration (in
der Regeltechnik als steilere Regelcharakteristik
bezeichnet). Eine Hmoglobinvariante illustriert
eindrcklich die physiologische Bedeutung der
Kooperativitt (.Abb.4.12).
Manche Enzyme besitzen zustzlich zur aktiven
Stelle eine allosterische Regulatorstelle Die Aktivitt gewisser Enzyme kann durch Verbindungen be-

56

Kapitel 4Enzyme

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.4.8 Pyridoxalphosphat-abhngige enzymatische Reaktionen. Pyridoxamin-5-phosphat wird bei Transaminierungs


reaktionen aus Pyridoxal-5-phosphat gebildet. Auer den angezeigten Reaktionen werden auch - und -Eliminationsreaktionen sowie - und -Substitutionsreaktionen von PLP-abhngigen Enzymen katalysiert. Das Co-Substrat Tetrahydrofolat ist ein
allgemeiner bertrger von Einkohlenstoff (C1)-Fragmenten

57
4.6 Regulation der Enzymaktivitt

.. Abb.4.9 Gemeinsame Zwischenverbindung aller PLP-abhngiger Reaktionen. Pyridoxalphosphat und Aminosure


bilden ein Imin (Schiff-Base). Diese kovalente Zwischenverbindung ist allen nichtenzymatischen und enzymatischen
PLP-abhngigen Reaktionen gemeinsam. Die Imin-Zwischenverbindung kann vielfltige Reaktionen eingehen
(.Abb.4.8), welche davon katalysiert wird, hngt ausschlielich vom Apoenzym ab

.. Abb.4.10 Sigmoide Kinetik eines Enzyms. Eine S-frmige


Kurve beschreibt die Abhngigkeit der Reaktionsgeschwindigkeit von der Substratkonzentration. Die Kurve entspricht
der Hill-Gleichung, in der K0,5 der Ligandenkonzentration bei
Halbsttigung entspricht:
vD

Vmax Sn
K0,5 CSn

Der Hill-Koeffizient n ist ein Ma fr den Grad der Kooperativitt. Sein Wert ist maximal gleich der Zahl der Substrat-Bindungsstellen des Enzyms. Ein Wert von 1 bedeutet Fehlen von
Kooperativitt; die Hill-Gleichung entspricht in diesem Fall
der Michaelis-Menten-Gleichung. Bei maximaler Kooperativitt liegt das Enzym nur als freies Enzym und als vollbesetztes
Enzym (alle Bindungsstellen mit Substrat besetzt) vor, Zwischenformen fehlen. Maximale Kooperativitt ist selten

.. Abb.4.11 Kooperativitt bei


oligomeren Enzymen. Das Binden des
Substrats an eine aktive Stelle, oder
allgemein eines Liganden an eine
Bindungsstelle, erhht die Affinitt
der anderen, noch unbesetzten Bindungsstellen. Hufig wird die Form mit
niedriger Affinitt als T-Zustand (tight)
und die Form mit erhhter Affinitt als
R-Zustand (relaxed) bezeichnet

einflusst werden, die entfernt von der aktiven Stelle


an einer anderen (allosterischen) Stelle an das Enzym binden. Das Binden des allosterischen Effektors
(allosterischen Aktivators oder Inhibitors) bewirkt
eine Konformationsnderung des Enzyms, welche
die Struktur und damit die funktionellen Eigenschaften der aktiven Stelle verndert (.Abb.4.13).
Allosterische Effekte sind von fundamentaler
biologischer Bedeutung Sie erlauben regulato-

rische Beziehungen zwischen Substanzen herzustellen, die chemisch-strukturell keine Mglichkeit

haben, miteinander direkt in Wechselwirkung zu


treten. Allosterisch regulierte Proteine wirken als
Vermittler bei der bertragung zellulrer Signale.
Allosterische Effekte ermglichen, dass sich die
verschiedenen Vorgnge in der Zelle und auch im
Gesamtorganismus zu einem regulatorischen Netzwerk verknpfen.

58

Kapitel 4Enzyme

1
2
3
4
5
6
7
8
9

.. Abb.4.12a-c Physiologische Bedeutung der Kooperativitt. Der Sttigungsgrad kooperativer oligomerer Proteine spricht
empfindlicher auf Vernderung der Ligandenkonzentration an. aOhne Kooperativitt: Um den Sttigungsgrad eines Enzyms
mit Michaelis-Menten-Kinetik von 10% auf 90% zu steigern, muss die Substratkonzentration 81-fach erhht werden. bMit
Kooperativitt (Beispiel Hmoglobin, ein Tetramer): Fr dieselbe Steigerung des Sttigungsgrades gengt eine 7-mal hhere
O2-Konzentration. cHmoglobin mit herabgesetzter Kooperativitt fhrt zu Problemen bei der O2-Abgabe: Normales Hmoglobin hat einen Hill-Koeffizienten n=2,7. Dieser Grad an Kooperativitt erlaubt, in der Peripherie viel O2 abzugeben (schwarzer
Pfeil), obwohl der Unterschied im O2-Partialdruck zwischen Lungen und peripheren Geweben verhltnismig klein ist. Eine
genetisch bedingte Hmoglobin-Variante (Hb Yakima, 99 Asp His) mit einem Hill-Koeffizienten von nur 1,5 gibt im Gewebe zu
wenig O2 ab (blauer Pfeil). Die Patienten leiden an den Folgen einer chronischen Unterversorgung der Gewebe mit O2; klinisch
steht eine starke Zunahme der Erythrozytenzahl im Vordergrund, die wegen der erhhten Viskositt des Blutes zu hmodynamischen Strungen fhrt

10
11
12
13
14
15
16
17
18
19
20

.. Abb.4.13 Allosterische Regulation der Enzymaktivitt

59
4.6 Regulation der Enzymaktivitt

Allosterische Regulationsvorgnge 

Rckkoppelungshemmung (Feedback inhibition): Das Schrittmacherenzym katalysiert den


geschwindigkeitsbestimmenden, in der Regel
irreversiblen Schritt in einer Stoffwechselkette.
Seine Regulation sorgt fr den bedarfsgerechten Durchsatz durch die Stoffwechselkette
(Beispiele: Phosphofructokinase als Schrittmacherenzym der Glykolyse, .Abb.15.7;
-Aminolvulinat-Synthase in Hmsynthese,
Acetyl-CoA-Carboxylase in Fettsuresynthese
und HMG-CoA-Reduktase in Cholesterol
synthese).
Bei der bertragung hormonaler Signale
wirken Second messengers wie cAMP als allo
sterische Effektoren bestimmter Zielenzyme.
Signalverstrkung: Chemische Signale werden
verstrkt, indem das Produkt einer allosterisch
aktivierten Enzymreaktion ein zweites Enzym
allosterisch aktiviert (Signalkaskade).


Die Aktivitt gewisser Enzyme wird durch kovalente Modifikation reguliert Diese Art der Re-

gulation kann als ein Spezialfall der allosterischen


Regulation betrachtet werden, bei welchem der allosterische Effektor kovalent an das Protein gebunden ist. Beispiele hierfr sind die reversible Phosphorylierung von Serinresten gewisser Proteine
und die irreversible proteolytische Aktivierung
inaktiver Zymogene (Proenzyme).

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514850-0
4.1 Allgemeine Eigenschaften der Enzyme
4.2 Katalyse und Aktivierungsenergie
4.3 Enzymkinetik
4.4 Struktur der aktiven Stelle, Wirkungs
mechanismus von Enzymen
4.5 Beispiele von Enzymmechanismen
4.6 Regulation der Enzymaktivitt
Weiterfhrende Literatur

61

Polysaccharide
und Oligosaccharide
Ph. Christen, R. Jaussi, R. Benoit

5.1

Reservehomoglykane62

5.2

Strukturhomoglykane63

5.3

Heteroglykane64

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_5, Springer-Verlag Berlin Heidelberg 2016

62

Kapitel 5 Polysaccharide und Oligosaccharide

12

Der weitaus grte Teil der in Organismen vorkommenden Kohlenhydrate sind Glykane (Polysaccharide und Oligosaccharide). Diese Polymere bestehen
aus glykosidisch verbundenen Monosacchariden
und Monosaccharidderivaten und haben, im Gegensatz zu Proteinen oder Nucleinsuren, keine
genau definierte Moleklmasse. Homoglykane
bestehen aus nur einer Art von Monosaccharid,
Heteroglykane dagegen aus zwei oder mehr verschiedenartigen Bausteinen.
Reservehomoglykane wie Strke oder Glykogen sind intrazellulre, -1,4-verknpfte Glucosepolymere und dienen als Energiereserve der Zelle
oder des Gesamtorganismus. Strukturhomoglykane wie Cellulose (-1,4-Glucosepolymer) oder
Chitin erfllen strukturelle Funktionen auerhalb
der Zelle.
Heteroglykane enthalten auer Glucose und
Galactose auch anionische Zuckerderivate. Glykoproteine (ZuckerProtein) und Proteoglykane/
Peptidoglykane (Protein/Peptid Glykosaminoglykane) finden sich an der Zelloberflche und sind
wichtig fr die Zell-Zell-Erkennung. Proteoglykane
der extrazellulren Matrix sind verantwortlich fr
die viskoelastischen Eigenschaften der Grundsubstanz des Binde- und Sttzgewebes. Ein Peptidoglykan, das Riesenmolekl Murein, bildet die Grundstruktur der bakteriellen Zellwand.

13

5.1 Reservehomoglykane

1
2
3
4
5
6
7
8
9
10
11

14
15
16
17
18
19
20

.. Abb.5.1 Glykosidische Bindung: 1,4-verknpfte D-Glucosereste. In der Ringform der Glucose (und anderer Zucker)
sind zwei Isomere mglich: Die Hydroxylgruppe an C1, d.h.
die freie Hemiacetalgruppe, kann nach unten (im -Anomer)
oder nach oben (im -Anomer) gerichtet sein. Es ergeben sich
dadurch zwei Typen glykosidischer Bindung

.Abb.5.2). Die -1,4-Bindungen der Amylose

und der unverzweigten Amylopektinabschnitte


ergeben eine schraubenfrmige 3D-Struktur der
Kette (.Abb.5.3). Die Strke der meisten Pflanzen
(insbesondere Weizen und Kartoffeln) besteht zu
7080% aus Amylopektin, der Rest ist Amylose.
Glykogen, das Speicherpolysaccharid in Tieren, ist dem Amylopektin sehr hnlich Es ist

Zucker (meist Glucose) als Energiereserve wird von


den Zellen als Polysaccharid gespeichert. Monosaccharideinheiten werden in Speicherpolymere eingebaut, um den osmotischen Druck, der proportional
zur Teilchenkonzentration ist, niedrig zu halten.

ebenfalls ein verzweigtes D-Glucosepolymer mit


-1,4-Bindungen und -1,6-Verzweigungen; das
Molekl ist jedoch kompakter gebaut mit einer
Verzweigung bei etwa jedem zehnten Glucoserest.
Glykogen findet sich besonders reichlich in der Leber und im Skelettmuskel. Es wird wie die Strke
intrazellulr in Granula gespeichert

speichern Strke in Form unlslicher Granula;


besonders reichlich findet sich Strke in Knollengewchsen (Kartoffeln) und Samen (Getreide);
hnliche Glucosepolymere kommen auch in Bakterien vor. Strke besteht aus unverzweigter Amylose (d-Glucose -1,4-glykosidisch verknpft;
.Abb.5.1) und verzweigtem Amylopektin (Glucose wie bei Amylose -1,4-verknpft, dazu bei
etwa jedem 25. Rest eine -1,6-Verzweigung;

sepolymer, kommt in vielen Bakterienhllen und


bei Pilzen (z.B. Hefe) vor. Die Glucosereste sind
-1,6-glykosidisch verbunden mit -1,2, -1,3 und
-1,4-Verzweigungen. Im biochemischen Labor
dient quervernetztes Dextran als Molekularsieb bei
der Gelfiltration (Size-exclusion chromatography).
Inulin ist ein in vielen Pflanzen vorkommendes
Fructosepolymer. Es ist im tierischen Krper nicht
abbaubar und wird zur Bestimmung des Volumens

Strke ist das wichtigste Speicherpolysaccharid in Pflanzen Die meisten Pflanzenzellen

In Pflanzen kommen weitere Reservehomoglykane vor Dextran, ein verzweigtes Gluco-

63
5.2Strukturhomoglykane

.. Abb.5.2-1,6-Verzweigungen in Amylopektin
und Glykogen. Ein Amylo
pektin-Polymer kann bis
zu 5000Glucosereste,
ein Glykogenpolymer bis
zu 60000Glucosereste
enthalten

.. Abb.5.3 Amylose. Die helicale Struktur ergibt sich aus den Bindungswinkeln der -1,4-glykosidischen Bindungen; ein
Molekl kann bis zu 1000Glucosereste enthalten. Iodprobe auf Strke: Einlagerung von I2 in die Amylosehelices (Einschlussverbindung) ergibt tiefblaue Farbe

des Extrazellulrraums (Abschn.33.4) und fr


Nierenfunktionsteste (Bestimmung der glomerulren Filtrationsrate) verwendet.
5.2 Strukturhomoglykane
Cellulose ist das wichtigste Strukturhomoglykan
der Pflanzen Sie macht mehr als 50% des gesam-

ten organisch gebundenen Kohlenstoffs in der Bio


sphre aus (ohne fossile Kohlenwasserstoffe). Die
extrazellulre, faserige und wasserunlsliche Substanz kommt in den Zellwnden sowie den verholzten Teilen der Pflanzengewebe vor. Das organische
Material des Holzes enthlt etwa 50% Cellulose.
Die Zellwnde der Baumwollfasern bestehen aus

Cellulose (Wolle und Seide, die zwei anderen natrlichen Textilfasern, bestehen aus Faserproteinen;
Abschn.3.9).
Cellulose ist ein lineares Homopolysaccharid
aus -1,4-verknpfter D-Glucose (.Abb.5.4). Die
langen Fadenmolekle (8000 bis 12000Glucoseeinheiten) lagern sich durch H-Bindungen zu zugfesten
Fasern zusammen. Tierische Organismen knnen
Cellulose nicht verwerten, da sie kein Enzym zur
Spaltung der -glykosidischen Bindung besitzen.
Ausnahmen sind holzabbauende Organismen wie
gewisse Bakterien, Pilze, Protozoen und Termiten
sowie Tierarten in Symbiose mit Cellulase produzierenden Mikroorganismen (z.B. Wiederkuer).
Das Homoglykan Chitin bildet das Grundgerst des Exoskeletts von Insekten und Crustaceen

Chitin besteht aus -1,4-verknpftem N-Acetyl

64

Kapitel 5 Polysaccharide und Oligosaccharide

1
2
3
4

.. Abb.5.4 Cellulose. Es kommen ausschlielich -1,4-Bindungen vor; die -Konfiguration bedingt, dass aufeinanderfolgende
Glucosereste um 180 gegeneinander gedreht sind: Es ergibt sich eine gestreckte Kette ohne Verzweigungen

glucosamin. Im Unterschied zur Cellulose ist beim


Chitin die Hydroxylgruppe an C-2 der Glucosereste
durch eine acetylierte Aminogruppe ersetzt. Chitin
ist wie Cellulose wasserunlslich. Bei Schalentieren
enthlt das Chitingerst oft zustzlich Calciumcarbonat, wodurch der Panzer fester wird.

5
6
7
8
9
10
11
12

5.3 Heteroglykane

13

Neben Glucose und Galactose kommen in Heteroglykanen auch mannigfaltige Derivate von Zuckern
vor (.Abb.5.5), die zum Teil mit Schwefelsure
verestert sind. Die Heteroglykane sind von stark
variabler Gre; kurze Heteroglykane sind meist
kovalent mit Proteinen oder Peptiden verbunden;
lngere Heteroglykane sind Bestandteile der Zellmembran, der extrazellulren Matrix tierischer Gewebe und der Zellwand von Bakterien. Aufgrund
des Mengenverhltnisses zwischen Kohlenhydratund Proteinanteil werden Glykoproteine von Proteoglykanen und Peptidoglykanen unterschieden
(.Tab.5.1).

14
15
16
17
18
19
20

.. Abb.5.5 In Heteroglykanen vorkommende Zuckerderivate

Bei Glykoproteinen berwiegt der Proteinanteil Die Oligosaccharide sind N- oder O-glykosi-

disch zumeist an -Schlaufen globulrer Proteine


gebunden (Abschn.22.6). Die Heteroglykanketten
sind nicht Teil der kompakten Proteinstruktur, sondern wasserlsliche Anhngsel. Die Glykosylierung

65
5.3Heteroglykane

.. Tab.5.1 Vergleich Proteoglykane und Glykoproteine


Bezeichnung

Kohlenhydrat

Nichtkohlenhydrat

Funktion

Glykoproteine

Oligosaccharide aus 220


verschiedenen Mono
sacchariden

Verschiedenste Proteine

Vielseitig, vom Protein und Zelltyp


abhngend; u.a. zellspezifischer
Marker fr Zell-Zell-Erkennung

Proteoglykane
(vgl. .Abb.5.6)

Glykosaminoglykane mit
sich wiederholenden Di
sacchariden; Moleklmasse
21033106

Einfach aufgebaute Proteinskelette (Kernprotein)

Bestandteil der extrazellulren


Matrix

Peptidoglykane
(vgl. .Abb.5.7)

Disaccharid aus N-Acetyl


glucosamin und N-Acetyl-
muraminsure

Peptide aus 45Aminosuren

Bestandteil der bakteriellen


Zellwand

kann gewisse Eigenschaften eines Proteins verndern, z.B. die Resistenz gegen Proteasen erhhen
und die Verweildauer im Blut verlngern.
Lectine
Zelloberflchenproteine von Pflanzen, Tieren
und auch Bakterien, welche spezifisch gewisse
Zuckerreste binden und zur Zell-Zell-Erkennung dienen. Im Labor werden Lectine zur
Affinittschromatographie von Zuckern und
Glykoproteinen benutzt:
Concanavalin A aus einer Bohnenart bindet -D-Glucose- und -D-Mannosereste,
Weizenkeim-Agglutinin bindet -N-Acetylmuraminsure- und -N-Acetylneuraminsurereste.

hnlich und bilden die viskoelastische, druckstabile


Komponente der Grundsubstanz des Binde- und
Sttzgewebes.
Hyaluronsure ist ein nichtsulfatiertes Glykosaminoglykan, dessen Disaccharideinheit aus Glucuronat und N-Acetylglucosamin besteht. Sie findet sich an Zelloberflchen adsorbiert, sowie in der
Gelenkschmiere, im Glaskrper des Auges und in
der Nabelschnurgallerte. Eine Hyaluronsurekette
bildet auch das Rckgrat riesiger Proteoglykankomplexe mit ber 500000Zuckerresten (105kDa).
Untereinheiten aus einem langen Kernprotein mit
angehefteten Heteroglykanketten sind ber ein Verbindungsprotein nichtkovalent mit dem Hyaluronsure-Rckgrat verbunden.

In Proteoglykanen berwiegt der Zuckeranteil

Die entsprechenden Heteroglykane werden als


Glykosaminoglykane oder saure Mucopolysac
charide bezeichnet.
Die Vorsilbe Muco weist
darauf hin, dass sie erstmals aus schleimartigen Sekreten isoliert worden sind (lat. mucus, Schleim).
Die Ketten bestehen aus sich wiederholenden Disaccharideinheiten. Mindestens einer der Zucker
besitzt eine negativ geladene Carboxylat- oder Sulfatgruppe, der zweite Rest ist oft ein Aminozucker.
Proteoglykane bestehen zu etwa 95% aus kurzen
Glykosaminoglykanen, die in Vielzahl kovalent an
ein Protein gebunden sind; diese groen Polyanionen binden Wasser und Kationen und sind sehr gut
wasserlslich. Die langen Ketten der im Folgenden
besprochenen Glykosaminoglykane sind einander

Chondroitinsulfat ist der Hyaluronsure sehr hn-

lich, enthlt jedoch sulfatiertes N-Acetylgalactosamin (NAG-Sulfat) anstelle von N-Acetylglucosamin.


Chondroitinsulfat findet sich an Zelloberflchen
adsorbiert, zusammen mit Hyaluronsure ist es zu-

66

Kapitel 5 Polysaccharide und Oligosaccharide

Keratansulfat und Heparansulfat sind in Vorkom-

men und Bau dem Chondroitinsulfat hnlich, sind


jedoch strker sulfatiert.

2
3
4
5
6
7

Das ebenfalls stark sulfatierte Heparin ist im Gegensatz zu den anderen Heteroglykanen nicht extrazellulr im Bindegewebe, sondern in den Granula von
Mastzellen zu finden. Es wirkt als Antikoagulans
durch Aktivierung von Antithrombin III (Abschn.31.1).

8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.5.6 Proteoglykankomplex aus Knorpel. Ein 400


4000nm langes Hyaluronsuremolekl dient als Rckgrat, an
dem bis zu 100Kernproteine hngen. Jedes Kernprotein trgt
um die 50Keratansulfatketten mit bis zu 250Disaccharideinheiten und etwa 100Chondroitinsulfatketten, die bis viermal
lnger sein knnen. Der Proteoglykankomplex besteht aus
95% Kohlenhydrat und 5% Protein

dem Bestandteil groer Proteoglykanaggregate in


der Grundsubstanz.

Agar aus Rotalgen ist ein Gemisch von Agarose

(linear verknpfte D-Galactose und 3,6-Anhydrogalactose) und Agaropektin. Agar wird zur Herstellung gallertartiger Nhrbden fr Bakterienkulturen und als Trgermatrix fr Elektrophoresen
verwendet.

Heteroglykane sind wichtig fr die Zell-Zell-Erkennung Die Zellen von Tieren besitzen keine

starren Wnde wie Pflanzen oder Bakterien, sondern eine weiche, flexible Oberflche, die oft als
Zellmantel (Cell coat) oder Glykokalix bezeichnet
wird. Die Kohlenhydratbestandteile des Zellmantels stammen von Glykoproteinen und Glykolipiden
der Plasmamembran (Abschn.22.6) wie auch von
adsorbierten Proteoglykanen. Der Zellmantel bildet

67
5.3Heteroglykane

.. Abb.5.7 Peptidoglykan, das Grundgerst der


Zellwand von Bakterien. Die Heteroglykanketten
bestehen aus N-Acetylglucosamin und N-Acetylmuraminsure, die alternierend auftreten und
-1,4-glykosidisch verknpft sind. Ein Tetrapeptid,
z.B. bei E. coli Ala D-Gln Lys D-Ala, setzt am
N-Acetylmuraminsure-Rest an. Das Vorkommen von
D-Aminosuren ist typisch fr bakterielle Zellwnde.
Ein Pentapeptid (Gly5) verbindet die Tetrapeptide
benachbarter Ketten

sich nur auf der Auenseite der Plasmamembran.


Einige Makromolekle, die an die Plasmamembran adsorbiert werden, sind auch Komponenten
der extrazellulren Matrix (z.B. Proteoglykane mit
Hyaluronsure und Chrondroitinsulfat; .Abb.5.6).
Die Plasmamembran geht damit flieend in die extrazellulre Matrix ber.
Vorgnge wie die Bildung eines Gewebes oder
das Erkennen fremder Zellen durch das Immunsystem hngen von der Erkennung einer Zelloberflche durch die Oberflche einer anderen Zelle ab.
Die extrazellulr exponierten Proteine der Plasmamembran sowie die meisten extrazellulren Proteine, z.B. die Proteine des Blutplasmas, sind Glykoproteine. Die Blutgruppenantigene entsprechen
dem Kohlenhydratanteil von Glykoproteinen und
Glykolipiden der Erythrozytenmembran. Bakterien
und Viren haften sich bei der Infektion von Zellen
an bestimmte Kohlenhydratanteile von Glykoproteinen und Glykolipiden der Zellmembran.

Vielfalt der Oligosaccharide


Zellen knnen durch Variieren der Struktur und
Anzahl der Oligosaccharide sowie des Ortes
der Verknpfung mit dem Protein eine groe
Anzahl art- und zellspezifischer Glykoformen
eines Proteins herstellen. Drei Monosaccharid
reste des gleichen Typs gengen, um ber
1000 verschiedene Trisaccharide zu bilden:
Die einzelnen Monosaccharide knnen
miteinander ber verschiedene Hydroxylgruppen verknpft sein.
Die glykosidische Bindung kann - oder
-Konfiguration haben.
Es knnen sich Verzweigungen bilden.

Ein Peptidoglykan bildet die Zellwand von Bakterien Bakterien besitzen auerhalb der Plasma-

membran eine Zellwand. Der wichtigste Bestandteil dieser robusten, doch flexiblen und porsen
Hlle ist das Riesenmolekl Murein, welches als
Sacculus (lat., Sckchen) die ganze Zelle umhllt.
Dieses Peptidoglykan besteht aus langen parallelen Heteroglykanketten, die durch Peptidbrcken
quervernetzt sind (.Abb.5.7). Intakte Zellwnde

68

Kapitel 5 Polysaccharide und Oligosaccharide

1
2
3
4
5
6
7
8
9
10
11
12
13
14

.. Abb.5.8 Die Zellhllen grampositiver und gramnegativer


Bakterien. Bei grampositiven Bakterien besteht die Zellwand
aus bis zu 20Lagen Peptidoglykan. Bei gramnegativen Bakterien, z.B. E. coli, ist das Peptidoglykan hingegen einschichtig.
Darber findet sich allerdings eine zustzliche Membran aus
Lipopolysacchariden, welche die Frbung verhindert. Die
Gramfrbung von Bakterien wurde von Hans Chr. J. Gram
eingefhrt

sind fr Bakterien lebensnotwendig: Bei ldierter


Zellwand kommt es in hypotonem Milieu infolge
des intrazellulren osmotischen Drucks zur Lyse
der Zelle. Nach dem Verhalten bei der sogenannten
Gram-Frbung werden grampositive und gramnegative Bakterien unterschieden (.Abb.5.8).
Archaea besitzen in ihrer Zellwand ein Pseudopeptidoglykan, das sich wesentlich vom Peptidoglykan
der Bakterien unterscheidet.
Das Enzym Lysozym und das Antibiotikum
Penicillin hemmen das Wachstum von Bakterien.
Das im Nasensekret und der Trnenflssigkeit
vorkommende Lysozym spaltet das Murein in
Disaccharide mit angehngten Peptiden. Penicillin hemmt die Synthese des Mureins, indem es als
kcat-Inhibitor mit der Glykopeptid-Transpeptidase
reagiert, welche die Vernetzung des bakteriellen
Zellwand-Peptidoglykans katalysiert:

Entdeckung des Penicillins


Alexander Fleming, Bakteriologe in London,
entdeckte 1922 das Lysozym, als er beobachtete, dass ein Tropfen Nasensekret Bakterien
auflst. Seine ganz groe Entdeckung machte
Fleming 1928, als er in einer Bakterienkultur
beobachtete, dass in der Umgebung des
kontaminierenden Schimmelpilzes Penicillium
notatum keine Bakterien wuchsen. Das erste
Antibiotikum, Penicillin, war entdeckt! Zum
Thema Zufallsentdeckung bemerkte Louis
Pasteur: Dans le champ de lobservation le
hasard ne favorise que lesprit prpar. Auf
Deutsch knnte das etwa heien: Alle haben
Glck, nur merkts nicht jeder!

15
16
17
18
19
20

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514854-0
5.1 Reservehomoglykane
5.2 Strukturhomoglykane
5.3 Heteroglykane
Weiterfhrende Literatur

69

Lipide und biologische


Membranen
Ph. Christen, R. Jaussi, R. Benoit

6.1

Fettsuren70

6.2

Triacylglycerole und Wachse70

6.3

Phospholipide und Glykolipide 72

6.4

Nichtverseifbare Lipide: Steroide,


Terpene und Eicosanoide 73

6.5

Biologische Membranen76

6.6

Membranproteine79

6.7

Durchlssigkeit biologischer Membranen 79

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_6, Springer-Verlag Berlin Heidelberg 2016

70

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 6 Lipide und biologische Membranen

Lipide sind wasserunlsliche Verbindungen, welche


sich durch apolare Lsungsmittel wie Chloroform,
Ether oder Benzol aus Gewebehomogenaten extrahieren lassen. Entsprechend dieser Definition, die
keinerlei Strukturmerkmale anfhrt, sind die Lipide
eine strukturell heterogene Gruppe von Biomoleklen. Auer ihren Lslichkeitseigenschaften ist ihnen
gemeinsam, dass sie aus aktivierter Essigsure (Acetyl-CoA; Abschn.14.2) synthetisiert werden. Zu
den Lipiden zhlt man die Fette (Neutralfette) und
die Lipoide (fetthnliche Substanzen). Ihre Funktionen sind vielfltig:
Bestandteil biologischer Membranen,
Intrazellulre Energiereserve,
Extrazellulre Transportform chemischer
Energie,
Schutzmantel an Oberflchen (Bakterienzellwnde, Pflanzenbltter, Insektenintegument,
Haut von Vertebraten),
Einige Vitamine und Hormone sind Lipide.

--

Jede Zelle besitzt eine Plasmamembran (Zellmembran), die sie gegen auen abgrenzt. Eukaryontische
Zellen besitzen zudem intrazellulre Membranen,
welche im Zellinnern die Zellorganellen abgrenzen.
Die Gesamtflche der intrazellulren Membranen
berwiegt diejenige der Plasmamembran bei weitem. Grundstzlich sind alle biologischen Membranen gleich gebaut: Eine durchgehende Lipiddoppelschicht wirkt als passive Barriere und darin
eingelagerte oder angelagerte Proteine erfllen
die aktiven Membranfunktionen (Stofftransport
durch die Membran, transmembranre Weiterleitung chemischer und physikalischer Signale, durch
Membranpotenziale getriebene Prozesse sowie Verankerung des Cytoskeletts). Plasmamembranen tragen an ihrer Oberflche zudem Kohlenhydrate, die
wichtig sind zur Zell-Zell-Erkennung.

dungen enthalten (einfach oder mehrfach ungesttigte Fettsuren; .Tab.6.1). Bei einer gesttigten
Fettsure besteht freie Drehbarkeit um alle C-C-Bindungen, wobei die wahrscheinlichste Konformation
mit niedrigster freier Energie die gestreckte Kette ist.
Die meisten ungesttigten Fettsuren besitzen eine
Doppelbindung zwischen C9 und C10. Die Doppel
bindungen liegen in der cis- (Z-) Konfiguration vor:

Lnge der Fettsure und Anzahl der Doppelbindungen bestimmen Schmelzpunkt Der Schmelz-

punkt liegt umso tiefer, je krzer die Kohlenwasserstoffkette ist und je mehr Doppelbindungen die
Fettsure besitzt (.Tab.6.1). Eine cis-Doppelbindung bewirkt einen Knick in der Kette, welcher die
regelmige Moleklpackung strt. Mehrfach ungesttigte Fettsuren werden starr und verkrzt.

6.1 Fettsuren

Lange unverzweigte Monocarbonsuren, v.a. die


Fettsuren mit 12 bis 24C-Atomen, sind Bausteine
vieler Lipide. Die Fettsuren in natrlichen Lipiden
besitzen eine gerade Anzahl von Kohlenstoffatomen,
weil sie aus C2-Einheiten (Acetyl-CoA) synthetisiert
werden. Sie knnen eine oder mehrere Doppelbin-

6.2

Triacylglycerole und Wachse

Triacylglycerole (Neutralfette, Triglyceride) sind


die quantitativ wichtigsten Lipide bei Eukaryonten Sie sind Ester des dreiwertigen Alkohols Gly-

71
6.2 Triacylglycerole und Wachse

.. Tab.6.1 Die am hufigsten vorkommenden Fettsuren und ihre Schmelzpunkte


Fettsure

Palmitinsure
Stearinsure
lsure

Anzahl C-Atome
und Anzahl
Doppelbindungen
16:0
18:0

Schmelzpunkt
(C)

cis-Isomer
trans-Isomer

.. Tab.6.2 Fettsuren im Neutralfett der mensch


lichen Leber
Massenanteil (%)
Palmitinsure 16:0

24

63

Stearinsure 18:0

70

lsure 18:1

43

Linolsure 18:2

18:1

20

13

Linolenure 18:3

45

Arachidonsure 20:4
a

Linolsure

18:2

Linolensure

18:3

11

Arachidonsure

20:4

49

cerol (Glycerin) mit drei Fettsuren. Sie bilden das


Reservefett und werden v.a. im Fettgewebe in spezialisierten Zellen gespeichert.

a
a

Alle Doppelbindungen in cis-(Z)-Konfiguration

Hydroxylgruppen des Glycerols sind mit verschiedenen Fettsuren verestert; dabei kommen mehr ungesttigte als gesttigte Fettsuren vor (.Tab.6.2).
Als Bausteine des Reservefettes sind langkettige
Fettsuren am gnstigsten, da sich auf diese Weise
viel Energie in osmotisch nicht wirksamen ltropfen speichern lsst. Reservefett und Membranlipide
sind bei Krpertemperatur flssig. Bei Raumtemperatur feste Triacylglycerole werden als Fett, flssige
als l bezeichnet. Triacylglycerole lassen sich durch
alkalische Hydrolyse spalten (Verseifung; eine Seife
ist das Alkalisalz einer Fettsure ):
Triacylglycerol+3 NaOH
Glycerol+3Seifen
Die in geringer Menge vorkommenden Mono- und
Diacylglycerole entstehen als Zwischenprodukte des
Fettstoffwechsels.

Wachse sind Ester langkettiger Fettsuren mit


langkettigen einwertigen Alkoholen Bei Wirbel-

tieren werden Wachse von den Hautdrsen ausgeschieden, um die Haut geschmeidig, gleitfhig und
wasserabstoend zu halten. Auch Haare und Federn
sind mit wachsartigen Sekreten berzogen. Besonders die Seetiere bilden und verwenden Wachse in
groen Mengen. Auch die Bltter und Frchte vieler
Pflanzen sind mit einer Wachsschicht berzogen.
Bienen bauen ihre Waben mit Wachs.
Die meisten der natrlich vorkommenden Neutralfette sind gemischte Triacylglycerole, d.h. die drei

1
2
3
4
5

72

Kapitel 6 Lipide und biologische Membranen

6.3

Phospholipide und Glykolipide

Phospholipide sind polare Lipide Sie besitzen

neben zwei langen hydrophoben Kohlenwasserstoffketten eine bei pH7 negativ geladene Phosphatgruppe und weitere ionische oder polare Gruppen.
Ihr amphiphiler Charakter ist wichtig fr die Struktur biologischer Membranen.

Glycerolphosphatide sind Bestandteile von


Membranen und von Lipoproteinen im Blut-

6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Bei Sphingosinphosphatiden bildet Sphingosin


den Kern des Molekls Sphingosin ist ein lang-

kettiger ungesttigter Aminoalkohol. Die zweite


Kohlenwasserstoffkette der Sphingolipide liefert
ein Fettsurerest, der ber eine Amidbindung ans
Sphingosin gebunden ist. Der hufigste Vertreter
der Sphingosinphosphatide ist das Sphingomyelin.

plasma Wie bei den Triacylglycerolen bildet Glycerol den Kern des Molekls. Anstelle eines dritten
Fettsurerests enthalten Glycerolphosphatide eine
Phosphatgruppe und eine zustzliche Alkoholkomponente. Die am hufigsten vorkommenden Glycerolphosphatide sind Phosphatidylethanolamin
und Phosphatidylcholin (Lecithin). Daneben kommen Phosphatidylserin und Phosphatidylinositol
vor, die analog aufgebaut sind.

73
6.4 Nichtverseifbare Lipide: Steroide, Terpene und Eicosanoide

6.4

Nichtverseifbare Lipide:
Steroide, Terpene
und Eicosanoide

Alle bisher besprochenen Lipide sind verseifbar. Zu


den nichtverseifbaren Lipiden, die keine Ester- oder
Amidbindungen enthalten, gehren die Steroide,
Terpene und Eicosanoide.

Die Steroide sind formal Derivate des Sterans


Quantitativ am wichtigsten ist das Cholesterol
(Cholesterin), ein Bestandteil der eukaryontischen

Zellmembran. Cholesterol ist auch die Ausgangssubstanz zur Synthese von Gallensuren, Steroidhormonen und Vitamin D.

C
A

Glykolipide sind glykosylierte Derivate von


Acyl-Sphingosin Sie enthalten wie die Sphin-

gosinphosphatide einen Fettsurerest, hingegen


als polaren Teil einen oder mehrere Zuckerreste
anstelle der Phosphatgruppe und dem zweiten Alkohol. Cerebroside enthalten einen einzigen Zuckerrest (z.B. Galactose) und finden sich besonders
hufig in den Myelinscheiden der Nervenzellen.
Ganglioside enthalten mehrere Zuckerreste. Sie
kommen in Membranen, besonders von Nervenzellen, vor. Die hufigsten Zuckerkomponenten sind
Glucose, Galactose, N-Acetylglucosamin, N-Acetylgalactosamin oder N-Acetylneuraminsure
(.Abb.6.1).
Die wichtigsten Strukturmerkmale der polaren
Membranlipide sind in .Tab.6.3 zusammengefasst.

--

Drei

fettlsliche

Vitamine

sind

Terpene

(.Abb.6.2):
Vitamin A, ein Carotinoid. -Carotin, eine
Vorlufersubstanz von Vitamin A, enthlt
zahlreiche konjugierte Doppelbindungen und
kommt besonders reichlich in Karotten (Mhren) vor, denen es die gelb-rote Farbe gibt.
Vitamin E, ein Tocopherol.
Vitamin K, ein Phyllochinon.
Eicosanoide (Prostaglandine und Thromboxane)
sind Derivate der Arachidonsure, einer mehrfach
ungesttigten C20-Fettsure (gr. eikosi, zwanzig)

Die Prostaglandine kommen in hoher Konzentration im Prostatasekret vor. Sie werden auch in vielen
anderen Geweben gebildet und wirken als Signalstoffe. Thromboxane leiten sich von den Prostaglan-

74

Kapitel 6 Lipide und biologische Membranen

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.6.1 Glykolipide. Der langkettige Aminoalkohol Sphingosin dient als Kern des Molekls. Der Fettsurerest ist nicht wie
bei den Glycerolphosphatiden ber eine Esterbindung, sondern ber eine Amidbindung an das Sphingosin gebunden

75
6.4 Nichtverseifbare Lipide: Steroide, Terpene und Eicosanoide

.. Tab.6.3 Bausteine der polaren Membranlipide


Phospholipide

Glykolipide

Glycerolphosphatid

Sphingosin-
phosphatid

Cerebrosid

Gangliosid

Alkohol

Glycerol plus zweiter


Alkohol (z.B. Cholin)

Sphingosin plus
zweiter Alkohol

Sphingosin

Sphingosin

Fettsure

Phosphat

Zucker

mehrere

.. Abb.6.2Terpene.
Kohlenwasserstoffe
dieser Klasse entstehen
durch Polymerisation von
C5H8-Einheiten (Isopentenyldiphosphat; Abschn.17.6 und 21.4)

76

Kapitel 6 Lipide und biologische Membranen

dinen ab und finden sich u. a. in den Thrombozyten


(Blutplttchen).

2
3
4
5

Amphiphile Lipide bilden spontan Doppelschichten Die polaren Lipide der Lipiddoppel-

6
7
8
9
10
11

6.5

Biologische Membranen

Funktion ab und variiert von Zelltyp zu Zelltyp:


Funktion

Proteingehalt
(Massen-%)

Myelinscheiden

Elektrischer
Isolator

18

Selektiver
Stoffaustausch
mit Umgebung

44

13

Plasmamembran einer
Leberzelle

14

Innere
Mitochondrienmembran

Stoffaustausch
und vektorielle Prozesse
(oxidative
ATP-Synthese)

76

15
16
17
18
19
20

schicht sind Phospholipide oder Glykolipide und


bestehen demnach aus einem hydrophilen Kopf
und zwei hydrophoben Schwnzen. Bei eukaryontischen Zellen ist zwischen die Lipide Cholesterol
eingelagert.

Membranen sind supramolekulare Strukturen bestehend aus Lipiden, Proteinen (und Kohlenhydraten) Die Zusammensetzung hngt von ihrer
Membran

12

polarer Lipide, deren apolare Ketten eine


hydrophobe Zone im Innern der Membran
bilden.
Die Membranproteine sind globulre Proteine;
sie sind, wie die Membranlipide, amphiphil
und mosaikartig in der Membran verteilt. Sie
sind teils in die Membran eingebettet, teils an
die Membranoberflchen angelagert.
Die Membran ist strukturell und funktionell
asymmetrisch, die Lipide und Proteine der
ueren und inneren Seite sind verschieden.

Je mehr aktive Funktionen eine Membran erfllt,


umso hher ist ihr Proteingehalt. Eine bestimmte
Membran ist immer gleich zusammengesetzt
(. Tab. 6.4).

Eine flssige Lipiddoppelschicht ist die


Grundstruktur jeder Membran In die Lipid-

doppelschicht sind globulre Proteine eingelagert.


Die folgenden Charakteristika zeichnen die Flssigmosaik-Struktur biologischer Membranen aus
(. Abb. 6.3):
Die Membran ist eine zweidimensionale
Lsung bestehend aus einer Doppelschicht

Wie Fettsuren bilden die polaren Membranlipide aufgrund ihrer amphiphilen Eigenschaften
im Wasser spontan supramolekulare Strukturen
(. Abb. 6.4).

Die Lipiddoppelschicht befindet sich unter


physiologischen Bedingungen in flssigem Zustand Die Lipidmolekle knnen rotieren, sich

biegen und lateral diffundieren. Spontaner Seitenwechsel (Flip-flop) von der inneren zur ueren
Schicht und umgekehrt kommt hingegen selten vor.
Die ungleiche Verteilung der Lipide auf die beiden
Seiten der Membran kommt durch ATP-abhngige
Transporter (Flippasen, Floppasen) zustande. Proteinmolekle bewegen sich in der Membran durch
laterale Diffusion (. Abb. 6.5).
Bei Eukaryonten enthalten Plasmamembranen
bis zu einem Molekl Cholesterol pro Molekl polares Lipid (. Tab. 6.4). Cholesterol erniedrigt einerseits die Fluiditt, hemmt aber andererseits den Pha-

77
6.5Biologische Membranen

.. Tab.6.4 Zusammensetzung der Plasmamembran von Zellen hherer Tiere (Richtwerte in Massen-%)
Proteine

50%

Lipide

50%

Cholesterol

25%

Polare Lipide (Schweineerythrozyt)

Kohlenhydrate

110%

Phosphatidylethanolamin

20%

Phosphatidylcholin

20%

Sphingomyelin

20%

Andere

15%

kovalent an Proteine oder Lipide gebunden

.. Abb.6.3 Flssigmosaikmodell biologischer Membranen. Die folgenden Befunde fhrten zum Modell: Polare Lipide bilden
in Wasser spontan Doppelschichten (flchenartig ausgebreitete Vesikel); die Permeabilitt fr kleine Molekle und Ionen
sowie der elektrische Widerstand biologischer Membranen entsprechen einer Lipiddoppelschicht; im Elektronenmikroskop
(Transmission und Gefriertzung) zeigen biologische Membranen eine doppelschichtige Struktur. Das Bild hier stammt aus der
Publikation von S.J. Singer and G.L. Nicolson: Science 175 (1972), 723, worin die Flssigmosaikstruktur biologischer Membranen
erstmals vorgeschlagen worden ist. Die Abbildung gibt eine zu regelmige Struktur der Membran wieder, nicht alle Lipide
haben die gleiche Struktur und auerdem ist bei Eukaryonten Cholesterin ein essenzieller Membranbaustein. Nicht gezeigt
sind der Membran angelagerte Proteine sowie die Kohlenhydratanteile der Glykolipide und Glykoproteine. Das Bild hlt aber
klar das Wesentliche fest: Lipiddoppelschicht, in welche die Proteine mosaikartig eingelagert sind. Wichtig auch, was kein Bild
wiedergeben kann: Biologische Membranen sind dynamische Strukturen, die Lipiddoppelschicht ist flssig, Lipidmolekle
diffundieren schnell und Proteine langsamer in seitlicher Richtung. Die Dicke biologischer Membranen betrgt 57nm, des
hydrophoben Inneren 3nm

78

Kapitel 6 Lipide und biologische Membranen

1
2
3
4
5
6
7
8
9
10

.. Abb.6.4 Supramolekulare Strukturen polarer Lipide in wsserigem Medium. In allen Fllen erreicht das System Lipid/Wasser
ein Energieminimum, indem die hydrophoben Kohlenwasserstoff-Ketten sich aneinanderlagern und den Kontakt mit dem
Wasser meiden (hydrophober Effekt); die polaren Gruppen sind in Kontakt mit den Wasserdipolen. Supramolekulare Strukturen
bilden sich nur mit amphiphilen Lipiden. Neutralfette in Wasser bilden ltropfen ohne hhere innere Ordnung. Aus sterischen
Grnden (zwei Kohlenwasserstoffketten) bilden Membranlipide keine Mizellen. Lipiddoppelschichten schlieen sich hingegen
bei gengender Ausdehnung zu Vesikeln mit abgeschlossenem Innenraum. Experimentell hergestellte Strukturen dieser Art
werden als Liposomen bezeichnet

11
12
13
14
15
16
17
18
19
20

.. Abb.6.5ac Experimenteller Nachweis der lateralen Diffusion von Membranproteinen. aFluoreszenzaufnahme einer Zelle,
deren Membranproteine mit einer fluoreszierenden Gruppe markiert sind. bDurch einen intensiven Lichtpuls werden an einer
zirkumskripten Stelle die fluoreszierenden Gruppen zerstrt (gebleicht). cDurch Diffusion gelangen ungebleichte Membranproteine in den gebleichten Bereich. Membranproteine, welche nicht durch Wechselwirkungen mit der extrazellulren Matrix
oder dem Cytoskelett in ihrer Beweglichkeit eingeschrnkt sind, zeigen eine Diffusionsgeschwindigkeit von mehreren m
min1. Membranlipide diffundieren mit einer Geschwindigkeit von1m s1

senbergang vom flssigen in den festen Zustand der


Lipiddoppelschicht. Cholesterol puffert demnach die
Membranfluiditt gegen Vernderungen der Temperatur. Bei Bakterien bestimmt das Verhltnis von
ungesttigten zu gesttigten Fettsureresten in den
Lipiden die Fluiditt der Membran. Die Membranlipide von E. coli-Bakterien, welche bei 27C wachsen, enthalten gleichviel gesttigte und ungesttigte
Fettsuren; bei 42C finden sich hingegen ber 60%
gesttigte Fettsuren in den Membranlipiden.

Die Fluiditt der biologischen Membran ermglicht Formvernderungen und die Teilung
von Zellen. Membranteile knnen sich berdies
ein- oder ausstlpen, sich abschnren und Vesikel
bilden. Umgekehrt kann ein Vesikel mit einer Membran fusionieren, d.h. ber Vesikelabschnrung
und -fusion knnen Membransegmente zwischen
verschiedenen Membranen ausgetauscht werden,
z.B. zwischen dem endoplasmatischen Retikulum
und der Plasmamembran.

79
6.7 Durchlssigkeit biologischer Membranen

.. Abb.6.6 Einbau von Proteinen in biologische Membranen


Integrierte Membranproteine: Bindung an Membran durch hydrophobe Effekte.
1.Transmembran-Proteine sind durch eine oder mehrere hydrophobe -Helices in der Membran verankert.
2.Verankerung in Membran durch einen kovalent ans Protein gebundenen langkettigen Kohlenwasserstoff.
3.ber Oligosaccharid und Phosphatidyl-inositol (Glykosyl-phosphatidyl-inositol (GPI)-Anker) in Membran verankert.
Periphere Membranproteine:
4.Bindung an Membranproteine durch nichtkovalente Wechselwirkungen

6.6 Membranproteine
Proteine knnen in die Membran integriert oder
peripher der Membran angelagert sein Die Art

des Einbaus richtet sich nach der Funktion des


Proteins (.Abb.6.6). Integrierte Membranproteine knnen mittels Detergenzien (Verbindungen
mit einem polaren und einem apolaren Teil) aus
der Membran herausgelst (solubilisiert) werden;
bei peripheren Membranproteinen gengen hierzu
hohe Salzkonzentrationen oder extreme pH-Werte.
Die Raumstruktur von Transmembranproteinen ist
schwierig zu bestimmen. In vielen Fllen knnen
nur die extramembranren Domnen dieser Proteine kristallisiert werden. Oft ist es jedoch mglich,
in ihrer Aminosuresequenz die 2030Reste langen
hydrophoben Helixsegmente zu erkennen, welche
die Membran durchqueren.
Kohlenhydrate der Membran sind kovalent an
Lipide oder Proteine gebunden Glykolipide und

Glykoproteine kommen nur auf der Auenseite der


Plasmamembran und der dem Cytosol abgewandten Seite anderer Membranen vor, z.B. auf der Innenseite der Membranen des Golgi-Apparats und
des endoplasmatischen Retikulums. Die Kohlenhydrate der Plasmamembran spielen eine wichtige
Rolle bei der Zell-Zell-Erkennung.

Biologische Membranen entstehen durch


selbstorganisiertes Wachstum vorbestehender
Membranen Polare Lipide knnen mit geeig-

neten Detergenzien aus der Membran extrahiert


werden. Bei erneuter Zugabe von Lipiden zu einer derart geschdigten Membran kann sich diese
vollstndig und unter Aufrechterhaltung ihrer
Asymmetrie rekonstituieren. Offenbar entspricht
die Anordnung der Proteine und Lipide einem
Energieminimum.
6.7

Durchlssigkeit biologischer
Membranen

Die Lipiddoppelschicht hat die Funktion einer


Permeabilittsschranke und eines elektrischen
Isolators Der elektrische Widerstand und die

Permeabilitt biologischer Membranen fr Molekle und Ionen entsprechen etwa derjenigen einer Lipiddoppelschicht. Ionen und grere polare
Molekle werden kaum durchgelassen. Die meisten Stoffwechselzwischenprodukte sind polar und
werden daher innerhalb der Zelle gehalten. Hingegen ist die Membran fr apolare und kleine polare
Molekle mehr oder weniger durchlssig. Gase
wie O2, CO2 und auch lipidlsliche Fremdstoffe

80

1
2
3

Kapitel 6 Lipide und biologische Membranen

wie Ethanol, Inhalationsansthetika (fluorierte


Kohlenwasserstoffe), viele Medikamente und Zellgifte diffundieren frei und rasch durch biologische
Membranen.
Inhalationsansthetika

4
5
6

(heute nicht mehr verwendet)

Lachgas

7
8

Desfluran

(hochfluorinierter Methylethylether)

Links auf
Springer Website:

9
10
11
12
13
14
15
16
17
18
19
20

Wasser passiert die Membran nicht als Einzelmolekl, sondern als Moleklhaufen, der sich zwischen
den flexiblen Kohlenwasserstoffketten der Lipide
hindurch bewegt. In spezialisierten Membranen
mit hohem Wasserdurchsatz (z.B. Sammelrohre der
Niere, Dnndarmepithel) bilden Proteine aus der
Familie der Aquaporine selektive Wasserkanle.
Ein Kanal, ein Monomer mit sechs Transmembranhelices, lsst ungefhr 109Wassermolekle pro
Sekunde passieren. Aquaporine kommen in allen
Organismen vor. Besondere Transportproteine
besorgen die Translokation spezifischer Molekle
durch bestimmte Membranen (Kap.26).

http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514858-0
6.1 Fettsuren
6.2 Triacylglycerole und Wachse
6.3 Phospholipide und Glykolipide
6.4 Nichtverseifbare Lipide: Steroide, Terpene
und Eikosanoide
6.5 Biologische Membranen
6.6 Membranproteine
6.7 Durchlssigkeit biologischer Membranen
Weiterfhrende Literatur

81

Nucleinsuren
Ph. Christen, R. Jaussi, R. Benoit

7.1

Struktur und Funktion der Nucleinsuren, bersicht 82

7.2

Mononucleotide82

7.3

Nucleinsuren85

7.4

Chromosomen89

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_7, Springer-Verlag Berlin Heidelberg 2016

82

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 7Nucleinsuren

Die Desoxyribonucleinsure (Deoxyribonucleic acid,


DNA) ist die Trgerin struktureller und regulatorischer genetischer Information. Basische Proteine,
die Histone, verpacken die langen DNA-Doppelhelices der Eukaryonten in die Chromosomen. Ribonucleinsuren (Ribonucleic acids, RNAs) setzen
zusammen mit den Aminoacyl-tRNA-Synthetasen
die genetische Information der DNA in die Struktur
von Proteinen um und sind zudem an der Regulation dieses Vorgangs, der Genexpression, beteiligt.
Die Aufklrung der molekularen Mechanismen
der Vererbung und der Umsetzung des Gens ins
Phn (das krperliche Merkmal) ist einer der eindrcklichsten Erfolge der modernen Naturwissenschaft und hat vor einem halben Jahrhundert das
weite Gebiet der Molekulargenetik erffnet. Die in
der Folge geschaffenen experimentellen Mglichkeiten haben zu bahnbrechenden Fortschritten in der
Biologie und der Medizin gefhrt.

zwischen RNA und RNA. Nach dem zentralen


Lehrsatz der Molekularbiologie wird die Information von DNA ber RNA auf Proteine bertragen,
sie gelangt jedoch nicht von den Proteinen zurck
zu den Nucleinsuren (.Abb.7.1).

7.1

stickstoffhaltigen Basen sind Derivate von Pyrimidin oder Purin.

Struktur und Funktion


der Nucleinsuren, bersicht

7.2 Mononucleotide

--

Mononucleotide erfllen in der Zelle drei ganz


verschiedene Funktionen:

Sie sind die Bausteine der DNA und RNA.


Als bertrger chemischer Energie oder bestimmter Moleklgruppen sind sie Cosubstrate
bei vielen Reaktionen des Stoffwechsels.
Gewisse Mononucleotide sind als Signalstoffe
an der Regulation des Stoffwechsels und anderer Prozesse beteiligt.

Mononucleotide bestehen aus drei typischen


Bestandteilen: Base, Pentose und Phosphat Die

Nucleinsuren sind unverzweigte Polymere aus


Nucleotiden Die genetische Information ist in

der Nucleotidsequenz der DNA verschlsselt. Gene


codieren RNAs; gewisse RNAs codieren Proteine,
andere haben regulatorische, strukturelle oder
katalytische Funktionen. In der eukaryontischen
Zelle befindet sich der Hauptteil der DNA im Kern;
kleine Anteile sind in den Mitochondrien und
Chloroplasten zu finden. Die Gre des Genoms
korreliert (von Pflanzen abgesehen) einigermaen
mit der morphologischen Komplexitt des Organismus (.Tab.7.1). Beim Menschen und bei hheren Tieren hat der grte Teil der DNA (>95%)
keine codierende Funktion sondern erfllt regulatorische und andere, noch unbekannte Aufgaben
(Abschn.9.1).
Die DNA besteht aus zwei komplementren
Polynucleotidstrngen. Die RNA ist hingegen einstrngig. Sowohl bei der Replikation der DNA vor
der Zellteilung als auch bei der Expression der genetischen Information (Transkription und Translation) beruht die Weitergabe der Information auf
spezifischer Basenpaarung: (1) in der doppelstrngigen DNA, (2) zwischen DNA und RNA sowie (3)

Die hufigsten Pyrimidinbasen in Nucleotiden sind

Die beiden wichtigsten Purinbasen sind

83
7.2Mononucleotide

.. Tab.7.1 Gre des haploiden Genoms verschiedener Organellen und Organismena


Anzahl Basenpaare
absolut

Lnge der gestreckten DNA (mm)

Relativ (E.coli=1)

Plasmid pBR322

4,410

0,001

0,0014b

Mitochondrien (Mensch)

1,6104

0,003

0,004b

Virus (Bakteriophage )

4,9104

0,011

0,015b

Chloroplasten (Tomate)

1,4105

0,03

0,04b

Escherichia coli

4,6106

1,00

1,36b

Hefe

1,2107

2,6

3,5c

Arabidopsis thaliana (Ackerschmalwand)

1,2108

27

37c

Drosophila melanogaster

1,8108

39

53c

Maus

3,210

695

945c

Mensch

3,4109

739

1005c

Erbse (Pisum sativum)

4,8109

1043

1418c

Weizen (Triticum sativum)

1,71010

3696

5027c

Die Werte basieren auf der Nucleotidsequenz des Genoms oder, im Fall der Erbse, dem C-Wert (DNA-Gehalt einer
Keimzelle); 109bp1pg=1012g DNA.

In diesen Fllen liegt die DNA als Einzelmolekl vor.

In Eukaryonten ist die DNA auf mehrere Chromosomen verteilt.

.. Abb.7.1 bertragung der Information vom


Gen zum Phn. Die Replikation beruht auf der
spezifischen Basenpaarung zwischen einem
Regulation
DNA-Einzelstrang und den DesoxyribonucleomiRNA
tiden, aus denen der zweite, komplementre
siRNA
Strang synthetisiert wird. Bei der Synthese
der mRNA luft der analoge Vorgang mit
Ribonucleotiden ab. Bei der Translation fhrt
die spezifische Basenpaarung zwischen mRNA
und tRNA zum Einbau einer spezifischen
Aminosure an einer bestimmten Position in der Polypeptidkette. Die durch das Codon vorgegebene Aminosure wird vorher
durch eine entsprechende Aminoacyl-tRNA-Synthetase auf die passende tRNA bertragen. Aminoacyl-tRNA-Synthetasen
dienen somit zusammen mit den tRNAs als bersetzer der Nucleinsure-Information in Protein-Information. Die rRNAs sind
Bestandteile der Ribosomen, der molekularen Maschinen, welche Proteine nach dem von der mRNA vorgegebenen Programm
synthetisieren. Kleine RNAs wie siRNA (small interfering RNA) oder miRNA (micro RNA) erfllen genregulatorische Funktionen;
sie binden an bestimmte mRNAs und regulieren deren Aktivitt (vgl. .Tab.7.3)

Absorptionsmaxima
Pyrimidine und Purine und damit Nucleotide
sowie Nucleinsuren besitzen ein Absorptionsmaximum bei 260nm. Das Absorptionsmaximum der Proteine ist vorwiegend durch
Tryptophanreste bedingt und liegt bei 280nm.

Die Basen zeigen Keto-Enol- bzw. Amin-Imin-Tautomerie:

84

1
2
3
4

Kapitel 7Nucleinsuren

Das Gleichgewicht liegt dabei stark auf der Seite der


Ketoform. Fr korrekte Basenpaarung muss die
Ketoform vorliegen; durch die Enolform knnen
Fehlpaarungen zustande kommen.

Die Pentosen sind Ribose oder Desoxyribose


Monoribonucleotide und RNA enthalten -D-Ri-

bose; Monodesoxyribonucleotide und DNA enthalten hingegen 2-Desoxy--D-Ribose.

In Nucleosiden sind die Pentosen N-glykosidisch


mit den Pyrimidin- oder Purinbasen verknpft. C1
der Pentose ist mit N1 der Pyrimidinbasen bzw. N9
der Purine verbunden:

Die Nucleoside besitzen Trivialnamen, die von


denen der Basen abgeleitet sind und bei den Pyrimidinnucleosiden auf -idin und bei den Purinnucleosiden auf -osin enden. Wenn sie Desoxyribose enthalten, wird dem Namen Desoxy- (engl.
Deoxy-) vorangestellt.

Der erste, ber eine Esterbindung an die Pentose


gebundene Phosphatrest (-Phosphatgruppe) kann
eine Sureanhydridbindung mit einem zweiten
Phosphatrest (-Phosphatgruppe) eingehen. Eine
weitere Sureanhydridbindung fhrt zu einem dritten Phosphatrest (-Phosphatgruppe). Beide Phosphorsureanhydrid-Bindungen sind energiereiche
Bindungen (.Tab.1.4).

5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Nucleotide sind Phosphorsureester der


Nucleoside Die Esterbindung befindet sich an

C3 oder C5 der Pentose.

85
7.3Nucleinsuren

.. Tab.7.2 Terminologie der Basen, Nucleoside und Nucleotide


Base

Nucleosid

Ribonucleosidmonophosphat

Desoxyribonucleosidmonophosphat

Nucleosid
diphosphat

Nucleosid
triphosphat

Adenin

Adenosin A

Adenosinmonophosphat
AMP

Desoxy-AMP
dAMP

ADP/dADP

ATP/dATP

Guanin

Guanosin G

Guanosinmono-phosphat
GMP

Desoxy-GMP
dGMP

GDP/dGDP

GTP/dGTP

Cytosin

Cytidin C

Cytidinmonophosphat CMP

Desoxy-CMP
dCMP

CDP/dCDP

CTP/dCTP

Uracil

Uridin U

Uridinmonophosphat
UMP

UDP

UTP

Thymin

Thymidin dT

dTDP

dTTP

Desoxythymidinmonophosphat
dTMP

Im gentechnischen Labor werden die Riboformen der Nucleoside und Nucleotide auch als rATP, rGTP usw. bezeichnet.

.Tab.7.2 zeigt die Terminologie der Basen und der

daraus abgeleiteten Nucleoside und Nucleotide. Die


hufigsten Nucleotide in der Zelle sind ATP, ADP
und AMP. ATP ist der hauptschliche bertrger
chemischer Energie in der Zelle. Der hydrolytische
Abbau von Nucleinsuren durch Nucleasen liefert
Nucleosid-5-monophosphate.
7.3 Nucleinsuren

Nucleinsuren sind lineare Polymere von Mononucleotiden, welche miteinander durch 3,5-Phosphodiesterbrcken verknpft sind (.Abb.7.2).
hnlich wie bei den Polypeptiden bestehen
die Polynucleotidstrnge aus einer Hauptkette
mit periodischer Struktur (-Phosphat-Pentose-Phosphat-Pentose-) und variablen Seitenketten
(Basen) als Trger der Individualitt und Information. Aus der Verknpfungsart der Nucleotide ergeben sich zwei verschiedene Enden des Nucleinsure-Molekls. Gem bereinkunft schreibt man die
Kette in der Richtung vom 5-Phosphat-Ende zum

3-Hydroxyl-Ende ohne Phosphat. Die Nucleotidse-

quenzen von Oligonucleotiden und Nucleinsuren


werden abgekrzt dargestellt: ACTG (manchmal
auch pApCpTpG).

86

Kapitel 7Nucleinsuren

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.7.2 DNA-Einzelstrang und RNA. Die RNA unterscheidet sich von der DNA dadurch, dass sie Uracil statt Thymin und
Ribose statt Desoxyribose enthlt. Sowohl bei der DNA als auch bei der RNA befindet sich am 5-Ende eine Phosphatgruppe
und am 3-Ende eine freie Hydroxylgruppe

87
7.3Nucleinsuren

Die DNA ist doppelstrngig und bildet eine


Doppelhelix.

2 nm

Zwei helicale, antiparallele Polynucleotidstrnge winden sich rechtsgngig um eine


gemeinsame Achse (Doppelschraube). Die Abbildung ist eine nur leicht modifizierte Version
des Modells, welches von James Watson und
Francis Crick 1953 verffentlicht worden ist.

Terminologie
Rechtsgngige Helix: Jeweils in 53-Richtung gesehen windet sich jeder Einzelstrang
im Uhrzeigersinn um die Helixachse.
Doppelstrngige (double-stranded) und einzelstrngige (single-stranded) Nucleinsuren
werden als dsDNA oder dsRNA bzw. ssDNA
oder ssRNA abgekrzt.

Die Basen liegen im Inneren der Helix, die


hydrophilen Phosphat- und Desoxyribosereste

befinden sich auen. Die Ringebenen der


Basen stehen senkrecht zur Helixachse. Die
Struktur entspricht einer um die Lngsachse
verdrillten Leiter, wobei die Phosphat-Zucker-Ketten die Holme und die Basenpaare die
Sprossen bilden.
Der Helixdurchmesser betrgt 2,0nm. Aufeinanderfolgende Basen sind auf der Helixachse
0,34nm voneinander entfernt. Nach 10Basen
wiederholt sich die Helixstruktur, d.h. die
Ganghhe der Schraube ist 3,4nm.
Die Basenpaarung ist spezifisch: Adenin ist
mit Thymin ber zwei H-Bindungen, Guanin
mit Cytosin ber drei H-Bindungen verbunden. Nur bei A-T und G-C Basenpaaren liegt
jeweils ein H-Donoratom gegenber einem
H-Akzeptoratom. Die glykosidischen Bindungen der Purin-Pyrimidin-Basenpaare sind
immer gleich weit voneinander entfernt, die

Kapitel 7Nucleinsuren

88

Sprossen der Leiter sind immer gleich lang:


Ein Purin-Purin-Paar wre zu lang und ein
Pyrimidin-Pyrimidin-Paar zu kurz.

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die H-Bindungen zwischen den Basen der


komplementren Strnge sowie hydrophobe
Effekte und Van-der-Waals-Krfte zwischen
den aufeinandergestapelten Basen (Base-stacking effects) stabilisieren die Doppelhelix.
Bei der Basenpaarung liegen die beiden
Zuckerreste nicht genau gegenber auf dem
Durchmesser der Doppelhelix, d.h. die
Leitersprossen fhren nicht durch deren
Lngsachse. Die Windungen der beiden
Helices liegen deshalb alternierend nher und
weiter voneinander, an der Oberflche der
Doppelhelix ergeben sich eine groe und eine
kleine Furche.

Die DNA kann neben der Watson-Crick-Doppelhelix, die als B-DNA bezeichnet wird, auch eine
Doppelschraube bilden, in welcher beide Strnge
nicht rechts-, sondern linksgngig verlaufen. Die
Phosphat-Zucker-Hauptkette verluft dabei im
Zickzack, weshalb diese Form Z-DNA genannt wird.
In GC-reichen Segmenten geht B-DNA besonders
leicht in die Z-Konformation ber. Die biologische
Bedeutung der Z-DNA-Struktur ist unklar.

Die Doppelhelixstruktur der DNA hat wichtige


Konsequenzen:

Die Basensequenz auf einem Polynucleotidstrang ist in keiner Weise eingeschrnkt.


Die Anzahl der Adeninreste ist bei allen DNAs,
unabhngig von der Spezies, gleich der Anzahl
der Thyminreste und die Anzahl der Guaninreste ist gleich der Anzahl der Cytosinreste:

A = T

G = C

(Purin) (Pyrimidin) (Purin) (Pyrimidin)


Die Summe der Purinreste ist damit gleich der
Summe der Pyrimidinreste:

ACG DTCC

Bei gegebener Basensequenz des einen Strangs


ergibt sich zwangslufig die Basensequenz des
zweiten Strangs: Die beiden Strnge sind kom-

89
7.4Chromosomen

plementr zueinander und enthalten damit


einander entsprechende Sequenzinformation.
Die Komplementaritt der beiden Strnge
liefert den Schlssel fr das Verstndnis der
Replikation der DNA bei der Zellteilung unter
Erhaltung der genetischen Information.

Ein berhmter Satz


It has not escaped our notice that the specific
pairing we have postulated immediately suggests a possible copying mechanism for the
genetic material. Aus der ersten Mitteilung
von James D. Watson und Francis H.C. Crick
ber das Doppelhelixmodell der DNA: Nature
171 (1953) 737738.

Die Replikation der DNA erfolgt semikonservativ


Bei der Synthese von DNA wird der Doppelstrang

geffnet, und jeder Einzelstrang determiniert jeweils


die Basensequenz eines komplementren Tochterstrangs. Die zwei neuen DNA-Doppelstrnge bestehen je aus einem Elternstrang und einem neu
synthetisierten Tochterstrang:

Die DNA kann schmelzen Bei hheren Tempe-

raturen (7090C) lsen sich die Einzelstrnge


voneinander (Schmelzen, Melting). Dieser mit
der Hitzedenaturierung von Proteinen vergleichbare Vorgang kann sehr einfach anhand der Zunahme der Absorption bei 260nm verfolgt werden.
GC-reiche DNA-Abschnitte haben einen hheren
Schmelzpunkt, da zwischen G und C drei und zwischen A und T nur zwei H-Bindungen zu lsen sind.
Die Renaturierung (Annealing) beim Abkhlen auf
niedrigere Temperatur fhrt zur vollstndigen Wiederherstellung der Doppelhelixstruktur.
Nucleinsuren mit komplementrer Basensequenz knnen hybridisieren Ein DNA-Einzel-

strang kann mit einem anderen DNA-Einzelstrang,


welcher eine grtenteils komplementre Basen-

sequenz aufweist (z.B. das gleiche Protein in einer


anderen Spezies codiert), eine hybride Doppelhelix
bilden. Zur Herstellung eines solchen DNA-DNA-Hybrids werden durch Erhitzen oder hohe pH-Werte
DNA-Einzelstrnge erzeugt und bei tieferer Temperatur und neutralem pH mit der komplementren
DNA hybridisiert. Alle Arten von Hybriden zwischen Nucleinsure-Einzelstrngen kommen vor:
DNA-DNA, DNA-RNA und RNA-RNA.
Die RNA ist in der Regel einstrngig Die kovalente Struktur der RNA unterscheidet sich von der
DNA-Struktur in zweierlei Hinsicht: Der Zucker in
der RNA ist Ribose statt Desoxyribose und anstelle
von Thymin kommt die nichtmethylierte Pyrimidinbase Uracil vor (Abschn.7.2). Die RNA-Molekle
sind mit Ausnahme einiger Virus-RNAs einstrngig.
Durch die Bildung so genannter Haarnadelschleifen
(Hairpin loops) ergeben sich jedoch auch Abschnitte
mit Doppelstrangstruktur. Die Basenpaarung ist nicht
so genau wie bei der DNA-Doppelhelix, z.B. paart
sich Uracil nicht nur mit A, sondern auch mit G.

RNA ist an der Expression der genetischen


Information beteiligt Die Gene bestimmen die

Aminosuresequenzen der Proteine. Die DNA ist


jedoch nicht die direkte Matrize fr die Proteinsynthese. Diese Aufgabe bernehmen mRNA-Molekle
(Kap.10). An der Proteinsynthese sind zudem
tRNA und rRNA beteiligt (.Tab.7.3). Die Auswahl der korrekten Aminosure treffen Aminoacyl-
tRNA-Synthetasen, welche die Aminosure kovalent an die passende tRNA koppeln (Kap.10).
Kleine RNAs (siRNA und miRNA, Abschn.11.3)
sind genregulatorisch wirksam.
7.4 Chromosomen
Die kleinen Genome von Bakterien und Viren sind
meist ringfrmig Bei Organismen mit kleinem

Genom wie Bakterien (.Tab.7.1) ist die gesamte


Erbinformation in einem oder mehreren ringfrmigen oder seltener linearen DNA-Moleklen enthalten und es sind eine bis ein paar wenige Kopien
des Genoms pro Zelle vorhanden. Die DNA bildet
zusammen mit basischen Proteinen, welche den
chromosomalen Proteinen von Eukaryonten entsprechen, das Nucleoid. Die Mitochondrien und
Chloroplasten der Eukaryonten besitzen ebenfalls

90

Kapitel 7Nucleinsuren

.. Tab.7.3 An der Proteinsynthese beteiligte RNA-Typen (vgl. Abb.7.1)


Massenanteil
in der Zelle (%)

Anzahl Nucleotide

mRNA, messenger RNA


Informationsbertrger von DNA zu Ribosom

variabel

tRNA, transfer RNA


Spezifische Trger der Aminosuren

15

75

rRNA, ribosomale RNA


Bestandteil der Ribosomen (Proteinsynthesemaschinen)

80

Prokaryonten
2900, 1500, 120
Eukaryonten
4700, 1900, 160, 120

snRNA, small nuclear RNA


Bestandteil der snRNPs
in Spleiosomen

wenig

100200

miRNA, micro RNA


Regulation: Abbau der mRNA, Hemmung der Proteinsynthese

wenig

2125

siRNA, small interfering RNA


Regulation: Abbau der mRNA

wenig

1923

2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

ein ringfrmiges DNA-Molekl mit einigen wenigen Genen. Auch die Nucleinsuren der Viren und
Plasmide sind zumeist ringfrmig.
Wie wird die DNA in Bakterienzellen gepackt?
Die gestreckte DNA von E. coli wre etwa 1000-mal
lnger als die Zelle. Das Packungsproblem wird
durch Verdrillung (Supercoiling) der ringfrmigen DNA zur kompakten DNA-Superhelix gelst
(.Abb.7.3). In der Zelle ist die DNA vorwiegend
im negativen Drehsinn verdrillt. Die DNA wird
hierbei in entgegengesetztem Sinn zur rechtshndigen Doppelhelix verdrillt, d.h. fr jede neu entstehende Windung in der Superhelix wird eine Windung in der Doppelhelix aufgehoben. Eine negative
Superhelix begnstigt daher die Trennung der Elternstrnge bei der Replikation.
Eukaryontische DNA ist linear und in Chromosomen verpackt Jedes Chromosom enthlt ein li-

neares DNA-Molekl mit freien Enden. Die gesamte


Lnge der 46 DNA-Molekle in einer diploiden
menschlichen Zelle betrgt etwa 2m; durch basische
Proteine (Histone) und andere Kernproteine wird
die DNA in die Chromosomen verpackt. Die Masse
der Chromosomen verteilt sich etwa hlftig auf DNA
und Proteine. Als Chromosomen wurden ursprnglich die nach Anfrbung im Lichtmikroskop sichtbaren Strukturen in Metaphase-Zellen bezeichnet. Im

Interphase-Kern ist die Struktur der Chromosomen


stark aufgelockert; sie fllen als Chromatin mehr
oder weniger gleichmig den Kernraum aus.

Nucleosomen sind die strukturellen Einheiten


des Chromatins Ein Chromosom ist etwa 10000-

mal krzer als das darin enthaltene DNA-Molekl.


Der hohe Verdichtungsgrad zeigt, dass die DNA
wie alle anderen biologischen Makromolekle nicht
nur eine dynamische sondern auch eine sehr flexible Struktur hat. In Eukaryonten bilden Histone
die Nucleosomen als erste Stufe der verdichtenden
Packung der DNA (.Abb.7.4). Die nucleosomalen
Histone H2A, H2B, H3 und H4 sind kleine Proteine
(102135Aminosurereste), die viel Lys und Arg
enthalten und das Histon-Oktamer, den Kern des
Nucleosoms, bilden. Die positiven Ladungen dieser basischen Seitenketten binden an die negativ
geladenen Phosphatgruppen der DNA. Die elektrische Neutralisierung der negativen Ladungen der
DNA durch die positiv geladenen Histone ist eine
zwingende Voraussetzung fr die dichte Packung
der DNA. H3 und H4 gehren zu den allerkonservativsten Proteinen; offenbar sind praktisch alle
ihre Aminosurereste funktionell wichtig. Das dem
Nucleosom aufgelagerte Histon H1 ist grer (etwa
220Aminosuren), und seine Sequenz ist weniger
konserviert.

91
7.4Chromosomen

11 nm

.. Abb.7.3 Verdrillung ringfrmiger DNA zu einer Superhelix. In Bakterien werden negative Supercoils durch ein
Enzym, die TopoisomeraseII (Gyrase) unter ATP-Verbrauch
eingefhrt. Dabei werden Phosphoesterbindungen in beiden
Strngen der DNA gespalten und nach Vernderung der
Topologie wieder zusammengefgt. Die TopoisomeraseI ermglicht den umgekehrten Vorgang, das Entdrillen der supercoiled DNA. Dabei wird in einer ATP-unabhngigen Reaktion
nur ein Strang gespalten und wieder zusammengefgt.

30 nm

.. Abb.7.4 Packung der DNA in Chromatin. aModell eines


Nucleosoms. Je zwei Kopien der vier nucleosomalen Histonproteine bilden den oktameren Kern des Nucleosoms (H2A,
H2B, H3, H4)2, um welchen die DNA in zwei Schlingen von
insgesamt 146bp gewunden ist. Die Lnge der Linker-DNA
zwischen den Nucleosomen betrgt gewhnlich 55bp, kann
aber je nach Gewebe und Spezies von etwa 10 bis ber
100bp variieren. Histon H1 ist auen angelagert; es bindet an
die DNA, welche zwischen benachbarten Nucleosomen liegt,
und stabilisiert die weitere schraubenfrmige Packung der
Nucleosomen.
bNucleosomenfilament. cChromatinfaser,
entsteht durch Anordnung des Filaments in Schraubenform
(wie hier gezeichnet) oder in Zickzackform. An den weiteren
Verdichtungsstufen (Schleifen, schraubenartige Anordnung
der Schleifen) sind die Nichthistonproteine des Chromatins
beteiligt.

92

1
2
3
4
5
6
7

Kapitel 7Nucleinsuren

Das Nucleosomenfilament (Durchmesser


11nm) faltet sich zu Chromatinfasern von 30nm
Durchmesser auf. ber die noch strker verdichteten Chromatinstrukturen hherer Ordnung, an
deren Stabilisierung die Nichthistonproteine des
Kerns beteiligt sind, ist noch wenig bekannt. Fr die
Replikation und Transkription wird die DNA segmentweise von den Nucleosomen freigesetzt. Auch
die fr die Regulation der Transkription wichtigen
Transkriptionsfaktoren (Abschn.11.2) binden an
nucleosomenfreie DNA-Abschnitte.
Die ringfrmigen Genome der Mitochondrien
und Chloroplasten sind nicht in Nucleosomen
verpackt. In Spermien, deren DNA ja nicht transkribiert wird, sorgen basische Protamine anstelle
der Histone fr eine besonders dichte Packung der
DNA.

8
9
10
11
12
13
14
15
16
17
18
19
20

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514843-0
7.1 Struktur und Funktion
der Nucleinsuren, bersicht
7.2 Mononucleotide
7.3 Nucleinsuren
7.4 Chromosomen
Weiterfhrende Literatur

93

Molekulare Genetik
Kapitel 8

Replikation, Reparatur und Rekombination


der DNA95
Ph. Christen, R. Jaussi, R. Benoit

Kapitel 9

Transkription: Biosynthese der RNA 107


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 10

Translation: bersetzung des Gens ins Phn 117


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 11

Regulation der Genexpression 127


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 12

Plasmide, Viren, Viroide und Prionen 139


Ph. Christen, R. Jaussi, R. Benoit

II

95

Replikation, Reparatur
und Rekombination der DNA
Ph. Christen, R. Jaussi, R. Benoit

8.1

DNA-Replikation bei Prokaryonten 96

8.2

DNA-Replikation bei Eukaryonten 100

8.3

DNA-Schden und Reparatursysteme 102

8.4

Genetische Rekombination105

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_8, Springer-Verlag Berlin Heidelberg 2016

96

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 8 Replikation, Reparatur und Rekombination der DNA

Die Verdoppelung der DNA ist Voraussetzung fr


die mitotische Zellteilung: Fr die beiden Tochterzellen wird je eine identische Kopie der DNA
bereitgestellt. Die DNA-Biosynthese verluft in
drei Phasen: Initiation, Elongation und Termination. Die Weitergabe der genetischen Information
beruht auf spezifischer Basenpaarung. Die DNA
wird semikonservativ repliziert, die DNA-Doppelhelices der Tochtergeneration bestehen aus
je einem der beiden Elternstrnge und einem
neusynthetisierten komplementren Tochterstrang. Der Multiprotein-Replikationskomplex
produziert gleichzeitig die zwei neuen gegenlufigen Tochterstrnge. Der eine Tochterstrang wird
kontinuierlich durch Anknpfen eines Nucleotids
nach dem anderen an das 3-OH-Ende verlngert. Der andere Tochterstrang wird ebenfalls in
53-Richtung, jedoch stckweise, synthetisiert
(Okazaki-Fragmente; .Abb.8.1). Die Replikationsmaschinerie berprft die Komplementaritt
der neusynthetisierten Strnge und korrigiert
allenfalls auftretende Fehler. Die hohe Przision
des Replikationsvorgangs zusammen mit hochwirksamen Reparatursystemen garantiert, dass
in einer Sugerzelle im Durchschnitt pro Replikationsrunde nur etwa ein Fehler pro 109 replizierte
Basen eingefhrt wird.
Fehlerfrequenz bei Zellteilung
Das haploide menschliche Genom enthlt
3109Basenpaare (bp). Bei jeder Teilung
einer Zelle sind demnach mehrere Fehler zu
erwarten.

Die DNA-Synthese ist zuerst bei Prokaryonten, insbesondere bei E. coli, eingehend untersucht worden.
Grundstzlich verlaufen die meisten Schritte bei Eukaryonten hnlich. Der Hauptunterschied liegt darin, dass sich bei Eukaryonten mit ihren wesentlich
greren Genomen komplexere Regulationsmechanismen der Genexpression ausgebildet haben.
Die DNA-Reparatursysteme sind frh in der
biologischen Evolution entstanden und funktionieren bei allen Lebewesen auf hnliche Art und
Weise. Sie stabilisieren das Genom und wirken den
Alterungsprozessen und der Tumorentstehung entgegen.

Die Rekombination von Genen und Genteilen


zusammen mit Punktmutationen ermglicht die
genetische Anpassung an vernderte Bedingungen
und die biologische Evolution.
8.1 DNA-Replikation

bei Prokaryonten

Zur DNA-Synthese braucht die DNA-Polymerase


smtliche vier Desoxyribonucleosid-Triphosphate,
Mg2+-Ionen, sowie einen DNA-Matrizenstrang mit
einem damit gepaarten Primer (Startermolekl),
d.h. einen vorbestehenden DNA- oder RNA-Strang
mit freier 3-OH-Gruppe. Die DNA-Polymerase
katalysiert das Anfgen einer Desoxyribonucleotid-Einheit nach der anderen an das 3-OH-Ende des
wachsenden Strangs; der neue Strang kann nur in
53-Richtung verlngert werden (.Abb.8.2).
Terminologie
Die 53-Richtung wird beibehalten fr
die Synthese von RNA und das Ablesen der
Codons bei der Proteinsynthese. Diese Richtung wird als stromabwrts (downstream)
bezeichnet.

Beide Strnge der Eltern-DNA dienen je einem


Molekl der DNA-Polymerase als Matrize Die
Replikationsgabel, an welcher die Replikation vor

sich geht, bewegt sich lngs der Eltern-Doppelhelix, wobei sich die Replikationsgabel fortwhrend
weiter ffnet (.Abb.8.1). Der Leitstrang (Leading
strand), der in Richtung auf die Replikationsgabel
wchst, wird ohne Unterbrechung synthetisiert.
Bakterielle DNA-Polymerasen koppeln etwa
500Nucleotide pro Sekunde an das 3-OH-Ende
des wachsenden DNA-Strangs. Beim an sich einfachen Prinzip der semikonservativen Replikation ist
sogleich eine Schwierigkeit zu erkennen: Die zwei
Tochterstrnge verlaufen antiparallel zueinander,
die DNA-Polymerase kann jedoch die Tochterstrnge nur in 53-Richtung synthetisieren.
Das Problem der gegenlufigen Verlngerung des
Folgestrangs (Lagging strand), welcher von der
Replikationsgabel wegwchst, wird dadurch gelst, dass er stckweise aufgebaut wird. Die Oka-

97
8.1 DNA-Replikation bei Prokaryonten

.. Abb.8.1 Replikationsgabel mit kontinuierlich synthetisiertem Leitstrang und Folgestrang aus Okazakifragmenten

zaki-Fragmente umfassen 10002000Nucleotide

bei Bakterien und nur 100200 Nucleotide bei


Eukaryonten.
Die DNA-Polymerase braucht einen RNA-Primer Bei Bakterien katalysiert die DNA-abhngige DNA-Polymerase III (Pol III) die Verlngerung

sowohl des Leitstrangs als auch des Folgestrangs;


sie bentigt hierzu ein Starter-Oligonucleotid mit
freier 3-OH-Gruppe. RNA-Polymerasen hingegen brauchen keinen Primer, sie knnen die
Polymerisierung mit einem einzelnen Nucleotid beginnen. Eine besondere RNA-Polymerase,
die DNA-Primase, synthetisiert daher einen dem
Anfang des Eltern-DNA-Strangs komplementren RNA-Primer von etwa 10 Nucleotiden. Die
Synthese des Leitstrangs bentigt nur am Anfang einen RNA-Primer; beim Folgestrang muss
hingegen fr die Synthese jedes einzelnen Okazaki-Fragments ein Primer bereitgestellt werden.
Die Synthese eines Okazaki-Fragments wird abgebrochen, sobald Pol III beim nchsten Primer
angelangt ist. Zur Bildung eines durchgehenden
DNA-Folgestrangs werden die RNA-Primer hydrolytisch abgebaut durch die 5-3-Exonucleaseaktivitt der DNA-PolymeraseI, welche die RNA von
DNA-RNA-Hybriden in einzelne Mononucleotide
spaltet. Die dabei entstehenden Lcken zwischen
den DNA-Abschnitten werden durch dasselbe Enzym mit Desoxyribonucleotiden aufgefllt. Pol I
besitzt drei enzymatische Aktivitten: 5-3-Exonuclease zum Entfernen von RNA-Primern, Polymerase zum Ankoppeln von Desoxynucleotiden
und 3-5-Exonuclease fr das Korrekturlesen (s.
unten).

.. Abb.8.2 Verlngerung der Polynucleotidkette durch


DNA-Polymerase. Ein Desoxyribonucleotid wird an das
3-OH-Ende eines vorbestehenden und mit dem Matrizenstrang basengepaarten Primers (Startstrangs) gekoppelt.
Durch nucleophilen Angriff der freien 3-OH-Gruppe des
Primers auf das -Phosphoratom des Nucleotids entsteht
eine Phosphodiesterbrcke (.Abb.7.2). Auf dieselbe Weise
werden weitere Nucleotide angehngt; der neue Strang
wchst demnach in 53-Richtung. Die Polymerase bildet
die Phosphodiesterbrcke nur, wenn das neue Nucleotid eine
Basenpaarung mit dem Matrizenstrang eingeht. Der Matrizenstrang bestimmt daher, welches Desoxyribonucleotid
(A, G, T, C) an den Tochterstrang gekoppelt wird. Die Reaktion
wird angetrieben durch die Spaltung von zwei energiereichen
Phosphorsureanhydridbindungen: NTP +H2O NMP +PPi
und PPi +H2O 2 Pi. Die Hydrolyse von PPi wird durch die in
allen Zellen vorkommende Pyrophosphatase (anorganische
Diphosphatase) katalysiert

Die DNA-Ligase verknpft die einzelnen


DNA-Stcke DNA-Ligasen verknpfen gespal-

tene Phosphodiesterbrcken in einem Strang eines DNA-Doppelstrangs. Brche im Strang (engl.


Nicks), wie sie zwischen den einzelnen aufgefllten
Okazaki-Fragmenten bestehen, werden ebenfalls
auf diese Weise repariert. Die Energie fr diese
Reaktion wird bei E. coli durch Koppelung an die
Hydrolyse von NAD+ (.Abb.14.2) zu Nicotinamid-Mononucleotid+AMP und bei Eukaryonten

98

Kapitel 8 Replikation, Reparatur und Rekombination der DNA

ist; (2) Pol III, welche den grten Teil der DNA
synthetisiert, wie auch Pol I besitzen zudem eine
korrekturlesende 3-5-Exonucleaseaktivitt, die
ungepaarte, d.h. dem Matrizenstrang nicht komplementre, Nucleotide vom wachsenden 3-Ende
entfernt.

1
2
3
4

/
/

5
6
7
8
9
10
11
12
13
14
15
16
17

.. Abb.8.3DNA-Ligase. Ein AMP-Rest, der von NAD+ (bei


E.coli) oder ATP (bei Eukaryonten) stammt, aktiviert die freie
5-Phosphatgruppe des Downstream-Segments. Durch nucleo
philen Angriff der 3-OH-Gruppe des Upstream-Segments auf
das entstandene Phosphorsureanhydrid entsteht die beide
Segmente verbindende Phosphodiesterbrcke

durch die Hydrolyse von ATP zu AMP+PPi geliefert (.Abb.8.3).


Blunt-end ligation in Gentechnik
Die ATP-abhngige DNA-Ligase des Bakteriophagen T4 kann bei hohen DNA-Konzentrationen zwei beliebige glattendige DNA-Duplexe
miteinander verbinden (Blunt-end ligation).

18
19
20

Zwei Korrekturlese-Mechanismen garantieren die


hohe Genauigkeit der DNA-Replikation: (1) Die
DNA-Polymerasen knnen einen Primer nur ver-

lngern, wenn er einschlielich des Nucleotids am


3-OH-Ende mit dem Matrizenstrang basengepaart

Das Entfernen ungepaarter Nucleotide vom 3-OHEnde erhht die Genauigkeit der Replikation. Die
Fehlerfrequenz von PolIII ist etwa 107, ohne Korrekturlesemechanismen wre sie 106105. Zustzliche Reparatursysteme, die erst nach der Synthese
der DNA wirksam werden, erhhen die Genauigkeit
weiter, so dass die Mutationsrate109 pro repliziertes Basenpaar betrgt.
Die Replikation beginnt am Origin An der bis
zu 300bp langen Startstelle (Origin of replication),
einem DNA-Segment mit vielen A-T Paaren (nur
zwei H-Bindungen!), entsteht die Replikationsblase, deren zwei Replikationsgabeln sich in entgegengesetzter Richtung vom Origin weg bewegen.
Das ringfrmige bakterielle Chromosom enthlt
nur ein Origin, dementsprechend bildet sich nur
eine Replikationsblase:

99
8.1 DNA-Replikation bei Prokaryonten

Bildung zweier Replikationskomplexe, die sich in


entgegengesetzter Richtung vom Origin entfernen,
ist die Initiation der Replikation abgeschlossen.
Whrend der Elongation werden der
Leitstrang und der Folgestrang durch je ein helicase-gebundenes Pol III-Molekl synthetisiert,

Zur Bildung der Replikationsblase binden mehrere


Kopien des Initiatorproteins DnaA ans Origin und
ffnen unter ATP-Verbrauch den Doppelstrang. Darauf bindet die DNA-Helicase an den Matrizenstrang
des jeweiligen Folgestrangs und entwindet die DNA.
Das natrlich vorkommende negative Supercoiling
der DNA (.Abb.7.3) erleichtert die Entwindung,
ist aber auf einen negativen Supercoil pro 20bp limitiert. Die Helicase bewegt sich in 53-Richtung
lngs des Matrizenstrangs des Folgestrangs und
zwingt unter ATP-Verbrauch die beiden Strnge
auseinander (.Abb.8.4). Das Binden zahlreicher Molekle des Einzelstrang-Bindungsproteins
(Single-strand binding protein SSB) verhindert, dass
die Einzelstrnge reassoziieren. Nach Synthese von
RNA-Primern durch die DNA-Primase beginnt Pol
III mit der Synthese des Leitstrangs bzw. des ersten Okazaki-Fragments des Folgestrangs. Mit der

.. Abb.8.4 Synthese von


Leitstrang und Folgestrang
durch den Replikationskomplex
von zwei DNA-Polymerase
III-Moleklen und Hilfsproteinen (der Komplex umfasst
weitere Proteine, die hier
nicht aufgefhrt sind). Durch
Bildung einer Schleife der
Folgestrang-Matrize knnen
beide Tochterstrnge gleichzeitig an der Replikationsgabel
synthetisiert werden. Nach
Synthese eines Okazaki-Fragments dissoziiert Pol III vom
Folgestrang und beginnt neu
mit der Synthese am Primer des
nchsten Okazaki-Fragments

welches sich mit der Replikationsgabel vom Origin


wegbewegt. Der Matrizenstrang des Folgestrangs
bildet eine Schleife, so dass beide Polymerasen des
Komplexes an der Replikationsgabel ihren Matrizenstrang in 35-Richtung ablesen knnen
(.Abb.8.4).
Die TopoisomeraseII (DNA-Gyrase; .Abb.7.3)
lst das bei der Wanderung einer Replikationsgabel
auftretende topologische Problem: Bei der ffnung der DNA-Doppelhelix in zwei Einzelstrnge
msste sich die stromabwrts liegende, noch nicht
replizierte, Doppelhelix um ihre Lngsachse drehen.
Da die B-DNA 10bp pro Windung aufweist, msste
jedes Mal, wenn die Replikationsgabel um weitere
10bp vorrckt, eine volle Drehung stattfinden. Bei
der zirkulren DNA von Bakterien ist eine Rotation
gar nicht mglich; es wrden positive Supercoils
(.Abb.7.3) eingefhrt. Bei Eukaryonten knnen
die Chromosomen im Zellkern ebenfalls nicht mit
der notwendigen Geschwindigkeit rotieren. Die
DNA-Topoisomerase II lst das Problem, indem sie
beide Strnge der DNA spaltet. Dadurch werden die

Kapitel 8 Replikation, Reparatur und Rekombination der DNA

100

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

vor und nach der Spaltstelle liegenden DNA-Stcke


frei gegeneinander drehbar; die DNA kann relaxieren und wird danach von der Topoisomerase wieder
ligiert.
Topoisomerase II-Hemmer
Die TopoisomeraseII ist unbedingt notwendig
fr die DNA-Replikation. Hemmstoffe bakterieller oder eukaryontischer TopoisomeraseII
kommen als Antibiotika bzw. Zytostatika in
Frage.

Der Leitstrang und die Okazaki-Fragmente werden kontinuierlich synthetisiert Pol III gleitet

auf dem Matrizenstrang von einer Base zur nchsten und katalysiert die Bildung von vielen tausend
Phosphodiesterbrcken, bevor sie von der DNA
dissoziiert (hohe Prozessivitt von Pol III). Pol I
hingegen, welche die Lcken zwischen den Okazaki-Fragmenten auffllt, bildet nur etwa 20Phosphodiesterbrcken in ununterbrochener Folge. Der
Replikationsgabel-Komplex ist eine Multiproteinmaschine aus zehn verschiedenen Proteinen mit
einer Gesamtmasse von 900kDa, welche die verschiedenen katalytischen Aktivitten (Polymerase,
5-3-Exonuclease, 3-5-Exonuclease) zusammenbringt. Die dimere Struktur des Komplexes erlaubt
die gleichzeitige Replikation beider Elternstrnge
an der Replikationsgabel. Die kontinuierliche bzw.
diskontinuierliche Synthese von Leitstrang und
Folgestrang bedingt den asymmetrischen Bau des
Komplexes, dessen beide Hlften zum Teil aus verschiedenen Polypeptidketten bestehen. Die hohe
Prozessivitt von Pol III ist auf deren zwei -Untereinheiten zurckzufhren, welche eine Klammer
um den Matrizenstrang (Clamp) bilden und den
Komplex der DNA entlang fhren.

--

8.2 DNA-Replikation

bei Eukaryonten

Die DNA der Eukaryonten wird grundstzlich auf


gleiche Weise wie in Prokaryonten synthetisiert
Die folgenden Unterschiede sind hervorzuheben:
Eukaryontische Zellen replizieren die DNA
nur whrend der S-Phase (Synthesephase)
des Zellzyklus (Kap.24). In Bakterien wird

whrend der Zellvermehrung dauernd DNA


synthetisiert.

Tierische Zellen enthalten mindestens


fnf verschiedene DNA-Polymerasen

(.Tab.8.1).
Eukaryontische Chromosomen besitzen viele
Origins of replication. Die DNA-Polymerase
koppelt nur etwa 50Nucleotide pro Sekunde
an, d.h. ist 10-mal langsamer als Pol III von E.
coli. Eine eukaryontische Zelle enthlt zudem
viel mehr DNA (.Tab.7.1). Mit einem einzigen Origin wrde die Replikation des lngsten
menschlichen Chromosoms ber einen Monat
dauern. Auf eukaryontischen Chromosomen
finden sich jedoch Origins im Abstand von
3300Kilobasen (kb). Die Vielzahl der Replikationsgabeln (>10000Origins im menschlichen Genom) verkrzt die Synthesezeit auf
einige Stunden:

Die drei DNA-Polymerasen von E. coli


Pol I: Entfernen der RNA-Primer, Fllen
der entstehenden Lcken im Folgestrang,
Korrekturlesen,
Pol II: Reparatur,
Pol III: Replikation, Korrekturlesen.

Alle vorbestehenden Histone bleiben an der Tochter-Doppelhelix, welche den Leitstrang enthlt,
gebunden. An die Tochter-Doppelhelix mit dem
Folgestrang lagern sich neu synthetisierte Histone.
Eukaryontische DNA ist linear, wodurch sich
bei der Synthese der 5-Enden der Tochterstrnge ein Problem ergibt Nach Entfernen
der RNA-Primer knnen die 5-Enden der

101
8.2 DNA-Replikation bei Eukaryonten

.. Tab.8.1 Funktionen eukaryontischer DNA-Polymerasen


DNA-Polymerase

Synthese von RNA-Primerna und deren Verlngerung mit dNTPs

Reparatur

Replikation der
Mitochondrien- und
Chloroplasten-Genome

Replikation, Korrekturlesen, Reparatur; enthlt


PCNAb

Reparatur,
Replikation

DNA-Polymerase enthlt 5Untereinheiten, darunter eine mit Primase-Aktivitt b PCNA (Proliferating cell nuclear antigen), reagiert mit Seren gewisser Patienten mit Lupus erythematodes, einer Autoimmunkrankheit) bildet Gleitklammer, die wichtig ist fr die Prozessivitt der DNA-Polymerase.

Tochterstrnge nicht aufgefllt werden, weil


fr das Ansetzen der Polymerase kein freies 3Ende vorhanden ist und fr die Synthese eines
Primers ein Matrizenstrang fehlt:

Bei jeder Zellteilung wird die lineare Eukaryonten-DNA unvermeidlich um die Lnge der RNA-Primer gekrzt und an den Enden der Chromosomen
liegende Gene wrden mit der Zeit eliminiert. Das
Problem wird dadurch gelst, dass besonderere
DNA-Abschnitte, die keine genetische Information
enthalten, beide Enden der chromosomalen DNA
verlngern. Diese Telomere (griech. telos, Ende)
werden stckweise bei der Zellteilung geopfert. Die
Telomere aller Eukaryonten sind einander sehr hnlich: Der Matrizenstrang der Telomer-DNA besteht
aus einigen hundert Wiederholungen einer Hexanucleotidsequenz (bei Vertebraten TTAGGG). Der
komplementre Strang ist 1216Nucleotide krzer.
Bei jeder Replikation gehen 50200Nucleotide der
Telomere verloren. Spermien, Oozyten und Zellen,

.. Abb.8.5 Mechanismus der Telomerase. Der Ribonucleo


protein-Komplex fungiert als reverse Transkriptase mit
eingebauter RNA-Matrize. Eine zur repetitiven (TTAGGG)n-Sequenz komplementre RNA ist Teil des Enzymkomplexes
und dient als Matrize fr die Verlngerung des 3-Endes des
Telomerenstrangs. Das 5-Ende wird darauf durch normale
Folgestrangsynthese aufgefllt

welche sich in Kultur permanent teilen (permanente


Zelllinien sowie niedere Eukaryonten wie Hefe),
besitzen Telomerase, einen Protein-RNA-Komplex, der Telomere synthetisiert und sie trotz Zellteilungen auf konstanter Lnge hlt. Als Matrize
dient ein Segment des RNA-Teils der Telomerase
(.Abb.8.5). Somatische Zellen vielzelliger Organismen besitzen hingegen keine Telomerase und
sind daher nicht unbegrenzt teilungsfhig (Abschn.24.5).
Mitochondrien und Chloroplasten besitzen
ihre eigene, ringfrmige DNA, welche durch die

DNA-Polymerase ber einen besonderen Mechanismus repliziert wird. Die DNA menschli-

102

Kapitel 8 Replikation, Reparatur und Rekombination der DNA

.. Tab.8.2 DNA-Schden und zustndige Reperaturprozessea


Agenzien

Rntgenstrahlung
O2-Radikale
Alkylierende Rea
genzien
Spontane Reaktionen
(Hydrolyse, Des
aminierung)

UV-Licht
Polyzyklische aromatische Kohlenwasserstoffe

Rntgenstrahlung
Chemotherapien
z.B. cis-Platin, Mito
mycin C

Replikationsfehler

DNA-
Schden

Fehlpaarungen (Uracil)
Basenelimination
Strangbrche
8-Oxoguanin

Pyrimidindimere und
weitere Photoprodukte
Ausgedehnte
DNA-Modifikationen

Quervernetzung
zwischen den beiden
Strngen
Doppelstrangbrche

A-G Fehlpaarungen
T-C Fehlpaarungen
Insertionen
Deletionen

DNA-
Reparatur

Basenexzisions
reparatur

Nucleotidexzisions
reparatur

Rekombinations
reparatur

Fehlpaarungs
(Mismatch)-Reparatur

a
Die unmittelbaren Konsequenzen von DNA-Schden sind Blockierung des Zellzyklus sowie Hemmung der Transkription, Replikation und Chromosomen-Segregation (Abschn.24.3); alles Strungen, welche Apoptose (programmierten Zelltod; Abschn.24.6) auslsen knnen. Irreparable Schden, welche nicht zur Apoptose der betreffenden Zelle
fhren, ergeben Mutationen, die verfrhtes Altern der Zellen oder Krebs und, falls in Keimbahn, Erbkrankheiten zur
Folge haben knnen.

2
3
4
5

8
9
10
11
12
13
14
15
16
17
18
19
20

cher Mitochondrien (16569bp) enthlt die Gene


fr nur 13Proteine sowie fr die 22tRNAs und
2rRNAs, welche zu deren Synthese ntig sind. Die
einzelnen Gene berlappen sich zum Teil, offenbar, um Platz zu sparen. Der genetische Code der
Mitochondrien weicht in vier Codons vom universellen Code ab.
8.3 DNA-Schden

und Reparatursysteme

Unter normalen Bedingungen berwiegen die


endogenen Vernderungen der DNA bei weitem
die Schden, welche durch uere Einwirkung
entstehen Die chemische Labilitt der DNA

hat hufige strukturelle Vernderungen zur Folge.


Die Zahl der spontan auftretenden DNA-Schden
in einer menschlichen Zelle wird auf 100000 pro
Tag geschtzt. Die endogenen Schden umfassen
Replikationsfehler (verursacht u.a. durch falsche
Basenpaarung aufgrund von Basentautomerie;
Abschn.7.2) und Reaktionen mit krpereigenen
Substanzen, insbesondere hydrolytische Depurinierung/Depyrimidinierung und Desaminierung
(A zu Hypoxanthin, das mit C paart; C zu U, das
mit A paart), Oxidationen (insbesondere durch Hydroxylradikale) sowie nichtenzymatische Methylie-

rung durch S-Adenosylmethionin. Exogene Schden knnen durch verschiedene Strahlenarten (UV,
ionisierende Strahlung) und mutagene Agenzien
entstehen. DNA-Schden fhren zu falscher Basenpaarung, seltener zu Deletion oder Rekombination.
Diverse Reparatursysteme beheben unverzglich die allermeisten Vernderungen der DNA
(.Tab.8.2). Zusammen mit der hohen Replikationsgenauigkeit und der biologischen Selektion erhhen sie die biologische Stabilitt der chemisch labilen DNA. Nichtkorrigierte und replizierte, stabile
Vernderungen in der Nucleotidsequenz der DNA
werden als Mutationen bezeichnet. Die hufigste
Mutation ist eine Punktmutation in der Form einer Substitution eines einzelnen Basenpaars. Gewisse DNA-Schden verhindern die Basenpaarung
und es ergeben sich weitere Typen von Mutationen
wie Deletionen oder Insertionen von einem oder
mehreren Basenpaaren. Von den lokal begrenzten
nderungen der Nucleotidsequenz, sind die strukturellen und numerischen Chromosomenaberrationen zu unterscheiden, bei denen grere Chro-

mosomenteile oder ganze Chromosomen fehlen,


Chromosomen verdoppelt sind oder Bruchstcke
ausgetauscht haben.

103
8.3 DNA-Schden und Reparatursysteme

Prfung von Substanzen auf Mutagenizitt


Ames-Test: Ein Teststamm von Salmonella
typhimurium, welcher wegen einer Punktmutation in einem Gen Histidin nicht synthetisieren kann, wird auf ein Kulturmedium
ohne Histidin gegeben. Die Bakterien werden
sich nur vermehren knnen, wenn sie durch
eine Rckmutation die Fhigkeit, Histidin zu
synthetisieren, zurckgewinnen. Die Testsubstanz wird dem Kulturmedium zugegeben; ihre
mutagene Wirkung ergibt sich aus der Anzahl
der sich entwickelnden Kolonien.

Eine hohe Mutationshufigkeit gefhrdet die Lebensfhigkeit von Organismen. Die Mehrheit der
Mutationen beeintrchtigt die Funktionsfhigkeit
der Genprodukte, z.B. die katalytische Aktivitt eines Enzyms (Loss of function). In wenigen Fllen
kommt es zu einem Zugewinn an Aktivitt (Gain of
function), z.B. knnen Mutationen das Zellwachstum beschleunigen und damit kanzerogen wirken.
Die Reparaturmechanismen beheben DNA-Schden, welche die Transkription verhindern oder zu
Mutationen fhren knnten.
Direkte Reparatur Die DNA-Ligase behebt
Einzelstrangbrche und Alkyltransferasen reparieren alkylierte Nucleotide. An O6 alkylierte
Guaninreste sind stark mutagen, da sie hufig
zum Einbau von Thymin statt Cytosin fhren. Die
O6-Methylguanin-DNA-Methyltransferase entfernt diese Methylgruppen. Die DNA-Photolyase
von Bakterien, Pilzen und Pflanzen spaltet Pyrimidindimere. UV-Bestrahlung (200300
nm)
kann zur Quervernetzung von zwei nebeneinanderliegenden Thyminresten fhren (C-C und C-T
Dimere sind seltener). Die Photolyase spaltet die
C-C-Bindungen zwischen den Pyrimidinringen
in einer lichtabhngigen Reaktion (300500nm).
Die Photoreaktion bentigt zwei Cofaktoren. Ein
Chromophor (je nach Spezies N5, N10-Methylentetrahydrofolat oder ein Flavinderivat) vermittelt die
Anregung von FADH, welches seinerseits das zur
Spaltung der C-C-Bindung notwendige Elektron
liefert. Beim Menschen sind direkte Reparaturen
von geringer Bedeutung.
Basenexzisionsreparatur Desaminierte,
methylierte oder anderswie beschdigte Basen

.. Abb.8.6 Reparatur der DNA durch Nucleotidexzision. Der


Reparaturkomplex besteht aus verschiedenen Untereinheiten
und erkennt lokale Vernderungen der Form der DNA-
Doppelhelix, wie sie z.B. bei Thymindimeren zu finden sind.
Der Reparaturkomplex entfernt ein 1020Nucleotide langes
Oligonucleotid an der schadhaften Stelle. DNA-Polymerase
und Ligase fllen und schlieen die entstandene Lcke

werden von basenspezifischen DNA-Glykosylasen


durch hydrolytische Spaltung der N-glykosidischen
Bindung aus der DNA entfernt. Der Desoxyribose-Rest wird dabei nicht entfernt, die Hauptkette
des DNA-Strangs bleibt intakt. Die Stelle ohne Base
wird als AP-Stelle bezeichnet (apurinisch bzw.
apyrimidinisch). AP-Stellen knnen auch durch
spontane Hydrolyse entstehen. Durch eine AP-Endonuclease, DNA-Polymerase und DNA-Ligase
wird der Desoxyribose-Rest entfernt und die Lcke
im Einzelstrang geschlossen.
Warum Thymin statt Uracil in der DNA?
Cytosin wird oft spontan oder durch Nitrit
(NO2) zu Uracil desaminiert. Wenn die DNA
Uracil enthielte, wrde ein Reparaturmechanismus bei einem fehlgepaarten GU-Basenpaar nicht entscheiden knnen, ob es sich um
ein ursprngliches GC- oder AU-Basenpaar
handelt. Weil jedoch in der DNA kein Uracil,
sondern Thymin vorkommt, entspricht ein U
einem desaminierten C. Uracilreste werden
durch die Uracil-N-Glykosylase aus der DNA
herausgeschnitten.

Nucleotidexzisions-Reparatur Ein Stck des

beschdigten Strangs wird herausgeschnitten und


durch neue Nucleotide ersetzt. Zum Beispiel werden bei Tieren Pyrimidindimere auf diese Weise
entfernt (.Abb.8.6).

104

Kapitel 8 Replikation, Reparatur und Rekombination der DNA

2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Replikationsfehler ergeben keine modifizierten Basen


sondern Fehlpaarungen der blichen Basen sowie
Deletionen und Insertionen. Falls ein Fehler den
Korrekturlesemechanismen der DNA-Polymerasen entgangen ist, kann ihn die Mismatch-Reparatur
nachtrglich korrigieren. Hierbei muss nicht nur die
Fehlpaarung im DNA-Duplex erkannt werden, es
muss auch der Tochterstrang, welcher den Fehler
trgt, vom Elternstrang unterschieden werden. Andernfalls wrde in der Hlfte der Flle der Elternstrang dem fehlerhaften Tochterstrang angepasst
und der Fehler damit genetisch fixiert. Bei E. coli
werden Eltern- und Tochterstrang anhand des geringeren Methylierungsgrades des Tochterstrangs
unterschieden: Nach der Replikation wird jeweils
der neue Tochterstrang mit einer gewissen Verzgerung methyliert (meist wird nur ein kleiner Teil
der A- und C-Basen methyliert zur epigenetischen
Regulation der Genexpression; Abschn.11.4); die
Reparatursysteme haben damit etwa zwei Minuten
Zeit, den Tochterstrang vom Elternstrang zu unterscheiden. Zur methylgesteuerten Fehlpaarungskorrektur in E. coli braucht es mehrere Proteine: drei
Mut (Mutator-)Proteine, eine Helicase, eine Exonuclease, das SSB-Protein, Pol III und eine DNA-Ligase (.Abb.8.7).
Homologe der Mut-Proteine finden sich auch
bei Eukaryonten. Defekte in diesen Proteinen fhren beim Menschen zu einer vererbbaren Prdisposition fr gewisse Krebserkrankungen. Allerdings
ist beim Menschen noch unklar, anhand welcher
Merkmale der Tochterstrang erkannt wird.
Rekombinationsreparatur Beschdigte DNA
wird mglicherweise repliziert, bevor der Schaden ausgebessert worden ist. In diesem Fall wird
die Replikation des beschdigten Matrizenstrangs
an der Schadenstelle, z.B. einem Pyrimidindimer,
unterbrochen; der Tochterstrang wird an der entsprechenden Stelle eine Lcke aufweisen. Dieser
Schaden kann nicht durch eine Exzisionsreparatur
behoben werden, da kein intakter Komplementrstrang, der als Matrize dienen knnte, vorhanden
ist. Der Schaden lsst sich jedoch durch Rekombinationsreparatur beheben, indem die Lcke durch das
entsprechende Segment aus dem intakten Schwesterduplex nach dem Mechanismus der genetischen
Rekombination (Abschn.8.4) gefllt wird. AnFehlpaarungs-(Mismatch-)Reparatur

.. Abb.8.7 Methylierungsgesteuerte Mismatch-Reparatur


in E. coli. Die Fehlpaarung G-T uert sich in einer lokalen
Deformierung der DNA-Doppelhelix, welche durch das MutS-
Protein erkannt wird. MutH, ber MutL mit MutS verbunden,
bindet an die nchste GATC-Sequenz, welche nicht methyliert
ist. Damit ist dieser Strang als der neusynthetisierte Strang
identifiziert und wird an dieser Stelle durch MutH gespalten
(nicked). Diese Stelle kann bis 1000bp vom Mismatch entfernt
liegen. Wenn die GATC-Sequenz weit weg vom Mismatch
liegt, wird eine Biegung in der DNA erlauben, die Mut-Proteine in gegenseitigen Kontakt zu bringen. Eine Exonuclease
entfernt nun mit Hilfe von Helicase und SSB-Protein alle
Nucleotide zwischen der Spaltstelle und der Region des
Mismatch, welche MutS identifiziert hat. Die DNA-Polymerase
III fllt dann die Lcke und behebt den Fehler. Die Ligase
beendet den Korrekturvorgang. Um eine Fehlpaarung zu korrigieren, werden unter Umstnden Tausende von Nucleotiden
entfernt

Hereditre Lichtberempfindlichkeit
Xeroderma pigmentosum: eine sehr seltene
Erbkrankheit des Menschen, wird durch
einen Defekt des Nucleotidexzisions-Reparatur-Mechanismus verursacht. Die Unfhigkeit
der Hautzellen, durch UV-Licht verursachte
DNA-Schden zu reparieren, steht im Vordergrund. Es entstehen Lichtschden der
Haut, insbesondere entwickelt sich bei diesen
Patienten hufig Hautkrebs.

105
8.4Genetische Rekombination

schlieend kann der Schaden auf dem ersten Strang


durch die Photolyase oder ber eine Exzision behoben werden.
Auf DNA-Schden reagiert E. coli mit einer
SOS-Reaktion (SOS Response) Das RecA-Protein

bindet an einzelstrngige DNA, wie sie in beschdigter DNA auftritt. RecA wird dadurch aktiviert
und stimuliert die autokatalytische Spaltung und
damit die Inaktivierung des LexA-Repressorproteins. Die SOS-Gene fr mehr als 15 verschiedene
Proteine, die alle an der Reparatur beschdigter
DNA beteiligt sind, werden nun exprimiert. Zu den
SOS-Proteinen gehrt eine besondere DNA-Polymerase, welche, wenn auch mit erhhter Fehlerrate,
ber beschdigte DNA hinweglesen kann.
8.4

Genetische Rekombination

Genetische Vernderungen erlauben die Adaptation einer Spezies an sich verndernde Bedingungen und ermglichen die biologische Evolution.
Die Vernderungen im Genom ergeben sich aus
den oben besprochenen Punktmutationen aber
auch durch den Austausch von DNA-Stcken zwischen verschiedenen Genen. Die Rekombination
von Genen und Genteilen kann die Domnenstruktur von Proteinen, aber auch die quantitative und
zeitliche Steuerung der Expression von Proteinen
verndern. Es werden zwei Typen genetischer Rekombination unterschieden: die allgemeine oder
homologe Rekombination und die ortsspezifische
Rekombination.
Die homologe Rekombination tauscht komplementre Segmente zwischen homologen
DNA-Moleklen aus Die Rekombination beginnt

damit, dass in zwei homologen DNA-Doppelstrngen am gleichen Ort Einzelstrangbrche entstehen.


Die dabei gebildeten freien Enden verbinden sich
bers Kreuz mit den komplementren Einzelstrngen im Nachbar-DNA-Duplex (Crossing over).
Eine Ligase verbindet die Bruchstcke in der neuen
Kombination (.Abb.8.8). Der Kreuzungspunkt
kann sich nach beiden Richtungen verschieben.
Die vierstrngige Holliday-Struktur kann entweder durch Spaltung der crossed-over Strnge oder
durch Spaltung der unvernderten Strnge in zwei
DNA-Duplexe geteilt werden.

In E. coli frdert RecA die homologe Rekombination (RecA stimuliert auch die Autoproteolyse
von LexA zur Auslsung der SOS-Reaktion).
RecA-Molekle assoziieren auf einzelstrngigen
DNA-Segmenten zu langgestreckten Polymeren.
Das RecA-ssDNA-Filament bindet darauf an einen
DNA-Duplex. Die Doppelhelix wird dabei entwunden und nach einer Sequenz abgesucht, welche der
ssDNA komplementr ist. Der Duplex wird weiter entwunden und die ssDNA paart sich mit dem
komplementren Strang des Duplex. Fortgesetzter
Strangaustausch verschiebt den Kreuzungspunkt.

Die ortsspezifische (site-specific) Rekombination fhrt DNA-Segmente in ein Genom ein


Der Ort, an welchem ein DNA-Segment in eine

andere DNA eingefhrt wird, ist in diesem Fall


nicht durch die Basenpaarung zwischen homologen
DNA-Segmenten gegeben, sondern wird durch ein
Rekombinationsenzym bestimmt, welches spezifische Nucleotidsequenzen auf einem oder beiden zu
kombinierenden DNA-Moleklen erkennt.
Die ortsspezifische Rekombination wurde im
Fall des Bakteriophagen (Bakteriophage: ein Virus, das Bakterien als Wirtszellen benutzt) entdeckt,
der auf diese Weise sein Genom in das Chromosom
von E. coli einfhrt. Gelangt das Virus in die Wirtszelle, wird eine viruscodierte Transposase, die -Integrase, synthetisiert, die sowohl an ein bestimmtes
Segment der zirkulren Virus-DNA als auch an eine
bestimmte Sequenz der bakteriellen DNA bindet.
Die Transposase schneidet wie ein Restriktionsenzym (Abschn.39.1) die zwei DNAs, wobei kurze
komplementre Einzelstrangabschnitte (Sticky
ends) entstehen, und ligiert die Virus-DNA in die
bakterielle DNA (.Abb.12.2). Der Vorgang kann
auch in umgekehrter Richtung ablaufen. Ortsspezifische Rekombination liegt auch der Vielfalt von
Antikrpern zugrunde (Abschn.32.4).
Transposons sind mobile DNA-Segmente

Gewisse genetische Elemente knnen aufgrund


ihrer besonderen Struktur leicht ihren Platz im Genom wechseln. Transposons kommen sowohl in
Prokaryonten als auch in Eukaryonten vor. Die einfachsten Transposons sind die Insertionssequenzen mit einer Lnge von etwa 1kb; sie codieren
einzig fr eine hochspezifische Transposase. Komplexe Transposons enthalten auer dem Transposase-Gen und den flankierenden Elementen (Trans-

106

Kapitel 8 Replikation, Reparatur und Rekombination der DNA

posase-Bindungsstellen) weitere Gene, z.B. fr


Enzyme, die bei Bakterien zu Antibiotika-Resistenz
fhren (Abschn.12.1). Bei Eukaryonten werden
Transposons ber eine RNA-Zwischenstufe durch
Retrotranskription (mit Reverser Transkriptase;
Abschn.12.2) nicht nur transponiert (Retro
transposition) sondern auch vermehrt. Aufgrund
von Sequenzhomologie der Retrotransposons und
retroviraler Genome wird angenommen, dass die
eukaryontischen Transposons von Retroviren abstammen.

1
2
3
4
5
6

Links auf
Springer Website:

http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514845-0

8
9

8.1 DNA-Replikation bei Prokaryonten


8.2 DNA-Replikation bei Eukaryonten
8.3 DNA-Schden und Reparatursysteme
8.4 Genetische Rekombination
Weiterfhrende Literatur

10
11
12
13
14
15
16
17
18
19
20

.. Abb. 8.8 Rekombination bers Kreuz, die Holliday-


Junction. Der Austausch homologer Segmente zwischen
zwei DNA-Moleklen wird als allgemeine Rekombination
bezeichnet. Die klassische Genetik gab schon berzeugende
Hinweise auf das Vorkommen solcher Austauschprozesse.
Robin Holliday schlug 1964 dafr das folgende Modell vor:
(1) Zwei homologe DNA-Duplexe lagern sich aneinander;
je ein Strang jedes Duplex wird von einer Endonuclease
gespalten. (2) Ein Ende jedes gespaltenen Strangs dringt in
den Nachbarduplex ein und wird dort mit dem anderen Ende
des gespaltenen Strangs ligiert. (3) Der Austausch der Einzelstrnge kann weitergehen, der Kreuzungspunkt zwischen
den zwei Duplexen kann sich verschieben (Branch migration).
(4)Dieses Zwischenprodukt der Rekombination kann auf zwei
verschiedene Arten geschnitten und wieder ligiert werden.
Eine Rotation (Gedankenexperiment!) des unteren Teils macht
die Topologie verstndlicher. (5) Es knnen die beiden rekombinierten Strnge geschnitten werden (Schnitt x) oder die
beiden unvernderten Strnge (Schnitt y). (6) Fr Fall x und
y ergeben sich diese zwei Strukturen. (7) Ihre Ligation liefert
diese Rekombinationsprodukte

107

Transkription: Biosynthese
der RNA
Ph. Christen, R. Jaussi, R. Benoit

9.1

Initiation108

9.2

Elongation und Termination 111

9.3

Modifikationen des primren Transkriptionsprodukts 111

9.4

Spleien (Splicing)113

9.5

Synthese der tRNA und rRNA 115

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_9, Springer-Verlag Berlin Heidelberg 2016

108

1
2
3
4
5
6
7
8
9
10

Kapitel 9 Transkription: Biosynthese der RNA

Die Expression der proteincodierenden Gene erfolgt


ber RNA als Zwischenstufe: Bei der Transkription
wird die DNA eines Gens in einen RNA-Einzelstrang umgeschrieben. Die Biosynthese der RNA
und die Art der Codierung der genetischen Information sind den entsprechenden Vorgngen bei der
DNA-Replikation hnlich. Durch Basenpaarung
wird der DNA-Matrizenstrang (Minus-Strang) in die
Nucleotidsequenz der RNA transkribiert, wobei die
RNA in 53-Richtung synthetisiert wird (wie die
DNA). Die Nucleotidsequenz der RNA ist danach
identisch mit der Sequenz des codierenden Strangs
der DNA (Plus-Strang) mit der Ausnahme, dass U
statt T eingebaut ist. Die Synthese aller RNA-Typen
(mRNA, tRNA, rRNA, snRNA, miRNA, siRNA
u.a.m.) wird durch DNA-abhngige RNA-Polymerasen katalysiert. Die Anforderungen an die Genauigkeit sind geringer als bei der DNA-Replikation (ein
Fehler pro 104105 eingebaute Nucleotide); ein Korrekturlesen findet nicht statt. Etwa drei Viertel des
menschlichen Genoms werden transkribiert, wovon
die21000 proteincodierenden Gene nur knapp
2% des Genoms ausmachen.

11
12
13
14
15
16
17
18
19
20

Bei der Replikation wird immer das gesamte Chromosom kopiert. Die Transkription hingegen ist
selektiv: In einer gegebenen Zelle werden zu einem
bestimmten Zeitpunkt nur gewisse Gene transkribiert. Das Signal (Erkennungsstelle) fr die Initiation ist ein A- und T-reicher Abschnitt, der Promotor. Damit die Transkription der Gene individuell
reguliert werden kann, muss die RNA-Synthesemaschinerie neben den Start- und Stopp-Signalen auch
regulatorische Sequenzen auf dem DNA-Doppelstrang erkennen.
Die primren Transkriptionsprodukte werden
bei Eukaryonten in vielfltiger Weise verndert.

Diese Reifung (Processing) der RNA verluft bei


den verschiedenen RNA-Typen in unterschiedlicher Weise. Bei der mRNA werden beide Enden
modifiziert und im Falle eukaryontischer mRNA
werden nichtcodierende Abschnitte (Introns) herausgeschnitten (Spleien, Splicing).
9.1 Initiation
Die RNA-Synthese bentigt keinen Primer Die

DNA-abhngigen RNA-Polymerasen verwenden


DNA als Matrize und die Ribonucleotide ATP,
GTP, UTP und CTP als Substrate. Im Unterschied
zur DNA-Synthese wird die Kette ohne Mitwirkung
eines Primers gebildet bzw. um einen Ribonucleosidmonophosphat-Rest verlngert durch nucleophilen Angriff der 3-OH-Gruppe des ersten Nucleotids
(GTP oder ATP) bzw. des wachsenden Strangs auf
das -Phosphoratom eines weiteren Ribonucleosidtriphosphats. Die Synthese wird angetrieben
durch die Hydrolyse des dabei entstehenden Pyrophosphats (PPi). Am 5-Ende neugebildeter mRNA
bleibt eine Triphosphatgruppe bestehen, welche
spter modifiziert wird. Nuclere DNA wird im
Kern transkribiert, die DNA von Mitochondrien
und Chloroplasten in den Organellen.

109
9.1Initiation

Box

-Box

.. Abb.9.1 Prokaryontische und eukaryontische Promotoren im Vergleich. Das erste Nucleotid, welches zu transkribieren ist,
wird mit +1 bezeichnet; das Nachbarnucleotid auf der 5-Seite (d.h. stromaufwrts) wird mit 1 nummeriert. Der Strang mit
den angegebenen Promotorsequenzen entspricht dem +Strang des betreffenden Gens. Die Transkriptionsfaktoren und die
RNA-Polymerase erkennen jeweils beide Strnge der DNA. Die Gre des eukaryontischen Promotors ist nicht genau festgelegt.
Kontrollregionen wie die GC-Box (Consensus-Sequenz GGGCGG), die CAAT-Box (nur diese ist angegeben) und die Octamer-Box
(ATTTGCAT oder ATGCAAAT) knnen fehlen; falls sie vorhanden sind, liegen sie bis zu 200Nucleotide stromaufwrts. Der Buchstabe N in der CAAT-Box bezeichnet irgendeines der Nucleotide A, T, G oder C. Die GC-Box findet sich bei konstitutiven Genen,
deren Expression nicht reguliert wird und die kontinuierlich exprimiert werden (Housekeeping genes)

Prokaryonten besitzen nur eine RNA-Polymerase


Das Enzym von E. coli besteht aus einem Kern
(Core-)Enzym mit vier Untereinheiten (2) und
einer (sigma-)Untereinheit, dem Initiationsfaktor, welcher bei der Initiation das Startsignal, das
Promotorsegment der DNA, erkennt. Der Promotor besteht aus der TATAAT-Sequenz oder einer

hnlichen Sequenz, die sich etwa 10bp stromaufwrts vom Start der RNA-Synthese befindet, sowie
einer weiteren, etwa 35bp stromaufwrts liegenden
Erkennungsstelle fr den Transkriptionskomplex
(.Abb.9.1). Die verschiedenen -Untereinheiten
der RNA-Polymerase erkennen spezifisch unterschiedliche Promotoren und bestimmen damit,
welche Gene transkribiert werden.
Definition
Consensus-Sequenz: Ein Sequenzabschnitt,
der innerhalb einer Gruppe verwandter
DNAs, RNAs oder Proteine nur geringfgig
variiert. Die Consensus-Sequenz gibt fr jede
Position an, welches Nucleotid oder welche
Aminosure dort am hufigsten vorkommt.
Consensus-Sequenzen bleiben erhalten, weil
sie funktionell wichtig sind. Hufig dienen
sie der Erkennung durch andere Molekle.
Die 10 (10bp upstream) Box ist ein Beispiel
fr eine Consensus-Sequenz. Ein Vergleich
vieler solcher Boxen zeigt, dass sich folgende

Nucleotide mit der angegebenen Wahrscheinlichkeit (%) an der jeweiligen Position


befinden: T80A95T45A60A50T96. In der AT-reichen
Promotorregion lassen sich zu Beginn der Transkription die beiden Strnge leichter voneinander trennen, da ein AT-Basenpaar nur 2 statt
3H-Bindungen wie ein GC-Paar besitzt.

Eukaryonten besitzen drei verschiedene Typen


von RNA-Polymerasen:
RNA-Polymerase I im Nucleolus transkribiert

die rRNA-Gene (45S rRNA-Vorlufer).


RNA-Polymerase II im Nucleoplasma synthetisiert die Vorlufer von mRNA sowie einen Teil
der kleinen Kern-RNAs (snRNA, small nuclear
RNA und miRNA, micro-RNA). -Amanitin,
ein Giftstoff aus Amanita phalloides, dem
Knollenbltterpilz, hemmt die RNA-PolymeraseII mit einem Ki von 108M.
RNA-PolymeraseIII im Nucleoplasma synthetisiert die kleinen RNAs wie tRNA, 5S-rRNA
und einen Teil der sn-RNA.

110

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 9 Transkription: Biosynthese der RNA

Das menschliche Genom


Obwohl das menschliche Genom (3109bp)
etwa 1000-mal grer ist als das Genom von
Bakterien, lassen sich in ihm nur etwa 21000
proteincodierende Gene erkennen, d.h. etwa
10-mal mehr Gene als in Bakterien. Nur knapp
2% der menschlichen DNA entsprechen Protein-Genen. Transkriptionsfaktoren bindende
Regionen machen weitere 8% des Genoms
aus. Der grte Teil der restlichen DNA erfllt
regulatorische und strukturelle Funktionen und
enthlt zudem19000RNA-Gene mit regulatorischer, aber auch struktureller und katalytischer Funktion. Derzeit ist die Funktion von
etwa 80% des menschlichen Genoms bekannt.

Allgemeine und genspezifische Transkriptionsfaktoren (Genregulatorproteine) bilden den eukaryontischen Initiationskomplex Die bakteri-

elle RNA-Polymerase beginnt mit der Synthese der


RNA, sobald sie an den Promotor gebunden hat. In
hheren Eukaryonten hingegen startet die Transkription erst nach der Bildung eines Initiationskomplexes aus den allgemeinen Transkriptionsfaktoren (TF) und genspezifischen Regulatorproteinen.
Allgemeine TF werden bei der Initiation der Transkription aller Gene gebraucht und binden in der
Region der TATA-Box ; der Initiationskomplex der
RNA-Polymerase II, welche die proteincodierenden
Gene transkribiert, enthlt die grte Zahl allgemeiner TF (etwa 35 verschiedene Proteine). Die genspezifischen TF erfllen regulatorische Funktionen
und binden an zustzliche, weiter stromaufwrts
liegende Promotorteile oder auch an weiter weg
liegende DNA-Abschnitte (Enhancers, Silencers).
Das Vorhandensein einer TATA-Sequenz in
dem einen oder anderen Strang der DNA bestimmt
den +Strang fr das betreffende Gen; der Strang
fungiert als Matrizenstrang fr die RNA-Polymerase. Die TATA-Box der Eukaryonten gleicht der
A/T-reichen Sequenz im Promotor der Prokaryonten, liegt jedoch 25bp (statt 10bp) stromaufwrts
vom Transkriptionsstart (.Abb.9.1). Ein dort bindendes Protein, der TATA-Faktor (z.B. TATA-Faktor
TFIID/TFIIB fr RNA-Polymerase II oder TFIIIA
fr RNA-Polymerase III), ist notwendig fr das Andocken des allgemeinen Initiationskomplexes.

Die zustzlichen, upstream Promotorteile mit


spezifischen Nucleotidsequenzen binden genspezifische TF. Der allgemeine Initiationskomplex
an der TATA-Box ist ohne diese an upstream Elemente gebundenen genspezifischen TF zu instabil,
um wirksam zu werden. Die genspezifischen TF
bestimmen die Stabilitt des Initiationskomplexes
und damit die Wahrscheinlichkeit, dass er mit der
Transkription beginnen kann. Die Konzentrationen
der genspezifischen TF sind reguliert und variieren
von Zelle zu Zelle und mit deren Bedingungen.
Zu den upstream DNA-Sequenzen, an welche die
genspezifischen TF binden, gehren die GC-Box,
die CAAT-Box und die Oktamer-Box (.Abb.9.1).
Je nach Gen enthlt der Promotor nur einzelne Typen der upstream Promotorelemente, deren Anzahl
berdies variieren kann.
Ein Beispiel von Genregulatorproteinen sind die
Steroidhormonrezeptoren, die als induzierbare TF
durch das Binden von Steroidhormonen aktiviert
werden und danach an ihre upstream Zielsequenz
auf der DNA binden (Abschn.11.2 und 27.5). Verabreichung des weiblichen Sexualhormons stradiol an Hennen erhht ber diesen Mechanismus
die Kopienzahl der Ovalbumin-mRNA in den Eileiterzellen von ungefhr 10 auf 50000 pro Zelle.
Promotoren von Genen, welche durch die Polymerase I oder III transkribiert werden, binden
besondere TF, besitzen aber auch eine TATA-Box.
Zustzliche eukaryontische Transkriptionsfaktoren (zustzliche Genregulatorproteine) binden
an Enhancer und Silencer Bei Eukaryonten wird

die Genexpression in erster Linie auf der Ebene


der Transkription reguliert. Neben den Promotorregionen, die bis zu etwa 200bp stromaufwrts
der Bindungsstelle der RNA-Polymerase liegen
(.Abb.9.1), gibt es als Enhancer (Verstrker) bzw.
Silencer (Abschwcher) bezeichnete genregulatorische Sequenzen, die sehr weit weg vom Promotor
liegen knnen (tausende von bp stromaufwrts oder
stromabwrts, auf dem einen oder anderen DNAStrang und auch innerhalb codierender Abschnitte).
Die zustzlichen Genregulatorproteine erkennen
die spezifischen Basensequenzen der Enhancerund Silencer-Abschnitte. Durch Wechselwirkung
mit dem allgemeinen Transkriptionskomplex beeinflussen die Genregulatorproteine als zustzliche
TF die Stabilitt des Initiationskomplexes und damit

111
9.3 Modifikationen des primren Transkriptionsprodukts

.. Abb.9.2 Transkriptionsblase. Das Modell zeigt, wie der DNA-Duplex vorbergehend entwunden wird, damit sich der
DNA-RNA-Heteroduplex aus Matrizenstrang (in 35-Richtung abgelesen) und der neu in 53-Richtung synthetisierten RNA
bilden kann. An der Elongationsstelle wird ein Ribonucleotid nach dem anderen gem dem Prinzip der Basenpaarung angefgt. Der Elongationskomplex bewegt sich mit der beachtlichen Geschwindigkeit von etwa 50Nucleotiden pro Sekunde

die Frequenz der Initiation der Transkription. Die


flexibel-dynamische Struktur der DNA macht es
mglich, dass sich Proteine, die weitab von der codierenden Sequenz an die DNA binden, am Initiationskomplex beteiligen knnen. Nheres zur Regulation der Transkription findet sich in Kap.11.
9.2

Elongation und Termination

Sobald die COOH-terminale Domne, eine lange


repetitive (Tyr-Ser-Pro-Thr-Ser-Pro-Ser)n-Sequenz,
der RNA-Polymerase II durch eine spezifische Proteinkinase phosphoryliert worden ist (zwei Ser pro
repetierte Einheit), zerfllt der Initiationskomplex,
die RNA-Polymerase wird frei und beginnt mit
der Elongation.
Damit die RNA-Polymerase
den Matrizenstrang (Strang) ablesen kann, entwindet eine Topoisomerase die beiden Strnge der
DNA. Auf einer Strecke von etwa 12bp entsteht ein
DNA-RNA-Heteroduplex. Die Region des Transkriptionskomplexes mit der RNA-Polymerase samt lokal
entwundener DNA und dem Heteroduplex wird als
Transkriptionsblase bezeichnet (.Abb.9.2). Nach
dem Durchgang der RNA-Polymerase verdrillt eine
Topoisomerase die DNA-Einzelstrnge wieder zum
Doppelstrang. Die Kettenverlngerung luft bei allen Genen gleich schnell ab, reguliert wird nur die
Frequenz des Transkriptionsstarts. Die Fehlerfrequenz (105104) ist dem weniger leistungsfhigen
Korrekturlesen entsprechend etwa 105-mal hher
als bei der DNA-Synthese.

Fr die Termination der Transkription sind


bei Prokaryonten besondere DNA-codierte Terminationssignale auf der neusynthetisierten RNA verantwortlich: Sekundrstruktur-Merkmale am 3-Ende
(Haarnadelschleifen) und eine U-reiche Sequenz,
die ein AU-Basenpaar-reiches DNA-RNA-Hybrid
von geringer Stabilitt ergibt, fhren zur Dissoziation der RNA-Polymerase vom Matrizenstrang. Der
Mechanismus der Termination bei Eukaryonten ist
je nach Typ der RNA-Polymerase verschieden. Die
RNA-Polymerase II stoppt mit der Transkription
kurz nach der Synthese des Polyadenylierungssignals (AAUAAA; Abschn.9.3). Nach Dephosphorylierung ihrer C-terminalen Domne ist die PolymeraseII bereit fr die nchste Transkriptionsrunde
und kehrt zurck an den Promotor.
9.3

Modifikationen des primren


Transkriptionsprodukts

Die RNA wird zum Teil schon whrend der Synthese modifiziert. Die Bearbeitung (Processing) des
primren Transkriptionsprodukts ist je nach RNATyp verschieden:
Transfer-RNA und ribosomale RNA werden
stckweise aus lngeren primren Transkripten herausgeschnitten (Abschn.9.5).
Messenger-RNA. Bei Eukaryonten ist das
primre Transkriptionsprodukt der proteincodierenden Gene im Gegensatz zu rRNA oder
tRNA eine hochmolekulare RNA unterschied-

112

Kapitel 9 Transkription: Biosynthese der RNA

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17

.. Abb.9.3 Cap am 5-Ende der mRNA. 7-Methylguanylat ist in umgekehrter Richtung angelagert, indem es ber eine 5-5-Triphosphatbrcke mit dem nchsten Nucleosid verbunden ist. Es sind drei verschiedene Cap-Formen bekannt: In Cap0 ist nur der
Guaninrest methyliert, in Cap1 ist zustzlich die Ribose des nchsten Nucleotids und in Cap2 auch die Ribose des bernchsten
Nucleotids methyliert. Die besonderen strukturellen Merkmale, welche die Cap-Struktur auszeichnen, sind in Blau wiedergegeben

licher Lnge (durchschnittliche Lnge etwa 8kb,


wobei Transkripte bis 20kb mglich sind). Diese
mRNA-Vorlufer werden als Pr-mRNA oder heterogene nuclere RNA (hnRNA) bezeichnet. Noch
im Zellkern wird die Pr-mRNA verkrzt und
modifiziert zur reifen mRNA, welche den Ribosomen als Vorlage zur Proteinsynthese dient. Die
Reifungsreaktionen sind langsam im Vergleich zur
Transkription und dauern etwa 30min. Weniger als
10% der primren Transkripte erscheinen als reife
mRNA-Molekle im Cytosol, der Rest wird im
Laufe der Reifung eliminiert. In einer Zelle kommen 1000020000 verschiedene mRNA-Spezies
vor, einzelne davon nur in wenigen Kopien.
Lnge von mRNA
Die mRNA eines Proteins von 300Aminosureresten ist etwa 1200Nucleotide lang:
3300Nucleotide zur Codierung der Aminosuresequenz plus die Translationssignale und
weitere Signale vor und nach dem codierenden Abschnitt.

18
19
20

Die Reifung (Processing) eukaryontischer PrmRNA zu mRNA umfasst drei verschiedene Vorgnge: Modifikationen an beiden Enden der RNA

und Eliminierung nichtcodierender Abschnitte (Introns) im Innern der Pr-RNA durch Spleien.

Modifikation am 5-Ende (Capping). Kurz


nach Beginn der Transkription wird das 5-Ende
der sich in Synthese befindlichen Pr-mRNA zur
Cap-Struktur (Kappe; .Abb.9.3) umgewandelt. Die
Cap-Struktur schtzt die mRNA vor der Verdauung
durch 5-Exonucleasen und Phosphatasen und ist
auch wichtig fr das Spleien und die Translation.
Modifikation am 3-Ende. Eine Endonuclease
spaltet die hn-RNA 1030Nucleotide nach einem
AAUAAA-Signal. An das dabei neu entstehende
3-Ende der hn-RNA fgt die Poly(A)-Polymerase
einen Poly(A)-Schwanz von bis zu 250Nucleotiden
an. Der Poly(A)-Schwanz scheint, zusammen mit
anderen Faktoren, die Lebensdauer der mRNA zu
bestimmen. mRNAs mit weniger als 15A-Resten
am 3-Ende werden abgebaut (Abschn.9.4).

Gentechnik
Praktische Konsequenz des Poly(A)-Schwanzes: mRNA lsst sich durch Chromatographie
ber eine Oligo(dT)-Sule von anderen
Nucleinsuren trennen.

113
9.4Spleien (Splicing)

9.4

Spleien (Splicing)

In eukaryontischen Genen unterbrechen nichtcodierende Abschnitte die codierende Sequenz

Eine nichtcodierende intervenierende (intra-genische) Sequenz der DNA und auch der Pr-mRNA

wird als Intron, ein proteincodierender (exprimierter) Abschnitt als Exon bezeichnet. Beim Spleien,
d.h. der Reifung der Pr-mRNA zur mRNA, werden
die Introns herausgeschnitten und die Exons zusammengefgt. Bestimmte Signalsequenzen kennzeichnen die Grenzen zwischen Exons und Introns.

Die Lnge und die Dichte (Introns pro Gen) der


Introns variieren von Spezies zu Spezies. Die Gene
niedriger Eukaryonten, z.B. von Hefen, enthalten
nur selten Introns (0,01Intron/Gen), das menschliche Genom enthlt hingegen im Durchschnitt
etwa 8Introns pro Gen. Durch Rekombination von
Exons (Exon shuffling) sind im Verlauf der Evolution neue Proteine entstanden, die in bestimmten
Domnen bereits definierte biologische Aktivitten
besaen (Modulbauweise der Proteine). Introns
kommen auch in RNA-codierenden Genen vor.
snRNPs besorgen das Spleien Das Spleien
findet im Zellkern statt und kann wie das Capping
schon vor Abschluss der Transkription erfolgen.
Das Herausschneiden der Introns und Zusammenfgen der Exons wird durch kleine Ribonucleoprotein-Partikel, die Small nuclear ribonucleoproteins
(snRNP oder Snurps) katalysiert. Die snRNP
binden an die Exon-Intron-bergnge und bilden zusammen mit der hnRNA die sogenannten
Spleiosomen (Spliceosomes). Bei hheren Eukaryonten sind 5 hauptschliche snRNP gefunden
worden, die mit U1, U2 etc. bezeichnet werden, da
ihre kurze RNA (snRNA, 100200Nucleotide) viel
Uracil enthlt.
Ein Intron kann die codierende Sequenz offenbar an beliebiger Stelle, sogar innerhalb eines
Codons, unterbrechen. Die snRNP binden an
Consensus-Sequenzen in der hnRNA. Die exakte
Erkennung der Consensus-Sequenzen wird durch
die snRNA der Snurps gewhrleistet, die mit den

Consensus-Sequenzen Basenpaarungen eingehen.


Das genaue Herausschneiden ist kritisch fr das
Erhalten des Leserasters der Exons.

Ein Lasso-Mechanismus spleit die PrmRNA Ein nucleophiler Angriff der 2-OH-

Gruppe des A-Rests der Intron-Verzweigungsstelle


auf das 5-terminale P-Atom des Introns leitet den
Spleivorgang ein (.Abb.9.4). Es entsteht eine 2,
5-Phosphodiesterbrcke innerhalb des Introns
und damit die Lasso (engl. Lariat)-Struktur. Das
3-OH-Ende von Exon1 wird frei und greift nun
seinerseits die Phosphodiesterbrcke zwischen Intron und Exon2 an. Dadurch werden Exon1 und
2 miteinander verbunden und das Intron in Lassoform freigesetzt. Das Spleien kommt demnach
durch zwei aufeinanderfolgende Umesterungen
zustande. Die beiden Fragmente der Pr-mRNA,
die bei der ersten Umesterung entstehen, werden
bis zur kovalenten Verbindung der Exons durch das
Spleiosom zusammengehalten.
Alternatives Spleien fhrt zu unterschiedlichen Genprodukten Durch Spleien an verschie-

denen Stellen knnen aus der gleichen hnRNA (PrmRNA) verschiedene reife mRNAs gebildet werden.
In solchen Fllen codiert das gleiche Gen mehrere
oder gar sehr viele verschiedenartige Proteine. Eine
Reihe von Proteinen kommt in unterschiedlich langen Versionen mit Deletionen oder Insertionen bestimmter Segmente vor. Typische Beispiele solcher
alternativ gespleiter Proteine sind die Immunglobuline, das Fibronectin der extrazellulren Matrix,

114

Kapitel 9 Transkription: Biosynthese der RNA

1
2
3
4
5
6
7
8
9
10

.. Abb.9.4 Spleien der Pr-mRNA. Die angegebenen Sequenzen an den beiden Spleistellen (Splice sites) und am Verzweigungspunkt (Branch site) sind Consensus-Sequenzen. N steht fr irgendeine der vier Basen A, U, G oder C; Y ist ein Pyrimidinnucleotid, Yn eine Sequenz hauptschlich aus Pyrimidinnucleotiden (hufig ist n=10), R ein Purinnucleotid. Die Basen GU zu
Beginn des Introns (5-Ende) und AG an dessen 3-Ende sind obligat. Die Consensus-Sequenzen garantieren eine eindeutige
Erkennung durch die snRNAs der snRNPs und damit die exakte Eliminierung des Introns

11
12
13

die Zelladhsionsproteine (Cell adhesion molecules,


CAMs), und der Vascular endothelial growth factor
(VEGF), ein Wachstumsfaktor. Alternatives, oft gewebespezifisches Spleien trgt wesentlich bei zur
Vielfalt des Proteoms von Eukaryonten.

14
15
16
17
18
19
20

Herausgespleiter Proteinteil

Gestrtes Spleien
Beim systemischen Lupus erythematodes,
einer Autoimmunkrankheit, finden sich Antikrper gegen snRNPs, PCNA (.Tab.8.1) und
weitere nuclere Antigene. Gewisse Formen
der Thalassmie (Mittelmeeranmie, autosomal-rezessiver Defekt der Globinsynthese) sind
auf Mutationen zurckzufhren, die fehlerhaftes Spleien der (seltener der -)Globin-PrmRNA zur Folge haben. Das Spleien strende
Mutationen sind auch bei manchen anderen
Erbkrankheiten gefunden worden.

Gewisse RNA-Molekle sind katalytisch aktiv Bei

niederen Eukaryonten wie Ziliaten oder Pilzen knnen bestimmte RNA-Molekle ihre Introns ohne die
Mitwirkung von Proteinen entfernen. Solche Ribozyme genannten RNA-Molekle besitzen sowohl
Nuclease- als auch Polymeraseaktivitt.

Nach Entfernen aller Introns verlsst die reife


mRNA den Kern Die Bindung an die snRNPs ver-

115
9.5 Synthese der tRNA und rRNA

.. Tab.9.1 Die Genome der Prokaryonten und Eukaryonten enthalten viele rRNA- und tRNA-Gene
Spezies
E. colia
Hefe
Mensch

18S/28S-rRNA
7
140
280

5S-rRNA
7
140
2000

tRNA
60
275
500

Bei E.coli bilden die 3rRNA-Gene jeweils ein Operon. Die 60tRNA-Gene sind teils ebenfalls in diese Operons und
teils in andere Operons integriert.

hindert den Austritt der hnRNA ins Cytosol. Nur


vollstndig gespleite RNA wird unter Mitwirkung
bestimmter Proteine durch die Kernporen ins Cytosol bugsiert. Bei Eukaryonten knnen ins Cytosol
gelangte mRNA-Molekle viele Male nacheinander
(bis zu 1000-mal) als Matrize fr die Proteinsynthese durch Ribosomen dienen

Bakterielle mRNA ist sehr kurzlebig; die Stabilitt eukaryontischer mRNA ist hher, variiert
betrchtlich und wird z.T. reguliert Die Halb-

wertszeiten der meisten bakteriellen mRNAs liegen


im Bereich weniger Minuten. Im Gegensatz dazu
variiert die Halbwertszeit eukaryontischer mRNAs
ber einen weiten Bereich (in Sugerzellen zwischen
10min und 24h). Mit einer Halbwertszeit von etwa
10h ist die Globin-mRNA recht stabil, die Halbwertszeiten kurzlebiger mRNAs von etwa gleich langen Wachstumsfaktoren betragen nur etwa 30min.
Die Stabilitt einer mRNA wird durch ihre Struktur
und insbesondere die Lnge des 3-Poly(A)-Schwanzes bestimmt: je krzer die Poly(A)-Region, umso
instabiler die mRNA. Beim Abbau entfernt zunchst
eine Poly(A)-Nuclease den Poly(A)-Schwanz, darauf wird die Cap-Struktur entfernt, und anschlieend depolymerisiert eine 5, 3-Exonuclease das
restliche RNA-Molekl. Verschiedene Abbaumechanismen sind bekannt: RNA-bindende Proteine
wie Exonucleasen und insbesondere an Ribosomen
gekoppelte Nucleasen bauen gewisse mRNAs bevorzugt ab. Der Abbau gewisser mRNAs wird durch
miRNA reguliert (Abschn.11.3).

9.5

Synthese der tRNA und rRNA

Die verschiedenen tRNAs werden von einem


Mehrfachen an Genen codiert Bei E.coli sind

tRNAs und rRNAs in Operons organisiert. Gene


fr tRNAs kommen hufig auch in rRNA-Operons
vor. Beim menschlichen Genom kommen etwa
50tRNAs und 500tRNA-Gene vor. Die tRNA-Gene
sind tandemartig hintereinander angeordnet mit
nichtcodierenden Zwischensequenzen (Spacer). Die
primren Transkriptionsprodukte werden im Zellkern durch die RNA-Polymerase III synthetisiert
und durch Nucleasen in die einzelnen tRNA-Molekle zerlegt. An deren 3-Ende wird durch die
tRNA-Nucleotidyltransferase die fr tRNA typische
Endsequenz CCA(3) angefgt. Weitere posttranskriptionale Modifikationen umfassen die Modifikation gewisser Basen und, bei Eukaryonten, das
Eliminieren von Introns.
Auch die rRNAs entstehen durch posttranskriptionale Spaltung lngerer RNA-Vorlufermolekle Das Genom von E. coli enthlt 7Ope-

rons mit den 3rRNA-Genen. In eukaryontischen


Genomen sind die Gene fr die 18S/28S-rRNA
in Tandem-Anordnung viele Male hintereinander wiederholt (.Tab.9.1) Die RNA-Polymerase
I synthetisiert im Nucleolus eine lange RNA (45S,
13000Nucleotide). Nach Methylierung an vielen
2-OH-Gruppen wird das 45STranskript durch spezifische Endonucleasen zerschnitten in 18SrRNA
fr die kleine Ribosomen-Untereinheit, sowie in
5.8S und 28SrRNA fr die groe Untereinheit. Die
5SrRNA der groen Untereinheit wird durch die
RNA-Polymerase III synthetisiert. Die kleinen und
groen Untereinheiten der Ribosomen werden im
Nucleolus aus den rRNA und den ribosomalen
Proteinen zusammengesetzt. Die Proteine und die
5S-rRNA werden vom Cytosol bzw. vom Kern dem

116

1
2
3
4
5

Kapitel 9 Transkription: Biosynthese der RNA

Nucleolus zugefhrt. Die kleinen und groen Ribosomen-Untereinheiten gelangen durch die Kernporen ins Cytosol.
Nucleolus
Ein kleines, dichtes, von keiner Membran
umgebenes Krperchen im Kern (Nucleus)
eukaryontischer Zellen, enthlt Ribonucleoproteine fr Synthese und Processing des
45SrRNA-Vorlufers sowie aus dem Cytosol
stammende ribosomale Proteine. In einem
Kern knnen mehrere Nucleoli vorkommen.

6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die rRNA und tRNA werden direkt durch Transkription gebildet, fungieren in der Zelle jedoch auf der
gleichen Ebene wie die Proteine. Bei der Synthese
der Proteine fhrt ein einziges Molekl des Transkriptionsprodukts, d.h. ein mRNA-Molekl, zur
Synthese vieler Proteinmolekle. Bei der Synthese
von rRNA und tRNA kompensiert die erhhte Anzahl von Genen das Fehlen dieses Amplifikationseffekts. Eine wachsende eukaryontische Zelle kann
107Ribosomen enthalten! (NB: Die Histone sind die
einzigen Proteine mit multiplen Genen.)
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514846-0
9.1 Initiation
9.2 Elongation und Termination
9.3 Modifikationen des primren
Transkriptionsprodukts
9.4 Spleien (Splicing)
9.5 Synthese der tRNA und rRNA
Weiterfhrende Literatur

117

Translation: bersetzung
des Gens ins Phn
Ph. Christen, R. Jaussi, R. Benoit

10.1

Der genetische Code 118

10.2

Proteinsynthese, bersicht120

10.3

Bildung der Aminoacyl-tRNA 120

10.4

Initiation, Elongation, Termination123

10.5

Hemmstoffe der Proteinsynthese 126

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_10, Springer-Verlag Berlin Heidelberg 2016

10

118

1
2
3
4
5
6
7
8
9

Kapitel 10 Translation: bersetzung des Gens ins Phn

Die bersetzung der Nucleotidsequenz der DNA


in die Aminosuresequenz der Proteine beruht auf
dem genetischen Code. Die Entzifferung des genetischen Codes besttigte, dass die Nucleotidsequenz
der DNA die Aminosuresequenz der Proteine bestimmt.
Die Dolmetschermolekle, welche die Nucleotidsprache der Gene mit 4 verschiedenen Buchstaben in die Aminosuresprache der Proteine mit
20Buchstaben bersetzen, sind die tRNAs zusammen mit den Aminoacyl-tRNA-Synthetasen, welche die tRNAs mit der zugehrigen Aminosure
aufladen. Die Ribosomen sind die molekularen Maschinen, welche Aminosuren unter Verbrauch von
ATP und GTP zu Polypeptiden zusammensetzen.
Sie bestehen aus rRNA und Proteinen. Die mRNA,
als einzelstrngige, dem +Strang entsprechende
Arbeitskopie der DNA, steuert die Ribosomen und
bestimmt die Aminosuresequenz des Translationsprodukts (.Abb.10.1).

10

10.1

11

In der mRNA kommen 4 verschiedene Basen vor,


die 20 verschiedene Aminosuren codieren Die

12
13
14
15
16
17
18
19
20

Der genetische Code

Buchstaben (A, G, C und U) bilden das Alphabet,


aus dem die Codons (Codewrter) zusammengesetzt sind. Mit vier Buchstaben knnen 43=64
verschiedene Tripletts gebildet werden, mehr als
genug, um die 20 proteinogenen Aminosuren zu
verschlsseln. In der Tat gibt es, mit zwei Ausnahmen, fr jede Aminosure mehr als nur ein Codon.
Synthetische RNA erlaubte die Entschlsselung des
genetischen Codes. Experimente mit Polymeren
eines Nucleotids (z.B. Poly(U): UUUU ) und
Co-Polymeren mit repetitiven Sequenzen von zwei
(z.B. UGUGUGoder GUGUGU) oder drei
Nucleotiden ermittelten die Bedeutung aller 64
mglichen Codons. Dabei lieen sich die folgenden
Regeln erkennen:
Die Codons berlappen nicht und sind nicht
durch Interpunktionszeichen getrennt.
Das Startcodon bestimmt das Leseraster fr
die mRNA.
Deletionen und Insertionen von Basen verschieben das Leseraster und verndern den
Sinn der Sequenz.

Von den 64 mglichen Tripletts codieren


61Tripletts je eine einzige Aminosure. AUG
dient zudem als Startcodon, d.h. als wichtigster Teil des Initiationssignals der Translation.
Die drei Stoppcodons dienen als Terminationssignale. Fr zwei Aminosuren (Trp,
Met) existiert nur je ein Codon, fr andere
gibt es bis zu sechs Codons (Leu, Ser, Arg).
Der genetische Code wird als degeneriert
bezeichnet, weil es fr bestimmte Aminosuren mehrere Codewrter gibt. Der Code ist
jedoch eindeutig, ein gegebenes Codon wird
nur von denjenigen tRNAs erkannt, welche
die entsprechende Aminosure bertragen
(.Tab.10.1).

Der Code ist nach einem bestimmten Prinzip degeneriert In Position3 wird nur zwischen Pyri-

midin und Purin unterschieden; manchmal haben


in dieser Position sogar alle vier Basen die gleiche
Bedeutung. Nur in vier Fllen ist auch die dritte Base
entscheidend: UGA Stopp, UGG Trp; AUG Met und
Start, AUA Ile. Fr jede der 20Aminosuren gibt es
in der Regel mehrere tRNA, die z.T. auch verschiedene Anticodons tragen. Es gibt jedoch auch tRNA,
deren Anticodon degenerierte Codons mit verschiedenen Basen an Position3 erkennt (Wackel- oder
Wobble-Mechanismus). Hier das Beispiel einer
tRNA fr Alanin:

Ala

Warum ist der genetische Code degeneriert? Wre

der Code nicht degeneriert, wrden 20 Codons


den Einbau von Aminosuren und die restlichen
44Codons einen Kettenabbruch bewirken: Der degenerierte Code minimiert die schdlichen Folgen
von Mutationen.
Der genetische Code ist universell Er gilt fr
alle Lebewesen, mit gewissen Ausnahmen bei der
DNA von Mitochondrien und bestimmten Einzellern. Die Vermehrung von Viren in Zellen ist nur
mglich, weil der zellulre Replikations-, Transkriptions- und Translationsapparat die Gene des Virus
interpretieren kann.

10

119
10.1 Der genetische Code

.. Abb.10.1 Translation. Die dem +Strang der DNA entsprechende mRNA enthlt das Programm zur Synthese
des Proteins mit genetisch bestimmter Aminosuresequenz. Die Basenpaarung zwischen dem Codon auf der
mRNA und dem Anticodon der Aminoacyl-tRNA sorgt fr
den Einbau der korrekten Aminosure durch das Ribosom. Voraussetzung dafr ist, dass die jeweilige tRNA mit
der richtigen Aminosure aufgeladen worden ist

.. Tab.10.1 Der genetische Code. AUG codiert nicht nur fr Methionin, sondern ist auch Startcodon, d.h. Teil des Initiationssignals. Ein Codon wird immer in 53-Richtung der mRNA angegeben und entspricht damit der Basensequenz
des +Strangs der DNA
Erste Base (5)

Zweite Base (Mitte)

Dritte Base (3)

Phe
Phe
Leu
Leu

Ser
Ser
Ser
Ser

Tyr
Tyr
Stopp
Stopp

Cys
Cys
Stopp
Trp

U
C
A
G

Leu
Leu
Leu
Leu

Pro
Pro
Pro
Pro

His
His
Gln
Gln

Arg
Arg
Arg
Arg

U
C
A
G

Ile
Ile
Ile
Met

Thr
Thr
Thr
Thr

Asn
Asn
Lys
Lys

Ser
Ser
Arg
Arg

U
C
A
G

Val
Val
Val
Val

Ala
Ala
Ala
Ala

Asp
Asp
Glu
Glu

Gly
Gly
Gly
Gly

U
C
A
G

Kapitel 10 Translation: bersetzung des Gens ins Phn

120

.. Tab.10.2 Relativer ATP-Verbrauch fr Synthesen in


einer wachsenden Kultur von E. coli

DNA
RNA
Protein
Lipide
Polysaccharide

3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

2,5%
3,1
88
3,7
2,7

Definition
Offenes Leseraster (Open reading frame, Orf):
Eine aus der Nucleotidsequenz der DNA abgeleitete Abfolge von Codon-Tripletts, welche
bei einem bestimmten Leseraster (eine der
drei Mglichkeiten, eine Nucleotidsequenz als
eine Folge von Tripletts zu lesen) ein 5-Startcodon, ein 3-Stoppcodon und dazwischen
eine codierende Sequenz (ohne Stoppcodons!)
von plausibler Lnge aufweist. Ein offenes
Leseraster entspricht wahrscheinlich einem
proteincodierenden Gen.

10.2

Proteinsynthese, bersicht

Die Proteine sind mengenmig und am Energieaufwand gemessen das Hauptprodukt des Stoffwechsels Ihre Synthese ist wahrscheinlich der

komplizierteste biochemische Vorgang berhaupt.


An dieser Schnittstelle von Gen und Phn wird
Information in Struktur und Funktion umgesetzt.
Proteine werden stndig synthetisiert, da sie, wie die
meisten Biomolekle auer der DNA, fortwhrend
erneuert werden. Die Halbwertszeit von Proteinen
betrgt beim Menschen fr Leberenzyme Minuten
bis Tage, fr Muskelproteine einige Wochen und fr
Kollagen Jahrzehnte. Proteine sind mengenmig
und am Energieaufwand gemessen das Hauptprodukt des synthetischen Stoffwechsels (.Tab.10.2).
Proteine werden durch Ribosomen synthetisiert An der Synthese von Proteinen sind beteiligt:

Ribosomen, mRNA, tRNA, Aminosuren, Enzyme


(>20 verschiedene Aminoacyl-tRNA-Synthetasen),
ATP und GTP. Fr die Synthese eines Proteinmolekls werden insgesamt etwa 150Komponenten
bentigt. Ribosomen sind mRNA-programmierte
Proteinsynthesemaschinen: Riesenkomplexe mit je
einer groen und kleinen Untereinheit, die ihrerseits

aus Proteinen und rRNA bestehen (.Tab.10.3). Die


Ribosomen von Prokaryonten und Eukaryonten
sind einander hnlich. Die kleine Untereinheit bindet die mRNA und tRNA; die groe Untereinheit
ist am Binden der tRNA beteiligt und katalysiert
die Elongation der Polypeptidkette. Alle Ribosomen eines Organismus sind identisch; die mRNA
bestimmt, welches Protein synthetisiert wird.

Die Synthese eines Proteins lsst sich in vier


Phasen unterteilen:
1. Bildung der Aminoacyl-tRNA. Hochspezifische

Aminoacyl-tRNA-Synthetasen sorgen dafr,


dass jede tRNA mit der entsprechenden Aminosure aufgeladen wird. Die Carboxylgruppe
der Aminosure wird aktiviert und an die tRNA
gebunden. Jede Aminosure wird dadurch mit
dem zugehrigen Anticodon markiert und die
Nucleinsuresprache in die Proteinsprache
bersetzt (.Abb.10.1).
2. Initiation. Die mit der ersten Aminosure beladene tRNA (Initiator-tRNA), die mRNA, die
kleine und die groe Untereinheit des Ribosoms bilden zusammen mit Hilfsproteinen (Initiationsfaktoren, IF) den Initiationskomplex.
Damit ist die Maschinerie zur rastergerechten
Ablesung der mRNA bereit.
3. Elongation. Gem der Abfolge der Codons in
der mRNA wird vom Aminoende der Peptidkette her ein Aminosurerest nach dem anderen
angefgt. Nach jedem Syntheseschritt verschiebt
sich das Ribosom auf der mRNA um ein Codon
in 53-Richtung. Ans benachbarte Codon auf
der 3-Seite lagert sich die nchste AminoacyltRNA an.
4. Termination. Beim Stoppcodon lst sich das
Polypeptid vom Ribosom, das darauf von der
mRNA dissoziiert und in seine Untereinheiten
zerfllt. Noch whrend die Kettenverlngerung
an einem Ribosom abluft, knnen weitere Ribosomen an der mRNA mit der Translation
beginnen und sogenannte Polysomen bilden
(.Abb.10.2).
10.3

Bildung der Aminoacyl-tRNA

Jede der 20 verschiedenen Aminosuren wird


kovalent an eine fr die betreffende Amino-

121
10.3 Bildung der Aminoacyl-tRNA

10

.. Tab.10.3 Zusammensetzung der Ribosomen. Der Sedimentationskoeffizient ist ein Ma fr die Sedimentationsgeschwindigkeit eines Partikels im Zentrifugalfeld einer Ultrazentrifuge und wird in Svedberg-Einheiten (S = 1013 s)
angegeben (Abschn.37.1). Nt, Nucleotide
Ribosomen

Kleine Untereinheit

Groe Untereinheit

Sedimentationskoeffizient

70S

30S

50S

Masse (kDa)

2520

E. coli

930

1590

RNA (Massenanteil 66%)

16S (1500Nt)

23S (2900Nt)
5S (120Nt)

Proteine (Massenanteil 34%)

21

31

Ratte
Sedimentationskoeffizient

80S

40S

60S

Masse (kDa)

4220

1400

2820

RNA (Massenanteil 60%)

18 S(1900Nt)

28S (4700Nt)
5,8S (160Nt)
5S (120Nt)

Proteine (Massenanteil 40%)

33

49

.. Abb.10.2 Polyribosom. Die Ribosomen bestehen aus einer kleinen und einer groen Untereinheit, die ihrerseits aus rRNA
und Proteinen aufgebaut sind (.Tab.10.3). Ribosomen bilden sich nur bei der Translation; unttige Ribosomen dissoziieren in
ihre Untereinheiten. Die mRNA ist an die kleine Untereinheit gebunden. Die vom NH2- zum COOH-Ende wachsende Polypeptidkette verlsst das Ribosom auf der Seite der groen Untereinheit und beginnt sich schon vor Beendigung ihrer Synthese zu
falten. Meist lesen mehrere Ribosomen gleichzeitig eine mRNA ab, so dass sich die hier schematisch dargestellte Situation eines
Polyribosoms ergibt. Der Minimalabstand zwischen den Ribosomen auf einer mRNA ist etwa 80Nucleotide (25nm). Die Ribosomen haben einen Durchmesser von 22nm und folgen demnach recht dicht aufeinander; auf der mRNA fr eine Globinkette
von 140Aminosureresten sind jeweils 56Ribosomen gleichzeitig am Werk

sure spezifische tRNA gekoppelt Die Spezifitt der Koppelung wird garantiert durch die
Aminoacyl-tRNA-Synthetasen, welche sowohl
die Aminosure als auch die betreffende tRNA

erkennen; fr jede tRNA gibt es eine spezifische


Aminoacyl-tRNA-Synthetase. Die Carboxylgruppe
der Aminosure wird unter ATP-Verbrauch aktiviert
und darauf an die zugehrige tRNA gekoppelt. Die

122

1
2

Kapitel 10 Translation: bersetzung des Gens ins Phn

Aminosure wird ber eine Esterbindung an die 2oder 3-OH-Gruppe des 3-endstndigen Adenosinnucleotids der tRNA gekoppelt. Alle tRNAs besitzen
ein CCA 3-Ende.

3
4
5

molekulargenetischen Polymerisierungsreaktionen ist proportional zum Ausma des mglichen

Schadens, der sich aus einem Fehler ergeben kann:


Replikation (verndertes Erbgut; Ausfall eines
Gens mglich)>Transkription (eine vernderte
mRNAviele fehlerhafte Proteinmolekle)>Translation (ein einziges fehlerhaftes Proteinmolekl).

7
8
9

Stille Mutationen (Silent mutations)

10

12
13

15
16
17
18
19
20

Punktmutationen (Austausch einzelner


DNA-Basen) und Fehler bei der Transkription
oder Translation knnen aus den folgenden
Grnden ohne funktionelle Folgen bleiben:
Die Aminosuresequenz des Proteins
bleibt unverndert, weil der genetische
Code degeneriert ist.
Die Aminosuresequenz des Proteins wird
wohl verndert, das Protein bleibt jedoch
funktionstchtig, weil der Austausch des
Aminosurerests strukturell und funktionell
keine Folgen hat (z.B. bei konservativer
Substitution wie GluAsp oder LeuIle).
Das fehlerhafte Protein ist inaktiv oder
instabil. Der Defekt bleibt unbemerkt, weil
andere Proteine den Ausfall kompensieren
(Redundanz). Der Phnotyp von knock-out
Musen (Abschn.39.12), bei denen ein
Gen ausgeschaltet worden ist, erweist sich
unter Laborbedingungen oft als unauffllig.

11

14

dass die tRNA mit einer falschen Aminosure beladen wird (z.B. Isoleucyl-tRNAVal), besitzen die
Aminoacyl-tRNA-Synthetasen einen hydrolytischen Korrekturmechanismus, welcher ValtRNAIle 100-mal rascher hydrolytisch spaltet als
Ile-tRNAIle. Aufgrund der Spezifitt des Enzyms
und dieses Korrekturmechanismus ergibt sich eine
Fehlerfrequenz von 0,010,01=104. Die Fehlerrate von 1:10000 bedeutet, dass bei der Synthese
eines Proteins von 500Aminosureresten in einem
von 20Proteinmoleklen eine falsche Aminosure
eingebaut wird. Die Genauigkeit der verschiedenen

Die Ribosomen bauen stur diejenige Aminosure


ein, welche an der tRNA hngt, deren Anticodon
an das Codon der mRNA gebunden ist. Die Spezifitt der Aminoacyl-tRNA-Synthetase fr eine
bestimmte Aminosure und fr die zugehrige
tRNA mit ihrem Anticodon sorgt dafr, dass bei
korrekter Paarung von Anticodon und Codon die
richtige Aminosure ins Protein eingebaut wird.
Die Aminoacyl-tRNA-Synthetase erkennt neben
der Anticodonschleife weitere Strukturmerkmale
der tRNA (.Abb.10.3). Schwieriger ist es fr das
Enzym, einander hnliche Aminosuren zu unterscheiden. Zum Beispiel unterscheiden sich Isoleucin und Valin in einer einzigen -CH2-Gruppe.
Fr den seltenen Fall (etwa 1% der Reaktionen),

123
10.4Initiation, Elongation, Termination

10

.. Abb.10.3 Struktur der tRNA. aDie schematische Kleeblattstruktur zeigt die mglichen Basenpaare (in Grau die kurzen Doppelhelix-Abschnitte14). Die angegebenen Nucleotide der insgesamt etwa 75Nucleotide entsprechen einer Consensus-Sequenz; die andern Nucleotide variieren und verleihen der tRNA Individualitt, so dass jede Aminoacyl-tRNA-Synthetase ihre
zugehrige tRNA klar erkennen kann. Die tRNAs enthalten zahlreiche modifizierte, nicht im Consensus inbegriffene Nucleoside
(fr die Alanin-tRNA der Hefe hier in Blau angegeben) wie T (Ribothymidin), (psi, Pseudouridin) und weitere ungewhnliche,
hier nicht bezeichnete Basen (Methylinosin, Dihydrouridin, Methylguanosin und Dimethylguanosin). bDie 3D-Struktur der
tRNA ist durch Rntgenkristallanalyse ermittelt worden und zeigt deren kompakten, L-frmigen Bau mit den vier Doppelhelixabschnitten. Das Anticodon liegt gut zugnglich am Ende des langen Arms des L; das 3-CCA-Ende, an welches die Aminosure
gekoppelt wird, ist am Ende des kurzen Arms ebenfalls gut zugnglich und frei beweglich

10.4

Initiation, Elongation,
Termination

Diese Vorgnge laufen bei Prokaryonten und Eukaryonten in hnlicher Weise ab. Im Folgenden
besprechen wir jeweils den Vorgang bei E.coli und
erwhnen danach die wichtigsten Besonderheiten
bei Eukaryonten.
Bei der Initiation wird die Proteinsynthesemaschinerie zusammengestellt und deren Ableseraster eingestellt Dazu werden bentigt:

--

mRNA mit 5-Cap-Region,


N-Formylmethionyl-tRNAf (f steht fr Formylmethionin); bei Eukaryonten Methionyl-tRNAi
(i steht fr Initiator),

Initiationsfaktoren IF (3 bei Prokaryonten;


mindestens 11 bei Eukaryonten),
GTP und ATP als Energielieferanten (wie
immer als Komplexe mit Mg2+),
beide ribosomalen Untereinheiten.

124

Kapitel 10 Translation: bersetzung des Gens ins Phn

1
2
3
4
5
6

EPA

7
8
9
10
11
12
13
14
15
16
17
18
19
20

EPA

.. Abb.10.4 Bildung des Initiationskomplexes der Translation bei Prokaryonten. Die drei Initiationsfaktoren IF1-3
bilden zunchst mit der kleinen Ribosomen-Untereinheit den
30S-Initiationskomplex, der darauf unter GTP-Verbrauch zum
70S-Komplex vervollstndigt wird. Das Binden von IF1 und
IF3 an die kleine Untereinheit verhindert die Bildung eines
unproduktiven 70S-Komplexes ohne mRNA und fMet-tRNAf.
Im Initiationskomplex ist fMet-tRNAf an das Startcodon
und die P-Stelle (Peptidyl-Stelle) des Ribosoms gebunden;
A, Aminoacylstelle; E, Exitstelle des Ribosoms

Das Startcodon AUG (in Prokaryonten selten auch


GUG) bindet die Initiator-Met-tRNA (fMet-tRNAf
bzw. Met-tRNAi). AUG und GUG codieren auch fr
internes Methionin bzw. Valin, in diesem Fall werden die Codons von tRNAMet bzw. tRNAVal erkannt.
Die drei Initiationsfaktoren (IF1-3) fixieren unter
ATP-Verbrauch die kleine Untereinheit des Ribosoms
und Formyl-Met-tRNAf ans Startcodon (.Abb.10.4).
Das Auffinden des Startcodons auf der mRNA
wird erleichtert durch die Ribosomen-Bindungsstelle, eine purinreiche Consensus-Sequenz

(Shine-Dalgarno-Sequenz), deren Mitte etwa


10Nucleotide stromaufwrts des Startcodons liegt.
Die Consensus-Sequenz paart ihre Basen mit einem
9-Basen-Segment am 3-Ende der 16S-rRNA der
kleinen Ribosomenuntereinheit. Der vollstndige
Initiationskomplex besteht aus dem 70S-Ribosom,
fMet-tRNAf und mRNA. Das Startcodon und die
Initiator-Met-tRNA liegen an der P-Stelle (Peptidyl-Stelle) des Ribosoms.
Bei Eukaryonten sind mindestens 11 verschiedene Initiationsfaktoren beteiligt (eIF; e, eukaryontisch). Bei Eukaryonten ist das Start-Methionin nie formyliert. Die kleine Untereinheit des
Ribosoms bindet an die Cap-Region der mRNA
und verschiebt sich stromabwrts bis zum ersten
AUG-Triplett, wo nach Binden der groen Untereinheit die Translation beginnt. Die Consensus-Sequenz fr die Startregion (Kozak-Sequenz) stark
exprimierter Proteine lautet: CC(A/G)CCAUGG
(Start-Codon blau). Eukaryontische mRNAs sind
monocistronisch, d.h. codieren nur fr ein Protein.
Bei der Elongation durchluft das Ribosom
einen katalytischen Zyklus mit Platzwechsel der
wachsenden Polypeptidkette Das Ablaufen des

komplexen Zyklus (.Abb.10.5) bentigt folgende


Komponenten:
Initiationskomplex bzw. ein Ribosom mit
Peptidyl-tRNA in der P-Stelle (Peptidylstelle),
Aminoacyl-tRNAs,
Elongationsfaktoren EF-Tu und EF-Ts, die
Enzyme, welche das wachsende Peptid in
der P-Stelle auf die Aminoacyl-tRNA in der
A-Stelle (Aminoacyl- oder Akzeptorstelle)
bertragen. Met-tRNA bindet nicht wie
fMet-tRNAf an IF2, sondern an EF-Tu. EF-G
wird bentigt fr die Translokation der Peptidyl-tRNA von der A-Stelle zur P-Stelle.
GTP.

--

Die Elongation bei Eukaryonten ist derjenigen bei


Prokaryonten sehr hnlich. Die Funktionen von
EF-Tu und EF-Ts werden von den zwei Untereinheiten des eukaryontischen Elongationsfaktors eEF-1
bernommen. eEF-2 entspricht EF-G.
Die Termination wird eingeleitet, sobald ein
Stoppcodon an die A-Stelle gelangt Fr die Ter-

mination werden bentigt:

125
10.4Initiation, Elongation, Termination

E
P
A
Stellen des Ribosoms

10

.. Abb.10.5 Elongations-Zyklus bei E.coli. In der Ausgangssituation (links) befindet sich die Peptidyl-tRNA (oder die fMettRNAf vor dem ersten Elongationsschritt) an der P (Peptidyl)-Stelle des Ribosoms. Die neue Aminoacyl-tRNA bindet im ersten
Schritt an die A (Akzeptor)-Stelle. Dazu wird der Elongationsfaktor EF-Tu bentigt, der GTP hydrolysiert. Im zweiten Schritt
wird die Peptidkette auf die -Aminogruppe des neuen Aminosurerests bertragen (Transpeptidierung). Im letzten Schritt
wird die um den neuen Aminosurerest verlngerte Peptidyl-tRNA von der A-Stelle in die P-Stelle verschoben. Dabei bleibt die
Peptidyl-tRNA ber die Anticodon-Codon-Basenpaare mit der mRNA verbunden. Zusammen mit der Peptidyl-tRNA wird daher
auch die mRNA um drei Nucleotide verschoben. Die Aufrechterhaltung der Codon-Anticodon-Bindung ist bei der Peptidyl-tRNA
nicht mehr wichtig, um die einzubauende Aminosure zu bestimmen, sie ist jedoch wichtig, um die mRNA genau drei Nucleotide zu verschieben und so das Leseraster nicht zu verndern. Die frei gewordene tRNA an der P-Stelle wird in die E (Exit)-Stelle
verschoben und verlsst das Ribosom

--

Stoppcodon (UAG, UAA, UGA),


Terminationsfaktor, welcher das Stoppcodon
erkennt,
GTP.

Es gibt keine tRNA, deren Anticodon einem Stoppcodon entsprche. Je nach Sequenz des Stoppcodons bindet einer der zwei Terminationsfaktoren
(Release factors RF1 und RF2) an die A-Stelle, d.h.
ein Protein anstelle eines Anticodons erkennt das
Stoppcodon. Die Peptidyltransferase bertrgt daraufhin das Peptid auf Wasser statt auf die Aminogruppe einer neuen Aminosure und spaltet damit

die Peptidkette hydrolytisch von der tRNA in der


P-Stelle ab. Danach zerfllt das Ribosom in seine
beiden Untereinheiten. RF3 untersttzt diese Vorgnge unter Verbrauch von GTP. Eukaryonten besitzen nur einen Terminationsfaktor (Release factor
eRF), der ebenfalls GTP verbraucht. Bei den meisten
Proteinen wird der NH2-terminale Formyl-Methionin-Rest (Prokaryonten) oder Methionin-Rest
(Eukaryonten) enzymatisch abgespalten. Bei Eukaryonten wird die frei gewordene -Aminogruppe
des nachfolgenden Rests hufig acetyliert oder sonst
wie modifiziert.

126

Kapitel 10 Translation: bersetzung des Gens ins Phn

Elongation
Geschwindigkeit (bei 37C):

E. coli

1520Aminosurereste pro s

Mensch

25Aminosurereste pro s

Energieverbrauch:
Beladen der tRNA (ATPAMP+2Pi)

2ATP

Binden der Aminoacyl-tRNA an


A-Stelle

1GTP

Translokation der Peptidyl-tRNA


(AP)

1GTP

5
6

Pro angefgten Aminosurerest werden


demnach 4 energiereiche Phosphatbindungen
bentigt.

hoher Letalitt. Das vom Krankheitserreger (Corynebacterium diphtheriae) ausgeschiedene Toxin ist
ein Enzym. Es inaktiviert den Elongationsfaktor EF2
von Eukaryonten durch eine chemische Modifikation. Ein einziges Molekl des Enzyms gengt, um
die Proteinsynthese einer Zelle stillzulegen. Fr den
nichtimmunisierten Menschen sind einige Nanogramm tdlich.
Antibiotika
Diverse Biomolekle, welche die Proteinsynthese nur in Prokaryonten hemmen, sind wichtig zur Bekmpfung bakterieller Infektionen:
Streptomycin:

Bindet an die bakterielle


16SrRNA der kleinen Untereinheit und fhrt zu fehlerhafter
Ablesung der mRNA und Hemmung der Translation.

Tetrazykline:

Binden an die 30S-Untereinheit


und hemmen das Binden der
Aminoacyl-tRNA.

Chloram
phenicol:

Hemmt die Peptidyltransferase-


Aktivitt der 50S-Untereinheit.

Erythromycin:

Bindet an die 50S-Untereinheit


und hemmt die Translokation.

7
8
9
10
11
12
13
14
15
16
17
18
19
20

10.5 Hemmstoffe

der Proteinsynthese

Die ribosomale Proteinsynthese wird durch eine


Reihe mannigfaltiger Naturstoffe und synthetischer
Derivate derselben gehemmt. Die Hemmstoffe interferieren mit ganz verschiedenen Teilen der komplexen Proteinsynthesemaschinerie. Manche dieser
Inhibitoren werden in der Medizin als Antibiotika
verwendet, einzelne dienen als wichtige Werkzeuge
der biochemischen Forschung.
Puromycin aus Streptomyces alboniger, einem
Strahlenpilz, ist ein Strukturanalog des Tyrosyl-Adenosin-Teils der Tyrosyl-tRNA und kompetiert mit Tyrosyl-tRNATyr um die Bindung an die
A-Stelle. Puromycin bildet eine Peptidbindung mit
der Carboxylgruppe des wachsenden Peptids an
der P-Stelle. Das Proteinfragment mit Puromycin
am C-Ende dissoziiert vom Ribosom. Puromycin
wird experimentell als allgemeiner Inhibitor der
Proteinsynthese verwendet. Fr eine medizinische
Verwendung ist Puromycin zu toxisch, da es die
Proteinsynthese nicht nur in Prokaryonten sondern
auch in Eukaryonten hemmt.
Cycloheximid hemmt die Peptidyltransferase-Aktivitt der 60S-Untereinheit eukaryontischer
Ribosomen und dient ebenfalls nur fr experimentelle Zwecke.
Diphtherietoxin Die Diphtherie war vor der
Entwicklung einer wirksamen Impfung eine sehr
gefrchtete bakterielle Infektionskrankheit mit

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514847-0
10.1 Der genetische Code
10.2 Proteinsynthese, bersicht
10.3 Bildung der Aminoacyl-tRNA
10.4 Initiation, Elongation, Termination
10.5 Hemmstoffe der Proteinsynthese
Weiterfhrende Literatur

127

Regulation
der Genexpression
Ph. Christen, R. Jaussi, R. Benoit
11.1

Regulation der Transkription bei


Prokaryonten: Operon128

11.2

Regulation der Transkription bei Eukaryonten:


Transkriptionsfaktoren130

11.3

Posttranskriptionale Regulation der Genexpression 133

11.4

Epigenetische Regulation und Vererbung 135

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_11, Springer-Verlag Berlin Heidelberg 2016

11

128

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 11 Regulation der Genexpression

Alle Zellen eines Organismus besitzen das gleiche


Genom (Gesamtheit der Gene). In Eukaryonten
dient die Mehrzahl der Gene (RNA-Gene) zur Produktion regulatorisch oder katalytisch aktiver RNA;
eine kleinere Anzahl der Gene (Protein-Gene) liefert Transkripte (mRNA) als Vorlage fr die Proteinsynthese. Die Palette der zellulren Proteine, das
Proteom (Gesamtheit der Proteine), variiert stark
je nach Zelltyp; in einer gegebenen Zelle werden
nur etwa 5% aller Protein-Gene exprimiert. Die
Regulation der Genexpression stellt das primre
Mittel zur zeit- und ortsgerechten Bereitstellung der
Makromolekle in der bentigten Menge dar. Die
allermeisten Gene werden ber die Frequenz des
Transkriptionsstarts gesteuert. Die Genregulationsmechanismen der verschiedenen Organismen gleichen sich in den Grundzgen; die wesentlichsten
Unterschiede finden sich zwischen Prokaryonten
und Eukaryonten.
Die DNA der Prokaryonten ist dicht mit hauptschlich proteincodierenden Genen besetzt und
verhltnismig einfache Mechanismen regulieren
deren Expression: Ein Operon enthlt mehrere hintereinander aufgereihte Gene, welche miteinander
reguliert und, nach Aktivierung des Operons, zusammen auf das gleiche mRNA-Molekl transkribiert werden.
Das Chromatin der Eukaryonten ist im Grundzustand stillgelegt, die Gene sind inaktiv; bei Aktivierung der weit verstreuten Gene wird das Chromatin lokal aufgelockert. Die eukaryontischen
Gene werden individuell reguliert: Sie besitzen
verschiedene Promotoren und zustzliche genspezifische regulatorische DNA-Abschnitte, darunter
auch die weitab vom Promotor liegenden Enhancer und Silencer. Jedes Gen codiert seine eigene
mRNA, deren Stabilitt von Gen zu Gen stark variiert. Die Genregulation bei vielzelligen Eukaryonten umfasst neben dem quantitativen Aspekt, d.h.
in welcher Menge ein bestimmtes Genprodukt
bereitgestellt wird, den komplexen qualitativen
Aspekt wie sich aus einer Eizelle die mannigfaltig
spezialisierten Zellen entwickeln, die doch alle das
gleiche Genom haben. Die Unterschiede zwischen

den verschiedenen Zelltypen entstehen frh in der


Entwicklung der Organismen und werden bei den
nachfolgenden Zellteilungen an die Tochterzellen
weitergegeben. Diese epigenetische Vererbung,
die Weitergabe von Merkmalen, welche nicht in
der Basenabfolge der DNA festgelegt sind, kommt
zustande durch Methylierung der DNA, Modifikation gewisser Histone und RNA-Interferenz
(RNAi).
Die groe Bedeutung eines regulatorischen
Netzwerks aus sehr vielen langen (>200Nucleotide)
nichtkodierenden RNAs, welches die Mehrzahl der
genregulatorischen Mechanismen beeinflusst, ist
erst in letzter Zeit erkannt worden.
11.1

Regulation der Transkription


bei Prokaryonten: Operon

Das Lactose-Operon (lac-Operon) von E. coli


fasst mehrere Gene zusammen In lactosefreiem

Medium wachsende Bakterienzellen besitzen pro


Zelle nur 12Molekle der -Galactosidase, die
Lactose (Milchzucker; Abschn.16.3) zu Glucose
und Galactose hydrolysiert. Enthlt hingegen das
Kulturmedium Lactose, wird die -Galactosidase
sehr rasch auf etwa 3000Molekle pro Zelle aufgestockt, sodass die Bakterien nun imstande sind,
Lactose effizient zu vergren (anaerob abzubauen
zu Lactat; Abschn.14.1). Lactose im Medium
bewirkt nicht nur die rasche Synthese (Induktion)
der -Galactosidase (Produkt des lacZ-Gens),
sondern beeinflusst auch die Expression anderer
Gene und Operons. Das lac-Operon reagiert auf
Lactose nicht nur mit einer Induktion der -Galactosidase sondern auch der Galactose-Permease
(Produkt des lacY-Gens) und der Galactosid-Acetyltransferase (Produkt des lacA-Gens). Die drei
Gene lacZ-lacY-lacA liegen in dieser Reihenfolge
hintereinander. Das Transkript des Operons, die
mRNA, enthlt die Leseraster aller drei Enzyme.
Fr deren Induktion ist nicht die Lactose direkt
verantwortlich, sondern ein metabolisches Umlagerungsprodukt, die 1,6-Allolactose.

129
11.1 Regulation der Transkription bei Prokaryonten: Operon

11

RNA-Polymerase. Die Allolactose wird in geringer


Menge als Isomerisierungsprodukt der Lactose gebildet. Im Labor wird zur Induktion des Operons oft
das metabolisch stabile synthetische Analog Isopropyl--d-thiogalactosid (IPTG) verwendet.

Das Regulator-Gen lacI macht das lac-Operon


induzierbar In gewissen E. coli Stmmen ist das

lac-Operon nicht induzierbar; die Gene werden


auch in Abwesenheit von Lactose exprimiert. Die
Induzierbarkeit hngt ab vom Regulator-Gen lacI,
welches den Lactose-Repressor codiert:

Das lac-Repressorprotein bindet an den Operator,


ein DNA-Segment in der 5-Kontrollregion des
Operons, verhindert die Bindung der RNA-Polymerase an den Promotor und blockiert dadurch die
Transkription. Sobald jedoch ein Induktormolekl
wie Allolactose an den Repressor bindet und eine
Konformationsnderung auslst, dissoziiert der
Repressor von der Operatorstelle (allosterischer Effekt; Abschn.4.6) und gibt den Weg frei fr die

Der lac-Repressor besteht aus vier identischen Untereinheiten und zeigt eine zweizhlige (180o) Symmetrie. Es bindet mit hoher Affinitt (Kd =1011M)
an das untenstehende DNA-Segment, ein sogenanntes Palindrom mit derselben Symmetrie.

130

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 11 Regulation der Genexpression

Terminologie
Ein molekulargenetisches Palindrom zeichnet
sich durch eine zweizhlige Symmetrieachse
(Punktsymmetrie, Rotation um 180) aus.
Die Sequenz vom 5- zum 3-Ende des einen
Strangs liest sich gleich wie die Sequenz vom
5- zum 3-Ende des anderen. Ein sprachliches
Palindrom hingegen liest sich von vorne gleich
wie von hinten, z.B. Anna oder Reliefpfeiler.

-Galactosidase wird nur synthetisiert, wenn das


Medium keine Glucose enthlt Wenn Glucose

vorhanden ist, bentigt die Zelle keine Lactose;


die Glucose reicht als Kohlenstoff- und Energiequelle. Glucose unterdrckt daher die Aktivitt des
lac-Operons (Katabolit-Repression). Bei niedriger
Glucosekonzentration erhht sich die Konzentration von cAMP (cyclicAMP; Abschn.16.2), einem
Hungersignal bei Bakterien, wie auch bei Mensch
und Tier. In E.coli bindet cAMP an das CAP (Catabolite gene Activator Protein), worauf der Komplex direkt stromaufwrts von der Bindungsstelle
der RNA-Polymerase im lac-Operon bindet. CAPcAMP erleichtert die Bindung der RNA-Polymerase
und erhht damit die Frequenz der Transkription.
Das lac-Operon steht demnach unter doppelter
Kontrolle: Hemmung durch Repressor und Aktivierung durch CAP-cAMP. Solange der Zelle gengend Glucose zur Verfgung steht, kme es einer
Verschwendung gleich, Enzyme zur Verwertung
anderer Energiequellen wie Lactose bereitzustellen.
Das Beispiel des lac-Operons zeigt, dass die Zelle zur
Regulation des Stoffwechsels verschiedene Regelgren benutzt, einerseits das Substrat des Operons
(Lactose) andererseits die allgemeine Stoffwechsellage (cAMP-Hungersignal). Die kombinierte Wirkung verschiedener Signale und regulatorisch wirksamer Proteine, die an spezifische DNA-Abschnitte
binden, finden sich auch bei Eukaryonten als Teile
komplexer regulatorischer Netzwerke.

11.2

Regulation der Transkription


bei Eukaryonten:
Transkriptionsfaktoren

Auch bei Eukaryonten wird die Expression spezifischer Gene entweder gefrdert oder gehemmt
durch das Binden bestimmter Proteine an die DNA
oder auch an die RNA. Dazu kommen regulatorische Effekte spezifischer kleiner RNA (miRNA und
siRNA) und chemischer Modifikationen der DNA
und der Histone.
Genspezifische Transkriptionsfaktoren (TF,
Genregulatorproteine) kontrollieren die Transkriptionsfrequenz Die Wechselwirkung genspezifi-

scher TF mit dem allgemeinen Transkriptionskomplex (Abschn.9.1) aktiviert die RNA-Polymerase.


Die Genregulatorproteine binden an stromaufwrts
gelegene genspezifische Promotor-Sequenzen
oder auch an weiter weg liegende Enhancer und
Silencer (Abschn.9.1); ihre groe Vielfalt ermglicht ein individuelles Regulationsmuster fr jedes
einzelne Gen.
Genspezifische TF bestehen aus zwei oder
drei Domnen: DNA-Bindungsdomne, Wirkungsdomne und Signalempfangsdomne Die

DNA-Bindungsdomne erkennt ein regulatorisches


Segment in der DNA-Doppelhelix. Die Wirkungsdomne interagiert mit der RNA-Polymerase und/
oder allgemeinen oder auch anderen genspezifischen
TF des Transkriptionskomplexes und beeinflusst dessen Stabilitt (und damit die Initiationsfrequenz).
Manche Genregulatorproteine besitzen zudem eine
Signalempfangsdomne, die externen Signalen erlaubt, die Aktivitt des TF zu steuern.
Die Bindungsstellen fr Genregulatorproteine
sind DNA-Segmente von 620bp; in manchen Fllen erkennt die DNA-Bindungsdomne nicht nur
ein bestimmtes DNA-Segment, sondern mehrere
Consensus-Sequenzen. Viele Genregulatorproteine
sind Dimere gleicher oder hnlicher Untereinheiten. Eine Dimerstruktur mit einer Rotationssymmetrie um 180o ist typisch fr DNA-bindende
Proteine: Sie entspricht der antiparallelen Struktur
der Erkennungsstellen in der DNA-Doppelhelix
(vgl. mit lac-Operatorstelle und Restriktionsstellen; Abschn.11.1, bzw. 39.1). Die Dimerisierung
eines TF erfolgt meist ber einen Leucin-Zipper
(Leucin-Reiverschluss; .Abb.11.1), eine Coiled

131
11.2 Regulation der Transkription bei Eukaryonten: Transkriptionsfaktoren

.. Abb.11.1 Leucin-Zipper. Der Leucin-Reiverschluss (vgl. .Abb.3.8) ist derjenige Teil


eines Transkriptionsfaktors, welcher das Dimer
stabilisiert. Er umfasst etwa 230Aminosurereste
und ist damit etwa doppelt so lang wie der hier
gezeigte Abschnitt. Er gabelt sich zur DNA-Bindungsdomne auf, welche die Ziel-DNA-Doppelhelix (schwarz/grau) mit basischen Aminosureresten
umklammert. Die Wirkungsdomne liegt am
anderen Ende (COOH-Ende) des Zippers und ist
hier nicht gezeigt. Koordinaten aus Protein Data
Bank, PDB-Accession 1YSA

coil-Struktur, wie sie auch im Keratin vorkommt


(.Abb.3.8).
Ein weiterer Typ von TF benutzt das Helix-turn-helix-Motiv, das sich ebenfalls scherenartig
an die DNA anlagert.
Ein drittes wichtiges Motiv DNA-bindender
Proteine ist der Zinkfinger, dessen Struktur durch
vier Bindungen der Polypeptidkette an ein Zinkion
zustande kommt (.Abb.11.2). Der helicale Teil eines Zinkfingers bindet in die groe Furche der DNA
und stellt den Kontakt mit zwei Nucleotiden her. In
vielen TF kommen mehrere Zinkfinger miteinander
vor; jeder der Zinkfinger bindet an eine bestimmte
Nucleotidsequenz und die Kombination mehrerer
solcher kurzer Sequenzen ergibt die Bindungsstelle
des TF. Mehrere hundert verschiedene Zinkfinger
und deren Zielsequenzen sind bekannt.

Genregulatorproteine mit einer Signalempfangsdomne wandeln chemische Signale in


genregulatorische Effekte um Das Signal, ein

nichtkovalent gebundener Ligand oder die Phosphorylierung durch eine bestimmte Proteinkinase,
fhrt zu einer Konformationsnderung der Signalempfangsdomne, welche nun die DNA-Bindungsdomne allosterisch aktiviert, indem sie
deren Affinitt fr das DNA-Zielsegment stark erhht. Dabei werden derart hohe Bindungsstrken
(Kd-Werte im Bereich von 1010 bis 108M) erreicht,
dass die Genregulatorproteine gezielt an die entsprechenden regulatorischen Sequenzen aller Zielgene

11

DNA-Bindungsdomne

DNABindung
in groer
Furche

.. Abb.11.2 DNA-bindendes Zinkfingermotiv. Das Zinkion


geht in diesem Beispiel eines Zinkfingers eine Komplexbindung mit den Stickstoffatomen zweier Histidinreste und den
Schwefelatomen zweier Cystein-Reste ein. In anderen Zinkfingern finden sich vier Cysteinreste als Liganden

binden. Die Wirkungsdomne des TF komplexiert


nun mit dem Transkriptionskomplex und frdert
oder erschwert die Initiation der Transkription des
entsprechenden Gens.
Die Aktivierung von Genen durch glucocorticoide Hormone gibt ein Beispiel, wie ein Signal die
Affinitt eines TF zur regulatorischen DNA-Sequenz
verndert. Glucocorticoide werden im Hungerzustand freigesetzt. Sie frdern in der Leber die Aktivierung der Gene bestimmter Stoffwechselenzyme
und damit die Produktion von Glucose aus Aminosuren und anderen Nicht-Kohlenhydrat-Ver-

132

1
2

Kapitel 11 Regulation der Genexpression

bindungen (Abschn.16.1). Glucocorticoide sind


Steroidhormone, also kleine hydrophobe Molekle,
die leicht in die Zelle diffundieren. Dort binden sie
an ein spezifisches Rezeptorprotein. Das Rezeptor-

protein, ein inaktiver TF, wird nach Andocken des


Hormons aktiviert und bindet an ein spezifisches
DNA-Element (Glucocorticoid response element,
GRE) und reguliert die entsprechenden Gene:

3
4
5
6
7
8
9
10
11

12

Initiationskomplex

13
14
15
16
17
18
19
20

Bei anderen Zielgenen oder in anderen Zielgeweben bindet der Hormon-Rezeptorkomplex in einem
anderen Kontext von Genregulatorproteinen und
kann unter Umstnden die Transkription hemmen.
Glucocorticoide aktivieren bzw. reprimieren jeweils
einen zell- und gewebetypischen Satz von Genen.
Verantwortlich hierfr ist nicht nur die zelltypische
Expression von TF, sondern auch die zelltypische
bermittlung des Signals. Die Wirkung bestimmter Signale, z.B. eines Hormons, auf die Gesamtheit
der Gene einer Zelle oder eines Gewebes wird heute
mittels Chiptechnik erfasst (Abschn.40.3).
Ein Teil der Genregulatorproteine sind Enhancer/Silencer-bindende Proteine Die Enhan-

cer/Silencer-Sequenzen liegen oft mehrere Kilobasen von der Promotor-Region (Abschn.9.1)


entfernt. Mehrere Proteinkomplexe (Enhancerund Silencer-bindende Proteine sowie weitere
Genregulatoren und Mediatorproteine) knnen
miteinander auf einen allgemeinen Transkriptionskomplex einwirken. Die Wahrscheinlichkeit eines
Transkriptionsstarts entspricht der algebraischen
Summe der Wirkungen der verschiedenen Genregulatorproteine:

133
11.3 Posttranskriptionale Regulation der Genexpression

11

Mediatorproteine

Die Aktivierung eines Gens ist ein statistisches


Ereignis mit einer bestimmten Frequenz Die

Aktivierung eines Gens in einer Zelle ist ein Einzelereignis. Ein RNA-Polymerase-Molekl kopiert
das Gen nach erfolgter Initiation nur einmal mit
einer konstanten, nichtregulierten Geschwindigkeit von etwa 20 Nucleotiden pro Sekunde (in
Eukaryonten). Fr die Herstellung einer weiteren
RNA-Kopie muss das Gen erneut aktiviert werden.
Ein sehr aktives Gen kann in einer Zelle mehrere
Male pro Minute transkribiert werden; die Transkription eines schwach exprimierten Gens hingegen kann in einer Zelle innerhalb mehrerer Tage
auch nur einmal stattfinden. Falls die produzierte
mRNA und das Protein jedoch stabil sind, kann das
biologisch aktive Genprodukt trotz der niedrigen
Transkriptionsfrequenz permanent in der Zelle
vorhanden sein.
Die Aktivierung einer Reihe von Genen kann
durch ein bergeordnetes Mastergen koordiniert
werden Nach Aktivierung eines Mastergens wer-

den eine Reihe von Genen in koordinierter Weise


strker bzw. schwcher exprimiert: Ein typisches
Beispiel ist das MYOD-Gen, welches den Trans
kriptionsfaktor MYOD codiert. Wird das Gen in
Fibroblasten exprimiert, synthetisieren diese Zellen Muskelproteine, die sie sonst nicht enthalten
und entwickeln eine muskeltypische Morphologie. Die Expression des MYOD-Mastergens gengt, um Fibroblasten in Muskelzellen umzuwandeln. Andere Beispiele solcher Mastergene haben
sich aus entwicklungsbiologischen Studien an der
Fruchtfliege Drosophila ergeben: Die Bildung der
Krpersegmente der Fliege wird durch Gene von
Homodomnen-Transkriptionsfaktoren (Homo-

box-Gene) kontrolliert. Analoge Gene steuern die

Bildung von Extremitten oder Augen.

11.3

Posttranskriptionale Regulation
der Genexpression

RNA-Interferenz (RNAi) reguliert die Halbwertszeit der mRNA Die zellulre Konzentration einer

mRNA wird durch die Geschwindigkeit nicht nur


von deren Synthese sondern auch von deren Abbau bestimmt. Bei Eukaryonten wird der Abbau
mancher mRNAs durch kurze nichtcodierende
RNA-Transkripte kontrolliert. Diese micro-RNA
(miRNA, in Haarnadelform mit Doppelstrang)
wird durch die Endoribonuclease Dicer (to dice,
in kurze gleichmige Stcke zerteilen) zu siRNA
(small interfering RNA) prozessiert und danach von
einer Helicase in Einzelstrnge zerlegt. Ein Strang
wird abgebaut whrend der andere sich mit einer
komplementren Sequenz auf der Ziel-mRNA paart
und mit Hilfe des Proteinkomplexes RISC (RNA-Induced Silencing Complex) den Abbau der mRNA
durch eine Argonaut-Endoribonuclease auslst.
Eine aufgrund nur teilweiser Komplementaritt
schwchere Wechselwirkung zwischen siRNA und
Ziel-mRNA fhrt nicht zum Abbau, kann jedoch
die Translation der betroffenen mRNA blockieren
(.Abb.11.3). Zelleigene, endogene miRNA dient
somit der Regulation zelleigener Gene.
Die einzelstrngigen Vorlufer der miRNA
sind meist durch Introns codiert und werden durch
RNA-Polymerase II synthetisiert. Sie zeigen Inverted repeats (umgekehrte Wiederholungssequenzen;
Abschn.12.1), so dass der Strang eine ausgedehnte

134

MikrogenDNA

2)

mRNA

3)

3
4
5

dsRNA
aus Virus

Chemische
Synthese und
Transfektion

miRNA

Dicer

miRNA

8
9
10
11
12
13
14
15
16
17
18
19
20

100%
komplementr

Abbau der
mRNA

1)
RNAPolymerase II

Leseraster
Dicer

22bp Helicase EinzelsiRNA


strang

6
7

Abbau

Zellkern

Cytoplasma

RISCKomplex Teilweise
komplemit
Minus- mentr
strang

Translationsstopp
AAAAAA

Kapitel 11 Regulation der Genexpression

.. Abb.11.3 Mechanismen der RNA-Interferenz RNAi. Die Entstehung und Wirkungsweise von siRNA ist vereinfacht dargestellt.
Die doppelstrngige siRNA kann aus drei verschiedenen Quellen stammen: 1) Transkriptionsprodukte aus hufigen regulatorischen Mikrogenen, die in nichtcodierender DNA und auch in Introns lokalisiert sein knnen; 2) im Labor synthetisierte miRNA,
die fr experimentelle Zwecke genutzt wird; 3) doppelstrngige RNA aus Viren und Transposons. Die Endonuclease Dicer spaltet miRNA in etwa 22bp lange Stcke, die doppelstrngige siRNA. Eine Helicase trennt die beiden Strnge der siRNA, worauf
der eine Strang abgebaut wird, whrend der zweite siRNA-Strang mit den Proteinen des RISC-Komplexes (RNA-Induced Silencing
Complex) zusammentritt. Der RISC bindet an mRNA-Abschnitte, welche zu seiner siRNA komplementr sind, und fhrt je nach
Passgenauigkeit zum Abbau der mRNA mit Hilfe der Argonaut-RNase (nicht gezeigt) oder zu einem Translationsstopp

Haarnadelstruktur bildet. Dicer-Endoribonucleasekomplexe schneiden die Vorlufer zu kurzen (21


25Nt) siRNA-Stcken zurecht, die am 5-Ende mit
einer Cap-Struktur versehen werden.
RNAi dient auch zum Schutz der Zelle gegen
mobile genetische Elemente wie Viren. Viele mobile
genetische Elemente produzieren dsRNA-Vorlufer,
welche in den Zellen von Dicern zu siRNA gespalten
werden. Durch Komplexierung mit RISC werden
danach die RNA-Produkte der mobilen genetischen
Elemente gezielt abgebaut, wobei die Zielsequenz
fr die Basenpaarung mit der siRNA berall auf der
exogenen mRNA liegen kann.

RNA-Interferenz bietet neue medizinische und


experimentelle Mglichkeiten Mittels RNA-In-

terferenz besteht die Mglichkeit, experimentell


oder als therapeutische Manahme die Expression
gewisser Gene zu unterdrcken. Im Labor bietet
siRNA eine Alternative zur Gen-knock-out-Technik
(Abschn.39.12).
In wenigen Fllen wird die Genexpression auf
dem Niveau der Translation reguliert Ein Bei-

spiel liefert die Synthese von Globin. In den Reti-

culozyten, den Vorluferzellen der roten Blutkrperchen, wird Hmoglobin bereitgestellt. Wird zu
wenig von der prosthetischen Gruppe, dem Hm,
produziert, blockiert eine Signalbermittlungskette
den Initiationsfaktor eIF2 und verhindert damit die
Initiation der Translation.
Posttranskriptionale bzw. posttranslationale
Modifikationen beeinflussen die biologische Aktivitt der Genprodukte Viele RNAs und Proteine

werden nach ihrer Synthese enzymatisch modifiziert und dadurch in ihrer biologischen Aktivitt
moduliert. Weit verbreitet sind die Phosphorylierung von Proteinen sowie die proteolytische Aktivierung inaktiver Proenzyme.

Riboswitches auf der mRNA stoppen deren


Translation oder brechen die Transkription ab

Vor allem in Bakterien, aber auch in Pflanzen und


Pilzen finden sich als Aptamere bezeichnete Bereiche der nichttranslatierten 5-Region gewisser
mRNAs, die aufgrund ihrer Raumstruktur einen
durch das Translationsprodukt beeinflussten Metaboliten binden. Diese Bindung lst eine Konformationsnderung der mRNA aus und kann deren

11

135
11.4 Epigenetische Regulation und Vererbung

Translation hemmen oder die Transkription abbrechen und so den betreffenden Stoffwechselweg
hemmen.
Lange, nichtkodierende Transkripte kommen
sehr hufig vor und haben wichtige strukturelle
und regulatorische Funktionen Lange Tran-

skripte ohne Leseraster kommen wesentlich hufiger vor als mRNAs. Sie stammen sowohl aus genreichen Regionen wie auch aus Zwischengenregionen
der DNA. Solche langen ncRNAs (Long noncoding
RNAs) greifen in die meisten genregulatorischen
Prozesse ein. Obschon die beteiligten Mechanismen
noch nicht aufgeklrt sind, scheint es plausibel, dass
lange ncRNA eine zentrale Rolle bei der rumlichen
Organisation des Chromatins und damit bei den
genregulatorischen Vorgngen spielt.
11.4

Epigenetische Regulation
und Vererbung

Epigenetische Regulationsmechanismen ermglichen die Differenzierung eukaryontischer


Zellen Alle somatischen Zellen eines Organis-

mus besitzen das gleiche Genom; die Unterschiede


zwischen einem Neuron, einer Leberzelle oder einer Epithelzelle beruhen auf einer zellspezifischen
stabilen Programmierung der unterschiedlichen
Expression bestimmter Gene (Zelldifferenzierung;
Abschn.36.1). Die Weitergabe von Expressionsmustern bei der Zellteilung, welche nicht genetisch,
d.h. in der Basenabfolge der DNA, festgelegt sind,
wird als epigenetische Vererbung bezeichnet. Die
wichtigsten epigenetischen Vererbungsmechanismen sind Histonacetylierung, DNA-Methylierung
und RNA-Interferenz.
Epigenetisch festgelegt sind auch Merkmale
wie die Verlngerung der Telomere in Keimzellen
(Abschn.8.2) und die Ausschaltung eines der zwei
X-Chromosomen in weiblichen Sugern. Ebenso
werden das Wachstum von Tumorzellen und die
Gedchtnismechanismen des Gehirns epigenetisch
beeinflusst.
Chromatin-Umlagerungskomplexe dienen
ebenfalls zur Regulation der Transkription Im

Grundzustand des Chromatins mit dichter nucleosomaler und supranucleosomaler Packung der
DNA sind die Promotorregionen nicht zugnglich

.. Abb.11.4 Sichtbare Genaktivitt in dekondensierten


polytnen Speicheldrsenchromosomen von Drosophila.
In den Puffs lsst sich der Einbau radioaktiv markierter
Ribonucleotide in die Transkripte durch Autoradiographie
(Exposition aufgetragener Rntgenfilm-Emulsion) mikroskopischer Prparate direkt darstellen. Die Silberkrner (schwarze
Flecken) sind nach der Entwicklung des gefrbten Prparats
im Mikroskop sichtbar und befinden sich in Regionen aktiver
RNA-Synthese.

fr die Bildung von Transkriptionskomplexen. Erst


eine Dekondensation macht die betroffenen Gene
fr die Transkriptionsmaschinerie zugnglich. Das
so genannte Puffing (Aufblhen) polytner Riesenchromosomen in den Speicheldrsen der Fruchtfliege Drosophila lsst die Dekondensation sichtbar
werden, weil in den polytnen Chromosomen etwa
1000 identische DNA-Molekle parallel zueinander
angeordnet sind (.Abb.11.4).
Unter ATP-Verbrauch lockern groe Chromatin-Umlagerungskomplexe die Struktur des Chromatins auf, lsen die DNA abschnittsweise von den
Nucleosomen und schaffen dadurch Zugang fr
Proteine zur DNA. Eine solche Umlagerung (Remodeling) des Chromatins ist nicht nur zur Replikation
der DNA notwendig sondern auch fr alle anderen
Vorgnge, bei denen Proteine an die DNA zu binden haben (Transkription, Regulation, Reparatur,
Rekombination etc.).
Histon-Modifikationen stabilisieren die aufgelockerte Struktur des Chromatins Die Histon-Acetyltransferase (HAT) bertrgt den Acetylrest von

Acetyl-CoA auf -Aminogruppen von Lysinresten


in der NH2-terminalen Domne der Histone:
O
CH3 C ~ S CoA

+ Lys (CH2)4 NH3


Lysin in Histon

Acetyl CoA

HAT

H S CoA

O
Lys (CH2)4 N C CH3
H

Kapitel 11 Regulation der Genexpression

136

1
2
3

N-terminaler Histonschwanz

M M

A
MP

A
M

MA

A
M

A
MM P

2
R

9 10
K S

14
K

17 18
R K

23
K

26 - 28
RK S

36
K

4
K

Nucleosomenkern

4
5

K9

6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Heterochromatin,
Gene stumm

K4

K9

Gene exprimiert

S10

K14

Gene exprimiert

K27
M

X-ChromosomInaktivierung

.. Abb.11.5 Der Histon-Code am Beispiel der Modifikation des Histons H3. Die aminoterminalen Schwnze der Histone ragen
aus dem oktameren Histonkern heraus und werden mehrfach posttranslational modifiziert. Die Modifikationen werden durch
Histonacetyltransferasen (HAT), Histonmethylasen und Histonkinasen durchgefhrt, die oft Teil eines Genaktivatorkomplexes
sind. Tausende von Varianten der Histonmodifikation knnen zustande kommen. Die spezifische Konstellation der Histonmodifikation in einer Chromatinregion wird von Proteinkomplexen erkannt und an die Proteine weitergeleitet, welche die Transkription, DNA-Reparatur, Rekombination, Genexpression usw. bewerkstelligen. Die Bedeutung nur einiger weniger Modifikationen
ist bekannt; wir sprechen jedoch im Sinn einer Hypothese vom Histon-Code. A, Acetylierung; M, Methylierung; P, Phosphorylierung; Zahl, Position des modifizierten Rests; R, Arginin; K, Lysin; S, Serin

Die positive Ladung der Histone und deren Affinitt


zur negativ geladenen DNA wird damit verringert,
wodurch die DNA sich leichter in eine Form umlagert, welche die Bildung des Transkriptionskomplexes zulsst: Das Gen wird aktiviert. Wie identifiziert
die HAT die zu aktivierenden Gene? Offenbar wird
sie durch Aktivatorproteine, einen besonderen Typ
signalabhngiger Transkriptionsfaktoren, an das
zu aktivierende Gen geleitet. Die aktivierten Gene
knnen auch wieder abgeschaltet werden; die Histondeacetylase macht die Acetylierung rckgngig, sobald die genaktivierenden Signale (Hormone,
Cytokine) verschwunden sind.
Weitere Histonmodifikationen wie die Methylierung von Lysin- oder Argininresten, Phosphorylierung und Ubiquitinierung knnen je nach Typ des

Histons und Ort der Modifikation die Genaktivitt


positiv oder negativ beeinflussen und somit das
zelltypische Genexpressionsmuster zustzlich fixieren. Der Zusammenhang zwischen dem Modifizierungsmuster der Histone und der Transkriptionsaktivitt der entsprechenden DNA-Abschnitte wird
in Analogie zum genetischen Code als Histon-Code
bezeichnet (.Abb.11.5). Vermutlich bleiben gewisse Histon-modifizierende Enzyme whrend der
Replikation ans Chromatin gebunden und ermglichen dadurch die Vererbung von Teilen des Histon-Codes.
Methylierung der DNA in der Kontrollregion
von Genen fixiert ein bestimmtes Expressionsmuster Dieser Mechanismus zur Programmie-

rung der Genexpression findet sich nur bei Verte-

137
11.4 Epigenetische Regulation und Vererbung

braten. Gewisse Cytosinbasen werden in Position5


methyliert.

11

hnlich einer Immunreaktion, von einigen wenigen


Zellen ausgehend ber eine ganze Pflanze ausbreiten.

Die Umstrukturierung von Genen kann regulatorische Konsequenzen haben Die Um-

platzierung von Genabschnitten in eine neue regulatorische Umgebung ist typisch fr Gene des
Immunsystems (Abschn.32.4). Ein weiteres
Beispiel dieser Art sind die regulatorischen Effekte
durch Einfgung (Insertion) von Onkogenen in
Chromosomen (Abschn.12.3).
Bei Sugern sind etwa 70% der CG-Sequenzen
methyliert und knnen dank der Resistenz der
methylierten DNA-Abschnitte gegen Spaltung mit
bestimmten Restriktionsenzymen (Abschn.39.1)
nachgewiesen werden. Die Methylierungen kommen in Promotor-Regionen mit hohem Gehalt
benachbarter C und G-Nucleotide (CpG-Inseln,
CpG islands) gehuft vor. In der Regel hemmt die
Methylierung dieser CpG-Inseln die Expression
des Gens. Die DNA-Methylase bertrgt whrend
der Replikation den Methylrest von S-Adenosylmethionin auf die DNA. Das Enzym erkennt hemimethylierte Abschnitte im Eltern-DNA-Doppelstrang und methyliert im anderen Strang die
entsprechenden Basen, das Methylierungsmuster
wird so an die Tochterzelle weitergegeben. Diese
sogenannte genomische Prgung (Genomic imprinting) uert sich darin, dass bei einigen Genen
die Expression davon abhngt, ob das betreffende
Allel von der Mutter oder vom Vater stammt, auch
wenn die Basensequenzen der zwei Eltern-Allele
samt deren Promotoren miteinander identisch sind.
Bei solchen Genen fhrt ein epigenetischer Mechanismus nicht nur zur Weitergabe von Merkmalen
bei der Mitose, sondern auch bei der Meiose der
Keimzellen und damit zu deren Weitergabe an die
nchste Generation.

RNA-Interferenz fhrt mittels bertragung


von RNA-Fragmenten zu epigenetischen Effekten Nach der Spaltung eines RNA-Molekls durch

den RISC-Komplex wird die kurze den Prozess auslsende miRNA oder siRNA wieder frei und kann
weitere RNA-Molekle angreifen. Die bermittlung
solcher kurzer RNAs durch Zell-Zell-Kontakte oder
bei Zellteilungen ergibt epigenetische Vererbungseffekte. Eine Virusresistenz kann sich auf diese Weise,

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514849-0
11.1 Regulation der Transkription
bei Prokaryonten: Operon
11.2 Regulation der Transkription
bei Eukaryonten: Transkriptionsfaktoren
11.3 Posttranskriptionale Regulation
der Genexpression
11.4 Epigenetische Regulation und Vererbung
Weiterfhrende Literatur

139

Plasmide, Viren, Viroide


und Prionen
Ph. Christen, R. Jaussi, R. Benoit

12.1

Plasmide140

12.2

Viren144

12.3

Tumorviren und Onkogene 147

12.4

Subvirale pathogene Agenzien: Viroide und Prionen 149

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_12, Springer-Verlag Berlin Heidelberg 2016

12

140

1
2
3
4
5
6
7
8
9
10
11
12
13
14

Kapitel 12 Plasmide, Viren, Viroide und Prionen

Das Genom eines Organismus enthlt viele konservierte DNA-Segmente, die durch Viren oder
Plasmide innerhalb eines Chromosoms aber auch
zwischen Chromosomen verlagert werden knnen
(Transposition). Diese mobilen genetischen Elemente (Transposons) knnen whrend der Phylogenese (Evolution der verschiedenen Spezies), der
Ontogenese (Individualentwicklung) und der Zelldifferenzierung an andere Orte im Genom verschoben werden. Das menschliche Genom enthlt eine
Vielzahl von Transposons, die oft in mehrfachen
Kopien vorkommen. Kurze Insertionssequenzen
im Transposon und der Akzeptorregion bestimmen das Woher und Wohin des Austauschs; Rekombinationsenzyme erkennen diese spezifischen
Nucleotidsequenzen und katalysieren die ntigen
Bindungswechsel.
Die Integration und Entfernung mobiler
DNA-Segmente wurden zuerst bei der Infektion
von Bakterien durch Bakteriophagen beobachtet
(Abschn.8.4). Am einfachsten lsst sich die genetische Rekombination jedoch anhand bakterieller
Antibiotika-Resistenzfaktoren in Plasmiden (meist
zirkulre dsDNA) darstellen.
Viren bestehen aus Nucleinsuren (dsDNA,
ssDNA, dsRNA oder ssRNA) und 1200 verschiedenen Proteinen (Hllproteine und Enzyme); gewisse Viren besitzen zudem eine Lipiddoppelmembran. Es gibt wohl kaum einen Organismus, der
nicht von Viren befallen werden kann und dessen
Genom nicht viele Wiederholungen (Direct repeats
und inverted repeats) als typische Spuren von Transposition enthlt:

15

17
18

20

12.1 Plasmide
Ein Plasmid kann seinem Wirtsbakterium Resistenz gegen ein Antibiotikum verleihen Plasmide wurden entdeckt, als Bakterienstmme von
medizinischer Bedeutung gegen Antibiotika (z.B.

Penicillin; Abschn.5.3) resistent geworden waren. Bakterien vermehren sich rasch. Eine Bakterienpopulation kann sich in 20Minuten verdoppeln;
ber Nacht kann aus einem einzelnen Bakterium
auf einem Nhrboden ein mit bloem Auge sichtbares Zellhufchen, eine Kolonie, entstehen. Die genetisch identischen Nachkommen eines einzelnen
Individuums werden als Klon oder Stamm (Strain)
bezeichnet:

Ein zunehmend ernsteres Problem der Medizin ist


die Entwicklung von antibiotikaresistenten Stmmen pathogener Bakterien. Die Resistenzmechanismen sind beraus vielfltig (.Tab.12.1).
Antibiotikum

16

19

Konformation. Viroide verursachen Krankheiten


von Kulturpflanzen, Prionen fhren bei Mensch,
anderen Sugern und auch bei Hefe zu Proteinfehlfaltungskrankheiten.

Inverted Repeats

Viroide und Prionen sind pathogene infektise Makromolekle und bestehen aus nackter zirkulrer

ssRNA bzw. aus dem Prionprotein in fehlgefalteter

Antibiotikum (Plural: Antibiotika): Produkt aus


Pilzen, Bakterien, Flechten usw., welches das
Bakterienwachstum hemmt. Halb- und vollsynthetische Derivate solcher Stoffe sowie biogene Verbindungen, die eukaryontische Zellen
wie Einzeller oder Pilze hemmen, werden oft
ebenfalls als Antibiotika bezeichnet.

Die Resistenz gegen ein Antibiotikum wird oft


von einer Bakterienzelle auf eine andere bertra-

141
12.1Plasmide

.. Tab.12.1 Wirkungsziele und Resistenzen verschiedener antimikrobieller Agenzien


Antimikrobielle Agenzien

Wirkungsziel

Beispiele von Resistenzen

Bacitracin, Carbapeneme, Cephalosporine, Cycloserin, Monobactame, Penicilline, Teichoplanin,


Vancomycin a, b

Zellwandsynthese

Penicillinase (-Lactamase)
Mutationen der D-Ala-D-Ala-
Synthetase
Verringerte Permeabilitt der Bakte
rienmembran

Trimethoprim a, b

Dihydrofolat-Reduktase

Synthese eines unempfindlichen


DHFR-Enzyms

Sulfonamide c

Synthese von Folsure

Mutationen in der Dihydropteroat-


Synthase

Polymyxine b

Zellmembran

Modifikation der Membran


glykolipide

Tetracycline, Spectinomycin d, e

30S-Untereinheit bakterieller Ribosomen

Exportsystem entfernt Antibiotikum


aus Zelle

Chloramphenicol, Clindamycin a, f

50S-Untereinheit bakterieller Ribosomen

Chloramphenicol-Transacetylase

Erythromycin (Makrolide) b

Peptidyltransferase

Methylierung von rRNA

Rifampicin

Bakterielle RNA-Polymerase

Mutationen der RNA-Polymerase

Chinolone

b, d

TopoisomeraseII (DNA-Gyrase), hemmen Entdrillung der DNA

Gyrase-Mutation

Das Antibiotikum wird beschleunigt abgebaut. b Das Zielmolekl des Antibiotikums wird verndert. c Sind keine
Antibiotika im engeren Sinn. Menschliche Zellen knnen Folsure als Vitamin aus der Nahrung aufnehmen und sind
deshalb unabhngig vom entsprechenden Syntheseweg. d Bakterien entwickeln effiziente Exportsysteme, welche die
Antibiotika aus der Zelle herauspumpen. e Inhibitoren der 50S-Ribosomen-Untereinheit, binden an die Peptidyltransferasestelle. f Inhibitoren der bakteriellen 30S-Ribosomen-Untereinheit, binden an die t-RNA-Akzeptorstelle.
a

gen Die Resistenzbertragung ist auf Transposons (Abschn.8.4) zurckzufhren. Transposons

sind als akzessorische Chromosomen zu betrachten;


sie werden als Plasmide bezeichnet, falls sie, wie die
Resistenzfaktoren, klein sind und sich unabhngig
von den entsprechenden chromosomalen Prozessen
vermehren. Plasmide bestehen aus zirkulrer doppelstrngiger DNA und kommen in Bakterien und
anderen Mikroorganismen vor. Pro Zelle knnen
mehrere Kopien eines Plasmids vorhanden sein,
die bei der Zellteilung oft ungleichmig auf die
Tochterzellen verteilt werden. Plasmide knnen
auch durch Konjugation (Paarbildung mit Hilfe von
F-Pili oder Sex-Pili) zwischen Zellen ausgetauscht
werden.

12

142

Kapitel 12 Plasmide, Viren, Viroide und Prionen

Struktur und Wirkungsweise der Plasmide

Die Gre von Plasmiden reicht von etwa 1000 bis


zu ber 100000 Basenpaaren. Ein Plasmid kann
sich unbeschrnkt vermehren, es benutzt die bakterielle Maschinerie zur Replikation wie auch zur
Transkription und Translation. Ein einfaches Plasmid besteht aus einer Replikations-Startstelle (Origin of replication, Ori), einer Insertionssequenz, einem Transposase-Gen und einem Resistenzgen. Die
Transposase wird durch die Synthesemaschinerie
des Wirtsbakteriums gebildet und katalysiert die Insertion des Plasmids ins Wirtsgenom sowie dessen
Exzision aus dem Wirtsgenom. In den Zellen liegt
die Plasmid-DNA als berspiralisierte geknuelte
Superhelix vor (.Abb.7.3).
Der Einbau mobiler genetischer Elemente in die
chromosomale DNA kann auf zwei Arten erfolgen,
je nachdem ob eine Homologie (partielle Sequenzidentitt) zwischen Transposon und Akzeptorregion
besteht oder nicht.

2
3
4
5
6
7
8
9

Integration ohne Homologie fhrt zu Inverted


repeats (umgekehrte repetitive Sequenzen) und
zur Duplikation von DNA-Segmenten Die Transposase erkennt ein Palindrom in der Plasmid-DNA

10
11
12
13
14
15
16

Plasmide knnen in die chromosomale DNA integriert und vererbt werden Die Integration ist ein

reversibler Prozess, der in hnlicher Weise auch bei


Viren vorkommt. Im Gegensatz zu Viren besitzen
Plasmide jedoch keine Proteinhlle und bestehen
aus nackter DNA. Plasmide wie auch Viren sind
wichtige Werkzeuge der Gentechnik.

und schneidet dieses glattendig bei seiner Symmetrieachse (.Abb.12.1). Das Wirtschromosom wird
an einer beliebigen Stelle mit einem versetzten
Schnitt geffnet und das Transposon dort von der
Transposase mit Hilfe wirtseigener DNA-Polymerase und DNA-Ligase eingefgt. An den Enden
des eingebauten Transposons verbleiben die beiden Hlften des Palindroms, die Inverted repeats.
Die Orientierung des eingebauten DNA-Segments
(die Ableserichtung eines Gens) bleibt unbestimmt.
Durch wiederholte Integration werden zahlreiche
Kopien eines Transposon-codierten Gens ins Chromosom eingebaut:

17
18
19
20

Homologie-abhngige Integration: Die palindromische Insertionssequenz des Plasmids ist identisch mit der Akzeptorsequenz Die Transposase

schneidet das Plasmid und die Akzeptor-DNA an


den homologen Sequenzabschnitten mit versetzten

Schnittstellen, so dass gleiche DNA-Enden entstehen, die von einer Ligase des Wirts kovalent verbunden werden (.Abb.12.2). hnliche Integrationsmechanismen laufen auch whrend der Infektion
von Zellen durch Viren ab.

143
12.1Plasmide

12

.. Abb.12.1 Integration eines Plasmids ohne Homologie zur Nucleotidsequenz der chromosomalen DNA. Die Transposase
schneidet das Plasmid glattendig und die Akzeptor-DNA mit berhngen und bringt die Enden danach fr Ligation und
Auffllen der Einzelstranglcken zusammen. Eine DNA-Polymerasereaktion ersetzt die an den berhngen auf einem Strang
fehlende DNA und verdoppelt damit die Akzeptorsequenz

.. Abb.12.2 Integration eines Plasmids mit Homologie zur Nucleotidsequenz der chromosomalen DNA. Die Transposase
schneidet Plasmid und Akzeptor-DNA und fgt sie danach zusammen. Der Schnitt ist versetzt und erfolgt in beiden DNAs in einem Segment mit gleicher DNA-Sequenz, so dass die berhngenden Enden der DNA miteinander hybridisieren und nur noch
ligiert werden mssen. Nach erfolgter Rekombination liegt beiderseits der Insertion eine Akzeptorsequenz vor (Direct repeats)

144

1
2
3
4
5

Kapitel 12 Plasmide, Viren, Viroide und Prionen

12.2 Viren
Viren sind Zellparasiten, die sich wie Plasmide
nicht selbst reproduzieren knnen Viren sind

absolute Parasiten; sie besitzen im Unterschied zu


Lebewesen keinen eigenen Stoffwechsel. Sie verwenden zellulre Maschinerien, Bausteine und
Energie zur Replikation sowie Transkription ihrer
DNA und zur Synthese ihrer weiteren Bestandteile,
dabei knnen sie die Wirtszelle schdigen oder tten. Sie sind, wie die noch primitiveren Plasmide, als
vagabundierende Gene aufzufassen.

Viren enthalten entweder DNA oder RNA


als Gentrger Es werden daher DNA-Viren und
RNA-Viren unterschieden. Die Gre des Genoms

ist uerst unterschiedlich; je nach Virus codiert das


Genom1200 verschiedene Proteine: Hllproteine,
welche die DNA umschlieen, und Enzyme fr die
Reproduktion der Viren; demgem variiert auch
die Gre und strukturelle Komplexitt der Viren.
Manche Viruspartikel zeigen geometrisch regulre
Strukturen und knnen daher kristallisiert und
rntgenkristallographisch mit atomarer Auflsung
untersucht werden.

6
7

HIV, Human immunodeficiency virus, Aids-Virus

8
9
10
11
12
13
14
15
16
17
18
19
20

Viren sind eine sehr heterogene Gruppe von


Zellparasiten
Sie werden nach diversen Ge-

sichtspunkten wie Typ der Wirtszelle, Art der Infektionsfolgen, der Nucleinsure und deren Replikation eingeteilt. Das International Committee on
Taxonomy of Viruses legt die Taxonomie der Viren
fest . Die folgenden Beschreibungen basieren
nicht auf dieser Taxonomie; sie bercksichtigen
die viralen Eigenschaften, welche den unterschiedlichen biologischen Effekten von Virusinfektionen
zugrunde liegen:
Bakteriophagen (kurz Phagen) befallen Bakterien als Wirtszellen, z.B. T4- oder (lambda)-Phagen in E. coli. Mykoviren (Pilzviren), pflanzliche
und tierische Viren befallen entsprechende Eukaryonten-Spezies.
Lytische Viren zerstren die Zellmembran. Unter Umstnden knnen sich die Viren aber auch

im lysogenen Zustand als temperente (abgeschwchte, nur potenziell lytische) Viren zusammen mit der Zelle vermehren, z.B. -Phagen und
Retroviren (.Abb.12.3).

Die Viren werden nach Nucleinsure und


mRNA-Synthese in sechs Klassen eingeteilt
(.Abb.12.4) Die Lebenszyklen der Virusklas-

senI und VI werden hier wegen deren Bedeutung


als Tumorviren und als Werkzeuge der Gentechnik
vorgestellt:
Viren der Klasse I enthalten doppelstrngige
DNA, die sie nach Adsorption an die Zelloberflche
in die Zielzelle injizieren (.Abb.12.5). Smtliche
Viruskomponenten werden durch die wirtseigene
Maschinerie produziert. Die neuen Viruspartikel
bilden sich spontan durch Selbstorganisation. Eine
viruscodierte DNase leitet den Abbau der zelleigenen DNA ein: Die Zelle wird lysiert und die Viren

145
12.2Viren

12

.. Abb.12.3 Lysogene und lytische Vermehrung des (lambda)-Bakteriophagen. Der -Phage ist nur eines unter vielen Viren,
welche sich durch zwei verschiedene Lebenszyklen den jeweils herrschenden Umgebungsbedingungen anpassen. Unter
bestimmten fr die Wirtszelle gnstigen Voraussetzungen wird das Virusgenom ins Genom des Wirts bertragen und vermehrt
sich dort kaum bemerkt fr viele Generationen zusammen mit der Wirts-DNA. Sind hingegen die Bedingungen fr den Wirt
stressig, kann sich das Virus durch rasche Synthese seiner viralen Produkte stark vermehren und sich von der Wirtszelle durch
deren Lyse absetzen

werden freigesetzt. In seltenen Fllen wird die DNA


des Virus ins Genom einer Zelle eingebaut, die dadurch lysogen wird.
Retroviren (Klasse VI) adsorbieren an Rezeptoren der Zelloberflche und gelangen durch
Membrantransport (Endocytose) ins Cytoplasma
(.Abb.12.6). Die virale +Strang-RNA wird durch
eine im Virus vorhandene Retrotranskriptase
(Reverse transcriptase) in einen komplementren
DNA-Strang umgeschrieben und vom selben Enzym zu einem DNA-Doppelstrang ergnzt (daher
die Bezeichnung Retroviren), der als provirale
DNA an beliebiger Stelle in ein Chromosom der
Wirtszelle eingebaut wird. Dieses integrierte Provirus, ein charakteristisches Merkmal der Retroviren, wird mit dem Genom der Zelle repliziert. Die
viralen Genprodukte (RNA und Proteine) werden
aufgrund der proviralen DNA synthetisiert, worauf

sie sich spontan zu neuen Viruspartikeln zusammen


lagern, welche die Wirtszelle via Membrantransport
(Exocytose) verlassen. Gewisse Retroviren nehmen
dabei aus der Zellmembran der Wirtszelle Lipide
und Proteine ihrer Hlle mit.
cDNA
Eine DNA, welche als Kopie einer RNA
durch Retrotranskription entsteht, wird als
copy-DNA, complementary DNA oder cDNA bezeichnet (cDNA ist wichtig in der Gentechnik;
Abschn.39.6).

Alle Viren sind Parasiten, Retroviren sind es im


hchsten Grad: Das virale Genom ist zwingend
ins Wirtsgenom integriert. Bei der Teilung der infizierten Zellen wird das Provirus auf die Tochter-

146

Kapitel 12 Plasmide, Viren, Viroide und Prionen

1
2

Virusgenom

3
4
5
6
7
8
9
10

.. Abb.12.4 Vereinfachte Klassifizierung der Viren nach Art der viralen Nucleinsure und nach Art der Bildung der mRNA. Das
virale Genom besteht aus dsDNA, ssDNA, dsRNA oder ssRNA, wobei ssDNA oder ssRNA jeweils einem +Strang (mit gleicher
Sequenz wie die mRNA) oder einem Strang (Komplementrstrang) entspricht. Die Transkription erfolgt ab dem Strang einer
dsDNA-Matrize oder ab dem Strang einer RNA-Matrize

11
12
13
14
15
16
17
18
19
20

.. Abb.12.5 Vermehrung von Viren der KlasseI. Beispiele: Bakteriophagen T4, T7, Sugerviren wie SV40 (Tumoren bei Affen),
Vaccinia (Kuhpocken), Variola (menschliche Pocken), Hepatitisvirus (Leberentzndung)

147
12.3 Tumorviren und Onkogene

12

.. Abb.12.6 Vermehrung der Retroviren (KlasseVI). Beispiele: HIV (Human immunodeficiency virus, Aids (Acquired immune deficiency syndrome)-Erreger), RSV (Rous sarcoma virus, Sarkomvirus des Huhns), HTLV (Human T-cell lymphotropic virus, T-Zell-Leukmien), MMTV (Mouse mammary tumor virus, Brustkrebsvirus der Maus)

generation bertragen, die dann unter Umstnden


wieder Viren produziert. Diese Mglichkeit ist von
besonderem Interesse, weil gewisse Retroviren und
andere Viren die Bildung von Tumoren auslsen
knnen. Die Virusinfektion kann sogar ber die
Keimbahn auf sptere Generationen des Wirts
bergreifen.
12.3

Tumorviren und Onkogene

Virale DNA im Genom der Zelle kann Tumoren


erzeugen Gewisse Viren knnen die normaler-

weise strikt regulierte Zellteilung und das Gewebewachstum beschleunigen und daher Krebs oder
auch gutartige Tumoren (z.B. Warzen) erzeugen
(lat. tumor, Schwellung). Whrend des Wachstums
eines Organismus und bei der Wundheilung bertrifft die Zellproduktion den Zelltod; im ausgewachsenen Organismus halten sich Zellproduktion und
Zelltod die Waage. Hie und da gert eine Zelle auer Kontrolle, sie produziert Tochterzellen, die sich
ebenfalls zu hufig teilen. Der bergang einer Zelle
mit normalem Wachstum zu einer unkontrolliert

proliferierenden Zelle wird als Transformation bezeichnet (Abschn.24.4).


Die Erzeugung von Tumoren ist bisher nur bei
Viren der KlassenI, II und VI beobachtet worden,
die sich ins Wirtsgenom integrierende dsDNA besitzen und damit die Replikation ihrer DNA ermglichen (.Abb.12.4).
Onkogene erzeugen Tumoren Besonders gut
untersucht sind die zur Tumorbildung fhrenden
Vorgnge bei den Retroviren (KlasseVI). Das zuerst
entdeckte tumorerzeugende Virus ist das Rous Sarcoma Virus (RSV) . Die provirale DNA des RSV ist
auf beiden Seiten von einer Insertionssequenz begrenzt und enthlt je ein gag, pol, env und ein nicht
in allen RSV-Stmmen vorkommendes V-SRC-Gen.
Die Insertionssequenzen i (Long terminal repeats,
LTR) bestehen aus terminalen repetitiven Abschnitten und sind den Inverted repeats bei Plasmiden
hnlich. Das GAG-Genprodukt ist ein Vorlufer
der Capsidproteine, die im Wirt antigene Immunreaktionen auslsen. Das POL-Gen codiert die virale
Retrotranskriptase, das ENV-Gen die Glykoproteine
der Virushlle und das V-SRC (sarcoma-)Gen eine
Proteinkinase. Die SRC-Kinase ist in der Plasma-

148

1
2
3

Kapitel 12 Plasmide, Viren, Viroide und Prionen

membran der Wirtszelle verankert und phosphoryliert Tyrosinreste bestimmter Proteine, welche
Signale zur Wachstumskontrolle bermitteln. Das
SRC-Gen kann auf diese Weise die Transformation
der Zelle auslsen und wird daher den Onkogenen
zugezhlt. Im Virus hat das Onkogen keine Funktion. RSV-Stmme ohne V-SRC-Gen erzeugen keine

GAG

POL

ENV

Tumoren; die Transformation erfolgt nur, wenn das


SRC-Onkogen die Synthese des Onkoproteins (im
Fall des SRC-Gens die SRC-Tyrosinkinase) veranlasst. Das Virus-Onkogen (V-SRC) ist eng verwandt
mit einem Gen der normalen Wirtszelle, dem zellulren Proto-Onkogen (cellular SRC, c-SRC, zelleigenes Tyrosinkinase-Gen).
v-SRC

5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

v-SRC =

Proto-Onkogene sind normale Bestandteile des


Genoms und codieren harmlose Zellkomponenten mit regulatorischer Funktion Sie werden erst

zu gefhrlichen Onkogenen, wenn sie strend ins


regulatorische Netzwerk der Zelle eingreifen, beispielsweise durch bermige Synthese eines Onkogenprodukts. Eine erhhte Transkriptionsfrequenz
des Proto-Onkogens kann infolge Stimulierung
durch benachbarte virale Kontrollelemente (Enhancer-Sequenzen in der viralen DNA) auftreten. Eine
weitere Mglichkeit, die Transkriptionsfrequenz zu
erhhen, besteht in der Amplifikation des viralen
Genoms.
Virale Onkogene stammen von zellulren Proto-Onkogenen ab Transpositionsmechanismen

hnlich denjenigen, die zwischen Plasmiden/Bakteriophagen und Bakterienchromosomen spielen,


knnen zellulre Proto-Onkogene in Viren bertragen. Viren dienen wie Plasmide als Vehikel zum
Gentransfer. Sie knnen einerseits virale Gene im
Wirtsgenom zurcklassen, andererseits aber auch
Wirtsgene oder Teile davon mitnehmen und in neue
Wirte einfhren.
Die Entdeckung zahlreicher Beispiele viraler
Onkogene (.Tab.12.2) hat wesentlich zum Verstndnis der Rolle der Proto-Onkogene bei der Kontrolle des Zellwachstums beigetragen. berdies ist
anzunehmen, dass Transpositionen die Evolution
der Organismen beschleunigen. Die Fhigkeit von
Plasmiden und Retroviren, fremde Gene nicht nur
Onkogene in Wirtszellen einzuschleusen, wird
auch biotechnologisch genutzt (Abschn.40.2).

Krebserzeugung durch DNA-Viren Im Gegensatz zu den Retroviren, die ein verndertes


zelleigenes Gen in die Zelle zurckbringen, fhren
DNA-Tumorviren der KlassenI und II der Zelle ein
viruseigenes Onkogen zu, das ins Zellgenom eingebaut wird. Das entsprechende Onkoprotein hemmt
ein zellulres Kontrollprotein, welches seinerseits
den Zellzyklus hemmt oder die Apoptose, den programmierten Zelltod, frdert. Zum Beispiel binden
die beiden Onkoproteine, das E7-Protein des Papillomavirus (Warzenvirus) und das E1A-Proteins
des menschlichen Adenovirus, an das Rb (Retinoblastom-)Protein. Das Rb-Protein ist ein Tumorsuppressorprotein und hemmt Aktivatoren des Zellzyklus. Die Onkoproteine verhindern die Bindung des
hemmenden Rb-Proteins an die Aktivatoren: Der
Zellzyklus luft schneller ab; die Hemmung einer
Hemmung frdert die Zellproliferation.
Andere Tumorvirus-Onkoproteine binden an
p53, ein weiteres wichtiges Tumorsuppressorprotein. Protein p53 stimuliert die Apoptose; seine
Hemmung frdert somit die Zelltransformation.
Die Onkogene und Tumorsuppressor-Gene wurden bei Viren entdeckt, sie spielen aber auch bei der
nichtviralen Krebsentstehung eine wichtige Rolle
(Abschn.24.4).
Viren verursachen nur wenige Tumorerkrankungen des Menschen (.Tab.12.3). Dennoch
ist deren Kenntnis wichtig, erffnet sie doch die
Mglichkeit, diese Tumoren durch Impfungen zu
verhindern (z.B. die Impfung junger Frauen gegen
Papillomaviren zur Prophylaxe von Gebrmutter-

149
12.4 Subvirale pathogene Agenzien: Viroide und Prionen

.. Tab.12.2 Beispiele von Onkogenen und Proto-Onkogenen a


Proto
onkogen

Onkogen

Zellulres
Produkt

c-SIS

v-SIS

B-Kette von
PDGF

c-ERB B

v-ERB B

EGF-Rezeptor

c-ERB A

v-ERB A

Thyroxin
rezeptor

c-haRAS

v-haRAS

G-Protein

c-SRC

v-SRC

Tyrosinkinase

c-FOS

v-FOS

Transkriptionsfaktor

c-MYC

v-MYC

Transkriptionsfaktor

Smtliche Proteine sind Bestandteile von Signal


bermittlungsketten zwischen Wachstumsfaktoren,
deren Rezeptoren und Transkriptionsfaktoren. PDGF,
Platelet-Derived Growth Factor; EGF, Epidermal Growth
Factor; G-Protein, Guanyl-nucleotide binding protein.

12

.. Tab.12.3 Viren und zugehrige Krebsformen a


Virus

Krankheit

Epstein-Barr-Virus
(DNA-Virus)

Burkitt-Lymphom in
Westafrika und Neuguinea; Nasopharyngeales
Karzinom in Sdchina;
bei uns keine Tumoren,
aber Pfeiffer-Drsenfieber
(Mononucleosis infectiosa)

Hepatitis B Virus
(DNA-Virus)

Hepatitis B und im
Sptstadium auch Leberkrebs

Papilloma-Virus
(DNA-Virus)

Warzen, Gebrmutterhalskrebs (Cervix-Karzinom),


Kaposi-Sarkom

HTLV-1 (Retrovirus,
verwandt mit HIV)

T-Zell-Leukmie in Japan

Die Fhigkeit bestimmter Viren, Krebs zu erzeugen,


hngt von der geographischen Lage ab. Die Lebensbedingungen und mgliche Einflsse anderer lokaler
pathogener Agenzien wie Malaria beeinflussen die
komplexe mehrstufige Karzinogenese.

halskrebs). Die potenzielle Gefahr einer bertragung tierischer Onkogene auf den Menschen durch
speziesbergreifend infektise Viren mahnt zur
Vorsicht im Umgang mit tierischem Material.

durch pflanzliche RNA-Polymerasen vermehrt, ihre


krankmachende Wirkung beruht mglicherweise auf
siRNA, die aus der viroidalen RNA entsteht und Teil
eines RISC (RNA-Induced Silencing Complex) wird.

12.4

den Prionkrankheiten ist das Prionprotein in seiner


Scrapie-Form (PrpSc; Abschn.3.8), eine konformationelle Abart des normalen Prpc (cellular Prp), eines Glykoproteins mit unbekannter physiologischer
Funktion, das an der Oberflche von Nervenzellen
und anderen Zellen ber Glycosylphosphatidylinositol (GPI) verankert ist. Das PrP-Gen wird in
infizierten kranken Tieren mit gleicher Frequenz
transkribiert wie in gesunden Tieren. Transgene
knock-out Muse ohne funktionierendes PrP-Gen
sind unter Laborbedingungen nicht zu unterscheiden von normalen Musen, erkranken aber nicht
nach Infektion mit PrpSc. Offenbar bewirkt PrpSc die
Umwandlung des normalen Prpc in PrpSc, das Aggregate mit ausgedehnter -Faltblattstruktur bildet
und sich weiter zu Fibrillen und amyloiden Plaques
zusammenlagert. Die kleinen, lslichen PrpSc-Agg-

Subvirale pathogene Agenzien:


Viroide und Prionen

Die kleinsten pathogenen Agenzien sind Makromolekle Mit der Zeit sind immer kleinere

Verursacher von Infektionskrankheiten gefunden


worden: Louis Pasteur und Robert Koch fanden
zwischen 1870 und 1880 die Bakterien; um die
Wende vom 19. zum 20.Jahrhundert wurden die
Viren entdeckt; und in den letzten Jahrzehnten sind
sogar Einzelmolekle, die Viroide (RNA) und die
Prionen (Proteine) , als Ursachen bertragbarer
Erkrankungen erkannt worden.
Viroide sind zirkulre ssRNA-Molekle mit 200
400Nucleotiden. Bis heute sind etwa 60 verschiedene
Typen bekannt, alle sind Erreger von Krankheiten
bestimmter Kulturpflanzen. Die Viroide werden

Prionen verursachen bertragbare Proteinfehlfaltungskrankheiten Das infektise Agens bei

150

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 12 Plasmide, Viren, Viroide und Prionen

regate sind cytotoxisch und fhren ber unbekannte


Mechanismen zum Absterben der Neuronen im
Zentralnervensystem. Mglicherweise berlasten
die PrpSc-Aggregate die zellulren Chaperonsysteme, welche daher die Faltung anderer, fr das
berleben der Zelle wichtiger Proteine nicht mehr
ausreichend untersttzen.
In Hefe (S. cerevisiae) sind konformationelle
Varianten mehrerer Proteine gefunden worden, die
sich wie das PrpSc der Suger verhalten und bei der
Zellteilung der Hefe epigenetisch auf Tochterzellen
bergehen.
Prionkrankheiten
Spezies
Creutzfeld-Jakob-Krankheit

Mensch

BSE (Bovine spongiform


encephalopathy), Rinderwahnsinn

Rind

Scrapie

Schaf

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514855-0
12.1 Plasmide
12.2 Viren
12.3 Tumorviren und Onkogene
12.4 Subvirale pathogene Agenzien:
Viroide und Prionen
Weiterfhrende Literatur

151

Stoffwechsel
Kapitel 13

Grundstzliches zum Stoffwechsel 153


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 14

Glykolyse und Citratzyklus 161


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 15

ATP-Synthese in Mitochondrien 177


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 16

Gluconeogenese, Glykogen, Disaccharide


und Pentosephosphatweg193
Ph. Christen, R. Jaussi, R. Benoit

Kapitel 17

Stoffwechsel der Fettsuren und Lipide 209


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 18

Stoffwechsel der Proteine und Aminosuren 225


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 19

Stoffwechsel der Purinund Pyrimidinnucleotide247


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 20

Photosynthese259
Ph. Christen, R. Jaussi, R. Benoit

Kapitel 21

Besonderheiten des Stoffwechsels


von Pflanzen und Bakterien 269
Ph. Christen, R. Jaussi, R. Benoit

III

153

Grundstzliches
zum Stoffwechsel
Ph. Christen, R. Jaussi, R. Benoit
13.1

Experimentelle Untersuchung des Stoffwechsels 154

13.2

bersicht ber den Stoffwechsel 156

13.3

Verwendung des im Katabolismus gebildeten ATP 158

13.4

Regulation des Stoffwechsels 159

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_13, Springer-Verlag Berlin Heidelberg 2016

13

154

1
2
3
4
5
6
7

Kapitel 13 Grundstzliches zum Stoffwechsel

Die hunderte bis tausende chemischer Reaktionen, die in einer Zelle und in einem vielzelligen
Organismus ablaufen, werden in ihrer Gesamtheit als Stoffwechsel (Metabolismus) bezeichnet.
Der Stoffwechsel dient zwei Zwecken: Gewinnung
chemischer Energie sowie Auf- und Abbau der
Bestandteile des Organismus. Jedes Lebewesen
entspricht einer Insel hoher Ordnung (niedriger
Entropie) inmitten eines chemischen Chaos. Fr
Aufbau und Erhaltung des hohen Ordnungsgrades
muss Energie von auen (Sonnenlicht bei phototrophen Organismen; Nhrstoffe bei chemotrophen
Organismen) zugefhrt und in eine von den Zellen
verwendbare Form (ATP) bergefhrt werden. Dabei wird Wrme frei.
Phototroph

verschiedene RNA-Molekle und 10 bis


300106Molekle von 600 verschiedenen
niedermolekularen organischen Verbindungen. Alle diese Komponenten werden
auf kleinstem Raum rasch und im richtigen
Mengenverhltnis synthetisiert.
Eindrckliche Zahlen zum menschlichen
Stoffwechsel: Ein erwachsener Mensch wird
in 50Jahren insgesamt 7.5t Nahrung (Trockengewicht) und 4000050000Liter Wasser
umsetzen. Die chemische Zusammensetzung
des Organismus und das Gewicht bleiben
dabei unverndert.


13.1

Der Stoffwechsel entspricht einem Netzwerk von


Stoffwechselketten und -zyklen Bei der Untersu-

chung einer Stoffwechselkette der Art

10
11
12
13
14
15
16
17
18
19
20

Experimentelle Untersuchung
des Stoffwechsels

Jede Einzelreaktion des Stoffwechsels wird durch


ein spezifisches Enzym katalysiert. Dank der Reaktions- und Substratspezifitt der Enzyme verluft der metabolische Fluss der Materie in den
geordneten Bahnen des Stoffwechselnetzwerks.
Komplexe regulatorische Netzwerke, welche die
katalytische Aktivitt einzelner Schlsselenzyme
steuern, passen den Stoffdurchsatz durch die verschiedenen Stoffwechselwege den jeweiligen Erfordernissen der Zelle und des Organismus an.
In diesem Teil des Lehrbuchs geht es darum, die
Bedeutung der wichtigsten Stoffwechselwege fr
das Leben der Zelle bzw. des Gesamtorganismus
aufzuzeigen.
Staunenswerte chemische Leistung 
Eine Kultur von E. coli in einer wsserigen
Lsung von Glucose und anorganischen
Salzen verdoppelt bei 37C ihre Zellzahl alle
30min. Jede Zelle enthlt durchschnittlich
500Molekle von jedem der insgesamt
1000 verschiedenen Proteine, mehr als 1000

----

interessieren folgende Fragen:


Welches Produkt wird aus dem Ausgangsstoff
A gebildet?
Welche Zwischenprodukte (X, Y) treten auf?
Welche Enzyme sind beteiligt?
Wie gro ist der Durchsatz, d.h. wie viel A
wird in einer Zelle oder im Organismus pro
Zeiteinheit zu Produkt umgewandelt?
Wie wird der Durchsatz reguliert?
Wo laufen die Reaktionen ab: in welchem Gewebe, in welchen Zellen, in welchem Zellkompartiment?

Wenn sich die Zufuhr des Ausgangsstoffs A nicht


ndert und gleichviel Produkt verbraucht wird,
wie A zugefhrt wird, befindet sich die Stoffwechselkette samt ihren Zwischenprodukten in einem
Fliegleichgewicht (Steady state): Die Zwischenprodukte entstehen mit der gleichen Geschwindigkeit, mit der sie weiterreagieren, ihre Konzentrationen bleiben unverndert.

155
13.1 Experimentelle Untersuchung des Stoffwechsels

13

.. Abb.13.1 Differenzielle Zentrifugation zur Isolierung von Zellorganellen.


Die Zellen werden schonend, d.h. ohne
Beschdigung der Zellorganellen, aufgeschlossen. Das Zellhomogenat wird
mehrfach mit jeweils erhhter g-Zahl
zentrifugiert: Immer kleinere Zellbestandteile werden abzentrifugiert und
finden sich im Sediment

Terminologie

Terminologie

Gleichgewicht AB
Die Konzentrationen von A und B bleiben
konstant, pro Zeiteinheit reagiert gleichviel A
nach B, wie B nach A reagiert.
Fliegleichgewicht A B C
Die Konzentration von B bleibt konstant, pro
Zeiteinheit entsteht gleichviel B aus A, wie B
nach C weiterreagiert (Steady state).

Der Stoffwechsel lsst sich auf verschiedenen


Ebenen untersuchen Im intakten Organismus

lassen sich durch Ftterungsversuche mit einem


bestimmten Ausgangsstoff (Vorlufer, Edukt), insbesondere wenn er isotopenmarkiert ist, Zwischenprodukte und Endprodukte des Stoffwechsels in Geweben, Blut oder Urin feststellen. Aufschlussreich
sind auch angeborene Stoffwechselstrungen und
bakterielle Stoffwechselmutanten: In beiden Fllen
blockiert ein genetischer Enzymdefekt vollstndig
oder teilweise einen bestimmten Schritt in der Stoffwechselkette:

Die Zwischenprodukte vor dem Block liegen in


erhhter Konzentration vor, die Metaboliten nach
dem Block werden in verringertem Mae oder gar
nicht gebildet.

Metabolit: Substanz, die im Stoffwechsel


gebildet oder umgesetzt wird.
Metabolom: Gesamtheit der Zwischen- und
Endprodukte des Stoffwechsels in Zellkompartiment, Zelle oder Organismus.

Eine Untersuchung des Stoffwechsels im berlebenden isolierten Organ schliet die Interferenz
von Seiten anderer Organe aus. Die hufigste Versuchsanordnung ist der Perfusionsversuch, bei welchem das Organ (z.B. die Leber) zur Versorgung
mit O2 und Nhrstoffen und zum Einbringen des
Ausgangsstoffes mit Blut oder einer geeigneten Ersatzlsung durchstrmt wird. Die Perfusionslsung
wird auf das Vorhandensein von Stoffwechselprodukten des Ausgangsstoffes untersucht.
Bei der Gewebeschnittmethode werden dnne
(<0,5mm) Schnitte aus berlebenden Organen in
einer Nhrlsung suspendiert. Die Zellen werden
dank der geringen Schnittdicke durch Diffusion
ausreichend mit Nhrstoffen und O2 versorgt. Die
zu untersuchende Vorlufersubstanz wird dem Inkubationsmedium zugegeben, das danach auf Metaboliten analysiert wird.
Zellkulturen erlauben, den Stoffwechsel in Mikroorganismen (Bakterien, Einzeller wie Hefe) und
auch tierischen oder pflanzlichen Zellen zu untersuchen.
Zur Erfassung der Stoffwechselleistungen der
verschiedenen Zellorganellen werden die Zellen
schonend aufgeschlossen, so dass die Organellen

156

1
2
3
4

intakt bleiben. Durch differenzielle Zentrifugation


(.Abb.13.1) solcher Zellhomogenate knnen bestimmte Organellen stark angereichert werden. Untersuchungen mit isolierten Organellen haben ergeben, dass gewisse Stoffwechselwege eukaryontischer
Zellen nur in bestimmten Organellen ablaufen (z.B.
Citratzyklus in Mitochondrien).
13.2

5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 13 Grundstzliches zum Stoffwechsel

Als Beispiel dient die Stoffwechselkette des Abbaus


von Glucose zu Pyruvat und die umgekehrte Reaktionsfolge zum Aufbau von Glucose:

bersicht ber
den Stoffwechsel

Die Stoffwechselwege lassen sich in zwei Gruppen einteilen:


Katabole Stoffwechselwege bauen groe,
komplexe Verbindungen zu kleineren, einfacheren Verbindungen ab.
Anabole Stoffwechselwege fhren von einfachen zu komplexeren Verbindungen.

Der Katabolismus, die Gesamtheit der abbauenden Reaktionen, ist als Ganzes genommen
ein exergonischer Vorgang Bei chemotrophen

Organismen werden Nhrstoffe und krpereigene


Makromolekle oxidativ unter Verbrauch von O2
zu CO2 und H2O abgebaut (.Abb.13.2). Die dabei
freiwerdende Energie wird zur Synthese energiereicher Phosphatverbindungen (v.a. ATP) verwendet,
z.T. wird sie als Wrme abgegeben.

Der Anabolismus entspricht im groen Ganzen einer Umkehr der katabolen StufenI und II

Die Synthesen der zelleigenen Makromolekle sind


endergonische Vorgnge. Sie werden zum Ablaufen
gebracht durch Verwendung der im Katabolismus
gewonnenen chemischen Energie (ATP); die Koppelung an die Hydrolyse von ATP macht sie exergonisch:

Bei sieben der zehn Einzelreaktionen entspricht


die anabole Reaktion einer Umkehr der katabolen
Reaktion, dasselbe Enzym katalysiert die Reaktion
in beiden Richtungen. Die Reaktion kann unter
physiologischen Bedingungen in beiden Richtungen ablaufen, weil sie in keiner Richtung stark
exergonisch ist. Als Beispiel die zweite Reaktion
im obigen Schema des Ab- und Aufbaus von Glucose:

157
13.2 bersicht ber den Stoffwechsel

13

.. Abb.13.2 Vereinfachte Darstellung des Katabolismus. Es lassen sich drei Stufen unterscheiden:
StufeI: Nhrstoffe und krpereigene Makromolekle werden zu ihren Bausteinen abgebaut.
StufeII: Bausteine werden zu Acetyl-Coenzym A abgebaut.
StufeIII: Acetyl-CoA wird oxidativ zu CO2 und H2O abgebaut.
Der Abbau der Makromolekle konvergiert ber gemeinsame Abbaustufen zu den wenigen Endprodukten. Alle Abbauwege
finden sich zusammen in einem zentralen Reaktionszyklus, dem Citratzyklus. Nucleinsuren sind nicht bercksichtigt, weil
sie quantitativ unwichtig sind. Ebenso sind andere Stoffwechselendprodukte als CO2 und H2O, wie z.B. NH3 oder Harnstoff als
Endprodukte des Stickstoffs von Aminosuren, nicht aufgefhrt

Einzelne anabole Reaktionen entsprechen jedoch


nicht einer einfachen Umkehr der katabolen Reaktion: Die anabole Reaktion folgt einem anderen
Reaktionsweg mit zustzlichen Reaktanten, welcher
durch ein anderes Enzym katalysiert wird. Hierzu
als Beispiel die dritte Reaktion im Schema:

Warum divergieren katabolische und anabolische


Stoffwechselwege bei bestimmten Schritten?

Die Zweigleisigkeit hat einen thermodynamischen


Grund. Wenn eine Reaktion in der katabolen Richtung stark exergonisch ist (G0), d.h. wenn
ihr Gleichgewicht stark auf der Produktseite liegt,
kann sie unter physiologischen Bedingungen,

158

Kapitel 13 Grundstzliches zum Stoffwechsel

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.13.3 Umschalten der Richtung eines Stoffwechselweges (Schritt3 im Abbau von Glucose). Die katalytischen Aktivitten der Phosphofructokinase und der Fructose-1,6-bisphosphatase werden durch allosterische Aktivatoren und Inhibitoren
reguliert. Je nach Stoffwechsellage wird die Stoffwechselkette in kataboler Richtung (Glykolyse, Abbau von Zucker) oder anaboler Richtung (Gluconeogenese, Neubildung von Glucose) laufen. Das eindeutige Umschalten entweder auf katabole oder
anabole Reaktion verhindert einen ATP-verbrauchenden Leerlaufzyklus (Futile cycle), in welchem Fructose-1,6-bisphosphat
unter Verbrauch von ATP gebildet und gleich wieder zu Fructose-6-phosphat und anorganischem Phosphat hydrolysiert wird

insbesondere bei den Reaktantenkonzentrationen in der Zelle, nicht rckwrts ablaufen. Fr


die anabole Richtung muss deshalb ein anderer
Reaktionsweg eingeschlagen werden. Die Phosphofructokinase-katalysierte Reaktion im obigen
Beispiel ist irreversibel, weil ATP eine allzu energiereiche Verbindung ist, um aus energiearmem
Fructose-1,6-bisphosphat und ADP, die in niedriger Konzentration vorliegen, synthetisiert werden
zu knnen. Aus analogen Grnden ist die anabole
Reaktion irreversibel, Fructose-6-phosphat kann
in der Zelle nicht mit anorganischem Phosphat zu
Fructose-1,6-bisphosphat phosphoryliert werden.

Der Durchsatz von Stoffwechselketten wird


bei den getrennt verlaufenden irreversiblen
Schritten reguliert Da zwei verschiedene Enzyme

die katabole und anabole Reaktion katalysieren,


knnen die Stoffwechselwege getrennt und damit
gegensinnig reguliert werden. Dank der richtungsspezifischen Regulation kann die Zelle zwischen
katabolem Stoffwechsel (Energieproduktion) und
anabolem Stoffwechsel (Anlage von Reserven chemischer Energie) umstellen (.Abb.13.3). Die allos-

terische Regulation der Enzyme wird ergnzt durch


die Regulation der Synthese gewisser Enzyme.
13.3

Verwendung des im
Katabolismus gebildeten ATP

ATP ist die Energiewhrung der Zelle Endergo-

nische Vorgnge werden durch Koppelung mit der


Hydrolyse von ATP angetrieben; fast immer, wenn
ein Prozess Energie kostet, wird die thermodynamische Rechnung mit ATP bezahlt. Ein erwachsener Mensch verbraucht 5080kg ATP pro Tag (bei
einem gesamten ATP-Gehalt von etwa 100g)! ATP
wird in derselben Zelle verbraucht, in der es synthetisiert worden ist. ATP dient nicht als extrazellulre
Transportform chemischer Energie. ATP durchluft
einen Zyklus :

13

159
13.4 Regulation des Stoffwechsels

Die Zellbestandteile sind einem fortwhrenden


Umsatz unterworfen Untersuchungen mit iso-

topenmarkierten Verbindungen haben gezeigt, dass


Proteine und auch die anderen Zellbestandteile mit
Ausnahme der DNA dauernd abgebaut und durch
neu synthetisierte ersetzt werden. Die Zellkomponenten befinden sich in einem Fliegleichgewicht
(.Tab.13.1).
Der energieaufwndige Umsatz der Zell- und
Krpersubstanz (.Tab.10.2) ist von zweifacher Bedeutung. Er eliminiert fehlerhafte Zellkomponenten, die durch spontan ablaufende Alterungsvorgnge oder uere Einwirkung verndert worden
sind. Zudem erlaubt der fortwhrende Umsatz von
Enzymen eine Regulation des Stoffwechsels durch
Vernderung der Synthesegeschwindigkeit gewisser
Enzyme, ein andauernder Abbau ist unabdingbare
Grundlage hierfr.
13.4

.. Tab.13.1 Umsatz (Turnover) von Zellbestandteilena


t1/2 (Tage)
Leber
Protein

56b

Glykogen

0,51

Phospholipide

12

Proteine

30

Glykogen

0,51

Phospholipide

200

Muskel

Gehirn

a
Nach der Halbwertszeit t1/2 ist die Hlfte einer
gegebenen Population von Moleklen abgebaut und
durch neu gebildete Molekle ersetzt worden.
b
Die sehr kurzlebige Ornithin-Decarboxylase hat
eine t1/2 von nur 10min.

Regulation des Stoffwechsels

Ein Organismus und auch eine Zelle verfgen nicht


immer ber gleich viel Nhrstoffe, sie bentigen
auch nicht immer gleich viel chemische Energie und
Baustoffe: Die Zelle passt sich den Bedingungen an,
indem sie den Stoffwechsel entsprechend reguliert.
Wechselnder ATP-Bedarf
Der ATP-Bedarf einer Muskelfaser kann einige
hundert Mal zunehmen, wenn sie vom Ruhezustand zu maximaler Leistung bergeht.

werden zur Deckung des Energiebedarfs diese Reserven und darauf krpereigene Proteine abgebaut.
Der Stoffwechsel wird auf zwei Stufen reguliert: Aktivitt oder Konzentration bestimmter
Enzyme werden verndert Bei allosterisch regulierbaren Enzymen kontrollieren Inhibitoren

und Aktivatoren die katalytische Aktivitt. In der


Regel betreffen die Regulationsmechanismen Enzyme, welche irreversible Reaktionen am Anfang
einer Stoffwechselkette katalysieren (.Abb.13.3).
Definition

Die wichtigsten Regulationsmechanismen entscheiden zwischen Katabolismus und Anabolismus


Je nach Gewebe wird der Aufbau von Krpersubstanz bestimmt durch das Nhrstoffangebot (z.B. im

Fettgewebe die Synthese von Reservefett) oder durch


den Bedarf an Zellbestandteilen (z.B. die Synthese
von Muskelproteinen beim Bodybuilding). Der Abbau von Nhrstoffen zur Gewinnung von ATP wird
ausschlielich durch den ATP-Bedarf der Zellen gesteuert, keinesfalls durch das Nhrstoffangebot. Bei
einem berangebot wird nicht vermehrt ATP gebildet, sondern chemische Energie in Form von Glykogen und Reservefett gespeichert. Im Hungerzustand

Schrittmacherreaktion: Regulierte und meist


langsamste Reaktion in einer Stoffwechselkette, deren Geschwindigkeit den Durchsatz
durch die Kette bestimmt.

Einige Hormone regulieren den Stoffwechsel, indem sie indirekt ber eine Signalkaskade die Aktivitt von Schrittmacherenzymen beeinflussen; andere Hormone wiederum stimulieren oder hemmen
die Synthese bestimmter Enzyme. Gewisse Enzyme
werden bei Fehlen ihres Substrats gar nicht synthetisiert, ihre Synthese wird ber eine Regelkette

160

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 13 Grundstzliches zum Stoffwechsel

durch das Substrat induziert. Im Gegensatz zu diesen induzierbaren Enzymen stehen die konstitutiven Enzyme, die immer in gleicher Konzentration
vorliegen.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1514857-0
13.1 Experimentelle Untersuchung
des Stoffwechsels
13.2 bersicht ber den Stoffwechsel
13.3 Verwendung des im Katabolismus
gebildeten ATP
13.4 Regulation des Stoffwechsels
Weiterfhrende Literatur

161

Glykolyse und Citratzyklus


Ph. Christen, R. Jaussi, R. Benoit

14.1

Glykolytischer Abbauweg162

14.2

Von Pyruvat zu Acetyl-CoA 168

14.3

Abbau von Acetyl-CoA im Citratzyklus 171

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_14, Springer-Verlag Berlin Heidelberg 2016

14

162

1
2
3
4
5
6
7

Kapitel 14 Glykolyse und Citratzyklus

Fr die meisten Gewebe ist Glucose neben Fettsuren der wichtigste Energielieferant. Wenn gengend
O2 vorhanden ist, wird Glucose durch die Reaktionskette der Glykolyse (griech. Abbau von Zucker)
im Cytosol zu Pyruvat (Anion der Brenztraubensure, pyruvic acid) und darauf durch den Pyruvatdehydrogenase-Multienzymkomplex in den
Mitochondrien zu Acetyl-CoA (aktivierte Essigsure) und CO2 abgebaut (aerobe Glykolyse). Acetyl-CoA wird weiter ber den Citrat-Zyklus oxidativ
zu CO2 abgebaut. Die Oxidation der entstehenden
Reduktionsquivalente (NADH und FADH2) durch
O2 in der Atmungskette ist gekoppelt mit der Synthese von ATP. Diese oxidative Phosphorylierung ist der Hauptlieferant von ATP in eukaryontischen Zellen (etwa 30mol ATP/Mol Glucose).

Zellen knnen Glucose auch ohne Koppelung


mit O2-abhngigen Oxidationsvorgngen zur Gewinnung von ATP nutzen (anaerobe Glykolyse).
Bei der Milchsuregrung wird Glucose nichtoxidativ ber Pyruvat zu Lactat (Anion der Milchsure) abgebaut. Bei Mensch und hheren Tieren
wird Glucose nur unter bestimmten Bedingungen
auf diese Weise abgebaut: in den Erythrozyten, die
keine Mitochondrien besitzen, und in der Muskulatur, wenn bei hoher Leistung der O2-Nachschub
nicht mehr ausreicht. Bei der alkoholischen Grung
der Hefe wird Pyruvat anaerob zu Ethanol und CO2
abgebaut. Der anaerobe Abbau von 1mol Glucose
zu Lactat oder Ethanol liefert nur 2mol ATP.

14.1

(9020mg/100mL) gehalten. Die Glucose im


Blut stammt entweder aus dem Darm (Strke in
Nahrung) oder aus der Leber (Glykogen-Reserve,
Gluconeogenese). Glucosetransporter in der Zellmembran ermglichen den passiven katalysierten
Transport der Glucose (Abschn.26.4) lngs des
Konzentrationsgeflles in die Zelle.
In den meisten Geweben (z.B. Leber, Gehirn,
Erythrozyten) ist die Aufnahme von Glucose nicht
reguliert Die Menge der aufgenommenen Glucose
wird allein durch den Konzentrationsunterschied
zwischen Blut und Zelle, d.h. durch den Glucoseverbrauch der Zelle, bestimmt. Der Energiestoffwechsel des Gehirns ist ein Sonderfall. Whrend
die meisten Zellen zur Gewinnung chemischer
Energie vorwiegend Fettsuren abbauen, kann das
Gehirn normalerweise nur Glucose verwenden. Bei

8
9
10
11
12
13
14
15
16
17
18
19
20

Glykolytischer Abbauweg

Alle Zwischenprodukte der Glykolyse (Abbau von


Zucker) sind phosphoryliert Der Abbau von Glucose zu Pyruvat erfolgt im Cytosol ber 10 enzy-

mkatalysierte Reaktionen (.Abb.14.1, ). Sobald


Glucose in die Zelle gelangt, wird sie phosphoryliert.
Alle weiteren Zwischenprodukte der Glykolyse tragen auch eine oder sogar zwei Phosphatgruppen
und sind bei pH7, dem physiologischen intrazellulren pH-Wert, negativ geladen. Da Ionen nicht
durch die Zellmembran diffundieren knnen, bleiben die Zwischenprodukte in der Zelle.
Abschnitt1: Aufnahme der Glucose in Zelle
und erste Phosphorylierung Beim Menschen
wird die Glucosekonzentration im Blut innerhalb relativ enger Grenzen konstant bei 51mM

163
14.1Glykolytischer Abbauweg

14

.. Abb.14.1 Glykolyse. Die


Reaktionskette von Glucose
zu Lactat lsst sich in folgende
Abschnitte unterteilen:
Aufnahme von Glucose in
die Zelle und Phosphorylierung
(Verbrauch von 1ATP)
Isomerisierung und Phosphorylierung (Verbrauch von 1ATP)
zu Fructose-1,6-bisphosphat
(C6) und Spaltung in 2Triosephosphate (2C3, Dihydroxy
acetonphosphat und Glycerinaldehyd-3-phosphat)
Bildung von ATP (Gewinn von
22 ATP) durch energetische
Koppelung mit der Oxidation
von Glycerinaldehyd-3-phosphat
zu Pyruvat
Reduktion von Pyruvat zu
Lactat zur Rckgewinnung von
NAD+
Blaue Pfeile geben die drei irreversiblen Reaktionen an

Absinken der Glucosekonzentration im Blut auf


Werte unter 23mM (Hypoglykmie) ist eine ausreichende ATP-Synthese im Gehirn nicht mehr gewhrleistet: Die Ionenpumpen versagen, es kommt
zu schweren Strungen der Gehirnfunktionen, die
von Krmpfen ber Bewusstlosigkeit und Koma bis
zum Tod fhren knnen.
Insulin frdert die Glucoseaufnahme in Muskel- und Fettzellen Insulin ist das wichtigste

Hormon zur Aufrechterhaltung einer konstanten


Glucosekonzentration im Blut. Ein Anstieg der
Glucosekonzentration erhht die Ausschttung
von Insulin. Das Hormon frdert in Muskel- und
Fettzellen die Fusion intrazellulrer Vesikel, wel-

che Glucosetransporter tragen, mit der Zellmembran, erhht damit die Anzahl der Glucosetransporter an der Zelloberflche und beschleunigt die
Aufnahme von Glucose. Durch Rckkoppelung
entsteht ein Regelkreis: Muskel- und Fettgewebe
nehmen mehr Glucose auf, die Glucosekonzentration im Blut sinkt, und die Insulinsekretion nimmt
wieder ab. Insulin ist das Hormon des berflusses: Bei berangebot dient die in Muskel- und
Fettgewebe aufgenommene Glucose zur Anlage
von Energiereserven in Form von Glykogen bzw.
Triacylglycerolen. Bei niedriger Konzentration
bleibt die Glucose im Blut dem Gehirn vorbehalten.

164

1
2
3

Kapitel 14 Glykolyse und Citratzyklus

Zur Phosphorylierung der Glucose zu Glucose-6-phosphat wird ATP investiert Unter physio-

logischen Bedingungen ist die Reaktion nicht umkehrbar; Glucose-6-phosphat ist keine energiereiche
Verbindung und kann nicht fr die Synthese von
ATP verwendet werden (.Tab.1.4).

Es folgt ein zweiter, wiederum irreversibler Phosphorylierungsschritt zu Fructose-1,6-bisphosphat,


katalysiert durch die Phosphofructokinase, dem
Schrittmacherenzym der Glykolyse (.Abb.14.1).
Dieses Enzym reguliert den Durchsatz durch die
ganze Stoffwechselkette. Der zweite Phosphorylierungsschritt sorgt dafr, dass bei der darauf folgenden Spaltung keine nichtphosphorylierte Triose
entsteht:

5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die Reaktion wird in der Leber und den insulinproduzierenden -Zellen des Pankreas durch die
glucosespezifische Glucokinase katalysiert. In allen
anderen Geweben phosphoryliert die allgemein fr
Hexosen spezifische Hexokinase die Glucose. Die
beiden Isoenzyme unterscheiden sich auch in ihrer
Affinitt fr Glucose. Die relativ hohe Affinitt der
Hexokinase fr Glucose (Km 0,1mM) fhrt dazu,
dass das Enzym bei physiologischen Glucosekonzentrationen bereits gesttigt ist und in die Zelle
aufgenommene Glucose mit Maximalgeschwindigkeit phosphoryliert. Die Glucokinase der Leber
hat hingegen einen hohen Km-Wert (10mM), die
Geschwindigkeit der Phosphorylierung erhht sich
daher mit dem Ansteigen der Glucosekonzentration im Pfortaderblut in der resorptiven Phase. Auf
diese Weise fngt die Leber berschssige Glucose
im Pfortaderblut ab. Sobald postresorptiv die Glucosekonzentration im Pfortaderblut sinkt, nimmt
auch die Geschwindigkeit der Phosphorylierung
ab, der Groteil der Glucose passiert die Leber und
steht den peripheren Geweben (Gehirn!) zur Verfgung.
Abschnitt2: ber Fructose-1,6-bisphosphat
(C6) zu zwei Triosephosphaten (2xC3) Glucose-6-phosphat, eine Aldose, isomerisiert zu Fructose-6-phosphat, einer Ketose:
Dihydroxyacetonphosphat, eine Ketose, und Glycerinaldehyd-3-phosphat, die entsprechende Aldose,

165
14.1Glykolytischer Abbauweg

14

.. Abb.14.2 Oxidation von Glycerinaldehyd-3-phosphat zu 3-Phosphoglyceroylphosphat. Die Oxidation des Aldehyds zur
Carbonsure (mit NAD+, Nicotinamid-Adenin-Dinucleotid, als Elektronenakzeptor) ist gekoppelt mit der Synthese eines energiereichen gemischten Sureanhydrids

stehen miteinander im Gleichgewicht. Glycerinaldehyd-3-phosphat ist das Substrat der nchsten


Reaktion.
Abschnitt3: Oxidationsreaktion liefert energiereiche Verbindung Die Glycerinaldehydphosphat-Dehydrogenase katalysiert die einzige
oxidative Reaktion der Glykolyse und produziert
aus Glycerinaldehyd-3-phosphat mit NAD+ als
Oxidationsmittel eine energiereiche Verbindung,
3-Phosphoglyceroylphosphat, ein gemischtes
Sureanhydrid aus 3-Phosphoglycerinsure und
Phosphorsure (.Abb.14.2). Die Oxidation von
Glycerinaldehyd-3-phosphat zu 3-Phosphoglycerinsure ist eine exergonische Reaktion; die Phosphorylierung der 3-Phosphoglycerinsure durch
anorganisches Phosphat zu 3-Phosphoglyceroylphosphat, einem energiereichen gemischten Sure-

anhydrid ist hingegen endergonisch. Die energetische Koppelung der beiden Teilreaktionen ber das
gemeinsame Zwischenprodukt, den energiereichen
Thioester der 3-Phosphoglycerinsure mit einem
Cysteinrest des Enzyms, ermglicht das Ablaufen
der Gesamtreaktion (.Abb.14.3).
NADH/NAD+
NADH besitzt ein Absorptionsmaximum bei
340nm (340=6220M1cm1), welches bei
NAD+ vllig fehlt. Enzymreaktionen, bei denen
NADH gebildet oder verbraucht wird, lassen
sich daher photometrisch verfolgen. Dieser
optische Test wird hufig zur Bestimmung von
Enzymaktivitten und Metabolitkonzentrationen eingesetzt.

Kapitel 14 Glykolyse und Citratzyklus

166

.. Abb.14.3Glycerinaldehydphosphat-Dehydrogenase. Der Reaktionsmechanismus dieses


Enzyms liefert ein schnes Beispiel fr die energetische Koppelung zweier Reaktionen: Die
exergonische Oxidation eines Aldehyds (in Form
seines Thiohemiacetals mit der Sulfhydrylgruppe
eines Cysteinrests des Enzyms) zur Carbonsure
(Schritt2) bringt die endergonische Bildung eines
energiereichen Sureanhydrids (3-Phosphoglycerinsure+Phosphorsure3-Phosphoglyceroyl
phosphat) zum Ablaufen (Schritt3). Gekoppelt
sind die beiden Reaktionen ber den energiereichen Thioester

1
2
Thiohemiacetal

3
4
5
6
7
8
9
10

.. Tab.14.1 Energiearme und energiereiche Verbindungena


G
kJ/mol

11
12

Energiearme Phosphatbindungen
Phosphat
ester

13
14
15
16
17
18
19
20

Glucose-6-P

+H2O

Glucose + Pi

13,8

Fructose-1,6-P2

+H2O

Fructose +Pi

16,7

Niedriges Phosphatgruppen ber


tragungspotenzial

Energiereiche Phosphatbindungen
Phosphat
anhydrid

ATP

+H2O

ADP+Pi

30,6

Gemischtes
Anhydrid

3-PGP

+H2O

3-PG+Pi

49,3

Enolphosphat

PEP

+H2O

Pyruvat+Pi

61,9

CoA+Acetat

31,4

Hohes
Phosphatgruppenber
tragungspotenzial

Energiereiche Thioesterbindung
Acyl-CoA

Acetyl-CoA

+H2O

Hohes Acetylgruppen-bertragungspotenzial

Um das Gruppenbertragungspotenzial der verschiedenen Verbindungen miteinander vergleichen zu knnen, wird


hier wie blicherweise die nderung der freien Energie der hydrolytischen Spaltung G angegeben, d.h. mit H2O als
Akzeptor der bertragenen Gruppe
a

167
14.1Glykolytischer Abbauweg

Im nchsten Schritt wird ATP zurckgewonnen,


indem der Phosphatrest von 3-Phosphoglyceroylphosphat auf ADP bertragen wird:

Das Phosphatgruppenbertragungspotenzial von


3-Phosphoglyceroylphosphat ist wesentlich hher
ist als dasjenige von ATP (.Tab.14.1). Die Synthese

14

von ATP in dieser Reaktion ist damit exergonisch.


Die bisherige Reaktionsfolge hat zur Synthese von
ATP gefhrt, ohne dass dabei Sauerstoff verbraucht
worden wre. Man stellt diese anaerobe ATP-Synthese als Substratkettenphosphorylierung der
oxidativen Phosphorylierung in den Mitochondrien
gegenber.
Mit der Verlagerung des Phosphatrests aus Stellung3 in Stellung2 (.Abb.14.1) wird der nchste
Schritt vorbereitet, in welchem die Enolase aus
2-Phosphoglycerat Phosphoenolpyruvat produziert, die energiereichste biologische Verbindung
berhaupt (.Tab.14.1). Daraus wird in der nchsten Reaktion ATP gewonnen:

Enolase

Phosphoenolpyruvat hat ein derart hohes Phosphatgruppenbertragungspotenzial, weil sich das entstehende Enolpyruvat spontan und rasch in Pyruvat
umwandelt, d.h. aus dem Gleichgewicht entfernt
wird. Die Pyruvatkinase-Reaktion ist daher unter physiologischen Bedingungen nicht reversibel.
Auch bei dieser Reaktion zur Synthese von ATP
handelt es sich um eine Substratkettenphosphorylierung.
Abschnitt4: Reduktion von Pyruvat zu Lactat:

In der anaeroben Glykolyse (Milchsuregrung)


ist diese Reaktion unbedingt notwendig, weil sie
NAD+ regeneriert und damit die Glycerinaldehydphosphat-Dehydrogenase-Reaktion und die Glykolyse fortwhrend ablaufen lsst (.Abb.14.1).
Lactat, das Endprodukt der anaeroben Glykolyse

wird von den Zellen ins Blut abgegeben und in der


Leber zur Resynthese von Glucose verwendet (Cori-Zyklus).
Die ATP-Bilanz der anaeroben Glykolyse ist
positiv (.Tab.14.2). Pro mol Glucose, welches
zu 2mol Lactat abgebaut wird, werden 2mol ATP
gewonnen. Die Energiebilanz zeigt, dass unter
Standardbedingungen (Konzentrationen der Reaktanten 1M) 31% der chemischen Energie, die
beim Abbau von Glucose zu Milchsure frei wird,
in Form von ATP gewonnen werden. Die Rechnung mit physiologischen Konzentrationen der
Reaktanten ergibt einen Wirkungsgrad von etwa
40%. Der Rest der freien Energie der Glucose wird
als Wrme freigesetzt. Unter Standardbedingungen und auch bei physiologischen Bedingungen
ist G bzw. G der Gesamtreaktion negativ,
d.h. der anaerobe Abbau von Glucose zu Lactat
samt der damit gekoppelten Bildung von ATP ist
exergonisch.

Die alkoholische Grung der Hefe ist eine


Variante der anaeroben Glykolyse Die beiden

anaeroben Abbauprozesse unterscheiden sich nur


in den Endstufen. Die Hefe ist ein einzelliger Eukaryont, sie besitzt Mitochondrien und kann unter

168

1
2

Kapitel 14 Glykolyse und Citratzyklus

.. Tab.14.2Glykolyse

3
4
5

ATP (mol/mol)

ATP-Bilanz (vgl. .Abb.14.1)


GlucoseGlucose-6-P

Fructose-6-PFructose-1,6-P2

3-Phosphoglyceroylphosphat3-Phosphoglycerat (2x)

+2

PhosphoenolpyruvatPyruvat (2x)

+2

Netto

+2

Energie-Bilanz

6
7

G (kJ/mol)
Glucose2 Milchsure

198

2ADP+2Pi2ATP+2H2O

+6l

Glucose+2ADP+2Pi2Milchsure+2ATP+2H2O

137
(Gesamtreaktion ist exergonisch!)

8
9

aeroben Bedingungen Pyruvat oxidativ zu CO2 abbauen. Bei Sauerstoffmangel stellen die Hefezellen

auf anaeroben Stoffwechsel um und bauen Glucose


zu Ethanol und CO2 ab:

Auch bei der alkoholischen Grung geht es darum,


NAD+ zu regenerieren, damit die Glykolyse unter
anaeroben Bedingungen kontinuierlich ablaufen
kann. Ihre Endprodukte sind beide von praktischer
Bedeutung: Die alkoholische Grung zuckerhaltiger Lsungen dient seit Urzeiten zur Herstellung
alkoholhaltiger Getrnke wie Bier und Wein; frei
gesetztes CO2 lsst Brot und Hefegebck beim Backen aufgehen.

14.2

10
11
12
13
14
15
16
17
18
19
20

Alkoholische Getrnke
Die Hefezellen knnen Alkohol bis zu einer
Konzentration von hchstens 15Volumen-%
(12Gewichts-%; 2,6M) produzieren. Destillation von Grlsungen liefert die hherprozentigen Alkoholika (gebrannte Wasser).

Von Pyruvat zu Acetyl-CoA

In eukaryontischen Zellen unter aeroben Bedingungen wird Pyruvat durch oxidative Decarboxylierung zu Acetyl-CoA umgesetzt. Diese Reaktion
wird durch den Pyruvatdehydrogenase (PDH-)
Multienzymkomplex
katalysiert und luft in
der Matrix der Mitochondrien ab. Ein erst krzlich entdecktes Transportprotein der inneren
Mitochondrienmembran bringt, angetrieben durch
den Protonengradienten (.Abb.15.6), Pyruvat aus
dem Cytosol in die Mitochondrien . Nicht nur
die Glykolyse, der Hauptweg des Kohlenhydratabbaus, sondern auch der Abbau gewisser Aminosuren fhrt ber die Oxidation von Pyruvat (Abschn.18.2). Die einfache Decarboxylierung von
Pyruvat zu freiem Acetaldehyd wie in der Hefe ist
nicht mglich, weil die in der Hefe vorkommende
Pyruvatdecarboxylase fehlt.

169
14.2 Von Pyruvat zu Acetyl-CoA

14

34kJ/ mol

.. Abb.14.4 Oxidative Decarboxylierung von Pyruvat. Die Bildung des energiereichen Thioesters Acetyl-Coenzym A wird
ermglicht durch Koppelung an die Decarboxylierung und Oxidation von Pyruvat (Reaktionsmechanismus des Pyruvatdehydrogenase-Multienzymkomplexes: .Abb.14.5). Die Sulfhydrylgruppe des Cysteaminrests von CoA bildet mit Essigsure und
auch langkettigen Fettsuren energiereiche Thioester mit hohem Acylgruppen (Carbonsurereste)-bertragungspotenzial.
Im Stoffwechsel fungiert CoA als genereller bertrger von Acylresten. CoA ist ein Derivat von AMP, das ber einen weiteren
Phosphatrest an das Vitamin Pantothensure gekoppelt ist, welches ber eine Amidbindung mit Cysteamin verbunden ist

Coenzym A (CoA) dient allgemein als bertrger von Acylgruppen (Carbonsureresten) Der

wichtigste Teil von CoA ist seine Sulfhydrylgruppe,


die mit Carbonsuren, Essigsure im Fall von Ace
tyl-CoA, aber auch mit langkettigen Fettsuren,
energiereiche Thioester mit einem hohen Acylgruppen-bertragungspotenzial bildet (.Abb.14.4;
.Tab.14.1).
Fnf aufeinanderfolgende vom Pyruvatdehydrogenase-Multienzymkomplex katalysierte Teilreaktionen fhren von Pyruvat zu Acetyl-CoA. Der Enzym
komplex mit einer Gesamtmasse von 4,6 103kDa
(eukaryontisches Ribosom 4,3 103kDa) besteht aus
je 24Pyruvatdehydrogenase- und Acetyltransferasemoleklen sowie 12Dihydrolipoamid-Dehydrogenasemoleklen. Die Reaktionszwischenprodukte
sind jeweils kovalent an das entsprechende Teilenzym gebunden. Das Entfallen der freien Diffusion
der Zwischenprodukte erleichtert die Bildung der
Enzym-Substrat-Komplexe und verringert die Mglichkeit von Nebenreaktionen mit anderen Verbindungen (.Abb.14.5).

Das Endprodukt Acetyl-CoA mit seinem hohen


Acetylgruppenbertragungspotenzial ist Substrat
nicht nur fr den katabolen Citratzyklus sondern
auch fr anabole Reaktionen wie die Synthese von
Fettsuren und Cholesterol.
Reversible Phosphorylierung reguliert den
PDH-Komplex Es ist die irreversible Reaktion von

Pyruvat zu Acetyl-CoA, bei der die Regulationsmechanismen eingreifen (vgl. Abschn.13.4). Der
PDH-Komplex gibt ein Beispiel fr die Regulation
der Enzymaktivitt durch kovalente chemische
Modifikation. Die Multienzymkomplexe enthalten
neben den drei an den Stoffwechselumsetzungen
direkt beteiligten Enzymen zustzliche, regulatorisch wirksame Enzyme, nmlich PDH-Kinase und
PDH-Phosphatase.

170

Kapitel 14 Glykolyse und Citratzyklus

1
2
3
4
5
6
7
; Abschn. 15.2)

8
9
10
11
12
13
14
15
16
17
18
19
20

oxidiert

.. Abb.14.5Pyruvatdehydrogenase-Multienzymkomplex

171
14.3 Abbau von Acetyl-CoA im Citratzyklus

14

versibel durch die darauf folgende Hydrolyse der

energiereichen Thioesterbindung.
, Citrat isomerisiert zu Isocitrat mit cis-
Aconitat als Zwischenprodukt. Die tertire Alkoholgruppe von Citrat wird damit zur sekundren Alkoholgruppe von Isocitrat, die im nchsten Schritt zu
einer Oxo-Gruppe dehydriert wird.
Oxidation mit NAD+ als Oxidationsmittel sowie irreversible Decarboxylierung der dabei intermedir entstehenden Oxosure Oxalsuccinat (nicht
im Schema) zu -Ketoglutarat (2-Oxoglutarat).
Wie die oxidative Decarboxylierung von Pyruvat zu Acetyl-CoA wird dieser Schritt von einem

Multienzymkomplex (-Ketoglutarat-Dehydrogenase) katalysiert, der die gleichen Coenzyme

Erhhte Konzentrationen von Stoffwechselprodukten, welche der Zelle chemische Energie liefern, aktivieren die PDH-Kinase allosterisch, wodurch die
PDH phosphoryliert und damit inaktiviert wird.
Wenn hingegen eine steigende Konzentration von
ADP einen Energiemangel der Zelle anzeigt oder
Pyruvat im berfluss vorliegt, wird die Kinase gehemmt, wodurch die Phosphatase die Oberhand
gewinnt und die PDH aktiviert.
14.3

Abbau von Acetyl-CoA


im Citratzyklus

Unter aeroben Bedingungen werden neben Pyruvat


auch Fettsuren sowie gewisse Aminosuren zu
Acetyl-CoA (C2) abgebaut. Durch Addition dieses
zentralen Zwischenprodukts des Stoffwechsels an
Oxalacetat (C4) wird Citrat (C6) gebildet, das im
Citratzyklus durch sukzessive Oxidations- und
Decarboxylierungsschritte zu CO2 und Oxalacetat
abgebaut wird. In der Bilanz wird dabei der Acetyl-Rest zu CO2 abgebaut. Citratzyklus, Zitronensurezyklus, Tricarbonsurezyklus und Krebszyklus
(nach Hans Krebs, Entdecker des Zyklus) sind Synonyma.

Der Citratzyklus luft ber 9Einzelreaktionen

(.Abb.14.6):
Der Acetylrest wird in den Zyklus eingeschleust. Die Aldoladdition wird praktisch irre-

(Thiamindiphosphat, Liponsure und FAD) und


Cosubstrate (CoA und NAD+) benutzt wie der
PDH-Komplex (.Abb.14.5).
Die Hydrolyse des energiereichen Thioesters Succinyl-CoA erlaubt, GTP aus GDP und Pi zu
synthetisieren (Succinat, Anion der Bernsteinsure;
succinic acid). Wie bei der Glykolyse handelt es sich
auch hier um eine Substratkettenphosphorylierung.

ATP und NTP


Aus GTP und ADP kann ATP gebildet werden.
Unspezifische Nucleosiddiphosphat-Kinasen
katalysieren die folgende Reaktion: ATP +NDP
ADP +NTP; wobei N irgendein Nucleosid
darstellt.

Die Succinatdehydrogenase bentigt FAD, ein


strkeres Oxidationsmittel als NAD+, als prosthetische Gruppe. Die Succinatdehydrogenase ist ein Enzym der Atmungskette in der inneren Mitochondrienmembran (KomplexII); alle anderen Enzyme des
Citratzyklus befinden sich in der mitochondrialen
Matrix.
Die Addition von H2O an die Doppelbindung
fhrt zu Malat (Anion der pfelsure, malic acid).
Die OH-Gruppe wird im nchsten Schritt zur Oxogruppe oxidiert.
Diese Reaktion bildet wieder Oxalacetat,
den Akzeptor von Acetyl-CoA. Fr jedes Molekl
Oxalacetat, das als Akzeptor verbraucht worden ist,
resynthetisiert der Zyklus ein Molekl Oxalacetat.

172

Kapitel 14 Glykolyse und Citratzyklus

1
2
3
4
5
6
7
8
9
10
11
12
13

FAD

FAD

14
15
16
17
18
19
20

.. Abb.14.6 Citratzyklus. Im Reaktionsschritt dient Oxalacetat als Akzeptor des Acetylrests von Acetyl-CoA. Im Endschritt
wird Oxalacetat regeneriert. Ohne primr vorhandenes Oxalacetat kann der Zyklus nicht ablaufen

173
14.3 Abbau von Acetyl-CoA im Citratzyklus

Bilanz des Citratzyklus

Acetyl-CoA C 3 NADC C FAD C GDP

14

Acetyl-CoA aktiviert allosterisch die Pyruvat-Carboxylase und hemmt die Pyruvat-Dehydrogenase:

C Pi C 2 H2 O
#

2 CO2 C 3 NADH C 3 HC C FADH2


C GTP C CoASH

Der Citratzyklus luft wie die Oxidation von Pyruvat zu Acetyl-CoA in der Mitochondrienmatrix ab.
Im Gegensatz zur Glykolyse werden im Citratzyklus
keine phosphorylierten Zwischenprodukte gebildet.
Alle Zwischenprodukte sind jedoch Tri- oder Dicarbonsuren und damit beim pH-Wert der Zelle
ebenfalls negativ geladen und nicht membrangngig.
Die wichtigsten Produkte des Citratzyklus sind
GTP und vor allen NADH und FADH2 als Substrate
fr die Atmungskette und die damit gekoppelte oxidative Phosphorylierung. Bemerkenswert ist ferner,
dass der Hauptteil des im Organismus gebildeten
CO2 in der Pyruvatdehydrogenase-Reaktion und
den zwei Decarboxylierungsreaktionen des Citratzyklus entsteht.
Warum laufen die oxidative Decarboxylierung
von Pyruvat zu Acetyl-CoA und der Citratzyklus
nur unter aeroben Bedingungen ab? Bei der

oxidativen Decarboxylierung von Pyruvat und den


Oxidationsschritten des Citratzyklus bernehmen
NAD+ und FAD die abgegebenen Reduktionsquivalente (Wasserstoffatome mit ihren Elektronen).
Nur unter aeroben Bedingungen knnen NADH
und FADH2 die Reduktionsquivalente in der Atmungskette auf O2 bertragen und dadurch zu
NAD+ und FAD reoxidiert werden.

Bei einem berschuss von Acetyl-CoA sorgen diese


Regelmechanismen dafr, dass weniger Ace
tylCoA, aber mehr Oxalacetat produziert wird. Dem
Citratzyklus wird dadurch mehr Akzeptor fr Acetyl-CoA zur Verfgung gestellt. Zudem wird mehr
Oxalacetat fr die Gluconeogenese (Abschn.16.1)
geliefert.
Der Citratzyklus muss permanent mit Zwischenprodukten aufgefllt werden Oxalacetat

und die anderen in Oxalacetat umwandelbaren


Zwischenprodukte des Zyklus sind wie die Enzyme
als Teile der Maschinerie, die Essigsure zu 2CO2
oxidiert, zu betrachten. Bei erniedrigter Konzentration von Oxalacetat knnte weniger Acetyl-CoA
in den Zyklus eingeschleust werden, Acetyl-CoA
wrde sich anstauen. In der Tat entziehen die Gluconeogenese und die Synthese bestimmter Aminosuren sowie von Hm und Fettsuren dem
Citratzyklus stndig Oxalacetat und andere Zwi-

Kapitel 14 Glykolyse und Citratzyklus

174

1
2
3

schenprodukte. Im Citratzyklus wird Oxalacetat


zwar regeneriert, kann aber netto nicht neugebildet werden. Die Zelle muss daher ber Reaktionen
verfgen, welche verbrauchtes Oxalacetat nachliefern, die Auffllreaktionen oder anaplerotischen
Reaktionen

4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Zudem fllen die Abbaureaktionen gewisser


Aminosuren den Citratzyklus mit Zwischenprodukten auf:

Die Carboxylierung von Pyruvat zu Oxalacetat


ist die wichtigste anaplerotische Reaktion. Die
Pyruvatcarboxylase bentigt Biotin, ein Vitamin, als prosthetische Gruppe und verbraucht
ATP:

175
14.3 Abbau von Acetyl-CoA im Citratzyklus

Die Pyruvatcarboxylase-Reaktion und die


anderen anaplerotischen Reaktionen sind
nicht nur wichtig fr die Nachlieferung von
Zwischenprodukten des Citratzyklus, sondern
auch fr die Gluconeogenese (Neubildung von
Glucose) aus Lactat und aus Aminosuren.
ber die Reaktion Oxalacetat Phosphoenolpyruvat werden Oxalacetat und andere
Metaboliten der Gluconeogenese zugefhrt
(Abschn.16.1).

Der Glyoxylatzyklus bei Pflanzen und Mikroorganismen erlaubt, Acetyl-CoA in Kohlenhydrat


umzuwandeln Der Glyoxylatzyklus, eine Variante des Citratzyklus, erlaubt gewissen Bakterien,

mit Essigsure oder anderen Fettsuren als einziger


Kohlenstoffquelle zu wachsen. In Pflanzensmlingen erlaubt der in den Glyoxysomen ablaufende Zyklus, Reservefett fr die Synthese von Kohlenhydrat
zu verwenden (Abschn.21.3).
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517042-0
14.1 Glykolytischer Abbauweg
14.2 Von Pyruvat zu Acetyl-CoA
14.3 Abbau von Acetyl-CoA im Citratzyklus
Weiterfhrende Literatur

14

177

ATP-Synthese
in Mitochondrien
Ph. Christen, R. Jaussi, R. Benoit

15.1

Organisation der Atmungskette 179

15.2

Redoxkomponenten der Atmungskette(FMN, FAD,


FeS-Zentren, Ubichinon, Cytochrome) 179

15.3

Chemiosmotischer Mechanismus der


oxidativen Phosphorylierung183

15.4

Transport von Reduktionsquivalenten vom


Cytosol in die Mitochondrien 186

15.5

ATP-Bilanz des oxidativen Abbaus von Glucose 188

15.6

Regulation der mitochondrialen ATP-Synthese 188

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_15, Springer-Verlag Berlin Heidelberg 2016

15

178

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 15 ATP-Synthese in Mitochondrien

Im Citratzyklus und bei der Fettsureoxidation


(Abschn.17.1) entstehen NADH und enzymgebundenes FADH2, die in einer stark exergonischen
Reaktion Sauerstoff zu Wasser reduzieren knnen:

NADH C HC C 1=2 O2 ! NADC C H2 O

G0 D 219 kJ=mol

ist auch stark exergonisch, verluft aber langsamer. Die chemische Energie wird schrittweise freigesetzt und mit einem Wirkungsgrad
von 40% zur Synthese von ATP genutzt.

NADH C HC C 1=2 O2 ! NADC C H2 O


FADH2 C 1=2 O2 ! FAD C H2 O

Die enzymkatalysierte bertragung der Elektronen von NADH und FADH2 auf O2 verluft ber
die mehrstufige Atmungskette. In der damit gekoppelten oxidativen Phosphorylierung wird die
bei diesen Redoxreaktionen frei werdende Energie
fr die Synthese von ATP aus ADP und Pi genutzt.
Knallgasreaktion
Die Energie, welche bei der bertragung von
NADH-gebundenem Wasserstoff auf Sauerstoff
verfgbar wird, lsst sich abschtzen aus der
bekannten Knallgasreaktion:
H2 C 1=2 O2 ! H2 O G0 D 242 kJ=mol

In diesem Fall wird die gesamte Energie als


Wrme frei (Die Reaktion ist nicht nur stark
exotherm, sondern verluft auch sehr rasch,
daher der Knall!).
Der biochemische Vorgang, die in den
Mitochondrien ablaufende Atmungskette,

Auen

Eine Reihe hintereinander geschalteter Elek


tronenbertrger (Flavoproteine, FeS-Zentren,
Ubichinon und Cytochrome) in der inneren
Mitochondrienmembran transferiert die Elek
tronen von NADH oder FADH2 auf O2. Die dabei
freigesetzte Energie wird genutzt, um Protonen
aus der Matrix in den Intermembranalraum der
Mitochondrien zu pumpen: Die Protonenkonzentration auerhalb der Membran wird hher als in
der Matrix. Das Zurckflieen der Protonen in
Richtung des Konzentrationsgeflles ist seinerseits
gekoppelt mit der Synthese von ATP durch die
ATP-Synthase der inneren Mitochondrienmembran (chemiosmotischer Mechanismus der oxidativen Phosphorylierung). Pro mol NADH, welches
in die Atmungskette eingeschleust wird, entstehen
3mol ATP. Im tierischen Organismus liefert die
oxidative Phosphorylierung den weitaus grten
Teil von ATP: Mitochondrien, die Kraftwerke der
Zelle!

179
15.2 Redoxkomponenten der Atmungskette

Der Elektronentransfer ist strikt mit der Phosphorylierung gekoppelt, d.h. keiner der beiden
Prozesse kann ohne den andern ablaufen. Somit
wird O2 nur verbraucht, wenn gengend ADP zur
Phosphorylierung zur Verfgung steht, und gengend ADP steht nur zur Verfgung, wenn viel
ATP verbraucht worden ist. Gewisse Giftstoffe, z.B.
2,4-Dinitrophenol, entkoppeln Elektronentransfer
und Phosphorylierung mit der Folge, dass bei hohem O2-Verbrauch nur wenig ATP und umso mehr
Wrme produziert wird. Andere Giftstoffe, z.B.
Cyanid, blockieren den Elektronentransport und
damit die ATP-Synthese.
15.1

Organisation der Atmungskette

Die Atmungskette ist ein Membranprozess Im

Unterschied zur Glykolyse und den meisten Reaktionen des Citratzyklus wird die Reaktionskette der
Zellatmung nicht durch gelste Enzyme katalysiert,
sondern durch Proteine der inneren Mitochondrienmembran. Drei groe Multiproteinkomplexe
(KomplexI, III und IV) transportieren zusammen
mit kleineren, mobilen bertrgern von Reduktionsquivalenten [Ubichinon (Ubiquinone, Coenzym Q) und Cytochrom c] die Elektronen schrittweise von NADH und FADH2 auf molekularen
Sauerstoff. In der ersten Phase werden H-Atome
und daraufhin Elektronen bertragen (.Abb.15.1).
Terminologie
Reduktionsquivalente:
Elektron: e
H-Atom: [H], Proton plus Elektron
Hydridion: H, Proton plus zwei Elektronen
Abspaltung von 2[H]: Dehydrierung=Oxidation (z.B. Lactatdehydrogenase)
Abspaltung von H2O: Dehydratisierung
(z.B. Enolase)
Abspaltung von H+: Deprotonierung

Bei den Redoxreaktionen im Stoffwechsel handelt


es sich sehr hufig um die Aufnahme oder Abgabe
von zwei Wasserstoffatomen. Bei der bertragung
auf FAD (Abschn.15.2) bleiben beide Protonen

15

mit den Elektronen verbunden, im Fall von NAD+


(.Abb.14.2) wird ein Proton abgetrennt:

FAD C 2H ! FADH2

NADC C 2H ! NADH C HC


(NAD+ hat ein Hydridion aufgenommen, das Proton ohne Elektron geht in Lsung)
FADH2, das im Citratzyklus und beim Abbau
von Fettsuren entsteht, wird ber besondere Flavoproteinkomplexe in die Atmungskette eingeschleust.
Die FAD-abhngige Succinatdehydrogenase, die im
Citratzyklus Succinat zu Fumarat oxidiert, ist ein
Protein der inneren Mitochondrienmembran (KomplexII ) und bertrgt die Wasserstoffatome von
FADH2 auf Ubichinon. Auch die Acyl-CoA-Dehydrogenase liefert bei der -Oxidation von Fettsuren
(Abschn.17.1) die Reduktionsquivalente ber
FADH2 an die Atmungskette.
Die Redoxkomponenten der Atmungskette sind
ihrem Redoxpotenzial entsprechend in Serie hintereinander angeordnet (.Abb.15.2). Der Unterschied
im Standardredoxpotenzial zwischen NAD+/NADH
und O2/O2 von +1,14V entspricht 219kJ/mol.
Die Oxidation von 1mol NADH liefert demnach
219kJ, ein Energiebetrag, der zur Bildung von maximal 3mol ATP ausreicht.
15.2 Redoxkomponenten

der Atmungskette(FMN, FAD,


FeS-Zentren, Ubichinon,
Cytochrome)

NAD+/NADH weist das niedrigste Redoxpotenzial auf NADH ist der wichtigste Zubringer

von Elektronen zur Atmungskette. Es sind ber


200 NAD+-abhngige Dehydrogenasen bekannt,
welche der folgenden Reaktionsgleichung entsprechen:

NAD+ und NADH werden von den Dehydrogenasen wie ein zweites Substrat bzw. Produkt behan-

180

Kapitel 15 ATP-Synthese in Mitochondrien

1
2
3
4
5
6
7
8
9
10

.. Abb.15.1 Atmungskette. Vier Teilfunktionen sind zu erkennen: 1.Einsammeln der an NADH und FADH2 gebundenen H-Atome
mit ihren Elektronen. Die Wasserstoffatome von FADH2 (aus dem Citratzyklus und dem Fettsureabbau) werden von den entsprechenden FAD-abhngigen Dehydrogenasen (Succinatdehydrogenase und Acyl-CoA-Dehydrogenase) direkt an Q (Coenzym Q,
Ubichinon) abgegeben. 2.Weitergabe der Reduktionsquivalente (H-Atome, bzw. Elektronen) von einem Redoxpaar an das nchste, d.h. an zunehmend strkere Oxidationsmittel. 3.Reduktion von molekularem Sauerstoff (O2), dem Endoxidationsmittel (finalem
Elektronenempfnger). 4.Nutzung der chemischen Energie, die bei den Redoxvorgngen in den KomplexenI, III und IV frei wird,
zum Herauspumpen von Protonen. Die angegebene Stchiometrie der Reaktionen entspricht der Oxidation von einem Molekl
NADH, d.h. der Abgabe von zwei Elektronen. Wenn zur bertragung der zwei Elektronen der gleiche Vorgang zweimal abzulaufen
hat, ist das durch (2x) gekennzeichnet

11
12
13
14
15
16

ox

17
18
19
20

.. Abb.15.2 Anordnung der Redoxkomponenten in der Atmungskette (Q, Coenzym Q, Ubichinon). Die Atmungskette transportiert Reduktionsquivalente, alle beteiligten Komponenten kommen daher in einer oxidierten und einer reduzierten Form
vor. Die oxidierte Form dient jeweils als Akzeptor der Reduktionsquivalente ([H] oder e) und geht bei deren Aufnahme in die
reduzierte Form ber. Das Standard-Redoxpotenzial nimmt von links nach rechts zu, der Sauerstoff ist das strkste Oxidationsmittel. Definitionsgem entspricht das Standard-Redoxpotenzial (Eo) eines Redoxpaares (z.B. NAD+/NADH) dem Potenzial,
das sich bei Standardbedingungen (Konzentrationen 1M, 25C, pH7,0) gegen eine Normalwasserstoffelektrode einstellt.
Gox=nFEo; wobei F=Faraday-Konstante (96,5kJmol1V1) und n=Anzahl bertragene Elektronen. Das Redoxpotenzial
eines Redoxpaares gibt an, wie leicht das Redoxpaar Elektronen aufnimmt. Je hher das Redoxpotenzial, umso strker wirkt die
oxidierte Komponente des Redoxpaares als Oxidationsmittel (Elektronenakzeptor)

181
15.2 Redoxkomponenten der Atmungskette

15

delt. Als Cosubstrate binden sie wie Substrat oder


Produkt nichtkovalent und reversibel an die aktive
Stelle. NADH kann somit an die aktive Stelle eines
anderen Enzyms binden und dort die Reduktionsquivalente an ein anderes Substrat weitergeben.
NADH, welches der Atmungskette zugefhrt
wird, stammt aus den Mitochondrien (Pyruvatdehydrogenase-Reaktion, Citratzyklus, Fettsureabbau und oxidative Desaminierung von
Glutamat zu -Ketoglutarat und NHC
4 ), aber auch
aus dem Cytosol (Glykolyse und weitere Reaktionen). NADH kann jedoch nicht aus dem Cytosol
durch die innere Membran in die Mitochondrien

gelangen. Besondere Mechanismen berfhren


die Reduktionsquivalente aus dem Cytosol in
die Mitochondrien (Abschn.15.4). Komplex I
(NADH-Q-Reduktase) mit einem Flavin-Coenzym
als Wasserstoffakzeptor besorgt das Einschleusen
der Reduktionsquivalente von NADH in die Atmungskette.
Flavin-abhngige Dehydrogenasen FMN
(Flavinmononucleotid) und FAD (Flavin-Adenin-Dinucleotid) enthalten ein intensiv gelbes heterozyklisches Ringsystem (lat. flavus, gelb). FMN
ist die phosphorylierte Form von Vitamin B2, FAD
ist ein Kondensationsprodukt von FMN und AMP.

FMN und FAD sind fest (durch nichtkovalente


Wechselwirkungen) an die entsprechenden Enzyme gebunden; als Coenzyme (prosthetische
Gruppen) dissoziieren sie nicht vom Enzym. ber
60Flavin-abhngige Dehydrogenasen sind bekannt
(Beispiele: Dihydrolipoamid-Dehydrogenase im
Pyruvatdehydrogenase-Komplex, .Abb.14.5; Succinatdehydrogenase im Citratzyklus, .Abb.14.6).
Das FMN der NADH-Q-Reduktase (Komplex I;
.Abb.15.1) hat ein hheres Redoxpotenzial als
NAD+. Daher wird NADH durch die NADH-QReduktase effizient oxidiert. Dabei entsteht die reduzierte Form von KomplexI (.Abb.15.2).
Eisen-Schwefel-Zentrum (FeS cluster) Eine
Komponente der Atmungskette mit noch hherem
Redoxpotenzial reoxidiert KomplexI. An der Weitergabe der Reduktionsquivalente ist ein FeS-Zentrum beteiligt. Zwei oder mehr Eisenionen sind
mit Cysteinresten des Proteins und mit Sulfidionen
koordiniert. Solche FeS-Zentren finden sich in Oxidoreduktasen und in den Komplexen der Atmungskette mit Ausnahme von KomplexIV.

Ubichinon (Q, Coenzym Q)


ist eine niedermolekulare Verbindung mit einer langen (C20) apolaren Seitenkette. Ubichinon ist daher fettlslich
und kann durch rasche Diffusion in der Lipiddoppelschicht der inneren Mitochondrienmembran mit
verschiedenen Membranenzymen reagieren. Ubichinon bernimmt Wasserstoffatome nicht nur von
KomplexI (FMNH2 ber FeS-Zentrum), sondern
auch von der Succinatdehydrogenase des Citratzyklus (KomplexII; FADH2). Ubichinon ermglicht
damit, dass Wasserstoffatome aus Metaboliten, die
nicht durch das relativ schwache Oxidationsmittel
NAD+ oxidiert werden knnen (das Redoxpaar Succinat/Fumarat hat ein relativ hohes Redoxpotenzial,
Eo=+0,031V), in die Atmungskette eingebracht
werden. Das gleiche Problem stellt sich beim oxidativen Abbau von Fettsuren. Auch dort gelangen
die Wasserstoffatome aus dem ersten Oxidationsschritt (Abschn.17.1) erst auf dem Niveau von
Ubichinon in die Atmungskette.

182

Kapitel 15 ATP-Synthese in Mitochondrien

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Bei der Reoxidation der Hydrochinonform von


Ubichinon trennen sich die Wege von Protonen
und Elektronen (.Abb.15.1). Fortan werden in
der Atmungskette nur noch Elektronen weitergegeben, wobei die zwei Elektronen aus QH2 einzeln
weitergereicht werden (.Abb.15.2). Das hhere
Redoxpotenzial von KomplexIII ist bedingt durch
die an diesem Multienzymkomplex beteiligten
Cytochrome, die auch an den zwei weiteren Redoxschritten der Atmungskette mitwirken.
Cytochrome sind hmhaltige Proteine von
Elektronentransportsystemen Hm ist ein Kom-

plex eines zyklischen Tetrapyrrols mit einem an die


Stickstoffatome der vier Pyrrolringe gebundenem
Eisenion. Die Cytochrome sind rotbraune Chromoproteine, die aufgrund unterschiedlicher Seitenketten des Hms und entsprechend verschiedener
Absorptionsspektren als Cytochrome des Typs a, b
oder c bezeichnet werden. Das Tetrapyrrol im Hm
von Cytochromen des Typs b und auch von Hmoglobin und Myoglobin ist ProtoporphyrinIX, eines
von 15 mglichen Isomeren mit verschiedener Verteilung der Seitenketten . Beim Elektronentransport durch Cytochrome wechselt das Hm-Eisen
seinen Oxidationszustand:

Ferri-Protoporphyrin C e
.Fe3C ;Fe III/


Ferro-Protoporphyrin
.Fe2C ;Fe II/

Die Hauptbestandteile von Komplex III (QH2-

Cytochrom c-Reduktase oder kurz Cytochrom


c-Reduktase) sind die Cytochrome b und c1. Kom-

plexIII bergibt die Elektronen einzeln von QH2


(QH22H++2e) an Cytochrom c (.Abb.15.1).
Cytochrom c ist das einfachste Cytochrom der
Atmungskette (104Aminosurereste, 12kDa). Es ist
an der Auenseite der inneren Mitochondrienmembran lokalisiert und pendelt als Elektronbertrger
zwischen Komplex III (Cytochrom c-Reduktase)
und KomplexIV (Cytochrom c-Oxidase).
Die beiden zuletzt in der Atmungskette auftretenden Cytochrome a und a3 sind Bestandteile von

183
15.3 Chemiosmotischer Mechanismus der oxidativen Phosphorylierung

KomplexIV (Cytochrom c-Oxidase). An der ber-

tragung des Elektrons von Cytochrom c auf molekularen Sauerstoff sind auer den Cytochromen a und
a3 auch zwei Kupferionen beteiligt, die einzeln in der
Nhe des Hmeisens der beiden Cytochrome liegen
und ihren Redoxzustand verndern (Cu2++e Cu+).
Die Cytochrom-Oxidase katalysiert eine heikle
Reaktion: die konzertierte berfhrung von 4Elektronen (von 4 einzelnen Cytochrom c-Moleklen!)
auf 1O2-Molekl (.Abb.15.1 wiedergibt der Einfachheit halber die Stchiometrie fr 1NADH-Molekl, welches nur 2 Elektronen liefert). Die
Cytochrom-Oxidase reagiert jedoch mit molekularem O2. Die bertragung von 4 Elektronen ist
notwendig, um aus O2 vollstndig reduzierten Sauerstoff (2O2) zu erhalten, der zu Wasser protoniert
wird (2O2+4H+2H2O). Nur teilweise reduzierte

Zwischenprodukte wie O
2 (O2+e ; Superoxidradi2
kal, Superoxidanion) oder O2 (O2+2 e; Peroxidanion) sind uerst reaktiv und gefhrlich fr die
Zelle. Um allfllig gebildetes O
2 unschdlich zu
machen, besitzen die Mitochondrien eine eigene SuC
peroxiddismutase: 2 O
! O2 C H2 O2.
2 C 2H
Oxidationswasser
Die Atmungskette, genauer die
Cytochrom-Oxidase , verbraucht etwa 90%
des gesamten vom menschlichen oder tierischen Organismus aufgenommenen Sauerstoffs. Die restlichen 10% werden von anderen
Enzymen wie Oxidasen (z.B. Xanthinoxidase)
und Monooxygenasen (Hydroxylasen; z.B.
Steroidhydroxylasen) verbraucht.
Die Reduktion von O2 in der Atmungskette
liefert das sogenannte Oxidationswasser:
300mL/Tag beim erwachsenen Menschen!

Inhibitoren der Atmungskette hemmen die Synthese von ATP Alle Redoxkomponenten der

Atmungskette befinden sich in einem Fliegleichgewicht. Bei ungehinderter Oxidation der im Katabolismus anfallenden Reduktionsquivalente
nimmt das Verhltnis der Konzentration der reduzierten Form zur Totalkonzentration einer Redoxkomponente entlang der Kette graduell ab. Wenn
an einer Stelle der Elektronenfluss durch einen der
folgenden Inhibitoren blockiert wird, werden alle

15

Redoxkomponenten vor dem Block voll reduziert


und alle Komponenten nach dem Block voll oxidiert:
Rotenon, ein pflanzliches Produkt, hemmt
spezifisch KomplexI, wird als Insektizid verwendet.
Antimycin A, ein Antibiotikum aus Streptomyces-Pilzarten, hemmt KomplexII (Cytochrom
c-Reduktase), wird fr experimentelle Zwecke
benutzt.
Cyanid (CN; wird aus Zyankali KCN, oder
Blausure HCN freigesetzt) blockiert die
Cytochrom c-Oxidase durch Komplexbildung
mit deren Fe3+-Ionen.
Kohlenmonoxid (CO) fhrt zum gleichen Ergebnis; es komplexiert mit den Fe2+-Ionen der
reduzierten Cytochrom c-Oxidase (sowie mit
dem Fe2+-Ion von Hmoglobin und Myoglobin).

Alle genannten Hemmstoffe sind potente Gifte fr


Mensch und Tier. Sie blockieren die Atmungskette
und verhindern die ausreichende Bildung von ATP.
Fehlen von Sauerstoff (Hypoxie, Anoxie) fhrt zum
gleichen Ergebnis.
15.3 Chemiosmotischer

Mechanismus der oxidativen


Phosphorylierung

Der Elektronenfluss in der Atmungskette ist gekoppelt mit der Synthese von ATP Zu den Auf-

gaben der Atmungskette (Respiratory chain) gehrt


nicht nur die Regenerierung von NAD+ und FAD
sondern auch das Bereitstellen der Energie zur
Synthese von ATP. Das Redoxpotenzial nimmt von
einer Komponente der Atmungskette zur anderen
zu. Welche Schritte lassen eine Nutzung der chemischen Energie der Reduktionsquivalente zur
Synthese von ATP zu? Die hohen Stufen der Zunahme des Redoxpotenzials entfallen auf die drei
KomplexeI, III und IV (.Abb.15.2). Der Abfall
der freien Energie bei jeder dieser Stufen gengt,
um ATP zu synthetisieren. Im Unterschied zu den
ATP-liefernden Reaktionen der Glykolyse und des
Citratzyklus sind Atmungskette und ATP-Synthese
nicht ber gemeinsame energiereiche Zwischen-

184

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18

Kapitel 15 ATP-Synthese in Mitochondrien

gekoppelt.
Der von Peter Mitchell, einem britischen Biochemiker, vorgeschlagene Mechanismus bercksichtigt nicht nur molekulare, sondern auch supramolekulare Gegebenheiten: Die mitochondriale
Matrix stellt ein geschlossenes Kompartiment dar,
das von seiner Umgebung, d.h. vom Intermembranalraum, durch die fr Metaboliten und Ionen
wenig durchlssige innere Mitochondrienmembran
getrennt ist. Hingegen ist die uere Mitochondrienmembran praktisch frei durchlssig, die Ionenzusammensetzung des Intermembranalraums entspricht derjenigen des Cytosols.
Die RedoxkomplexeI, III und IV pumpen Protonen aus den Mitochondrien Die Redoxreak-

tionen der Atmungskette sind mit einer Verschiebung von Protonen aus der mitochondrialen Matrix
gekoppelt. Sobald die Mitochondrien NADH und
FADH2 mit O2 oxidieren, nimmt der pH-Wert auerhalb der Mitochondrien ab und innerhalb der
Mitochondrien steigt er an (.Abb.15.1). Die drei
EnzymkomplexeI, III und IV haben, neben dem
Elektronentransport, noch eine zweite Funktion
als Protonenpumpen. Bei aktiver Zellatmung
bauen sie ein elektrochemisches Potenzial auf,
das aus einem elektrischen Potenzial (Ladungsunterschied innen und auen) und einem chemischen Potenzial (Konzentrationsunterschied der
H+-Ionen innen und auen; pH0,5) besteht.
Fr die Synthese von 1mol ATP mssen 34mol
H+ aus den Mitochondrien herausgepumpt werden
(.Abb.14.3).
Membranpotenzial der Mitochondrien 
Elektrochemisches Potenzial ber innerer
Mitochondrienmembran:
RT
pH
F
D 0,17 V  0,06  .0,5/

p D Em  2,303

D 0,17 V C 0,03 V
.85 %/

19
20

Zum Vergleich:

produkte, sondern durch einen chemiosmotischen Mechanismus miteinander energetisch

D 0,20 V

.15 %/

G0 D p  F  19 kJ=mol HC

ADP C Pi ! ATP C H2 OI G0 D 30 kJ=mol


p

Elektrochemisches Gesamtpotenzial
(Proton motive force, Protonen bewegende Kraft)

Em

Elektrisches Membranpotenzial

Faraday-Konstante (96kJ/mol)

pH

0,5


Der Rckfluss von Protonen in die Matrix treibt
die ATP-Synthese an Das elektrochemische Po-

tenzial, das die Protonenpumpen aufbauen, wird


zur Synthese von ATP genutzt (.Abb.15.3). Der
Rckfluss der Protonen in die mitochondriale
Matrix ist ein exergonischer Vorgang, er erfolgt
in Richtung des elektrischen Potenzials und des
Konzentrationsgeflles. Die ATP-Synthase , ein
Multiproteinkomplex, der wie die Komplexe der Atmungskette in die innere Mitochondrienmembran
eingebettet ist, koppelt die endergonische Synthese
von ATP an den exergonischen Rckfluss der Protonen (.Abb.15.4). Die ATP-Synthase besteht aus
dem Protonenkanal Fo und der in die Matrix hineinragenden katalytischen Einheit F1. Der F1-Teil
besteht aus einem ringfrmigen ()3-Hexamer
und wird durch weitere Proteine in der Membran
verankert. Ins Innere des hexameren Rings ragt als
langgestreckter Stiel die -Untereinheit, welche ber
ein weiteres Protein mit dem Fo-Teil verbunden ist.
Die -Untereinheiten synthetisieren ATP in einem
dreistufigen zyklischen Vorgang.
ATP-Synthase-Hemmer
Das Subskript von Fo bedeutet, dass dieser Teil
der ATP-Synthase durch Oligomycin hemmbar
ist. Oligomycin, ein Produkt von Actinomyces-Pilzarten, verhindert den H+-Rckfluss
durch die Fo-Pore und hemmt auf diese Weise
die ATP-Synthase in Mitochondrien wie auch
die Photophosphorylierung in Chloroplasten.
Oligomycin wird als Fungizid verwendet.

Die ATP-Synthase wirkt als molekularer Motor, welcher den Protonenfluss nutzt, um ATP zu syntheti-

185
15.3 Chemiosmotischer Mechanismus der oxidativen Phosphorylierung

15

Auen

.. Abb.15.3 Chemiosmotischer Mechanismus der oxidativen Phosphorylierung. Das durch die Atmungskette mit ihren Protonenpumpen produzierte elektrochemische Potenzial treibt die Protonen zurck in die Matrix. Der Rckfluss der Protonen liefert
der ATP-Synthase die notwendige Energie, um ATP aus ADP und Pi zu synthetisieren. In den Reaktionsgleichungen bedeuten HC
i
Protonen innen (in der Mitochondrienmatrix) und HC
a Protonen auen. Die Stchiometrie der Bilanzgleichung ist vereinfacht:
Effektiv werden nur etwa 2.5Mol ATP pro Mol NADH synthetisiert

sieren. Das ()3-Hexamer wirkt als Stator und die


langgestreckte -Untereinheit im Innern des Stators
bernimmt die Rolle des Rotors (.Abb.15.5). Der
Protonenfluss durch die Kontaktflche zwischen
Stator und Rotor bewirkt eine Rotation des c12Rings und damit der -Untereinheit. Die Drehung
der -Untereinheit mit ihrer asymmetrischen Struktur verndert zyklisch die Konformation der drei
aktiven Stellen auf den -Untereinheiten des F1-Teils
und ermglicht damit die Synthese von ATP.

Auen

Die von oxidativer Phosphorylierung entkoppelte Atmungskette produziert nur Wrme Das

klassische Beispiel fr eine Entkoppelung der zwei


Vorgnge ist die Vergiftung der Mitochondrien mit
2,4-Dinitrophenol:

Dinitrophenol und Dinitrophenolat diffundieren


frei durch die innere Mitochondrienmembran. Es
entsteht so ein Kreisprozess, der zum Ausgleich
der Protonenkonzentrationen in und auerhalb
der Matrix fhrt. Die Atmungskette selbst luft
ungehindert ab, es wird jedoch kein elektrochemisches Potenzial aufgebaut und daher auch kein
ATP synthetisiert. Die durch Oxidation von NADH

186

Kapitel 15 ATP-Synthese in Mitochondrien

1
2

Auen

3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.15.4 ATP-Synthase. Der Multiproteinkomplex ist in die innere Mitochondrienmembran eingebettet und besteht aus
einem statischen Teil (Stator in Grau) und einem sich drehenden Teil (Rotor in Blau). Der Rckfluss von Protonen durch die Kontaktflche von Protein a des Stators und dem je nach Spezies aus 9 bis 12c-Untereinheiten bestehenden Ring des Rotors in der
Membran versetzt den c12-Ring mitsamt der - und -Untereinheit in eine kontinuierliche Rotation. Die zwei -Untereinheiten
und die -Untereinheit fixieren das ()3-Hexamer an Protein a. Die -Untereinheit, die in den ()3-Ring des Stators hineinreicht und eine asymmetrische Struktur aufweist, dreht sich in 120-Schritten, dadurch wird die Konformation der -Einheiten
zyklisch verndert und die Synthese von ATP angetrieben. Abb.15.5). Nachdem 34Protonen durch die Stator (Protein a)-Rotor
(c12)-Kontaktflche in die Matrix zurckgeflossen sind, hat sich der c12-Ring kontinuierlich um 120 gedreht; bei Erreichen dieses
Drehwinkels relaxiert der Rotor durch eine ruckartige Rotation des -Stiels im ()3-Ring. Die Umwandlung der kontinuierlichen
Drehung des c12-Rings in die schrittweise Drehung des -Stiels setzt elastische Eigenschaften der Proteine voraus

und FADH2 verfgbare Energie wird ungenutzt als


Wrme freigesetzt. Bei einer Dinitrophenol-Vergiftung steigt die Krpertemperatur an (Hyperthermie). Als Abmagerungsmittel ist Dinitrophenol
wegen seiner hohen Toxizitt unbrauchbar.
Das Entkoppeln von Atmungskette und
ATP-Synthese durch Erhhung der Protonendurchlssigkeit der inneren Mitochondrienmembran ist
von physiologischer Bedeutung fr die Regulation
des Wrmehaushalts des Organismus. In Spezies,
bei welchen die Neugeborenen keinen Pelz besitzen (Mensch, Ratten) und auch bei Winterschlfern
(Murmeltieren) findet sich in der Unterhaut an
verschiedenen Stellen des Krpers braunes Fettgewebe (Die Farbe ist auf einen hohen Gehalt an
Mitochondrien mit ihren Cytochromen zurckzufhren). Das braune Fettgewebe oxidiert Fettsuren und produziert Wrme nach Bedarf als eine Art
Durchlauferhitzer fr den Organismus. Die innere

Mitochondrienmembran brauner Fettgewebezellen


enthlt das Protein Thermogenin (Uncoupling protein), welches Protonenkanle bildet, damit einen
Kurzschluss im Protonenkreislauf herstellt und die
oxidative Phosphorylierung zugunsten einer vermehrten Wrmeproduktion drosselt.
15.4 Transport

von Reduktionsquivalenten
vom Cytosol
in die Mitochondrien

Die innere Mitochondrienmembran ist fr NADH


nicht durchlssig NAD+ wird nicht nur in der

mitochondrialen Matrix (bei der oxidativen Decarboxylierung von Pyruvat und im Citratzyklus) sondern auch im Cytosol (Glykolyse) zu NADH reduziert. Damit die Glykolyse im Cytosol kontinuierlich

187
15.4 Transport von Reduktionsquivalenten vom Cytosol in die Mitochondrien

15

ablaufen kann, muss im Cytosol gebildetes NADH


reoxidiert werden. Die aerobe Reoxidation von
NADH ist jedoch nur in den Mitochondrien mglich, wobei die innere Mitochondrienmembran fr
NADH undurchlssig ist. Das Problem der Impermeabilitt der Mitochondrienmembran fr NADH
wird dadurch gelst, dass die beiden Reduktionsquivalente des NADH auf ein membrangngiges
Molekl bertragen werden. Die Membran ist selektiv durchlssig fr eine Reihe von Metaboliten des
Citratzyklus dank spezifischer Transportsysteme,
welche den Durchtritt von Dicarbonsureanionen
ermglichen. In den meisten Fllen handelt es sich
dabei um einen gekoppelten Gegentransport (Antiport): Ein Anion wird gegen ein anderes ausgetauscht; Teilchenkonzentration und elektrische Ladung auf den beiden Seiten der Membran verndern
sich nicht (Abschn.26.3). Fr die berfhrung
von Reduktionsquivalenten wird der Malat-Aspartat-Weg (Malate-aspartate shuttle) benutzt:

.. Abb.15.5 Katalytischer Zyklus der ATP-Synthase. aJede


der drei aktiven Stellen auf den -Untereinheiten des
()3-Hexamers durchluft der Reihe nach drei Phasen. In
der Loose-binding-Phase (L) werden ADP+Pi gebunden; in
der Tight-Phase (T) wird wegen der starken Bindung und
der reaktionsgnstigen gegenseitigen Positionierung von
ADP und Pi ohne weiteren Energieaufwand ATP gebildet; in
der Open-Phase (O) wird Energie verbraucht, um die aktive
Stelle zu ffnen und ATP freizusetzen. bDie drei -Einheiten
ndern ihren Funktionszustand in einer durch die schrittweise Rotation des -Stiels (in Blau) koordinierten Weise.
Jedes Mal wenn der -Stiel um 120 rotiert, geht jede der drei
Untereinheiten in den nchsten Funktionszustand ber. Die
asymmetrische Struktur der -Untereinheit soll andeuten,
dass deren Rotation die entsprechenden Konformationsnderungen in den drei aktiven Stellen auslst. Zum Beispiel wird
der O-Teil der -Untereinheit bei der nchsten 120-Drehung
des -Stiels der aktiven Stelle, die jetzt die T-Konformation
aufweist, die O-Konformation aufzwingen

(-Ketoglutarat)

Kapitel 15 ATP-Synthese in Mitochondrien

188

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Malat und Aspartat sind C4-Verbindungen, die in


Mitochondrien und Cytosol an Stoffwechselreaktionen teilnehmen und deren Konzentrationen in den
beiden Kompartimenten ber zwei Antiport-Systeme im Gleichgewicht stehen. Im Cytosol bernimmt Oxalacetat die Reduktionsquivalente von
NADH, das dabei entstehende Malat bringt diese in
die mitochondriale Matrix, wo sie wieder auf NAD+
bergehen. Der Rest der Reaktionen dient dazu, den
Anfangszustand des Systems wieder herzustellen.
Aspartat dient dabei als Transportform von Oxal
acetat. Der Malat-Aspartat-Shuttle ist bei Vertebraten der quantitativ wichtigste Mechanismus zum
Transport von Reduktionsquivalenten aus dem
Cytosol in die Mitochondrien. Es bestehen weitere
Transportmglichkeiten fr Reduktionsquivalente,
z.B. der Glycerol-3-phosphat-Zyklus im Insektenmuskel.
15.5

ATP-Bilanz des oxidativen


Abbaus von Glucose

Die Oxidation von 1mol NADH in der Atmungskette reicht fr die Synthese von maximal 3mol
ATP Hingegen liefert die Oxidation von FADH2

(Succinat-Dehydrogenase des Citratzyklus, Fettsureabbau), dessen Reduktionsquivalente erst auf der


Stufe von Ubichinon in die Atmungskette gelangen,
nur 2mol ATP. Die maximale ATP-Ausbeute des
oxidativen Abbaus von Glucose zu CO2 und H2O
betrgt 38ATP (.Tab.15.1).
Wirkungsgrad
Energieausbeute

G0 .kJ=mol/

C6 H12 O6 C 6 O2 ! 6 CO2 C 6 H2 O

38 ADP C 38 Pi ! 38 ATP C 38 H2 O

2810

C1180

Wirkungsgrad
1180 kJ=mol
D 0;4 .40 %/
2810 kJ=mol

Wenn mit physiologischen Konzentrationen,


d.h. mit G-Werten, statt Standardbedingungen (G0; Konzentration 1mol/L) gerechnet
wird, ergibt sich ein Wirkungsgrad von 50%.
Die 38mol ATP sind aufgrund experimenteller

Befunde ein zu hoher Wert, ungefhr 30mol


ATP pro mol Glucose scheinen realistischer; der
entsprechende Wirkungsgrad ist 40%.


Die oxidative Phosphorylierung verwendet ausschlielich ADP als Substrat und kann nur ATP
synthetisieren Die unspezifische Nucleosiddiphosphat-Kinase phosphoryliert die anderen

Nucleosiddiphosphate (Ribo- und Desoxyriboformen) unter Verbrauch von ATP zu den entsprechenden Triphosphaten:

Diese Reaktionen weisen einen G0-Wert von


etwa Null auf, d.h. das Gleichgewicht bei Standardbedingungen liegt in der Mitte. Da jedoch
ATP in wesentlich hherer Konzentration als ADP
und die anderen Nucleosiddiphosphate vorliegt,
lassen sich die Triphosphate problemlos synthetisieren.
15.6

Regulation der mitochondrialen


ATP-Synthese

Ein Stoffwechselprozess, welcher der Zelle chemische Energie in Form von ATP liefert, erfllt seine
Funktion nur dann optimal, wenn sein Durchsatz
dem Bedarf der Zelle angepasst wird.
Die strikte Koppelung von Atmungskette und
ATP-Synthese zusammen mit dem strikten ATP/
ADP-Antiport bewirken eine bedarfsgerechte
Synthese von ATP Die strikte Stchiometrie von

ATP-Synthese und Oxidation von Coenzym-gebundenem Wasserstoff (3ATP pro NADH) weist
darauf hin, dass die beiden Vorgnge miteinander
gekoppelt sind. Die Koppelung ist gegenseitig: keine
ATP-Synthese ohne Oxidation, keine Oxidation
ohne ATP-Synthese. Die gekoppelten Reaktionen
knnen nur ablaufen, wenn jedes einzelne Substrat vorhanden ist: Reduktionsquivalente, O2, ADP
und Pi.

15

189
15.6 Regulation der mitochondrialen ATP-Synthese

.. Tab.15.1 Maximale ATP-Ausbeute des oxidativen Abbaus von Glucose zu CO2 und H2Oa
Substratketten-
Phosphorylierung

NADH-Oxidation

FADH2-Oxidation

Summe

2b1c

2b1c3d

2b1c3d

2b1c (GTP)

2b3c3d

2b1c2d

24

Glykolyse
Glucose2Pyruvat
(Cytosol)
Pyruvat-Oxidation
PyruvatAcetyl-
CoA+CO2
(Mitochondrien)
Citratzyklus
Acetylrest2 CO2
(Mitochondrien)
Total

38

Die Anzahl Mol ATP gebildet pro Mol oxidierter Glucose sind angegeben.

 er Faktor2 ergibt sich aus der Tatsache, dass Glucose in 2Triosephosphate gespalten wird und ATP erst nach dieser
D
Spaltung gebildet wird.

Die zweite Zahl gibt an, wie viel Mal im betreffenden Stoffwechselweg ATP (GTP), NADH oder FADH2 gebildet werden.

Die dritte Zahl entspricht der Anzahl Mol ATP, die pro Mol NADH oder FADH2 maximal gebildet werden knnen.

Die Konzentration von ADP und Pi in


den Mitochondrien kann mit der Stoffwechsellage der Zellen stark schwanken, da in den
Mitochondrien ein einfacher Erhaltungssatz gilt:
[ATP]+[ADP]=konstant. Die Konstanz der Summe
rhrt daher, dass die Ausfuhr von ATP ins Cytosol,
wo es verbraucht wird, und die Einfuhr von ADP
aus dem Cytosol durch den ATP-ADP-Translokator der inneren Membran streng kontrolliert wird
. Das sekundr-aktive Antiport-System (Abschn.26.3) importiert ein ADP-Molekl fr jedes
exportierte ATP-Molekl. Zur Aufnahme von Pi
dient ein weiteres sekundr-aktives Antiport-System (.Abb.15.6). Ein hoher ATP-Verbrauch im
Cytosol lsst wegen des ATP/ADP-Antiports die
ADP-Konzentration in den Mitochondrien ansteigen. Umgekehrt fhrt ein geringer ATP-Verbrauch im Cytosol zu einer niedrigen ADP-Konzentration in den Mitochondrien. ADP-Mangel in
den Mitochondrien ist gleichzusetzen mit einem
Mangel an Akzeptor fr Pi. Ein Mangel an ADP
als Pi-Akzeptor verlangsamt die Phosphorylierung (Pi+ADPATP) und die damit gekoppelte
Atmungskette. Diese Regulierung der Zellatmung

durch den ATP-Verbrauch wird als Akzeptorkontrolle der Zellatmung bezeichnet.


Schwerarbeit
Die Zellatmung kann bei hohem ATP-Verbrauch, zum Beispiel bei schwerer aerober
Muskelarbeit, bis auf das Zehnfache des
Ruhewerts ansteigen. Entsprechend wird dann
auch zehnmal mehr O2 verbraucht und zehnmal mehr CO2 gebildet.

Die Akzeptorkontrolle der Zellatmung kann allerdings nur funktionieren, wenn auch der Nachschub an NADH und Metaboliten, deren Abbau
NADH liefert, adquat reguliert wird. Wie bereits
bei der Einfhrung in den Stoffwechsel (Kap.13)
erwhnt, wird die Geschwindigkeit von Stoffwechselketten bei den irreversiblen und damit nur in
einer Richtung ablaufenden Reaktionen gesteuert. Auf diese Weise werden auch die Glykolyse
und der Citratzyklus, die Zulieferer von NADH
und FADH2 fr die Atmungskette, reguliert
(.Abb.15.7).

190

Kapitel 15 ATP-Synthese in Mitochondrien

Auen

1
z

3
4

.. Abb.15.6 Wichtige aktive Transportsysteme der inneren Mitochondrienmembran. Es handelt sich hier ausnahmslos
um sekundr-aktive Transportsysteme,
die entweder durch das elektrische oder
das chemische Potenzial, welche die
Atmungskette hervorbringt, angetrieben
werden

Translokator
z

5
6
7
z

8
9
10

11
12
13
14
15
16
17
18
19
20

.. Abb.15.7 Allosterische Regulation von Glykolyse und Citratzyklus. Der Glykolyse vorgeschaltet ist die Mobilisierung des
Reservekohlenhydrats Glykogen durch die Glykogenphosphorylase (Abschn.16.2).
Reguliertes Enzym

Aktivator

Glykogenphosphorylase

AMP

ATP, Glucose, Hexose-P

Phosphofructokinase (PFK)

AMP, ADP, F-2,6-P2

ATP, Citrat

Pyruvatdehydrogenase-

Inhibitor

ATP, Acetyl-CoA

Komplex (PDH)
ATP, Acyl-CoA, NADH, Succinyl-CoA

Citrat-Synthase
Isocitrat-Dehydrogenase

AMP, ADP

Pyruvatcarboxylase

ATP, NADH
NADH, Succinyl-CoA

-Ketoglutarat-Dehydrogenase
Acetyl-CoA

191
15.6 Regulation der mitochondrialen ATP-Synthese

15

192

Kapitel 15 ATP-Synthese in Mitochondrien

Eine erhhte Konzentration von AMP widerspiegelt eine erhhte Konzentration von ADP:

2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

DieRegulation ist durchaus sinnvoll: bei hoher


Konzentration von ATP oder ATP-liefernden Metaboliten wird der Durchsatz der Glykolyse und des
Citratzyklus gedrosselt; bei tiefer Konzentration von
ADP und AMP werden diese katabolen Stoffwechselwege beschleunigt und liefern der Atmungskette
mehr NADH und FADH2.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517043-0
15.1 Organisation der Atmungskette
15.2 Redoxkomponenten der Atmungskette
(FMN, FAD, FeS-Zentren, Ubichinon,
Cytochrome)
15.3 Chemiosmotischer Mechanismus
der oxidativen Phosphorylierung
15.4 Transport von Reduktionsquivalenten
vom Cytosol in die Mitochondrien
15.5 ATP-Bilanz des oxidativen Abbaus
von Glucose
15.6 Regulation der mitochondrialen
ATP-Synthese
Weiterfhrende Literatur

193

Gluconeogenese, Glykogen,
Disaccharide
und Pentosephosphatweg
Ph. Christen, R. Jaussi, R. Benoit

16.1

Gluconeogenese194

16.2

Abbau und Aufbau von Glykogen 197

16.3

Stoffwechsel der Disaccharide 204

16.4

Pentosephosphatweg206

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_16, Springer-Verlag Berlin Heidelberg 2016

16

194

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

Woher kommt die Glucose, welche der Zelle ber


Glykolyse, Citratzyklus und oxidative Phosphorylierung die Synthese von ATP ermglicht? Glucose
wird bei Mensch und Tier entweder mit der Nahrung in Form von Strke und Disacchariden zugefhrt oder durch Abbau des Reservekohlenhydrats
Glykogen erhalten. Sind diese Quellen erschpft,
wird Glucose aus Nichtkohlenhydrat-Vorlufern
synthetisiert (Gluconeogenese).
Der Pentosephosphatweg, ein alternativer Abbauweg fr Glucose, versorgt den Organismus mit
NADPH und Pentosen: Die Zelle bentigt NADPH
als Reduktionsmittel fr reduktive Synthesen (z.B.
von Fettsuren aus Acetyl-CoA) und Pentosen als
Bausteine von Nucleotiden und Nucleinsuren.
In NADP+ ist der Adenosinrest von NAD+ in der
2-Stellung phosphoryliert (.Abb.14.2). NADP+
wird wie NAD+ durch ein Hydridion (H) reversibel
zu NADPH reduziert.
16.1 Gluconeogenese
Die Neusynthese von Glucose und anderen Zuckern aus Nichtkohlenhydrat-Vorlufern macht
den Organismus unabhngig von zugefhrten
Kohlenhydraten Zucker und Zuckerderivate sind

Bausteine der bakteriellen Zellwand; bei Eukaryonten sind sie Bestandteile der Glykoproteine und Glykolipide der Zellmembran sowie der extrazellulren
Matrix, bei Pflanzen der Cellulosefasern. Bei Vertebraten versorgt Glucose das Gehirn mit Energie; die
Glucosekonzentration im Blut von 5mM (beim
Menschen) wird unabhngig von der Kohlenhydratzufuhr konstant gehalten.

Glucoseverbrauch
Das Gehirn eines erwachsenen Menschen
verbraucht etwa 140g Glucose pro Tag; Erythrozyten und Nebennierenmark bentigen
zustzliche 3040g pro Tag.

Leber, Niere und Darmmucosa besitzen die zur

Gluconeogenese notwendigen Enzyme. Wenn


keine Kohlenhydrate mit der Nahrung aufgenommen werden und die Glykogenreserve der Leber
erschpft ist, bilden diese Organe Glucose aus Aminosuren oder Lactat. Mensch und Tier synthetisieren keinerlei Kohlenhydrate aus Fettsuren. In
Pflanzen hingegen ist die Synthese von Kohlenhydrat aus Acetyl-CoA, d.h. aus Fettsuren, mglich
(Glyoxylatzyklus; Abschn.21.3).

Die Gluconeogenese entspricht einer Umkehrung der Glykolyse Die drei irreversiblen Schritte

der Glykolyse mssen allerdings aus energetischen


Grnden umgangen werden (.Abb.16.1).
1. PyruvatPhosphoenolpyruvat: Um Phosphoenolpyruvat (PEP, eine sehr energiereiche Verbindung) aus Pyruvat herzustellen, werden zwei
energiereiche Phosphatverbindungen bentigt.
2. Fructose-1,6-P2Fructose-6-P: Die irreversible
Phosphofructokinase-Reaktion wird umgangen.
Die Umwandlung von Fructose-1,6-P2 zu Fructose-6-P wird mglich durch Verzicht auf die
Synthese von ATP.
3. Glucose-6-PGlucose: Die Glucose-6-phosphatase liefert Glucose ins Blut. Das Enzym kommt
nur in Geweben vor, in welchen Gluconeogenese mglich ist.

16
17
18
19
20

.. Abb.16.1 Gluconeogenese. Der Reaktionsweg entspricht weitgehend einer Umkehr der Glykolyse. Die drei irreversiblen glykolytischen Reaktionen mssen allerdings unter Energieverlust umgangen werden. Die drei Umgehungsreaktionen (blau) sind
exergonisch, weil andere Substrate und Produkte daran beteiligt sind. Sie werden daher auch durch andere Enzyme katalysiert.
Die Umgehungsreaktionen sind, wie die entsprechenden glykolytischen Reaktionen, irreversibel: eine wichtige Voraussetzung,
um einen Leerlaufzyklus zu vermeiden. Die Biotin-abhngige Pyruvatcarboxylase-Reaktion ist in Abschn.14.3 als anaplerotische Reaktion des Citratzyklus beschrieben. Die Malatdehydrogenase-Reaktion ist auch Teil des Citratzyklus. Zwei Isoenzyme
katalysieren die gleiche Reaktion im Cytosol und in den Mitochondrien. Die PEP-Carboxykinase ist das Schrittmacher- Enzym
der Gluconeogenese und wird durch glucocorticoide Hormone induziert

195
16.1Gluconeogenese

3 - Phosphoglyceroylphosphat
k

16

196

Bilanz der Gluconeogenese:

2 Pyruvat C 4 ATP C 2 GTP C 2 NADH

2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

C 2 HC C 6 H2 O
#

Glucose C 4 ADP C 2 GDP C 6 Pi C 2 NADC


G0 D 38 kJ=mol

Es werden 6 energiereiche Phosphatbindungen


verbraucht; bei der Glykolyse hingegen nur 2ATP
gewonnen. Der Organismus lsst sich die Synthese
von Glucose, dem Energietrger, etwas kosten.

allosterischer Aktivator der Phosphofructokinase


und allosterischer Inhibitor der Fructose-1,6-bisphosphatase schaltet Fructose-2,6-bisphosphat die
Stoffwechselkette auf Glykolyse (.Abb.16.2). Eine
regulatorische Kaskade, die durch die Glucosekonzentration im Blut ber die Hormone Insulin
und Glucagon (Abschn.28.7) kontrolliert wird,
fhrt bei hoher Glucosekonzentration zu vermehrter Bildung von Fructose-2,6-bisphosphat
und damit zu Glykolyse bei gehemmter Gluconeogenese.

Zur Neubildung von Glucose dienen glucogene Aminosuren und andere Metaboliten Alle

Stoffwechselzwischenprodukte, welche in Pyruvat


oder Oxalacetat umgewandelt werden knnen, taugen als Ausgangsstoffe der Gluconeogenese:
Glucogene (glucoplastische) Aminosuren,
Glycerol aus dem Abbau von Triacylglycerolen,
Lactat aus dem anaeroben Abbau von Glucose und Glykogen in Muskulatur (anaerobe
Glykolyse bei intensiver Muskelaktivitt) und
Erythrozyten (keine Mitochondrien, anaerobe
Glykolyse liefert ATP). Lactat gelangt auf dem
Blutweg in die Leber, die daraus Glucose synthetisiert, welche sie wiederum den peripheren
Geweben zur Verfgung stellt (Cori-Zyklus).

--

Definitionen
Hormone: Hormone sind Botensubstanzen
(Messengers), welche auf dem Blutweg von
der Hormondrse zum Zielgewebe gelangen
(Kap.28). Gewisse Hormonrezeptoren auf
der Zelloberflche sind mit einem G-Protein
(GTP-bindenden Protein) gekoppelt, das
seinerseits bei Binden des Hormons an den
Rezeptor die Adenylatcyclase aktiviert. Dieses
Enzym bildet cAMP (zyklisches, cyclic Adenosin-3,5-monophosphat) aus ATP (.Abb.16.4).
Als Second messenger bringt cAMP das chemische Signal zum entsprechenden Zielprotein
in der Zelle.

Glykolyse und Gluconeogenese werden gegensinnig reguliert Die drei Umgehungsreaktionen

der Gluconeogenese knnten in Kombination


mit den jeweiligen glykolytischen Reaktionen
zu ATP-verbrauchenden Leerlaufzyklen fhren.
Ein solcher Futile cycle, der nur Wrme produzieren wrde, knnte entstehen, wenn z.B. die
Reaktionen der Phosphofructokinase und Fructose-1,6-bisphosphatase gleichzeitig ablaufen
wrden (.Abb.16.1). Gegenlufige Regulation
der beteiligten Enzyme, welche den Stoffwechsel
entweder auf Glykolyse oder auf Gluconeogenese
schaltet, verhindert den Leerlaufzyklus (Abschn.13.2). Die wichtigste Rolle beim gegensinnigen Ein- und Ausschalten von Phosphofructokinase und Fructose-1,6-bisphosphatasen spielt
Fructose-2,6-bisphosphat, das in geringen Mengen aus Fructose-6-phosphat gebildet wird: Als


Hormonal gesteuerte Enzyminduktion verstrkt
die Gluconeogenese Bei Kohlenhydratmangel
wird vermehrt das Hormon Glucagon sezerniert,

das Enzyme der Gluconeogenese induziert. Ebenso


induzieren die glucocorticoiden Hormone, die
bei Stressbedingungen von der Nebennierenrinde
vermehrt sezerniert werden, diese Enzyme, insbesondere die PEP-Carboxykinase (.Abb.16.1). Die
Glucocorticoide bewirken eine lnger dauernde
Umstellung des Kohlenhydratstoffwechsels auf
Gluconeogenese aus Aminosuren, indem sie auch

16

197
16.2 Abbau und Aufbau von Glykogen

.. Abb.16.2 Gegensinnige Regulation von Glykolyse und Gluconeogenese durch Fructose-2,6-bisphosphat. Die Konzentration
der Glucose im Blut ist die Regelgre. Die Phosphofructokinase (PFK) und die Fructose-1,6-bisphosphatase (FBP) werden ber
folgende Kaskade reguliert:
Regelgre

Glucosekonzentration

Glucosekonzentration

hoch

niedrig

Hormone

Insulin

Insulin

Glucagon

Glucagon

Second messenger

cAMP

cAMP

Fru-6-P-Kinase

Fru-2,6-P2-Phosphatase

Dritter messenger

Fru-2,6-P2

Enzyme

PFK

Fru-2,6-P2

PFK nicht mehr

FBP

FBP nicht mehr

Stoffwechselweg

Glykolyse

Glykolyse

Gluconeogenese

Gluconeogenese

Trivial: Aufhebung einer Aktivierung entspricht einer Hemmung und Aufhebung einer Hemmung einer Aktivierung

den Proteinabbau stimulieren und Enzyme fr den


Abbau von Aminosuren induzieren.
16.2

Abbau und Aufbau


von Glykogen

Die am raschesten verfgbare Quelle fr Glucose


ist deren Speicherform, das Glykogen Das ver-

zweigte, wasserunlsliche, aber viel Wasser bindende Glucosehomopolymer bildet zusammen mit
den Enzymen fr seinen Aufbau und Abbau elektronenoptisch erfassbare Partikel (520 103kDa) im
Cytosol, die Glykogengranula. Glykogen wird
nach reichlicher Kohlenhydratzufuhr in der Leber
und Muskulatur synthetisiert und bei Mangel an
Glucose wieder abgebaut. Der Glykogengehalt der
Gewebe hngt daher vom Ernhrungszustand ab.

Glykogengehalt (erwachsener Mensch)


Leber

maximal 10% des


Organgewichts

150g

Muskel

maximal 1% des
Organgewichts

250g
_____

Total

400g

400g 17,5kJ/g=6900kJ=1640kcal

Das Glykogen deckt den Energiebedarf fr


2/3Tag (Tagesbedarf 10000kJ=2400kcal).

Der maximale Glykogengehalt (400g) ist 13-mal hher als der Glucosegehalt des Organismus (30g).
Warum wird Glykogen, dessen Synthese chemische
Energie kostet, statt Glucose gespeichert? Der osmotische Druck lsst die Speicherung von Glucose
in hheren Konzentrationen nicht zu; das polymere
Glykogen ist hingegen osmotisch nur wenig wirksam (niedrige Teilchenkonzentration!).
Glykogen hat die gleiche Struktur wie Strke,
das Reservekohlenhydrat der Pflanzen Glykogen

ist nur etwas strker verzweigt. Die Glucosereste sind


ber -1,4-Bindungen miteinander verbunden, die

198

1
2

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

Verzweigungen kommen durch -1,6-Bindungen


bei etwa jedem 10.Glucoserest zustande. Das einzige C1-Ende ist glykosidisch an einen Tyrosinrest
des Proteins Glykogenin gebunden. Glykogenin als

autokatalytisch wirksame Glucosyltransferase phosphoryliert sich selbst und bildet das Zentrum jedes
Glykogenmolekls. Der Glykogeningehalt einer Zelle
bestimmt deren Gehalt an Glykogenmoleklen.

Glykogen wird phosphorolytisch abgebaut

Die Phosphorylase verkrzt die freien Enden eines


Glykogenmolekls, bis vor einer -1,6-Verzweigung nur noch drei -1,4-verknpfte Glucosereste
verbleiben und das Enzym aus sterischen Grnden
nicht mehr an die -1,4-Bindungen herankommen
kann. Die Transferase-Aktivitt des Debranching
enzyme
behebt die sterische Hemmung, indem
sie die drei -1,4-verbundenen Glucosereste auf
einen anderen Zweig des Glykogenmolekls verpflanzt. Eine zweite aktive Stelle des Debranching
enzyme spaltet den zurckbleibenden -1,6-gebundenen Glucoserest hydrolytisch unter Bildung von
freier Glucose ab. Damit ist die -1,6-Verzweigung
eliminiert und der phosphorolytische Abbau kann
fortgesetzt werden. Die Gleichung der Gesamtreaktion ist

3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die bertragung endstndiger Glucosereste auf


anorganisches Phosphat (statt auf Wasser wie bei
Hydrolyse) produziert Glucose-1-phosphat; ohne
Energieaufwand entsteht ein phosphorylierter Zucker, welcher die Zelle nicht verlassen kann.

Glykogen C nPi C mH2 O


#

n Glucose-1-P . 90 %/ C m Glucose . 10 %/:

199
16.2 Abbau und Aufbau von Glykogen

16

Nur in Leber und Nieren kommt Glykogen zusammen mit Glucose-6-phosphatase vor Nur diese

Organe knnen aus Glykogen stammende Glucose


ins Blut abgeben. Die Muskelzellen hingegen verwenden ihre Glykogenreserve ausschlielich zur
Gewinnung von ATP. Die Glucose im Blut stammt
daher entweder aus dem Darm nach Kohlenhydratzufuhr oder aus der Leber (Glykogen oder Gluconeogenese).
Die Synthese von Glykogen entspricht nicht
einer Umkehrung des Abbaus Die Konzentration

Die freigesetzte Glucose wird ins Blut abgegeben


oder zu Glucose-6-phosphat phosphoryliert. Glucose-1-phosphat wird zu Glucose-6-phosphat isomerisiert, das entweder der Glykolyse zugefhrt oder
nach Dephosphorylierung ins Blut abgegeben wird:
Glykogen
Glucose-1-P

Phosphoglucomutase

Glucose-6phosphatase

Glucose-6-P

Glucose
H2O

Muskel
Glykolyse

Pi

Leber
Niere
Blut

von anorganischem Phosphat (12mM) ist im Vergleich zur Konzentration von Glucose-1-phosphat
zu hoch fr eine effiziente Rckreaktion ([Pi]/[Glucose-1-P] 100!). Die Glykogensynthese geht aus
von UDP-aktivierter Glucose, zu deren Synthese die
Zelle zwei energiereiche Phosphatbindungen investiert. Die Glykogensynthase koppelt die aktivierten
Glucosereste an das freie C4-Ende einer vorbestehenden -1,4-verknpften Polyglucosidkette:

200

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die Verzweigungen werden durch das Branching


enzyme gebildet. Dieses Gegenstck zum Debranching enzyme versetzt -1,4-verknpfte Oligoglucoside von 67 Glucoseresten in eine zentralere
Stellung unter Bildung einer -1,6-Verzweigung,
worauf die Glykogensynthase den neuen Zweig
verlngert.

16

201
16.2 Abbau und Aufbau von Glykogen

Die zahlreichen Enden der verzweigten Reservekohlenhydrate erlauben sowohl eine raschere Synthese
des Polymers als auch eine raschere Mobilisierung
der Glucose.
Gegensinnige Regulation des Aufbaus und
Abbaus von Glykogen verhindert einen Leerlaufzyklus Es sind hier die gleichen Mechanismen zur

Vermeidung eines Leerlaufzyklus wirksam wie bei


der Gluconeogenese und Glykolyse: Das Schrittmacherenzym der einen Stoffwechselrichtung wird
aktiviert und dasjenige der gegenlufigen Richtung
gehemmt. Die Glykogenphosphorylase und Glykogensynthase werden sowohl allosterisch als auch
hormonal reguliert (.Abb.16.3). Bei Brennstoffmangel, d.h. bei niedriger Konzentration von Glucose, Glucose-6-phosphat sowie ATP und erhhter Konzentration von AMP, wird der Abbau von
Glykogen stimuliert und dessen Aufbau gehemmt.
Bei Brennstoffberschuss, d.h. hohen Konzentrationen von Glucose-6-phosphat und ATP, wird
Glykogen synthetisiert und dessen Abbau gehemmt.
Die hormonale Regulation im Muskel wird
durch Muskelttigkeit ausgelst, welche die Freisetzung von Adrenalin aus dem Nebennierenmark
(Abschn.28.3) stimuliert. ber einen G-Pro-

tein-gekoppelten (coupled) Rezeptor (GPCR), die


Adenylatcyclase und eine Phosphorylierungskaskade wird die Glykogenolyse aktiviert und die

Glykogensynthese gehemmt (.Abb.16.4). In der


Leber wird die gleiche Signalkaskade durch das
Peptidhormon Glucagon, dem Gegenspieler von
Insulin, ausgelst. Absinken der Glucosekonzentration im Blut lst die Sekretion von Glucagon durch
die -Zellen der Langerhans-Inseln im Pankreas aus
(Abschn.28.7) :
Muskelaktivitt

Adrenalin Glykogenolyse
im Muskel
Versorgung
der Muskelfasern
mit Glucose

Blutglucose

Glucagon Glykogenolyse
in Leber
Abgabe von
Glucose ins Blut

Der Kaskadenmechanismus verstrkt das Signal Falls ein Signalmolekl ein Enzym aktiviert,

wird die Konzentration des Produkts der enzymatischen Reaktion hher sein als die Konzentration
des Signalmolekls, d.h. jede derartige Stufe der
Signalweitergabe verstrkt das Signal. Im Beispiel

202

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

1
2
3
4
5

6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.16.3 Regulation von Glykogensynthese und -abbau. Die allosterischen Aktivatoren und Inhibitoren sind alles Verbindungen, deren Konzentrationen die Versorgung der Zelle mit Glucose und allgemein mit chemischer Energie anzeigen.
Die Hemmung der Glykogenphosphorylase durch Hexosephosphate macht sich auch bemerkbar bei der Galactosmie und
der hereditren Fructoseintoleranz (Abschn.16.3), die beide mit hohen Konzentrationen eines Hexosephosphats (Galactose-1-phosphat bzw. Fructose-1-phosphat) einhergehen

der Glykogenolyse (.Abb.16.4) ist die Konzentration von Adrenalin 1010M, diejenige von Glucose-1-phosphat 104M: Die Kaskade verstrkt das
chemische Signal 106-mal!

UDP-Glucuronsure oxidiert werden, die an einer


Reihe von Reaktionen beteiligt ist:

Glykogenspeicherkrankheiten fhren zu
Glucosemangel Die Erkenntnis, dass der Auf-

und Abbau von Glykogen ber verschiedene Wege


laufen, ergab sich aus der Untersuchung von Patienten, die Glykogen wohl synthetisieren, aber
nicht abbauen konnten. Hereditre Defekte eines
der Glykogenolyse-Enzyme fhren zu einer berladung von Leber, Niere und Muskel mit Glykogen, erniedrigter Konzentration von Glucose im
Blut (Hypoglykmie) oder ungengendem Glucosenachschub in der Muskulatur. Diese seltenen
Krankheiten sind vielfltig; es kann ihnen ein
Mangel an Glykogenphosphorylase in Leber oder
Muskulatur, aber auch ein Defekt des Debranching
enzyme oder der Glucose-6-phosphatase zugrunde
liegen.

UDP-Glucose wird nicht nur zur Synthese von


Glykogen verwendet UDP-Glucose kann zu

ber diese aktivierte Form werden gut wasserlsliche Glucuronatreste in Heteroglykane


eingebaut. Galacturonat wird auf dieselbe
Weise aktiviert.
UDP-Glucuronat dient zur Konjugation
schlecht wasserlslicher Verbindungen

16

203
16.2 Abbau und Aufbau von Glykogen

cyclase

in

.. Abb.16.4 Regulation der Glykogenolyse und der Glykogensynthese durch Hormone. Die Muskel- und Leberzellen besitzen
spezifische Hormonrezeptoren in der Zellmembran, die Adrenalin (aus Nebennierenmark) bzw. Glucagon (aus Pankreasinseln)
binden. Das Binden des Hormons an den Rezeptor wird ber eine Konformationsnderung an ein G-Protein (GTP-bindendes
Protein; Abschn.27.2) weitergeleitet, welches die Adenylatcyclase aktiviert, die ihrerseits aus ATP zyklisches (cyclic) AMP
(cAMP) produziert. cAMP steuert als intrazellulrer bertrger des Hormonsignals (Second messenger) gewisse Stoffwechselvorgnge. Im Fall des Glykogenstoffwechsels aktiviert cAMP allosterisch die Proteinkinase A (PK-A), welche durch Vermittlung der
Phosphorylase-Kinase die Phosphorylase aktiviert und die Glykogen-Synthase direkt inaktiviert. Die beiden Zielenzyme werden
an bestimmten Serin-, Threonin- oder Tyrosinresten phosphoryliert

204

1
2
3
4
5
6
7

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

(Bilirubin, Steroidhormone, gewisse Medikamente) mit Glucuronat, um diese in besser


wasserlsliche und damit harnfhige Derivate
berzufhren (Glucuronidierung, eine der
Entgiftungsreaktionen der Leber; Abschn.31.2).
Die meisten Tiere knnen Ascorbinsure aus
UDP-Glucuronsure synthetisieren. Beim
Menschen fehlen die entsprechenden Enzyme,
Ascorbinsure ist daher ein essenzieller Nahrungsbestandteil (Vitamin C).

16.3

Stoffwechsel der Disaccharide

Die Synthese der Lactose geht von UDP-Glucose


aus, die zu UDP-Galactose isomerisiert:

8
9
10
11
12

Bei dieser Reaktion wird einzig die Stellung der OHGruppe an C4 gewechselt. Die Reaktion macht den
Organismus unabhngig von zugefhrter Galactose.
UDP-Galactose dient zum Einbau von Galactose in
Glykolipide und Glykoproteine sowie zur Synthese
von Lactose:

13
14
15
16
17
18
19
20

-Galactosyl-1,4-glucosid

Die Lactosesynthase kommt nur in der laktierenden


Milchdrse vor.
Lactose und Saccharose sind wichtige Bestandteile der menschlichen Nahrung Das
quantitativ wichtigste Kohlenhydrat in der menschlichen Nahrung, die Strke, ist ein Glucosepolymer. Mit der Lactose (-Galactosyl-1,4-glucosid,
Milchzucker), die bei Sugern am Anfang des Lebens das einzige Kohlenhydrat in der Nahrung ist,
und der Saccharose (-Glucosyl-1,2--fructosid,
Rben- bzw. Rohrzucker; Synthese in Pflanzen,
Abschn.21.3), die als Sstoff dient und in Industrielndern bis zu 15% des Kohlenhydrats in
der Nahrung ausmacht, werden neben Glucose
zwei weitere Zucker, Galactose und Fructose, dem
Stoffwechsel zugefhrt.

-Glucosido-1,2--fructosid

Die Lactose wird im Dnndarm zu den Monosacchariden hydrolysiert. Die freigesetzte Galactose
wird in der Leber in den Stoffwechsel eingeschleust
(.Abb.16.5). Zwei hereditre Stoffwechseldefekte betreffen den Abbau von Lactose:
Die hufige Lactoseintoleranz ist harmlos.
Bei milchungewohnten Bevlkerungsgruppen ist
es normal, dass Erwachsene Milchzucker nicht
verwerten knnen: Im Brstensaum des Dnndarmepithels fehlt die Lactase (-Galactosidase).
Die Darmflora baut die nicht resorbierte Lactose
zu Lactat und anderen niedermolekularen Verbindungen ab, die zu Durchfall, Blhungen und
Bauchschmerzen fhren. Lactoseintolerante Menschen entwickeln einen Widerwillen gegen Milch
und Milchprodukte. Bei der Mehrheit der Erdbevlkerung (75%) verschwindet ein Groteil der
Lactaseaktivitt im Jugendlichenalter; sie bleibt nur
erhalten bei Bevlkerungsgruppen, die Milchnahrung gewohnt sind. Die persistierende Expression
des Lactase-Gens ist auf eine Mutation in der regulatorischen DNA, welche das Lactase-Gen epigenetisch kontrolliert, zurckzufhren.
Die Galactosmie ist eine viel seltenere, jedoch
schwerwiegende Strung des Galactosestoffwechsels. Die autosomal-rezessiv vererbte Krankheit
beruht auf einem Mangel an Uridyltransferase,
dem Enzym, welches Galactose dem glykolytischen Abbauweg zufhrt (.Abb.16.5). Galacto-

205
16.3 Stoffwechsel der Disaccharide

16

.. Abb.16.5 Einschleusung von Galactose in den Stoffwechsel. Galactose stammt zum allergrten Teil aus der Lactose in
Milch und Milchprodukten. Die Lactase im Darm hydrolysiert die Lactose. Beim Eintritt in die Zellen wird die Galactose phosphoryliert. Die Epimerisierung zu Glucose (Wechsel der Stellung der OH-Gruppe an C4) erfolgt auf der Stufe der UDP-Formen
der beiden Zucker durch die UDP-Galactose-4-Epimerase, das Enzym, welches auch an der Synthese von Lactose beteiligt ist.
Die Uridyltransferase tauscht den Glucose-1-P-Rest gegen Galactose-1-P aus. Ein Defekt dieses Enzyms verursacht die Galactosmie; Mangel an Lactase im Darm fhrt zur Lactoseintoleranz

se-1-phosphat staut sich an und hemmt die Glykogenphosphorylase (.Abb.16.3). Die Hypoglykmie
uert sich bereits in den ersten Lebenstagen: Die
Kinder sind trinkunlustig, erbrechen, nehmen nicht
an Gewicht zu und werden, falls nicht behandelt,
wegen des Glucosemangels in einer kritischen
Phase der Gehirnentwicklung schwachsinnig. Die

klinisch-chemischen Befunde sind: Hypoglykmie,


Galactosmie (zu hohe Konzentration von Galactose im Blut), Galactosurie (Galactoseausscheidung im Urin) und Fehlen der Uridyltransferase.
Frherkennung der Krankheit ist uerst wichtig:
Lactosefreie Dit verhindert die Fehlentwicklung
des Gehirns und andere Folgen; die Dit ist lebens-

206

Kapitel 16 Gluconeogenese, Glykogen, Disaccharide und Pentosephosphatweg

12

lang beizubehalten. Testen auf Galactosmie ist Teil


des routinemigen Neugeborenen-Screenings.
Die Saccharose wird im Darm hydrolytisch zu
Glucose und Fructose gespalten. Eine spezifische
Fructokinase phosphoryliert in der Leber Fructose zu Fructose-1-phosphat, welches dort durch
die ebenfalls spezifische Fructose-1-phosphat-Aldolase in Dihydroxyacetonphosphat und Glycerinaldehyd gespalten wird. Die Triosekinase
phosphoryliert Glycerinaldehyd zu Glycerinaldehyd-3-phosphat und schleust ihn damit in den
glykolytischen Abbauweg ein.
Bei der hereditren Fructoseintoleranz fehlt
die Fructose-1-phosphat-Aldolase. Das nicht abgebaute Fructose-1-phosphat hemmt allosterisch die
Glykogenphosphorylase (.Abb.16.3) sowie die
Fructose-1,6-bisphosphatase (.Abb.16.1). Hypoglykmie mit belkeit, Erbrechen, Schwitzen und
Schock ist die Folge; die Trger dieser Stoffwechselvariante meiden Frchte und Sigkeiten.
Typischerweise betreffen die hufigsten erblichen Strungen des Stoffwechsels (Glykogenspeicherkrankheiten, Fructoseintoleranz, Galactosmie)
dessen Zulieferwege und nicht Glykolyse, Citratzyklus oder oxidative Phosphorylierung. Strungen
dieser zentralen Stoffwechselwege sind mit dem Leben von Keimzellen oder frhen Embryonalstadien
nicht vereinbar.

13

16.4 Pentosephosphatweg

1
2
3
4
5
6
7
8
9
10
11

14
15
16
17
18
19
20

Fr den Abbau von Glucose ist der Pentosephosphatweg unbedeutend (10% des gesamten
Glucoseabbaus), er ist jedoch wichtig zur Versorgung der Zellen mit NADPH und Ribose. Wie die
Glykolyse luft auch der Pentosephosphatweg im
Cytosol ab und beginnt mit Glucose-6-phosphat.
Der oxidative Teil des Pentosephosphatwegs
liefert NADPH und Pentosen Zwei Oxidations-

schritte und eine Decarboxylierung ergeben pro


mol Glucose 2mol NADPH und 1mol Pentose (Ribulose-5-phosphat).

NADPH dient als Reduktionsmittel bei der Synthese

von Fettsuren, Cholesterol, Desoxynucleosiddiphosphaten etc. und hlt das zellulre Glutathion
in reduzierter Form (Redoxhomostase; Abschn.31.3). Pentosen, insbesondere Ribose und
Desoxyribose, sind notwendig zur Synthese von
Nucleotiden, Nucleinsuren und gewissen Coenzymen (NAD+, NADP+, FAD, CoA). Eine Isomerase
katalysiert die Umwandlung der Ketose Ribulose-5-P in Ribose-5-P, die entsprechende Aldose.

207
16.4Pentosephosphatweg

Hereditrer G-6-P-DH-Mangel
Glucose-6-phosphat-Dehydrogenase-Mangel ist die hufigste monogene Erbkrankheit
und die hufigste Enzymopathie berhaupt
(X-chromosomal-rezessiv vererbt). Die ungengende Produktion von NADPH fhrt in den
Erythrozyten zu einem Mangel an reduziertem Glutathion (Abschn.31.3). Oxidative
Schden von Proteinen und Zellmembranen
fhren zu einer hmolytischen Anmie.

Der nichtoxidative Teil dient der Rckfhrung


berschssiger Pentosen in den glykolytischen
Abbauweg:

Dieser Teil des Pentosephosphatwegs ist im Unterschied zum oxidativen Teil vollstndig reversibel.
Der Flux der Reaktanten passt sich daher den Stoffwechselbedrfnissen der Zelle an:
Bedarf der Zelle an NADPH
und Pentosen

Pentosephosphatweg
luft

im molaren Verhltnis>2 : 1

vollstndig ab

Bedarf an NADPH
und Pentosen

Nur oxidativer Teil luft ab

im molaren Verhltnis
von 2:1
Bedarf der Zelle an NADPH
und Pentosen

Nichtoxidativer Teil
luft

im molaren Verhltnis<2:1

rckwrts ab

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517044-0
16.1 Gluconeogenese
16.2 Abbau und Aufbau von Glykogen
16.3 Stoffwechsel der Disaccharide
16.4 Pentosephosphatweg
Weiterfhrende Literatur

16

209

Stoffwechsel der Fettsuren


und Lipide
Ph. Christen, R. Jaussi, R. Benoit

17.1

-Oxidation von Fettsuren 210

17.2

Fettsuresynthese213

17.3

Ketonkrper217

17.4

Synthese und Abbau der Triacylglycerole 218

17.5

Stoffwechsel der Phospholipide 220

17.6

Stoffwechsel von Cholesterol 220

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_17, Springer-Verlag Berlin Heidelberg 2016

17

210

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

Der grte Teil der Fettsuren findet sich als Baustein der Triacylglycerole im Reservefett und der
polaren Lipide in den Membranen. Freie Fettsuren sind eine Transportform chemischer Energie;
das Fettgewebe versorgt damit die Muskulatur und
andere Organe. Die in Organismen vorkommenden
Fettsuren sind unverzweigt und besitzen meist eine
gerade Anzahl von C-Atomen, besonders hufig
sind C16- und C18-Fettsuren. Etwa die Hlfte der
Fettsuren in einem tierischen Organismus ist ungesttigt mit 1 bis 3Doppelbindungen.
Die Fettsuren werden in der Mitochondrienmatrix durch -Oxidation zu Acetyl-CoA abgebaut.
Zunchst wird die Fettsure mit CoA aktiviert, worauf mit FAD und NAD+ als Elektronenakzeptoren
das -Ketoderivat der Fettsure gebildet wird, das
darauf thiolytisch durch CoA-SH zu Acetyl-CoA
und dem um zwei C-Atome verkrzten Acyl-CoA
gespalten wird. Jeder weitere Abbauzyklus spaltet erneut Acetyl-CoA ab. Die Fettsuresynthese
luft im Cytosol ab, sie verwendet Acetyl-CoA als
Baustein und entspricht formal einer Umkehr der
-Oxidation: Ausgehend von Acetyl-CoA verlngert jeder Synthesezyklus die Kette um weitere zwei
C-Atome. Als Reduktionsmittel dient, wie bei den
meisten reduktiven Biosynthesen, NADPH. Fettsuren werden v.a. in der Leber aber auch in anderen Organen wie Fettgewebe und der laktierenden
Milchdrse synthetisiert.
Die Ketonkrper (Hauptvertreter -Hydroxybutyrat) werden in der Leber vermehrt gebildet,
wenn im Hungerzustand durch verstrkten Fettsureabbau mehr Acetyl-CoA anfllt, als der Citratzyklus aufnehmen kann. Die wasserlslichen Ketonkrper gelangen von der Leber zu peripheren Organen,
die sie zur Energiegewinnung abbauen.
Die Lipide sind nach dem Kriterium ihrer Lslichkeit in organischen Lsungsmitteln definiert,
sie sind daher nicht nur strukturell, sondern auch
funktionell sehr vielfltig: Triacylglycerole dienen
als Hauptreserve chemischer Energie, polare Lipide
und Cholesterol sind Membranbestandteile, und
aus Cholesterol entstehen wichtige, biologisch aktive Stoffe wie die Steroidhormone, das VitaminD
und die Gallensuren. Die Stoffwechselwege der
verschiedenen Lipidgruppen haben wenig gemeinsam.

17.1

-Oxidation von Fettsuren

Die hormonregulierte Lipase mobilisiert die quantitativ bedeutendste Energiereserve des tierischen Organismus: Sie hydrolysiert die Triacylglycerole in den
Fettzellen zu Glycerol und Fettsuren; ihre Aktivitt
erhht die Fettsurekonzentration im Blut. Die Lipase
wird durch Adrenalin, Noradrenalin und Glucagon
(Hungersignale der Zelle) ber cAMP aktiviert und
durch Insulin (berfluss-Signal) gehemmt. Die Fettsuren sind schlecht wasserlslich und werden daher
im Blut als Komplexe mit Serumalbumin transportiert (Abschn.34.4). Viele Gewebe resorbieren
Fettsuren aus dem Blut zur Energiegewinnung; eine
Ausnahme sind Gehirn und Erythrozyten, die hierzu
ausschlielich Glucose verwenden. Besonders intensiv ist der Abbau der Fettsuren in der Leber, die aus
Fettsuren Ketonkrper produziert und ans Blut abgibt zur Energieversorgung peripherer Gewebe.
Energiespeicher in Pflanzen
Auch Pflanzen und Algen speichern Kohlenhydratpolymere und Triacylglycerole als Energiereserve. Besonders reichlich sind die Reserven
in den Teilen, welche der Verbreitung der
Pflanzen dienen: Samen enthalten Strke (Getreidekrner, allgemein bei Grsern) oder Fette
(Sonnenblumenkerne), Wurzelknollen enthalten Strke als Energiereserve und Proteine als
Lieferanten von Aminosuren (Kartoffeln).

Vor dem Abbau werden die Fettsuren aktiviert und in die Mitochondrien verschoben:

211
17.1 -Oxidation von Fettsuren

Acyl-CoA-Synthetasen aktivieren die Fettsuren

Die Acyl-CoA-Synthetasen bilden eine kleine Familie


von drei an das ER und die uere Mitochondrienmembran gebundenen Enzymen, die Fettsuren verschiedener Lnge als Substrate akzeptieren. Wie bei
der Aktivierung der Aminosuren vor dem Beladen
der tRNA ist die Bildung von Acyl-AMP (energiereiches Sureanhydrid mit hohem Acylgruppen-bertragungspotenzial) gekoppelt mit der Hydrolyse von
PPi durch die ubiquitre Pyrophosphatase: Es werden
2 energiereiche Phosphatbindungen gespalten. Der
Acylrest von Acyl-AMP wird auf die SH-Gruppe von
CoA bertragen. Die Acyl-CoA-Synthetasen katalysieren beide Teilreaktionen:

17

Acyl-CoA, ein Thioester, ist eine energiereiche Verbindung mit einem hohen Acylgruppenbertragungspotenzial (.Tab.14.1). Analog zur Bezeichnung von Acetyl-CoA als aktivierte Essigsure, wird
Acyl-CoA als aktivierte Fettsure bezeichnet. AcylCoA kann die innere Mitochondrienmembran nicht
passieren.

Fr den Transport in die Mitochondrien wird


der Fettsurerest auf Carnitin bertragen:

Der Acylcarnitin-Carnitin-Carrier bugsiert Acyl


carnitin durch die Membran, worauf durch erneute
Umesterung wieder Acyl-CoA entsteht. Das freie
Carnitin gelangt mit demselben Carrier zurck ins
Cytosol:

-Oxidation baut die aktivierte Fettsure zu Acetyl-CoA ab Eine Oxidation an C (daher -Oxi-

dation) leitet die Abspaltung von Acetyl-CoA


ein. Geradzahlige Fettsuren werden vollstndig
zu Acetyl-CoA abgebaut durch Wiederholung einer
Folge von 4Reaktionen: Erste Oxidation, Hydratation, zweite Oxidation und Thiolyse durch CoA
(.Abb.17.1). Die Reaktionsgleichung fr die erste
Abbaurunde ist

Acyl.Cn /-CoA C FAD C NADC


CH2 O C CoA
#

Acyl.Cn2 /-CoA C FADH2 C NADH


CHC C Acetyl-CoA

Die Abbauzyklen wiederholen sich, bis die Fettsure


vollstndig zu Acetyl-CoA abgebaut ist. Wie bei den
Acyl-CoA-Synthetasen existieren drei Stze von Enzymen der -Oxidation fr verschiedene Bereiche
der Kettenlnge.

212

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

Die Bilanzgleichung fr den vollstndigen Abbau von Palmitinsure (gesttigte C16-Sure) zu Ace
tyl-CoA ist:

1
2

Palmitat .C16 /CATPC8 CoAC7 FADC7 NADC

C 7 H2 OCH2 O .fr die Hydrolyse von PPi /

8 Acetyl-CoAC7 FADH2 C7 NADHC7 HC

C AMPC2 Pi

5
ATP-Bilanz

ATP-Bilanz des vollstndigen Abbaus von


Palmitinsure zu CO2 und H2O ber Citratzyklus
und oxidative Phosphorylierung (mol ATP pro
mol Palmitat):
8Acetyl-CoA liefern

7
8
9
10
11
12
13
14

17
18
19
20

- 2ATP

Total

129ATP

Die Palmitinsure liefert mehr ATP pro C-Atom


als Glucose:

15
16

Bei der Aktivierung der Fettsure


sind 2 energiereiche Phosphatbindungen verbraucht worden
(ATP+H2OAMP+2 Pi)

Palmitinsure
.. Abb.17.1 -Oxidation aktivierter gesttigter Fettsuren.
Die Fettsuren werden vom COO-Ende her abgebaut.
Die erste Oxidation, die Einfhrung einer Doppelbindung
zwischen C und C, erfolgt durch FAD, welches an Flavoprotein5 (FP5) gebunden ist, ein Komplex, der wie KomplexII
zwei Wasserstoffatome an CoQ der Atmungskette abgibt.
Bei der Wasseranlagerung kommt eine OH-Gruppe an C
zu liegen. Die zweite Oxidation entspricht der Oxidation
eines Alkohols durch NAD+. Die Thiolyse durch CoA liefert
Acetyl-CoA und einen Acylrest, der bereits durch CoA aktiviert
ist fr die nchste Abbaurunde

Glucose

129 ATP=16 C  8;1 ATP=C

38 ATP=6 C  6;3 ATP=C

Der Unterschied beruht darauf, dass Palmitinsure strker reduziert ist als Glucose.

213
17.2Fettsuresynthese

Der Wirkungsgrad bezogen auf synthetisiertes


ATP:
O2

Fettsureoxidation .Palmitinsure C16 ! CO2 ; H2 O/


G0 D 9773 kJ=mol

ATP-Synthese .129 mol ATP  31 kJ=mol/

17

Beim Abbau ungeradzahliger Fettsuren


bleibt am Ende Propionyl(C3)-CoA Ungerad-

zahlige Fettsuren sind allerdings selten; Propionyl-CoA entsteht aber auch beim Abbau gewisser
Aminosuren. Ein besonderer Stoffwechselweg
schleust Propionyl-CoA in den Citratzyklus ein:

G0 D C3934 kJ=mol


Energieausbeute

3934
 100 D 40 %
9773

Unter physiologischen Bedingungen ist die


Ausbeute hher (60%).

Der hufigste genetische Defekt in der -Oxidation


betrifft die Medium-chain acyl-CoA dehydrogenase
MCAD (spezifisch fr Acylreste mit 412C-Atomen). Der MCAD-Mangel uert sich beim Kleinkind durch eine ausgeprgte Neigung zu Hypoglykmie mit ungengender Bildung von Ketonkrpern
(Abschn.17.3) und kann zu pltzlichem Kindstod
fhren. MCAD-Mangel ist hufig (1:6000 in Europa
und Nordamerika; autosomal-rezessiver Erbgang;
Teil des Neugeborenen-Screenings). Therapie: Verhinderung einer katabolen Stoffwechsellage durch
hufige, regelmige Zufuhr von Kohlenhydrat.
Der Respiratorische Quotient (RQ), definiert als
mol CO2 produziert pro mol verbrauchtem O2, ist fr

Palmitinsure
Glucose

Glucogene Verbindungen
Propionsure kann ber die Reaktionen des
Citratzyklus der Gluconeogenese zugefhrt
werden. Verbindungen wie Propionsure, aus
denen im Stoffwechsel Glucose gebildet werden kann, werden als glucogene Verbindungen bezeichnet. Die glucogene Propionsure
ist wichtig bei der Celluloseverwertung der
Wiederkuer: Cellulose wird im Pansen durch
Bakterien zu Propionsure abgebaut (Propion
suregrung).

16 CO2
D 0;69
23 O2
6 CO2
D 1;00
6 O2

Experimentell gemessene Werte des RQ stimmen


mit diesen errechneten Werten gut berein. Der RQ
gibt Aufschluss, in welchem Verhltnis der Organismus Fette und Kohlenhydrate zur ATP-Synthese
verbrennt.
Bei ungesttigten Fettsuren ist der erste Abbauschritt vorweggenommen Ungefhr die Hlfte

der Fettsuren im tierischen Organismus ist ungesttigt. In der -Oxidation entfllt bei jeder Doppelbindung der erste Oxidationsschritt. Allerdings mssen
die Doppelbindungen in die jeweilige --Position
verschoben werden und von der cis-Konfiguration,
in der sie in allen natrlichen Fettsuren vorliegen,
zur trans-Konfiguration wechseln. Die 3-cis-2-transIsomerase katalysiert diese Umstellungen.

17.2 Fettsuresynthese

--

Die Synthese der Fettsuren entspricht in keiner


Weise einer Umkehr des Abbaus:
Die Synthese erfolgt im Cytosol.
Zwischenprodukte sind an Phosphopantethein, die prosthetische Gruppe eines

Proteins, gebunden.

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

214

1
2
3
4
5
6
7
8
9
10

--

Die beteiligten Enzyme sind (bei Sugern) Teil


eines multifunktionellen Enzymproteins, der
Fettsuresynthase.
Fettsuren werden durch sukzessives Ankoppeln von C2-Einheiten aufgebaut; der Donor
dieser C2-Fragmente ist eine C3-Verbindung.
Als Reduktionsmittel dient NADPH.
Die Fettsuresynthase liefert Fettsuren mit
maximal 16C-Atomen (Palmitinsure), zur
Verlngerung braucht es zustzliche Enzym
systeme.

Terminologie
Synthetase (X:Y Ligase; Enzymklasse6;
Abschn.4.1): verbindet zwei Substrate
unter ATP-Verbrauch (Beispiel: Acyl-CoA-Synthetase)
Synthase: Die Bezeichnung fr Enzyme aller
Klassen, bei welchen die Synthese im Vordergrund steht (Beispiel: Fettsuresynthase)

Carboxylierung von Acetyl-CoA zu Malonyl-CoA


leitet die Fettsuresynthese ein:

11

Die Fettsuresynthase ist eine groe molekulare


Maschine aus zwei identischen Polypeptidketten
mit je 2300Aminosureresten und 8 verschiedenen
Domnen. Sieben Domnen sind katalytisch aktiv und bearbeiten nacheinander das Substrat, das
von der achten Domne (Acyl carrier protein ACP)
durch kovalente Bindung an Ort gehalten wird. In
Bakterien liegen alle Domnen als einzelne Proteinmolekle vor.
Die zentrale SH-Gruppe des Phosphopantetheins, der prothetischen Gruppe der ACPDomne, bindet die Malonylreste kovalent und die
verlngerten -Ketoacylreste, an denen alle Syntheseschritte erfolgen. Das Phosphopantethein ist ber
eine Phosphoesterbindung an einen Serinrest der
ACP-Domne gebunden:

12
13
14
15
16
17
18
19
20

Phosphopantethein hat dieselbe Struktur wie der


funktionelle Teil von CoA (.Abb.14.4). ACP entspricht damit einer makromolekularen Form von
CoA, welche an einem beweglichen, 2nm langen
Arm die zentrale SH-Gruppe trgt.
Zu Beginn der Synthese wird das Enzym mit
den Reaktanten geladen: Der Acetylrest von AcetylCoA wird durch die Acetyltransacylase auf die zentrale SH-Gruppe bertragen. Von dort bernimmt
ihn die Ketoacylsynthase (Condensing enzyme)
und bindet ihn an ihre periphere SH-Gruppe.
An die nun freie zentrale SH-Gruppe koppelt die
Malonyltransacylase einen Malonylrest aus Malo-

nyl-CoA. Die Fettsuresynthase ist damit bereit fr


den ersten Verlngerungszyklus (C2+C3C4+CO2;
.Abb.17.2) mit der Abfolge von Kondensation,
Reduktion, Wasserabspaltung und nochmaliger
Reduktion. Der lange Phosphopantethein-Arm der
ACP-Domne reicht dabei den Fettsurerest von einer Enzymdomne zur nchsten weiter. Wiederholtes Durchlaufen derselben Reaktionsfolge verlngert
den Acylrest weiter.
Warum liefert Malonyl-ACP und nicht Acetyl-ACP die C2-Einheiten zur Verlngerung? Die
bei Malonyl-ACP mgliche Decarboxylierung
macht die Kondensationsreaktion irreversibel, d.h.

215
17.2Fettsuresynthese

.. Abb.17.2 Synthese von


Fettsuren. Das Schema
beginnt mit der bereits beladenen Fettsuresynthase: Ein
Acetylrest an der peripheren
SH-Gruppe (der Ketoacyl-Synthase) und ein Malonylrest
an der zentralen SH-Gruppe
(des ACP). Die Polymerisierung
entspricht formal einer Umkehr
der -Oxidation. Nach der
Kondensation, die wegen der
Decarboxylierung irreversibel ist, wird die entstandene
-Ketosure zur -Hydroxysure reduziert. Darauf wird
H2O abgespalten unter Bildung
einer ,-Doppelbindung. Die
zweite Reduktion ergibt die
gesttigte Fettsure. Fr beide
Reduktionsschritte dient wie
bei den meisten Biosynthesen
NADPH als Reduktionsmittel. Zu Beginn eines neuen
Verlngerungszyklus laufen
die gleichen Vorgnge ab wie
beim ersten Aufladen der Fettsuresynthase: Der gesttigte
Acylrest wird von der zentralen
auf die periphere SH-Gruppe
bertragen, und die nun freie
zentrale SH-Gruppe wird mit
einem neuen Malonylrest
beladen. Das Enzym ist damit
fr eine neue Runde bereit. Zur
Synthese von Palmitinsure
(C16) luft der Zyklus 7-mal ab;
darauf setzt die Thioesterase-Domne aus Palmityl-ACP
hydrolytisch Palmitinsure frei

17

216

1
2

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

schiebt deren Gleichgewicht ganz auf die Seite des


Produkts.
Bilanzgleichung der Fettsuresynthese aus
Acetyl-CoA:

oxidative Decarboxylierung zu Pyruvat durch das


Malatenzym (Malic enzyme):

3
4
5
6
7
8
9
10
11
12
13
14

ATP-Bedarf fr Fettsuresynthese
Es kostet 7ATP+14NAPDH
(143=42ATP-quivalente), d.h. total 49ATP,
um Palmitinsure (C16) aus 8Acetyl-CoA zu
synthetisieren. Beim Abbau der Palmitinsure
zu CO2 und H2O (Abschn.17.1) werden insgesamt 129ATP gewonnen. Der Organismus
49
100=38% der maxiinvestiert demnach 129
mal mglichen ATP-Ausbeute in das Anlegen
von Fettreserven!

Transportproblem: Die Fettsuresynthese luft im

Cytosol ab, das hierzu bentigte Acetyl-CoA entsteht hingegen in den Mitochondrien (aus Pyruvat
von der Glykolyse oder aus bestimmten Aminosuren) und kann die Mitochondrienmembran
nicht passieren. Lsung des Problems: In der ersten Reaktion des Citratzyklus, katalysiert durch die
Citratsynthase, reagiert Acetyl-CoA mit Oxalacetat
zu Citrat, das durch einen Antiport mit Malat in
das Cytosol bergefhrt wird. Hier gewinnt die
ATP-Citratlyase unter ATP-Verbrauch Acetyl-CoA
zurck:

Diese Reaktion liefert einen Teil des NADPH, welches fr die Fettsuresynthese bentigt wird; den
greren Teil liefert der Pentosephosphatweg. In
intensiv Fettsuren synthetisierenden Geweben finden sich sowohl die Enzyme des Pentosephosphatwegs als auch das Malatenzym.
Terminologie
Sure

Anion

HOOC-CHOH-COOH

pfelsure
Malic acid

Malat
Malate

HOOC-CH=CH-COOH
(cis)

Maleinsure
Maleic acid

Maleat
Maleate

HOOC-CH2-COOH

Malonsure
Malonic acid

Malonat
Malonate

Kettenverlngerung (>C16) und Einfhrung von


Doppelbindungen bentigen zustzliche Enzyme
auf der cytosolischen Seite der ER-Membran Die

Fettsuresynthase bildet nur gesttigte Fettsuren


mit 16 C-Atomen. Die Kohlenwasserstoffkette
wird unter Verwendung von Malonyl-CoA verlngert. Doppelbindungen werden durch die Desaturase eingefhrt:

15
16
17
18
19
20

Desaturase

ber diesen Weg kann Glucose, welche nicht zur


Energiegewinnung in den Mitochondrien abgebaut
wird, fr den Aufbau von Fettsuren und damit
zum Anlegen von Fettreserven verwendet werden.
Die NADH-abhngige Malatdehydrogenase reduziert das in der Citratlyase-Reaktion entstandene
Oxalacetat zu Malat, das durch Antiport mit Citrat
wieder in die Mitochondrien aufgenommen wird.
Ein weiterer Weg fr Malat im Cytosol ist dessen

Das Enzym enthlt FAD, Cytochrom b5 und Nichthm-Eisen und wird den mischfunktionellen Oxidasen zugezhlt: O2 oxidiert zwei Substrate, die
Fettsure und NADPH. Auf eine Hydroxylierung an
C9 folgt eine Wasserabspaltung unter Einfhrung
einer Doppelbindung zwischen C9 und C10. Suger
knnen nur eine C9-C10 (9)-Doppelbindung ein-

217
17.3Ketonkrper

17

fhren. Linolsure (18:2; C18, 2Doppelbindungen)


und Linolensure (18:3) sind daher essenzielle
Fettsuren, die mit der Nahrung zugefhrt werden
mssen. Arachidonsure (20:4) kann hingegen aus
Linolsure gebildet werden.
Der Nachschub an Malonyl-CoA reguliert die
Fettsuresynthese Fettsuren werden syntheti-

siert, wenn der Organismus ber einen berschuss


an Kohlenhydraten verfgt. Die Acetyl-CoA-Carboxylase, das erste Enzym in der Kette der Synthesereaktionen, wird allosterisch durch Citrat, dem
ersten Zwischenprodukt des Citratzyklus, aktiviert.
Citrat kann die Reaktion 25fach beschleunigen.
Eine hohe Citratkonzentration in der Zelle zeigt an,
dass die Zelle ausreichend mit chemischer Energie
versorgt ist. Palmitat hemmt das Enzym als Feedback inhibitor.

17.3 Ketonkrper

Im Hungerzustand und bei Diabetes mellitus (Abschn.34.3) steht den Zellen zu wenig Glucose zur
Verfgung. Unter diesen Bedingungen baut die
Leber Fettsuren zu Ketonkrpern (Acetoacetat,
-Hydroxybutyrat und Aceton) ab und liefert den
peripheren Organen Ketonkrper als Energietrger
anstelle von Glucose.

Die Ketonkrper werden in den Lebermitochondrien synthetisiert, sobald der Fettsure-

abbau mehr Acetyl-CoA liefert, als der Citratzyklus


aufnehmen kann:

Acetyl-CoA +

3-Hydroxy-3-methylglutaryl-CoA
Acetyl-CoA

Die Kondensation von zwei Moleklen Acetyl-CoA


zu Acetoacetyl-CoA, entspricht einer Umkehr des
Thiolyse-Schrittes beim oxidativen Abbau von
Fettsuren. Ein kleinerer Teil des Acetoacetyl-CoA
stammt aus unvollstndigem Abbau ketogener
Aminosuren (Abschn.18.3). Durch Kondensa-

tion mit einem dritten Molekl Acetyl-CoA entsteht


3-Hydoxy-3-methylglutaryl-CoA (ein Zwischenprodukt der Cholesterolbiosynthese; .Abb.17.5),
das durch die HMG-CoA-Lyase in Acetoacetat und
Acetyl-CoA gespalten wird. Aceton entsteht in geringer Menge durch spontane Decarboxylierung

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

218

1
2
3
4

von Acetoacetat. Die Reduktion von Acetoacetat


(Acetessigsure) zu -Hydroxybutyrat (-Hydroxybuttersure) dient der Rckgewinnung von NAD+.
Damit knnen durch -Oxidation fortwhrend
Ketonkrper ins Blut nachgeliefert werden. -Hydroxybutyrat und Acetoacetat sind im Gegensatz zu
den langkettigen Fettsuren wasserlslich und sind
normale Blutbestandteile.
Ernergietrger im Blut

Konzentration (Mensch):

6
7

9
10

12
13
14
15
16
17
18
19
20

5mM

Fettsuren

0,5mM

Ketonkrper

0,2mM

Die Konzentration von Ketonkrpern kann


im Hungerzustand und bei Diabetes mellitus
bis auf 10mM ansteigen. Eine berproduktion von Ketonkrpern, den Carbonsuren
-Hydroxybuttersure (pKa = 4,7) und Acetessigsure (pKa =3,6), fhrt zu einer metabolischen (durch den Stoffwechsel verursachten)
Acidose (bersuerung) des Organismus.

11

Glucose

Fr Skelett- und Herzmuskulatur sind Ketonkrper wichtige Energielieferanten auch unter normalen Bedingungen. Wenn die Versorgung mit
Glucose knapp wird, kann sogar das Gehirn nach
einer Angewhnungsphase, in der die notwendigen Enzyme synthetisiert werden, Ketonkrper zur
Gewinnung von ATP nutzen. Fettsuren kann das
Gehirn hingegen nicht verwenden, weil hierfr die
notwendigen Transportmechanismen fehlen (BlutHirn-Schranke).
Die peripheren Gewebe bauen Ketonkrper in
den Mitochondrien ber folgende Schritte ab:
Reoxidation von -Hydroxybutyrat zu Acetoacetat. Die periphere Zelle gewinnt dabei
NADH, welches der oxidativen Phosphorylierung zur ATP-Gewinnung zugefhrt wird.

Acetoacetat
3-Ketosure-CoA-

Acetoacetyl

Acetoacetyl-CoA wird durch Thiolyse mit CoA


zu 2Acetyl-CoA gespalten, die dem Citratzyklus zugefhrt werden; Succinyl-CoA und Succinat sind Zwischenprodukte des Citratzyklus.

17.4

Synthese und Abbau


der Triacylglycerole

Triacylglycerole (Triacylglycerole, Triglyceride,


Neutralfette) machen bei Mensch und Tier den
Hauptteil der Lipide aus und sind die quantitativ
wichtigste Energiereserve des Krpers.

Triacylglycerole entstehen aus Glycerol-3phosphat und Acyl-CoA Glycerol-3-phosphat

stammt aus der Glykolyse oder aus abgebauten


Nahrungsfetten:

P,

Die Fettsuren stammen aus Nahrungsfetten, abgebauten Krperlipiden oder werden aus Acetyl-CoA
neu synthetisiert; fr die Kondensation mit Glycerol-3-phosphat werden sie unter ATP-Verbrauch
zu Acyl-CoA aktiviert (wie bei der Vorbereitung
zur -Oxidation; Abschn.17.1). Die dreistufige
Synthese von Triacylglycerol wird durch den Triacylglycerolsynthase-Komplex in der Membran
des glatten ER katalysiert:

17

219
17.4 Synthese und Abbau der Triacylglycerole

Zusammensetzung des Krperfetts


Die Fettsurezusammensetzung des Krperfetts ist variabel und hngt in beschrnktem
Ausma von der Art des Nahrungsfetts ab:
Palmitinsure

16:0

20%

Stearinsure

18:0

7%

lsure

18:1

50%

Linolsure

18:2

Andere Fettsuren

10%
13%

Die ungesttigten Fettsuren berwiegen; das


Krperfett muss bei Krpertemperatur flssig
sein!

Der Abbau des Reservefetts wird durch die hormonregulierte Fettgewebelipase eingeleitet

Der Synthasekomplex selbst wird nicht reguliert.


Hingegen aktiviert Insulin (berfluss-Signal) die
Lipoproteinlipase, die aus den Triacylglycerolen der Lipoproteine (Chylomikronen und VLDL;
Abschn.34.4) Fettsuren freisetzt. Die Fettzellen
erhalten damit mehr Fettsuren zur Anlage von
Fettreserven.
.. Abb.17.3 Abbau von Triacylglycerol.
Die im Fettgewebe frei werdenden
Fettsuren werden in anderen Organen,
insbesondere in Muskeln und Leber,
oxidativ abgebaut und versorgen diese
Organe mit chemischer Energie. Glycerol
kann vom Fettgewebe nicht wiederverwendet werden, da dort die Glycerolkinase fehlt, wird aber in der Leber verwendet
zur Synthese von Glucose, polaren Lipiden
und Triacylglycerolen oder auch ber Glykolyse und Citratzyklus oxidativ abgebaut

Die Lipase im Fettgewebe spaltet Triacylglycerole


in Fettsuren, die vorwiegend in Muskulatur und
Leber verwertet werden, und in Glycerol, das von
der Leber weiterverwendet wird (.Abb.17.3). Im
Hungerzustand lsen die Hungersignal-Hormone
Glucagon (-Zellen des Pankreas) und Adrenalin/Noradrenalin (Nebennierenmark) ber ihre
G-Protein-gekoppelten Rezeptoren die erhhte
Bildung von cAMP aus, welches die Proteinkinase
A aktiviert, die ihrerseits die Lipase phosphoryliert
und damit aktiviert (vgl. mit der sehr hnlichen
Aktivierung der Glykogenphosphorylase, die im
Hungerzustand die Kohlenhydratreserve mobilisiert; .Abb.16.4). Das berfluss-Hormon Insulin
(-Zellen des Pankreas) hingegen wirkt antilipolytisch, indem es eine Phosphodiesterase aktiviert,
die cAMP hydrolysiert und damit die lipolytischen
Signale unterdrckt.

1
2
3

220

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

17.5

Stoffwechsel der Phospholipide

Synthese und Abbau von Phospholipiden Zur


Synthese von Phosphatidylcholin wird aktiviertes

Cholin (CDP-Cholin) an Diacylglycerol gekoppelt


(.Abb.17.4). Die Membranlipide werden rasch
umgesetzt (t1/2=12Tage). Ubiquitre Phospholi-

pasen bauen die Phospholipide ab: Zellulre Phos-

pholipasen bauen Membranlipide ab oder produzieren Signalmolekle; Phospholipasen aus dem


Pankreas verdauen Phospholipide aus der Nahrung.
Die Phospholipasen werden nach ihrem Angriffsort
in den Phospholipiden eingeteilt:

4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

von

DurchSpaltung mit Phospholipase A2 entsteht


Lysophosphatidylcholin (Lysolecithin), ein amphiphiles Lipid mit einer einzigen Kohlenwasserstoffkette, das Mizellen bildet, wie ein Detergens
wirkt und biologische Membranen beschdigt. Die
in tierischen Giften (Bienen, Schlangen) vorkommende Phospholipase zerstrt daher, falls sie in den
Blutkreislauf gelangt, die Erythrozytenmembran
(Hmolyse). Ein ganz besonderes Membranlipid ist
Phosphatidylinositol, aus welchem die Phospholipase C zwei wichtige Second messengers bildet: Diacylglycerol (DAG) und Inositol-1,4,5-triphosphat
(IP3) (Abschn.27.2).
Gestrter Abbau von Sphingolipiden fhrt zu
Lipidspeicherkrankheiten Verschiedene lysoso-

male Hydrolasen sind am Abbau der Sphingolipide,


die wie die anderen Phospholipide rege umgesetzt
werden, beteiligt. Bei genetisch bedingtem Fehlen
bestimmter Hydrolasen kommt es zu den typischen
Sphingolipidosen, die zumeist schwere Strungen
der Gehirnentwicklung zur Folge haben, aber auch
andere Organe wie die Leber betreffen knnen. Die
Sphingolipidosen gehren zu den lysosomalen
Speicherkrankheiten.

17.6

Stoffwechsel von Cholesterol

Cholesterol (Cholesterin) ist biochemisch aber


auch medizinisch wichtig :

Der erwachsene menschliche Krper enthlt


140g Cholesterol; der hchste Gehalt (10% des
Organgewichts) findet sich in der Nebennierenrinde (Steroidsynthese!).
Cholesterol ist ein Bestandteil eukaryontischer
Membranen; bei Prokaryonten und in der
inneren Mitochondrienmembran kommt es
hingegen nicht vor. Eukaryontische Zellen,
welche wegen eines Stoffwechseldefekts kein
Cholesterol synthetisieren, neigen zu rascher
Lyse.
Cholesterol entspricht 50% der Gesamtlipide
in den Myelinscheiden der weien Hirnsubstanz.
Cholesterol ist Vorlufersubstanz von Gallensuren, Steroidhormonen und Provitamin D.
Cholesterol-Ablagerungen in den Gefwnden sind ein Teilaspekt der Arteriosklerose.
Gallensteine bestehen zum grten Teil aus
dem praktisch wasserunlslichen Cholesterol.

Cholesterol wird wie Fettsuren aus Acetyl-CoA


synthetisiert In einer ersten Synthesephase kon-

densieren 3Molekle Acetyl-CoA zu einer C6-Verbindung, die nach Decarboxylierung eine aktivierte

221
17.6 Stoffwechsel von Cholesterol

.. Abb.17.4 Synthese von Phosphatidylcholin

17

222

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

C5-Verbindung liefert. Weitere Kondensationen


ergeben Cholesterol und seine Derivate:

Acetyl-CoA (C2)

Mevalonat (C6)

Ubichinon

4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Isopentenyldiphosphat (C5)

In Bakterien und
Pflanzen: Vitamin A, K, E;
Kautschuk

Cholesterol
Vitamin D

Gallensuren
Progesteron

Cortisol

Oestradiol

Aldosteron

Pro Tag synthetisiert der erwachsene menschliche


Organismus 1g Cholesterol, bei gemischter Kost
werden zudem 0,3g aus tierischen Nahrungsmitteln
aufgenommen. Die erste Synthesephase geht von
Acetyl-CoA ber 3-Hydroxy-3-methylglutaryl-CoA
(HMG-CoA, ein Zwischenprodukt der Ketonkrpersynthese; Abschn.17.3) zur C5-Verbindung
Isopentenyldiphosphat (.Abb.17.5).
Statine hemmen Cholesterolsynthese
Die HMG-CoA-Reduktase (.Abb.17.5) ist das
Zielenzym von Medikamenten zur Senkung
der Cholesterolproduktion. Die Statine sind
Strukturanaloge von Mevalonat und damit
kompetitive Hemmstoffe der HMG-CoA-Reduktase.

.. Abb.17.5 Synthese von Cholesterol, PhaseI: vom


Acetyl-CoA zum Isopentenyldiphosphat. Der erste Schritt entspricht einer Umkehr der Thiolyse und ist reversibel. Die Thiolase kommt nicht nur in den Mitochondrien sondern auch im
Cytosol vor. Der zweite und der dritte Schritt sind irreversibel.
Der dritte Schritt, die Synthese von Mevalonsure, stellt
die Weiche in Richtung Cholesterol. In den Mitochondrien
werden aus 3-Hydroxy-3-methylglutaryl-CoA der Ketonkrper
Acetoacetat und Acetyl-CoA produziert (Abschn.17.3), im
Cytosol hingegen wird HMG-CoA zu Mevalonat reduziert, das
ber drei ATP-abhngige Reaktionen und einer damit verbundenen Decarboxylierung zu Isopentyldiphosphat umgewandelt wird. Die Polymerisierung dieser aktivierten Isopreneinheit (C5) mit ihrer Doppelbindung fhrt zur Synthese einer
Reihe biologisch wichtiger Verbindungen, einschlielich des
Cholesterols (.Abb.17.6)

223
17.6 Stoffwechsel von Cholesterol

In der zweiten Phase der Cholesterolsynthese wird


zunchst ein offenkettiges Polymer von Isopentenyldiphosphat aufgebaut, worauf oxidative Demethylierungen zu den Ringschlssen fhren
(.Abb.17.6). Bei den Reduktionsschritten beider
Synthesephasen dient vom Pentosephosphatweg
geliefertes NADPH als Reduktionsmittel.

C5 -PP
C5 -PP

Cholesterol wird nicht abgebaut, es kann


nur ausgeschieden werden Das Cholesterol

wird im Blut durch Lipoproteine (Abschn.34.4)


transportiert. Vom Gesamtcholesterol im Plasma
(Normalwert<5mM=214mg/100mL) sind zwei
Drittel mit ungesttigten Fettsuren verestert, ein
Drittel ist freies Cholesterol. Cholesterol kann nicht
wie Glucose oder Fettsuren zur ATP-Gewinnung
abgebaut werden. Es wird entweder in Gallensuren
oder Steroidhormone umgewandelt oder mit der
Galle (20% als Cholesterol und80% als Gallensuren) ausgeschieden.

C5 -PP

C15 -PP

C15 -PP

Die Cholesterolsynthese wird ber die HMGCoA-Reduktase reguliert Der wichtigste Regu-

lationsmechanismus betrifft die Transkription des


HMG-CoA-Reduktase-Gens. Dieses Gen wie auch
die Gene weiterer am Cholesterolstoffwechsel beteiligter Proteine, einschlielich des LDL-Rezeptors
(Abschn.34.4), enthalten ein Sterol-regulatory
element (SRE) im Promotor. Bei niedriger Cholesterolkonzentration setzt das ER den entsprechenden Transkriptionsfaktor, das SRE-Bindungsprotein
frei, dessen Binden ans SRE die Transkription des
HMG-CoA-Reduktase-Gens in Gang setzt. Bei hoher Cholesterolkonzentration hingegen verhindern
Sterolsensor-Proteine die Freisetzung des SRE-Bindungsproteins.
Zudem regulieren Hormone die katalytische
Aktivitt der HMG-CoA-Reduktase: Glucagon er.. Abb.17.6 Synthese von Cholesterol, PhaseII: Polymerisierung von Isopentenyldiphosphat und Ringschlsse. Durch
Kopf-Schwanz-Polymerisierung von 3Moleklen Isopentenyldiphosphat entsteht eine aktivierte C15-Verbindung (Farnesyldiphosphat), wovon 2Molekle Kopf-Kopf verbunden
werden zu Squalen (C30). Bei allen Polymerisierungsschritten
wird Pyrophosphat (PPi) freigesetzt, das darauf hydrolysiert
wird (nicht angegeben). Bei jedem Schritt werden demgem
2 energiereiche Phosphatbindungen (bei der Synthese von
Squalen sogar deren 4) gespalten, um die Reaktionen zum
Ablaufen zu bringen. Drei oxidative Demethylierungsschritte
fhren zu den Ringschlssen und damit zu Cholesterol (C27)

C30

C27

17

Kapitel 17 Stoffwechsel der Fettsuren und Lipide

224

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

hht die Produktion von cAMP, die nachgeschaltete


Proteinkinase A phosphoryliert und inaktiviert die
HMG-CoA-Reduktase; Insulin hat die entgegengesetzte Wirkung.
Hypercholesterolmie und Arteriosklerose
Die Konzentration von Cholesterol im
Blutplasma korreliert mit der Hufigkeit des
Auftretens von Cholesteroleinlagerungen in
Arterienwnde (ein Teilaspekt der Arterio
sklerose) und mit dadurch bedingten Verengungen und Verschlssen der Koronararterien.
Zur Senkung der Cholesterolkonzentration im
Blutplasma bestehen folgende Mglichkeiten:
Verminderung der Cholesterolaufnahme
durch cholesterolarme Ernhrung,
Hemmung der HMG-CoA-Reduktase durch
Statine,
Steigerung der Ausscheidung von Gallensuren durch Hemmung von deren Rckresorption aus dem Darm (Gallensuren
bindende Ionenaustauscher).

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517045-0
17.1 -Oxidation der Fettsuren
17.2 Fettsuresynthese
17.3 Ketonkrper
17.4 Synthese und Abbau der Triacylglycerole
17.5 Stoffwechsel der Phospholipide
17.6 Stoffwechsel von Cholesterol
Weiterfhrende Literatur

225

Stoffwechsel der Proteine


und Aminosuren
Ph. Christen, R. Jaussi, R. Benoit

18.1

Abbau von Proteinen 226

18.2

Abbau der Aminosuren: Weg des Stickstoffs 228

18.3

Abbau der Aminosuren: Weg des Kohlenstoffs 232

18.4

Strungen im Abbau der Aminosuren 237

18.5

Synthese der Aminosuren 238

18.6 C1-Stoffwechsel239
18.7

Synthese von Kreatin und Porphyrinen


aus Aminosuren243

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_18, Springer-Verlag Berlin Heidelberg 2016

18

226

1
2
3

Der Abbau von Nahrungsproteinen und krpereigenen Proteinen speist den Aminosuren-Pool des
Organismus. berschssige Aminosuren knnen
nicht wie Glucose und Fettsuren als Reserve angelegt werden; sie werden zur Energiegewinnung abgebaut oder zu anderen Energietrgern umgebaut:
Krpereigene
Proteine

4
5

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

CO2 + H2O oder Glucose,


Ketonkrper, Fettsuren
Nahrungsproteine

Aminosurenpool
Harnstoff

6
Biogene Amine,
Polyamine

7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die krpereigenen Proteine werden fortwhrend


umgesetzt (beim Menschen 12% des Gesamtproteins pro Tag). Der Abbau erfolgt in spezialisierten,
vom Rest der Zelle abgeschotteten Rumen: Die
membranumschlossenen Lysosomen besorgen den
generellen, nichtselektiven Abbau und im Innern
groer Proteinabbaumaschinen, der Proteasomen,
findet der Ubiquitin-kontrollierte, ATP-verbrauchende Abbau schadhafter Proteine statt.
Viele Enzyme des Aminosurestoffwechsels bentigen Pyridoxal-5-phosphat, ein Vitamin B6-Derivat, als prosthetische Gruppe. Die Phenylketonurie ist der hufigste der zahlreichen genetischen
Enzymdefekte im Aminosurestoffwechsel.
Aminosuren sind nicht nur die Bausteine von
Peptiden und Proteinen sondern auch Ausgangssubstanzen zur Synthese mannigfaltiger niedermolekularer stickstoffhaltiger Verbindungen mit
wichtigen Funktionen: biogene Amine, Polyamine,

weitere Signalmolekle und gewisse Hormone,


Stickstoffmonoxid (NO), Kreatin und Porphyrine.
18.1

Abbau von Proteinen

Proteine werden wie alle anderen biologischen


Makromolekle hydrolytisch abgebaut Die

Enzyme, welche Peptidbindungen spalten, werden


als Proteasen oder Peptidasen bezeichnet. Endopeptidasen spalten Peptidbindungen im Inneren von Polypeptidketten; Exopeptidasen spalten

Aminosuren vom NH2-Ende (Aminopeptidasen)


oder vom COOH-Ende (Carboxypeptidasen) ab.
Extrazellulre Proteasen finden sich unter den Verdauungsenzymen im Darm und als so genannte
Matrixproteasen in der extrazellulren Matrix; zudem erfllen sie besondere Funktionen, z.B. bei
der Blutgerinnung. Intrazellulre Proteasen kommen in allen Zellkompartimenten vor und bauen
die zelleigenen Proteine ab. Besondere Peptidasen
entfernen von Proteinen die zielbestimmenden
Prpeptide (Abschn.22.3) und die aktivittssupprimierenden Propeptide (Abschn.25.3 und
33.1). Die Proteine im Blutplasma werden intrazellulr abgebaut, das nichtglykosylierte Serumalbumin in den Nieren, die glykosylierten Plasmaproteine in der Leber.
Lysosomen bauen Proteine nichtselektiv und
ATP-unabhngig ab Die Lysosomen enthalten

etwa 50 verschiedene Hydrolasen, darunter eine


Reihe von Proteasen, die Cathepsine. Dem pH-Wert
in den Lysosomen entsprechend liegt das pH-Optimum der lysosomalen Hydrolasen bei pH5. Das
tiefe pH-Optimum schtzt die Zelle: Allenfalls
aus den Lysosomen ausgetretene Enzyme sind im
Cytosol bei pH 7 inaktiv. Lysosomen bauen Zellbestandteile und von auen aufgenommenes Material ab, indem sie mit membranumschlossenen
Teilen im Cytosol (Vesikeln, Endosomen und Phagosomen) fusionieren und deren gesamten Inhalt
verdauen. Lysosomen sind verantwortlich fr den
erhhten Abbau von Proteinen zur Gluconeogenese im Hungerzustand, den Muskelschwund bei
krperlicher Inaktivitt sowie das entwicklungsbedingte Einschmelzen von Organen wie Kaulquappenschwnzen oder die drastische Massenabnahme
des Uterus nach der Entbindung.

Proteasomen bauen fr den Abbau markierte


Proteine ab Diese Proteinabbaumaschinen neh-

men nur Proteine auf, die strukturell beschdigt


sind durch Mutation, fehlerhafte Synthese oder
Faltung, molekulare Alterungsvorgnge (Oxidation, Desamidierung u.a.m.) oder schdigende
Agenzien. Ein ATP-verbrauchendes Enzymsystem
identifiziert die schadhaften Proteinmolekle und
markiert sie mit Ubiquitin, einem Protein von nur
76Aminosureresten, das bei Eukaryonten in allen Zellen (ubiquitr) vorkommt. Dabei wird die
-Carboxylgruppe des Ubiquitins ber eine Amid-

227
18.1 Abbau von Proteinen

18

.. Abb.18.1 Das Proteasom ist ein


17nm langer Multiproteinkomplex
mit einem Durchmesser von 11nm
und einer Masse von 700kDa. Vier
aufeinander gestapelte Ringe von je
7Untereinheiten bilden einen zentralen 20S-Hohlzylinder, in welchem
die eingebrachten Proteine zu kleinen
Peptiden abgebaut werden. Die
kontrollierte Zufuhr der abzubauenden, mit Ubiquitin markierten Proteine
erfolgt durch die ATP-hydrolysierenden
19S-Kappen, auf einer oder auch beiden Seiten des Zylinders. Ubiquitinierungsenzyme und molekulare Chaperone sind die Zubringer beschdigter
Proteine und binden vorbergehend
an die Kappe

bindung an die -Aminogruppe von Lysinresten des


abzubauenden Proteins gebunden:

nicht-proteolytischen Regulation mannigfalti-

ger Prozesse wie Histonmodifikation oder Vesikeltransport.


Konservatives Ubiquitin

An einen Lysinrest (z.B. Lys48) des ersten angehefteten Ubiquitinmolekls kann ein zweites Ubiquitinmolekl auf gleiche Weise angehngt werden,
blicherweise wird eine Kette von 4Ubiquitinmolekle gebildet, um das Abbausignal zu verstrken. An einem Zielprotein knnen auch mehrere
Ubiquitinketten angebracht werden (Polyubiquitinylierung).
Der ubiquitinkontrollierte Abbau von Proteinen durch Proteasomen ist besonders wichtig bei
der Regulation des Zellzyklus (Abschn.24.3)
und bei der angeborenen Immunabwehr (Abschn.32.1). Zudem ist Ubiquitin beteiligt bei der

Die Aminosuresequenz von Ubiquitin ist


hochkonserviert: Sie ist bei Mensch und
Drosophila identisch und nur in 3Positionen
verschieden bei Hefe.

Das Proteasom hat eine fasshnliche Struktur


(.Abb.18.1, ). Die proteolytisch aktiven Stellen liegen im Innern des Fasses. Zustzliche Proteinkomplexe kontrollieren beide Zugnge: Nur
ubiquitinierte Proteine werden erkannt und unter
ATP-Verbrauch sowie Entfernung der Ubiquitinreste ins Innere der Proteasomen aufgenommen, wo
sie in kleine Peptide von 78Aminosureresten zerlegt werden. Die abgespaltenen Ubiquitinmolekle
werden rezykliert. Proteasomen mit etwas einfa-

228

1
2
3
4

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

cherem Bau und ohne Ubiquitinkontrolle kommen


auch in Prokaryonten vor.
18.2

Abbau der Aminosuren: Weg


des Stickstoffs

Das Endprodukt des intrazellulren Abbaus von


Proteinen wie auch der Verdauung von Proteinen

im Darm sind Aminosuren. Die freien Aminosuren im Organismus (beim erwachsenen


Menschen nur 70g) dienen zur Synthese von
Proteinen und anderen N-haltigen Verbindungen
oder werden zur Energiegewinnung verwendet;
bei proteinreicher Ernhrung und im Endstadium des Hungerzustands, wenn die Fettreserven
erschpft sind, werden Aminosuren vermehrt
abgebaut.

5
6
7
8
9

Polyamine

10
11
12
13
14

Transaminierungsreaktionen sind an Synthese


und Abbau von Aminosuren beteiligt Bei ei-

ner Transaminierung wird die Aminogruppe einer


Aminosure auf eine -Ketosure bertragen:

Aminosure + -Ketosure

-Ketosure + Glutamat

Aminosure + Oxalacetat

-Ketosure + Asparat

Eine weitere Transaminierungsreaktion verbindet


diese beiden Reaktionen:
Asparat + -Ketosure

15

Oxalacetat + Glutamat

16
17
18
19
20

Reaktionen dieser Art werden durch Aminotransferasen (Transaminasen nach der lteren Nomenklatur) katalysiert, die alle Pyridoxal-5-phosphat
als prosthetische Gruppe verwenden (.Abb.18.2).
Die wichtigsten Transaminierungsreaktionen sind
die bertragungen der Aminogruppe einer Aminosure entweder auf -Ketoglutarat oder auf Oxalacetat unter Bildung von Glutamat bzw. Aspartat:

DieAminogruppen berschssiger Aminosuren knnen durch Transaminierung zur Synthese


mangelnder Aminosuren aus den entsprechenden
-Ketosuren verwendet werden. Transaminierungsreaktionen verbinden den Aminosurestoffwechsel ber die Ketosuren des Citratzyklus
mit dem Kohlenhydratstoffwechsel. Beim Abbau
der Aminosuren erlauben Transaminierungen,
die Aminogruppen verschiedenster Aminosuren
auf die Ketosuren des Citratzyklus (-Ketogluta-

229
18.2 Abbau der Aminosuren: Weg des Stickstoffs

18

-Ketoglutarat
.. Abb.18.2 Mechanismus der Transaminierung durch Pyridoxal-5-phosphat (PLP)-abhngige Aminotransferasen (Beispiel:
Alanin-Aminotransferase). In allen PLP-abhngigen Enzymen ist PLP ber eine Iminbindung (Schiff-Base) mit der -Aminogruppe eines Lysinrests an der aktiven Stelle kovalent verbunden. Der erste Reaktionsschritt der ersten Halbreaktion ist eine
Transaminierung: Die -Aminogruppe wird gegen die -Aminogruppe der Aminosure (das erste Substrat, Alanin im gezeigten
Beispiel der Alanin-Aminotransferase) ausgetauscht. Es entsteht eine Aldimin-Zwischenverbindung (Hydrolyse wrde einen
Aldehyd, nmlich PLP, liefern, daher die Bezeichnung Aldimin). Darauf wird ein Proton von C der Aminosure auf C4 des Co
enzyms verschoben, wodurch eine Ketimin-Zwischenverbindung entsteht. Hydrolytische Spaltung der neu entstandenen Doppelbindung zwischen C und N ergibt das erste Produkt, die -Ketosure, welche dem Aminosuresubstrat entspricht, sowie
die Aminform des Coenzyms, Pyridoxamin-5-phosphat. Damit ist die erste Halbreaktion der Transaminierung abgeschlossen.
Die zweite Halbreaktion entspricht einer Umkehr der ersten, allerdings mit einer anderen -Ketosure und damit auch einer
anderen Aminosure. Hier reagiert die Pyridoxaminform der Aminotransferase mit -Ketoglutarat zur Ketimin-Zwischenverbindung. Daraus entsteht durch Protonenverschiebung und nachfolgende Transaminierung das Aminosureprodukt Glutamat
und das Enzym im Ausgangszustand. Alle Teilreaktionen sind reversibel. Das Schema zeigt nur die Wechselwirkungen zwischen
dem Coenzym und den Substraten. Das Apoenzym, der Proteinteil des Enzyms, ist verantwortlich nicht nur fr eine zustzliche
Beschleunigung der einzelnen Reaktionsschritte, insbesondere der Protonenverschiebungen durch allgemeine Sure-Basen
katalyse, sondern auch fr die Substrat- und Reaktionsspezifitt des Enzyms

230

1
2

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

rat, Oxalacetat) zu bertragen und damit Glutamat


und Aspartat zu produzieren, die ihrerseits die
Aminogruppen fr die Synthese von Harnstoff liefern. Glutamat und Aspartat werden dadurch zum

3
4
5
6
7
8
9

Transaminierung
Aminosure
Aminosurespezifische
Aminotransferase
-Ketoglutarat

Sammelbecken der Aminogruppen aus anderen

Aminosuren.
Durch Koppelung mit Transaminierungsreaktionen wird die oxidative Desaminierung zum
Hauptweg fr die Bildung von Ammoniak:

Oxidative
Desaminierung
-Ketoglutarat

NH4+
NADH + H+

Harnstoff
Atmungskette

GlutamatDehydrogenase

Glutamat

H2O
NAD+

Glutamin dient als ungiftige Speicherund Transportform von NHC


4 Ammoniak

zentration im Blut 3040M) ist stark toxisch und


wird entgiftet, indem Glutamat unter ATP-Verbrauch zu Glutamin amidiert wird:

Glutamin ist ein Proteinbaustein und dient auch als


Quelle von N-Atomen zur Synthese von Pyrimidin- und Purinbasen sowie Aminozuckern. Durch
hydrolytische Spaltung der Amidbindung (Desamidierung) wird NHC
4 aus Glutamin bei Bedarf wieder
freigesetzt:

Vertebraten (Fischen und Amphibien vor der Metamorphose). Die schlecht wasserlsliche Harnsure
(ein Purin; Abschn.7.2) ist das Abbauprodukt
bei Sauropsiden (Reptilien und Vgel; weier Vogeldreck besteht aus fast reiner Harnsure). Suger
und Amphibien nach der Metamorphose eliminieren ber vier aufeinander folgende Vorgnge den
Stickstoff der Aminosuren als sehr gut wasserlslichen Harnstoff:
1. Verschiebung der -Aminogruppe auf -Ketoglutarat (Transaminierung),
2. Abspaltung der Aminogruppe aus dem entstandenen Glutamat (oxidative Desaminierung),
3. Bildung einer ungiftigen Transportform des
freigesetzten Ammoniaks (Glutamin),
4. Bildung eines harnfhigen N-haltigen Ausscheidungsprodukts (Harnstoff).

C
(NHC
4 NH3 C H I pKa D 9;25 , Normalkon-

10
11
12
13
14
15
16
17
18
19
20

Vertebraten benutzen drei verschiedene Wege


zur Ausscheidung des Stickstoffs von Aminosuren Beim Abbau von Aminosuren stellt sich das

Problem der berfhrung der N-haltigen Gruppen in ausscheidungsfhige energiearme Abbauprodukte. Eine direkte Ausscheidung von NHC
4
durch die Haut findet sich nur bei wasserlebenden

231
18.2 Abbau der Aminosuren: Weg des Stickstoffs

18

.. Abb.18.3 Harnstoffzyklus. Die Bildung von Carbamoylphosphat und dessen Kondensation mit Ornithin zu Citrullin findet in
der mitochondrialen Matrix statt. Die anderen Reaktionen des Zyklus laufen im Cytosol ab. Carbamoylphosphat ist eine aktivierte
Form (gemischtes Sureanhybrid) der Carbaminsure (H2NCOOH), zu deren Bildung 2ATP verbraucht werden. Die mitochondriale Carbamoylphosphat-Synthase I braucht NHC
4 als Substrat, whrend die an der Synthese von Pyrimidinnucleotiden (Abschn.19.2) beteiligte cytosolische Carbamoylphosphat-Synthase II die Amidgruppe von Glutamin verwendet. Die Kondensation
von Citrullin und Aspartat verbraucht nochmals 2 energiereiche Phosphatbindungen. Das aus Argininosuccinat eliminierte
Fumarat kann ber einen nebengeschalteten Zyklus zu Aspartat zurckverwandelt werden. Daran beteiligt sind Reaktionen des
Citratzyklus (FumaratMalatOxalacetat) und die Transaminierung von Glutamat und Oxalacetat. Arginin ist der unmittelbare
Vorlufer von Harnstoff. Die Arginase spaltet die Amidingruppe hydrolytisch ab, es entsteht Isoharnstoff (nicht gezeigt), der
spontan zu Harnstoff tautomerisiert. Ornithin ist als C5-Diaminocarbonsure das nchstniedrigere Homolog von Lysin (C6).
Pro Zyklus werden 4 energiereiche Phosphatbindungen gespalten: Die Entsorgung hat ihren Preis!

Die Leber, das Hauptorgan des Aminosurenstoffwechsels, synthetisiert den Harnstoff durch eine
zyklische Reaktionsfolge, den Harnstoffzyklus

(Ornithinzyklus; .Abb.18.3). Der grte Teil der



NHC
4 -Ionen, welche zusammen mit HCO3 Carbamoylphosphat bilden, stammt aus der oxidativen

232

1
2
3
4

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

Desaminierung von Glutamat sowie aus der Desamidierung von Glutamin, der Transportform von
Ammoniak, d.h. ursprnglich wiederum aus Glutamat. Die beiden N-Atome des Harnstoffs stammen
demnach einerseits aus Glutamat und andererseits
aus Aspartat, d.h. aus den zwei Aminosuren, die
durch Transaminierung der entsprechenden -Ketosuren (-Ketoglutarat bzw. Oxalacetat) mit verschiedenen anderen Aminosuren entstanden sind:

5
6
7

18.3

Abbau der Aminosuren: Weg


des Kohlenstoffs

Die strukturelle Vielfalt der 20 proteinogenen Aminosuren fhrt zu unterschiedlichen Abbauwegen,


die sich aber grundstzlich hnlich sind. Die folgenden Teilschritte finden sich beim Abbau aller
Aminosuren:
1. Entfernen der Aminogruppe durch Transaminierung oder oxidative Desaminierung (die Aminosure wird zur entsprechenden Ketosure),
2. Einschleusen des zurckbleibenden C-Skeletts
in Glykolyse oder Citratzyklus,
3. Je nach Stoffwechsellage Abbau zu CO2 und H2O
bzw. Umbau zu Glucose (Gluconeogenese) oder
Fettsuren.
Aminosuren sind glucogen oder ketogen oder
beides Die drei einfachsten Flle:

8
9

-Ketoglutarat

10
11

-Ketoglutarat

12
13
14
15
16
17
18
19
20

-Ketoglutarat

Harnstoffzyklus
Der Harnstoffzyklus wurde 1932 von Hans
Krebs, der damals klinischer Assistent in
Freiberg i. B. war, und Kurt Henseleit, einem
Medizinstudenten, als erster zyklischer Stoffwechselweg beschrieben. Fnf Jahre spter,
in Sheffield, England, fand Hans Krebs den
Citratzyklus, auch Krebszyklus genannt.

Alle drei Produkte (Pyruvat, Oxalacetat und -Ketoglutarat) knnen zur Gluconeogenese verwendet
werden. Die Abbauwege der brigen in Proteinen
vorkommenden Aminosuren sind komplizierter.
Insgesamt werden aus den 20Aminosuren 7 verschiedene Abbauprodukte gebildet, wovon 5 (Pyruvat, Oxalacetat, -Ketoglutarat, Succinyl-CoA und
Fumarat) der Gluconeogenese zugefhrt werden
knnen. Die Aminosuren, deren Abbau eines dieser Zwischenprodukte liefert, werden als glucogene
Aminosuren bezeichnet. Mit Ausnahme von Lysin
und Leucin sind alle 20 proteinogenen Aminosuren
glucogen (.Abb.18.4); sie sind damit die wichtigsten Ausgangsstoffe fr die Gluconeogenese sowie
fr die anaplerotischen Reaktionen des Citratzyklus.
Ketogene Aminosuren liefern als Abbauprodukte
Acetoacetat, einen Ketonkrper, und Acetyl-CoA,
woraus sich Ketonkrper synthetisieren lassen. Ketonkrper knnen im tierischen Organismus nicht

233
18.3 Abbau der Aminosuren: Weg des Kohlenstoffs

18

-Ketoglutarat

.. Abb.18.4 Glucogene und ketogene Aminosuren. Das C-Skelett aller 20 proteinogenen Aminosuren kann zu CO2 und H2O
abgebaut werden. Aus den meisten Aminosuren kann Glucose gewonnen werden; bei einigen dieser glucogenen Aminosuren (den blau umrandeten) wird ein Teil des Molekls zu Acetyl-CoA oder Acetoacetat abgebaut, die in Lipide und Ketonkrper
umgewandelt werden knnen. Von den ketogenen Aminosuren liefern Isoleucin und die aromatischen Aminosuren (schwarz
umrandet) neben Acetyl-CoA auch Zwischenprodukte der Gluconeogenese. Ausschlielich ketogen sind einzig Leucin und Lysin

zu Kohlenhydrat, jedoch zu Lipiden umgebaut


werden. Ausschlielich ketogen sind nur Leucin
und Lysin. Sowohl glucogen als auch ketogen sind
Phenylalanin, Tyrosin, Tryptophan und Isoleucin.
Die C-Skelette aller Aminosuren knnen natrlich
auch, statt zu Glucose bzw. zu Lipiden umgebaut
zu werden, zu CO2 und H2O abgebaut und direkt
zur ATP-Gewinnung genutzt werden (.Abb.18.4).
Der Stoffwechsel von Phenylalanin und Tyrosin
wird im Folgenden wegen seiner biologisch-medizinischen Bedeutung ausfhrlicher dargestellt.

Phenylalanin wird durch eine mischfunktionelle Oxidase zu Tyrosin hydroxyliert:

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

234

1
2
3

In der Reaktion der Phenylalanin-4-monooxygenase (Phenylalaninhydroxylase ) stammt das


Sauerstoffatom der neu eingefhrten Hydroxylgruppe des Tyrosins aus molekularem Sauerstoff.
Das reaktionstrge O2-Molekl wird reduktiv

gespalten und aktiviert, indem das zweite Sauerstoffatom in einer stark exergonischen Reaktion zu
H2O reduziert wird. Die reduzierenden H-Atome
stammen aus dem Cofaktor Tetrahydrobiopterin
(BH4):

Phenylalaninhydroxylase

4
5
6
Dihydrobiopterin-

7
8
9
10
11
12
13
14
15
16
17
18
19
20

Terminologie
Hydroxylase, Monooxygenase, mischfunktionelle Oxidase: Die beiden O-Atome von molekularem O2 oxidieren einerseits das Substrat
und andererseits einen H-bertrger (s. auch
Fettsure-Desaturase; Abschn.17.2).
Tetrahydrobiopterin: Die Pterine wurden als
Farbstoffe in Schmetterlingsflgeln entdeckt.
Wie bei der Reaktion der Phenylalanin-Hydroxylase fungiert BH4 als Cosubstrat bei einer
Reihe weiterer Hydroxylierungsreaktionen:
TyrosinDopa,
Tryptophan5-Hydroxytryptophan,
ArgininN-HydroxyargininCitrullin+NO.
(Die NO-Synthase katalysiert diese
NO-produzierende Reaktionsfolge, an
beiden Teilreaktionen ist BH4 beteiligt.)

--

Tyrosin ist glucogen und ketogen Der oxidative


Abbau fhrt zu glucogenem Fumarat und dem Ketonkrper Acetoacetat (.Abb.18.5).
Tyrosin ist ein Vorlufer von Catecholaminen Die Tyrosin-3-monooxygenase (Tyrosinhydroxylase), ein der Phenylalaninhydroxylase ho-

mologes BH4-abhngiges Enzym, hydroxyliert


Tyrosin zu Dopa (Dioxyphenylalanin, ltere Bezeichnung fr 3,4-Dihydroxyphenylalanin). Die
Decarboxylierung von Dopa und anderer (z.T.

ebenfalls hydroxylierter) Aminosuren durch Pyridoxal-5-phosphat-abhngige Decarboxylasen


produziert Dopamin und weitere biogene Amine,
die als Neurotransmitter, Hormone und Mediatoren
wirksam sind (Abschn.28.3 und 29.1):
;

(Neurotransmitter, Gewebehormon)

(inhibitorischer Neurotransmitter)
;
Gewebehormon, beteiligt an allergischen Reaktionen)

Tyrosin ist auch Vorlufer der Melanine Diese


wichtigsten Pigmente der belebten Natur schtzen
Mensch, Tiere, Pilze und Pflanzen vor ionisierender
Ultraviolettstrahlung. Melanin wird durch spezialisierte Zellen, die Melanozyten, produziert und intrazellulr in Melanosomen abgelagert. Melanin findet
sich in zahlreichen Abkmmlingen des Ektoderms
wie Haut, Auge (Iris und Chorioidea), Zentralnervensystem (Substantia nigra) und Haaren. Melanine sind
aromatische Polymere. Sie entstehen aus Tyrosin ber
eine Reaktionsfolge, deren erste zwei Schritte durch
die Tyrosinase katalysiert werden (.Abb.18.6).
Dopachinon kann auch Cystein addieren; Zyklisierung des Addukts und Polymerisierung zusammen mit Indol-5,6-chinon ergibt das gelbe bis

235
18.3 Abbau der Aminosuren: Weg des Kohlenstoffs

.. Abb.18.5 Oxidativer Abbau von Tyrosin. Der


Entfernung der Aminogruppe durch Trans
aminierung folgen zwei Oxidationsschritte mit
molekularem Sauerstoff als Oxidationsmittel, die
zur Ringffnung fhren. Das entstehende Diketon
durchluft eine cis-trans Isomerisierung und wird
darauf hydrolytisch gespalten. Die Endprodukte
sind der Ketonkrper Acetoacetat und Fumarat,
ein Zwischenprodukt des Citratzyklus. Tyrosin
ist daher sowohl ketogen als auch glucogen
(.Abb.18.4). Fehlen der Homogentisat-Dioxygenase fhrt zur Alkaptonurie (Abschn.18.4)

rotbraune Phomelanin oder das rote Trichochrom,


den Farbstoff roter Haare. Der Typ des Melanins
und die Dichte der Melanozyten bestimmen Hautund Augenfarbe.
Genetisch bedingtes Fehlen der Tyrosinase ist
fr den Albinismus verantwortlich. Die betroffenen
Individuen zeigen weie Haut, flachsblondes Haar
und rote Augenfarbe (bei Tieren: weies Fell, weies
Federkleid).

18

-Keto-

Tyrosinase
Die Tyrosinase ist ein Kupferenzym; bei der
Reaktion wechselt das Kupferion seine Valenz.
Das Enzym ist in Pflanzen und Pilzen weit
verbreitet. Tyrosinase-Reaktionen sind auch
verantwortlich fr das Dunkelwerden der
Schnittflchen von pfeln, Bananen, Champignons oder Kartoffeln.

236

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

.. Abb.18.6 Melaninsynthese. Die erste und zweite Reaktion


sind eng miteinander gekoppelt, Dopa ist der Wasserstoffdonor
bei der Hydroxylierung von Tyrosin zu Dopa, die nach dem
allgemeinen Prinzip der Monooxygenase-Reaktionen verluft.
Die Tyrosinase katalysiert beide Reaktionen. Die nachfolgende
Bildung des Indolrings und die Polymerisierung zum Melanin
verlaufen spontan

18

237
18.4 Strungen im Abbau der Aminosuren

decarboxyliertem S-Adenosylmethionin (SAM)


und Spermin aus Spermidin plus decarboxyliertem SAM gebildet; Cadaverin (produziert von
Bakterien, mitverantwortlich fr den Geruch von
verwesendem Fleisch und Fisch) entsteht durch
Decarboxylierung von Lysin:

Polyamine haben wichtige, derzeit noch wenig


verstandene Funktionen Polyamine sind Abbau-

produkte basischer Aminosuren und werden in


pro- und eukaryontischen Zellen gebildet. Putrescin entsteht durch Decarboxylierung von Arginin
und Folgereaktionen oder durch Decarboxylierung
von Ornithin; Spermidin wird aus Putrescin plus
+

H3N
NH3
+

Putrescin

H3N

H2
+
N
NH3
+

Spermidin
+

H3N

H2
+
N

N
+
H2

Spermin
+

H3N

NH3
+

NH3
+

Cadaverin

Polyamine sind unbedingt notwendig fr die Proliferation von Sugerzellen. Sie stabilisieren biologische Membranen und modulieren gewisse Ionenkanle. Mit ihren mehrfachen positiven Ladungen
binden sie an DNA und RNA. Ihre Synthese ist
strikt reguliert.
18.4

Strungen im Abbau
der Aminosuren

Die Alkaptonurie ist eine seltene Stoffwechselanomalie Bei Kleinkindern mit diesem au-

tosomal-rezessiv vererbten Stoffwechseldefekt


(Hufigkeit 1:250000) frben sich urinbenetzte
Windeln spontan schwarz. Das Fehlen der Homogentisat-Dioxygenase (.Abb.18.5) fhrt zu stark
vermehrt ausgeschiedenem Homogentisat, einem
Hydrochinon, das durch Luftsauerstoff in alkalischem Milieu zum schwarzen Chinon oxidiert wird
(fr eine alkalische Reaktion sorgt der Harnstoff im
Urin, der durch die Urease der Bakterien, die sich in

genssten Windeln vermehren, zu Ammoniak und


CO2 hydrolysiert wird). Ablagerungen des Pigments
fhren im mittleren Lebensalter zu degenerativen
Gelenkerkrankungen.
Inborn error of metabolism
Archibald E. Garrod untersuchte zu Beginn des
20.Jahrhunderts die Alkaptonurie und prgte
dabei den Begriff der angeborenen Stoffwechselerkrankung (Inborn error of metabolism), der
ein Enzymdefekt zugrunde liegt.

Phenylketonurie: die hufigste (1:10000) und


wegen ihrer schwerwiegenden Konsequenzen
und der Mglichkeit einer wirksamen Therapie
auch die wichtigste erbliche Strung des Aminosurestoffwechsels Der autosomal-rezessiv
vererbten Krankheit liegt ein Defekt der Phenyl
alaninhydroxylase
zugrunde. Die Folge des

Defekts, eine gestrte Entwicklung des Gehirns, ist


nicht auf eine ungengende Produktion von Tyrosin

238

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

zurckzufhren (bei normaler Ernhrung erhalten


Sugling und Kind gengend Tyrosin), sondern
ergibt sich aus dem Anstauen des Substrats der
Phenylalaninhydroxylase-Reaktion: Phenylalanin,
dessen Konzentration im Blut 1030fach erhht
ist, hemmt den Transport anderer groer neutraler
Aminosuren durch die Blut-Hirn-Schranke. Der
Mangel an Aminosuren fhrt zu ungengender
Synthese von Proteinen und gewisser Neurotransmitter (Catecholamine und Serotonin). Neben
Phenylalanin kommen auch Phenylpyruvat (durch
Transaminierung aus Phenylalanin entstanden)
und weitere Derivate in erhhter Konzentration in
Blut und Urin vor; die erhhte Konzentration von
Phenylpyruvat, einem Phenylketon, im Urin hat der
Krankheit den Namen gegeben.
Die Therapie besteht in einer lebenslangen
phenylalaninarmen Dit und ermglicht, falls sie
frh genug einsetzt, eine normale Entwicklung
des Gehirns. Die Diagnose muss daher so frh wie
mglich gestellt werden. Die Bestimmung der Phenylalaninkonzentration im Blut ist Teil des Neugeborenen-Screenings.
Phenylketonurie-Varianten
ber 400 verschiedene Punktmutationen
sind bekannt, welche eine Phenylketonurie
verursachen. Die meisten Patienten sind
gemischt-heterozygot, d.h. die beiden Allele
tragen verschiedene Mutationen. Es liegen
demnach viele verschiedene Varianten vor. Die
gemessenen Phenylalaninhydroxylase-Aktivitten liegen zwischen totalem Fehlen und
30% des Normalwerts.

Bei einer atypischen Form der Phenylketonurie


(12% der Patienten) liegt der Defekt in der Synthese von Tetrahydrobiopterin (Abschn.18.3),
des Cosubstrats der Phenylalaninhydroxylase. Die
genaue Diagnose ist wichtig, weil diese Patienten
durch Zufuhr des Cofaktors erfolgreich behandelt
werden knnen.

18.5

Synthese der Aminosuren

Pflanzen, Pilze und viele Bakterien knnen alle proteinogenen Aminosuren synthetisieren. Mensch
und Tier mssen gewisse Aminosuren, die essenziellen Aminosuren, mit der Nahrung aufnehmen.
Fr den Menschen sind 9Aminosuren essenziell:
Aminosuren mit verzweigten Seitenketten

Valin, Leucin, Isoleucin

Basische Aminosuren

Lysin, Histidin

Hydroxy-Aminosure

Threonin

Schwefelhaltige
Aminosure

Methionin

Aromatische
Aminosuren

Phenylalanin, Tryptophan

Die 11 nichtessenziellen Aminosuren werden natrlich zum groen Teil ebenfalls aus der Nahrung
bezogen, knnen aber bei Bedarf auch im Organismus gebildet werden. Sehr einfach ist die Synthese
aus den entsprechenden -Ketosuren durch Trans
aminierung, zumeist mit Glutamat als Donor der
Aminogruppe:
PyruvatAlanin,
OxalacetatAspartat,
-KetoglutaratGlutamat,
3-PhosphohydroxypyruvatPhosphoserinSerin.

---

Bei Glutamat besteht auch die Mglichkeit der Synthese durch reduktive Aminierung:
-Ketoglutarat+NH+4+NAD(P)H+H+
Glutamat+NAD(P)++H2O
Es handelt sich hier um die Umkehr der oxidativen Desaminierung. Als Ausnahme unter
den Dehydrogenasen verwendet die Glutamatdehydrogenase sowohl NADPH als auch
NADH.
Aus den obigen nichtessenziellen Aminosuren lassen sich weitere Aminosuren synthetisieren:
Glutamat+NHC
4 +ATPGlutamin+ADP+Pi
(Diese durch die Glutaminsynthetase katalysierte Reaktion ist auch bei der Stickstoffassimilation wichtig, da sie Ammoniak fixiert;
Abschn.21.1.)

239
18.6C1-Stoffwechsel

18

Aspartat+Glutamin+ATPAsparagin+Glutamat+AMP+PPi
(Transamidierung)
GlutamatProlin
(Ringschluss, mehrstufig, ATP- und NAD(P)-
abhngig)
Citrullin+AspartatArginin
(mehrstufig, Reaktionen des Harnstoffzyklus;
.Abb.18.3)
Serin Glycin+Methylen-Tetrahydrofolat
(Diese Reaktion wird durch die Pyridoxal-5-phosphat-abhngige Serin-Hydroxymethyl-Transferase katalysiert. Sie liefert ein
Einkohlenstoff (C1)-Fragment, fr welches
Tetrahydrofolat als bertrger fungiert;
Abschn.18.6)

Synthese aus essenziellen Aminosuren:


Phenylalanin Tyrosin
(Phenylalaninhydroxylase-Reaktion)
Methionin und Serin Schwefelatom bzw.
C-Skelett von Cystein (.Abb.18.8)

Bei der Synthese von Cystein wie auch bei der Synthese von Glycin aus Serin wird ein C1-Fragment
abgespalten und bertragen. Verschiebungen von
C1-Einheiten finden sich auch bei zahlreichen anderen Stoffwechselreaktionen, jedoch nicht in den
bisher besprochenen groen Abbau- und Syntheseketten, sie werden daher gesondert als C1-Stoffwechsel behandelt.
18.6 C 1-Stoffwechsel

Bei der Bildung von Glycin aus Serin wird die abgespaltene Hydroxymethylgruppe von Tetrahydrofolsure bernommen. Auch in anderen Reaktionen
treten an Tetrahydrofolat gebundene C1-Einheiten
auf.
Tetrahydrofolat, der bertrger von C1-Einheiten, leitet sich von Folsure, einem Vitamin,
ab Folat ist biologisch nicht aktiv, es muss ber
zwei Schritte zum aktiven Tetrahydrofolat (FH4) re-

duziert werden:

Die C1-Einheiten kommen in drei verschiedenen


Oxidationsstufen vor, zusammen bilden sie den C1Pool. Den drei Oxidationsstufen (IIII) entsprechen
die folgenden Gruppen (.Abb.18.7):
I

CH3

Methylgruppe (Oxidationsstufe
von Methanol H3COH)

II

CH2

Methylengruppe (Oxidationsstufe
von Formaldehyd HCHO)

III

CH=

Methenylgruppe (Oxidationsstufe
von Ameisensure HCOOH)

CHO

Formylgruppe

CHNH

Formiminogruppe

Die verschiedenen Oxidationsstufen von C1-FH4


liefern C1-Einheiten fr zahlreiche Synthesevorgnge.

S-Adenosylmethionin (SAM) ist wie Methyl-FH4


an Methylierungsreaktionen beteiligt Methionin

ist ein Thioether, der im tierischen Organismus nicht


synthetisiert werden kann. Die an das Schwefelatom
gebundene Methylgruppe ist reaktionstrge, sie wird
aktiviert, d.h. leicht bertragbar auf andere Verbindungen, durch die Bildung einer Sulfoniumverbindung mit Adenosin (.Abb.18.8). Die Umwandlung
von Methionin in Homocystein dient verschiedenen
Zwecken: SAM ist Methylgruppendonor bei zahlreichen Methylierungen, Methionin wird abgebaut und
(nichtessenzielles) Cystein wird synthetisiert.

240

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

.. Abb.18.7 bertragung von C1-Einheiten aus Serin auf Tetrahydrofolat (FH4). Die
Hydroxymethylgruppe des Serins wird
zunchst an N10 des Tetrahydrofolats (FH4)
gebunden, woraus durch Wasserabspaltung
N5, N10-Methylen-FH4 entsteht. Die Spaltung
der C2-C3-Bindung des Serins wird durch
die Serin-Hydroxymethyl-Transferase, ein
Pyridoxal-5-phosphat (PLP)-abhngiges
Enzym katalysiert. Die drei verschiedenen
Oxidationsstufen FH4-gebundener C1-Einheiten knnen ber enzymkatalysierte Reaktionen ineinander umgewandelt werden.
Um Folsure in der Zelle zu halten, wird sie
ber ihren Glutamatrest an Polyglutamat
(Glu6) gebunden

241
18.4 Strungen im Abbau der Aminosuren

18

Serin
4
Cystathionin
-Ketobutyrat

.. Abb.18.8 S-Adenosylmethionin, Methylzyklus und Cysteinsynthese. Der Methylzyklus besteht aus drei Vorgngen:
Bildung von S-Adenosylmethionin (SAM). Bilanzmig werden drei Mol ATP verbraucht, um aus dem Thioether Methionin
ein Mol aktivierter Methylgruppe in Form von SAM, einer reaktionsfhigen Sulfoniumverbindung, zu gewinnen.
bertragung von CHC
3 , ein elektrophiles Carbokation, auf ein Atom mit freiem Elektronenpaar, z.B. ein N-Atom. Dabei entsteht wiederum ein Thioether.
Regeneration von Methionin in zwei Schritten. Nach hydrolytischer Abspaltung von Adenosin wird das entstandene
Homocystein durch N5-Methyl-FH4 zu Methionin methyliert. Die Methioninsynthase (FH4-Homocystein-S-Methyltransferase)
bentigt Cobalamin (Vitamin B12; Abschn.35.3) als prosthetische Gruppe.
Cysteinsynthese: Serin liefert das C-Gerst und Methionin via Homocystein die Sulfhydrylgruppe

242

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

1
2

Methioninsynthase

3
4
5
6
7
8
9
10
11
12

.. Abb.18.9Methyl-FH4-Zyklus und Methylzyklus: Zusammenspiel von Tetrahydrofolat und Cobalamin (Vitamin B12) bei
Methylierungsreaktionen. Das Schema zeigt die bekannten Reaktionen zur Gewinnung von C1-Einheiten aus Serin (.Abb.18.7)
und den Methylzyklus (.Abb.18.8). Die Methylierung von Homocystein zu Methionin ist eine dem Methyl-FH4-Zyklus und dem
Methylzyklus gemeinsame Reaktion; die dafr verantwortliche Methioninsynthase ist ein Cobalamin (Vitamin B12)-abhngiges
Enzym.

Im Methylzyklus (.Abb.18.9) wird die


Methylierung von Homocystein zu Methionin
durch die Methionin-Synthase mit Cobalamin als
prosthetischer Gruppe katalysiert. Damit sind die
SAM-vermittelten Methylierungsreaktionen von
zwei Vitaminen, Folsure und Cobalamin (Vitamin
B12), abhngig. Bei ungengender Aktivitt der Cobalamin-abhngigen Methionin-Synthase wird sich
FH4 als N5-Methyl-FH4 in der Methylfalle (Methyl
or Folate trap) anstauen und dem Stoffwechsel nicht
mehr zur Verfgung stehen. Die Symptome eines
Folsuremangels knnen daher auch die Folge einer
mangelhaften Cobalaminzufuhr sein.

Der wichtigste Lieferant von C1-Einheiten ist


Serin Zwei Quellen fr C1-Einheiten stehen zur

C1-Einheiten sind fr manche Biosynthesen die limitierenden Vorstufen, ohne C1-Einheiten lassen
sich weder Nucleinsuren noch Proteine synthetisieren. C1-Einheiten werden nicht in den Hauptstoffwechselketten gebildet und sind als Mangelware

eine Achillesferse des Stoffwechsels. Die entsprechenden Enzyme sind daher Ziele fr medikamentse Interventionen (Bakteriostatika, Zytostatika;
Abschn.19.4, .Abb.19.5).

Verfgung: Stoffwechselprodukte (Serin, Glycin, Histidin) und mit der Nahrung zugefhrte Verbindungen (Serin, Methionin, Glycin, Histidin, Phospholipide). Serin, die quantitativ wichtigste Quelle, kann
durch Oxidation des Glykolysezwischenprodukts
3-Phoshoglycerat zu 3-Phosphohydroxypyruvat,
gefolgt von Transaminierung zu Phosphoserin und
abschlieender Hydrolyse produziert werden; ber
diesen Weg werden C1-Fragmente aus Kohlenhydrat
gewonnen. Die C1-Einheiten werden auf verschiedenen Oxidationsstufen in den C1-Pool eingeschleust:

13
14
15
16
17
18
19
20

243
18.7 Synthese von Kreatin und Porphyrinen aus Aminosuren

18.7

Synthese von Kreatin


und Porphyrinen aus
Aminosuren

Die Synthese vieler N-haltiger Verbindungen geht


von Aminosuren aus. Beispiele sind die Purin- und
Pyrimidinnucleotide (Kap.19), sowie Kreatin und
Porphyrine, deren Synthesewege im Folgenden besprochen werden.
Kreatinphosphat dient in Muskel- und Nervenzellen als Reserve an energiereichem Phosphat
Kreatinphosphat (in Muskelfasern 1020mM;

Abschn.30.5) dient durch Umkehr der Kreatin-

kinase-Reaktion zur Resynthese von ATP. An der


Synthese von Kreatin sind drei Aminosuren beteiligt (.Abb.18.10). Bei Crustaceen bernimmt Argininphosphat (ebenfalls mit Guanidiniumgruppe)
die Stelle von Kreatinphosphat.

Porphyrine sind prosthetische Gruppen zahlreicher farbiger Proteine Ein Porphyrin-Ringsystem bildet den organischen Teil des Chlorophylls

(Mg2+ als Zentralion) der Pflanzen und photosynthetisierenden Bakterien. Hm, das sich in den zahlreichen Hmproteinen (Hmoglobin, Myoglobin,
Cytochrome, Katalase, Peroxidasen) findet, ist ebenfalls ein Porphyrinderivat (Fe2+/Fe3+ als Zentralion).
Die Synthese von Hm beginnt und endet in den
Mitochondrien mit einem wichtigen Zwischenspiel
im Cytosol (.Abb.18.11). Die (delta-)Aminolvulinat-Synthase, welche die erste Reaktion, die
Bildung von 5-Aminolvulinat aus Glycin und Succinyl-CoA katalysiert, ist das Schrittmacherenzym
des ganzen Synthesewegs. Hmatin (mit Fe3+), das
unter aeroben Bedingungen spontan und sehr rasch
aus nicht an ein Hmprotein gebundenem Hm

.. Abb. 18.10 Synthese von Kreatinphosphat. Glycin liefert


den Kern, an den die Amidiniumgruppe von Arginin angehngt wird, und S-Adenosylmethionin fungiert als Methylgruppen-Donor. Kreatinphosphat bildet spontan Kreatinin,
das Lactam (intramolekulares Amid) von Kreatin. Kreatinin
wird nicht abgebaut, sondern im Urin ausgeschieden
(12 g/24h). Die Menge Kreatinin, die in 24h ausgeschieden
wird, ist proportional zur Muskelmasse und bemerkenswert
konstant fr ein bestimmtes Individuum. Die Bestimmung der
Serumkonzentration von Kreatinin dient daher als einfacher
Nierenfunktionstest (glomerulre Filtrationsrate)

18

244

Kapitel 18 Stoffwechsel der Proteine und Aminosuren

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb. 18.11 Hmsynthese. Ein Teil der Synthesereaktionen findet in den Mitochondrien und ein Teil im Cytosol statt. Aus
Succinyl-CoA, einem Zwischenprodukt des ebenfalls in den Mitochondrien ablaufenden Citratzyklus, entsteht durch Kondensation mit Glycin und nachfolgende Decarboxylierung 5-Aminolvulinat (auch als (delta)-Aminolvulinat bezeichnet). Die
5-Aminolvulinat-Synthase, ein Pyridoxal-5-phosphat-abhngiges Enzym, ist das Schrittmacherenzym des Synthesewegs.
Das Endprodukt Hm, genauer dessen Oxidationsprodukt Hmatin mit Fe3+, wirkt nicht nur als allosterischer Rckkoppelungshemmer dieses Enzyms, sondern reprimiert auch dessen Synthese. Im Cytosol kondensieren zwei Aminolvulinat-Molekle zu
Porphobilinogen mit einem Pyrrolring. Die nchsten Schritte fhren zum zyklischen Tetrapyrrol, dabei werden die Aminogruppen abgespalten. Das entstehende farblose Uroporphyrinogen III wird durch die Einfhrung weiterer Doppelbindungen und
Decarboxylierung zu Protoporphyrin IX, das nun ein durchkonjugiertes System von Doppelbindungen aufweist und daher die
typische rote Farbe zeigt. Die Seitenketten sind mit zwei Ausnahmen nicht mehr polar und erlauben die Einbettung des Hms
ins apolare Innere von Proteinen. Zum Schluss baut ein besonderes Enzym, die Ferrochelatase, Fe2+ als Zentralatom in den
Porphyrinring ein. Das damit entstandene Hm b findet sich im Hmoglobin, Myoglobin und manchen Oxidoreduktasen, wo
es nichtkovalent ans Protein gebunden ist

(Fe2+) entsteht, wirkt nicht nur als allosterischer


Inhibitor der Synthase, sondern hemmt auch die
Transkription des Gens dieses Enzyms: eine gleich
doppelt wirksame Rckkoppelungshemmung! Beim
Menschen wird die Synthase mit einer Halbwertszeit von nur 80min umgesetzt. Hmatin hlt zudem

die Translation von Globin-mRNA in Gang (Abschn.11.3). Die gegensinnige Regulation stimmt die
Synthesegeschwindigkeiten von Hm und Globin
aufeinander ab.

Hereditre Strungen der Porphyrinsynthese


fhren zu schweren Krankheiten Bei Enzymde-

245
18.7 Synthese von Kreatin und Porphyrinen aus Aminosuren

fekten im Syntheseweg der Porphyrine hufen sich


Zwischen- und Nebenprodukte an, aus denen durch
Oxidationsreaktionen weitere Porphyrine entstehen.
Diese Porphyrine sind, wie das ProtoporphyrinIX,
rote und rot-fluoreszierende Farbstoffe, die photoaktivierbar sind und photochemische Prozesse
auslsen knnen. Die ausgeschiedenen Porphyrine
frben den Urin rot.
Die erythropoetische Porphyrie beruht auf
einer fehlgeleiteten Porphyrinsynthese in den Erythroblasten, den Vorluferzellen der Erythrozyten.
Nicht verwendbare Oxidationsprodukte von Porphobilinogen hufen sich an und lagern sich in der
Haut ab. Die Haut wird lichtempfindlich: Photochemische Prozesse bilden Sauerstoffradikale, die
Hautgeschwre und Hautnarben zur Folge haben.
Bei der hepatischen Porphyrie stehen episodische
Bauchbeschwerden (die Patienten werden bei unklarer Diagnose oft operiert) sowie neurologische
und psychische Strungen im Vordergrund.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517046-0
18.1 Abbau von Proteinen
18.2 Abbau der Aminosuren:
Weg des Stickstoffs
18.3 Abbau der Aminosuren:
Weg des Kohlenstoffs
18.4 Strungen im Abbau von Aminosuren
18.5 Synthese der Aminosuren
18.6 C1-Stoffwechsel
18.7 Synthese von Kreatin und Porphyrinen
aus Aminosuren
Weiterfhrende Literatur

18

247

Stoffwechsel der Purinund Pyrimidinnucleotide


Ph. Christen, R. Jaussi, R. Benoit
19.1

Synthese der Purinnucleotide; Wiederverwertung


von Purinbasen248

19.2

Synthese der Pyrimidinnucleotide; Wiederverwertung


von Pyrimidinnucleosiden250

19.3

Regulation der Nucleotidsynthese 251

19.4

Synthese der Desoxyribonucleotide 251

19.5

Abbau der Nucleinsuren und Nucleotide 255

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_19, Springer-Verlag Berlin Heidelberg 2016

19

248

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 19 Stoffwechsel der Purin- und Pyrimidinnucleotide

Alle Gewebe synthetisieren dauernd Ribonucleotide


als Bausteine der RNA. Desoxyribonucleotide werden in geringerer Menge bentigt, da DNA nur vor
der Zellteilung und zu Reparaturzwecken synthetisiert wird. Die Zellen in Darmmucosa, Haut und
Knochenmark erneuern sich fortlaufend, hingegen
teilen sich die Zellen in Gehirn, Muskulatur, Knochen und Knorpel nur selten.
Purin- und Pyrimidinnucleotide werden entweder aus kleineren Vorstufen de novo synthetisiert
oder aus Purinbasen und Pyrimidinnucleosiden,
welche vom Nucleinsurenabbau stammen, wieder aufgebaut (Wiederverwertungsweg, Salvage
pathway).
Inhibitoren diverser Schritte der Purin- und
Pyrimidinsynthese werden als Bakteriostatika oder
Zytostatika eingesetzt: Sulfonamide hemmen die
Synthese der Folsure in Bakterien; das Zytostatikum Fluorouracil wird zu Fluoro-dUMP umgesetzt,
welches die Thymidylat-Synthase hemmt; Folsureantagonisten hemmen die Dihydrofolat-Reduktase
und werden als Bakteriostatika und Zytostatika verwendet.
berschssige Nucleotide werden abgebaut.
Die Ribose wird als Ribosephosphat freigesetzt; die
Pyrimidinbasen werden zu Ammoniak und CO2 abgebaut, whrend die Purinbasen je nach Spezies als
Harnsure oder Allantoin im Urin ausgeschieden
werden. Die schlecht wasserlsliche Harnsure
und ihr Natriumsalz (Natriumurat) fallen bei hheren Konzentrationen leicht aus: Harnsteine und
Gicht (Ablagerung von Natriumuratkristallen in
gewissen Geweben) knnen die Folgen sein.
19.1

phosphat (PRDP), worauf der Purinring Atom


um Atom aufgebaut und danach geschlossen wird
(.Abb.19.1). Pro mol Nucleotid werden 6mol
energiereicher Phosphatbindungen verbraucht.
Der komplizierte Syntheseweg die Atome des heterozyklischen Ringsystems stammen aus fnf verschiedenen Quellen zeigt die wichtige Rolle von
Aminosuren bei der Biosynthese stickstoffhaltiger
Verbindungen (Die Zahlen bezeichnen die einzelnen Additionsschritte in .Abb.19.1):

AMP und GMP werden aus IMP in weiteren energieverbrauchenden Reaktionen gebildet (.Abb.19.2).
Basenspezifische Nucleosidmonophosphat-Kinasen
produzieren daraus unter ATP-Verbrauch die entsprechenden Nucleosiddiphosphate:

Die Triphosphate werden durch eine unspezifische


Nucleosiddiphosphat-Kinase gebildet, die weder
zwischen den verschiedenen Basen noch zwischen
Ribo- und Desoxyribonucleotiden unterscheidet (N
und M bedeuten irgendein Nucleosid):

Synthese der Purinnucleotide;


Wiederverwertung von
Purinbasen

Ein erwachsener Mensch synthetisiert etwa 500mg


neuer Purin- und Pyrimidinnucleotide pro Tag; die
Wiederverwertung von Purinbasen und Pyrimidinnucleosiden aus dem Abbau von Nucleinsuren und
Nucleotiden liefert etwa zehnmal mehr.

Die heterozyklischen Ringe der Purinnucleotide werden vom Pentosephosphatrest


ausgehend aufgebaut Zunchst wird Ribo-

se-5-phosphat aktiviert zu 5-Phosphoribosyl-1-di-

Wiederverwertung der Purinbasen hilft Energie


sparen Rezyklieren der beim Abbau von Nuclein-

suren und Nucleotiden anfallenden Purinbasen


(Rcklauf bis zu 90%!) erbrigt deren energieaufwndige de-novo-Synthese. Wie bei der Neusynthese wird hierzu 5-Phosphoribosyl-1-diphosphat
(PRDP, die aktivierte Form von Ribose-5-phosphat)
verwendet:

249
19.1 Synthese der Purinnucleotide; Wiederverwertung von Purinbasen

19

.. Abb.19.1 De-novo-Synthese von Purinnucleotiden. An 5-Phosphoribosyl-1-diphosphat (PRDP), der aktivierten Form von
Ribose-5-phosphat, wird die Diphosphatgruppe stereospezifisch (-Anomer) durch die Amidgruppe von Glutamin ersetzt.
Darauf wird Glycin mit ATP aktiviert und ber eine Amidbindung angekoppelt. Im Folgenden wird Atom um Atom hinzugefgt
und der Fnfring und darauf der Sechsring aufgebaut. Die C-Atome stammen aus Glycin, Formyl-FH4 und CO2; die N-Atome
werden durch Glutamin (2x), Glycin und Aspartat geliefert. Das Endprodukt ist das Nucleotid Inosinmonophosphat (IMP); die
entsprechende Purinbase, 6-Hydroxypurin, wird als Hypoxanthin bezeichnet

In extrahepatischen Geweben wird der grte Teil


der Purinnucleotide ber den Wiederverwertungsweg gewonnen. Ein Ausfall der HGPRT hat daher
schwerwiegende Konsequenzen fr die Gehirnentwicklung (Abschn.19.5).

250

Kapitel 19 Stoffwechsel der Purin- und Pyrimidinnucleotide

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.19.2 Bildung von AMP und GMP aus IMP. Zur Synthese von AMP wird die Hydroxylgruppe in Stellung6 der tautomeren
Form von IMP durch die Aminogruppe von Aspartat ersetzt, dabei entsteht Fumarat (hnlich wie bei Schritt6 in .Abb.19.1
und bei der Harnstoffsynthese, .Abb.18.3). Zur Synthese von GMP wird in Stellung2 eine Hydroxylgruppe eingefhrt, die
darauf durch eine Aminogruppe ersetzt wird

19.2 Synthese

der Pyrimidinnucleotide;
Wiederverwertung
von Pyrimidinnucleosiden

Aminosuren sind auch an der Pyrimidinsynthese beteiligt Im Unterschied zur Synthese

der Purinnucleotide wird zunchst der N-haltige


Ring gebildet, der anschlieend an Ribosephosphat
gekoppelt wird. Der Pyrimidinring wird aus der
Amidgruppe von Glutamin, CO2 und Aspartat
gebildet (.Abb.19.3). Darauf wird unter Verwendung von aktiviertem Ribose-5-phosphat
ein Mononucleotid produziert, welches zu UMP
decarboxyliert wird. UMP wird unter Verwendung
von ATP zu UDP und UTP phosphoryliert. Trans
amidierung mit Glutamin ersetzt die Hydroxylgruppe von UTP durch eine Aminogruppe und
ergibt CTP:

Pyrimidinnucleoside werden wiederverwertet

Im Unterschied zu den Purinnucleotiden werden


bei den Pyrimidinnucleotiden nicht die Basen, sondern die beim Abbau anfallenden Pyrimidinnucleoside rezykliert:

251
19.4 Synthese der Desoxyribonucleotide

19

19.3 Regulation

der Nucleotidsynthese

Rckkoppelungsmechanismen regulieren die


Synthese von Purin- und Pyrimidinnucleotiden
Fr eine bedarfsgerechte Produktion von Purinnucleotiden (Syntheseweg: .Abb.19.1) sorgen

Rckkoppelungshemmungen auf mehreren Stufen


kombiniert mit einer Rckkoppelungsaktivierung
bers Kreuz: GTP aktiviert die Synthese von ATP
und ATP aktiviert die Synthese von GTP; die kreuz
weise Abhngigkeit stimmt die Synthesen von ATP
und GTP aufeinander ab:

Die allosterische Aktivierung des ersten Schritts


durch PRDP (5-Phosphoribosyldiphosphat), die
aktivierte Form von Ribose-5-phosphat, die fr die
Synthese von Purinnucleotiden (.Abb.19.1) und
auch von Pyrimidinnucleotiden (.Abb.19.3) bentigt wird, stimmt die Produktion von Purin- und
Pyrimidinnucleotiden aufeinander ab. Wie im ersten Schema gezeigt, wird die Synthese von PRDP
gedrosselt, sobald ausreichend Purinnucleotide vorhanden sind. Herabgesetzte Produktion von PRDP
hat verringerte Aktivierung, d.h. Verlangsamung
der Synthese von Pyrimidinnucleotiden zur Folge.
Da aus UTP sowohl CTP wie auch dTTP (s. unten)
entstehen, ist deren Synthese in diesen Regulationsmechanismus eingeschlossen.
19.4 Synthese

der Desoxyribonucleotide

Eine Rckkoppelungshemmung des ersten Schritts


(Carbamoylphosphat-Synthase) durch das Endprodukt UTP reguliert die Synthese der Pyrimidinnucleotide bei Eukaryonten. Bei Prokaryonten wird
die Aspartat-Carbamoyl-Transferase durch CTP
ber eine allosterische Rckkoppelungshemmung
reguliert:

Zur Synthese von DNA werden dATP, dGTP, dCTP


und dTTP bentigt. Diese Desoxyribonucleotide
entstehen durch reduktive Entfernung der Hydroxylgruppe an C2 der Ribonucleotide.

Die Ribonucleotide werden ausnahmslos


auf der Stufe der Ribonucleosiddiphosphate
reduziert Die Reduktion in der 2-Position des

Riboserests erfolgt fr die Purin- und Pyrimidinnucleosiddiphosphate auf die gleiche Weise: eine

252

Kapitel 19 Stoffwechsel der Purin- und Pyrimidinnucleotide

Radikalreaktion mit Thioredoxin, einem kleinen


Protein (100Aminosurereste) mit zwei Sulfhydrylgruppen, als Reduktionsmittel (.Abb.19.4).
Die Ribonucleosiddiphosphat-Reduktase (Ribonucleotid-Reduktase) wird allosterisch reguliert.
Der wichtigste allosterische Rckkoppelungsinhibitor ist dATP, aber auch die anderen dNTPs sowie
ATP sind wirksam; durch Rckkoppelungshemmung und durch Modulation der Substratspezifitt
des Enzyms sorgen sie fr ein ausgewogenes Mengenverhltnis der verschiedenen dNTPs.

1
2
3
4
5

Desoxythymidinmonophosphat (dTMP) entsteht aus dUMP In der DNA kommt Thymin

(5-Methyluracil) anstelle von Uracil vor. Die Synthese


der Desoxythymidinnucleotide geht von dUDP aus,
das zu dUTP phosphoryliert wird, woraus dUMP
durch hydrolytische Abspaltung von PPi entsteht:

7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.19.3 De-novo-Synthese von Pyrimidinnucleotiden.


Aus Hydrogencarbonat und der Amidgruppe von Glutamin
wird Carbamoylphosphat gebildet, das zusammen mit
Aspartat die Atome zum Aufbau des Pyrimidinrings liefert.
Die im Cytosol vorkommende Carbamoylphosphat-Synthase
II verwendet die Amidgruppe von Glutamin zur Synthese
von Carbamoylphosphat, whrend das mitochondriale
Isoenzym, die an der Harnstoffsynthese beteiligte Carbamoylphosphat-Synthase I, hierzu NHC
4 bentigt. Nach dem
Ringschluss wird Ribose-5-phosphat aus PRDP N-glykosidisch
angekoppelt. UMP wird zu UTP phosphoryliert, woraus die
weiteren bentigten Pyrimidinnucleotide gebildet werden.
Bei Eukaryonten wird die Carbamoylphosphat-Synthase II
und bei Prokaryonten die Aspartat-Carbamoyl-Transferase
durch allosterische Rckkoppelungshemmung reguliert

Die C1-Einheit fr die Methylierung von dUMP zu


dTMP stammt von N5, N10-Methylentetrahydrofolat.
Die Methylengruppe muss dabei zur Methylgruppe
reduziert werden. Methylen-FH4 fungiert in dieser durch die Thymidylat-Synthase katalysierten
Reaktion nicht nur als C1-Lieferant sondern auch
als Reduktionsmittel: FH4 wird zu FH2 (Dihydrofolat) oxidiert. FH2 kann im Gegensatz zu FH4 keine
C1-Einheiten bertragen. Die Dihydrofolat-Reduktase katalysiert die Rckgewinnung von FH4
aus FH2 mit NADPH als Reduktionsmittel.
Warum Methylierung von dUMP ? 
Warum wird dUMP und nicht dUDP oder dUTP
methyliert? Der energieverbrauchende Umweg ber das Monophosphat verhindert, dass
die unspezifische Nucleosiddiphosphatkinase
dUDP zu dUTP phosphoryliert. Da die DNA-Polymerase nur ungengend zwischen dTTP und

253
19.4 Synthese der Desoxyribonucleotide

.. Abb.19.4 Reduktion von


Ribonucleosiddiphosphaten
zu 2-Desoxyribonucleosiddiphosphaten. In einer komplexen
Radikalreaktion, an der ein Eisenzentrum der Ribonucleosiddiphosphat-Reduktase (Ribonucleotid-Reduktase) beteiligt ist, wird
die Hydroxylgruppe an C2 durch
ein Wasserstoffatom ersetzt

Ribon
Ribonucleosid

ribo

dUTP unterscheidet, knnte das Vorhandensein von dUTP in der Zelle dazu fhren, dass
dieses Nucleotid flschlicherweise in die DNA
eingebaut wrde.


Inhibitoren der Synthese von Folsure, dTMP
und Purinnucleotiden hemmen das Zellwachstum Zellen, die sich rasch teilen, sind auf einen

ausreichenden Nachschub von Purinnucleotiden


und von dTTP, einem Pyrimidinnucleotid, zur
Synthese von RNA und DNA angewiesen. Die Synthese beider Nucleinsurekomponenten ist von FH4
abhngig. Hemmstoffe der Synthese von Folsure,
der Thymidylat-Synthase und der Dihydrofolat-Reduktase werden als Bakteriostatika (Hemmer des
Bakterienwachstums) bei bakteriellen Infektionskrankheiten und als Zytostatika (Hemmer des Zellwachstums) bei gewissen Krebsformen eingesetzt
(.Abb.19.5).
Zytostatika
Bei einer Chemotherapie mit Zytostatika werden vorwiegend die Zellen mit hoher Teilungsrate betroffen: Krebszellen, daneben aber auch
die Zellen des Knochenmarks (eine massive
Abnahme der Zahl der weien Blutzellen ist zu
vermeiden), des Immunsystems, der Darmschleimhaut und der Haarwurzeln.

19

254

Kapitel 19 Stoffwechsel der Purin- und Pyrimidinnucleotide

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.19.5 Hemmstoffe der Synthese von Folsure und dTMP. Das untenstehende Reaktionsschema zeigt die Zielenzyme der
wichtigsten Inhibitoren der Synthese von dTMP.
Sulfonamide (Sulfanilamide) sind Analoge der para-Aminobenzoesure, einer Vorstufe der Folsure (Abschn.18.6). Sie
hemmen die Synthese der Folsure in Bakterien (im Schema nicht aufgefhrt) und werden, zumeist in Kombination mit einem
Folsureantagonisten, als Bakteriostatika verwendet. Mensch und Tiere knnen Folsure nicht synthetisieren: Folsure ist ein
Vitamin.
Fluorouracil wird in den Zellen in Fluoro-dUMP umgewandelt, welches die Thymidylat-Synthase nach dem Modus eines mechanismusaktivierten Inhibitors (kcat-Inhibitors) hemmt. Fluorouracil wird als Zytostatikum verwendet.
Folsureantagonisten sind Analoge der Folsure, die als kompetitive Inhibitoren mit sehr hoher Affinitt an die Dihydrofolat-Reduktase binden (Dissoziationskonstante des Enzym-Inhibitor-Komplexes Ki109M!). Folsureantagonisten werden als
Zytostatika und Bakteriostatika verwendet

255
19.5 Abbau der Nucleinsuren und Nucleotide

19.5

Abbau der Nucleinsuren


und Nucleotide

Purin- und Pyrimidinbasen aus der Nahrung sowie


berschssige Nucleotide aus abgebauter RNA (wenig aus DNA) werden dem Katabolismus zugefhrt.
Pyrimidinbasen werden wie Aminosuren unter
Energiegewinn abgebaut zu CO2, H2O und Ammoniak, das als Harnstoff ausgeschieden wird. Purinbasen hingegen kann der menschliche Organismus
nicht zu niedermolekularen Verbindungen zerlegen:
Sie werden hnlich wie Cholesterol lediglich in eine
Ausscheidungsform, in Harnsure oder Allantoin,
umgewandelt:

Harnsure ist extrem schlecht wasserlslich Beim

Abbau von Purinnucleotiden zu Harnsure wird zunchst vom Nucleosidmonophosphat der Phosphatrest hydrolytisch abgespalten, darauf wird die Pentose
phosphorolytisch entfernt und in zwei Oxidationsschritten die Harnsure produziert (.Abb.19.6).
Protonierte Harnsure (lat. acidum uricum; pKa=5,4)
ist extrem schlecht wasserlslich (Lslichkeitsgrenze
0,5mg/100mL); Urat, ihr Anion, ist etwas besser
lslich (6,4mg/100mL; 0,4mM). Die physiologische Konzentration von Natriumurat im Blutplasma

19

(0,250,3mM) liegt allerdings nur wenig unter der


Lslichkeitsgrenze. Das Lslichkeitsproblem der
Harnsure besteht nur bei Mensch, Menschenaffen und Neuweltaffen. Die anderen Suger besitzen
Uratoxidase und wandeln Harnsure zum weitaus
besser wasserlslichen Allantoin um (.Abb.19.6).

Strungen im Purinabbau verursachen eine


Reihe von Krankheiten Einer Form von schwerem
Immundefekt liegt ein kongenitaler Fehler im Purinabbau zugrunde. Ein Mangel an Adenosin-Desaminase fhrt zu einem Rckstau von Nucleotiden

(.Abb.19.6); die Konzentration von dATP kann


bei solchen Patienten bis auf das Fnfzigfache des
normalen Wertes ansteigen. Die Folge sind schwere
Strungen in der Regulation des Nucleotidstoffwechsels (Hemmung der Ribonucleosiddiphosphat-Reduktase; .Abb.19.4). Die sich daraus ergebende
mangelhafte DNA-Synthese uert sich als mangelhafte Entwicklung der B- und T-Lymphozyten.
Der Gicht, einer der hufigsten Stoffwechselkrankheiten, liegt eine erhhte Konzentration der
Harnsure zugrunde. Da die Konzentration von
Urat auch in den Geweben nur wenig unter der
Lslichkeitsgrenze liegt, fhrt schon eine verhltnismig geringe Erhhung der Konzentration zum
Ausfallen von Natriumuratkristallen. Die Kristalle
bilden sich intra- und extrazellulr in den Geweben (Knorpel, Sehnen) und der Synovialflssigkeit
(Gelenkschmiere) peripherer Gelenke (tiefere Temperaturen erleichtern Kristallisation). Dadurch ausgelste Entzndungsreaktionen verursachen akute
Schmerzattacken. Eine bevorzugte Lokalisation ist
das Grozehengrundgelenk (Podagra, Zipperlein).
Im chronischen Stadium kommt es zu irreversiblen
Schden der Nieren und der Gelenke.
Die Ursachen fr eine erhhte Harnsurekonzentration sind vielfltig. Mgliche Ursachen einer
primren Hyperurikmie sind:
berproduktion von Harnsure (bei einem Drittel der Patienten) wegen Defekt
im Wiederverwertungsweg der Purinbasen
(Hypoxanthin-Guanin-Phosphoribosyl-Transferase, HGPRT),
Gesteigerte Biosynthese von Purinnucleotiden
aufgrund eines Defekts in der allosterischen
Hemmung durch AMP, GMP und IMP,
Hereditre Strung der Harnsureausscheidung durch die Nieren.

256

Kapitel 19 Stoffwechsel der Purin- und Pyrimidinnucleotide

1
2
3
4
5
6
7

Purinn
1

8
Purinn

10
Xanthinoxidase

11
12
13
14
15

Xanthinoxidase

16
17
18
19
20

Uratoxidase

257
19.5 Abbau der Nucleinsuren und Nucleotide

Sekundre Hyperurikmien ergeben sich als Folge


anderweitiger Strungen wie erhhtem Zellumsatz
bei Leukmien und hmolytischen Anmien, verringerter Harnsureausscheidung durch die Nieren
oder bermiger Zufuhr zellreicher Innereien (Leber, Niere, Thymus) mit der Nahrung.
Zur medikamentsen Behandlung der Hyper
urikmie dient Allopurinol. Dieses Strukturanalogon von Hypoxanthin hemmt die Xanthinoxidase
kompetitiv (.Abb.19.6). Als Folge werden anstelle
von Harnsure besser wasserlsliches Hypoxanthin
und Xanthin ausgeschieden.

19

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517047-0
19.1 Synthese der Purinnucleotide;
Wiederverwertung von Purinbasen
19.2 Synthese der Pyrimidinnucleotide; Wiederverwertung von Pyrimidinnucleosiden
19.3 Regulation der Nucleotidsynthese
19.4 Synthese der Desoxyribonucleotide
19.5 Abbau der Nucleinsuren und Nucleotide
Weiterfhrende Literatur

Eine schwerwiegende Erbkrankheit, bei der verstrkt produzierte Harnsure zu Gicht fhrt, ist das
seltene Lesch-Nyhan-Syndrom (Syndrom: Symptomenkomplex). Ein Defekt der Hypoxanthin-Guanin-Phosphoriboxyl-Transferase (HGPRT; Abschn.19.1) schrnkt die Wiederverwertung der
Purinbasen ein. Die gestrte Entwicklung des Zentralnervensystems ist wahrscheinlich die Folge einer
ungengenden Versorgung der Zellen mit Purinnucleotiden.

.. Abb.19.6 Abbau von Purinnucleotiden (Ribo- und Desoxyribo-) zu Harnsure oder Allantoin. Die beiden durch die Xanthin
oxidase katalysierten Reaktionen liefern H2O2 und wegen teilweiser unvollstndiger Reduktion des Sauerstoffs auch das
Superoxidanion-Radikal O2. Wasserstoffperoxid und das Superoxidanion sind zellschdigende Produkte und werden durch besondere Enzyme unschdlich gemacht (Abschn.31.3). Die Uratoxidase (Uricase), welche die schlecht wasserlsliche Harnsure
durch Oxidation und Decarboxylierung in das weitaus besser lsliche Allantoin und weitere Produkte berfhrt, kommt bei den
meisten Sugern vor. Sie fehlt beim Menschen und einigen anderen Primaten. Ein genetischer Defekt der Adenosin-Desaminase
oder sehr selten der Purinnucleosid-Phosphorylase (blaue Querstriche) fhrt zu schwerer angeborener Immunschwche

259

Photosynthese
Ph. Christen, R. Jaussi, R. Benoit

20.1

Chloroplasten260

20.2

Komponenten und Organisation


des Photosyntheseapparats261

20.3

Chlorophyll262

20.4

Lichtgetriebene Reduktion von NADP+


und Synthese von ATP 262

20.5

Synthese von Kohlenhydrat aus CO2266

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_20, Springer-Verlag Berlin Heidelberg 2016

20

260

1
2
3
4
5
6

Kapitel 20Photosynthese

Phototrophe Organismen (Pflanzen, Algen, Cyanobakterien) benutzen Lichtenergie (E=h), um aus


CO2 und Wasser organische Substanzen, in erster
Linie Kohlenhydrate, aufzubauen. Von dieser Syntheseleistung abhngig sind auch die chemotrophen Organismen, die auf organische Nhrstoffe als
Energietrger und Baustoffe angewiesen sind. Die
Photosynthese liefert zudem den fr die oxidative
Phosphorylierung bentigten Luftsauerstoff.
Bei der Photosynthese werden Niedrigenergie-Elektronen aus H2O (hheres Redoxpotenzial)
auf CO2 bertragen unter Bildung von Kohlenhydrat (CH2O)n mit Hochenergie-Elektronen:
Photosynthese

7
8
9

20.1 Chloroplasten

10
11
12
13
14
15
16
17
18
19
20

nen, Protonen und Sauerstoffatome zerlegt und die


Elektronen durch Aufnahme von Lichtenergie auf
ein Energieniveau (mit stark negativem Redoxpotenzial) angehoben, das ausreicht, um NADP+ zu
reduzieren. An der Lichtanregung der Elektronen
zur Bildung von NADPH ist Chlorophyll beteiligt, ein grner Tetrapyrrol-Farbstoff hnlich dem
Hm, jedoch mit Mg2+ als Zentralion, welcher die
Lichtenergie einfngt. In Eukaryonten laufen die
Lichtreaktionen in besonderen Organellen ab, den
Chloroplasten.
NADPH ist ein gengend starkes Reduktionsmittel, um CO2 durch Reduktion an einem
organischen Akzeptor zu fixieren. Diese CO2-Assimilierung durch die Dunkelreaktionen ist lichtunabhngig; die beteiligten enzymatischen Reaktionen entsprechen zum Teil den nichtoxidativen
Abschnitten des Pentosephosphatwegs.

Die Photosynthese liefert Glucose entsprechend der


Nettogleichung
Lichtenergie

6 CO2 C 6 H2 O ! C6 H12 O6 C 6 O2 I


G0 D 2820 kJ mol1 :

Bilanzmig wird CO2 durch Wasser zu Kohlenhydrat reduziert; Lichtenergie ermglicht den photosynthetisierenden Zellen, das hierzu bentigte
NADPH und ATP bereitzustellen:
NADPH (.Abb.14.2) als Reduktionsmittel
mit negativem Redoxpotenzial, d.h. mit hoher
freier Energie,
ATP zum Antreiben gewisser Syntheseschritte.

Wasser ist ein zu schwaches Reduktionsmittel, um


CO2 zu reduzieren. In den Lichtreaktionen der
Photosynthese werden H2O-Molekle in Elektro-

Chloroplasten besitzen wie Mitochondrien eine


uere, permeable Membran und eine innere, protonenundurchlssige Membran. Ebenso verfgen
sie ber ein eigenes Restgenom, das einen geringen Teil ihrer Proteine codiert, und ber eine Proteinsynthesemaschinerie, die derjenigen von Prokaryonten entspricht: Chloroplasten sind wie die
Mitochondrien aus endosymbiontischen Bakterien
entstanden.
Die Chloroplasten enthalten Thylakoide, abgeplattete Membransckchen, die wie Mnzen aufeinander gestapelt sind und dadurch die Grana (lat.,
Krner) bilden. Die Grana sind miteinander ber
dnne Membrankanle verbunden.

261
20.2 Komponenten und Organisation des Photosyntheseapparats

20

(2x)

.. Abb.20.1 Die lichtabhngigen Reaktionen der Photosynthese. Durch Chlorophyll eingefangene Lichtenergie wird von
den PhotosystemenII (PS II) und I (PS I) benutzt, um H2O-Moleklen Elektronen zu entziehen und damit NADP+ zu reduzieren.
Diese Redoxreaktionen sind gekoppelt mit einer Erhhung der Protonenkonzentration im Lumen der Thylakoide. Drei in die
Thylakoidmembran eingelagerte Proteinkomplexe katalysieren diese Vorgnge. PS II spaltet Wasser in Elektronen, Protonen
und Sauerstoff; durch Licht angeregtes Chlorophyll bertrgt die Elektronen auf das niedermolekulare, in der Lipiddoppelschicht gelste Plastochinon (Q), das sie an den Cytochrom b6f(Cyt bf )-Komplex weitergibt. Der H+-Gradient wird hauptschlich
aus zwei Quellen gespeist: PS II, das bei der Wasserspaltung Protonen ins Thylakoidlumen abgibt, und der Cyt bf-Komplex, der
Protonen vom Chloroplastenstroma ins Thylakoidlumen pumpt (analog KomplexIII in der Atmungskette). Den Elektronentransport vom Cyt bf-Komplex zu PS I besorgt Plastocyanin (Pc), ein kleines Protein mit der gleichen Funktion wie Cytochrom cin
der Atmungskette. Eine weitere Anregung des Chlorophylls in PS I durch Licht ermglicht die Reduktion eines eisenhaltigen
Proteins, des Ferredoxins, dessen Fe2+-Form das Elektron zur Reduktion von NADP+ liefert

Der Chloroplastenraum auerhalb der Thylakoide


wird als Stroma, das Innere der Thylakoide als Lumen bezeichnet. Die Thylakoide entstehen durch
Abknospung der inneren Chloroplastenmembran:
Das Lumen der Thylakoide entspricht topologisch
dem Intermembranalraum der Chloroplasten. Das
lichteinfangende Chlorophyll befindet sich in der
Thylakoidmembran, wo auch die lichtgetriebenen
Elektronentransportvorgnge ablaufen (Lichtreaktionen). Im Stroma der Chloroplasten wird Kohlenhydrat aus CO2 und Wasser synthetisiert (Dunkelreaktionen). Der Ausdruck Dunkelreaktionen
bedeutet, dass sie lichtunabhngig sind; in der Natur
laufen die Dunkelreaktionen jedoch bei Licht ab, sobald die Lichtreaktionen das zur Kohlenhydratsynthese bentigte NADPH und ATP liefern.
20.2 Komponenten

und Organisation
des Photosyntheseapparats

Wie die Atmungskette besteht die Photosynthesemaschinerie aus groen membranstndigen Proteinkomplexen und kleineren beweglichen Elektronenbertrgern. In der Thylakoidmembran finden
sich in der Richtung des Elektronenflusses aufge-

fhrt drei Komplexe

: PhotosystemII (PS II),


Cytochromb6/f-Komplex (Cyt bf-Komplex) und PhotosystemI (PS I; .Abb.20.1). Die Nummerierung

entspricht der Reihenfolge, in welcher die beiden


Systeme entdeckt worden sind. Plastochinon (Q),
hnlich dem Ubichinon in der Atmungskette, bertrgt die Elektronen von PS II auf Cyt bf. Von dort
bringt Plastocyanin (Pc), ein kleines, wasserlsliches,
nicht in die Membran eingebettetes Protein, die Elektronen zu PS I. Das Kupferion des Pc wechselt dabei
zwischen dem Cu2+- und Cu+-Zustand. Ferredoxin,
ein eisenhaltiges Protein, ist an der bertragung der
Elektronen von PS I auf NADP+ beteiligt.
Die drei Komplexe PS I, Cyt bf und PS II vollbringen die folgende Nettoreaktion:

2 H2 O C 2 NADPC ! O2 C 2 NADPH C 2 HC
Das Einzigartige der Photosynthese ist, dass die
Energie zur Reduktion von NADP+ mit H2O dem
Licht entnommen wird. Zudem wird ein Teil der
eingefangenen Lichtenergie genutzt, um einen
Protonengradienten aufzubauen, aus dem, hnlich
wie bei der oxidativen Phosphorylierung, ATP gewonnen wird. Damit steht zur Verfgung, was zur
Synthese von Kohlenhydrat aus CO2 und H2O notwendig ist: NADPH und ATP.

262

1
2
3
4
5
6

Kapitel 20Photosynthese

20.3 Chlorophyll

Grne Pflanzen verwenden Chlorophyll als Lichtrezeptor; photosynthetisierende Bakterien und


Algen benutzen andere Rezeptorfarbstoffe. Chlorophyll hat eine hnliche Struktur wie Hm (Abschn.15.2); jedoch ist das Zentralion im Tetrapyrrolring Mg2+ statt ein Eisenion und die Seitenketten
sind verschieden. Eine der Chlorophyll-Seitenketten eine ist hydrophobe Phytylgruppe, eine C16Kohlenwasserstoffkette mit 4Methylgruppen, die
ber eine Esterbindung mit dem Ringsystem verbunden ist:

7
8

13
14
15
16
17
18
19
20

Die gelbrote Farbe des Herbstlaubes ist auf


Carotinoide zurckzufhren. Abbau des
Chlorophylls fhrt zum Sichtbarwerden der
Carotinoide.

Lichtgetriebene Reduktion von


NADP+ und Synthese von ATP

Die zwei Photosysteme sind in Serie geschaltet

10

12

Bunt sind schon die Wlder

20.4

11

Die Lichtsammelkomplexe der Photosysteme


enthalten auer Chlorophyll auch Carotinoide als
zustzliche Lichtsammler. Carotinoide sind lange
Polyene; zahlreiche konjugierte Doppelbindungen
geben ihnen eine gelbrote Farbe (Abschn.6.4).
Die Carotinoide sind beteiligt an der Energiebertragung zum Reaktionszentrum. Auerdem fangen
sie Sauerstoffradikale ab, die bei den photochemischen Reaktionen entstehen.

Chlorophyll a (obige Struktur) und b (mit Formyl-

restCHO anstelle der blauen Methylgruppe), die


zusammen in Pflanzen vorkommen, absorbieren
aufgrund zahlreicher konjugierter Doppelbindungen intensiv im Rot- und Blaubereich (z.B. Chlorophyll a: 428=112 000M1cm1!); das Licht des dazwischen liegenden Grnbereichs wird reflektiert,
daher das Grn der Pflanzen.
Die Lichtsammelkomplexe von PS II und PS I
enthalten je einige hundert Chlorophyllmolekle.
Die allermeisten Chlorophyllmolekle nehmen
nicht direkt an den Photoreaktionen teil, sondern
dienen als lichtsammelnde Antennen: Sie werden
durch Photonen angeregt und bertragen die Energiequanten auf umgebende Chlorophyllmolekle.
Die Chlorophyllmolekle sind an Proteine gebunden und so angeordnet, dass sie anregende Quanten
(Excitonen) mit einer Ausbeute von nahezu 100%
an umgebende Chlorophyllmolekle weitergeben,
bis die Anregung ein Chlorophyll-Paar im Reaktionszentrum des PhotosystemsII erreicht (Chlorophyll P680, absorbiert Licht bis zu einer Wellenlnge von 680nm).

Die durch Serienschaltung der beiden Photosysteme


nutzbar gemachte Energie reicht aus, um NADP+
zu reduzieren und zudem ATP zu synthetisieren (.Abb.20.2). Das Chlorophyllpaar im Reak
tionszentrum des PhotosystemsII (P680+, d.h. in
oxidierter Form) bernimmt nacheinander die vier
Elektronen, die bei der Spaltung von 2H2O in 4H+
und O2 im Wasserspaltungszentrum (WSZ) frei
werden. Das aufgenommene Elektron ist ber beide
Molekle des 680-Paars delokalisiert. Im Dunkeln,
ohne Anregung durch Licht, kann Chlorophyll
P680 das aufgenommene Elektron nicht weitergeben. Wird es hingegen durch ein Exziton von den
Antennen-Chlorophyllmoleklen angeregt, hat es
eine starke Tendenz, das Elektron auf einen Akzeptor zu bertragen: Angeregtes Chlorophyll P680 reduziert Phophytin, ein dem Chlorophyll hnliches
Pigment (ohne Mg2+) des PS II.
Zwei reduzierte Phophytinmolekle bertragen darauf je ein Elektron auf Plastochinon (Q), den
lipidlslichen Elektronenbertrger zwischen PS II
und dem Cyt bf-Komplex:

263
20.4 Lichtgetriebene Reduktion von NADP+ und Synthese von ATP

20

Redoxpotenzial (v)

(2x)

.. Abb.20.2 Der Elektronenfluss von H2O zu NADP+ bei der Photosynthese. Ein Photon aktiviert ber den Lichtsammelkomplex
von PhotosystemII (PS II) die reduzierte Form von Chlorophyll P680 in dessen Reaktionszentrum. Im angeregten Zustand gibt
P680 ein Elektron an Phophytin (Ph), ein Chlorophyll ohne Zentralatom, ab. ber Plastochinon (Q), den Cytochrom b6f (Cyt
bf )-Komplex und Plastocyanin (Pc) gelangt das Elektron zu P700+, der oxidierten Form des Chlorophylls im Reaktionszentrum von
PS I, welches damit zu P700 reduziert wird. Anregung von P700 durch ein Photon ermglicht die Weitergabe des Elektrons ber
eine Kette von Elektronenbertrgern auf Ferredoxin (Fd). Die Ferredoxin-NADP+-Reduktase bertrgt das Elektron auf NADP+. Die
Passage des Elektrons durch den Cyt bf-Komplex ist gekoppelt mit einer Protonenpumpe, welche das Thylakoidlumen ansuert.
Der Protonengradient dient zur Synthese von ATP. Die von angeregten P680-Moleklen weitergegebenen Elektronen werden
durch Elektronen aus H2O ersetzt. Das Wasserspaltungszentrum (WSZ) von PS II enthlt ein Manganzentrum, das ber Redoxreaktionen von Mangan-Ionen (Mn4+ bis Mn2+) Elektronen aus H2O entfernt und an P680+ (die oxidierte Form von P680) weitergibt. Die
Entfernung von Elektronen aus H2O fhrt zur Bildung von O2 und zur Abgabe von Protonen ins Thylakoidlumen

,
,

Der Cyt bf-Komplex enthlt zwei Cytochrome und


ein Eisen-Schwefel-Zentrum (Abschn.15.2) und
berfhrt, energetisch gekoppelt mit aktivem Protonentransport ins Thylakoidlumen, zwei Elek-

tronen von Plastochinol (QH2) auf Plastocyanin


(Pc). Plastocyanin ist ein Kupferproteinkomplex;
das aufgenommene Elektron reduziert Cu2+ zu
Cu+. Das Elektron wird an Chlorophyll P700+ des
PS I weitergegeben. Sobald P700 durch ein Exziton aus den Antennen-Chlorophyllmoleklen
angeregt wird, gibt es das vom Plastocyanin bernommene Elektron weiter an eine kurze Reihe
von hier nicht weiter beschriebenen Elektronenbertrgern. Am Ende reduziert das Elektron das
Eisen-Schwefel-Zentrum von Ferredoxin, einem
kleinen (100Aminosurereste), wasserlslichen
Protein im Chloroplastenstroma. Die FerredoxinNADP+-Reduktase, ein FAD-haltiges Enzym, ber-

264

Kapitel 20Photosynthese

trgt zwei Elektronen von reduziertem Ferredoxin


auf NADP+:

ATP wird wie bei der oxidativen Phosphorylierung ber einen chemiosmotischen Mechanismus gewonnen Der Cyt bf-Komplex, der von

3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

lekl, 2NADPH- und 3ATP-Molekle zu produzieren. (E=h=hc/; rotes Licht mit einer Wellenlnge von 700nm hat eine Energie von 171kJ/
mol Photonen).

Wasserspaltungszentrum liefert Elektronen Das

Elektron, welches Ferredoxin reduziert, stammt


ursprnglich aus exzitonangeregtem Chlorophyll
P680 des PS II (.Abb.20.2). Aus P680 entsteht
dabei P680+, das ein neues Elektron erhalten muss,
damit ein weiteres Exziton die Kette von Redoxreaktionen erneut starten kann. Beim nachgeschalteten PS I spielt sich eine analoge Redoxreaktion mit
Chlorophyll P700+ und reduziertem Plastocyanin
ab: P700++Pc(Cu+)P700+Pc (Cu2+).
Das Elektron zur Reduktion von Chlorophyll
P680+ wird vom Wasserspaltungszentrum des PS
II (WSZ in .Abb.20.2) geliefert. Das WSZ ist ein
Mangan-Ionen Proteinkomplex, der Elektronen aus
Wasser ber Redoxreaktionen der Mn-Ionen (Mn4+
bis Mn2+) an P680+ weiterleitet und damit P680 fr
eine neue Runde lichtgetriebener Redoxreaktionen
bereitstellt. P680+ ist ein sehr starkes Oxidationsmittel mit einer dermaen starken Tendenz (strker
als Sauerstoff), ein Elektron zu bernehmen, dass es
ber den Mangankomplex sogar dem Wasser Elektronen entziehen kann:

2 H2 O C 4 P680C ! 4 HC C O2 C 4 P680
Die 4Protonen werden ins Thylakoidlumen freigegeben. Dabei ist es sehr wichtig, dass alle 4Elektronen rasch und mglichst gleichzeitig von
P680+-Moleklen aufgenommen werden, um die
Bildung unvollstndig oxidierter Sauerstoffderivate zu vermeiden. Das analoge Problem, wenn
auch in entgegengesetzter Richtung, besteht bei der
Atmungskette; dort gilt es, O2 mglichst vollstndig zu H2O reduzieren, damit ein Minimum unvollstndig reduzierter Sauerstoffderivate entsteht
(Abschn.15.2 und 31.3).
Die Stchiometrie der Photosynthese ist
schwierig abzuschtzen. Es wird angenommen, dass
die Energie von 8Photonen gengt, um 1O2-Mo-

QH2 Reduktionsquivalente bernimmt, um seinerseits Plastocyanin zu reduzieren, ist dem KomplexIII der Atmungskette hnlich, der ebenfalls
durch QH2 reduziert wird, um danach Cytochrom
c zu reduzieren (Abschn.15.2). Und wie KomplexIII verwendet auch der Cyt bf-Komplex die
beim Elektronentransport frei werdende Energie,
um Protonen durch die Membran zu pumpen. Die
ins Thylakoidlumen gepumpten Protonen zusammen mit den Protonen aus dem Wasserspaltungsapparat des PhotosystemsII (.Abb.20.2), suern
das Thylakoidlumen an (pH5). Der pH-Unterschied zwischen Thylakoidlumen und Stroma wird
zudem verstrkt durch das Proton, welches bei der
Reduktion von NADP+ zu NADPH im Stroma
verbraucht wird. Der Protonengradient wird genutzt, um ATP aus ADP und Pi zu synthetisieren
(.Abb.20.3).
Vergleich Thylakoide und Mitochondrien
In den Mitochondrien werden die Protonen
von innen nach auen gepumpt. In den Thylakoiden erfolgt der Transport in der entgegengesetzten Richtung. Bei diesem Vergleich ist
jedoch zu beachten, dass die Thylakoide durch
Einstlpung und Abschnrung der inneren
Chloroplastenmembran entstehen.

Sobald mehr reduziertes Ferredoxin vorliegt, als


zur Reduktion des anfallenden NADP+ bentigt
wird, bergibt Ferredoxin sein Elektron an den Cyt
bf-Komplex statt an NADP+. Der dadurch erhhte
Elektronenfluss durch den Cyt bf-Komplex erhht
die Leistung der Protonenpumpe und damit die
ATP-Synthese. Diese zustzliche Produktion von
ATP wird durch den zyklischen, ber PS I lichtgetriebenen Elektronenfluss (.Abb.20.2) in Gang
gehalten und daher als zyklische Photophosphorylierung bezeichnet.

265
20.4 Lichtgetriebene Reduktion von NADP+ und Synthese von ATP

20

(2x)

.. Abb.20.3 Synthese von ATP durch die ATP-Synthase in der Thylakoidmembran. Die Lichtreaktionen von PS II und PS I
fhren zu einem Konzentrationsunterschied von H+ zwischen Thylakoidlumen (pH5) und Chloroplastenstroma (pH8) mit
einem entsprechenden elektrochemischen Potenzial. Der Rckfluss der Protonen ins Stroma treibt wie bei der oxidativen
Phosphorylierung eine molekulare Maschine mit Rotor und Stator, die ATP synthetisiert (chemiosmotischer Mechanismus;
Abschn.15.3)

1
2
3
4

266

Kapitel 20Photosynthese

20.5

Synthese von Kohlenhydrat


aus CO2

Das erste Produkt der CO2-Fixierung ist 3-Phosphoglycerat Das auf der Erde wohl in grter
Menge vorkommende Protein, die Ribulose-1,5-bisphosphat-Carboxylase/Oxygenase, kurz Rubisco,

katalysiert die Fixierung von CO2:

5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Die Spaltung der C2-C3-Bindung ist kombiniert


mit einer Carboxylierung an C2: Aus einer Pentose
(C5) und CO2 entstehen 2Triosen (2C3). Pflanzen,
die CO2 ausschlielich ber diese C3-Photosynthese
assimilieren, werden als C3-Pflanzen bezeichnet.
Dazu gehren die meisten Kulturpflanzen gemigter Klimazonen: Getreidearten, Kartoffeln, Leguminosen.
Der kleinere Teil des 3-Phosphoglycerats wird
aus den Chloroplasten ins Cytoplasma exportiert
(Antiport mit Pi) und dort zur Synthese von Glucose (Gluconeogenese, Abschn.16.1) und Strke
verwendet; der grere Teil des 3-Phosphoglycerats
wird im Calvin-Zyklus zur Resynthese von Ribulose-1,5-bisphosphat verbraucht (.Abb.20.4). Die
Reaktionen des Zyklus werden durch eine Reihe von
Enzymen im Chloroplastenstroma, darunter die

Aldolase (Enzym der Glykolyse) und die Transketolase (Enzym des Pentosephosphatwegs), katalysiert.
Die Bilanzgleichung des Calvin-Zyklus ist:

3 CO2 C 9 ATP C 6 NADPH


#

Glycerinaldehyd-3-P C 9 ADP C 8 Pi
C 6 NADPC :

Wie der Name andeutet, reagiert die Ribulose-1,5-P2-Carboxylase/Oxygenase nicht nur mit
CO2, sondern auch mit O2. Die Reaktion mit Sauerstoff spaltet Ribulose-1,5-P2, so dass nur ein Molekl
3-Phosphoglycerat produziert wird. Das zweite Produkt, 2-Phosphoglycolat (C2), geht dem Calvin-Zyklus verloren und wird ber hier nicht dargestellte
Reaktionen als Glycin in den Stoffwechsel einschleust. Die mit der Photosynthese kompetierende
Reaktion von Rubisco mit O2, wird als Photorespiration bezeichnet. Unter bestimmten Bedingungen
verringert sie die Photosynthese um fast ein Drittel.
Ihre Bedeutung ist unklar; mglicherweise ist sie ein
nicht eliminierbares berbleibsel aus den Zeiten, da
die O2-Konzentration auf der Erde noch gering war.
In einigen Pflanzen wie Mais und Zuckerrohr,
die bei hoher Lichtintensitt und Temperatur wachsen, findet sich zustzlich zur Rubisco-Reaktion
eine Variante der Photosynthese, welche den Anteil
der Photorespiration verringert: Zur Assimilation
von CO2 wird nicht nur Ribulose-1,5-P2 verwendet,
sondern auch Phosphoenolpyruvat (PEP) zu Oxal
acetat carboxyliert:

Oxalacetat ist eine C4-Verbindung, der Vorgang


wird daher C4-Photosynthese genannt und die entsprechenden Pflanzen werden als C4-Pflanzen bezeichnet. Die weiteren Schritte sind aus .Abb.20.5
ersichtlich. In den Gefbndelscheidenzellen oxidiert und decarboxyliert das Malatenzym (auch an
Fettsuresynthese beteiligt; Abschn.17.2) Malat
zu Pyruvat und CO2. Dadurch wird die CO2-Konzentration in den Zellen 10- bis 50-mal hher

267
20.5 Synthese von Kohlenhydrat aus CO2

.. Abb.20.4Calvin-Zyklus.
Rubisco fixiert CO2; die Synthese von Glucose, Strke
oder anderen Reservekohlenhydraten bentigt ATP
und NADPH; die zyklische
Reaktionsfolge regeneriert
Ribulose-1,5-bisphosphat,
den Akzeptor von CO2. Das
Schema des im Chloroplastenstroma ablaufenden
Zyklus ist vereinfacht,
verschiedene Zwischenprodukte sind weggelassen

.. Abb.20.5C4-Pflanzen. Der besondere Stoffwechselweg erhht


die Konzentration von CO2 in den
Gefbndelscheidenzellen und
verbessert dadurch bei der Rubisco-Reaktion die Bedingungen fr
die Photosynthese auf Kosten der
Photorespiration

Mesophyllzelle

20

268

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 20Photosynthese

als in der Atmosphre. Bei dieser stark erhhten


CO2-Konzentration bertrifft die Photosynthese
durch Rubisco (Reaktion mit CO2) die Photorespiration (Reaktion mit O2) bei weitem. Das bei der
Decarboxylierung entstandene Pyruvat wird in Mesophyllzellen unter Verbrauch von zwei energiereichen Phosphatbindungen in Phosphoenolpyruvat
zurckverwandelt. Der Calvin-Zyklus luft gleich
wie in C3-Pflanzen ab . In verschiedenen C4-Pflanzen finden sich Varianten der C4-Photosynthese; bei
allen geht es jedoch darum, die CO2-Konzentration
in den Gefbndelscheidenzellen anzuheben, um
bei der Rubisco-Reaktion die Photosynthese auf
Kosten der Photorespiration zu frdern.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517048-0
20.1 Chloroplasten
20.2 Komponenten und Organisation des
Photosynthese-Apparats
20.3 Chlorophyll
20.4 Lichtgetriebene Reduktion von NADP+
und Synthese von ATP
20.5 Synthese von Kohlenhydrat aus CO2
Weiterfhrende Literatur

269

Besonderheiten
des Stoffwechsels
von Pflanzen und Bakterien
Ph. Christen, R. Jaussi, R. Benoit

21.1

Stickstoff-Assimilation aus N2 und Nitrat 270

21.2

Schwefel-Assimilation aus Sulfat 272

21.3

Transport- und Speicherformenvon Kohlenhydraten,


Lipiden und Proteinen bei Pflanzen 273

21.4

Sekundrstoffwechsel der Pflanzen 274

21.5

Phytohormone276

21.6

Stoffwechselwege in Bakterien 277

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_21, Springer-Verlag Berlin Heidelberg 2016

21

270

21
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 21 Besonderheiten des Stoffwechsels von Pflanzen und Bakterien

Pflanzen beziehen Energie aus dem Sonnenlicht


und nehmen smtliche Baustoffe in anorganischer
Form auf: Kohlenstoff als CO2, Stickstoff als Nitrat
oder Ammoniak und Schwefel als Sulfat. Pflanzen
sind photoautotroph.
Die Photosynthese in Pflanzen, Algen und gewissen Bakterien versorgt alle anderen Lebewesen
mit organisch gebundenem Kohlenstoff. Bodenbakterien assimilieren N2 aus der Luft, und PflanC
zen assimilieren NO
3 und NH4 aus dem Boden,
wodurch sie die Biosphre mit organisch fixiertem
Stickstoff versorgen. Dasselbe gilt fr die Assimilation von Schwefel aus SO2
4 durch Bakterien und
Pflanzen. Stickstoff und Schwefel werden auf gleiche
Weise assimiliert: Reduktion zu NH3 bzw. H2S, danach Einbau in Aminosuren und Synthese weiterer
N-haltiger und S-haltiger Verbindungen.
Definition
Assimilation
Aufnahme einfacher anorganischer Verbindungen zur Synthese organischer Verbindungen.

Pflanzen transportieren Kohlenhydrat zumeist in


Form von Saccharose und speichern chemische
Energie in Form von Strke und Triacylglycerol.
Im Unterschied zu Mensch und Tier synthetisieren Pflanzen Speicherproteine als Aminosurereserve. Der Sekundrstoffwechsel der Pflanzen
produziert uerst vielfltige Verbindungen als
Schutz gegen Fra und mikrobielle Pathogene.
Zahlreiche sekundre Pflanzeninhaltsstoffe werden
als Medikamente verwendet. Die Phytohormone
regulieren fast ausschlielich Wachstum und Entwicklung der Pflanze und nur in seltenen Fllen
den Stoffwechsel. Die Besonderheiten der direkten
Zell-Zell-Verbindungen sowie der extrazellulren
Matrix bei Pflanzen sind in Abschn.25.1. bzw.
25.4 aufgefhrt.
Bakterien weisen zahlreiche Stoffwechselwege
auf, die weder bei Tieren noch Pflanzen vorkommen, und ihnen erlauben, unter verschiedensten
Bedingungen zu wachsen.

21.1

Stickstoff-Assimilation aus N2
und Nitrat

Pflanzen und viele Bakterien knnen alle Aminosuren aus kleineren Bausteinen synthetisieren Den dafr notwendigen Stickstoff beziehen

sie aus anorganischen Verbindungen. Fr Pflanzen


ist Nitrat (NO
3 ) die wichtigste Stickstoffquelle.
Frei lebende nichtsymbiontische Bodenbakterien
wie Clostridium, Azotobacter und Cyanobakterien
knnen N2 aus der Luft durch Reduktion zu Ammoniak in gebundene Form berfhren. Die symbiontischen Knllchenbakterien (Bodenbakterien
der Gattung Rhizobium) der Leguminosenwurzeln
versorgen auf diese Weise wichtige Kulturpflanzen
(Klee, Sojabohnen, Bohnen, Erbsen) mit Ammo
niak. Dngung trgt zustzlich NHC
4 und NO3 in
die Bden ein . Eine weitere Quelle fr Ammoniak sind Blitzentladungen in der Atmosphre, die
etwa 3% des natrlich fixierten Stickstoffs liefern.
Bakterien reduzieren N2 zu NH3 Die dafr
notwendigen Reduktionsquivalente stammen aus
der Oxidation organischer Verbindungen wie Pyruvat oder aus H2. Die Fixierung von N2 bentigt
auerdem viel ATP:

Die Nitrogenase ist ein Eisen und Molybdn


enthaltender Multienzymkomplex, welcher die
zur Reduktion von N2 bentigten Elektronen je
nach Bakterienspezies von reduziertem Ferredoxin
(Abschn.20.4) oder von Flavodoxin, einem kleinen, dem Ferredoxin hnlichen FeS-Protein, bernimmt und in die dreistufige Reaktion einspeist:

271
21.1 Stickstoff-Assimilation aus N2 und Nitrat

Die Nitrogenase reduziert zudem H2O zu H2, das


mit Diimin reagiert, um wiederum N2 zu bilden:

21

Dieser nicht unterdrckbare Leerlaufzyklus produziert pro mol N2, das fixiert wird, etwa ein mol
H2:

Photosystem
oder oxidativer
Elektronentransport

Die Hydrolyse von ATP ermglicht die Elektronenbertragung vom Fe-Protein auf das Mo-Fe-Protein.
Zwei ATP binden an das reduzierte Fe-Protein; ihre
Hydrolyse ndert dessen Konformation, erniedrigt
damit das Redoxpotenzial und ermglicht die Elektronenbertragung auf das Mo-Fe-Protein.
Leghmoglobin

ist Nitrat, das gewisse Bodenbakterien durch Oxidation von NHC


4 produzieren. Bei Nitratmangel
verwenden die Pflanzen auch direkt NHC
4 . Bei der
Nitratreduktion wird NO
ber
zwei
Schritte
zu
3
reduziert;
die
dafr
bentigten
ReduktionsNHC
4
quivalente stammen aus der Photolyse von Wasser
(Abschn.20.4; Photosynthese):

Die Rhizobium-Symbionten enthaltenden


Wurzelknllchen sind rtlich. Die von
Knllchenbakterien befallenen Wurzelzellen
synthetisieren Leghmoglobin, das O2 bindet
und damit in den Rhizobien einerseits den
O2-Partialdruck niedrig hlt und die leicht oxidierbare Nitrogenase schtzt, andererseits der
oxidativen Phosphorylierung O2 zur ATP-Synthese zur Verfgung stellt (die Fixierung von
einem N2-Molekl kostet 16ATP!).

Pflanzen reduzieren NO


3 zu NH3 Die meisten

Pflanzen behelfen sich ohne symbiontische N2-fixierende Bakterien. Ihre wichtigste Stickstoffquelle

Ammoniumion
+
NHC
4 wird rasch entgiftet Das zelltoxische NH4
wird organisch gebunden:

Synthetase

Glutamin + -Ketoglutarat

2 Glutamat

272

21
2
3
4

Kapitel 21 Besonderheiten des Stoffwechsels von Pflanzen und Bakterien

Die Summe beider Reaktionen

NHC
4

C -Ketoglutarat C NAD.P/H C ATP


#

Glutamat C NAD.P/C C ADP C Pi


entspricht, abgesehen vom ATP-Verbrauch, der
Reaktion, ber welche Bakterien NHC
4 assimilieren:

+ -Ketoglutarat

6
7
8
9

Warum ist die Kombination der beiden ersten Reaktionen trotz ATP-Verbrauch wichtiger als diese

10

Denitrifizierung

Biologische Fixierung

(Nitratatmung)

11

ATP-unabhngige Reaktion? Die Glutamin-Synthetase hat eine fast 100-mal hhere Affinitt fr NH4+
(Km 0,1mM) als die Glutamat-Dehydrogenase. Die
Hydrolyse von ATP erlaubt, die Konzentration von
NHC
4 niedrig zu halten.
Die Assimilation von Nitrat und Sulfat luft in
den Chloroplasten ab. Als Transportform von Stickstoff zur Versorgung der oberirdischen Organe der
Pflanzen dienen Glutamin, Glutamat, Aspartat, bei
gewissen Pflanzen auch Allantoin und Allantoinsure.
Der Stickstoff durchluft wie CO2 und O2 (Photosynthese) einen globalen Kreislauf . Fakultativ
anaerobe Bakterien verwenden zur ATP-Synthese
Nitrat anstelle von O2 als Elektronenakzeptor in einer atmungskettenhnlichen molekularen Maschinerie; hierbei wird Nitrat zu N2 reduziert. Diese
anaerobe Atmung, genauer Nitratatmung, hat Denitrifizierung zur Folge, der Stickstoffkreislauf wird
damit geschlossen:

45 %
52 %

12
13
14
15
16
17
18
19
20

21.2 Schwefel-Assimilation

aus Sulfat

Mensch und Tier sind auf die S-haltige Aminosure


Methionin in der Nahrung angewiesen. Pflanzen
und Bakterien knnen hingegen Sulfat und andere
oxidierte anorganische Schwefelverbindungen als
S-Quellen verwenden. hnlich wie Nitrat muss
Sulfat hierzu reduziert werden; und wie bei der Reduktion von Nitrat zu NH3 stammen die Reduktionsquivalente bei Pflanzen aus der Photolyse von
Wasser und bei Bakterien aus der Oxidation organischer Verbindungen. Vor der Reduktion wird Sulfat

unter ATP-Verbrauch zu Adenosin-5-phosphosulfat (APS) aktiviert:

Die Reduktion fhrt in zwei Schritten ber HSO


3
(Sulfit) zu H2S (Schwefelwasserstoff); die unmittelbaren Elektronenbertrger in Pflanzen sind
reduziertes Glutathion (GSH) und Ferredoxin
(Abschn.20.4), in Bakterien sind es u.a. Thioredoxin (Abschn.19.4) und NADPH. Wie NH3 ist

273
21.3 Transport- und Speicherformen

auch H2S ein Zellgift, das sofort organisch gebunden


wird; in einer Pyridoxal-5-phosphat-abhngigen
Reaktion wird H2S mit O-Acetylserin zu Cystein
und Acetat umgesetzt. Cystein liefert den Schwefel
zur Synthese der meisten anderen schwefelhaltigen
Verbindungen.
21.3

Transport- und Speicherformen


von Kohlenhydraten, Lipiden
und Proteinen bei Pflanzen

Energietrger und Bausteine werden im Phloem der


Leitorgane an ihre Verbrauchsorte transportiert. Die
wichtigsten Transportmetaboliten sind Saccharose
und proteinogene Aminosuren. Ein intensiver
Transport von Aminosuren findet vor dem Laubfall aus den Blttern in die berdauernden Organe
der Pflanze statt.
Saccharose wird aus UDP-Glucose und Fructose-6-P synthetisiert Im Cytoplasma wird zu-

nchst Saccharose-6-phosphat gebildet, das zu Saccharose (Abschn.16.3) dephosphoryliert wird.


Pflanzliche Zellwnde
UDP-Glucose dient auch zur Synthese der
Cellulose (-1,4-verknpftes Glucosepolymer;
.Abb.5.4), die pflanzlichen Geweben Zugfestigkeit verleiht, sowie weiterer Zucker und Zuckerderivate in der Zellwand (Abschn.25.4).
Lignin, ein wasserunlsliches Polymer, das den
Sttz- und Leitgeweben der Pflanzen Druckfestigkeit verleiht, entsteht in der verholzenden Zellwand durch oxidative Polymerisierung
aromatischer Alkohole (Phenylalaninderivate;
.Tab.25.2).

Strke entsteht aus ADP-Glucose In Samen,

Knollen und gewissen Frchten bilden die Amyloplasten Strke aus herantransportierter Saccharose.
Die Synthese erfolgt hnlich wie die Glykogensynthese bei Tieren (Abschn.16.2); ADP-Glucose
bernimmt dabei die Rolle von UDP-Glucose:

21

Strke wird wie Glykogen phosphorolytisch abgebaut.


Terminologie
Plastiden: Zellorganellen in Pflanzen mit multiplen Kopien eines eigenen kleinen Genoms
und einer Doppelmembran, entwickeln sich
aus Proplastiden zu Chloroplasten, Amyloplasten, pigmenthaltigen Chromoplasten und
weiteren ineinander umwandelbare Formen.

Oleosomen speichern Triacylglycerole Die in

Plastiden synthetisierten Fettsuren werden an der


ER-Membran zu Triacylglycerolen verestert. In kleinen, mit einer einfachen Lipidschicht umgebenen
ltrpfchen werden die Triacylglycerole ins Cytosol
freigegeben. Sie finden sich in allen Zellen; in fettspeichernden Samen (bis 50% der Masse) werden
sie bei der Keimung zu Kohlenhydraten umgebaut.
Besondere Organellen, die Glyoxysomen, bauen
die Fettsuren durch -Oxidation zu Acetyl-CoA
ab (in den Mitochondrien der Pflanzen findet keine
-Oxidation statt). Aus zwei Acetyl-CoA entsteht
darauf im Glyoxylatzyklus Succinat (.Abb.21.1),
das ber den Citratzyklus der Gluconeogenese zugefhrt wird. Pflanzen transportieren keine Lipide,
fr den Transport werden Lipide zu Saccharose umgewandelt.
Speicherproteine finden sich in Samen
und Speicherorganen (Wurzeln, Knollen) Im

Unterschied zu Mensch und Tier, synthetisieren


Pflanzen besondere Reserveproteine, die ausschlielich als Speicher von Aminosuren dienen.
Nach Synthese der Proteine an der ER-Membran
schnren sich proteingefllte Vesikel direkt vom
ER ab. Die Samenkeimung lst die Synthese von
Endoproteasen, Carboxy- und Aminopeptidasen
aus, welche die Reserveproteine zu Aminosuren
hydrolysieren.

274

Kapitel 21 Besonderheiten des Stoffwechsels von Pflanzen und Bakterien

.. Abb.21.1Glyoxylatzyklus. Der Glyoxylatzyklus


erlaubt Pflanzen und
gewissen Bakterien, im
Gegensatz zu den Tieren,
aus Fettsuren Kohlenhydrate herzustellen. In
Pflanzen luft der Zyklus in
spezialisierten Organellen,
den Glyoxysomen, ab

21
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

21.4 Sekundrstoffwechsel

der Pflanzen

Stoffwechselwege, die weder Makromolekle noch


Energietrger synthetisieren, sind bei Pflanzen besonders zahlreich.
Mehr als 200000 pflanzliche Sekundrmetaboliten sind bekannt Die meisten davon treten

nur in bestimmten Pflanzengruppen und oft nur


unter bestimmten Bedingungen auf. Ihre Funktionen als Lockstoffe (Farb-, Duft-, Aromastoffe),
Schreckstoffe, Frahemmer, Bakterizide, Gifte oder
Hemmstoffe konkurrierender Pflanzen sind beraus vielfltig. In Anbetracht der Tatsache, dass zwei
Drittel aller Tierspezies Herbivoren sind und 30%
aller Pilzspezies, 1015% aller Bakterienarten, 45%
der bekannten Viren und smtliche Viroide Pflanzenpathogene sind, erweisen sich diese Schutzstoffe
zusammen mit Dornen, Stacheln und Zellwnden
als, wie ein Blick in die grne Natur zeigt, beraus
erfolgreich. Die wichtigsten Gruppen pflanzlicher

Sekundrmetaboliten werden im Folgenden mit


Beispielen vorgestellt.

Alkaloide sind die grte Gruppe sekundrer


Pflanzenstoffe Alkaloide enthalten Stickstoff (zu-

meist heterozyklisch gebunden) und reagieren daher alkalisch; sie werden zumeist aus Aminosuren,
insbesondere Tryptophan und Tyrosin synthetisiert.
Alkaloide dienen den Pflanzen als Bitterstoffe oder
Toxine.
Wichtige Alkaloide (.Abb.21.2, ):
Morphin, Hauptalkaloid des Opiums (aus
Schlafmohn, Papaver somniferum), wirkt auf
Zentralnervensystem, hochpotentes Analgetikum (Schmerzmittel),
Codein (Methylmorphin), wirkt auf ZNS,
hemmt Hustenzentrum, geringere analgetische Wirkung (und geringere Suchtgefahr) als
Morphin,
Lysergsurederivate (in .Abb.21.2 D-Lysergsure) Vorstufe der Ergotalkaloide aus
dem Mutterkorn (Secale cornutum, der

275
21.4 Sekundrstoffwechsel der Pflanzen

21

.. Abb.21.2 Alkaloide, einige wichtige Beispiele:


Morphin, hochwirksames Analgetikum, Suchtgefahr; Codein, Antitussivum (hustenstillendes Mittel);
D-Lysergsure, Vorstufe der Ergotalkaloide des
Mutterkorns auf Roggen, Lysergsure-Diethylamid
LSD wirkt halluzinogen; Cocain, Aufputschmittel,
Suchtgefahr; Vinblastin und Vincristin hemmen
Mitose, als Zytostatika verwendet; Nicotin; Chinin,
frher zur Prophylaxe und Therapie der Malaria
eingesetzt

Dauerform von Claviceps purpurea, einem auf


Roggen wachsenden Pilz); damit vergiftete
Personen erleiden Gefspasmen und deren
Folgen (Ergotismus, St. Antoniusfeuer im
Mittelalter); das knstlich hergestellte Lysergsure-Diethylamid LSD ist ein hochwirksames
Halluzinogen,
Cocain des Cocastrauches, wirkt auf ZNS,
Aufputschmittel,

Vinblastin und Vincristin aus Vinca rosea,


einer Immergrn-Art, hemmen die Ausbildung der Spindel-Mikrotubuli und damit die
Mitose, werden als Zytostatika verwendet,
Nicotin aus Nicotiana tabacum, wirkt erregend
und in hheren Dosen lhmend auf vegetative
Ganglien, wird auch als Schdlingsbekmpfungsmittel eingesetzt,

276

21
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 21 Besonderheiten des Stoffwechsels von Pflanzen und Bakterien

Chinin der Chinarindenbume, frher zur


Prophylaxe und Therapie der Malaria eingesetzt, heute nur noch ausnahmsweise verwendet,
Atropin aus Tollkirsche Atropa belladonna und
dem Stechapfel Datura stramonium, kompetitiver Antagonist von Acetylcholin, hemmt
das parasympathische Nervensystem; erweitert
Pupillen, gibt den Augen einen sympathischen
Ausdruck (daher das Epitheton belladonna),
Coniin, das Gift in Sokrates Schierlingsbecher,
stammt aus dem Gefleckten Schierling Conium
maculatum; verursacht aufsteigende periphere
Lhmungen (motorisch und sensibel),
Colchicin aus der Herbstzeitlose Colchicum
autumnale, hemmt die Polymerisierung von
Tubulin und dient zur Behandlung akuter
Gichtanflle,
Curare, das Pfeilgift amazonischer Indianer,
blockiert die Acetylcholinrezeptoren und fhrt
zu schlaffer Lhmung der quergestreiften Muskulatur,
Strychnin aus der Brechnuss Strychnos
nux-vomica, lst Krampfanflle aus, durch
Blockierung inhibitorischer Glycinrezeptoren
(Chloridkanle im Rckenmark) .

Auch Phenole erfllen vielfltige Funktionen Als

Phenole werden Pflanzeninhaltsstoffe bezeichnet,


die einen aromatischen Ring mit einer oder mehreren OH-Gruppen aufweisen. Dazu gehren u.a.
die Elektronenbertrger Ubichinon in der Atmungskette, Plastochinon und Phyllochinon in der
Photosynthese, Tocopherole (Vitamin E), Cumarine (frahemmende Bitterstoffe) und Flavonoide,
deren Glykoside (Anthocyane) als Bltenfarbstoffe
und UV-Schutzpigmente dienen.

Terpenoide sind Polyisoprene mit mannigfaltiger Struktur und Verwendung Terpene

werden aus Isopentenyldiphosphat synthetisiert


(.Abb.17.5). Die niedermolekularen Terpenoide
besitzen einfache Ringe oder Ringsysteme. Die Zahl
der C5-Einheiten reicht von 2 bis ber 500. Dementsprechend vielfltig sind die biologischen Funktionen und die praktische Verwendung der Terpenoide
(.Tab.21.1).

Fraschutz durch toxische Proteine


Zum Fraschutz setzen Pflanzen neben Sekundrmetaboliten auch toxische Proteine ein:
Lectine (binden an spezifische Zuckerreste),
wie Concanavalin A oder Weizenkeim-Agglutinin, binden an Oberflchenglykoproteine
des Darmepithels und fhren zu funktionellen Darmstrungen; Protease-Inhibitoren
wehren Herbivoren und Bakterien ab; gewisse
Kartoffelsorten und Samen von Leguminosen
sind erst nach Hitzedenaturierung der darin
vorkommenden Protease-Inhibitoren zum
Verzehr geeignet. Das hochtoxische Ricin, ein
Protein aus Ricinus communis, bindet an die
60S-Ribosomenuntereinheiten und blockiert
die Translation.

21.5 Phytohormone

Wie die tierischen Hormone sind die Phytohormone in geringen Konzentrationen (<1M) wirksam. Den Pflanzenhormonen eigen sind die folgenden Eigenschaften:
Sie sind zumeist Stoffwechselendprodukte; nur
wenige Peptidhormone (z.B. das Abwehrhormon Systemin) sind bekannt. Das Blhhormon Florigen ist das bislang einzige bekannte
pflanzliche Proteohormon.
Sie regulieren Wachstums- und Differenzierungsvorgnge und nur in wenigen Fllen den
Stoffwechsel des ausdifferenzierten Organismus.
Ihre Rezeptoren sind vielfach intrazellulr
lokalisiert.
Ihre Gewebe- und Organspezifitt ist gering
und ihr Wirkungsspektrum oft recht breit.
Sie sind mit den tierischen Gewebehormonen
zu vergleichen, Syntheseort und Wirkort liegen
oft nahe beieinander.

Die wichtigsten Phytohormone:


Auxine frdern das Streckungswachstum der

Zellen und damit das Lngenwachstum von


Spross und Wurzel, sie steuern die verschiedenen Tropismen der Pflanzen. Der wichtigste
Vertreter dieser funktional definierten Gruppe

21

277
21.6 Stoffwechselwege in Bakterien

ist das aus Tryptophan gebildete Indol-3-acetat.


Cytokinine sind Adeninderivate mit substituierter Aminogruppe; sie frdern die Zellteilung. ber Rezeptoren in der Zellmembran
und eine Signalkette aktivieren sie Transkriptionsfaktoren. Das Nitratreduktase-Gen ist eines
der Zielgene.
Gibberelline sind tetrazyklische, aus 4Isopren
(C5)-Einheiten aufgebaute Terpene. Sie frdern die Zellstreckung in der Hauptachse; in
Zwergsorten ist hufig die Gibberellinsynthese
gestrt. Gibberelline mobilisieren bei der Samenkeimung die Speicherstoffe, u.a. aktivieren
sie die -Amylase-Gene.
Abscisinsure ist ebenfalls ein Terpenderivat.
Als Antagonist der anderen Phytohormone
bewirkt sie den Ruhezustand von Knospen
und Samen.
Ethylen (H2C=CH2), ein Gas, beschleunigt
Blattfall und Fruchtreifung. Zudem wird bei
Verwundung oder mechanischer Belastung,
z.B. durch Windeinwirkung, vermehrt Ethylen
synthetisiert und damit die Bildung von Festigungselementen, welche die mechanische Widerstandsfhigkeit erhhen, gefrdert. ber einen Rezeptor in der Zellmembran deblockiert
Ethylen einen Signalweg, der ber spezifische
Transkriptionsfaktoren die ethylenregulierten
Gene aktiviert (.Abb.27.4).
Brassinolide sind Phytosteroide, die lokal als
Wachstumsregulatoren wirken; Rezeptor ist
eine Proteinkinase.

21.6

.. Tab.21.1 Terpenoide, einige Beispiele


Beispiel

Anzahl C5-
Einheiten

Funktion und
praktische
Verwendung

Thymol, Menthol,
Kampfer

Schreckstoffe

Sesquiterpene

Lockstoffe

Phytol

Verankerung
von Chlorophyll
im Protein

Taxol

Stabilisiert Mikrotubuli, hemmt


Zellzyklus; als
Fungizid und
Zytostatikum
verwendet

Gibberelline

Phytohormone

Steroide (in der


Regel als Glykoside vorkommend) Saponine

6 (23)

Detergenzien mit
antimikrobieller
Wirkung

Herzglykoside
(Digitalis
glykoside,
Strophantin)

6 (23)

Gifte gegen Tiere

Carotinoide

8 (24)

Carotine, Xanthophylle als akzessorische Photosynthesepigmente,


Farbstoffe,
Provitamin A

Dolichol

15

Trger von
Oligosacchariden
in ER-Membran
fr Glykoproteinsynthese

Polyterpene
Kautschuk
Guttapercha

500
(all trans)
100
(all cis)

Fraschutz
(im Milchsaft)
do.

Stoffwechselwege in Bakterien

Dank der Vielfalt ihres Stoffwechsels haben Bakterien alle erdenklichen kologischen Nischen besetzt. Fr den Menschen sind sie wichtig als Erreger
von Krankheiten und als dominanter Teil des Mikrobioms (Abschn.36.6), zudem finden Bakterien
seit Urzeiten biotechnologische Verwendung.
Gewisse Bakterien besitzen photosynthetisierende Systeme Die frher als Blaualgen bezeichneten Cyanobakterien benutzen unter aeroben

Bedingungen wie die grnen Pflanzen zwei chlorophyllabhngige Photosysteme mit H2O als Elek

tronendonor. Andere Bakterien besitzen jedoch nur


ein einziges Photosystem und verwenden anstelle
der Wasserspaltung reduzierende Verbindungen wie
H2S u.a.m. Die in extrem salzhaltigen Gewssern
lebenden Halobakterien (Archaea) benutzen dem
Sehpigment Rhodopsin hnliche lichtsammelnde
Pigmente . Bacteriorhodopsin erzeugt in einer

278

21
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 21 Besonderheiten des Stoffwechsels von Pflanzen und Bakterien

lichtabhngigen Reaktion einen Protonengradienten ber die Plasmamembran, welcher die Synthese
von ATP antreibt. Wie beim Sehvorgang dient Retinal als Photorezeptor, der bei Lichtabsorption
isomerisiert (11-cisall-trans; Abschn.29.2). Im
Unterschied zu den Chlorophyll-abhngigen Photosystemen werden Protonen durch die Membran
gepumpt, ohne dass Redoxvorgnge daran beteiligt
sind.

Bei Bakterien fhren verschiedene Wege zur


Kohlenstoffassimilation Cyanobakterien sind
wie die Pflanzen photoautotroph, andere Bakte-

rien nutzen anorganische Verbindungen nicht nur


als Synthesevorstufen, sondern auch als Quelle
chemischer Energie. Diesen chemoautotrophen
Organismen dienen anorganische Verbindungen
wie H2S, NH3, Fe2+ oder H2 als Reduktionsmittel
(Elektronendonoren). Wieder andere Bakterien sowie die Pilze sind heterotroph, d.h. auf die Zufuhr
organischer Verbindungen angewiesen, sei es aus
totem organischem Material (Saprophyten) oder
von lebenden Organismen (Symbionten, Parasiten;
hierzu gehren die fr Mensch, Tier oder Pflanze
pathogenen Bakterien).

Bakterien sind obligat aerob, fakultativ aerob,


aerotolerant anaerob oder obligat anaerob Die

aeroben Bakterien, deren Zellatmungssystem O2 als


terminalen Elektronenakzeptor verwendet, lassen
sich einteilen in obligate Aerobier, die unbedingt
O2 bentigen, und fakultative Aerobier, die mit O2
zwar besser wachsen, aber auch ohne O2 auskommen. Die Anaerobier beziehen chemische Energie
ber anaerobe Stoffwechselwege: Bei Grungen
dienen organische Verbindungen als H-Akzeptoren, wobei je nach Bakterium verschiedene reduzierte Endprodukte gebildet werden (Ethanol,
Propionsure, Milchsure, Buttersure, Methan);
bei anaerober Atmung nehmen anorganische Ver
2
bindungen die Elektronen auf (NO
3 , NO2 , SO4 , S,
). Aerotolerante Anaerobier bentigen kein
CO2
3
O2, knnen aber in Gegenwart von O2 wachsen.
Obligate (strikte) Anaerobier hingegen berleben
nicht in der Gegenwart von Sauerstoff, da sie ber
keine Schutzmechanismen gegen reaktive Sauerstoffderivate (Abschn.31.3) verfgen. Zu dieser
Gruppe gehren fr den Menschen wichtige Krankheitserreger wie Clostridium tetani, der Erreger des
Tetanus (Wundstarrkrampfs), sowie Clostridium

perfringens und andere Clostridienspezies, welche


den Gasbrand, eine gefrchtete Wundinfektion,
hervorrufen.
Gewisse pathogene Bakterien produzieren Toxine Die Cholera ist eine durch Vibrio cholerae

verursachte Infektionskrankheit des Darms. Hauptsymptom ist eine massive Diarrhe, die wegen Wasser- und Elektrolytverlust bald lebensbedrohend
wird. Verantwortlich dafr ist das Choleratoxin,
ein vom Bakterium ausgeschiedenes Protein. Darm
epithelzellen nehmen das Toxin auf; nach proteolytischer Abspaltung wirkt dessen A-Untereinheit
als Enzym, das ADP-Ribose von NAD+ auf einen
bestimmten Argininrest der -Untereinheit eines
G-Proteins bertrgt (Abschn.27.2). Die modifizierte -Untereinheit kann GTP nicht mehr hydrolysieren: Sie aktiviert die Adenylatcyclase, ohne
diese abschalten zu knnen. Die Konzentration von
cAMP kann daher bis auf das Hundertfache des
normalen Werts ansteigen. Die Epithelzellen reagieren mit einer entsprechend gesteigerten Sekretion
von Wasser und Elektrolytionen.
Der Diphtherieerreger Corynebacterium diph
theriae produziert ebenfalls ein Enzym. Das hochtoxische Enzym bertrgt, dem Choleratoxin hnlich,
ADP-Ribose von NAD+ auf den eukaryontischen
Elongationsfaktor eEF-2 und inaktiviert ihn (Abschn.10.5).
Das Botulinumtoxin
ist eine Protease; die
verschiedenen Stmme von Clostridium botulinum
scheiden mindestens sieben verschiedene Toxintypen aus. Die Bakterien vermehren sich unter anaeroben Bedingungen (Konserven!) in Fleisch, Fisch
oder proteinreichem Gemse. Das Toxin hemmt
die Freisetzung von Acetylcholin an cholinergen
Synapsen, indem es Proteine des SNARE-Komplexes (Abschn.22.3) spaltet und damit die Fusion
der synaptischen Vesikel mit der prsynaptischen
Membran verhindert. Das Botulinumtoxin (ein Enzym!) ist das strkste bekannte Gift; bei intravenser Verabreichung ist die fr den Menschen tdliche
Dosis 100ng. Erhitzen der kontaminierten Speisen desaktiviert das Toxin durch Denaturierung.
Therapeutisch wird das Toxin bei gewissen Formen
von Muskelkrmpfen und kosmetisch zur Glttung
von Hautfalten eingesetzt (Botox) .
Auf hnliche Weise hemmt das Tetanustoxin
von Clostridium tetani, dem Erreger des Wund-

279
21.6 Stoffwechselwege in Bakterien

starrkrampfes, die Ausschttung von Transmittern


an Synapsen im Rckenmark und fhrt damit zu
einer krampfartigen Lhmung der Gesichts- und
Rumpfmuskulatur.
Die Ursache von Nahrungsmittelvergiftungen
sind Toxine, die in den Nahrungsmitteln schon vor
deren Genuss produziert worden sind. Zumeist
ist es Staphylococcus aureus, der sich in unsachgem aufbewahrten Nahrungsmitteln vermehrt und
Membranporen bildende Proteine, die Enterotoxine, produziert. Nach Genuss der dadurch vergifteten Nahrungsmittel kommt es innerhalb kurzer
Zeit (1- 6h) infolge von Ionen- und Wasseraustritt
in den Darm zu Erbrechen und Durchfall.

Einige Bakterienarten produzieren medizinisch wichtige Antibiotika


Hierzu gehren
Streptomycin und hnliche Verbindungen, die

heute als Antibiotika der zweiten Reihe eingesetzt


werden. Makrolid-Antibiotika wie Erythromycin
besitzen groe Lactonringe mit angehefteten Zuckerresten. Die Tetracycline werden als Breitspektrum-Antibiotika gegen fast alle grampositiven und
gramnegativen Keime eingesetzt.
Die Stoffwechselleistungen gewisser Bakterien werden biotechnologisch genutzt Bakte-

rielle Prozesse liefern die Milchprodukte Kse und


Joghurt als auch eine Reihe weiterer Produkte der
Nahrungsmittelindustrie wie Essig, Zitronensure,
gewisse Vitamine (B1, B12, C) und Aminosuren
(Glutamat, ein die Umami-Geschmacksrezeptoren
ansprechender Geschmacksverstrker; Aspartat
und Phenylalanin zur Synthese des knstlichen
Sstoffs Aspartam; Abschn.29.3), sowie Dihydroxyaceton (Hautbrunungsmittel) und biologisch
abbaubare Polymere (Kunststoffe) wie Poly-3-hydroxybutyrat (PHB).
Gentechnisch vernderte Bakterien werden
weiter eingesetzt zur industriellen Produktion
menschlicher Proteine (Insulin u.a.m.) mittels
rekombinanter DNA (Abschn.39.9, .Tab.39.3)
und zur Synthese (insbesondere zur stereospezifischen Hydroxylierung) gewisser Steroidhormone.
Komponenten gewisser Bakterien, z.B. der Erreger
von Diphtherie, Tetanus und Keuchhusten, dienen
als Impfstoffe.
Enzymreaktoren mit isolierten bakteriellen
Enzymen stellen aus Maisstrke Fructose her, die
hufig als Sstoff benutzt wird, da ihre Skraft

21

hher ist als diejenige von Saccharose oder Glucose.


Weite Anwendung finden isolierte bakterielle Enzyme oder in Bakterien hergestellte rekombinante
Enzyme in der Gentechnik (Abschn.39.1). Abwasserreinigungsanlagen sind mikrobielle Kultursysteme, die organisches Material unter anaeroben
Bedingungen zu Methan und CO2 abbauen oder
unter aeroben Bedingungen zu Mikrobenzellen und
CO2 umwandeln.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517049-0
21.1 Stickstoff-Assimilation aus N2 und Nitrat
21.2 Schwefel-Assimilation aus Sulfat
21.3 Transport- und Speicherformen von
Kohlenhydraten, Lipiden und Proteinen
bei Pflanzen
21.4 Sekundrstoffwechsel der Pflanzen
21.5 Phytohormone
21.6 Stoffwechselwege in Bakterien
Weiterfhrende Literatur

281

IV

Molekulare Zellbiologie
Kapitel 22

Zellkompartimente und Proteinsortierung 283


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 23

Cytoskelett und molekulare Motoren 297


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 24

Zellzyklus; Kontrolle von Zellwachstum


und Zelltod305
Ph. Christen, R. Jaussi, R. Benoit

Kapitel 25

Zelladhsion, Zellkontakte und


extrazellulre Matrix315
Ph. Christen, R. Jaussi, R. Benoit

Kapitel 26

Stoffaustausch durch Membranen 323


Ph. Christen, R. Jaussi, R. Benoit

Kapitel 27

Rezeptoren und Signaltransduktion 331


Ph. Christen, R. Jaussi, R. Benoit

283

Zellkompartimente
und Proteinsortierung
Ph. Christen, R. Jaussi, R. Benoit

22.1

Kompartimenthnliche Strukturen in Bakterien 285

22.2

Kompartimente der Eukaryontenzellen 285

22.3

Mechanismen des intrazellulren Proteintransports 287

22.4

Proteintransport im Golgi-Apparat 290

22.5

Proteintransport zwischen Golgi-Apparat,


Zelloberflche und Lysosomen 290

22.6

Proteinglykosylierung whrend Transport


durch ER und Golgi-Apparat 291

22.7

Import von Proteinen in Mitochondrien,


Chloroplasten und Peroxisomen 292

22.8

Pfrtner-kontrollierter Transport (Gated


transport) durch die Kernhlle 294

22.9

Kontrolle der Faltung und der Lokalisierung von Proteinen


durch molekulare Chaperone und Proteasomen 295

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_22, Springer-Verlag Berlin Heidelberg 2016

22

284

1
22
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 22 Zellkompartimente und Proteinsortierung

Eukaryontische Zellen sind durch symbiontische


Vereinigung prokaryontischer Zellen entstanden.
Intrazellulre Kompartimente sind ein wichtiges
gemeinsames Merkmal aller Eukaryonten; zum
Teil sind sie durch diese Endosymbiose entstanden,
zum Teil durch Einstlpen der Zellmembran.
Terminologie
Endosymbiont: Zelle, welche in Wirtszelle zu
gegenseitigem Vorteil existiert.
Zellkompartiment: funktionell spezialisiertes,
membranbegrenztes Abteil in Zelle.
Cytoplasma: Raum einschlielich aller Organellen zwischen Zellmembran und Kern.
Cytosol: Cytoplasma mit wasserlslichem
Material ohne Organellen und Cytoskelett.

In bereinstimmung mit der Endosymbionten-Theorie synthetisieren eukaryontische Zellen


Proteine einerseits im Cytosol und andererseits in
den aus Bakterien entstandenen Mitochondrien sowie den in Pflanzen vorkommenden Chloroplasten
und anderen Plastiden (NB Pflanzenzellen enthalten Chloroplasten und Mitochondrien!).
Im Laufe der Evolution sind die meisten Gene
der endosymbiontischen Zellen ins Genom der
Wirtszelle bertragen worden, so dass nun die
entsprechenden Proteine nach ihrer Synthese
im Cytosol in die Organellen importiert werden
mssen. In eukaryontischen Zellen werden auer
Mitochondrien und Chloroplasten diverse andere
Organellen und auch Membranen mit spezifischen
Proteinen ausgestattet. Diese nichtcytosolischen
Proteine werden bei ihrer Synthese mit einem
Kennzeichen, einer Adresse, versehen, die ihren
Bestimmungsort festlegt. Diese Adressen sind kurze
lineare Signalsequenzen, rumlich strukturierte Signale in greren gefalteten Regionen des Proteins
oder posttranslational bertragene Strukturen.
Das primre Sortierungssignal (Zielerkennungssequenz, Prsequenz) der im Cytosol produzierten Proteine befindet sich am NH2-Terminus;
es erscheint daher bei der Synthese des Proteins zuerst an der Oberflche des Ribosoms und bestimmt
die Einschleusung in den sekretorischen Weg. Bei
diesen Proteinen kann die Membrantranslokation

schon whrend der Translation in Gang kommen


(cotranslationale Translokation), whrend sie bei
anderen Proteinen erst nach Abschluss der Translation stattfindet (posttranslationale Translokation).
Eine Signalpeptidase spaltet das NH2-terminale Signalpeptid bei seinem Erscheinen im Lumen des ER
bzw. der Mitochondrien oder Plastiden ab.
Terminologie
Processing eines Proteins: Gesamtheit der
posttranslationalen Modifikationen und der
Zielfindungsprozesse (Targeting)

Sortierungssignale knnen aber auch im Protein


verbleiben und mehrfach Verwendung finden:
Kernproteine werden nach ihrer Synthese im Cytosol in den Kern transportiert; bei der Kernteilung
in jedem Zellzyklus zerfllt die Kernhlle vorbergehend und der Importvorgang wiederholt sich bei
der Bildung der Tochterkerne.
Der cotranslationale Weg dient dem Einschleusen von Proteinen in die entsprechende ribosomenbindende Membran. Das raue endoplasmatische
Retikulum (ER) bindet cytoplasmatische Ribosomen; die innere Mitochondrienmembran und die
Thylakoidmembran binden die bakteriellen Ribosomen des Organelleninnenraums, welche die wenigen in den Organellengenomen codierten Membranproteine synthetisieren. Nach dem Transport
durch die ER-Membran werden die Proteine, gegebenenfalls mittels weiterer Adressen, durch einen
komplex gesteuerten Vesikeltransport (lat. vesicula,
Blschen) in der Zelle weiterbefrdert.
Terminologie
Die ribosomenbesetzte Membran des ER
erscheint im elektronenoptischen Bild als
raues ER; glattes ER hingegen trgt keine
Ribosomen.

Endosymbiontische Organellen (Mitochondrien,


Plastiden) und Peroxisomen verwenden den posttranslationalen Weg fr den Import von Protei-

nen. Die meisten Proteine der Mitochondrien und


Plastide werden vom Genom des Zellkerns codiert

285
22.2 Kompartimente der Eukaryontenzellen

22

und auf freien (nicht membrangebundenen) Ribosomen synthetisiert. Die Proteine werden erst nach
Abschluss ihrer Synthese von der Zielorganelle aufgenommen. In den meisten Fllen wird das Sortierungssignal whrend oder kurz nach der Translokation durch die Membran proteolytisch entfernt.

22.2 Kompartimente

22.1 Kompartimenthnliche

dere Plastiden dazu. Die Anzahl und Form dieser


Kompartimente variiert stark je nach Zelltyp. Beispielsweise bildet der Golgi-Apparat in Neuronen
ein komplexes Netzwerk rund um den Kern und
in sekretorischen Zellen mehrere lateral ber Tubuli verbundene kompakte Stapel von Zisternen. In
Pflanzenzellen sind viele einzelne Zisternenstapel,
die Dictyosomen, im gesamten Cytoplasma verteilt.
Die Kompartimentierung eukaryontischer Zellen erlaubt, gewisse Vorgnge und Bedingungen
durch rtliche Isolierung auseinander zu halten:
Replikation und regulierte Transkription der DNA
im Kern, Abbau von Makromoleklen bei saurem
pH in Lysosomen, oxidativer Abbau sehr langkettiger Fettsuren (>C24) mit Produktion von H2O2 in
Peroxisomen, Proteinglykosylierung und Bildung
von Disulfidbrcken im ER. Die Kompartimentierung ist auch Voraussetzung fr eine Reihe essenzieller biologischer Prozesse, welche auf unterschiedlichen Konzentrationen gewisser Stoffe und
elektrischer Ladungen auf den zwei Seiten einer
Membran beruhen: Atmungskette und oxidative
Phosphorylierung, Photosynthese sowie Membranund Aktionspotenzial bei Neuronen.

Strukturen in Bakterien

Bakterienzellen besitzen keine membranbegrenzten Kompartimente, verfgen aber ber Mechanismen zur rtlichen Anreicherung spezifischer
Molekle Im periplasmatischen Raum zwischen

der Zellwand und der Plasmamembran gramnegativer Bakterien befinden sich zahlreiche Proteine,
z.B. Hydrolasen, welche polymere Nhrstoffe verdauen und membrangngig machen. Die periplasmatischen Proteine verlassen das Cytoplasma der
Zelle auf dem gleichen Weg wie andere sezernierte
Proteine: Ein NH2-terminales Signalpeptid , das
kurz nach Beginn der Synthese an der Oberflche
des Ribosoms erscheint, bindet an Rezeptoren der
Zellmembran, worauf die wachsende Polypeptidkette durch komplex gebaute Proteinporen ins Periplasma geleitet wird. Das Signal wird in der Regel
schon whrend der Translokation des naszierenden
Proteins proteolytisch abgespalten.
Die bakterielle Zellmembran vergrert hnlich
wie Mitochondrien durch mehrfaches Einfalten ihre
Oberflche. Dadurch werden membrangebundene
Prozesse wie die lichtgetriebene ATP-Synthese
durch Bakteriorhodopsin (ein lichtabsorbierendes violett-rotes Protein gewisser Archaea) in vermehrtem Mae mglich. Eine weitere lokalisierte
Struktur bildet das kovalent an Komponenten der
Zellmembran gebundene Nucleoid aus dichtgepackter DNA, dessen Bindung an die Membran die
Verteilung der Tochtergenome bei der Zellteilung
erleichtert. Die Anzahl der Genome pro Zelle ist
bei Bakterien nicht so streng reguliert wie bei Eukaryonten. Bakterien enthalten je nach Wachstumszustand eine bis vier Genomkopien pro Zelle und
knnen zustzlich viele Kopien kleiner genetischer
Elemente, z.B. Plasmide, enthalten.

der Eukaryontenzellen

Alle eukaryontischen Zellen haben dieselben


Kompartimente: Zellkern, endoplasmatisches
Retikulum (ER), Golgi-Apparat, Lysosomen,
Mitochondrien und Peroxisomen
In Pflanzenzellen kommen noch Chloroplasten und an-

Topologie der Zelle und Dynamik der Organellen Die rumliche Anordnung von Kompar-

timenten versteht sich aufgrund ihrer Evolution.


Eine Organellengruppe (Kern, ER, Golgi-Apparat, Lysosomen und zugehrige Vesikel) entstand
durch Einstlpung und Ablsung von Zellmembranteilen ins Zellinnere (.Abb.22.1). Charakteristischerweise bilden diese Organellen, mit
Ausnahme des Kerns, eine strukturelle und funktionelle Einheit, mit regem Membranaustausch
durch Vesikeltransport.
Der Innenraum dieser Organellen und Vesikel ist topologisch dem
Zellauenraum gleichzusetzen.

286

Kapitel 22 Zellkompartimente und Proteinsortierung

uere

22
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

.. Abb.22.1 Hypothetische Evolution eukaryontischer Organellen. Die DNA einer Vorluferzelle war vermutlich an die Zellmembran gebunden und wurde in einer Einstlpung eingeschlossen. Spter verloren solche Einstlpungen den Kontakt zur
Zellmembran und entwickelten sich zum heutigen zusammenhngenden System, welches die doppelte Kernmembran und
das ER umfasst. Die Sekretion bestimmter Proteine drfte schon frh in der Evolutionsgeschichte zu membrangebundenen
Polyribosomen gefhrt haben. Auch in den heutigen eukaryontischen Zellen sind Polysomen an die Oberflche des ER und
des Kerns gebunden. Die Entstehung der Doppelmembranen von Mitochondrien und Chloroplasten wird ebenfalls durch
eine Einstlpung erklrt: ber Einstlpungen fanden die prokaryontischen Vorluferzellen dieser Organellen den Eintritt in
eukaryontische Wirtszellen. Whrend der weiteren Evolution ergab sich eine enge symbiontische Beziehung zwischen den
zwei vergesellschafteten Zellen; die eingewanderte prokaryontische Zelle spezialisierte sich zum Mitochondrium bzw. zum
Chloroplasten und anderen Plastiden

Mobile Membranlipide
Die Lipide des ER und der damit verbundenen Organellen (Golgi-Apparat, Lysosomen,
sekretorische Vesikel, Endosomen) und der
Zellmembran werden in einer Sugerzelle mit
einer Halbwertszeit von etwa einer halben
Stunde umgewlzt, d.h. vom ER in die Zellmembran gebracht und wieder zurckgefhrt.

Eine zweite Organellengruppe ist durch Symbiose


entstanden; prokaryontische Zellen wanderten
in eukaryontische Vorluferzellen ein. Durch das
nachfolgende Verlagern von Genen aus dem Genom der endosymbiontischen Zelle in das Genom
der Wirtszelle und eine Neuverteilung der Stoffwechselreaktionen entstand eine gegenseitige Abhngigkeit. Die Verlagerung der prokaryontischen
Gene in den Zellkern drfte mehrere Vorteile mit
sich gebracht haben: geringere Kopienzahl der
Gene pro Zelle, sexuelle statt mtterliche Vererbung, weniger DNA-Schden durch mitochondriale Reactive oxygen species ROS (Abschn.31.3)

sowie mit nucleren Genen integrierte regulatorische Kontrolle.


Im Gegensatz zu den Organellen des sekretorischen Weges (ER und damit verbundene Organellen) findet an den Membranen der endosymbiontischen Organellen kein Vesikelaustausch statt.
Dennoch sind auch die endosymbiontischen Organellen als dynamische Gebilde aufzufassen, kann
doch in einer Hefezelle durch einen schnellen, reversiblen Prozess ein einzelnes groes Mitochondrium
in hunderte kleinere Mitochondrien zerfallen. Der
Innenraum der Mitochondrien (Matrix) und Chloroplasten (Stroma) entspricht topologisch dem
Innenraum des ursprnglichen Endosymbionten.
Der Intermembranalraum entspricht dem Zellauenraum, bzw. dem prokaryontischen Periplasma.
Die Thylakoide der Chloroplasten sind von einer
zustzlichen Membran begrenzt und sind als abgeschnrte Einstlpungen der Innenmembran zu
verstehen.

287
22.3 Mechanismen des intrazellulren Proteintransports

22

22.3 Mechanismen

des intrazellulren
Proteintransports

Vier verschiedene Transportarten bringen neusynthetisierte Proteine an deren Zielort:


1. Cotranslationale Membraninsertion oder Membranpassage ins raue ER,
2. Vesikeltransport des sekretorischen Weges
(ER-Golgi-Zelloberflche),
3. Posttranslationale Translokation in Mitochon
drien, Plastiden und Peroxisomen (Abschn.22.7),
4. Pfrtner-kontrollierter Transport (Gated transport) durch die Kernhlle (Abschn.22.8).
In Fall1 und 3 wird das Protein durch eine Membran hindurch aus dem Zellinnenraum herausgebracht. In Fall2 und 4 verschiebt sich das Protein
innerhalb der Zelle zwischen verschiedenen Organellen; die Innen-auen-Topologie ndert sich nicht
(.Abb.22.2).
Bei der cotranslationalen Translokation bindet
das NH2-terminale Signalpeptid des naszierenden
Proteins ans Signal recognition particle (SRP) Das

SRP besteht aus einer kurzen RNA und sechs Polypeptiden. Es kann als dritte Untereinheit des Ribosoms aufgefasst werden: Es lagert sich an Ribosom
und Signalpeptid, unterbricht die Translation und
bindet an den SRP-Rezeptor an der ER-Oberflche
(.Abb.22.3) bzw. an der Innenseite der prokaryontischen Zellmembran. Sobald der Ribosom-SRP-Polypeptid-Komplex an den SRP-Rezeptor gebunden
hat und die Pore in der ER-Membran geffnet worden ist, dissoziiert das SRP weg, und die Translation der naszierenden Polypeptidkette wird fortgesetzt. Translation und Membrantranslokation des
Proteins sind nun gekoppelt: Das Polypeptid wird
weiter verlngert und gleichzeitig durch die Pore geleitet. Ein stark hydrophobes Segment (Stop-transfer-Sequenz) im naszierenden Protein bewirkt seine
Verlagerung aus der hydrophilen Translokationspore in die Lipiddoppelschicht der ER-Membran:
Es entsteht ein Transmembransegment des Proteins.
Ohne Stop-transfer-Sequenz wird das Protein von
Anfang bis Ende durch die Membran transloziert.
SRP-Komplex und Translokationspore knnen
whrend der Biosynthese eines Proteins auch erst

.. Abb.22.2 Intrazellulre Routen der Proteinverteilung. Mit


Ausnahme einiger in den Genomen von Mitochondrien und
Plastiden codierter Proteine werden alle Proteine im Cytosol
synthetisiert und anschlieend an ihre Bestimmungsorte in
der Zelle verfrachtet. Es existieren vier verschiedene Transportarten: Beim Gated transport werden bestimmte Proteine
zwischen dem Cytosol und dem Kern verschoben; die topologische Lage der Proteine ndert sich nicht. Beim cotranslationalen Membrantransport und beim posttranslationalen
Membrantransport wird das Protein durch eine Pore von der
einen Seite der Membran zur anderen befrdert. Beim Vesikeltransport bleibt das Protein auf derselben Membranseite,
wird aber in einem Vesikel von einem Kompartiment zum
anderen verschoben

beim Erscheinen eines proteininternen Signalpeptids aus dem Ribosom zusammengestellt werden.
Der NH2-Terminus befindet zu diesem Zeitpunkt
im Cytosol. Die nachfolgenden Teile des Proteins
werden jedoch in und durch die Membran geschleust, der COOH-Terminus kommt ins Innere
des ER zu liegen und der NH2-Terminus bleibt im
Cytosol. Enthlt das Protein mehrere Signal- und
Stop-transfer-Sequenzen, kann die Polypeptidkette
die Membran mehrfach durchqueren. Mittels geeigneter Abfolge von Signal- und Stop-transfer-Sequenzen knnen auf diese Weise verschiedene
Transmembran-Anordnungen der Polypeptidkette
entstehen.
Vesikel transportieren Proteine von einem
Kompartiment in ein anderes und zurck, aber
nicht durch Membranen Vesikel sind kleine

kugelfrmige, membranbegrenzte Rume mit


einem Durchmesser von 5075nm. Proteintrans-

288

Kapitel 22 Zellkompartimente und Proteinsortierung

1
22
3
4
5
6
7
8
9

und Translokation
.. Abb.22.3 Proteintranslokation durch die Membran des ER. Vor und nach dem cotranslationalen Transfer des Polypeptids
hlt ein Protein die hydrophile Pore geschlossen

10
11
12
13
14
15
16
17
18
19
20

.. Abb.22.4 Vesikeltransport von Proteinen. Proteine gelangen zunchst durch cotranslationale Translokation ins Innere des
ER. Darauf werden sie mittels Knospung und Fusion von Vesikeln weitertransportiert. Eine Translokation durch Membranen
findet dabei nicht mehr statt

portierende Vesikel entstehen durch Knospung


(Budding)
an der Membran des ER oder aus
den Membranen des sekretorischen, exocytotischen und endocytotischen Wegs. Die Vesikel
bringen ihre im rauen ER synthetisierte Proteinfracht an deren Bestimmungsorte und fusionieren (verschmelzen) dort mit der Zielmembran
(.Abb.22.4). Whrend des vesikulren Transports passieren die Proteine keine Membran.
Die Vesikel verschieben ihre Fracht (lsliche und

membrangebundene Proteine) blo von einer


Membranzisterne in die nchste.
Adressierung der Vesikel bestimmt den Transportweg Diffusion und GTP/ATP-getriebener

Transport entlang den Mikrotubuli (Abschn.23.4)


verteilen die Vesikel in der Zelle. Spezifische Adressen ermglichen den Vesikeln, ihre Zielmembran
zu erkennen. Eine allgemeine Adressierung entsteht
durch eine Oberflchenmarkierung, den Coat, der
nur auf bestimmten Vesikeln vorkommt: Clath-

289
22.3 Mechanismen des intrazellulren Proteintransports

rin-bedeckte Vesikel (Clathrin-coated vesicles)

besorgen den selektiven Transport von Transmem


branrezeptoren an die Zelloberflche. Clathrin ist
ein Proteinkomplex aus 3 schweren (je 180kDa)
und 3 leichten Ketten (je 25kDa) . Bei der Knospung der Vesikel aus der Plasmamembran entstehen
Vertiefungen, die Coated pits:

22

ARFGTP exponiert einen Fettsurerest des Molekls, der es in der Membran verankert. Nachdem
sich ein neues Vesikel von der Golgi-Membran
abgelst hat, verliert es den Coat: ARFGTP hydrolysiert sein GTP zu GDP, worauf ARFGDP den
Fettsurerest zurckzieht und zusammen mit dem
gebundenen Coatomer-Protein von der Membran
dissoziiert. Ein Guanin-Nucleotid-Freigabe/Austausch-Faktor (Guanine-nucleotide-releasing protein GNRP bzw. Guaninenucleotide-exchange factor GEF) katalysiert den Austausch von GDP gegen
GTP, das im berschuss im Cytosol vorliegt, und
regeneriert ARFGTP. ARF interagiert sowohl mit
Clathrin wie auch mit dem Coatomer-Proteinkomplex und kann daher das Coating und Uncoating
verschiedener Vesikeltypen antreiben.

Bindungsproteine (SNARE) identifizieren die


Zielmembran Fr die Zielfindung der freigesetz-

Coatomer-bedeckte Vesikel (Coatomer-coated


vesicles) besorgen den nichtselektiven Transport in

den Nahbereichen des ER und Golgi-Apparats. Das


Coatomer besteht aus einem Proteinkomplex von
700800kDa. Der ADP-Ribosylation factor ARF,
ein GTP-bindendes Protein aus der Unterfamilie
der kleinen monomeren G-Proteine, vermittelt das
Coating von Coatomer-bedeckten Vesikeln:

Alle Mitglieder der Familie der G-Proteine wirken


als Schalter (Heterotrimere G-Proteine der G-Protein-coupled receptors GPCR; Abschn.27.2): Sie
kommen in einer GTP- oder einer GDP-Form vor,
die sich funktionell voneinander unterscheiden.

ten coat-losen Vesikel sorgen v-SNARE (vesicular


Synaptosome-associated protein receptors) auf der
Vesikelmembran und t-SNARE (target-SNARE)
an den Zielmembranen (Target membranes). Das
Andocken von vSNARE (auf Vesikelmembran) an
passende t-SNARE (auf Zielmembran) bringt die
ATP- und GTP-abhngige Membranfusionsmaschinerie in Gang.
Falls die Plasmamembran die Zielmembran ist,
kommt es zur Exocytose: Der Inhalt der Vesikel
wird sezerniert (nach auen abgegeben). Diese Art
der Sekretion von Zellinhalt ist nicht auf Proteine
beschrnkt: Auch bei der bertragung der Nervenerregung an Synapsen verschmelzen die synaptischen Blschen des prsynaptischen Neurons mit
der prsynaptischen Membran und schtten den
Neurotransmitter in den synaptischen Spalt aus
(Abschn.29.1).

290

1
22
3
4
5
6
7
8
9
10

Kapitel 22 Zellkompartimente und Proteinsortierung

22.4 Proteintransport

im Golgi-Apparat

Ein NH2-terminales Signal gengt zur Sekretion


eines Proteins Manche Proteine wie Serumpro-

teine, Verdauungsenzyme oder Proteohormone


werden von der Zelle sezerniert. Die NH2-terminale
Signalsequenz dieser Proteine gibt den Ansto zur
cotranslationalen Passage durch die ER-Membran;
das Signalpeptid wird dabei abgespalten. Abknospen der Membranregion und Verschmelzen der
entstandenen Vesikel mit einer Zielmembran bringt
die Proteine vom ER zum Golgi-Apparat, von dort
weiter zur Zellmembran und ins Auenmilieu. Dieser Weg wird als Standardweg (Default pathway)
bezeichnet und bentigt auer dem Signalpeptid
keine weiteren Adressen im Protein. Als Ausnahme
besitzen die fr das ER oder den Golgi-Apparat bestimmten Proteine ein Rckhaltesignal. Die beteiligten Membranregionen samt den Proteinen, welche den Transport bewerkstelligen, werden mittels
rcklufiger Vesikel rezykliert.

11
12
13
14
15
16
17
18
19
20

Der Golgi-Apparat besteht aus einem Stapel flacher, untereinander Vesikel austauschender Zisternen Die aus dem rauen ER stammenden Pro-

teine werden in cis-Golgi-Zisternen aufgenommen


und via mediale und trans-Golgi-Zisternen weitergeleitet. Die Vesikel bewegen sich in der Randzone
des Stapels in unmittelbarer Nhe ihrer Zielmembran und gelangen ohne besondere Signale durch
Diffusion an ihr Ziel.

Im Golgi-Apparat werden Proteine mit Oligosacchariden modifiziert Whrend der Passage

durch die Zisternen des Golgi-Apparats werden


praktisch alle lslichen und membranstndigen
Proteine glykosyliert (Ausnahme: Serumalbumin).
Jedes Subkompartiment des Golgisystems und auch
des ER enthlt einen zelltypspezifischen Satz von
Glykosylierungsenzymen, welche in bestimmter
Reihenfolge die einzelnen Schritte der Mono- und
Oligosaccharid-Synthese katalysieren: Das Produkt
eines Enzyms ist das Substrat des nchsten Enzyms.
22.5

Proteintransport zwischen
Golgi-Apparat, Zelloberflche
und Lysosomen

Die Wege der konstitutiv sezernierten (1), der sekretorischen (2) und der lysosomalen Vesikel (3)
verzweigen sich beim Austritt aus dem Golgi-Apparat:
1. Der oben beschriebene Standardweg von Proteinen ohne zustzliches Signal fhrt an die

Zelloberflche. Membranproteine verbleiben


in der Zellmembran, bis sie durch Endocytose
internalisiert oder degradiert werden; lsliche
Proteine werden durch Exocytose ins Auenmedium sezerniert.
2. Der regulierte sekretorische Weg ermglicht
die Speicherung groer Mengen von Proteinen,
Peptiden und auch kleineren Moleklen (z.B.
Neurotransmittern in Nervenzellen), welche auf
ein Signal rasch abgegeben werden knnen. Die
Fusion dieser Vesikel mit der Zellmembran ist
reguliert, z.B. durch das Aktionspotenzial und
Ca2+-Ionen an den chemischen Synapsen (Abschn.29.1).
3. Im lysosomalen Weg erfolgt die Sortierung
der Proteine aufgrund eines Signals in ihrem
Oligosaccharidteil. Im Golgi-Apparat werden
die Oligosaccharide der fr Lysosomen bestimmten Proteine (Hydrolasen) mit Mannose-6-phosphat markiert. Damit binden diese
Proteine an Mannose-6-phosphat-Rezeptoren,
welche die Proteine in die Lysosomen leiten.
An der Zelloberflche werden durch Knospung
nach innen Vesikel, die Endosomen, gebildet.
Durch SNARE-gesteuerte Fusion mit den Gol-

291
22.6 Proteinglykosylierung whrend Transport durch ER und Golgi-Apparat

gi-Vesikeln, welche die Hydrolasen enthalten,


reifen Endosomen zu Lysosomen heran. Eine
ATP-getriebene Protonenpumpe in der Membran der lysosomalen Vesikel pumpt Protonen
nach innen. Das Innenmilieu wird auf pH5
angesuert, worauf die Hydrolasen vom Mannose-6-phosphat-Rezeptor dissoziieren. Die
freigesetzten Hydrolasen verdauen den Inhalt
der Lysosomen (Die lysosomalen Abbauenzyme
werden aufgrund ihres pH-Optimums im sauren Bereich als saure Hydrolasen bezeichnet).
Die niedermolekularen Abbauprodukte werden
via Membrantransport ins Cytosol befrdert.
Unverdauliche Reste werden von den Lysosomen durch Fusion mit der Plasmamembran aus
der Zelle gebracht. Die dabei mitentlassenen
lysosomalen Proteine werden mittels des Mannose-6-phosphat-Rezeptors wieder in eine Zelle
zurckgebracht; sie knnen auf diese Weise
auch von einer Zelle in eine andere gelangen.
22.6

Proteinglykosylierung whrend
Transport durch ER und GolgiApparat

Proteinglykosylierungen schtzen Zellen gegen


uere Einflsse Ein Drittel der neu synthetisier-

ten Proteine gelangt ins ER und wird dort modifiziert. Die cis-, medialen und trans-Zisternen des
Golgi-Apparats funktionieren wie ein Flieband: Sie
verfgen je ber einen bestimmten zellspezifischen
Satz von Enzymen, welche die im ER bertragenen
Oligomannose-Strukturen trimmen und mit Heteroglykanen versehen.
Die Oligosaccharidketten der Membranproteine, membranassoziierten Proteine und Glykolipide bilden einen Mantel rund um die Zelle, die
Glykokalix (.Abb.22.5). Weil Oligosaccharide
relativ rigide Strukturen bilden (im Gegensatz zu
Peptidbindungen haben glykosidische Bindungen
nur wenig Rotationsfreiheit) verwehrt die Glykokalix durch ihre Raumbeanspruchung ueren
Agenzien, wie z.B. abbauenden Enzymen, den
Zugang zur Zellmembran. Die stark hydrophilen
Zuckerreste an der Membranoberflche erschweren berdies das Umflippen der Glykolipide und
Glykoproteine auf die Innenseite der Membran und

22

.. Abb.22.5 Die Schutzhlle der Zelle: Glykokalix (Zellmantel) aus Glykoproteinen und Glykolipiden. Die Oligosaccharide der verschiedenen Glykoproteine und Glykolipide bilden
zusammen mit adsorbierten Proteoglykanen (nicht gezeigt)
die dichte Glykokalix-Schicht, welche die Zellmembran nach
auen abschirmt. Rezeptoren fr grere Molekle sind meist
selbst glykosyliert und ragen mit ihrer Erkennungsstelle fr
das Signalmolekl aus der Glykokalix heraus

tragen damit zur Aufrechterhaltung der Asymmetrie biologischer Membranen bei. Wie treten Makromolekle und Zellen trotz der Glykokalix in
Wechselwirkung mit der Plasmamembran? Bei vielen membranstndigen Rezeptoren ragt die ligandenbindende Domne des Rezeptors aus der Glykokalix heraus und ist ber ein stark glykosyliertes
Segment der Polypeptidkette mit der membrangebundenen Domne verbunden.
Proteine werden an bestimmten Sequenzsignaturen glykosyliert Die Signatur -Asn-X-Ser/Thr
veranlasst eine N-verknpfte (N-linked) Glykosylierung, sofern sie sterisch zugnglich ist:

292

1
22
3

Kapitel 22 Zellkompartimente und Proteinsortierung

Fr die O-verknpften (O-linked) Glykosylierungen besteht keine typische Signatur; in den meisten
Fllen ist der erste an einen Ser- oder Thr-Rest geknpfte Zucker N-Acetylgalactosamin; oft werden
an mehreren benachbarten Ser- und Thr-Resten
(Cluster) Glykosylierungen gefunden:

4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Auch diverse andere Aminosurereste knnen


O-verknpfte Oligosaccharide tragen. Kollagen ist
z.B. an Hydroxylysin-Resten mit Galactose oder
Glucose-Galactose2-Einheiten modifiziert.
Ein mannosereiches Oligosaccharid mit 14Zuckerresten leitet die N-verknpfte Glykosylierung
ein Bereits whrend der Translation werden im
rauen ER die N-verknpften Oligosaccharide ans

Protein gekoppelt. An der ER-Membran wird zunchst aus 2 N-Acetyl-Glucosaminresten und


5Mannoseresten eine Vorstufe aufgebaut, die ber
eine energiereiche Pyrophosphatbindung mit membranverankertem Dolicholphosphat verbunden ist.
Nach weiteren Modifikationen wird dessen Oligosaccharidteil auf Proteine bertragen (.Abb.22.6).
Die proteingebundenen Oligosaccharidketten
werden im Golgi-Apparat weiter modifiziert. Die
N-Glykosylierungen sind sehr variabel und knnen
120Zuckerreste enthalten. Ihre Zusammensetzung
hngt vom Vorhandensein der verschiedenen hochspezifischen Glykosylierungsenzyme im Golgi-Apparat ab. Jeder Zelltyp besitzt einen bestimmten Satz
solcher Enzyme, der zu einer zellspezifischen Signatur in Form komplexer Oligosaccharide an der
Zelloberflche fhrt.
Die menschlichen Blutgruppen-Haupttypen
(A, B und 0) sind beispielsweise auf genetisch vorbestimmte Glykosylierungsunterschiede der Erythrozytenmembran und verschiedener Epithelien
innerer Organe zurckzufhren. Die Blutgruppen

unterscheiden sich in den Spezifitten der von den


Blutgruppen-Genen codierten Glykosyltransferasen. Die Zellwnde der Darmbakterien (3001000
verschiedene Spezies) und vermutlich auch gewisse
Nahrungsbestandteile prsentieren viele verschiedene Oligosaccharide, ihre Abbauprodukte gelangen in die Blutzirkulation. Das Immunsystem des
heranwachsenden Organismus bildet Antikrper
gegen diese fremden Antigene. Hingegen wird ein
bestimmtes auf den eigenen Erythrozyten vorhandenes Oligosaccharid vom Immunsystem als krpereigenes Antigen erkannt; die Bildung spezifischer
Antikrper gegen die eigenen Antigene wird damit
ausgeschlossen (Abschn.32.6). Deshalb finden
sich in einem Individuum wohl Antikrper gegen
fremde Blutgruppenantigene, da diese bakteriellen
Oligosacchariden entsprechen, nicht aber gegen die
eigenen Blutgruppenantigene.
22.7

Import von Proteinen


in Mitochondrien,
Chloroplasten und Peroxisomen

Mitochondrien und Chloroplasten sind endosymbiontische Organellen, deren Gene zum grten
Teil ins nuclere Genom der Wirtszelle transferiert worden sind
Die Proteinaufnahme in

die Organellen endosymbiontischen Ursprungs erfolgt durch einen anderen Mechanismus als in die
vom ER abstammenden Organellen: Die Proteine
werden im Cytosol synthetisiert, von Rezeptoren
auf den Organellen gebunden und danach durch
deren energieabhngige Importmaschinerie aufgenommen. ATP-hydrolysierende Chaperone (Abschn.3.7) des Cytosols und der Organellen halten
die Proteine in entfalteter oder entfaltbarer Form,
sind beteiligt an der Membrantranslokation und
untersttzen die nachfolgende Faltung.

Amphipathische Signalpeptide fdeln die


mitochondrialen Proteinvorlufer (Precursors)
ber Rezeptoren an der Mitochondrienoberflche
in die Importmaschinerie ein Die etwa 20Ami-

nosurereste langen, vorwiegend NH2-terminalen


Importsignale (Prpeptide) enthalten hydrophobe
und basische, jedoch keine sauren Aminosurereste.
Die basischen Reste alternieren mit ungeladenen,
zumeist hydrophoben Resten, sodass sich eine

293
22.7 Import von Proteinen in Mitochondrien, Chloroplasten und Peroxisomen

22

.. Abb.22.6 N-Glykosylierung eines Proteins im ER. Dolicholphosphat mit seinen vielen hydrophoben Isopren-Einheiten
verankert das Oligosaccharid whrend dessen Synthese in der Membran. Die ersten Zuckerreste (2N-Acetylglucosamin- und
5Mannosereste) werden auf der cytoplasmatischen Seite der ER-Membran angefgt. Danach flippen die Molekle in der
Membran; das Oligosaccharid gelangt auf die luminale Seite der Membran. Dort werden weitere GDP- bzw. UDP-aktivierte
Mannose- und Glucosereste angehngt (nicht gezeichnet). Das verlngerte Oligosaccharid wird en bloc unter Abspaltung
seiner energiereichen Pyrophosphatbindung auf Asn-X-Ser/Thr-Sequenzen naszierender Polypeptidketten bertragen. Die
Amidgruppe der Asparaginseitenkette fungiert dabei als Akzeptor. Die mannosereiche (high-mannose) Glykosylierung wird in
der Folge zumindest teilweise wieder abgebaut. Zelltypspezifische Glykosidasen und Glykosyltransferasen modifizieren danach
die Oligosaccharide und erweitern sie im Golgi-Apparat mit zustzlichen Zuckerresten

amphipathische -Helix bildet (vgl. .Abb.3.8);


die Sequenz eines typischen mitochondrialen Importsignals ist z.B. NHC
3 -Met-Leu-Ser-Leu-Arg+-Glu-Ser-Ile-Arg+-Phe-Phe-Lys+-Pro-Ala-ThrArg+-Thr-Leu-. Das Signalpeptid bindet an den
Importrezeptor, der es an die Importmaschinerie
weiterleitet. Dieser Proteinkomplex schleust das
Protein in einer hydrophilen Pore durch beide
Membranen der Mitochondrien (.Abb.22.7).
Die Polypeptidkette bleibt whrend der Translokation entfaltet und wird im Innern der Organelle
von mitochondrialen Chaperonen empfangen. Die
Bindung der mitochondrialen Chaperone verhindert das Zurckdiffundieren der translozierenden
Kette; die Freisetzung derselben verbraucht ATP.

Der Importkomplex berbrckt die mitochondriale Auen- und Innenmembran und bringt sie so
nahe zusammen, dass die Translokation direkt in
die Matrix der Organelle fhrt. Von dort gelangt ein
Teil der importierten Proteine aufgrund weiterer Signale durch die mitochondriale Sekretionsmaschinerie zurck in die innere Membran oder in den
Intermembranalraum zwischen der inneren und der
ueren Mitochondrienmembran.
Peroxisomen besitzen kein eigenes Genom

Diese Organellen mit variabler Gre besitzen nur


eine einfache Membran. Sie entstehen durch Teilung
oder durch Abknospung aus dem ER. Zustzliche
Proteine werden in gefaltetem Zustand durch die
Membran importiert; das Signal ist meist eine Ser-

294

Kapitel 22 Zellkompartimente und Proteinsortierung

1
22
uere Membran,

3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Lys-Leu-Sequenz in der Nhe des COOH-Terminus.

Peroxisomen bauen oxidativ mit O2 als Elektronenakzeptor gewisse Verbindungen (z.B. lange Fettsuren mit >18C-Atomen) ab, welche die Hauptstoffwechselwege nicht bewltigen knnen. Dabei
bilden sie H2O2, das sie aber auch gleich entgiften
(Abschn.31.2). In Pflanzen sind sie an der Photorespiration beteiligt (Abschn.20.5).
22.8 Pfrtner-kontrollierter

Transport (Gated transport)


durch die Kernhlle

Die Kernhlle (Nuclear envelope) besteht aus zwei


ber Porenstrukturen verbundenen Membranen
Die innere Membran der Kernhlle enthlt

Proteine, welche an die Intermedirfilamente der


filzhnlichen nucleren Lamina binden. Der Raum
zwischen innerer und uerer Membran bildet ein
Kontinuum mit dem ER:

.. Abb.22.7 Import von Proteinen


in Mitochondrien und Chloroplasten. Die Topologie der beiden
Organellen ist hnlich, allerdings
bildet die Thylakoidmembran
mit dem Thylakoidraum einen
zustzlichen abgeschlossenen
Raum innerhalb der Chloroplasten.
Die Importmaschinerien beider
Organellen sind einander hnlich,
aber nicht homolog. Im vergrerten Ausschnitt wird das Beispiel
der besser bekannten Proteinimport-Poren der Mitochondrien
gezeigt. Whrend der Translokation
eines Proteins durch die beiden
Membranen bilden TOM (Translocator of outer membrane ) und TIM
(Translocator of inner membrane
) einen Komplex; freier
TOM mit andockendem Protein;
zustzlicher Porenkomplex fr
den cotranslationalen Einbau von
Proteinen in die innere Membran
und die Translokation in den Intermembranalraum. Die molekularen
Chaperone, welche die entfalteten
Proteine auerhalb und innerhalb
der Organelle binden, sind nicht
gezeigt

uere Kernmembran

295
22.9 Kontrolle der Faltung und der Lokalisierung von Proteinen

Die Kernhlle einer Sugerzelle besitzt 3000


4000Poren. Der Porenrand besteht aus je 8Multiproteinkomplexen; der ganze Porenkomplex enthlt 30 verschiedene Proteintypen und insgesamt
gegen 500Proteinmolekle. Kleine Molekle diffundieren ungehindert durch die Poren; Molekle von
>5kDa werden durch die Kernporenkomplexe in
beiden Richtungen unter Energieaufwand transportiert. Whrend der DNA-Synthese in der S-Phase des
Zellzyklus transportiert eine einzige Pore im Durchschnitt 100Histonmolekle pro Minute in den Kern;
bei raschem Wachstum mssen in der gleichen Zeit
ungefhr 6 ribosomale Untereinheiten den Kern in
der Gegenrichtung verlassen. Zudem werden laufend viele weitere Proteine transportiert. Die Poren
besitzen spezifische Import- und Export-Rezeptoren. Importsignale (Nuclear localization signals) sind
kurze basische Abschnitte von etwa 48Aminosuren mit Lysin-, Arginin- und Prolinresten; Exportsignale zeigen 4 nahe zusammenliegende hydrophobe
Reste, oft Leucinreste. Im Kern verbleibende (kernresidente) Proteine besitzen nur ein Importsignal,
wogegen Shuttle-Proteine wie die Histone sowohl
Import- als auch Exportsignale aufweisen. Auch reife
mRNA wird kontrolliert aus dem Kern exportiert.
Dank der groen Poren knnen alle Protein- und
RNA-Molekle in nativem Zustand einschlielich
fertig zusammengesetzter ribosomaler Untereinheiten die Kernhlle passieren.
22.9

Kontrolle der Faltung und der


Lokalisierung von Proteinen
durch molekulare Chaperone
und Proteasomen

Fehlerhafte oder falsch lokalisierte Proteine werden mit Ubiquitin markiert und durch Proteasomen abgebaut Die Biosynthese und Zielfindung

von Proteinen insbesondere von Membranproteinen sind fehleranfllige Vorgnge. Bei gewissen ins
ER importierten Proteinen erlangen blo 20% der
neusynthetisierten Molekle die native Faltungsform. Besondere Mechanismen zur Qualittskontrolle fhren deshalb falsch strukturierte oder lokalisierte Proteine dem Abbau zu. Fehlgefaltete Proteine
exponieren in der Regel hydrophobe Bezirke, die bei

22

korrekter Faltung ins Innere des Molekls zu liegen


kmen. Die exponierten hydrophoben Teile bewirken, dass die betroffenen Proteine in wsserigem
Milieu aggregieren. Die molekularen Chaperone
(Abschn.3.7) wirken der Aggregation entgegen:
Ein im Cytosol und auch im ER vorhandenes Hsp70
dient sowohl als Faltungshilfe wie auch als Kontrollpunkt zur Ausmerzung fehlgefalteter Proteine.
Entsteht die lsliche, native Struktur nicht innerhalb
einer begrenzten Zeit, werden sie durch Ubiquitinligasen mit mehreren Ubiquitinmoleklen gekennzeichnet (defekte ER-Proteine werden hierzu durch
eine besondere Glykosylierung markiert und aus
dem ER ins Cytosol exportiert) . Die Proteasomen erkennen Polyubiquitin-markierte Proteine
und bauen sie ab (Abschn.18.1). Die Proteasomen
eliminieren bis zu einem Drittel aller neu synthetisierten Proteine! Die Zelle betreibt demnach einen
groen Aufwand zur Kontrolle der korrekten Struktur und Lokalisierung der Proteine.
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517051-0
22.1 Kompartimenthnliche Strukturen
in Bakterien
22.2 Kompartimente der Eukaryontenzellen
22.3 Mechanismen des intrazellulren Proteintransports
22.4 Proteintransport im Golgi-Apparat
22.5 Proteintransport zwischen Golgi-Apparat,
Zelloberflche und Lysosomen
22.6 Proteinglykosylierung whrend Transport
durch ER und Golgi-Apparat
22.7 Import von Proteinen in Mitochondrien,
Chloroplasten und Peroxisomen
22.8 Pfrtner-kontrollierter Transport (Gated
transport) durch die Kernhlle
22.9 Kontrolle der Faltung und der Lokalisierung von Proteinen durch molekulare
Chaperone und Proteasomen
Weiterfhrende Literatur

297

Cytoskelett und molekulare


Motoren
Ph. Christen, R. Jaussi, R. Benoit

23.1

Actinfilamente298

23.2

Mikrotubuli299

23.3

Intermedirfilamente301

23.4

Motorproteine fr den intrazellulren Transport 303

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_23, Springer-Verlag Berlin Heidelberg 2016

23

298

1
2
23
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 23 Cytoskelett und molekulare Motoren

Das Cytoskelett, ein intrazellulres Proteingerst,


ist verantwortlich fr Form, mechanische Festigkeit
und rumliche Organisation der Zelle. Es besteht
aus groen teils linearen, teils vernetzten Proteinassoziaten aus wenigen Typen von Untereinheiten:
Actinfilamente und Intermedirfilamente sind
langgestreckte Polymere aus jeweils einem Typ von
Untereinheit, whrend Mikrotubuli aus Heterodimeren von - und -Tubulin aufgebaut sind. Alle
drei Filamenttypen knnen aus Tausenden von Untereinheiten bestehen und die ganze Zelle durchziehen. Sie knnen nach Bedarf, d.h. auf entsprechende Signale, durch Anlagern weiterer Einheiten
sich verlngern oder sich durch Depolymerisierung
verkrzen. Im Cytoskelett sind sie zu einem dynamischen Gesamtsystem verbunden. Zusammen
mit ATP-getriebenen Motorproteinen ist das Cytoskelett auch verantwortlich fr Formvernderungen
der Zelle und fr intrazellulre Bewegungen: Motorproteine transportieren zusammen mit Actinfilamenten und Mikrotubuli Proteine, Organellen und
Vesikel an deren Zielorte in der Zelle.
Terminologie
Assoziat: Geordnete Aneinanderlagerung
nativer Proteine (z.B. Multienzymkomplexe,
Cytoskelett)
Aggregat: Ungeordnete Aneinanderlagerung
fehlgefalteter Proteine (z.B. bei Proteinfehlfaltungskrankheiten)

23.1 Actinfilamente
Actinfilamente kommen berall in der Zelle vor,
konzentrieren sich aber im Zellcortex, der ueren Region des Cytoplasmas Actinfilamente

knnen in zwei- oder dreidimensionalen Netzwerken vorliegen.

Die Filamente bestehen aus flexiblen Actinpolymeren mit einem Querschnitt von 59nm. Monomeres
Actin ist ein asymmetrisches globulres Protein mit
zwei Domnen. Dadurch ergibt sich eine schraubenartige Packung im Filament und in der elektronenoptischen Darstellung der Eindruck zweier umeinander gewundener Polymerketten. Im Falle einer
Wechselwirkung mit Motorproteinen wie Myosin
sind die Filamente oft gebndelt (z.B. im Muskel;
Abschn.30.1).
Actincortex: eine flexible, kontraktile Hlle unter der Zellmembran Das Motorprotein Myosin

und weitere actinbindende Proteine vernetzen die


Actinfilamente. Nukleationszentren in der Plasmamembran organisieren den Actincortex. Die Signale
zur Reorganisation des Cortex durch neue Bndelung von Fasern stammen oft aus der Umgebung
der Zelle. Die Faserbndel des Actincortex knnen
die Zellmembran verformen und stachelartige bis
lamellenhnliche Ausstlpungen oder Einbuchtungen bilden.

299
23.2Mikrotubuli

23

Chromosomentrennung bei Zellteilung


Centrosom: Microtubuli Organizing Center
MTOC am Minus-Ende der Mikrotubuli einer
Zelle. Im Innern der diffusen Matrix des
Centrosoms befinden sich zwei Centriolen
(Basalkrperchen).
Centromer: Region der Chromosomen, wo die
Chromatiden zusammenhngen und bei der
Zellteilung die Spindelfasern ansetzen.
Kinetochor: Mehrschichtige Struktur auf dem
Centromer mitotischer Chromosomen, an welcher die Spindelfasern (ein einzelner Mikrotubulus in Hefen, 3040Mikrotubuli in Sugern)
ansetzen (.Abb.24.4).

Lamellenhnliche Ausstlpungen (Lamellipodien)


vermitteln das Kriechen von Zellen auf Unterlagen;
Einstlpungen leiten die Furchung der Zelle und deren Teilung in zwei Tochterzellen ein. Kontraktile
Actin-Myosin-Bndel knnen auch auerhalb des
Actincortex vorkommen.
23.2 Mikrotubuli
Die Mikrotubuli sind lange hohle Zylinder aus
Polymeren von -Tubulindimeren
Sie ha-

ben einem Auendurchmesser von 2025nm, sind


relativ steif und knnen von einem Ende der Zelle
bis zum anderen reichen. Sie bilden die grten zellulren Proteinstrukturen, und sie sind polar: Das
sogenannte Minus-Ende der Mikrotubuli ist stabil
ins kernnahe Centrosom eingebettet. Ihr Plus-Ende
mit den exponierten -Untereinheiten ragt in die
Peripherie, ins Cytoplasma hinaus; am Plus-Ende
knnen -Tubulindimere rasch anpolymerisieren
oder wegdissoziieren. Mikrotubuli knnen dadurch
vom Zellzentrum in die Peripherie hinauswachsen
bzw. sich von dort zurckziehen. Ein paar hundert
Mikrotubuli wachsen jederzeit vom Centrosom aus
ins Cytoplasma, einige davon bis zur Zellmembran.
Im Lichtmikroskop beobachtet man unregelmig
wiederkehrende ruckartige geradlinige Bewegungen
von Partikeln: Organellen werden von Motorproteinen den Mikrotubuli entlang transportiert.

Die
Geschwindigkeit der Elongation der Tubuli hngt
von der Konzentration der freien Tubulindimere
ab. Nach dem Erreichen eines bestimmten Ausmaes des Netzes ist die Konzentration der freien
Dimere derart gesunken, dass Depolymerisierung
und Polymerisierung einander die Waage halten.
Diese kritische Konzentration von freiem Tubulin
(20M 2mg mL1) entspricht etwa der halben Gesamtkonzentration. Die Halbwertszeit eines einzelnen Tubulus betrgt rund 10min; Tubulinmolekle
sind mit einer Halbwertszeit von ber 20h wesentlich stabiler. In intakten Zellen knnen Mikrotubuli
mit dem Mikroskop beobachtet werden, whrend
sie durch fluoreszenzmarkierte Tubulinmolekle
verlngert werden. Die Mikrotubuli wachsen mit
konstanter Geschwindigkeit gegen die Zellperipherie, schrumpfen aber pltzlich sehr rasch zurck.
Dieses Phnomen wird als dynamische Instabilitt
der Mikrotubuli bezeichnet. Die Instabilitt ist auf
die Hydrolyse des an -Tubulin gebundenen GTP
zurckzufhren (.Abb.23.1). In Gegenwart eines
nichthydrolysierbaren GTP-Analogs gewachsene
Mikrotubuli sind stabil. Nach der Polymerisierung
wird gebundenes GTP langsam zu GDP hydrolysiert. GDP-Tubulin am Plus-Ende dissoziiert vom
Tubulus. Rasch polymerisierende Tubuli, bei denen die Polymerisierung schneller abluft als die
Mikrotubuli sind dynamische Strukturen

300

Kapitel 23 Cytoskelett und molekulare Motoren

1
2
23
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Ruhender
Tubulus
.. Abb.23.1 Dynamische Instabilitt der Mikrotubuli. Durch die Bindung von GTP wird das Tubulindimer gestreckt und in
dieser Form ins Polymer eingebaut. Langsame Hydrolyse des tubulingebundenen GTPs fhrt zur gekrmmten GDP-Form des
-Dimers und destabilisiert dadurch den Tubulus. Der stabile Bereich des wachsenden Tubulus, in welchem das GTP noch
nicht zu GDP hydrolysiert ist, wird als GTP-Cap bezeichnet

GTP-Hydrolyse, besitzen an ihrem Plus-Ende eine


GTP-Kappe (GTP-Cap), welche den Tubulus vor
der Depolymerisierung schtzt. Verlangsamt sich
die Polymerisierung, geht die Kappe verloren und
der betroffene Tubulus depolymerisiert rasch.
Die dynamische Instabilitt der Mikrotubuli
ermglicht die Morphogenese der Zelle Die

Depolymerisierung der radial vom Centrosom


ausgehenden Mikrotubuli wird in der Zellperipherie gesteuert. rtlich beschrnkte Stabilisierung der Mikrotubuli verlngert Cytoskelett und
Zelle in einer bestimmten Richtung. Die Stabilisierung wird durch Wechselwirkungen zwischen
den Mikrotubuli und zustzlichen Proteinen wie
Tropomyosin erreicht. Die damit entstehende Polarisierung der Zelle ist je nach Zelltypus stabil
(z.B. Epithelzelle mit ihrer apikalen und basalen
Seite) oder vernderlich (z.B. Makrophagen, die
ihre Pseudopodien mal in dieser, mal in jener
Richtung ausstrecken).
Bei der Zellteilung verteilt der aus Mikrotubuli
gebildete Spindelapparat die replizierten Chro-

mosomen auf die beiden Tochterzellen (Abschn.24.3).

Modifikationen und Mikrotubuli-assoziierte


Proteine beeinflussen die Eigenschaften des Cytoskeletts Mikrotubuli (z.B. in Nervenzellen)

knnen durch enzymatische Acetylierung und


andere Modifikationen stabilisiert werden. Die
Modifikationen hngen zusammen mit der Bindung zustzlich stabilisierender Proteine. Diese
Mikrotubuli-assoziierten Proteine (MAP) bilden
eine zelltypspezifisch exprimierte Gruppe von Proteinen, welche die Mikrotubuli stabilisieren sowie
deren Wechselwirkungen mit anderen Zellkomponenten beeinflussen. Besonders im Nervensystem
finden sich MAP-1 und MAP-2 sowie tau ()-Proteine (Bestandteil von Proteinaggregaten bei Alzheimer-Krankheit). MAPs und tau-Proteine binden
auf der gesamten Lnge der Mikrotubuli und vermitteln die Verbindung zu anderen Komponenten
des Cytoskeletts. MAPs knnen auch Motorproteine
sein, welche unter Hydrolyse von ATP entlang der
Filamente wandern.

301
23.3Intermedirfilamente

23

23.3 Intermedirfilamente
Die Intermedirfilamente sind eine Familie schnurhnlicher, reifester Fasern Intermedirfila-

mente finden sich besonders reichlich in Zellen,


welche mechanischem Stress ausgesetzt sind. Sie
bilden Netzwerke zwischen Zell-Zellkontakten und
verleihen den Geweben mechanische Stabilitt.
Filamente im Vergleich
Durchmesser (nm)
Actinfilamente
(Mikrofilamente)

59

Intermedirfilamente

10

Mikrotubuli

2025

Die nuklere Lamina, ein annhernd kugelfrmiges lcheriges Netzwerk innerhalb der Kernhlle,
besteht aus Laminen, einer besonderen Gruppe von
Intermedirfilamentproteinen. Ausgehend von der
Kernlamina durchziehen Intermedirfilamente das
Cytoplasma bis in die Zellperipherie, in Geweben
besonders zu den interzellulren Kontaktstellen
(Desmosomen; Abschn.25.1). Das stabile und unlsliche Netzwerk der Intermedirfilamente bleibt
nach Extraktion der Zellen mit milden Detergenzien als mit fluoreszierenden Antikrpern frbbares
Muster bestehen, was ursprnglich zur Bezeichnung
Cytoskelett gefhrt hat (.Abb.23.2).

Intermedirfilamente bestehen aus langen,


apolaren Polypeptidhelices Im Gegensatz zu

den globulren Actin- und Tubulinmoleklen sind


die Intermedirfilamentproteine lange Faserproteine mit einem NH2-terminalen Kopf und einem
COOH-terminalen Schwanz. Der Mittelteil besteht
aus einer -Helix mit Heptad repeats (repetitive
Consensus-Sequenz von 7Aminosuren). Die Wiederholung hydrophober Aminosurereste in regelmigen Abstnden fhrt zur Zusammenlagerung
zweier -Helices, die sich schraubenartig umeinander winden (Coiled coils; .Abb.3.8). Die apolaren
Dimere lagern sich antiparallel und in der Lnge
versetzt zu Tetrameren zusammen und bilden grere Assoziate, welche ihrerseits zu einem helikalen 10-nm-Filament zusammentreten (.Abb.23.3).
Die meisten Intermedirfilamentproteine haben
zentrale Stabdomnen von etwa 310Aminosure-

.. Abb.23.2 Intermedirfilamentgerst. Das Bild zeigt eine


vierzellige Kolonie menschlicher Leberkarzinomzellen in
Kultur. Mit fluoreszenzmarkierten Antikrpern gegen Keratin,
einem weit verbreiteten Intermedirfilamentprotein, sind die
Intermedirfilamente dargestellt. Die vernetzten Filamente
durchziehen die Zelle von der Kernlamina bis zur Zellmembran

resten, welche die ausgedehnte -Helix bilden. Die


beiden Enddomnen sind jedoch variabel; Intermedirfilamentproteine zeigen Moleklmassen von
40kDa bis 200kDa (.Tab.23.1). Die Enddomnen
ragen oft aus dem Filament heraus und vermitteln die Wechselwirkungen mit anderen zellulren
Strukturen. In einer Zelle knnen mehrere Typen
von Intermedirfilamenten vorkommen, die verschiedenen Intermedirfilamentproteine assoziieren
jedoch nie zu gemischten Filamenten.
Die Intermedirfilamente sind sehr stabil. Sie
werden nicht dauernd umgebaut wie Mikrotubuli
und verschwinden nicht whrend der Zellteilung
wie Actinfilamente. Eine Ausnahme ist die nuklere
Lamina, die whrend der Mitose zerfllt, sobald sie
durch eine Zellzyklus-Kinase phosphoryliert wird.
Nach beendeter Zellteilung werden die Modifikationen durch Phosphatasen rckgngig gemacht und
die nuklere Lamina tritt wieder zu einem Netz zusammen.
Intermedirfilamente sind uerst reifest

Die verschiedenen Filamente verhalten sich bei mechanischer Belastung unterschiedlich. Mikrotubuli
lassen sich strecken; sie reien, sobald sie auf etwa
das Anderthalbfache ihrer Lnge gedehnt werden;
Actinfilamente sind etwas zugfester, aber auch sie
reien bei hherer Belastung. Die elastischen Inter-

302

Kapitel 23 Cytoskelett und molekulare Motoren

1
2
23
4
5
6
7
8
9

.. Abb.23.3 Aufbau der Intermedirfilamente. Die Zusammenlagerung der Untereinheiten des Intermedirfilaments nach
dargestelltem Muster luft spontan in weiteren nicht dargestellten Schritten bis zur Bildung von Protofilamenten. Acht dieser
Protofilamente bilden ein Intermedirfilament mit einem Durchmesser von etwa 10nm

10
11

.. Tab.23.1 Proteine der Intermedirfilamente


Gruppe

Komponenten

Lokalisierung

Keratine

13

Typ I (sauer) oder Typ II (neutral/


basisch)
4070kDa

Weit verbreitet, besonders in Epithelzellen und Derivaten (Haare, Hrner,


Hufe, Ngel)

Nuklere Lamine

Nuklere Lamina

14

Lamine A, B, C
6575kDa

Vimentin-hnliche Proteine

Vimentin 54kDa

Mesenchymale Zellen, hufig whrend Entwicklung

Desmin 53kDa

Muskel

Glial fibrillary acidic protein (GFAP)


50kDa

Gliazellen (Astrozyten und


Schwann-Zellen)

Peripherin 66kDa

Neuronen

Neurofilamentproteine NF-L, NF-M,


NF-H
60130kDa

Neuronen

12

15
16
17
18
19
20

Neuronale Intermedirfilamente

303
23.4 Motorproteine fr den intrazellulren Transport

23

medirfilamente sind jedoch die weitaus zugfestesten Filamente und sind hauptverantwortlich fr die
mechanische Stabilitt tierischer Zellen.
Wenig Intermedirfilamente in Pflanzen
Die mechanische Stabilitt der Pflanzengewebe ist durch die starren Zellwnde aus
Cellulose gewhrleistet; pflanzliche Gewebe
enthalten deshalb wesentlich weniger Intermedirfilamente als tierische.

23.4

Motorproteine fr den
intrazellulren Transport

Kinesine und Dyneine transportieren Organellen


den Mikrotubuli entlang Mit Fluoreszenzmikros-

kopie knnen Organellen beobachtet werden, wie sie


sich den Mikrotubuli entlang bewegen, umgekehrt
bewegen sich Mikrotubuli auf proteinbeschichtetem
Glas. Mit solchen Motilittstests konnten Dutzende
von Kinesinen und Dyneinen, den mikrotubuliassoziierten Motorproteinen, charakterisiert werden. Kinesine bewegen sich typischerweise zum Plus-Ende
(peripheren Ende) der Mikrotubuli, Dyneine zum Minus-Ende, d.h. gegen das Centrosom (.Abb.23.4).
Die weniger zahlreichen Dyneine besorgen den Organellentransport und sind Teil des Spindelapparats
whrend der Mitose. Die Kinesine bilden eine grere
Familie und spielen ebenfalls eine Rolle beim Transport von Organellen und bei Mitose und Meiose sowie beim axonalen Transport synaptischer Vesikel.
Ein spezifischer Rezeptor auf der Oberflche der Organelle bindet ber ein Adaptorprotein an ein Mikrotubuli-abhngiges Motorprotein, z.B. ein Kinesin
bei Vesikeln des endoplasmatischen Retikulums oder
ein Dynein bei Golgi-Vesikeln. Die verschiedenen
Motorproteine unterscheiden sich je nach zugehrigem Filament und Fracht (Cargo). Sowohl Dyneine
wie auch Kinesine bestehen aus zwei schweren und
zwei oder mehreren leichteren Polypeptidketten. Jede
schwere Kette enthlt einen globulren ATP-bindenden Kopf und einen Schwanz mit einer Reihe stabfrmiger Domnen.
Die Kopfdomnen der Motorproteine bestimmen Richtung und Geschwindigkeit der Bewegung Die Kopfdomnen sind ATPase-Motoren,

.. Abb.23.4 Motorproteine transportieren ihre Fracht den


Mikrotubuli entlang. Die Richtung des Transports wird durch
den Typ des Motorproteins bestimmt, die Art der Fracht durch
vielfltige Adaptorproteine

die an Mikrotubuli oder im Fall von Myosin an


Actinfilamente binden. Der Schwanzteil bestimmt
die Fracht, indem er mit spezifischen Adaptorproteinen interagiert.
Die meisten Motorproteine bewegen sich nur in
einer Richtung entlang den Mikrotubuli. In Axonen
beobachtet man kinesinvermittelten Transport von
Organellen, welche sich vom Zellkrper weg bewegen; Dyneine bringen ihre Fracht zum Zellkrper.
Das Dynein wird wie alle Proteine im Zellkrper
synthetisiert und muss danach in nichtfunktionellem Zustand zuerst in die Peripherie transportiert
werden, um dort Cargo aufzunehmen und zum
Zellkrper zu befrdern.

Spezialisierte Bndel von Mikrotubuli und


Motorproteinen bewegen Flagellen und Cilien
Auf der Oberflche vieler Zellen, z.B. von Pro-

tozoen oder von Lungenepithelzellen, befinden


sich haarhnliche Anhnge, die durch koordinierte
Bewegungen Flssigkeitsstrme an der Zelloberflche erzeugen oder die Zelle in wsserigem Milieu
fortbewegen. In den Lungen sind es etwa 109Cilien
pro cm2, welche den sezernierten Schleim zusammen mit abgestorbenen Zellen und eingeatmeten
Partikeln von den Lungen zum Rachen heraufbefrdern, von wo er hinuntergeschluckt wird. Eizellen
werden in hnlicher Weise durch den Eileiter vom
Ovar zum Uterus bewegt. Die Flagelle (lat. flagellum, Geiel), ein den Cilien verwandtes Organell,
treibt das Spermium zur Eizelle. Whrend die Cilien koordinierte peitschenartige Schlge ausfhren,

304

1
2
23
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 23 Cytoskelett und molekulare Motoren

schlngeln sich die lngeren Flagellen durch wellenfrmige Formnderungen vorwrts.


Die Grundstruktur beider Organellen ist das
Axonem, das sich ber die ganze Lnge einer Cilie oder Flagelle erstreckt und aus neun doppelten
Mikrotubuli besteht, die sich um ein zentrales Mikrotubulipaar scharen. Dynein verbindet die Mikrotubuli und krmmt unter ATP-Verbrauch die
Cilien und Flagellen. Die Basis fr das Axonem
bilden die Basalkperchen (Centriolen) mit neun
Tripletts von Mikrotubuli im Actincortex der Zelle.
Das Arrangement der Tripletts bildet das Muster fr
das Axonem. Aus jeweils zwei von drei Mikrotubuli des Basalkrperchens sprieen die axonemalen Mikrotubuli. Neue Centriolen entstehen durch
Duplikation aus den vorhandenen Centriolen. Die
Orientierung des Cilienschlags wird durch die Orientierung der Centriolen festgelegt.
Bakterielle Flagellen sind vollkommen anders
gebaut als Flagellen eukaryontischer Zellen. Das
bakterielle Flagellum ist ein helikal gewundenes
Rohr aus dem Protein Flagellin. Es wird an seiner
Basis im Bereich der Zellmembran von einem aus
einem Rotor und einem Stator gebildeten Motorkomplex in rotierende Bewegung versetzt und zieht
oder stt die Zelle je nach Drehrichtung, welche
hufig wechselt (bakterielle Chemotaxis; Abschn.27.3).
Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517242-0
23.1 Actinfilamente
23.2 Mikrotubuli
23.3 Intermedirfilamente
23.4 Motorproteine fr den intrazellulren
Transport
Weiterfhrende Literatur

305

Zellzyklus; Kontrolle von


Zellwachstum und Zelltod
Ph. Christen, R. Jaussi, R. Benoit

24.1

Konzept des Zellzyklus 306

24.2

Mitosen und Meiosen whrend des


Lebenszyklus der Organismen 307

24.3

Maschinerie des Zellzyklus 308

24.4

Wachstumskontrolle und Tumorbildung309

24.5

Kontrolle der Bereitschaft zur Teilung: Checkpoints 312

24.6

Apoptose, programmierter Zelltod 313

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_24, Springer-Verlag Berlin Heidelberg 2016

24

306

1
2
3
24
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 24 Zellzyklus; Kontrolle von Zellwachstum und Zelltod

Durch Zellteilung entsteht aus der befruchteten Eizelle ein erwachsener Mensch mit etwa 1014 Zellen.
Da whrend der Morphogenese gewisse Zellen kontrolliert absterben, werden wesentlich mehr als 1014
Zellen gebildet, bis ein Mensch zur vollen Gre
ausgewachsen ist. Auch nachher finden weiterhin
Zellteilungen statt: Die Teilung von Stammzellen
(Abschn.36.1) liefert Ersatz fr abgestorbene
Zellen; der Zellnachschub ist besonders intensiv in
den Geweben mit hohem Zellumsatz, wie Epidermis
(Oberhaut), Darmschleimhaut oder blutbildendem
Knochenmark. Die meisten differenzierten Zellen
eines adulten Organismus befinden sich jedoch im
Ruhezustand und teilen sich nicht mehr. Wachstumsfaktoren und andere uere Einwirkungen
knnen den Ruhezustand entsprechender pluripotenter Stammzellen beenden und sie erneut zur
Teilung bringen, z.B. bei der Wundheilung.
Wachstum und Zellvermehrung
Bei prokaryontischen und auch eukaryontischen Zellen wird der Ausdruck Wachstum
zumeist verwendet zur Bezeichnung der Vermehrung der Zellen durch Teilung und nicht
nur des Grerwerdens der einzelnen Zellen.

Eine lebende Zelle hat grundstzlich drei Mglichkeiten: Sie kann ruhen, in den Zellzyklus eintreten
oder sterben. Die Entscheidung zum Zelltod fllt
in der Regel, wenn die Zelle nicht mehr gebraucht
wird oder schdigend wirkt, indem sie sich z.B. am
falschen Ort befindet oder durch Mutationen die
Wachstumskontrolle verloren hat. Komplexe Mechanismen kontrollieren die Vorgnge, die zu Zellvermehrung oder Zelltod fhren. In vielen Fllen
knnen bei Ausfall eines bestimmten Kontrollmechanismus andere Mechanismen mit hnlicher Wirkung einspringen. Nie ist es ein einzelner Faktor,
der das berleben einer Zelle kontrolliert, sondern
immer ein Signalbermittlungs-Netzwerk, welches
zahlreiche Pro- und Kontra-Signale integriert. Fllt
die Entscheidung auf Zelltod, wird wenn mglich
der Vorgang des kontrollierten Zelltods (Apoptose) eingeleitet: Die Makromolekle der Zelle werden einem regulierten Programm gem abgebaut
und resorbiert. Falls der energieabhngige Weg der
Apoptose nicht mehr eingeschlagen werden kann,

zerfllt die Zelle in einem wenig kontrollierten Prozess, der Nekrose. Dabei entstehen toxische Produkte und schwer resorbierbare Zellfragmente, die
eine Entzndungsreaktion und die Einwanderung
von Phagozyten auslsen.
Redundanz
Produkte verschiedener Gene, welche dieselbe
Funktion oder sehr hnliche Funktionen
ausfhren knnen, werden als redundante
Proteine oder RNAs bezeichnet. Die Redundanz sichert die Zelle gegen Mutationen in
Genen, deren Proteine das Zellwachstum
kontrollieren.

24.1

Konzept des Zellzyklus

Der Zellzyklus ist ein Modell Zellen sind variable

Gebilde, die sich laufend ihrer Umgebung anpassen. Die Zellteilung verluft je nach Zelltyp unterschiedlich, und jede Zelle ist als ein Individuum zu
betrachten. Die Vergrerung der Zelle und deren
Teilung in zwei Tochterzellen werden daher nicht
einheitlich kontrolliert. Dennoch sind einige regulatorische Grundprinzipien festzustellen, die fr
praktisch alle Zellen zutreffen.

Der Zellzyklus luft in mikroskopisch und


biochemisch unterscheidbaren Phasen ab

Die vier Phasen sind die G1-, S-, G2- und M-Phase

(.Abb.24.1). G1 und G2 stehen fr Gap-Phasen


(Zwischenphasen), S fr Synthese und M fr Mitose. Ruhende (sich nicht teilende) Zellen, d.h. die
allermeisten somatischen Zellen, befinden sich im
Nebenschluss des Zyklus in der G0-Phase. Die G1und G2-Phasen knnen in den Zyklen bestimmter
Zellen, z.B. frher embryonaler Zellen, fehlen.
Terminologie
Somatische Zellen: Krperzellen auerhalb
der Keimbahn.
Keimzellen: Eizellen und Spermien, einschlielich deren Vorluferzellen. Keimbahn:
Zellfolge in der Individualentwicklung (Ontogenese), welche die Erbinformation direkt an
die Nachkommen weitergibt.

24

307
24.2 Mitosen und Meiosen whrend des Lebenszyklus der Organismen

In den Gap-Phasen wachsen die Zellen und stellen


die in der nchsten Phase bentigten Biomolekle
bereit; whrend der S-Phase wird die gesamte chromosomale DNA repliziert; und in der M-Phase werden die Chromosomen auf die zwei Tochterzellen
verteilt, die sich anschlieend trennen (Cytokinese).
Die Zellzyklusphasen auerhalb der Mitose werden
als Interphase zusammengefasst.

Frhe embryonale Teilungen laufen rasch


und ohne Vermehrung der Zellmasse ab Das

Eindringen des Spermiums aktiviert den Zyklus


der Eizelle, die darauf eine Reihe schneller Zyklen von nur je 3h durchluft. Whrend dieser
Furchungsteilungen halbiert sich die Zellgre bei
jeder Teilung; die Zellmasse wird nicht vermehrt,
es wird blo das Genom verdoppelt. Sobald bei der
Furchung die Gre somatischer Zellen des adulten Organismus erreicht wird, verlngert sich der
Zellzyklus um eine Wachstumsphase (in G1): Der
regulre Zellzyklus im adulten Suger dauert mindestens 24h.
24.2

Mitosen und Meiosen whrend


des Lebenszyklus
der Organismen

Diploide somatische Zellen durchlaufen Mitosen;


das haploide Genom der Keimzellen entsteht bei
der Meiose Bei der Mitose wird die DNA in der

S-Phase verdoppelt, worauf die zwei neuen Genome


auf die Tochterkerne und -zellen aufgeteilt werden.
Eine diploide somatische Sugerzelle wird somit
whrend der S-Phase kurzfristig zu einer tetraploiden Zelle, die bei der Cytokinese in zwei diploide
Tochterzellen gespalten wird; der tetraploide Kern
der G2-Zelle ist grer als der Kern der G1-Zelle.
Bei der Meiose finden im Gegensatz zur Mitose zwei Zellteilungen statt. Nach der Replikation
der DNA paaren sich die homologen Chromosomen. Gleichzeitig ist die DNA-Rekombination
massiv stimuliert; in den gepaarten Regionen werden Gene und Gensegmente ausgetauscht. Danach
werden in der ersten Zellteilung die Chromosomen
durch den Spindelapparat getrennt. In einer zweiten Zellteilung, die in einem verkrzten Zyklus ohne
DNA-Replikation abluft, werden die Chromatiden
voneinander getrennt.

24 h
Point of no return

.. Abb.24.1 Der eukaryontische Zellzyklus. Die schematische Darstellung eines typischen Zyklus von etwa 24h Dauer
deutet die relativen Lngen der einzelnen Phasen an, die
allerdings je nach Zelltyp verschieden sind. Die G1-Phase
kann sehr lange dauern, u.U. bis zum Absterben der Zelle. Bei
extrem langandauernder G1-Phase befindet sich die Zelle
nicht mehr im Zyklus sondern im G0-Zustand. G1, Gap (Lcke,
Zwischenphase)-Phase1; G2, Gap-Phase2; S, (DNA-)Synthese-Phase; M, Mitose; Point of no return, Zeitpunkt in G1-Phase,
ab dem der Zyklus unaufhaltsam weiterluft. Die Interphase
umfasst alle Bereiche des Zellzyklus auerhalb der Mitose

Chromosomen und Zellteilung


Ploidie: Anzahl der ungepaarten Chromosomen pro Zelle. Ein haploides menschliches
Genom enthlt 23Chromosomen; ein diploides deren 46, d.h. je einen mtterlichen und
vterlichen Chromosomensatz. Ein haploider
Chromosomensatz besteht aus 22Autosomen
und einem Geschlechts-Chromosom: dem
X-Chromosom oder dem Y-Chromosom (diploid weiblich: XX; diploid mnnlich: XY).
Meiose: Reduktionsteilung der diploiden Zelle
zu haploiden Tochterzellen.
Chromatid: einzelnes Chromosom mit nur einem DNA-Doppelstrang. Die zwei Tochterchromatiden werden whrend der Kondensation
der Chromosomen in der Mitose sichtbar.

Whrend des sexuellen Lebenszyklus lsen diploide und haploide Phasen einander ab Diploide

Zellen vermehren sich durch Mitosen; eine Meiose


bringt sie in die haploide Phase. Bei gewissen primitiven Eukaryonten, z.B. Hefen, vermehren sich auch
die haploiden Zellen durch Mitosen und knnen

308

Kapitel 24 Zellzyklus; Kontrolle von Zellwachstum und Zelltod

1
2
3
Cycline

24

CDKs

5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

den Hauptteil einer Zellpopulation einnehmen. Bei


vielen niederen Pflanzen ist die haploide Phase auf
eine kurze Periode des Lebens beschrnkt. Bei hheren Pflanzen und Tieren befinden sich nur noch
die Keimzellen in der haploiden Phase.
24.3

Maschinerie des Zellzyklus

Fluktuationen der Konzentration der Cycline


begleiten den Zellzyklus Nach der Zugabe von

Spermien durchlaufen befruchtete Seeigel-Eier eine


Reihe synchroner Zellteilungen. Eine fr analytische Zwecke ausreichende Menge synchronisierter
Zellen ist damit einfach zu erhalten. Die elektrophoretische Auftrennung der Proteine solcher Zellen
zu verschiedenen Zeitpunkten nach der Befruchtung zeigt, dass die Menge der meisten Proteine
entsprechend der Vergrerung und Vermehrung
der Zellen mit der Zeit zunimmt. Nur die Cycline
sind periodischen Konzentrationsschwankungen
unterworfen (.Abb.24.2): Sie verschwinden vor
bergehend und tauchen im nchsten Zellzyklus
wieder auf.
Eine Familie Cyclin-abhngiger Proteinkinasen treibt den Zellzyklus voran Proteinkinasen

kontrollieren nicht nur Stoffwechselvorgnge (Abschn.14.2, 16.2 und 17.4), sondern auch den Zellzyklus. Die Besonderheit der Zyklus-Proteinkinasen
ist, dass sie nur als Komplexe mit Cyclinen aktiv
sind, sie werden daher als Cyclin-dependent kinases
(CDKs) bezeichnet. Die regelmige Zu- und Abnahme der Konzentration der Cycline whrend dem
Zellzyklus wird begleitet von einer gleichermaen
fluktuierenden CDK-Aktivitt (.Abb.24.2). Wh-

.. Abb.24.2Die
Schwankungen der
Konzentration der Cycline und der Aktivitt
der CDKs (Cyclin-dependent kinases) im Zellzyklus. Das Verschwinden
und Wiederauftauchen
der Cycline wird leicht
verzgert durch die Aktivitt der CDKs, welche
die Mitose auslsen,
widerspiegelt

rend der Cyclingehalt der Zelle in der Interphase


stetig ansteigt, verndert sich die CDK-Aktivitt
sprungartig und bringt die Mitose in Gang.
Die CDK-Cyclin-Komplexe werden durch Phosphorylierung bzw. Dephosphorylierung gesteuert Die CDK-Cyclin-Heterodimere werden erst

aktiv, nachdem die T-Schleife (T-Loop) der Kinaseuntereinheit durch eine bergeordnete Proteinkinase phosphoryliert worden ist und eine dadurch
ausgelste Konformationsnderung des T-Loops die
aktive Stelle des Enzyms freigelegt hat. Eine zweite
bergeordnete Kinase wirkt dieser Aktivierung entgegen: Eine Phosphorylierung an der aktiven Stelle
der CDK verhindert die korrekte Orientierung des
gebundenen Substrats ATP. Das Fortschreiten des
Zyklus wird durch eine Phosphatase ausgelst,
welche die hemmende Phosphorylierung an der
aktiven Stelle entfernt. Die Aktivitt des CDK-Cyclin-Komplexes wird zudem durch hemmend wirkende Untereinheiten (z.B. p16 oder p21) reguliert.
Terminologie der Proteine
Mit p und einer Zahl, welche der Moleklmasse in kDa entspricht, z.B. p21, p53 etc.,
werden Proteine bezeichnet, die keinen anderen Namen tragen.

Heute sind rund 10 homologe menschliche CDKs,


etwa ebenso viele Cycline und eine Reihe inhibitorischer Untereinheiten bekannt. Fr den bertritt
von einer bestimmten Phase des Zellzyklus zur
nchsten sind jeweils Komplexe einer phasenspezifischen CDK mit einem phasenspezifischen Cyclin
zustndig (.Abb.24.3). Die Substrate der CDKs

24

309
24.4 Wachstumskontrolle und Tumorbildung

.. Abb.24.3 Aktivierung und Desaktivierung der Cyclin-abhngigen Kinasen (CDKs). Als regulatorisches Protein
bestimmt ein Cyclin nicht nur, ob die
Kinase aktiv ist, sondern auch, welche
Art von Substrat sie umsetzt. Deshalb
werden verschiedene Gruppen von
Zielproteinen am Anfang der S-Phase
und zu Beginn der Mitose phosphoryliert. Als zustzliche Kontrollmglichkeit besitzt die Kinase je eine die
Aktivitt positiv (am T-Loop) oder
negativ (an der aktiven Stelle, nicht
gezeigt) beeinflussende Phosphorylierungsstelle (zur Zeichenerklrung vgl.
.Abb.24.1)

CDK
Mitosen-Cyclin

Cyclin abgebaut

CDK
Cyclin
Cyclin abgebaut

CDK

variieren je nach Phase des Zellzyklus: Am G1-Sbergang werden vor allem Transkriptionsfaktoren zur Expression der Replikationsenzyme phosphoryliert. Zu Beginn der Mitose phosphorylieren
CDKs Effektorproteine, welche zu morphologischen
Konsequenzen fhren (Zerfall der Kernhlle durch
Phosphorylierung von Lamin, Chromosomenkondensation, Bildung der Mikrotubuli des Spindelapparats). Beim Abschluss einer Phase werden die
phasenspezifischen Cycline ubiquitiniert (Abschn.18.1) und rasch abgebaut.
Der Spindelapparat verteilt die Chromosomen
auf die Tochterzellen Die Mitose kann in mehrere

Phasen unterteilt werden, die sich im Lichtmikroskop aufgrund der Gestalt des Spindelapparats und
der Lokalisierung der kondensierten Chromosomen
unterscheiden lassen (.Abb.24.4). Motorproteine
befinden sich einerseits im Kinetochor, welches das
Chromosom mit den Kinetochor-Mikrotubuli verbindet, und andererseits zwischen sich gegeneinander bewegenden Mikrotubuli der inneren Spindelhlften. Die ueren Mikrotubuli der Spindel sind
ber Motorproteine mit Verankerungspunkten im
Actincortex in der Zellperipherie verbunden. Auf
diese Weise entstehen die Krfte, welche die Chromosomenhlften und Spindelpole whrend der Mitose auseinander ziehen.

24.4 Wachstumskontrolle

und Tumorbildung

Wachstumsfaktoren stimulieren die Vermehrung


von Sugerzellen Hefezellen knnen sich in Mini-

malmedien z.B. mit Glucose, Aminosuren und Vitaminen vermehren. Bei hheren Eukaryonten gengen diese Nhrstoffe zwar zum Erhalt der Zellen,
die Zellen beginnen sich aber erst zu teilen, wenn sie
durch Wachstumsfaktoren (Abschn.27.3) stimuliert werden. Der bergang vom Ruhezustand der
Zelle zum aktiven Zyklus wird als Start bezeichnet.
Startkinasen lsen den bergang zwischen G0/G1und S-Phase aus. In Hefezellen werden die Startkinasen aktiviert, sobald ausreichend Nhrstoffe zur
Verfgung stehen; in Sugerzellen wird der Phasenbergang durch Wachstumsfaktoren ausgelst. In
beiden Fllen aktivieren die vernderten Bedingungen intrazellulre Signalbermittlungsketten,
welche den Zellzyklus steuern.
Zell-Zell-Kontakte hemmen das Gewebewachstum Direkte Wechselwirkungen zwischen

benachbarten Zellen knnen ber Signaltransduktion und Zellzykluskontrolle das Gewebewachstum


einschrnken. In Kulturen normaler Zellen bringt
diese Kontaktinhibition das Wachstum zum Erliegen, sobald eine einlagige Zellschicht (Monolayer)
den Boden der Kulturschale vollstndig bedeckt;
Krebszellen hingegen haben die Kontaktinhibition
verloren und wachsen mehrlagig (Multilayer). An

310

Kapitel 24 Zellzyklus; Kontrolle von Zellwachstum und Zelltod

1
2
3
24
5
Kinetochor

.. Abb.24.4Chromosomensegregation
(Beispiel MeioseII). Zug- und Stokrfte
bringen die Chromatiden an ihre Zielorte. In
der ersten Phase werden bei stabiler Position
der Spindelpole die Chromatiden durch
Mikrotubuli der Spindelfasern auseinander
gezogen (Kinetochor: Struktur aus Proteinen
und DNA-Abschnitten, an welcher die Spindelfasern ansetzen). In der zweiten Phase
dehnt sich die gesamte Spindel zusammen
mit den Chromatiden seitlich aus. Gegen
Ende der Teilung werden die Chromatiden
noch weiter zu den Polen hin gezogen. Die
Wechselwirkungen zwischen den wachsenden Microtubuli der einen Spindelhlfte und
denjenigen der anderen rufen Stokrfte
hervor, welche die Spindel ausdehnen

7
8
9
10

Sto-

11
12
13
14
15
16
17
18
19
20

Wundrndern entfllt die Kontaktinhibition; von


den Rndern her wachsen Zellen ein und beheben
den Defekt.
In Krebszellen sind Gene der Wachstumskontrolle ausgefallen Sechs Merkmale sind typisch

fr einen malignen Tumor, alle haben einen engen


Bezug zur Kontrolle des Zell- und Gewebewachstums (.Tab.24.1). Grundstzlich wird angenommen, dass die Zellen eines Tumors von einer einzelnen mutierten somatischen Zelle abstammen.
Die genetisch identischen Nachkommen eines einzelnen Individuums werden als Klon oder Stamm
(Strain) bezeichnet.
Die hufigsten Mutationen bei der Initiation eines Tumors betreffen Gene, die zur Stabilisierung des

Genoms beitragen. Wird das Gen eines Proteins inaktiviert, welches an der DNA-Reparatur beteiligt ist,
erhht sich die Frequenz, mit der sich im Genom der
Zelle und ihrer Nachkommen Mutationen anhufen.
Mutationen, welche entweder Protoonkogene (Abschn.12.3) aktivieren oder Tumorsuppressorgene
(Abschn.24.5) inaktivieren, frdern die Entstehung
eines Tumors. Nach und nach verlieren die betroffenen Zellen die Kontrolle ber ihr Wachstum: Die
Promotionsphase des Tumors beginnt. In einem in
der Regel jahrelangen Prozess entsteht aus der ursprnglichen mutierten Zelle in Wechselwirkung mit
der Umgebung ein neues Gewebe, ein Tumor.
Gutartige oder benigne Tumoren (z.B. Adenome oder Myome) wachsen am Ort ihrer Entste-

311
24.4 Wachstumskontrolle und Tumorbildung

.. Tab.24.1 Sechs Merkmale maligner Tumoren; ein


Tumor wird erst maligne, wenn er alle sechs angefhrten Eigenschaften erworben hat
Merkmal

Molekulare Grundlage
(Beispiel)

Erhhte Eigenversorgung mit Wachstumssignalen

Erhhung von RAS (Onkoprotein)

Unempfindlichkeit auf
anti-Wachstumssignale

Verlust von pRB, Retino


blastoma-Protein (Tumorsuppressorprotein)

Vermeiden von Zelltod


(Apoptose)

berproduktion des berlebensfaktors


IGF1, Insulin-like growth
factor 1

Unbegrenztes Replika
tionspotenzial, Aus
bleiben der Alterung
(der Seneszenz)

Erhhte Aktivitt
der Telomerase

Permanente Blutgefbildung (Angiogenese)

Produktion eines Induktors fr VEGF, Vascular


endothelial growth factor

Invasion ins Gewebe


und Metastasierung

Inaktivierung von E-Cadherin (Zelladhsionsprotein)

hung, respektieren die Gewebegrenzen und bilden


keine Ableger. Bsartige oder maligne Tumoren
(Karzinome, Sarkome und Leukmien) hingegen
zeichnen sich durch invasives Wachstum aus, penetrieren die Gewebegrenzen und durchdringen die
Gefwnde: Tumorzellen gelangen in Lymph- und
Blutbahn und bilden Ableger (Metastasen).
Die Transformation einer normal wachsenden Zelle zu einer unkontrolliert proliferierenden
Zelle beruht auf vielfacher Vernderung somatischer DNA Endogene und exogene Faktoren fr-

dern die Transformation: Chemische Stoffe durch


Modifikation der DNA, genetische Prdisposition
durch mangelhafte DNA-Reparatur (Abschn.8.3),
ionisierende Strahlung, Bildung von O2-Radikalen
(Abschn.31.3) und Tumorviren durch Insertion/Deletion von DNA im Wirtsgenom (Abschn.12.3).

Neu gebildete Blutgefe stimulieren das


Wachstum Ein Tumor kann nur dann ber eine

Gre von rund einem Millimeter Durchmesser

24

hinauswachsen, wenn er durch neu gebildete Blutgefe versorgt wird (Angiogenese). Mit zunehmendem Abstand zu einer Blutkapillare nimmt die
Lebensfhigkeit von Zellen aus zwei Grnden ab:
Mangel an Nhrstoffen, aber auch an Wachstumsund berlebensfaktoren, welche vom Endothel
(einlagige Zellschicht der Kapillarwand) produziert
werden. Erwirbt der Tumor die Fhigkeit, Blutgefe z.B. durch Sekretion bestimmter Wachstumsfaktoren anzulocken, wird er besser versorgt und
wchst. In weiteren Schritten kann der Tumor die
Fhigkeit erwerben, Gefwnde zu penetrieren
und zu metastasieren.
Zur Zelltransformation wrden prinzipiell
sechs Mutationen gengen Meist sind allerdings

mehr Mutationen notwendig, um die sechs zur


malignen Transformation einer Zelle notwendigen
Eigenschaften (.Tab.24.1) zu erwerben. In der Regel werden Tumorzellen durch Zelltod (Apoptose;
Abschn.24.6) oder Immunreaktionen des Krpers
(Kap.32) eliminiert, bevor in einer Zelle alle zur
Transformation notwendigen Prozesse abgeschlossen sind. Nur im seltenen Fall, dass alle Abwehrmechanismen unterlaufen worden sind, entsteht ein
maligner Tumor.
Auch bei virusbedingtem Krebs (Abschn.12.3) erklrt die Beteiligung des Virus nur einen Teilaspekt des zellpathologischen Geschehens.
Die maligne Transformation von Zellen ist in jedem
Fall die Folge eines vernderten genetischen Programms in somatischen Zellen, welches das Resultat
eines ber mehrere Jahre dauernden, mehrstufigen
Geschehens mit mannigfachen Ursachen ist. Genetische, infektise (z.B. virale), ernhrungs- und
umweltbedingte Faktoren spielen dabei zusammen.
Die Entwicklung von Resistenz gegen Zytostatika wird durch die Heterogenitt des Tumorgewebes und die erhhte Mutationsfrequenz in
Krebszellen begnstigt Woher stammt die bei

einer Krebsbehandlung sich hufig entwickelnde


Resistenz des Tumors gegen verschiedenste Zytos
tatika? Whrend der oft jahrelangen Entwicklung
eines malignen Tumors erwerben die ursprnglich
monoklonalen Krebszellen zahlreiche weitere Mutationen, sodass sich der Tumor zu einem heterogenen, mosaikartigen Gewebe aus verschiedenartig
mutierten Zellklonen entwickelt. Die zahlreichen
Folgemutationen garantieren, dass Tumoren in der

Kapitel 24 Zellzyklus; Kontrolle von Zellwachstum und Zelltod

312

1
2
3
24
5
6
7

Regel einige Zellen enthalten, welche sich durch


eine gewisse Resistenz gegen ein bestimmtes Zytostatikum auszeichnen; die hohe Mutationsfrequenz der Tumorzellen ermglicht zudem, unter
dem Selektionsdruck der Behandlung die Resistenz
rasch zu erhhen.
Terminologie
Neoplasien: Neubildungen von Gewebe aufgrund von Verlust der Wachstumskontrolle:
Karzinom: von epithelialem Gewebe ausgehend, z.B. Lungenkarzinom
Sarkom: von mesenchymalem Gewebe ausgehend, z.B. Osteosarkom
Leukmie: von Blutvorluferzellen im Knochenmark ausgehend, z.B. akute lymphatische
Leukmie

8
9
10
11
12
13
14
15
16
17
18
19
20

.. Tab.24.2 Zusammenfassung der Zellzyklus-Kontrollpunktea


Zyklus
phase

Kontrollmerkmal

Reaktion der Zellzyklus-Maschinerie

G1

Zelle zu klein,
DNA-Schden

Stopp! Keine Aktivierung der Start-Kinase

DNA-Replikation
unvollstndig

Stopp! Keine
Vorbereitung zur
Aktivierung des CDKCyclin-Komplexes

G2

Zelle zu klein,
DNA-Schden

Stopp! Keine Aktivierung des CDK-Cyclin-


Komplexes

Chromosom
nicht an Spindel

Stopp! Keine Inaktivierung des CDKCyclin-Komplexes

Die Checkpoints, an denen durch Signale ausgelste mehrstufige Mechanismen den Ablauf des Zyklus
hemmen, sind angegeben.

24.5

Kontrolle der Bereitschaft


zur Teilung: Checkpoints

Kontrollpunkte (Checkpoints) berwachen den


korrekten Abschluss jeder Phase des Zellzyklus
Jede Zelle ist dauernd schdigenden Einfls-

sen ausgesetzt, welche die Integritt der DNA beeintrchtigen knnen. Treten DNA-Schden auf
oder stimmt z.B. die Verteilung der Chromosomen
in der Metaphasenplatte nicht, so stellen Sensoren
diese Unregelmigkeiten fest und bermitteln
entsprechende Signale in erster Linie an die Zellzykluskinasen. Der Zellzyklus wird vorbergehend
arretiert und damit Zeit zur Reparatur der Schden gewonnen. Bei Erfolg der DNA-Reparatursysteme wird der Zellzyklus wieder in Gang gesetzt;
bei irreparablen Schden wird der programmierte
Zelltod (Apoptose; Abschn.24.6) eingeleitet. An
den Kontrollpunkten werden nebst der Intaktheit
der DNA auch die Gre der Zelle und die korrekte Ausbildung des Spindelapparats berwacht
(.Tab.24.2).
Die Kontrollpunkte des Zellzyklus sind ber
negative Rckkoppelung gesteuert und reagieren
daher sehr empfindlich auf Schden Bei einem

Checkpoint sind theoretisch zwei berwachungsmodi mglich: die Feststellung der Intaktheit des
Genoms oder die Feststellung eines Fehlers. In der

Natur sind Checkpoints immer ber negative Rckkoppelung gesteuert und nicht ber ein positives
Signal, das besttigen wrde, dass alles in Ordnung
ist:
Feststellen eines Fehlers

Negativsignal
Zellzyklus stoppt
(Hochempfindlicher Kontrollmechanismus)
Feststellen der Intaktheit

Unter vielen Positivsignalen fehlt ein einziges.


Die geringe Verminderung der Positivsignale ist kaum
fassbar. (Untauglicher Mechanismus)

Betrachten wir als Beispiel eines Kontrollmerkmals


die Intaktheit der DNA: Mit Hilfe eines spezifischen Bindungsproteins ist es einfach, einen einzelnen Doppelstrangbruch zu registrieren und ein
Signal auszulsen. Tatschlich gengt ein einzelner
DNA-Doppelstrangbruch in einer Zelle, um das
Verlassen der G2-Phase zu blockieren!

313
24.6 Apoptose, programmierter Zelltod

Das Tumorsuppressorprotein p53 spielt eine


zentrale Rolle bei der Kontrolle des Eintritts in die
S-Phase Wenn eine Zelle mit beschdigter DNA

in die S-Phase eintritt, knnen whrend der Replikation der DNA Mutationen im Tochterstrang genetisch fixiert werden. In Tumoren ist das gehufte
DNA-Schden

p53

24

Auftreten von Mutationen oft auf Beschdigung


beider Allele des Gens des p53-Tumorsuppressorproteins zurckzufhren. Die Konzentration
dieses Proteins steigt in einer normalen Zelle bei
DNA-Schden rasch an und lst eine Blockierung
des G1-S-bergangs aus:

Synthese von p21

Hemmung von Zellzykluskinasen


Tendenz zur Apoptose erhht

Protein p53 fungiert hierbei als Transkriptionsfaktor, welcher die Synthese des Zellzyklusinhibitors p21
stimuliert; p21 bindet an die Zellzykluskinasen und
hemmt deren Aktivitt. Protein p53 frdert auerdem
den Eintritt der Zelle ins Apoptoseprogramm. Sowohl
das Verhindern der Akkumulation von Mutationen
wie auch die Eliminierung schwer beschdigter Zellen wirken der Kanzerogenese entgegen.

Das Tumorsuppressorprotein pRB wirkt als


Transkriptionsrepressor Defekte des Gens fr

pRB sind ursprnglich beim Retinoblastom, einem


seltenen Augentumor von Kindern, entdeckt worden. Analog zum p53-Gen finden sich Defekte des
RB-Gens allgemein bei Tumoren; in den meisten
Fllen ist wenigstens eines der beiden Gene mutiert.
In ruhenden Zellen ist pRB dephosphoryliert
und aktiv; es blockiert den Zellzyklus am G1-Checkpoint, indem es den Transkriptionsfaktor E2F bindet
und damit die Synthese von Proteinen verhindert,
welche die Zelle fr den bergang in die S-Phase
bentigt. Ein mitogener Stimulus bringt die folgende Regulationskaskade in Gang: Synthese von
G1-Cyclin Aktivierung der entsprechenden CDK
Phosphorylierung und damit Inaktivierung
von pRB Dissoziation des pRB-E2F-Komplexes
Proteinsynthese und bergang des Zyklus in
S-Phase. In analoger Weise ist pRB an der Regulierung des G0-G1-bergangs beteiligt.
Die Anzahl mglicher Teilungszyklen ist durch
das Altern somatischer Zellen (Seneszenz) begrenzt In Kultur gehaltene Zellen von Sugern

und Vgeln vermehren sich nicht unbeschrnkt. Fibroblasten aus Embryonen teilen sich etwa 50-mal.
Darauf geraten sie in eine lngere Ruhephase (G0),
nach der sie absterben. Zellen aus einem 40-jhrigen Menschen knnen sich noch etwa 40-mal teilen,
whrend Zellen aus einem 80-jhrigen Menschen

sich nur noch 30-mal teilen. Ebenso teilen sich Zellen von Tierarten mit einer kurzen Lebensspanne
in einer Zellkultur weniger oft als Zellen langlebiger Spezies. Zellen der Keimbahn und aus Tumoren vermehren sich hingegen praktisch beliebig, sie
sind unsterblich (immortal) und knnen sog. permanente Zell-Linien bilden. Eine mgliche Erklrung fr dieses Verhalten liefert die Beobachtung,
dass das Reparaturenzym Telomerase, das fr die
Erhaltung der Gesamtlnge der chromosomalen
DNA notwendig ist, nur in sich permanent teilenden Zellen aktiv ist (Abschn.8.2). Offenbar berwacht ein besonderer Mechanismus die DNA-Enden und stoppt bei Verkrzung der Telomere die
Vermehrung der Zellen durch forcierten Eintritt in
die G0-Phase.
24.6

Apoptose, programmierter
Zelltod

Der kontrollierte Zelltod spielt bei vielzelligen Eukaryonten eine wichtige Rolle whrend der Ontogenese und dient wie die Zellzykluskontrolle der
berwachung der Zellzahl, indem er nicht mehr
bentigte, beschdigte oder gealterte Zellen eliminiert. Insbesondere neigen auch Zellen, welche
den Kontakt mit ihren Nachbarzellen (fokale Adhsionspunkte; Abschn.25.1) verloren haben, zur
Apoptose. Die Plastizitt des Zentralnervensystems,
die Selektion von Eizellen und Spermien bei ihrer
Reifung und die Elimination autoreaktiver T-Zellen
sind Beispiele fr besondere Vorgnge im adulten
Organismus, an denen apoptotische Mechanismen
beteiligt sind.

Ein Teil der Zellen des primitiven Wurms


Caenorhabditis elegans stirbt whrend der Ent-

314

1
2
3
24
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 24 Zellzyklus; Kontrolle von Zellwachstum und Zelltod

wicklung gezielt ab Der etwa 1mm lange durch-

sichtige Fadenwurm C. elegans ist eine wichtige


Modellspezies der Entwicklungsbiologie. Die Entwicklung der insgesamt 959Zellen eines Tieres aus
der Eizelle kann im Lichtmikroskop verfolgt werden;
der Stammbaum jeder einzelnen Zelle ist bekannt.
Whrend der Entwicklung werden 131Zellen (14%
der Gesamtzahl) durch Apoptose entfernt: Der Kern
kondensiert, die Zellbestandteile werden abgebaut
und von den umgebenden Zellen resorbiert.
Beim Fadenwurm mit seiner berschaubaren
Anzahl von Zellen wurden Mutanten mit verstrkter oder auch reduzierter Apoptose entdeckt. Die
Proteinprodukte der mutierten Gene waren Caspasen, Proteasen mit einem Cysteinrest an der aktiven
Stelle, die Polypeptidketten COOH-terminal von
Aspartatresten schneiden, sowie mitochondriale
Proteine, welche den Zelltod frdern oder hemmen,
indem sie die Permeabilitt der Mitochondrien
fr bestimmte Proteine frdern (Bax) oder hemmen (Bcl2). Die Mitochondrien integrieren die
berlebens- und Todessignale der Zelle. Fllt der
Entscheid zum Zelltod, nimmt die Permeabilitt
der ueren Mitochondrienmembran rasch zu.
Zusammen mit einigen anderen Proteinen wird
Cytochrom c aus den Mitochondrien freigesetzt.
Dieser Bestandteil der Atmungskette wirkt auerhalb der Mitochondrien als Zellkiller: Cytochrom
c bindet im Cytosol an einen Proteinkomplex mit
Pro-Caspasen und aktiviert diese. Dadurch wird
eine proteolytische Kaskade ausgelst, die zum Abbau vieler Zellproteine fhrt und eine DNase aktiviert, die mit dem Abbau des Genoms beginnt. Die
Apoptose ist damit in Gang gebracht und wird mit
der Resorption der verdauten Zellbestandteile durch
die umgebenden Zellen abgeschlossen werden.
Ausma der Apoptose
Von den 1014 Zellen eines adulten menschlichen Organismus werden pro Tag um die
61010Zellen durch Apoptose ausgemustert,
d.h. im Schnitt eine von 2000Zellen.

Links auf
Springer Website:
http://www.springer.com/
life+sciences?SGWID=0-10
027-6-1517243-0
24.1 Konzept des Zellzyklus
24.2 Mitosen und Meiosen whrend
des Lebenszyklus der Organismen
24.3 Maschinerie des Zellzyklus
24.4 Wachstumskontrolle und Tumorbildung
24.5 Kontrolle der Bereitschaft zur Teilung:
Checkpoints
24.6 Apoptose, programmierter Zelltod
Weiterfhrende Literatur

315

Zelladhsion, Zellkontakte
und extrazellulre Matrix
Ph. Christen, R. Jaussi, R. Benoit

25.1

Stabile Zell-Zell- und Zell-Matrix-Kontakte 316

25.2

Kurzlebige Zell-Zell-Wechselwirkungen318

25.3

Extrazellulre Matrix (ECM)319

25.4

Pflanzliche Zellwand: Papier und Holz 321

Ph. Christen, R. Jaussi, R. Benoit, Biochemie und Molekularbiologie,


DOI 10.1007/978-3-662-46430-4_25, Springer-Verlag Berlin Heidelberg 2016

25

316

1
2
3
4
25
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Kapitel 25 Zelladhsion, Zellkontakte und extrazellulre Matrix

Die meisten Zellen hherer Organismen arbeiten


als Team in Geweben und Organen zusammen.
Die Zellen stehen dort in Kontakt mit der extrazellulren Matrix (Extracellular matrix ECM), einem
komplexen Geflecht sezernierter Faserproteine
und Glykane sowie daran gebundener Proteine der
Signalbermittlung. Die ECM hlt die Zellen und
die Gewebe zusammen. Direkte Zell-Zell-Wechselwirkungen stabilisieren die Gewebe zustzlich; die
zellinternen Netze der Intermedirfilamente und
Actinfilamente wirken dabei mit den Zell-Zell-Kontakten zusammen. Zelloberflchenproteine besitzen
Bindungsstellen fr die verschiedenen Komponenten der ECM. Viele Zellen neigen auerhalb ihrer
gewohnten Umgebung, d.h. ohne Verankerung in
der ECM, zur Apoptose.
Gewebetypische ECM
Die hauptschlichen Gewebe der Vertebraten
sind: Zentrales und peripheres Nervensystem,
Muskeln, Blut, lymphoides Gewebe, Parenchyme innerer Organe (Leber, Niere, Drsen),
Epithelien und Bindegewebe. Die extrazellulre Matrix (ECM) des Bindegewebes besteht
vorwiegend aus Kollagenfasern und enthlt
nur wenige Zellen. Im Gegensatz dazu werden
die flchigen Epithelien vorwiegend durch
direkte Wechselwirkungen zwischen den
Zellen zusammengehalten; die Zellen liegen
auf einer dnnen Schicht von ECM, der Basallamina. Die Zellen der Organparenchyme, d.h.
die spezifischen Zellen eines inneren Organs,
welche dessen Funktion ausben, sind in die
ECM eingebettet.

Pflanzliche Zellwnde sind eine besondere Form


der ECM, welche jede einzelne Zelle umschliet
und stabilisiert. Die pflanzlichen Zellwnde gaben
ursprnglich den Anlass zur Beschreibung der Cellulae (lat. Kmmerchen), die sich in Lichtmikroskopen gut darstellen lassen und in gewissen Fllen
sogar von bloem Auge sichtbar sind.

25.1

Stabile Zell-Zell- und ZellMatrix-Kontakte

Gewisse Zell-Zell-Kontaktstellen (Ankerverbindungen, Anchoring junctions) sind mit dem Cytoskelett oder der extrazellulren Matrix (ECM)
verbunden Anchoring junctions sind v.a. in

Epithelien gut ausgebildet (.Abb.25.1). Spezifische Ankerproteine verbinden gewisse Typen von
Zell-Zell-Kontaktpunkten mit dem Cytoskelett im
Zellinnern benachbarter Zellen (.Tab.25.1).
An denDesmosomen verbinden Plaques cytoplasmatischer Ankerproteine und Cadherine als Haftproteine die Keratinfilamente von Nachbarzellen.
Das Netzwerk der Keratinfilamente (spezifische Intermedirfilamente) stabilisiert damit das Gewebe
zellbergreifend:

An den interzellulren Adhrenzkontakten (Adherens junctions) vermitteln wiederum bestimmte


Cadherine die Verbindung zwischen den Actinfilamenten in den Adhsionsgrteln benachbarter
Zellen.
Hemidesmosomen
und fokale Adhsionspunkte verbinden die Zellen mit der extrazellulren Matrix. Auf der Zellinnenseite sind die
Hemidesmosomen wie die Desmosomen an Keratinfilamente gekoppelt, mit der ECM sind sie durch
Integrine verbunden (.Tab.25.1). An den fokalen
Adhsionspunkten sind Integrine in der Basallamina verankert und bilden durch ihre Verbindung

317
25.1 Stabile Zell-Zell- und Zell-Matrix-Kontakte

25

mit dem Actinskelett Ansatzstellen fr die Zellbewegung. Das Fehlen fokaler Kontakte kann Apoptose auslsen.
ab

Die Tight junctions dichten Epithelschichten


Diese Zell-Zellverbindungen bilden eine

Barriere dichter Nhte (Zonula occludens) zwischen


benachbarten Zellmembranen. Die Nahtstellen sind
mit eng aneinander liegenden Untereinheiten des
Tight-junction-Proteins besetzt. Beim Darmepithel
als Beispiel (.Abb.25.1) wird dadurch der Interzellulrraum vom Darmlumen abgeschlossen. Auerdem verhindern die Tight junctions, dass Proteine
der apikalen Zellmembran in die laterale oder basale
Membran diffundieren. Spezifische Proteine, z.B.
Transporter fr Metaboliten, sind damit auf bestimmte Oberflchenregionen der Zelle beschrnkt;
die apikal/basal Polarisierung des Epithels wird aufrechterhalten.

Adhsionsgrtel
Adherens junction

.. Abb.25.1 Zellvernetzung im Darmepithel. Die an den einzelnen Typen von Zell-Zell-Kontaktstellen beteiligten Proteine
sind in .Tab.25.1 aufgefhrt

In Pflanzen verbinden Plasmabrcken (Plasmodesmen) benachbarte Zellen Die dicken, star-

Durch Gap junctions knnen kleine Molekle


direkt von Zelle zu Zelle diffundieren
Gap

junctions finden sich in praktisch allen tierischen


Zellverbnden. Ionen und Molekle von weniger
als 1kDa knnen durch diese Proteinporen diffundieren. Bei einer Gap junction (Nexus) sind die
Membranen der beiden Zellen nur etwa 24nm
voneinander entfernt; die Connexone sind aneinander gelagert (Porendurchmesser 1,5
nm;
26Untereinheiten). Die elektrischen Synapsen,
z.B. im Herzmuskel, beruhen auf diesen interzellulren Kanlen.

ren Zellwnde der Pflanzen erlauben keine direkten


Verbindungen wie die Gap junctions zwischen zwei
benachbarten Zellmembranen. Pflanzenzellen kommunizieren durch feine fadenartige Plasmabrcken,
welche durch fusionierte Membranen benachbarter
Zellen entstanden sind und einen zentralen Desmotubulus aus glattem ER enthalten:

Kapitel 25 Zelladhsion, Zellkontakte und extrazellulre Matrix

318

.. Tab.25.1 Zell-Zell und Zell-Matrix-Kontakte bei Vertebraten und die daran beteiligten Proteine (die intrazellulre
Lokalisierung der hier beschriebenen Kontaktstellen ist in Abb.25.1 am Beispiel einer Darmepithelzelle gezeigt)

2
3
4
25
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20

Zell-ZellVerbindung
Desmosom

Cytoskelett

Ankerprotein

Intermedirfilamente

Adherens
junction
Tight
junction

Actinfilamente im
Adhsionsgrtel
Keine
Verbindung

Desmoplakin
Plakoglobin
(-Catenin)
und Catenine
Keines

Gap junction
Nexus
Zell-Matrix
Verbindung
Hemidesmosom
Fokale
Adhsionen

Keine
Verbindung

Keines

Connexin

Intermedirfilamente
Actinfilamente

Plectin,
BP230
Talin, Vinculin,
-Actinin,
Filamin

Integrin 64,
BP180
Verschiedene
Integrine

Obwohl die Plasmodesmen vllig anders gebaut


sind als die Gap junctions, zeigen sie eine hnliche freie Permeabilitt fr Molekle <800Da. Der
Durchmesser der Plasmodesmen ist mit 2040nm
wesentlich grer als derjenige der Connexon-Poren. Pflanzliche Zellen im Gewebeverband knnen
deshalb als ein ber Plasmabrcken zusammenhngendes Syncytium betrachtet werden, worin eine
Vielzahl von Zellen mit je einem eigenen Kern ein
gemeinsames Plasma teilen.