Sie sind auf Seite 1von 507



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 2

The following type of bonding is strongly directional in solids.


Vander Waal's







Answer & Explanation

Answer: Option D
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

Fog is an example of colloidal system of


solid dispersed in gas.


solid dispersed in liquid.


liquid dispersed in gas.


gas dispersed in liquid.

Answer & Explanation

Answer: Option C
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

Chromium molybdenum steel can not be welded using __________ welding.




electrical resistance




any of these

Answer & Explanation

Answer: Option B



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 2

No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

Speisses is a mixture of the following:


Arsenides of heavy metals.


Antimonides of heavy metals.


Arsenides & antimonides of heavy metals.


Iron, cobalt and nickel.

Answer & Explanation

Answer: Option A
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

10. Auto collimator is used to check






rotor balancing



Answer & Explanation

Answer: Option B



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 3

11. In troposphere (the weather domain), the temperature 't' at height 'h' above the sea
level in metres is given by (where, temperature at sea level is 15C and t is in C.)

t = 15 - 0.0065 h


t = 15 + 0.0065 h


t = 0.0035 h - 15


t = 15 - 0.0035 h

Answer & Explanation

Answer: Option A
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

12. A high pressure boiler generates steam at a pressure greater than __________
kg/cm2 .








Answer & Explanation

Answer: Option D
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

13. Evaporative cooling process employs a combination of cooling and humidification in

which the

sensible heat is added.


sensible heat is removed and the latent heat is added.


latent heat is removed.


sensible heat is added and latent heat is removed.

Answer & Explanation

Answer: Option B



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 3

No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

14. Which of the following is not an explosive ?








Lead azide

Answer & Explanation

Answer: Option B
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

15. Maxwell's thermodynamic relations applies to the


chemical systems in equilibrium.


mechanical systems in equilibrium.


irreversible thermodynamic processes.


reversible thermodynamic processes.

Answer & Explanation

Answer: Option A



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 4

16. Annealing ofwhite cast iron produces __________ iron.









Answer & Explanation

Answer: Option C
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

17. Resistance of an electrical conductor is proportional to its (where, l = length and A =

cross-sectional area of the conductor)





both 'a' & 'b'

Answer & Explanation

Answer: Option D
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

18. A solar cell converts the sunlight directly into __________ energy.








Answer & Explanation

Answer: Option B
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

19. If a nuclear reactor produces more fissile nuclear fuel than it consumes, then it is



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 4

called a __________ reactor.









Answer & Explanation

Answer: Option B
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

20. Wrought iron is never shaped by




cold working





Answer & Explanation

Answer: Option A



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 5

21. Powder metallurgy process does not make metal powder by








electrolytic deposition

Answer & Explanation

Answer: Option C
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

22. In the blast furnace, incorporation of water vapour in the blast gives the following

Increases the reducing potential of the gas.


Increases the flame temperature.


No significant change occurs.


Increases the hydrogen content in the metal.

Answer & Explanation

Answer: Option A
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

23. Pick out the wrong statement.


A ferromagnetic material becomes paramagnetic above the 'Curie



Permanent magnets are made of hard materials, whereas electromagnets

require soft magnetic materials.


Soft magnetic materials (e.g., pure iron) have higher permeability and low
hysterisis loss and coercive forces.


Tungsten steel and alnico are not hard magnetic materials.

Answer & Explanation



Chemical Engineering Basics - Chemical Engineering Questions and Answers Page 5

Answer: Option D
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

24. The usual energy consumption in electric arc furnace steel making is __________
KWh/ton of steel.

60 - 100


400 - 700


1200 -1500


2000 - 2300

Answer & Explanation

Answer: Option B
No answer description available for this question. Let us discuss.

View Answer



Discuss in Forum

25. Maximum permissible air velocity in pipelines is about __________ metre/second.








Answer & Explanation

Answer: Option B




26. Areaunderthestressstraincurveuptothe__________isreferredtoasthemodulusof














27. __________isthehardestoxideandishenceusedwherehighwearresistanceathigh














28. TitaniumalloysareweldedusingtheFollowingprocess:

















29. AnalloyofFe0.4%Cis














30. Amaterialinwhichtheatomsarearrangedregularlyinsomedirectionsbutnotinothers,














31. Inextrusionofmetals,whichofthefollowingstatementistrue?














32. Nuclearfissionofoneatomofuranium235producestheenergyequivalenttoabout














33. Whichofthefollowingparametersisnotresponsiblefortheheatlossfromahotsteam

















34. Machinabilityofhardalloysandtoolsteelsisimprovedby














35. Transformationrangeforferrousmaterialisthetemperatureintervalduringwhich














36. Maximumamountofthermalradiationisemittedatallwavelengthsatanyspecified














37. Incondensersusedinthermalpowerplants,steamisnormallyusedinshellsideand














38. Cobalt60isusedasasourceof__________inmedicaltherapy&industrial


















39. Absolutezeropressurecanbeattainedatatemperatureof














40. Theproductoutfromacupolaiscalled














41. NusseltnumberisrelatedtoGrashoffnumber(Gr)inturbulent&laminarflow














42. Ifthedemandforanitemistrebledandtheordercostisreducedtoonethird,thenthe





decreasesbyafactorof 3.









43. CopperdepositsarefoundinIndiaatthefollowinglocation:

















44. Electricalconductivitiesofsemiconductorsareoftheorderof__________ohm/cm.

10 3


10 3


10 15


l0 15







45. Corrosionofmetalscannotbepreventedbyits














46. Transitionfromlaminartoturbulentzoneinfreeconvectionheattransferisgovernedby














47. Themosteconomicalchannelsectionforthefluidflowistheoneforwhichthedischarge














48. Energyofthesunarisesmainlyfrom__________reactions.


















49. Whichofthefollowingfasteningdeviceshasaheadatoneendandanutfittedtothe














50. Suddenfallofatmosphericpressurebyalargeamountisanindicationofthe














6. __________ofairdoesnotincreasewithincreaseintemperature.














7. Sphericalshapeofmercurydropletsisduetoits














8. Subzerotreatmentofsteelisdoneto


















9. Airpetrolratioformaximumpowergenerationinsparkignitionengineisabout














10. Whichofthefollowingvariesasthesquarerootofoilpressureduringatomisationoffuel














11. Themostsuitablematerialofconstructionforasewertocarrysewageunderhigh














12. Fillermaterialusedinweldingshouldhave__________ascomparedtotheparentmetal














13. Oxygencylindersusedforautogenous(cutting/welding)purposesare


















14. Identifythecorrectstatement.














15. Dowthermisa














16. Tocounteractthebadeffectsofstrainhardeningonacoldformedpart,itmustbe














17. Thedewpointtemperaturelinesonpsychrometricchartsarestraightinclinedsloping














18. Galvaniccorrosioncannotbepreventedby


















19. Fireinfuelgaspipelinesisextinguishedmosteffectivelyby














20. Whichofthefollowingisthemostsuitableabrasiveforgrindinghightensilestrength














21. Casehardeningisnotdoneby














22. Satellitesburnoffduringreentrytoearth'satmosphere,becauseofthe














23. Withincreaseincompressionratio,thevolumetricefficiencyofaircompressor


















24. Neutronsarepresentinallatomsexceptthatof












25. Biologicalshieldinanuclearreactorisgenerallyprovidedtoprotectagainstthe














26. __________circuitismostcommonlyusedtomeasurestrainwiththehelpofastrain














27. WhichofthefollowingisnormallynotfoundinboththeS.I.(petrol)&C.I.(diesel)














28. __________isaspecialconstituentofchlorophyllwithoutwhichphotosynthesisisnot

















29. __________isusedasamaterialofconstructionforthebladeofpowersaw.














30. Duringdecarburisingofaplaincarbonsteel,thethicknessofferritelayergrowthis














31. Laserweldingiswidelyemployedinthe__________industries.














32. Drynessfactorofsteamisdefinedastheratioofthemassofvaporinthemixturetothe














33. Whichofthefollowingisusedtoproducedraughtinthelocomotiveboilers?














34. Temperbrittlenessofamaterialcanbefairlydetectedbythe__________test.


















35. WhenthewavelengthofincidentXraysincreases,theangleofdiffraction














36. Theelasticstrainenergyofaunitlengthofanedgedislocationascomparedtothatofa














37. Thespecificgravityofcoaldependsmainlyonits__________content.














38. Incaseofcondensers&evaporatorsoperatingundergiventerminalconditions,LMTD

















39. Normalisingdoesnot__________ofametal.














40. Whichofthefollowinghardnesstestsdoesnotmeasuretheindentationhardnessof














41. Withincreaseinannealingtemperature,thefollowingdefectdensitydecreases.














42. Carnotcycleisalsotermedastheconstant__________cycleinthermodynamics.














43. Thermistorsareusedin__________devices.


















44. Broachingtoolsareusuallymadeof














45. Theratiooftheshearstresstotheprincipalstressonaprincipalplaneis












46. Minimumsafedistancebetweentwoliquidfuelstoragetanksisequalto(where,H=













47. Propulsionofrocketfollowsfromthe














48. Inmultipasswelds,shotpeeningisdoneaftereachpassto


















49. Pickoutthecorrectstatement.














50. ConsidertheequilibriumA

(g) +B(g) =AB(g) .WhenthepartialpressureofAis10


thepartialpressureofBis10 3atmandthepartialpressureofABis1atm,the



10 5atm1




10 5(dimensionless)







1. Inchemicaldehumidificationprocess














2. Secondaryhardeninginsteelsarisesoutofthe














3. Drillsareusuallymadeof


















4. Tumblingistheprocessofimprovingthe__________ofthematerials/parts.














5. The__________ofadoubleactingreciprocatingpumpascomparedtothesingleacting














7. Firerefiningprocessisemployedincaseof














8. Largerlength&diameterwaterpipesaremadeby














9. Carbidetippedcuttingtoolsaremanufacturedbypowdermetallurgytechniquesandhave


















10. Thetemperatureatwhichferromagneticmaterialcannolongerbemagnetisedbythe














11. Bafflesprovidedontheshellsideofashellandtubeheatexchangeraremeantfor














12. Whenanisolatedthermodynamicsystemexecutesaprocess,














13. Brittlenessinducedduetothepresenceofsulphurinsteelcanbereducedbyadding


















14. Atomic__________ofanelementisawholenumber.














15. Theboiling&freezingpointsonanewlydefinedtemperaturescaleindegree'D'are














16. Whichofthefollowingisanunconventionalsourceofenergy?














17. Theproduct(s)ofroastingofasulphideoreis(are)














18. Whichofthefollowingareconsideredapplicationsofultrasonictesting?


















19. Suitabilityofsteelforitsuseincableisjudgedbyitsstrengthin














20. Hydrogeninliquidsteelsisdissolved














21. __________ironisproducedbytheannealingofwhitecastiron.














22. Themechanismwhichchangesthevalueofmanipulatedvariableinresponsetothe














23. FahrenheitandCentigradescaleshavethesamereadingsat














24. Whichofthefollowinglowmeltingalloycontainingbismuthandleadisusedforelectric


















25. Watertubeboileristheone,inwhich














26. Dephosphorisationofmoltenpigironisfavouredby














27. Inaneutralsolution



OH ionsareabsent.


bothH+andOH ionsarepresentinverysmallbutequalconcentration.









28. Whichofthefollowingcommonlyusedcondensertubematerialshasthelowestthermal


















29. Strainhardeningeffectinametalsubjectedtocoldworkingisduetothe__________














30. Acommondisinfectantusedinvillagewellsfordisinfectionofwateris














31. Moistairiscooledalongthelineofconstant__________,whenitispassedoveracold&














32. Whichofthefollowingmetalscannotbehotworkedatroomtemperature?














33. Primarydesignationofsteelisbasedonits


















34. Steelcontaininglowpercentageofnickel,chromium&tungstenaretermedasthe














35. Superheatingofsteamisdoneatconstant














36. Acylindericalrodsubjectedtoatensilestrainwithintheelasticlimitundergoesavolume













37. Thesurfacetensionofaliquid,atcriticaltemperatureis














38. Largescalefireonfuelgaslineisnormallyextinguishedby


















39. Brazingisthejoiningofmetals














40. Moistclimateisthemostfavourablefactorinthesiteselectionfara














41. Drysaturatedsteamcanbeconvertedintosuperheatedsteamby














42. Pickoutthewrongstatement.














43. Increasingsulphurcontentinpigirontendstomakeit


















44. Oxyacetylenereducingflameisusedwhilecarryingoutweldingon














45. M10indexofcokeindicatesits














46. Ganttchartsareusedforstreamliningthe














47. IntheBayer'sprocess,bauxiteisdigestedunderpressureusing














48. Circularcrosssectionmachinepartswhicharesymmetricalabouttheaxisofrotationare














49. Thesubstanceusedasasmokescreeninwarfareis


















50. Thesamevolumeofallgasesisrepresentativeoftheir














1. Intheformationofcermets,theratioofceramicmaterialtometallicmaterialisusually














2. Enzymesbelongtothecategoryof














3. Whatisthevalueofincludedangleofatriangularnotchformaximumdischarge?














4. Forseparatingsmallpiecesofmetalfromengineoilofacar,thebestseparating


















5. Heatflowacrossahollowsphereofinnerradius'r1'andouterradius'r2'isdirectly










6. Theultimatestrengthintensionforsteelis__________timestheultimatestrengthin














7. Theactivityofpurehydrogengasat1000Cand5atmpressure














8. Whichofthefollowingtransducersismostcommonlyusedforthemeasurementofshock

















9. Thepowerofalowcapacityprimemoverismostsuitablymeasuredbya__________














10. __________additionincreasesthedepthofhardnessofsteel.














11. Themostimportantconsiderationinvalueengineeringisthe














12. Limecontainsabout90%CaO.PercentageCaOpresentinlimestoneisabout














13. Themostimportantmaterialhandlingsysteminanintegratedsteelplantisthe


















14. Propertyofamaterialtoresistatensileforcewithoutgivingawayisameasureofits














15. Castironhastheuniquepropertyofhigh














16. Steelswithhighcarbonequivalenthavepoorweldability,becauseinthesesteelsduring














17. IfthepHvalueofasolutionofsodiumchlorideis7thenwhatwillbethepHvalueofthe












18. Measurementoftheareaoftheindentedsurfaceisnotinvolvedinthe__________


















19. Salvagevalueisthemostflexiblecriteriaforanalysingafinancialinvestment.'Salvaging'














20. Superconductioninmetalsisobservedatatemperatureof__________K.














21. Springbackinsheetmetalbendingdependsonthe














22. Theyieldpointinfatigueloadingcomparedtothatinstaticloadingisless.Theratioof












23. Whichofthefollowingisnotusedasafuelinrocketpropellaht?


















24. Hypo(sodiumthiosulphate)becauseofitscomplexformingbehaviourisusedin














25. Temperatureofhotgasesflowinginapipeismeasuredbyathermocoupleinsertedinthe














26. __________weldingwillbethemostsuitableforbuttweldingtwo20cmsthickboiler














27. Machinabilityofhardalloys&toolsteelsisimprovedby
































29. __________forcesdonotactincaseoffluids.














30. Whichofthefollowingisnotanaturalabrasive?














31. Thefunctionofanozzleprovidedinsteamturbineisto














32. Whichofthefollowingpolymersisobtainedbycopolymerisationofthreemonomers?














33. Siliconpercentageinthesiliconsteelusedforelectricalappliances/equipmentsis














34. Materialofconstructionoffoundarycrucibleis


















35. Titaniumcanbeeasilyweldedusing__________welding.














36. Feedcheckvalveisusedinsteamboilersto














37. Threeelasticconstantsforacompletelyanisotropicelasticmaterialwhichfollowsthe














38. Swagingisa/an__________operation.

















39. Pigironis














40. Classificationofmetalformingprocessesintohotandcoldworkingisbasedonthe

















1. Kinematicviscosityofwaterascomparedtothatofairis














42. Whichofthefollowingisthemostsuitableforremovingfineparticles(<1micron














43. Whichofthefollowingistheterminologyusedforthetemperatureatwhichthephase


















44. Puddlingprocessisusedforconvertingpigironinto














45. Additionof__________insteelcanhelpinincreasingthedepthofhardness.
















46. Onoffcontrol














47. Thetensileloadelongationcurveofametaldoesnotdescribe














48. Usualvalueoftheresistancesuitableforawireresistancestraingaugeis__________


















49. Permanentsetinamaterialisproducedbysubjectingitto














50. Thefollowingisatypicalanioniccollectorusedinflotation.














1. Fluorineisnotaconstituentof














2. ThemostcommonlyusedcombustionsystemmanufacturedinIndiaforthethermal














3. Duringsolidstatesinteringofpowders,thefollowingmechanismcanbeactive.


















4. Thetransitiontemperatureatwhichalltheferromagneticmaterialsbecomeparamagnetic














5. Regenerationofmolecularseiverequiresittobeheatedtoatemperatureofabout














6. Areductioninthermalresistanceduringheattransferdoesnotoccurinthe














7. UnitofviscosityinCGSsystemis













8. Shaft/rotorspeedismostaccuratelymeasuredbya


















9. __________testdeterminestheyieldstrength,Young'smodulusofelasticity,














10. Therollingprocesscannotbeusedtoproduce














11. CoefficientofperformanceofaCarnotcyclerefrigeratoroperatingbetween23Cand+












12. Presenceofnickel&chromiuminsteeldoesnotraiseits














13. Hotextrusionprocessisnotusedformaking


















14. Additionof__________tosteeldoesnothelpinimprovingitsmachinability.














15. Quartzisa__________material.














16. Theunitsoftherateconstantforasecondorderreactionare














17. Themostseriousmanufacturingdefectfromfracturetoughnesspointofviewis














18. Leakageinacookinggascylinderisdetectedby


















19. Whichofthefollowingisthemostwearresistantgradeofcarbideusedforthecutting














20. Theratioofmassofaneutrontothatofanelectronisabout1839.Whatistheratioof














21. Laserisadevicetoproduce














22. Additionofsmallamountof__________togreycastironisdonetoproducenodular














23. Minimumthermalefficiencyofasteamboilermaybearound__________percent














24. Thetemperatureatwhichthemagneticpropertyofirondisappears(i.e.,itbecomesnon


















25. Fatiguelimitimprovementbyoverstressingthemetalbysuccessivelyincreasingtheload














26. Themalleabilityofamaterialisthepropertybyvirtueofwhichitcanberolledor














27. Particlenatureofcathoderaysisprovedduetothefactthatthey














28. Themostcommonlyusedmoderatorinnuclearpowerplantsis


















29. Babbitliningisusedonbrass/bronzebearingstoincreasethe














30. Theheatofneutralisationremainsconstant,whenthereisareactionbetweendilute














31. Joiningofthinfoilsispreferredtobedoneby














32. Whichofthefollowingmetalsreactsviolentlywithwater?














33. Asteamcarrayingpipelineisinsulatedwithtwolayersofinsulatingmaterialswiththe

















34. Damagetometalsurfacebymechanicalactioniscalled














35. Theescapevelocityofabodyonearthwhichisindependentofitsmassisabout












36. Whichofthefollowingtestisusedfordistinguishingamongdryoils,semidryingoilsand














37. Thewetbulbtemperatureislowerindryairthaninwetairatthesametemperature.A













38. Theprocessofremovalofscaleformedduringhotrollingofsteelistermedas


















39. Apsychrometerdoesnotmeasurethe__________temperatureofmoistair.














40. Anidealmaterialformakingcookingvesselsshouldhave














41. Whichofthefollowingapproachestheidealgasbehaviourmostclosely?














42. Whichofthefollowingisnotthefunctionofavolutecasingprovidedinacentrifugalpump














43. Thepressureoutsideabubble/dropletofliquidis__________theinternalpressure.


















44. Twowiresofthesameradius&materialhavinglengthintheratioof1:2arestretched














45. Powdermetallurgytechniqueisusedintheproductionof__________tools.














46. Principalalloyingelementsofcasttoolalloyswhichhaveveryhighwearresistance&high














47. Whichofthefollowingisthemostsuitablematerialofconstructionforthecondenser














48. Whichofthefollowingisanoredressingoperation?


















49. Gratingsisassociatedwiththemeasurementof














50. __________jointismostlyusedforjoiningpipescarryingwateratlowpressure.














1. AsolutionwhichresistschangeinitspHvalueonadditionofacid/alkaliiscalledthe














2. Pickoutthewrongstatement.














3. Theboltissubjectedto__________whenthenutistightenedbyputtingthewasher


















4. Whichofthefollowingisnotcategorisedastheoreagglomerationprocess?














5. Withincreaseintemperature,thesurfacetensionofwater














6. Thesizeofthetetrahedralvoidintheclosestpackingofatomsis__________thatofthe














7. __________theexhaustgasisanindicationoftheincompletecombustionoffuel.














8. Air/fuelratioonmolar(volume)basisforcombustionofmethanewiththeoreticalquantity


















9. Frostformationontheevaporatortubesinthedomesticrefrigerators














10. Functionoffeedcheckvalveinaboileristo














11. Ganistercontainsmaximumpercentageof














12. Nitrogenisnotanessentialcomponentof














13. Ininventorycontroltheory,theeconomicorderquantity(EOQ)isthe


















14. Themainchargeinblastfurnaceisusually














15. Theatmospherictemperatureduringmeltingofice/snow(intheatmosphere)














16. Atroomtemperature,F.C.C.crystalstructureisobservedin














17. Thebasicfunctionofthedruminaboileristo














18. Pickoutthewrongstatement.


















19. Colloidscanbepurifiedby














20. Themostprominentsinglecauseofcorrosioninboilertubes,drums,economisersand














21. Maximumcarboncontentincastironis__________percent.













22. Screwsarespecifiedbytheir__________diameters.














23. Thestressatwhichextensionofthematerialtakesplacemorerapidlyascomparedtothe














24. Amaterialbeingtestedforendurancestrengthissubjectedtothe__________load.


















25. Withincreaseinpressure,thelatentheatofsteam














26. 'Flaretower'usedinindustryismeantfor














27. Whichofthefollowinghasthehighestmodulusofelasticity(about7x10 6kg/cm2)?















28. ElectrolyticreductioncellusedforconversionofcalcinedAl2O3toAlisacarbonlined


















29. Allradiationsfallingonablackbodyare














30. Styrofoamisthecommercialnameof














31. Ceramicmaterialsare














32. Drynessfractionofdrysteamis











33. Whichofthefollowingprocessesfollowsthehardeningprocessforreducingthehardening














34. Heatrequiredtoraisethetemperatureofabodyby1Ciscalledits


















35. Coatingofzincoversteelisknownas














36. Airpetrolratioinanautomotivepetrolengineisaround














37. Thepropertyofmaterial,bywhichagivenamountofenergyisabsorbedbyit,without














38. Sacrificialanodemethodisusedintheprotectionofpipelineswhichareburied


















39. Electrochemicalcorrosioncanoccur,onlyif__________ispresentincontactwithmetal.














40. Crystallisationofpolymersisanundesirableproperty.Crystallisationofcelluloidis














41. Preheatingpriortoweldingisdoneforthepurposeof














42. Presenceofsulphurinsteelreducesthe














43. Frotherisaddedinthefrothfloatationcellusedinorebeneficiationtostabilisetheair


















44. Ottocycleusedinsparkignitionpetrolenginesisalsoknownastheconstant














45. Fireonfueloillinescanbeextinguishedby














46. Inafurnacewithheatingelementtemperatureat1700C,thedominantmachanismof














47. Opticalactivityisa/an__________property.














48. Solutionlossreactionoccurs


















49. Outofthefollowingmaterials,theonewhichgenerallyexhibitsanyieldpointis














50. TheefficiencyofaCarnotheatengineoperatingbetweenabsolute














1. Grossnationalproduct(GNP)meansthetotalvalueof__________inacountry.














2. Energytobesuppliedtotheradioactivenucleusfortheemissionofaneutronis














3. Thecoordinationnumberinsimplecubicstructureis











4. Outofthefollowingsurfaces,theemissivitywillbeminimumfor


















5. Thepropertyofmaterial,bywhichagivenamountofenergyisabsorbedbyitwithout














6. Nonferrousalloysusedformakingcuttingtoolsneednothavehigh














7. Hollowshaftscanbemadeasstrongassolidshaftsbymakingthetwistingmomentsof














8. Capacity&powerrequirementforanaircompressorworkingathighaltitudecomparedto


















9. Glycereneisusedasacoolantincoolingofsomeenginesinsteadofwater,because














10. Coldworkingofamaterialresultsinincreaseinhardness,whichistermedasthe














11. Potablewatermeansthewaterusedfor














12. Onetonofrefrigerationisnotequivalenttotheheatremovalrateof














13. Startingfrictionislowincaseofthe__________lubrication.


















14. Ultimatestrengthintensionascomparedtothatinshearforsteelis














15. Whichofthefollowingheattreatmentprocessesisusuallyappliedtocastings?














16. Photographicplatesarecoatedwith














17. Hardeningofsteelisnotpossible,unlessitisheated__________criticalpoint.














18. Isotropicmaterialshavethesame__________inalldirections.


















19. Themostimportantrequirementforaluminiumindustryistheavailabilityofcheap














20. Spheriodisingofamaterialisa/an__________process.














21. Thetracemetalpresentininsulinis














22. Coldcrackingintheheataffectedzoneofahighstrengthsteelweldcantakeplace














23. Drossingisa__________operation.














24. Mostofthephosphorouspresentintheblastfurnaceburdenentersinto


















25. Duringsensibleheatingofhumidair














26. IroncontentinIndianironoreisabout__________percent.














27. Theheattreatmenttowhichthesteelwirecontaining>0.25%carbonissubjectedtois














28. __________ofhardalloyandtoolsteelisdonetomakeiteasilymachinable.


















29. Whichofthefollowingmainlydecidesthecurrenttobeemployedisarcwelding?














30. Temperatureattainedinsolderingofmetalsisabout__________C.














31. Thenormalstressisthesameinalldirectionsatapointinafluid,onlywhenthefluid














32. A2kgobjectweighs1.8kgfonaspringbalance.Thevalueof'g'atthatlocationin














33. Inchemicaldehumidificationofair


















34. WhatisthepHofdistilledwater?











35. Pickoutthecorrectstatement.














36. Dielectric














37. Normalisingofanobjectdoesnot














38. Plasmais


















39. Themachanisminvolvedintheremovalofmetalindrillingoperationisby














40. Thermalconductivityofamaterialdoesnotdependuponits














41. Carbonsupplyinpackcarburisingprocessisintheformof














42. Waterhammeriscausedinsteamcarryingpipelines,becauseof














43. Powdermetallurgyisusedtoproduce


















44. CatalystusedinthecatalyticconverteremployedinautomobilestoconvertCOinto














45. Forathermodynamicsystemundergoingaprocess,whichofthefollowingpairsbest














46. Themainconstituentofbonesis














47. Globularformofcementiteisformedduringthe__________process.














48. Faraday'slawofelectrolysisisrelatedtothe














49. Thetwoelementsrequiredtoformsubstitutionalsolidsolutionshouldnothave


















50. Rankinecyclecomprisesoftwoisothermalandtwo__________processes.














1. Diamagneticmaterials














2. Inconnectionwithcorrosionofmetals,passivationistheprocessthat














3. Withincreaseinimpuritiesinmetals,theircorrosionresistances


















4. Mostimportantpropertyofsteelsforuseinautomobilebodiesisthe














5. Considerationofthecreepisthemostimportantincaseofthe














6. Pipelinescarryingvariousutilitiesinchemicalindustriesareidentifiedbytheircolour














7. Whatisthepercentageofchromiumin1841highspeedsteel?












8. Preheatingbeforeweldingisdoneto


















9. Thermaldiffusivityofasubstanceisproportionalto(where,k=Thermalconductivity)













10. Dewpointtemperaturealwaysgivesanindicationofthe__________ofthemoistair.














11. Forafirstorderchemicalreaction,theconcentrationofthereactantdecreases














12. AirstandardOttocycleismoreefficientthanthedieselcycleforthesame














13. Incaseofbrasses,withdecreasingzincpercentageandincreasingcopperpercentage,its

















14. Asuitablelubricantusedforwatchesis














15. Outofthefollowing__________ironhasthebestcapabilitytobearsudden&excessive














16. Fortheirreversiblereaction,C +2C=C C ,H298=60000J.mole1.Ifasystem

a 2












17. Projectionwelding&studweldingiscategorisedasthe__________welding.














18. Thedrivingforceforthesinteringofapowdercompactis














19. Theamountofwaterevaporatedinkgperkgoffuelburntinaboileriscalledthe


















20. VolumetriccompositionoffluegasanalysedwiththeOrsatapparatusis:CO2=12%,














21. AfluidistermedastheNewtonionfluid,whentheshearstressis__________the














22. Transitionfromlaminarflowtoturbulentflowinfluidflowthroughapipedoesnotdepend














23. Whenthewetsteamisthrottledbutstillremainswetattheexitofthethrottlevalve,


















24. Limestoneadditionintheblastfurnaceisdonetoflux__________presentintheraw













25. The'transitiontemperature'forductiletobrittlebehaviourofsteelincreaseswithincrease














26. Theburnoutheatfluxinthenucleateboilingregimeisnotafunctionofthe














27. Theapproximateheightofablastfurnacehavingausefulvolumeof2000m3isabout














28. Thecathodeinanelectrochemicalcellalwayscarries


















29. Anoxidationprocessisaccompaniedwithdecreaseinthe














30. Hotdippingprocessisusedforcoatingalowmeltingpointmetal(e.g.Pb,Sn,Zn)oniron,














31. Hotextrusionofaluminiumisdoneinthetemperaturerangeof__________C.














32. Stelliteisa__________material.














33. Percentageofargon(byvolume)indryatmosphericairisabout














34. Anabruptandsuddenfallinthereadinpofbarometerisanindicationofthe


















35. Steamcondensertubesaremadeofadmirabilitybrass,inwhichpercentageofzinc&














36. Withincreaseintemperature,theelectricalconductivityofa__________decreases.














37. Alltheatomsoftheworldcompriseofelectrons,proton&neutronexceptthatof














38. Whichofthefollowinggasescauseglobalwarming?


















39. Multistagecompressionofairascomparedtosinglestagecompressionoffersthe














40. Finegrainedsteelshave














41. Dislocationcrossslipisdifficultinthosematerials,whichhave














42. Shrinkageallowanceonpatternisprovidedtocompensateforshrinkagewhenthe














43. Sparkplugisprovidedina/an


















44. Oxyacetylenereducingflameisusedwhilecarryingoutweldingon














45. NusseltnumberisrelatedtotheReynoldsnumber(Re)inturbulent&laminarflow














46. Leadpencilcontains














47. Functionofgearboxisto














48. Pearlitecomprisesof


















49. Whichofthefollowingifpresentinironore,enhancesitsvalue?














50. Asperinternationalnorms,themaximumpermissiblevalueofnoiselevelintheindustrial














1. Coatingprovidedontheelectrodesusedinthearcweldingisnotexpectedto














2. Desalinationofwater














3. Viscoelasticbehaviourisobservedin__________materials.


















4. Probabilityofcavitationoccuringbecomesveryhigh,whenthelocal__________














5. Whichofthefollowingmaterialshasthepoorestelectricalconductivity?














6. Glassreactswith














7. Thecostofprovidingserviceinaqueingsystemdecreaseswiththe














8. Theactivitycoefficientofthesoluteinadilutesolution


















9. Constituentsofstelliteare














10. Thekinematicviscosity(instoke)andtheabsolute/dynamicviscosity(inpoise)arethe














11. Multistagecompressionisnecessaryforhighefficiency,














12. __________cannotincreasethefatiguestrengthofamaterial.














13. Iftheheadisdoubledin&centrifugalpump,thepowerrequiredwillincreaseintheratio



2 3/2


2 5/2


2 1/3











14. Workhardenablealloysteelusedtomakethebucketwheelexcavators,bladesof














15. Electrometallurgyisnotinvolvedintheextractionof__________fromitsore.














16. Afreelyfloatingobjectisstable,ifitscentreofbuoyancy














17. Whichofthefollowingmaterialsdoesnotformadherentoxidefilmonsurface?














18. Cassiteriteisanoreof


















19. Insheetmetalforming,stretcherstrainsoccurin














20. Forgrindingofsoftermaterials,thegrindingwheelshouldhave__________grainsize.














21. Nusseltnumber/Biotnumbervaries














22. Outofthefollowing,maximumtemperaturedropforagivenheatflow&forthesame














23. Parallelstraightlinepatternoftemperaturedistributionforbothhotandcoldfluidsis


















24. Rockwellnumberrepresentsthe














25. Whichofthefollowingfasteningdeviceshasitsbothendsthreaded?














26. Notchedbartestisusedfortestingthe__________ofamaterial.














27. Themostsuitablematerialfordiecastingis














28. Heatingofanorebelowitsmeltingpointinpresenceofexcessofairiscalled














29. Depreciationofmachinesfailsundertheindirectexpenseshead.Asperincometax


















30. Asemiconductorisdamaged&behaveslikeaconductor,onpassingastrongelectric














31. Thebankoftubeslocatedatthebackofthedomesticrefrigeratorsarethe__________














32. Materialhavingnegativecoefficientoflinearexpansionis














33. Specificgravityofhotmetal(pigiron)is__________timesthatoftheblastfurnaceslag.











34. __________isthehardestmaterialoutofthefollowing.


















35. Thephenomenonofwelddecayisfoundincaseof














36. Ifasolidiscompressedadiabaticallyinitselasticrange,its__________remainsconstat














37. 'GASOHOL'widelyusedinBrazilasamotorfuelisamixtureofalcoholand














38. Ondecreasingthegrainsizeofapolycrystallinematerial,thepropertymostlikelyto


















39. Itispossibletoformmartensite














40. Whichofthefollowingmaterialhandlingequipmentsisnotsuitableformovingmaterials














41. Theeffectoffrictionontheflowofsteamthroughanozzleistodecreasethe














42. Thermalequivalentofelectricalpowerinpracticalcalculationis__________kcal/kWh.














43. Gross&Netcalorificvalueswillbethesamefor


















44. AspertheIndianboilerregulation(IBR),thetypeofjointpreferredforthecircumferential














45. Presenceofsmallquantityofsulphurinlowcarbonsteelimprovesits














46. Duraluminisanalloyofaluminiumandcopper.Percentageofcopperinduraluminis













47. Copperisnotpresentasanalloyingconstituentin














48. Leadisaddedto60:40brassprimarilytoimprove


















49. Airintakeforanaircompressorshouldbepreferablytakenfrom














50. Currentassetofafactoryincludesthe














1. LVDTusedfordisplacementmeasurementisa/an__________transducer.














2. Astaticfluidcannothave














3. Inaforceddraftcoolingtower,wateriscooledfrom95to80Fbyexposuretoairwitha


















4. Whichofthefollowingisthemostelasticmaterial?














5. The'laughinggas'is














6. Esterisformed,whenanalcoholreactswith














7. Whichofthefollowingaccountsformaximumlossofenergyinacoalfiredboiler?














8. Presenceofsulphurinthefuelfiredinafurnace


















9. Boilingtemperatureofcarbondioxideatatmosphericpressureis__________C.














10. Eutectoidreactionforironcarbonsystemoccursatatemperatureof__________C.














11. Theabilityofasubstancetoassumetwoormorecrystallinestructureiscalled














12. Themainfunctionofthedeaeratorusedinthethermalpowerplantisto














13. Lubricantscanbeusedto


















14. Whichofthefollowingistermedastheboilermounting?














15. Paintspraygunworksontheprincipleof














16. Gascarryingpipelinesarebestjoinedby














17. Scabisadefectdevelopedduring__________ofmetals.














18. Pickoutthewrongstatementaboutpowdermetallurgytechnique.


















19. Afloatingbodyoscillatesaboutits__________whenitisdisplacedslightly.














20. Whichofthefollowingrelativelyemploysthehighestheattransfersurfaceareainahigh














21. Theroutingfunctioninaproductionsystemdesignisconcernedwiththe














22. Fillermaterialusedinweldinghavingthelowestmeltingpointoutofthefollowingis














23. Whichofthefollowinghasthehighestdensityandthelowestmeltingpoint?


















24. Electrolytesconductelectriccurrentby














25. Toimprovethemachinabilityofsteelbyitssoftening,itissubjectedto














26. Heattransferbyradiationfromahotbodywillbemostrapid,ifitssurfaceis__________














27. Reductionreactioninvolvesthe














28. Specificheatofanidealgasdependsuponits


















29. Incaseofcompressionofonekgofair,theworkdonewillbetheleast,whenthevalueof













30. A__________typepressuresensingelementiscommonlyusedinaneroidbarometer.














31. Athermallythinbodyistheoneforwhich














32. Airrefrigerationcycleisusedintheaircrafts,becauseof














33. Failureofamaterialisattributedto__________ifitfailsbelowitsyieldpoint.


















34. Protectionofshiphullsagainstseawatercorrosionisdonebycoatingwithzincbecauseof














35. Whichofthefollowingpairsregardingtheeffectofalloyingelementsinsteelsarenot














36. Thephenomenonofstrainageingisgenerallyexperiencedwith














37. Thecapacityofamaterialtoabsorbenergydependsuponbothitsstrength&stiffness.














38. Fillermetalisnotusedinthe__________welding.


















39. Theheatreleasedbycoolingonemoleofcopperfrom400Ktoroomtemperature(300K)







2.3x10 6J







40. Suddenimmersion/dippingofredhotsteelbarinwatermakesit














41. Amaterialexpandingfreelyduetoheatingwilldevelop__________stress.














42. Amachinehavingassumedlifeof20yearsispurchasedforRs32000/.Itsscrapvalueat














43. Morethan1000tonsrefrigerationcapacityplantsareusuallyof__________type.


















44. Pickoutthewrongstatement.














45. Theincreaseinhardnessofmetalduetoitscoldworkingistermedasthe__________














46. Themaximumaxialcompressionstressduringcoldupsettingofacylindericalrodofradius














47. Electrodepotentialisnotconcernedwiththemeasurmentof














48. __________columnispreferredtobeused,whenahighliquidholdupisrequiredina

















49. Tungsteninhighspeedsteelisresponsibleforits














1. Outofthefollowingsubstances,onetonof__________willstorethemaximumheatfor














2. Inwhichofthefollowingreactions,applicationofvacuumwillhelp?














3. Inspectionofsurfaceandsubsurfacecracksinnonmagneticalloysisdoneby

















4. Pickoutthewrongstatement.













5. Whichofthefollowingexemplifiesresemblencewiththeextrusionprocess?














6. Fillermetalisusedin__________welding.














7. Acetyleneshouldneverbeconveyedthrough__________pipe,asitformsanunstable














8. Whichofthefollowingcontainstheleastpercentageofcarbon?


















9. Electricarcfurnaceisemployedmainlyfortheproductionof__________steel.














10. Heattreatmentofsteelisdonemainlytochangeits














11. __________methodofdepreciationcalculationensuresthattheinterestischargedon














12. MainalloyingelementinElinvarusedinprecisioninstruments,hairspringsforwatches














13. Colorofbrasschangesfromyellowto__________afteritsdezincificationwhich


















14. Heatdissipationincoolingtowersismainlyby














15. InBOF,desiliconisationisafirstorderreaction.Sothesiliconcontentofthemetal














16. Hoope'scellispredominantlyusedfortheelectrolyticrefiningof














17. Leadpercentageinpuregalenaisabout














18. Pickoutthewrongstatement.


















19. Thelifeofaballbearingisinverselyproportionalto














20. Pickoutthewrongstatement.














21. Stonewarepipesusedforsewersforcarryingsewagenormallyisjoinedby__________














22. Whichofthefollowingparametersisactuallymeasuredduringtensiletestingofa














23. 'Endcooler'or'aftercooler'isemployedinaircompressormainlyto


















24. Streaklines,streamlines&pathlinesarealmostidenticalfor__________fluidflow.














25. Thesuctionanddeliverypressureforatwostagecompressorare1and25atm













26. Theterm'Value'invalueengineeringtechniquereferstothe__________costofthe














27. Meltingpoint&boilingpointsofliquidoxygenarerespectively218.8C&183C,while










28. Theentropychangeforaspontaneousprocessis

















29. MilligramofKOHrequiredtosaponify1gmofoiliscalledits__________number.














30. Pickoutthewrongstatementaboutafastbreederreactor.














31. Thespeedofsoundwillbemaximumin




























33. Incaseofwater(Prandtlnumber6)flowingoveraflatplateheatedovertheentire














34. __________numberissometimesusedinplaceofGrashoffnumberinfreeconvection


















35. Wroughtirondoesnothavethe














36. Nitridingofsteelisaprocessfor














37. Themaximumpercentageofchromiumthatcanbeaddedtosteelisabout














38. Holesinaplateforrivettedjointsispreferablymadeby














39. Thetemperatureatwhichagas,whensubjectedtoJouleThomsonexpansion,neither


















40. Sourceofheatsupplyinacupolais














41. Machinetoolbodiesareusuallymadeof














42. Outofthefollowing,thebestmaterialcapableofwithstandingshock&vibrationwithout














43. Onincreasingtheyieldstrengthofasteelfrom450to650MPa,its__________will


















44. Therefractorybrickwhichhasgoodthermalshockresistanceathightemperaturebut














45. Thepathandmovementsfollowedbymen,materials&equipmentsinexecutingthe














6. Nocuttingfluidisnormallyused,whilemachining














47. Anorthotropicmaterialisaspecialclassofanisotropicmaterial,whichisdescribedbytheir














48. pHvalueofrainwaterinIndiarangesfrom


















49. Thecapital&runningcostsofsimilarmachineshavingunequalservicelifecanbe














50. Picktheoddmanout.














1. Withincreaseincarbonpercentageinsteel,its














2. Percentageofgaungeismaximumintheoreof














3. Theformsinwhichvariousmetalsandnonmetalsoccurinnaturearecalledminerals.














4. Pickoutthewrongstatement.


















5. Themostcommonlyusedmaterialforsewersforcarryingsewageinthenormalsituation














6. Therefractoryliningofthebottominabasicelectricarcfurnaceismadeof














7. Alcoholsarenotsuitableasdieselenginefuelbecausethecetanenumberofalcoholsis














8. Mattesmeltingisusedintheextractionof














9. Percentageofdifferentialpressurelostinaventurimeterwithataperingof15maybe

















10. Compresseddryairisusedasthecuttingfluid,whilemachining














11. Oxidelayerformedonthenonferrousmetalsurfaceafteritsannealingis














12. Siliconpercentageinsiliconsteelusedforelectricalequipmentsisabout












13. Catalystusedinthe'catalyticconverter'employedinautomobileexhaustlinefor


















14. Liquidnitrogencontainerscanbemadefrom














15. Materialshaving__________latticestructureareusuallythemostductile.














16. Metalcuttingbyoxyacetyleneflameisaccomplishedbythe__________ofthemetal.














17. Thematerialusedforcoatingtheweldingelectrodeistermedasthe














18. Inanamorphousmaterial,atomsdefyanydefiniteatomicstructureandexistinrandom


















19. Eventhoughheattransfercoefficientsinboilingliquidsislarge,useoffinsis














20. InNewton'slawofviscosity,whichstatesthattheshearstressisproportionaltothe














21. Whichofthefollowingmaterialshastheleastscrapvalue?














22. Forcebetweenthemoleculesofthesamesubstanceiscalled__________force.














23. Stressesencounteredinthemetalformingprocessesarelessthanthe__________of


















24. Whichofthefollowingisnotaferromagneticmaterial?














25. Raindropsfallingthroughatmosphericairattainlimitedterminalvelocity,becauseof














26. Additionofsilicontocastiron














27. Leadispouredintothejointbetweentwo__________pipes.














28. About__________tonofcokeisrequiredinacupolatoproduceonetonofcasting.


















29. Thereareoneoctahedralvoidand__________tetrahedralvoidintheclosestpackingof














30. Whichofthefollowingispronetocupandconefracture?














31. __________remainsconstantduringtheadiabaticcoolingofmoistair.














32. __________jointisusuallyusedforjoiningcastironpipesmostlyusedfortemporary














33. Outofthefollowing,thealloywhichhasequalpercentageofconstituents,is


















34. Whichofthefollowingisthecorrectnatureofshearstressdistributionalongthecross









35. Steelisweldedusingthe__________flame.




























37. Shampoosarecommerciallynotavailableintheformof














38. Agaswhichiscollectedoverwaterbecomesmoistenedduetowatervapor,exertsitsown


















39. Carbonispresentintheformof__________ingreycastiron.














40. In"ImperialSmeltingProcess"forextractionofzinc,zincvapourthusproducedis














41. Thedewpointofmoistairbecomes__________withdecreaseinitsrelativehumidity.














42. HeatingofferromagneticmaterialstoatemperatureaboveCurietemperaturemakesit














43. Lapjointsarepreferredoverbuttjointsinsoldering/brazing,becausethesejointsare


















44. Colourcomparatorisusedtomeasurethe














45. Pickoutthewrongstatement.














46. Anatombombworksontheprincipleof














47. Eutecticreactionforironcarbonsystemoccursatatemperatureof__________C.














48. Whichofthefollowingisanexampleofstresscorrosion?


















49. FeO(s)+CO(g)=Fe(s)+CO2(g),k=0.435at1173EAtequilibrium,whatwillbe














50. Fibrereinforcedplastic(FRP)are














1. Maragingsteelsderivetheirstrengthfromthefollowingmechanism:














2. Ceramiccompoundsascomparedtometalliccompounds














3. Pressureexertedbyaliquiddependsuponits


















4. Themostdetrimentalimpurityinhighpressureboilerfeedwateris














5. Pickoutthewrongstatement.














6. Semiconductorsnormallyemploy__________bonding.














7. Highendurancelimitofcarburisedmachinepartsisbecauseofthefactthatcarburisation














8. In__________process,thereisanincreaseinentropywithnodegradationofenergy.


















9. Whichofthefollowingiscategorisedastheplasticwelding?














10. Inspiteoflargeheattransfercoefficientsinboilingliquids,finsareusedadvantageously,














11. Whenwaterissprayedonair,passingthroughaninsulatedchambermaintainedata














12. Thehardnessofthelathebedmaterialismeasuredbythe














13. RADARis


















14. Inthefloatationprocess,pineoilisusedasthe














15. Withincreasingcarbonpercentinsteelbeyond0.8%,itsultimatetensilestrength(UTS)














16. Pickoutthecorrectstatement.














17. Ageingofsteelreferstothe














18. Whendrybulbtemperature&wetbulbtemperatureofmoistairisthesame,itmeans


















19. Whenmetalsareheatedtohightemperature,their__________increasesingeneral.














20. Africtionlighterisnormallyusedforlightinggasweldingtorch,becauseofthereason














21. __________isnotusedasamaterialofconstructioninthermocouples.














22. Coarsegrainedsteelshave














23. Steelballsaremanufacturedbycoldheading.Aftercoldforming,theyaresubjectedto


















24. Freeoxygenisremovedfromboilerfeedwater,becauseit














25. Outofthefollowing,thematerialshavingmaximummagneticpermeabilityis














26. Amaterialbeingtestedforendurancestrengthissubjectedtothe__________load.














27. Pickoutthewrongstatement.














28. Oldcyclehandlesarecoatedwithnickelusing


















29. CANDUtypenuclearreactorusingnaturaluraniumasfuelistheextensivelyusednuclear














30. Pickoutthewrongconversionofabsolute&kinematicviscosities.







1m2/sec=10 4stokes.





31. Unitmolarsolutionof__________isthebestconductorofelectricity.














32. Acoalwithhigh__________contentwillignitemosteasily.














33. Theweightofabodyatthecentreoftheearthis


















34. Forthesameheatinput&compressionratio,efficiencyofOttocycleishigherthanthatof














35. Thesinglemostimortantrequirementforaturbinebladematerialis












36. Incoldworkingofmetalascomparedtoitshotworking














37. __________istheprocessusedforsettingupcompressivestressesinthesurfaceofa














38. Mho'sscaleofhardness,whichconsistsof10standardmineralsisusedforthe

















39. Whichofthefollowingisaweakacid?














40. Pigironisaproductof














41. Flywheelisprovidedinamachineto














42. Nickelisa__________material.














43. Greycastiron(usedformakingundergroundwaterpipesandmanholecovers)as


















44. L.D.convertersaregenerallylinedwith














45. Whentheweightofaballinsidetheballmillisjustbalancedbythecentrifugalforce,














46. __________isnotaheattreatmentprocess.














47. Aningotishotforgedtoa60%reductionincrosssectionarea.Thepercentagereduction













48. Volutecasingofacentrifugalpumpdoesnotfacilitate














49. Desertaircoolersbeingrenderedineffectiveinrainyseasonisdueto


















50. Thehydraulicradiusofacircularpipeofdiameter'd'flowingfullis














1. Safetymatchesisproducedusing














2. Calorificvalueof__________arealmostsame.














3. Whichofthefollowingpairsisnotcorrectlymatched?


















4. Commonlyusedfluxforbrazingis














5. Ironhasgot__________isotopes.














6. Aboyweighing110lbclimbsupa50fthighverticaldestinationin100seconds.Horse













7. Enduranceisameasureoffatiguelimitofametal.Fatiguecrackinnitridedmachineparts














8. Carbonpercentageinhighspeedsteeltoolmaterialis0.6to1.0.Thehardnessofcarbon

















9. Draftallowancegiventopatternsisfor














10. Whichofthefollowingweldingprocessesemploysthehighestweldingtemperature?














11. Thebestcriterionforanalysinganeconomicinvestmentisthe














12. Deformationbandisabsentinmaterialshaving__________latticecrystalstructure.














13. Outofthefollowing,therayshavingthelowestwavelengthisthe


















14. Afinegrainedgrindingwheelshouldnotbeusedforgrinding__________materials.














15. Whatistheeffectontheperformanceoftheeconomiserinthethermalpowerplant














16. ThebulkmodulusofamaterialwithPoisson'sratioof0.5isequalto














17. CompressionratioofanI.C.engineistheratioofthe














18. Twostrokeenginecomparedtoafourstrokeenginehas


















19. Ferritesare__________magnetic.














20. ThepHvalueisthemeasureofhydrogenionconcentrationinasolution.ThetermpH














21. TheAl2O3contentofcryoliteinHallHeroult'scellismaintainedbetween__________














22. Numberofelectronsintheoutermostshellofasemiconductormaterialis










23. Thevelocityatwhichindividualparticlesfromafluidisedbedarecarriedawaybythefluid


















24. Tipofthematchstickcontainsamixtureof














25. Whichofthefollowingisnotanoreofaluminium?














26. Mechanism/phenomenoninvolvedintheimprovementoffatiguestrengthofamaterialby














27. Springsarenotmadeof














28. Pickoutthewrongstatement.


















29. Monazitedepositsconstituteanimportantsourceforthefollowingmetal.














30. raysare














31. Heattreatmentofsteelisdonetomainlychangeits__________properties.














32. Normaldosageofchlorineinpublicwatersupplyschemerangesfrom__________ppm.














33. Castironhastheuniquepropertyofhigh


















34. Thermalshockproducedbycoolingismoredengerous/deleteriousthanthatproducedby














35. Thehardnessofagrindingwheelisspecifiedbythe














36. Scalingoccursinboilertubesduetothefactthat,thesolubilityofCa(OH)2__________














37. Whiletherecrystallisationtemperatureforpuremetalsis0.3Tm,thesameforalloysis














38. Thefactorofsafetyforbrittlematerials(havingelongation<5%)isbasedonthe


















39. Carburettorinasparkignitionengineisusedto














40. __________arenotemittedbyradioactivesubstances.














41. Agoodabrasive














42. Outofthefollowing,__________pipeistheleastcorrosionresistant.














43. Inordertoprotecttheaquaticcreatures,thedissolvedoxygencontentinfreshwater
















44. Forwhichpairofthefuelgases,calorificvalue(C.V.)ofonefuelisalmostdoublethatof














45. Sheardisingprocessisusedfor














46. Thepredominantmodeofheattransferwhichtakesplacefromboilerfurnacetowater














47. Whichofthefollowingisaninedibleoil?














48. Lightyearistheunitof


















49. Ingrannularcorrosionoccurs__________stainlesssteel.














50. Incaseoffluidmovingmachineries,therelationshipbetweensaturationtemperatureand














1. Additionofberylliumtocopperisdonemainlytoproducea/an__________alloy.














2. Theproductoutfromacupolaiscalled














3. Resilienceofamaterialisimportant,whenitissubjectedto


















4. Existenceofvelocitypotentialimpliesthatthefluidis














5. Thevelocityofsoundinairisindependentofchangesinits














6. AdummyactivityisusedinPERTnetworktodescribethe














7. Whichofthefollowingisnotacharacteristicobservedinmaterialfailurebyfatigue














8. Apolymeristermedasan'elastomer',ifitspercentageelongationismorethan100%.An


















9. Currentemployedinresistanceweldingrangesfrom__________kVA/cm2.














10. Brittlenessinducedduetothepresenceofsulphurinsteelcanbereducedbyadding














11. Fibrousfractureisnormallyencounteredinthe__________materials.














12. Badodourinsanitarylatrinesisreducedbyperiodicallysprinkling














13. __________hasthehighestmeltingpointoutofthefollowing.














14. Theonlysuitablemethodforhardeningthelowcarbonsteeliscasehardening.Whichof


















15. Annealingofcastiron














16. Coatingthicknessincaseofgalvanisingofsteelsheetgenerallycorrespondstothe














17. Chlorineactsasableachingagentonlyinthepresenceof














18. Coronadischargeisrelatedtotheoperationofa/an


















19. Plasticsasamaterialofconstructionsufferfromthedrawbackoflow














20. Outofthefollowing,thebestmaterialcapableofwithstandingshock&vibrationwithout














1. Factorofsafetyistheratioofthe__________stresstotheworkingstress.














22. Themajoritychargecarriersinptypesiliconare














23. Referringtotheperiodictableofelements,itisfoundthatwithincreasingatomicnumber.


















24. Withincreasein__________Knockingtendencyinasparkignitionpetrolengine














25. Between230and370C,bluebrittlenessiscausedinmildsteelbecauseofthe














26. Siliconpercentageinthesiliconsteelusedforelectricalappliances/equipmentsis














27. Whichofthefollowingisnotadielectricmaterial?














28. Magneticpermeabilityofironisincreasedbyits


















29. Thematerialswhichfractureevenatsmallstrainsaretermedasbrittle,whilethose














30. Materialofconstructionoffoundarycrucibleis














31. Boilingpointofwatergetsloweredathighaltitudes(e.g.,hills),because














32. Withincreaseintemperature,theelectricalconductivityofsemiconductors














33. Whichofthe,followingisnotassociatedwiththefunctioningofapetrolengine?


















34. MinimumnumberofmembersrequiredtoformaPublicLimitedJointStockCompanyis













35. Inaneutecticsystem,twoelementsarecompletely














36. 'Cryogenics'isconcernedwiththegeneration&useoflowtemperatureintherangeof














37. Thecapacityofaspringtostoreenergyiscalledthespringformcoefficient.Stiffnessofa














38. Whichofthefollowingmaterialshasthemaximumshrinkageallowance?


















39. Vibrationupto100kilohertzcanbemostaccuratelymeasuredbya__________type














40. Normalisingdoesnot__________ofametal.














41. Boilertubesizeisspecifiedbyitsthicknessand__________diameter.














42. Breakevenpointrepresentsthecondition,whenthecompanyrunsundernoprofitno














43. UnitofsurfacetensioninS.I.unitis


















44. Thejointforsolderingissupportedbybindingwiremadeof














45. Themainreducingagentinironblastfurnaceis














46. Young'smodulusofamaterialisthemeasureofits














47. Whichofthefollowingisnotusedasabearingmaterial?














48. Brasspartswithhighresidualtensilestressatthesurfacearesusceptibletoseason
















49. Waterflowintheriverduringfloodcanbecategorisedasthe__________flow.














50. Basicity[%Cao+%MgO/%SiO2)oftheslaginIndianblastfurnaceisintherangeof














1. Yieldstrengthofamaterialisdeterminedbythe__________test.














2. Influidflow,andheatandmasstransfer,oneencounters(i)kinematicvelocity(),(ii)














3. Windowpanesofaeroplanesarenormallymadeof


















4. __________fluxisusedfortheextractionofmetalfromitsselffluxingores.














5. Gooddesignofthecasingofacentrifugalpumpaimsatminimisingthe














6. Leadismostreadilydissolvedin














7. Whichofthefollowingisasyntheticabrasive?














8. Dezincificationisaformofcorrosion,whichspecificallyappliesto


















9. Waterhammerinpipelinesresults,whentheflowingfluid














10. Thepreferredalloyingelementforlowtemperatureapplicationsofsteelis













11. Outofthefollowing,thedimensionlessquantityis














12. Whenacopperballisheated,thelargestpercentageincreasewillbeinits














13. Whichofthefollowinghardnesstestsusesthedepthofpenetrationcausedbythe


















14. Themostcommonlyusedmoderatorinnuclearpowerplantis














15. Inanisochoricprocess,














16. Cokeisaddedintheblastfurnaceto














17. Abalanceddraughtboilerfurnaceemploys__________draughtfan.














18. Aluminiumoxide(anabrasive)isusedforgrinding


















19. Inacasting,coldshutdefectiscausedby














20. Evenminutepresenceofimpuritiesincopperimpairsitselectricalconductivityseriously.














21. Whichofthefollowingmetalscanbeextractedfromitsorebybothpyrometallurgicalas














22. Ifaheattransfersurfaceispockmarkedwithanumberofcavities,thenascomparedto














23. Piezoelectricisamaterial


















24. Oxygencontentbelow__________percentinaircontaminatedwithnitrogendoesnot














25. Moistairiscooledalongthelineofconstant__________,whenitispassedoveracold&














26. ProductionofonetonofsteelplateinamodernintegratedsteelplantinIndiaconsumes














27. Ceramictipsforthecuttingtoolarepreparedfrom__________powder.














28. Fatiguestrengthofametalisimprovedby


















29. Saturatedsteamatapressureof25kg/cm2isthrottledtoattain5kg/cm2.Thenthe














30. An"orangepeel"effectisobserved














31. Themagnitudeofwaterhammercausedinpipeflowisindependentofthe














32. Ametalloidpossessesthecharacteristicsofboththemetalsandnonmetals.Whichofthe














33. Nocuttingfluidisnormallyused,whilemachining


















34. TwosolutionsA1&A2havepHvalueof2&6respectively.Itimpliesthatthesolution














35. Whichofthefollowingisadisaccharide?














36. Hardness&tensilestrengthofausteniticstainlesssteelcanbeincreasedby












37. Whichofthefollowingmetalsoccursinnatureintheirfreemetallicstate?














38. Themostsuitablematerialforasewerforcarryingstormwateris














39. Inatotallyirreversibleisothermalexpansionprocessforanidealgas,E=0,H=0.


















40. Sulphurismeltedinthesulphuricacidplantmostcommonlybyemploying














41. In1841highspeedsteel,18,4&1respectivelydenotethepercentageof














42. Roleofa"collector"infrothfloatationisto














43. Fortherunningofpowergeneratingturbines,thesteamusedshouldbe


















44. Creepconsiderationisthemostimportantincaseofthe














45. ThediffusioncoefficientofNiinCuat1000Kis1.93x10 16m2.S1anditis1.94x

10 14m2S1at1200K.Theactivationenergy(ink.J.mole1)forthediffusionofNiin














46. Whichofthefollowinghasrotteneggysmell?














47. Freezingof35%oleumduringitsshipmentinwinterisavoidedbytheadditionofsmall














48. Inhotworking,dynamicrecoveryoccursin


















49. Whichofthefollowingmanufacturingprocessesproducesthestrongestcomponents?














50. Castironcomparedtosteelisbetterin














1. Sewageisnotanexcellentmediumforthegrowthof














2. Whichofthefollowingpairiscorrectlymatched?














3. Rateofchemicalreactionisnotmuchaffected,ifthereactantsarein__________form.


















4. Materialsusedformakingpermanentmagnetscontainingironandnickelaremadeby














5. Lubricationisdonetocontrol














6. Thedeliverypressureofboilerfeedwaterpumpcomparedtotheboilersteampressureis














7. Theexcessairrequiredforthecombustionofpulverisedcoalisoftheorderofabout













8. Pickoutthewrongstatement.


















9. __________ofaustenitedecreasesthehardenabilityinsteel.














10. Ajigisusedwhile__________ahole.














11. At100%relativehumidity,thedewpointtemperatureofmoistairis














12. Whichoneisneutralincharacter?














13. Gagepressurewithinasphericaldropletofafluidis'p'.Whatwillbegagepressurewithin

















14. Whilethebincardsareusedintheeffectivestoresmanagement,thequeingtheoryis














15. Diameteroftherivettobeprovidedona20mm.thickboilerplatewillbe__________














16. Halflifeofaradioactiveisotopecorrespondstothetimerequiredforhalfofthe














17. Theproductofacommercialdirectreductionprocessis














18. Inthedivingapparatus,heliumisusedalongwithoxygen,becauseitis


















19. Materialshavingresistivityrangingfrom1to100ohm.cmistermedas














20. Duringsensiblecoolingofair,itswetbulbtemperature














21. WhichofthefollowingemissionsintheexhaustgasofanI.C.enginecausesthe














22. IfReynoldsnumberisgreaterthan1,thenthe














23. Thetypeofpumpusedforliftinglargequantityofsewageisa__________pump.


















24. Whichofthefollowingmetalsisnotsubjectedtoelectrolyticrefinning/purification?














25. Themostimportantfunctionofawasheristoprovidebearingareaandwashersare














31. Amaterialiscapableofresistingsofteningathightemperature,becauseofitsproperty














32. Cascadecontrolis














33. Softeningofhardnedsteelisdonebyits

















34. Air/fuelratiobyweightforcombustionofmethanewiththeoreticalquantityofairwillbe














35. Whichofthefollowingalloyingelementsispresentinmaximumpercentageinhighspeed














36. __________isanonvolatilefilmformingconstituentofapaint.














37. Accordingtomaximumshearstressfailurecriterion,yieldinginmaterialoccurs,whenthe












38. Transformercoresarenormallymadefrom


















39. __________testistheappropriatetesttodeterminewhetheramaterialisductileor














40. Mainconstituentofboneashis














41. Temperingofamaterialdoesnotimproveits














42. Highrelativehumiditydecreasestheevaporativeprocessandasthetemperatureis














43. WhichofthefollowingperformancecharacteristicsofaS.Iengineisnotaffectedbythe

















44. __________glassisusedinthemercuryinglassthermometermeantformeasuringa














45. Heatreleaseduringphasechangeisobservedincaseofa/an














46. Thehardenabilityofsteeldecreaseswith














47. Pickoutthecorrectstatementaboutthecondensation.














48. Changeinvolumeofmetalsfromabsolutezerotemperaturetotheirmeltingpointsis


















49. Wohlertestisadestructivetesttofindoutthe__________strengthofapreparedmetal














50. Alloypowdermanufacturedbythefollowingprocesshavesphericalshapes.














1. Whichofthefollowingisaboileraccessoryi.e.,notaboilermounting?














2. Whichofthefollowingforcesdoesnotactonafluidatrest?














3. Densityinthesolidstateisslightlylessthanthatinitsliquidstate,incaseof


















4. Strainhardeningeffectinmetalssubjectedtocoldworkingisduetothe__________














5. __________numberdetermineswhetherthefluidflowinanopenchannelis














6. Whichofthefollowingisnotanoreofiron?














7. Whichisthemostlethalweapon?














8. Reynoldsnumberofafluidflowinginacircularpipeis10000.WhatwillbetheReynolds


















9. Anexampleofunsteadynonuniformflowistheflowofliquidunderpressurethrougha














10. Whichofthefollowingcontributesmaximumasmainsourceofsulphurintheblast














11. Acolloidalsystem,inwhichaliquidisdispersedingasiscalleda/an














12. Blastfurnaceisa














13. Speedofasubmarineindeepsea&thatofanaeroplaneismeasuredbya/an


















14. Theprimarystrengtheningmechanismin70:30brassisthe














15. Xraysdonotexhibitthepropertyof














16. Killedsteels














17. Whichofthefollowingphenomenon/phenomenais/arediffusioncontrolled?














18. JouleThomsoncoefficientistheratioof

















19. Expansiondeviceusedinawindowairconditionerisa/an














20. Theunitofgcis










21. IntheacidBessemerprocess,thehotmetalshouldhavethefollowingcompositon.














22. Whichofthefollowingdoesnotcomeunderthecategoryofelectrochemicalcorrosion?














23. Unbreakablecrockeriesaremadefrom__________polymers.


















24. Cupolaproduces__________iron..














25. Eulernumberisdefinedastheratioofinertiaforceto__________force.














26. Holesforrivettingpurposesshouldbepreferablymadeby














27. Oneofthemethodsofpurificationofleachliquorisionexchange,whichinvolves














28. Asteampipeisintendedtobeinsulatedwithtwolayersofinsulatingmaterialsofdifferent


















29. Largediametershaftsaremanufacturedby














30. CommonsaltisproducedfromseawaterinIndiagenerallybythe__________method.














31. Batchprocessispreferredovercontinuousprocess,whenthe














32. Whichofthefollowingisapermanentfastening?














33. Hot&coldworkingofmaterialcausesits__________deformation.














34. Theratioofthermal&electricalconductivityissameforallthemetalsatthesame

















35. Inafuelcell,chemicalenergyisconvertedinto














36. Whichofthefollowingisnotacupronickelalloy?














37. Electrochemicalcorrosionoccurs














38. Theabilityoftoolsteeltoresistsofteningathightemperaturesistermedas__________


















39. Improvementinmechanicalpropertiesofmetalsinitshotworkingisduetothegrains














40. Young'smodulusofelasticityofamaterialistheslopeoftheinitiallinearportionofthe














41. Venturimeterisusedtomeasuretheflowrateoffluidsinpipes,whenthepipeisin














42. Oftenearingdefectsarefoundduringdeepdrawingoperation,becausethe














43. __________isnotacasehardeningprocess.














44. Whichonecanbedirectlysolidifiedfromgaseousstatewihtoutenteringintoliquidstate?


















45. Whichofthefollowingistermedastheboilermounting?














46. Shockresistingsteelsshouldpossesshigh














47. Fatiguelifeisexpectedtoincreaseby














48. Specific__________isadimensionlessquantity.


















49. __________isnotusedasthecontrolrodmaterialinanuclearreactor.














50. Superheatedvapourbehaveslike














1. Theinstrumentbasedonthefollowingprincipleisusedforthemeasurementofoxygen














2. Workstudydealswiththe__________study.














3. Maximumchangeinthehardnessofmartensiteoccursinthecarboncontentrangeof


















4. Knockingtendencyinapetrolenginedecreaseswithincreasing














5. Hooke'slaw














6. Themomentofinertiaofabodycomesintoplayin__________motion.














7. Thermoplasticsarenevermouldedusing














8. Pickoutthewrongstatement.Ifthenetpositivesuctionhead(NPSH)requirementofa


















9. Whilethethermosettingpolymersareamorphousinnature,thethermoplasticpolymers














10. Thestressatwhichametalfailsbyfatiguelies














11. Annealingofamaterialdoesnot














12. Whichofthefollowingisnotanoreofaluminium?














13. Boilerdraughtof10mmwatercolumnisequivalentto


















14. Thefugacityofliquidwaterat298Kisapproximately3171Pa.Consideringtheidealheat





1.01x10 5Pa









15. ThelegofabarometriclegpumpislongerthantheToricellianleg,whichisabout












16. Commonlyemployedcoolantforhighpressureturbogeneratoris














17. Slightdisplacementofafloatingbodyinliquidmakesittooscillateaboutits














18. Buoyancyforcedependsonthe__________theliquid.


















19. "EncyclopaediaofChemicalTechnology"hasbeen














20. Statisticalqualitycontrolwasdevelopedby__________,anAmericanscientistduring














21. Productionofahollowproductbyinflationofatubeorparisoniscalledthe__________














22. Asparkignitionpetrolenginehas














23. Outofthefollowing,thehighestemfforagiventemperatureisgeneratedbythe


















24. Whichistheonlymetalthatexistsinliquidstateatroomtemperature?














25. Anapproximately__________processexemplifiestheflowofagasthroughaverylong














26. AmetalhavingaPoisson'sratio=0.3iselasticallydeformedunderuniaxialtension.Ifthe














27. Thequantityofelectricityrequiredtodepositonegmequivalentofanysubstanceisone














28. Surfacetensionisduetothe__________forces.














29. Atabsolutezerotemperature,foranyreactioninvolvingcondensedphases


















30. Metalsingeneralhavealowvalueofthermal














31. __________oftestspecimensisnotinvolvedinanyhardnesstestingmethod.














32. Outofthefollowing,themostductilematerialis














33. Whathappens,whenSO2ispassedthroughasolutionofH2Sinwater?


















34. Whichofthefollowingwillresistmaximumshock&vibrationwithoutcracking?














35. Surfacetensionofaliquid














36. Fordynamicstrainmeasurement,thewheatstonebridgeusedisof__________type.














37. Whichdrugismadefromvegetables?














38. Whichofthefollowingaremadeoutofthecarbonsteelhavingcarboncontentof0.9to


















39. Materialofconstructionofsurveyingmetallictapesis__________whichhaslow














40. Weldedjointissuperiortorevettedjointinrespectofeaseoffabrication,weightand














41. Siliconpercentageinacidresistantcastironisabout












42. Thermalexpansionofsolidisemployedinthetemperaturemeasurementbya














43. Stressandstrainarerelatedby__________elasticconstantsforalinearlyelastic,














44. Thebehaviourofametalspecimen,whichwhenplasticallystrainedintensionreducesits


















45. Functionoffusiblepluginaboileristo














46. Whatistherangeoftemperingtemperature(C)formostofthematerials?














47. Absorptivityofagreybodyvarieswiththe














48. Inradiativeheattransfer,agreysurfaceistheone,whichhas


















49. Overheatingofsatellitesduringreentrytoearthiscontrolledby














50. Themostabundantmetalpresentintheearth'scrustis














1. Toughnessofamaterialismeasuredbythe














2. Pickoutthewrongstatementaboutnucleateboiling.














3. L.D.(LinzDonawitz)converterisusedintheproductionof


















4. Turning/machiningof__________usuallydoesnotrequireanycuttingfluid.














5. Powdermetallurgyprocessingcanbeusedformaking














6. Whichofthefollowingalloyingelementswhenaddedinsteeldoesnotimproveits














7. Largestapplicationoflaserweldingisin__________welding.














8. Whichofthefollowingisaneutralfluxusedinthepyrometallurgyofmetalextraction?


















9. Thecriticalpressureatwhichthelatentheatofvaporisationofsteambecomeszerois














10. Valueofamaterialisusuallyconsideredasarelationshipbetween














11. Whichofthefollowingisnotanoreofzinc?














12. Pressuregaugesareneverconnecteddirectlytothelivesteamlineratheraloopor














13. Phosphorousisaddedtocoppermeltto

















14. Whichofthefollowingisnotasuitablesolidlubricant?














15. Onanaverage__________fastneutronsareproducedbynuclearfissionofeachatom












16. Castabilityofaluminiumisincreasedbytheadditionof__________init.














17. Additionof__________tosteelcannotimpartithighstrengthatelevatedtemperature.














18. Hardmagneticmaterialshavehigh














19. Thedifferenceinthepropertiesofasubstanceinthreestatesofmatterdependsuponthe


















20. Ignitionoffuelinadieselengineisby














21. Whatisthecriticalradiusofinsulation(cms)forametalliccylinder,iftheconvectiveheat












22. Whichsetofmaterialsisusedasamoderatorinnuclearreactor?














23. Malleabilisationheattreatmentisperformedon

















24. Forhardeninghighalloysteel,itistobeheatedslowlyanduniformlytoavoid














25. Disposablepatternsaremadeof














26. Thetypeofwaterfilternormallyemployed/preferredfortreatingsmallquantitiesofwater














27. Theradioactiveisotopeofhydrogenis














28. Refrigerativecoolingemployedduringlongdistancetransportationoffoodstuffsis


















29. Internalcracksindrawnbarsaredueto














30. Yieldstrengthofapolycrystallinemetalwithanaveragegrainsize,d,isproportionalto













31. Apipelineburiedinsoiliscommonlyprotectedfromcorrosionby














32. Circulationofliquidmetal(i.e.moltensodium)inaliquidmetalcoolednuclearreactoris














33. Titaniumisproducedby__________ofTiCl4.


















34. __________straingaugeisthemostsensitivesensingelementforstrainmeasurement.














35. Asimpleclosedgrindingcircuitmayconsistof














36. Inatitrationinvolvingweakacidandstrongbase,thepreferredindicatoris














37. Solidificationtimeofamoltenmetalinacastingisproportionalto(where,V=volumeof














38. Pickoutthewrongstatement.



















39. Minimumdiameterofthetubeusedformakingwatermanometershouldbe











40. Whichofthefollowingheattreatmentprocessesisusedforsofteningthehardened














41. Duringbrazing,ifthefluxesareentrapped,itresultsinthe














42. Maximumheatdissipationoccursfromasteelwire(k=0.5W/m.k)of15mmdiameter














43. Allmodesofheattransferi.e.,conduction,convection&radiationoccurincaseofthe


















44. Thestandardinstrumentusedforcalibratingtheloadappliedbyuniversaltestingmachine














45. ThereductantusedintheextractionofmagnesiumfromcalcineddolomiteviaPidgeon's














46. Withincreaseinpressure,thesaturationtemperatureofsteam














47. 'Sterilisedzone'aroundahazardouschemicalindustryisanareawith__________km













48. Pickoutthewrongstatement.Terminationofpolymerisationreactionoccurs,ifthe

















49. Athin,flat&squareplatemeasuring2mx2misfreelyhanginginambientairat25C.














50. Themaximumvalue,whichtheresidualstressinamaterialcanreachisthe














1. Pickoutthewrongstatement:














2. Thetensilestrengthofplasticsrangesfrom__________kg/mm2.














3. Ceramictipsforthecuttingtoolarepreparedfrom__________powder.


















4. Grainhardnessismeasuredbythe__________hardnesstestingmethod.














5. Thethermalefficiencyofaheatenginegivinganoutputof4KWwithaninputof10000














6. Numberofelectronsintheoutermostorbitofasemiconductoris










7. Theconditionofdiffractionfromacrystalisgivenby














8. Galenaisanoreof














9. Areductionprocessisaccompaniedwithincreaseinthe


















10. Draughtproducedbyatallchimneyduetodensitydifferencebetweenhotfluegasinside














11. Firstempiricaltemperaturescaleconceivedisthe__________temperaturescale.














12. Incontinuouscastingofliquidsteel,themouldismadeof














13. Diamonddoesnotconductelectricity,because


















14. __________cannotbeforged.














15. Materialhavingmaximumdensityis














16. Whichofthefollowingisnotfoundinironcarbonequilibriumdiagram?














17. Whichofthefollowingmetalscannotbeextractedbypyrometallurgicalprocessfromits














18. Nitrogencompoundsarenotusedinthemanufactureof


















19. Stelliteisatradenameforthe














20. Needlesareproducedby














21. Aromaticsaredesiredconstituentsof














22. Galvaniccorrosion














23. Increasingthetemperatureofamaterialmakesit


















24. Whichofthefollowingabsorbsmaximumheatinahighpressureboiler?














25. Thelaminarboundarylayerthicknessinzeropressuregradientflowoveraflatplatealong














26. __________cycleisthemostefficientthermodynamiccycle.














27. Dewpointofairindicatesits














28. Outofthefollowing,__________waveshavethelargestwavelength.














29. Picktheoddmanoutofthefollowing.


















30. Afurnaceismadeofarefractorybrickwallofthickness0.5metreandthermal














31. Hotworkingofleadiscarriedoutat














32. Anengineer'shammerismadeofhigh__________steel.














33. Impeller&casingofcentrifugalpumphandlingcorrosiveliquidandfrequentlyrunning


















34. Isotropicmaterialshavethesame__________inallthedirections.














35. Thegasesusedinthetreatmentofasthmaisamixtureof__________andoxygen.














36. Grindingwheelmadeofsiliconcarbideismostsuitableforgrindingmaterialsoflowtensile














37. Whichofthefollowingisthemosteffectiveinhibitorofgraingrowth,whenaddedinsmall














38. Acontrolleractioninwhichthereisacontinousrelationbetweenthevaluesofcontrolled


















39. Anidealfluidis














40. Whendrybulbtemperature&wetbulbtemperatureofmoistairisthesame,itmeans














41. High__________ofcastironmakesitsuitableforuseinmachinebeds.














42. Whichofthefollowingalloyingelementsreducestheformationofironsulphideinsteel?














43. Inagehardenablealloys,maximumductilityisobtained


















44. Prandtlmixinglengthinturbulentflowsignifiesthe














45. Magnesiumadditiontocastironincreasesits














46. ThedimensionsofPlanck'sconstantisthesameasthatofthe














47. 1%concentrationofwatervaporinairisequivalentto__________ppm(partsper














48. Theratioofcoildiametertowirediameterofaspringiscalledthespring


















49. Theminimumtemperaturetowhichthewatercanbecooledinacoolingtoweristhe














50. Dialysisistheprocessofseparatingsubstancesinthe














1. Whichofthefollowingiscapableofactingbothasanacidfluxaswellasabasicfluxinthe














2. Whichisthemostsuitablejointforthepipes,witharelaidsubmergedunderwater,














3. Floatingcontrolaction

















4. Boilerratingisnormallydoneintermsof














5. Thepressuredropperunitlengthforlaminarflowoffluidthroughalongpipeis












6. Uptothecriticalradiusofinsulation,addedinsulation,will














7. Limestoneisaddedintheblastfurnace(duringpigironmanufacture)to














8. Cementiteisinthelamellarforminthe__________phaseofsteel.


















9. Toimprovethemachinabilityofsteel,itisgenerallysubjectedto














10. Siliconinsteel














11. Dislocationsare__________defects.














12. Thethicknessofoxidefilmisyattimet.IfK1,K2andK3arethetemperaturedependent














13. Whichofthefollowinghastheleastvalueofultimatetensilestrength(UTS)?


















14. Whichofthefollowingisacommonlyusedmanometricliquidforlowpressurerange?














15. Thehigheststressthatamaterialcanwithstandforaspecifiedlengthoftimewithout














16. Temperatureprofilealongthelengthofagasgascounterflowheatexchangeriscorrectly











17. Metalshotsusedinshotblastingaremadeof


















18. Atthepointofboundarylayerseparationinfluidflow,the














19. BrinellHardnessNumber(BHN)fortalcisapproximatelyintherangeof














20. Aspringmaterialshouldhavelow


















21. Specificgravityofametal,whichweighs5kginairand4kgwhensubmergedinwater,













22. WhichofthefollowingisanacidicconstituentofB.F.slag?














23. Alumina,silica,limeandironoxidearethebasicrawmaterialforthemanufactureof


















24. Materialofconstructionoftheelectrodeusedintheelectricresistanceweldingis














25. Inpractice,thecompressionratioofcompressionignition(CI)enginerangesfrom














26. __________propertyofsteelincreasesbyadditionoflargeamountofsiliconinit.














27. __________stresscannotbesustainedbyafluidinequilibrium.














28. __________testcanbetermedasthesemidistructivetest.














29. Uniformrammingofsandingreensandmouldingprocessleadsto


















30. Theyieldpointphenomenonobservedinannealedlowcarbonsteelisduetothepresence














31. Thenoblemetals














32. Whichofthefollowingisanexampleofcathodicprotectionofmetalsagainstcorrosion?














33. Thermalefficiencyofaninternalcombustionengineisaround__________percent.

















34. Pickoutthecorrectcombinationabouttheroleofvariousadditivesusedinpolymers.














35. Thelightestnoninflammablegasis














36. Siliconcrystalcanbeconvertedtoptypesemiconductorbydopingwith














37. Largediameterreinforcedcementconcrete(RCC)pipesaregenerallyjoinedby














38. Increaseintheentropyofasystemrepresentsthe


















39. Propertyresponsibleforthetalcumpowdertoclingtotheskinisthe














40. __________hasanegativecoefficientoflinearexpansion.














41. WavelengthofXraysisabout1angstron,howeveritcannotpassthroughasheetof














42. AlloyingelementspresentinHaynessstellite,whichhassuperiorperformancethanhigh














43. TheminimumandthemaximumnumberofmembersrequiredtoformaPrivateLimited

















44. TheleachingsolventusedinBaeyer'sprocessforthepurificationofbauxiteis














45. Austemperingprocessresultsintheformationof__________structure.














46. Volumeofblastfurnaceslagisabout__________timesthevolumeofhotmetal(pig











47. Basicopenhearthfurnace(BOF)isnotusedforproducing__________steel.














48. PrincipalalloyingelementinElinvar(usedformakinghairspringsforwatches)is














49. Thevalueofy=cp/<500Cforair&mostcommongasescanbesafelyassumed

















50. Teslametreperampere(T.m/A)istheunitforthemeasurementof














1. Thefunctionofneutralfluxusedinthepyrometallurgyofmetalextractionistoincrease














2. Thethermodynamiclaw,PVy=constant,isnotfollowedbythe














3. Pickoutthewrongstatementaboutthemachinabilityofmetals.Machinabilityofametal


















4. Therefrigerantfreon12ischemically














5. Whichofthefollowingphenomenonwillexhibittheminimumheattransfer?














6. Pickoutthecorrectstatement














7. Ammoniagascanbedriedby














8. Consumableelectrodesareusedinthe__________welding.


















9. Magnesiumispresentin














10. Thepassagebetweenthenozzleandthe__________iscalled'sprue'incaseofinjection














11. Theamountofdifferentsubstancesproduced,whenthesamequantityofelectricityis














12. Amaterialhavinggooddampingpropertyislikelytohave














13. Exposureto__________accelaratesthedegradationofplastics.



















14. Steelproducedfromphosphaticironis__________innature.














15. __________istheprocessofcoatingthesurfaceofsteelwithaluminiumoxide,thereby














16. Whichofthefollowinghastheleastoiliness?














17. Surfacefinishofcastingdoesnotdependuponthe














18. Loadcellsusedforthemeasurementofweighthas


















19. Whiletheoxyacetyleneflameproducesatemperatureof3200C,thetemperature














20. FortheStoke'slawtobevalidinthecaseofafallingsphereinafluid,the














21. Coldchiesel&hammersaremadeof














22. Whichofthefollowingdoesnotlowerthesurfacetensionofliquids?














23. __________propertyofamaterialisdeterminedbytheHerbertPendulumdevice.














24. Cathodicprotectioniswidelyusedincontrollingcorrosionin


















25. Methylorangeindicatorturns














26. Outofthefollowing,themostmelleablematerialis














27. Additionofsilicontoaluminiumimprovesits














28. Whichofthefollowingpropertiesofasolidisnotdependentoncrystalimperfection?


















29. Inagoodrimmingsteel














30. "'Dikes'arelowheightwallsmadearoundthestoragevesselsmeantforstoring













31. Additionof__________tosteeldoesnothelpinimprovingitsmachinability.














32. Chalcopyriteisanoreof














33. Thefollowingisemployedassacrificialanodetoprovidecathodicprotectiontoships,














34. Heattransferby__________isalmostabsentincaseoffluidisedbeddryingoperation.


















35. Increasingthecarboncontentofsteel














36. __________metalisusedasabearinglinermaterial.














37. Foranidealgas,CpCvis











38. Sandusedtostopthegreensandfromstickingtothepatternistermedasthe














39. Brazingfillermetalusedforjoiningsteelplates


















40. Finegrainsizeinmetallicmaterialwill














41. Electrometallurgicalmethodsofmetalextractionisnormallyusedforthosemetals














42. Loweringofrecrystallisationtemperatureofmetalscanbeachievedbyits














43. Anexampleofabuffersolutionis


















44. Asolidaluminiumball,whenquenchedinawaterbathmaintainedat40C,coolsdown














45. Namethesafetydeviceusedtoprotecttheboiler,whenthewaterlevelfallsbelowa














46. Coldchiesel'shammersaremadeof














47. IntheXrayradiographytechnique,thetubevoltageforthickerplatesascomparedto














48. Atomic__________isawholenumberforanelement.


















49. Workrequiredforcompressionofagascontainedinacylinderis7000kJ.During














50. Highestcuttingspeedisachievedbythe__________toolmaterial.














1. Earingisadefectfoundinsteelsafterthefollowingmetalworkingoperation(s).














2. Forasmallscaletoyfactory,thefixedcostpermonthisRs.5000/.Thevariablecostper














3. Hydrogencanbe
































5. __________wireisneverusedformakingtheheatingelement.














6. Incontinuouscastingprocess,graphitemouldsareusedwithaviewtoproviding














7. Energyrequiredtocompressahotgasascomparedtocoldgaswillbe














8. Inthecommercialproductionofwhichofthefollowingmetals,matallothermicreduction


















9. Newwaterwellsaredisinfectedwithchlorineintheformof














10. Inaboundarylayerdevelopedalongtheflow,thepressuredecreasesinthedownstream














11. Velocityofagasinsoundisnotproportionalto(where,T=Absolutetemperatureofthe












12. Amateriallackingintoughnessisusuallytermedas














13. Thebasicconstituentofvegetableoilsis

















14. Latentheatofdrysteamatatmosphericpressureis539Kcal/kgwhich__________














15. Whichofthefollowingterminologyisusedforthetemperatureatwhichnewgrainsare














16. Whenatuningforkvibrates,thewavesproducedintheforkare














17. Fatiguelimitofamaterialshouldnotbeincreasedby














18. Forafixedcrosssectionalarea,themosteconomicalchannelsectionhasmaximum


















19. Pelletsarenotaspopularaburdenassinterintheironblastfurnace,becauseoftheir














20. Aformofstresscorrosionfailuretermedas'seasoncracking'isgenerallyobservedin














21. Amaterialsubjected__________musthavehighresilience.














22. Triplepointofwateris














23. Soluteatomswhichcauseyieldpointphenomenoninmildsteelare/is














24. __________pipeisthemostsuitableforcarryingsanitarydrainage.


















25. Liquorpoisoninggenerallyoccursduetothepresenceof__________init.














26. Pickoutthewrongstatement.














27. Morethan95%of__________ispresentincorrundum.



A1 2O3











28. Blowoffcockisprovidedinsteamboilerto


















29. Workhardeningofamaterial














30. Blastingoftrinitrotoluene(TNT)isdonebymixingitwithammonium














31. Thermitweldingiscategorisedasthe__________welding.














32. AgashavinganegativeJouleThompsoncoefficient,whenthrottled,will














33. Annealingofmetaldoesnot


















34. Whichofthefollowingisacommonconstituentofbothpaintandoilvarnish?














35. Lithiumisausefulalloyingadditiontoaluminium,becauseit














36. Whichofthefollowingrepresentsthecorrecttimetemperaturecurvewhenablockof











37. Pickoutthewrongstatementaboutcoating/electroplatingofmetals.


















38. Incaseofa,centrifugalpump,theratioh 1/h 2istermedasthe__________efficiency

(where,h 1=actualmeasuredhead&h 2=headimpartedtothefluidbyimpeller).














39. Brinellhardnessnumber(BHN)ofamaterialisanumber,whichhas


















40. Vanadiumadditiontosteelimprovesits














41. PlantsproducecarbohydratesfromtheCO2presentintheatmosphereby














42. Identifythecorrectstatementwithreferencetotheextractivemetallurgyofaluminium.














43. AparticleissettlinginaliquidunderStokesianconditions.Thefreefallingvelocityofthe


















44. Whichofthefollowingisnotusedasanalloyingelementinsteelusedformaking














45. Pickoutthewrongstatement.














46. Thefatigueresistanceofamaterialisimprovedbythefollowingtechnique.














47. Increaseintemperature,ingeneralresultsinthe














48. Whichofthefollowingcanbemanufacturedusingpowdermetallurgytechniques?


















49. Removalofnoncondensablesfromsteamorothervapouristermedasthe__________














50. Coldheadingorupsettingiscategorisedasthe__________process.














1. Tinplatedironandgalvanisedironaregenerallyproducedby














2. Inadrillingprocess,themetalisremovedbybothshearing&extrusion.Generalpurpose














3. Dezincificationisaformofcorrosionespeciallyapplicableto


















4. Whichofthefollowingmaterialsisnotsuitableasadiematerialforwiredrawing?














5. ByXraydiffraction,itisnotpossibletodeterminethe














6. Mildsteelhas__________crystallatticestructure.














7. Whichofthefollowingdoesnothaveasharpmeltingpoint?














8. Aluminiumisextractedfrom


















9. __________fluidforceisnotconsideredintheNavierStokesequation.














10. Whatisthevalueofentropyat273K?











11. Tinisnotpresentasanalloyingelementin














12. Thermitweldingusesthefollowingenergysource.














13. Thefrictionfactorfortheturbulentfluidflowinaroughpipedoesnotdependuponthe


















14. Fluegasespassthroughthefollowingboileraccessoriesinahighpressurenatural














15. Casehardeningofamaterialis














16. ThedifferenceinoneunitofRockwellhardnessnumbercorrespondstoadifferenceinthe














17. Steelballsaremanufacturedby














18. __________temperatureremainsconstantduringadiabaticsaturationprocessof

















19. Thebestlubricantsforamachineworkingathightemperature&loadis














20. Onefaceofafurnacewallisat1030Candtheotherfaceisexposedtoroom














21. RungaKuttamethodisusedtosolvea/an














22. Recrystallisationtemperatureofsteelis__________C.














23. Pressurerequiredtoincreasethedensityofwaterbyabout1%is__________














24. Eliminationofbrittlenessresultingfromweldingofsawbladesisdoneby__________of


















25. Themaximumstressbelowwhichamaterialcanwithstandaninfinitenumberofcycleof














26. Thebestguidetojudgethegeneralqualityofwateristhemeasurementofits














27. Wroughtironisnot














28. Whichofthefollowingisthelargestquantumofpressure?


















29. Whichofthefollowingisnotachargematerialforcupola?














30. Whichofthefollowingisanundesirablepropertyofslagproducedduringthe














31. In__________process,ionsofsaltsreactwithwatertoproduceacidityoralkalinity.














32. __________isusedfortyingthesteelcoloumnstoconcretefoundation.














33. Fatigueresistanceofamaterialismeasuredbythe


















34. __________isthetradenameassignedtoanonferrouscastalloycomposedofcobalt,














35. Adensestructureofgrindingwheelisnotusedforthe














36. Whichofthefollowingisnotaprincipalalloyingelementforthestructuralsteel?














37. Metalloids














38. Pickoutthewrongstatement


















39. Leadispouredintothejointsbetweentwo__________pipes.














40. 'Icepoint'isdesignatedonFarenhitetemperaturescaleby













41. Maximumhardenabilityofsteeldependsuponits














42. Blastfurnaceslagismainlymolten














43. Ajetengineturbinebladeisnormallymanufacturedby


















44. Stainlesssteelisweldedusing














45. Thecoolingraterequiredtofreeze1tonofwaterat0Cintoiceat0Cin24hoursis














46. Thephenomenonoccurringduringexplosionofahydrogenbombis














47. Squaresteelkeyisnormallystronginfailurebyshear&crushing.Keysarenormally














48. Nitridingofasteelpartdoesnotincreaseits


















49. __________ofgreycastironproduceswhitecastiron.














50. Asthefluidflowrateincreases,thefloatoftherotameter














1. Titaniumisaddedtomoltenaluminiumalloysbeforecastingforthepurposeof














2. Cementedcarbidetoolsarenotsuitableforcutting














3. Thedifferencebetweengross&netcalorificvaluesoffuelisduetothe


















4. Whichofthefollowingispreferredforrivetting?














5. Heatingthehypoeutectoidsteelsto30Cabovetheuppercriticaltemperatureline,














6. Outofthefollowing,whichwillfracturemostreadity,whenhitwithahardhammer?














7. Apycnometerisusedforthemeasurementof














8. Forinfiniteparallelplaneshavingemissivities1&2,theinterchangefactorforradiation


















9. Workingoflinearvariabledifferentialtransducer(LVDT)isbasedontheprincipleof














10. Ahighlyelasticmaterialisdeformedleastonloadingandretainsitsoriginalformon














11. Maximumpermissiblesulphurcontentinsteelis__________percent.














12. Thedimensionalformulaofbulkmodulusofelasticityissameasthatofthe














13. Ferromagneticmaterialowetheirpropertiesto__________innersubshells.


















14. Whichofthefollowingmetalsisthemostpronetoworkhardening?














15. 'Amortization'inrespectoffinancialobligationofacompanymeansthe














16. Differenceatanyinstantbetweenthevalueofthecontrolledvariableandthesetpointis














17. Theexpectedefficiencyofasinglerivettedlapjointisoftheorderof50%.Ifthe














18. Nickeland__________arethealloyingelementaddedinsteeltoincreaseitstoughness.


















19. Whichofthefollowingequipmentsisusedforliquiddispersion?














20. Eutectoidcompositionofcarbonsteelatroomtemperatureis














21. Midrexprocessofspongeironproductionusesreformednaturalgasasthereducing














22. Corrosionis














23. Whichofthefollowingisnotanoreofcopper?














1. Additionof__________tosteeldoesnotimparthardness.














2. Foraspontaneousnaturalprocessatconstanttemperatureandpressure,thefreeenergy














3. Inertialforcesareobtained,whentheelasticforcesaremultipliedby__________


















4. Temperatureofhotgasesflowinginapipeismeasuredbyathermocoupleinsertedinthe














5. Wavelengthofradiationemittedbyabodydependsonthe__________ofitssurface.










