Sie sind auf Seite 1von 192



$(QJOLVK



8VHUVDQG0DLQWHQDQFH0DQXDO
,VVXH5HYLVLRQ

1&SURFHVVLQJFHQWUH

529(5
/6/6

Series number

Information on this publication

,QIRUPDWLRQRQWKLVSXEOLFDWLRQ

Code:

Issue:

Revision:

Approval number:

5801A0103

(01, 1999)

98/0036

(01, 1999)

98/0013M

(03, 1999)

98/0084M

(10, 1999)

98/0318M

List of changes
Revision:

Additions :

new document

Deletions :

Changes :

B.4

C.11

C.5

This manual has been prepared for use by clients only and it contains information protected by
copyright. It must not be photocopied or reproduced in any form, either fully or in part, without the
prior written consent of BIESSE. The manual is supplied together with the machine, and must be
kept in a safe place in order to have it always to hand for consultation.
The manual must only be used by personnel who have been adequately trained to operate the
machine. BIESSE cannot be considered responsible or liable for damage resulting from incorrect
or improper use of the documentation provided. In order to avoid incorrect manoeuvres that might
result in danger to the operator or to third parties, it is essential to read and fully understand all the
documentation supplied with the machine.

BIESSE S.p.A. Woodworking Machinery


(5801a0103.fm-210300)

Information on this publication

BIESSE S.p.A.

Woodworking Machinery
(5801a0103.fm-210300)

Table of contents

7DEOHRIFRQWHQWV

,QWURGXFWLRQ
Field of application and limits of the manual . . . . . . . . . . . . . . . . . . . . . . 11
Documents supplied with the machine . . . . . . . . . . . . . . . . . . . . . . . . . . 11
Warning signs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
Warnings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 12

&KDSWHU

'HVFULSWLRQ

1.1

General view and main parts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-2

1.2

Work table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-3

1.3

Operating section . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-5


Collet spindle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-6

1.4

Tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-7

1.5

Safety devices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-8

1.6

What the machine is designed to do . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-10


Characteristics and dimensions of workable materials . . . . . . . . . . . . . . 1-10
Machining operations possible . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-11

1.7

Control area . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-13

1.8

Danger area . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14

1.9

Optionals for the work table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14


Electronic position display device . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14
Additional suction cups . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14
Additional rows of stops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14
Double movement stop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-14
Ball support . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-15
Larger work table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-15
Work table with 4 working areas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-15
Solid work table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-16
Chip removal conveyor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-17
Curved door and window frame machining kit . . . . . . . . . . . . . . . . . . . . 1-17

1.10

Optionals for the operating section . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-17


Boring head BH 43 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-17
Electrospindles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-18
Collet spindles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-18
Automatic tool orientation device (axis C) . . . . . . . . . . . . . . . . . . . . . . . . 1-18
Blower . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-18

BIESSE S.p.A. Woodworking Machinery


(5801a0103toc.fm-210300)

Table of contents

Electrospindle aggregates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-18


Milling units . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-21
Other devices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-21
1.11

Optionals for the tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-22


Revolver tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-22
Belt tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-22
Rack tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 1-22

&KDSWHU

&RQWUROVDQGVLJQDOOLQJGHYLFHV

2.1

Layout of controls and signalling devices. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-1

2.2

Main switch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-2

2.3

XNC numerical control module . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-2


PLC Keyboard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-3
Override . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-4

2.4

Operator control panel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-4

2.5

Supplementary front button pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-5

2.6

Supplementary rear button pad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-6

2.7

Pedals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-6

2.8

Portable supplementary button pad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 2-7

2.9

Button unlocking tools from the belt tool magazine . . . . . . . . . . . . . . . . . . . . . . 2-7

2.10

Button unlocking tools from the electrospindle. . . . . . . . . . . . . . . . . . . . . . . . . . 2-7

&KDSWHU

%DVLFRSHUDWLRQV

3.1

Switching on . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-1

3.2

Switching off . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-1

3.3

Emergency stop . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-1

3.4

Deactivating the emergency devices . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-2

3.5

Axes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-2
Axis C. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-3
Axis Cr . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-3

3.6

Working area . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-3

3.7

Row of stops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4

3.8

Origin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4

3.8.1

Machine origin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-4

3.8.2

Work table origin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3-5

&KDSWHU

6HWWLQJXS

4.1

Boring tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-1

4.2

Milling tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-2

4.3

Circular blade tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-4

4.4

Fitting tools on the boring head . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-5


Fitting the circular blade tool on boring head BH 43 . . . . . . . . . . . . . . . . 4-6

BIESSE S.p.A. Woodworking Machinery


(5801a0103toc.fm-210300)

Table of contents

4.5

Fitting tools on pincer-type spindles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-6

4.6

Fitting tools in aggregates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-8

4.7

Electrospindle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-10
Fitting pincer-type spindles and aggregates . . . . . . . . . . . . . . . . . . . . . . 4-10
Heating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-11

4.8

Revolver tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-11


Installation of the aggregate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-12
Compatibility of tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-12
Limits for tools to be used in the magazine . . . . . . . . . . . . . . . . . . . . . . . 4-14

4.9

Belt tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-15


Installation of the aggregate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-15
Compatibility of tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-16
Limits for tools to be used in the magazine . . . . . . . . . . . . . . . . . . . . . . . 4-17

4.10

Rack tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-17


Installation of the aggregate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-18

4.11

Working table. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-20


Positioning the mobile support . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-20
Positioning the central and side stops . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-21
Positioning the shapeable suction cup . . . . . . . . . . . . . . . . . . . . . . . . . . 4-21
Fitting the seal element on the shapeable suction cup . . . . . . . . . . . . . . 4-22
Fitting clamps on the stops . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-22
Use of the electronic position display device . . . . . . . . . . . . . . . . . . . . . . 4-23
Solid work table . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 4-24

&KDSWHU

0DFKLQLQJ

5.1

Selecting the origin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-1

5.2

Locking the piece in position . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-1


Normal locking . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-2
Locking with clamps . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-2
Locking with auxiliary vacuum system . . . . . . . . . . . . . . . . . . . . . . . . . . 5-2

5.3

Starting machining . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-3


Restarting machining after a suspension . . . . . . . . . . . . . . . . . . . . . . . . 5-3

5.4

Pendular machining . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-3

5.5

Restarting the machine after an emergency stop . . . . . . . . . . . . . . . . . . . . . . . 5-4

5.6

Restarting the machine after a power cut . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-5

5.7

Machining with the curved door and window frame kit . . . . . . . . . . . . . . . . . . . 5-6

Pendular machining with suspension . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-3

Machining the arch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5-6


Disabling the kit to allow normal use of the machine . . . . . . . . . . . . . . . 5-10

&KDSWHU
6.1

0DLQWHQDQFH

Table of maintenance operations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-1

BIESSE S.p.A. Woodworking Machinery


(5801a0103toc.fm-210300)

Table of contents

6.2

Characteristics of lubricants . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-2

6.3

General cleaning of the machine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-4

6.4

Draining condensation from the FRL unit. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-4

6.5

Cleaning the belt tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-5

6.6

Checking tool lock on the electrospindle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-5

6.7

Cleaning the vacuum pump . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-6

6.8

Cleaning the guides and racks . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-6

6.9

Lubrication of the belt tool magazine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-7

6.10

Checking pressure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-7

6.11

Cleaning the electrospindle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-8

6.12

Cleaning the ISO 30 pincer-type spindle . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-9

6.13

Cleaning and lubricating the HSK F50, F63 pincer-type spindle . . . . . . . . . . . . 6-10

6.14

Lubrication of the milling unit with circular blade tool . . . . . . . . . . . . . . . . . . . . . 6-10

6.15

Lubrication and cleaning of the aggregate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-10

6.16

Lubrication of the circular blade tool unit on boring head BH 43 . . . . . . . . . . . . 6-11

6.17

Lubricating of the boring head and cleaning the spindles . . . . . . . . . . . . . . . . . 6-12

6.18

Checking wear on the blades and replacing the dust separator . . . . . . . . . . . . 6-13

6.19

Topping-up lubricant in the FRL unit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6-14

6.20

Topping-up lubricant in the central greasing system . . . . . . . . . . . . . . . . . . . . . 6-15

&KDSWHU
7.1

7URXEOHVKRRWLQJ

Problems, causes and solutions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 7-1

$SSHQGLFHV
$SSHQGL[$

6DIHW\LQIRUPDWLRQ

A.1

Transport and moving . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A-1

A.2

Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A-1

A.3

Tools . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A-1

A.4

Preparation and machining . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A-2

A.5

Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A-3

A.6

Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . A-3

$SSHQGL[%

7HFKQLFDOFKDUDFWHULVWLFV

B.1

General information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B-1

B.2

Position of operating section units along axes X -Y . . . . . . . . . . . . . . . . . . . . . . B-3

B.3

Position of operating section units along axis Z . . . . . . . . . . . . . . . . . . . . . . . . . B-5

B.4

Working range . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B-6

B.5

Electrospindle aggregates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B-24

B.6

Layout of the machine, connection points and working dimensions . . . . . . . . . B-28

BIESSE S.p.A. Woodworking Machinery


(5801a0103toc.fm-210300)

Table of contents

B.7

Noise level . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . B-41

$SSHQGL[&

7UDQVSRUWDQG,QVWDOODWLRQ

C.1

List of parts to be transported . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-1

C.2

Lifting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-2
Main structure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-2
Mesh guard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-4
Contact mats . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-4
Vacuum pump and box of material supplied with the machine . . . . . . . . C-4

C.3

Moving . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-5
Main structure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-5

C.4

Installation area . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-6


Electrical system requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-6
Pneumatic system requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-7
Suction system requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-7
Flooring requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-8
Environmental requirements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-9

C.5

Anchoring the machine to the ground . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-9

C.6

Removing and positioning the electrical control cabinet . . . . . . . . . . . . . . . . . . C-14

C.7

Removing the blocking devices used for transport . . . . . . . . . . . . . . . . . . . . . . C-16

C.8

Refitting the tool magazine and automatic tool change device . . . . . . . . . . . . . C-18

C.9

Repositioning the cable-carrier chain for axis Y . . . . . . . . . . . . . . . . . . . . . . . . C-18

C.10

Levelling the machine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-19

C.11

Assembling the mesh guard . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-20


Arrangement of the components forming the mesh guard . . . . . . . . . . . C-20
Door assembly plan. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-22
Diagram of how to anchor the mesh guard to the floor . . . . . . . . . . . . . . C-23

C.12

Assembling the chain supports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-23

C.13

Assembling the main suction conveyor and curtain guards . . . . . . . . . . . . . . . C-24

C.14

Fixing the contact mats . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-25

C.15

Installation of the additional button pads . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-26

C.16

Installation of the vacuum pump . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-27

C.17

Electrical system connection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-27

C.18

Connecting the pneumatic system . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-28

C.19

Connecting the chip suction system . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C-29

$SSHQGL['

'HFRPPLVVLRQLQJ'HPROLWLRQ

$SSHQGL[(

*XDUDQWHHDQGFOLHQWVHUYLFLQJ

E.1

Conditions of the guarantee . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E-1

E.2

Client servicing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . E-2

BIESSE S.p.A. Woodworking Machinery


(5801a0103toc.fm-210300)

Table of contents

$QDO\WLFDO,QGH[

10

BIESSE S.p.A. Woodworking Machinery


(5801a0103toc.fm-210300)

Introduction

,QWURGXFWLRQ

)LHOGRIDSSOLFDWLRQDQGOLPLWVRIWKHPDQXDO
This manual is aimed at users of the machine for which it provides basic information that the user
must know before starting to use the machine. It also contains information on the maintenance of
the machine necessary to ensure that it remains efficient and safe over time. In order to use the
machine properly, the Users and Programming manual and Enclosures must also be consulted.

'RFXPHQWVVXSSOLHGZLWKWKHPDFKLQH
User s and Programming Manual. Contains information on the typical operations and
procedures to follow in order to produce the programs that can be carried out with the software
connected to the machine.
Spare Parts Catalogue. This is used to order components that must be replaced, following the
instructions given in the introduction to the manual.
Circuit diagrams. These describe the main plants of the machine (electric, pneumatic, etc.) and
are provided for the technician responsible for solving problems. This technician must be expert
and competent in his job.
Enclosures. These contain information on any special parts of the machine. In order not to miss
any important information, each Enclosure must be consulted together with the document to which
it refers.

:DUQLQJVLJQV
Paragraphs that should not be overlooked are highlighted and preceded by the symbols described
and illustrated below:
DANGER

Paragraphs marked with this symbol indicate an imminent danger, and the contents must
therefore be taken into careful account in order to prevent a serious accident.
CAUTION

Paragraphs marked with this symbol indicate procedures to be used and actions to be
taken to avoid any damage to goods and property.

BIESSE S.p.A. Woodworking Machinery


(a101h001.fm-210300)

11

Introduction

INFORMATION

This symbol is used to indicate points of particular importance that must not be overlooked.

:DUQLQJV
The safety information provided in the appendix to this manual must be read before using the
machine.

12

BIESSE S.p.A.

Woodworking Machinery
(a101h001.fm-210300)

Chapter 1.

&KDSWHU

'HVFULSWLRQ

The machine is designed and built for installation in workshops and factories operating in the
woodworking business. It is available in two models:
It is available in a number of models:
q

ROVER 30 L2

ROVER 30 S2

ROVER 30 L3

ROVER 30 S3

A CE version is also available for each model, and is destined for the European market and for
those countries complying with Directive 89/392 and subsequent amendments. The differences
between the various models and versions will be underlined within the manual.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1-1

Chapter 1.
Description



*HQHUDOYLHZDQGPDLQSDUWV
ROVER 30 L2, ROVER 30 S2

ROVER 30 L3, ROVER 30 S3

A - Base; this is the machines bearing structure.


B - Work table; this is equipped with the devices used to position and fix the piece to be
machined. For further details, please go to the paragraph 1.2 Work table.
C - Operating section; this is equipped with the groups used to machine the piece. For further
details, please go to the paragraph 1.3 Operating section.
D - Tool magazine; this is used to house the tools required to machine the piece, and it enables
the tool to be changed automatically 1.4 Tool magazine.
E - Electrical cabinet; contains the principle electronic devices and the numerical control.
F - Numerical control and Control panel; used to manage machine operations. For further
information, please see Chapter 2. Controls and signalling devices.
G - Vacuum pump; provides the suction necessary to lock the piece to be worked in position.

1-2

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

H - Identification plate; this indicates the name and address of the manufacturer, and main
information about the machine (model, serial number, etc.).



:RUNWDEOH

The main parts of the work table are illustrated and described below, and indications of their
position on the machine are also given (seen from above).

ROVER 30 L2, ROVER 30 S2

ROVER 30 L3, ROVER 30 S3

J
A
A
G
B

BG

C
D

E
F

front of the machine

front of the machine

A - Mobile support; this supports the piece positioning and locking devices that are fitted on it,
and can be positioned manually along the X axis.
B - Fixed support; this supports the piece and the side stops.
C - Shapeable suction cup; this is used to support and lock the piece. It can be positioned
manually along the Y axis. The channels on its surface allow the vacuum area to be modified,

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1-3

Chapter 1.
Description

by means of a special rubber seal element. There are 2 types of shapeable suction cup, a
normal one and a small one.
D - Rear stop; this is used as a reference when positioning the rear end of the piece.
E - Front stop; this is used as a reference when positioning the front end of the piece.
F - Centre stop; this is used as a reference when positioning the right or left hand side of the
piece (according to the working area being used).
G - Side stop; this is used as a reference when positioning the right or left hand side of the piece
(according to the working area being used).
H - Bar support; this rises automatically during loading and unloading operations, and is used to
facilitate movement of heavy pieces.
J - Clamp; this is an auxiliary locking device used when the characteristics of the piece do not
allow it to be locked safely using the suction cups alone. It is fitted on the top of the stops.

1-4

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description



2SHUDWLQJVHFWLRQ

The main parts of the operating section are illustrated and described below.

ROVER 30 L2, ROVER 30 S2

ROVER 30 L3, ROVER 30 S3

B
C

Slot A

Slot B

Slot A
Slot B

Slot C

A - Boring head; this is fitted with 20 spindles for vertical boring and 4 chucks, each one with 2
opposed spindles for horizontal boring. The vertical boring spindles are used to machine the
top side of the piece. Of the 4 horizontal boring chucks, 3 are used to machine the sides of the
piece parallel to the plane Y - Z, and 1 is used to machine the sides parallel to the plane X - Z.
The vertical boring spindles and the horizontal boring chucks can be used either singly or in
groups.
B - Electrospindle; this is mainly used for milling operations. The electrospindle has a power
level of 7.7 kW (10.5 HP) and the ISO 30 type coupling allows the tool to be changed quickly.
The electrospindle can also change tools automatically using the tool magazine (see pag. 1 7).The electrospindle is fitted to a slide that allows it to descend when in use and to rise again
when machining operations have been completed.
C - Slot; these are areas in which it is possible to install additional electrospindles or optional
milling units (see par. 1.10 Optionals for the operating section). The operating section has 2
or 3 slots, according to the machine model. These are known as A and B or A, B and C, and 1
of them is already occupied.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1-5

Chapter 1.
Description

&ROOHWVSLQGOH
The collet spindle is used to fit the tool in the electrospindle.
A - Coupling; this is the part that connects to
the electrospindle. This is an ISO 30 type
coupling set up for use with ERC 32 type
collets. Rotation can be to the left or to the
right. Those with left-hand rotation can be
identified by the slot on the outside of the
coupling.
B - Collet; this is used to house and lock the
tool shank. These are ERC 32 type collets,
which allow the use of tools with a shank
diameter of between 6 and 20 mm. Each
collet is set up for a specific shank
diameter.

C
B

C - Ring; this is used to tighten the collet and lock the tool in place. The slots on the outside of
the ring are provided to increase the grip when tightening.

1-6

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description



7RROPDJD]LQH

A - Revolver tool magazine; this is provided with 7 seats for an equal number of tools with ISO
30 or HSK F50 coupling. This type of magazine also allows the tool to be changed during
boring head boring operations. It is only used in the models ROVER 30 L2, ROVER 30 S2.
B - Belt tool magazine; this is provided with 12 seats for an equal number of tools with ISO 30
coupling. It is fitted with an automatic tool change device, which picks up the tool required
from the tool magazine and positions it in an area to which the electrospindle will be moved to
pick it up.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1-7

Chapter 1.
Description



6DIHW\GHYLFHV

The safety devices are the same for all models. However, in some of these devices there are
differences between CE and non-CE versions.
CE version

F
E

C
D

B
A
G

Non-CE version

C
D

H
G

1-8

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

A - Emergency button; used to shut down the machine immediately. It is located on the control
panel and in other points on the machine. For further information, please see Chapter 2.
Controls and signalling devices.
B - Emergency cord; this is foot-operated and is used to stop the machine immediately.
C - Sound-proof casing; limits the amount of noise generated by the operating section.
D - Curtain guards; these are made of PVC and serve to protect the operator from the risk of
airborne chips or tool fragments.
E - Cut off valve; this is used to perform maintenance or repairs on the machine in safety. When
closed it discharges the pneumatic system and blocks the air flow from the supply network.
The device can be locked to prevent it from being tampered with by unauthorised persons.
F - Mesh guard; protects the operator from the risk of interference with moving parts. It is fitted
with sliding doors that allow access to the internal area in order to carry out tooling and/or
maintenance operations. The doors are fitted with safety microswitches that can be locked.
Opening of the doors causes the machine to stop immediately
G - Contact mats; these detect the presence of the operator and stop the machine immediately
in the event of any danger.
H - Chain supports; these define the area within which the operating section moves. On the
clients request they can be replaced by the mesh guard provided with the CE version.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1-9

Chapter 1.
Description



:KDWWKHPDFKLQHLVGHVLJQHGWRGR

The machine is set up to be used on its own with manual intervention by an operator for loading
and unloading of the material to be worked. The machine has been designed, constructed and
protected with safety measures exclusively for uses that correspond with the specifications and
data indicated in this manual or otherwise supplied by BIESSE.

&KDUDFWHULVWLFVDQGGLPHQVLRQVRIZRUNDEOHPDWHULDOV
It is possible to work panels in solid wood, fibre panels, chipboard panels, plywood and MDF
(medium density fibres) with the following maximum dimensions:

Y
X
Z

front of the machine

Model

ROVER 30 L2

(mm)

4432

1540

200

ROVER 30 S2

(mm)

3432

1540

200

ROVER 30 L3

(mm)

4432

1215 (opt. 1540)

200

ROVER 30 S3

(mm)

3432

1215 (opt. 1540)

200

The maximum values indicated for axis X and Y correspond to the surface area of the piece
resting on the machine work table. The value indicated for axis Z corresponds to the maximum
thickness of the piece that can be machined without interfering with the operating section when it is
moved. Information relating to workability of the piece must be calculated each time, taking into
account the maximum movements to be performed by the operating section unit carrying out
machining operations, the position of the piece on the work table, the dimensions of the tool and
the working dimensions of any other units on the operating section. On axis X and Y it is also
possible to load pieces with larger dimensions than the ones indicated. In this case, always check
that the piece is safely supported and locked before starting machining operations.

1 - 10

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

Maximum dimension of the piece along axis X for pendular machining is the following:
Model

X1

X2

X3

X4

ROVER 30 L2

(mm)

1500

2100

1300

2100

ROVER 30 S2

(mm)

1000

1600

800

1600

ROVER 30 L3

(mm)

1500

2100

1300

2100

ROVER 30 S3

(mm)

1000

1600

800

1600

X1 = value for CE version; X2 = value for CE version with suspension; X3 = value for non CE
version; X4 = value for non CE version with suspension.
The minimum dimensions are not easy to define, since the intensity of the vacuum clamping
system depends on porosity, thickness and dimensions of the piece. In addition, the minimum
clamping intensity differs for each type of tool used. Whenever questions arise concerning the
effectiveness of the standard clamping system, the use of auxiliary clamping systems is
recommended (stop clamps, front pushers, etc.). In any case, BIESSE is available for any further
information or clarification that may be required.

0DFKLQLQJRSHUDWLRQVSRVVLEOH
The various machining operations that can be performed are described and illustrated below.
Some of the machining operations listed can only be performed using optional units.
q

Vertical boring.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1 - 11

Chapter 1.
Description

Horizontal boring.

Vertical and horizontal milling.

Inclined boring and milling.

1 - 12

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description



Cutting.

&RQWURODUHD

The following are the areas in which the operator must stand when the machine is in operation in
order to operate and oversee the controls:
q

In front of the electrical cabinet in order to


operate the controls on the control panel
and use the NC.

In front of the base in order to load the


material and check that the machine is
operating normally.

The area/s in which the operator must stand to set up the machine will be indicated in the relevant
chapter.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1 - 13

Chapter 1.
Description



'DQJHUDUHD

The danger area in the machine is the whole area occupied by moving parts when the machine is
working. This area is protected by a number of safety devices.



2SWLRQDOVIRUWKHZRUNWDEOH

The optionals available for the work table are described and illustrated below.

(OHFWURQLFSRVLWLRQGLVSOD\GHYLFH
This is installed on the front of each mobile
support. It is used to display the positions at
which the supports themselves, the suction cups
and the stops must be positioned.

$GGLWLRQDOVXFWLRQFXSV
It is possible to add one shapeable suction cup to each mobile support. Normally when this option
is requested for models ROVER 30 L3 and ROVER 30 S3 both the additional row of stops and the
larger work table are also requested.

$GGLWLRQDOURZVRIVWRSV
The rear row of stops can be added on models ROVER 30 L3 and ROVER 30 S3.

'RXEOHPRYHPHQWVWRS
This can be used in place of the normal stop, or
fitted as an additional row of stops. It is used to
position special pieces with protruding edges.

1 - 14

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

%DOOVXSSRUW
This is fitted in place of the bar support, and is
used for the same purpose.

/DUJHUZRUNWDEOH
For the models ROVER 30 L3 and ROVER 30 S3, it is possible to request a longer work table
(along the Y axis) than the one foreseen for the standard models. Usually, when this option is
requested a row of stops and a suction cup is also added on each mobile support. The figure
below shows the arrangement of parts when requesting this option.

front side of the machine

:RUNWDEOHZLWKZRUNLQJDUHDV
It is possible to request division of the work table into 4 working areas instead of the 2 foreseen in
the standard machine.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1 - 15

Chapter 1.
Description

6ROLGZRUNWDEOH
This type of work table is used in particular to machine large, thin panels, which would not be
adequately supported on the standard machine work table.

A number of accessories are available for this type of work table:


Suction cup; allows the piece to be locked at a
certain distance above the table, in order to
perform machining operations on the edges.
There are suction cups of various diameters
fitted with balls to facilitate the movement of
large pieces.

Stop; provides a reference when positioning the


piece. The stop drops down automatically when
the piece is locked.

1 - 16

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

&KLSUHPRYDOFRQYH\RU
This is positioned on the base under the work
area and provides for removal of waste material.
The device also comprises a bin for collection of
waste material, which is positioned at the
discharge end of the conveyor.

&XUYHGGRRUDQGZLQGRZIUDPHPDFKLQLQJNLW
The kit comprises a group of devices, fitted to the work table, which allows machining of curved
door and window frames. For further information, please see paragraph 5.7 Machining with the
curved door and window frame kit.



2SWLRQDOVIRUWKHRSHUDWLQJVHFWLRQ

The optionals available for the operating section are described and illustrated below.

%RULQJKHDG%+
This is an optional for models ROVER 30 L2 and
ROVER 30 S2. It is fitted in place of the boring
head provided with the standard model. It is
fitted with 27 vertical boring spindles and 7
chucks with horizontal boring spindles. It is also
provided with a circular blade tool unit for
straight milling along axis X. With this type of
boring head, slot A is cancelled.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1 - 17

Chapter 1.
Description

(OHFWURVSLQGOHV
It is possible to fit other electrospindles in the free slots. It is also possible to request and install 8
kW (10.9 HP) electrospindles, or to use other types of coupling: HSK F50 or HSK F63.

&ROOHWVSLQGOHV
It is possible to request collet spindles for ERC 40 collets. The ERC 40 collets make it possible to
use tools with a shank size of between 6 and 25 mm.

$XWRPDWLFWRRORULHQWDWLRQGHYLFH D[LV&
This is fitted on the electrospindle. It is used to
provide automatic orientation in any direction of
the aggregate fitted to the electrospindle (see
Electrospindle aggregates).

%ORZHU
This consists of a pipe on the electrospindle that
provides a jet of air during operation to cool and
clean the surrounding area.

(OHFWURVSLQGOHDJJUHJDWHV
These are fitted on the electrospindle and are used for a number of different operations. They can
also be used in the tool magazine. All the aggregates are equipped with ISO 30 coupling and
some of them have an HSK F50 and/or F63 coupling. The following gives an illustration and
description of all the aggregates provided.

1 - 18

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

Aggregate for vertical boring; fitted with 3


vertical spindles. It is used to bore hinge
application slots.

Aggregate for horizontal boring; fitted with 2


opposite horizontal spindles.

Aggregate for horizontal milling; fitted with 1


horizontal spindle.

Aggregate for straight milling and cutting; fitted


with 1 spindle for circular blade tools of 120
mm.

Aggregate for horizontal milling; fitted with 4


horizontal spindles. The body of the aggregate
can be rotated manually from 0 to 90.

Aggregate for horizontal milling, straight milling


and cutting; fitted with 2 horizontal spindles and
1 spindle for circular blade tool of 120 mm. It is
not possible to use all 3 spindles at the same
time; only 2 spindles can be used at any one
time. The body of the aggregate can be rotated
manually from 0 to 90.
Aggregate for horizontal and inclined milling;
fitted with 1 horizontal spindle which can be
inclined between 0 and 90.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

ISO 30
HSK F50

ISO 30
HSK F50

ISO 30
HSK F50

ISO 30
HSK F50

ISO 30
HSK F50
HSK F63

ISO 30
HSK F50
HSK F63

ISO 30
HSK F50
HSK F63

1 - 19

Chapter 1.
Description

Aggregate for straight and inclined milling and


cutting; fitted with 1 spindle which can be
inclined between 0 and 90 for circular blade
tools of 120 and 180 mm.

ISO 30
HSK F50
HSK F63

Aggregate for straight milling and cutting; fitted


with 1 spindle for circular blade tools of 180
mm.

ISO 30
HSK F50
HSK F63

Aggregate for straight milling and cutting; fitted


with 1 spindle for circular blade tools of 250
mm.

ISO 30
HSK F63

Aggregate for horizontal milling; fitted with 1


horizontal spindle. Used for particularly deep
machining operations.

1 - 20

ISO 30
HSK F50
HSK F63

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 1.
Description

0LOOLQJXQLWV
The milling units are groups set up to perform specific machining operations. They are installed on
the operating section in the free slots.
A - Milling unit with 1 spindle for circular blade
tools of 180 mm. Used for straight milling
along axis X or axis Y. It can be fitted with a
device to provide automatic orientation of
the tool in the desired direction (X or Y).

B - Milling unit with 1 horizontal spindle with


ERC 32 collet coupling. Used for
particularly deep milling operations, for
example when cutting out the cavities for
door locks.

2WKHUGHYLFHV
Copier; used on the electrospindle. It is used to
copy the surface of the panel, while maintaining
the same working depth setting.

CAUTION

To avoid any risk of damage, never perform zeroing operations on axis C when the copier is
fitted to an electrospindle that has an automatic tool orientation device.
Thickness tracer; used to detect the thickness of
the piece automatically.

Thickness tracer (RENISHAW type); used to


detect the thickness, width and length of the
piece automatically.

BIESSE S.p.A. Woodworking Machinery


(a102h002.fm-210300)

1 - 21

Chapter 1.
Description



2SWLRQDOVIRUWKHWRROPDJD]LQH

The following describes and illustrates the optionals available for the tool magazine.

5HYROYHUWRROPDJD]LQH
For models ROVER 30 L2 and ROVER 30 S2, it is possible to request that the revolver tool
magazine for HSK F63 couplings be fitted.

%HOWWRROPDJD]LQH
It is possible to request 12 or 18 tool holder belt tool magazines set up for ISO 30, HSK F50 and
HSK F63 couplings.

5DFNWRROPDJD]LQH
It is possible to request the rack tool magazine. This is fitted in the left hand part of the base under
a special cover. The magazine is made up of 1 or 2 racks, each of which has 3 or 5 tool holders.
The electrospindle aggregates are housed in the racks with 3 tool holders. Tools with a maximum
diameter of 160 mm are housed in the racks with 5 tool holders.

1 - 22

BIESSE S.p.A.

Woodworking Machinery
(a102h002.fm-210300)

Chapter 2.

&KDSWHU



&RQWUROVDQGVLJQDOOLQJGHYLFHV

/D\RXWRIFRQWUROVDQGVLJQDOOLQJGHYLFHV

ROVER 30 L2, ROVER 30 S2

ROVER 30 L3, ROVER 30 S3

H
H

C
B

J
E
E
F

F
E

A - Main power switch; (see page 2 - 2 ).


B - XNC numerical control module (see page 2 - 2).

BIESSE S.p.A. Woodworking Machinery


(a103h002.fm-210300)

2-1

Chapter 2.
Controls and signalling devices

C-

Operator control panel (see page 2 - 4 ).

D - Supplementary front button pads; (see page 2 - 5).


E - Supplementary rear button pad; (see page 2 - 6).
F - Pedals; (see page 2 - 6).
G - Button unlocking tools from the magazine; (see page 2 - 7).
H - Button unlocking tools from the electrospindle; (see page 2 - 7).
J - Portable supplementary button pad (see page 2 - 7).



0DLQVZLWFK

The main switch is used to connect and/or


disconnect the power supply to the machine.
The switch is lockable to prevent it from being
operated by others.
0 = power off.
1 = power on.



;1&QXPHULFDOFRQWUROPRGXOH

The XNC numerical control module is described


in the Users and Programming Manual. The
following describes the functions of the soft-keys
on the PLC keyboard A and override B, not
mentioned in the manual.

2-2

BIESSE S.p.A.

Woodworking Machinery
(a103h002.fm-210300)

Chapter 2.
Controls and signalling devices

3/&.H\ERDUG
Stop row soft-keys; used to select the row of
stops to be used for machining.
On = row of stops selected.

Clamp stops soft-key; used to operate the


clamp stops when the program is running.
On = function enabled;
Flashing = the function is still enabled, but the
locking with the suction cups is disabled.

Bar supports soft-key; used to operate the bar


supports or the ball supports when machining.
On = function enabled.

Magazine Cover soft-key; used to open and


close the rack tool magazine cover.
On = the magazine is open.

Reset Slot soft-key; used to bring up the


electrospindle when it has been left down
following sudden stoppage of the machine.

Test Cones soft-key; used to start a test cycle


on the tools in the revolver tool magazine. The
numerical control indicates when it is necessary
to carry out this operation.

Chip Conveyor soft-key; used to start the chip


removal conveyor.

BIESSE S.p.A. Woodworking Machinery


(a103h002.fm-210300)

2-3

Chapter 2.
Controls and signalling devices

Reset Slot for tool change soft-key; used to


reset an electrospindle that has been left down
in the tool change position on the belt tool
magazine following a sudden stoppage of the
machine.
Reset Slot for tool change soft-key; used to
reset an electrospindle that has been left down
in the tool change position on the revolver tool
magazine following a sudden stoppage of the
machine.

2YHUULGH
This is used to change the percentage
programmed speed of the axes.



2SHUDWRUFRQWUROSDQHO

Emergency button; used to stop the machine


immediately in an emergency.

Start button; used to start the machine.

Vacuum Indicator; when this indicator lights up


this means that there is a drop in the vacuum
level.

2-4

BIESSE S.p.A.

Woodworking Machinery
(a103h002.fm-210300)

Chapter 2.
Controls and signalling devices

Tooling selector; this is used to start tooling of


the operating section.
Right = tooling mode enabled.

CAUTION

Before enabling the tooling mode, always ensure that axis Z in the operating section is in
the park position (up) or that it is well clear of the belt tool magazine. This is to avoid any
risk of collision between the operating section and the automatic tool change device, which
will carry out certain preset movements immediately after tooling mode is enabled.
Double movement stops selector; used to
enable use of the double movement stops when
the program is running.
Right = function enabled.

Vacuum pump selector; used to enable the


operating mode that prevents the piece from
unlocking in case of a sudden emergency.
Right = function enabled.

Special clamps selector; used to enable use of


the clamps in the curved door and window frame
machining kit when the program is running.
Right = function enabled.



6XSSOHPHQWDU\IURQWEXWWRQSDGV

Select Origin button; used to select the origin


and start machining operations. The button
indicates the following conditions.
Off = origin can be selected for machining
operations;
On = origin cannot be selected for machining
operations;
Flashing = the origin contains a locked piece;
press the button to confirm machining.

BIESSE S.p.A. Woodworking Machinery


(a103h002.fm-210300)

START 1 (2,3,4)

2-5

Chapter 2.
Controls and signalling devices

Auxiliary vacuum system selector; used to


activate the auxiliary vacuum system.
Right (ON) = function enabled.

OFF
CN

ON

SX 1 (SX 2, DX 2, DX 1)



6XSSOHPHQWDU\UHDUEXWWRQSDG

Emergency button; used to stop the machine


immediately.

Direction selector; used to select the direction


of movement during manual movement of the
belt tool magazine.
Left (1) = the magazine moves backwards, for
example from position 7 to position 6.
Right (2) = the magazine moves forwards, for
example from position 7 to position 8.

Movement buttons; used for manual


movement of the belt tool magazine. When they
are pressed together the magazine moves to the
next position in the direction selected.



3HGDOV

The pedals control clamping of the piece. Each


work area is provided with a pedal.

2-6

BIESSE S.p.A.

Woodworking Machinery
(a103h002.fm-210300)

Chapter 2.
Controls and signalling devices



3RUWDEOHVXSSOHPHQWDU\EXWWRQSDG

Emergency button; used to stop the machine


immediately

Override; used to vary the programmed speed


of the axes.



%XWWRQXQORFNLQJWRROVIURPWKHEHOWWRROPDJD]LQH

This button is located on the belt tool magazine and is used to unlock a tool from the magazine.
Pressing the button unlocks the tool and releasing it re-locks the tool.



%XWWRQXQORFNLQJWRROVIURPWKHHOHFWURVSLQGOH

This button is located on the operating unit and


is used to unlock the tool from the
electrospindle. If there is an electrospindle in slot
A as well there will be 2 of these buttons, with
indications of which slot they control. Pressing
the button unlocks the tool in the respective slot
and releasing it re-locks the tool.

BIESSE S.p.A. Woodworking Machinery


(a103h002.fm-210300)

2-7

Chapter 2.
Controls and signalling devices

2-8

BIESSE S.p.A.

Woodworking Machinery
(a103h002.fm-210300)

Chapter 3.

&KDSWHU



%DVLFRSHUDWLRQV

6ZLWFKLQJRQ

1.

Turn the main power switch to position 1 (ON).

2.

Make sure that all the emergency stop devices are disabled.

3.

Close all the doors in the mesh guard.

4.

Bring the main factory pneumatic system up to pressure and open the cut-off valve.

5.

Activate the chip suction system and make sure that the connection tube sectioning guillotine
is open.

6.

Press the start button on the operator control panel. The button will light up.



6ZLWFKLQJRII

1.

Always wait for the end of the work cycle.

2.

Set the numerical control to power off.

3.

Press the emergency button.

4.

Turn the main machine switch to 0 (OFF) and then turn off the workshop mains section
switch.

5.

Turn off the pneumatic circuit at the connection with the workshop line.

6.

Close the pneumatic circuit at the cut-off valve.



(PHUJHQF\VWRS

To stop the machine immediately, press the


nearest emergency stop button A with a hand,
or press the emergency cord B with a foot.

A
B

BIESSE S.p.A. Woodworking Machinery


(a104h002.fm-210300)

3-1

Chapter 3.
Basic operations



'HDFWLYDWLQJWKHHPHUJHQF\GHYLFHV

1.

If a button has been pressed, turn it in the direction indicated by the arrows on the button.

2.

If the emergency cord has been activated,


press button A on the microswitch of the
cord using a foot.
A



$[HV

The machines operating section moves along 3 main axes: X, Y and Z. The movements of the
operating section are controlled by the encoders on the motors driving the axes. Each axis has a
negative direction and a positive direction. There is a rule that allows the positive direction of the
axes to be identified with ease, using the right hand.
q

The thumb indicates the positive direction


of axis X.

The index finger indicates the positive


direction of axis Y.

The middle finger indicates the positive


direction of axis Z.

Y+

Z+
X+

The following figure illustrates the positive and


negative directions of axes X, Y and Z with
reference to a central point (0, 0, 0), and
shows how the right hand rule is applied to the
machine.

ZY-

X(0, 0, 0)

X+

Y+
Z+
front side of
the machine

3-2

BIESSE S.p.A.

Woodworking Machinery
(a104h002.fm-210300)

Chapter 3.
Basic operations

$[LV&
Axis C corresponds to rotation of the automatic
t o ol o r i e n ta ti o n de v i c e ( o pt i o na l ) . Th i s
movement is express ed in sexagesimal
degrees, and it can be either positive or
negative. Positive movement corresponds to
rotation in a clockwise direction.

C+

C-

Z+

$[LV&U
Axis Cr corresponds to rotation of the revolver
and belt tool magazines. If both magazines are
present, rotation of the revolver tool magazine
will be identified by Cr1. Movement of the
r ev ol ver tool ma gaz ine is e xpr es s ed i n
sexagesimal degrees, whereas that of the belt
tool magazine is expressed in millimetres.
Both have a positive and a negative direction
of movement. Positive movement corresponds
to rotation in a clockwise direction.



Cr Cr +

Y+

Cr +
Cr (Cr1 -) (Cr1 +)
Z+

:RUNLQJDUHD

The working area is the area on work table in which machining operations are performed. The
work table is divided into 2 or 4 working areas. The working areas on the left hand side of the work
table are known as SX1 and SX2, whereas those on the right hand side are DX1 and DX2. Each
working area has one or more reference points for positioning of the piece (see Work table origin
pag. 3 - 5). It is possible to lock one piece at a time in each working area.

2 working areas

SX1

BIESSE S.p.A. Woodworking Machinery


(a104h002.fm-210300)

4 working areas

DX1

SX1

SX2

DX2

DX1

3-3

Chapter 3.
Basic operations



5RZRIVWRSV

A row of stops is the whole set of front or rear stops. The front stops form the first row and the rear
ones form the second row. Each row of stops allows a specific work table origin to be selected (see
pag. 3 - 5). The row of stops to be used for machining operations is selected using the relative
soft-key on the PLC keyboard.



2ULJLQ

The origin is a reference point used to calculate the coordinates for movement along the axes. The
machine has 2 types of origin:
q

machine origin;

work table origin.



0DFKLQHRULJLQ

The machine origin, or absolute origin, is the maximum distance to the left, to the rear or upwards
that the operating section can move to. This position, which is set when the machine is installed, is
used as the main reference point and all the other origins will be calculated using this point. The
reference point for the machine origin on the operating section is spindle number 1 on the boring
head. This reference can be changed by selecting any one of the other spindles and slots.

3-4

BIESSE S.p.A.

Woodworking Machinery
(a104h002.fm-210300)

Chapter 3.
Basic operations



:RUNWDEOHRULJLQ

The work table origin allows the machine to identify the position of the piece. The work table origin
for axes X - Y is the angle formed by the stops, and for axis Z it is the contact surface of the
shapeable suction cups. There can be 4 or 8 of these origins along axes X and Y. The number of
origins on the work table depends on the rows of front and rear stops that are present. Origins are
identified as follows:

ROVER 30 L2, ROVER 30 S2

ROVER 30 L3, ROVER 30 S3

X
5

Origins X and Y on the work table can be of 2 types:


q

straight origin;

mirror origin.

Straight origin
This is the origin used to perform a program in which the initial coordinate is the top left hand
corner of the piece. Origins 1, 3, 5 and 7 are straight origins.
Mirror origin
This is the origin used to perform a program in which the initial coordinate is the top right hand
corner of the piece. Origins 2, 4, 6 and 8 are mirror origins.
Example of machining using straight or mirror origin
The following example shows a program containing the instructions necessary to perform a
vertical boring operation at X = 100 and Y = 70, and the result obtained with the different origins.

BIESSE S.p.A. Woodworking Machinery


(a104h002.fm-210300)

3-5

Chapter 3.
Basic operations

Example A shows the result using a straight origin. Example B shows the result using a mirror
origin.

100

70

100

70

Straight and mirror origins are usually used to machine the right and left hand sides of a piece of
furniture (sides, doors, etc.), using the same program.

3-6

BIESSE S.p.A.

Woodworking Machinery
(a104h002.fm-210300)

Chapter 4.

&KDSWHU



6HWWLQJXS

%RULQJWRROV

A number of types of boring tools are commercially available, and most of them belong to one of
the following categories:
A - Dead boring tool; used to machine holes
that end inside the piece without reaching
the other side.

B - Through boring tool; used to machine holes


that pass right through the piece.
C - Large diameter dead boring tool; used to
machine hinge application slots.
The coupling must be cylindrical with a diameter
of 10 mm and a minimum length of 20 mm.
The coupling must also have a flat section, used
to lock the tool in the spindle.

min 20

10

The diameter (D) of tools and their extension


from the nose of the spindle (L) can vary. Always
m ake sur e that they fall within the lim its
indicated in the following table. The values in the
table are expressed in millimetres.

Unit

Tools A - B

Tool C

D max

L max

D max

L max

Boring head

20

53

35

53

Boring aggregates

20

40

35

40

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4-1

Chapter 4.
Setting-up



0LOOLQJWRROV

The milling tools are fixed using a spindle fitted with a collet and lock ring. The diameter and length
of the shank will vary according to the type of collet fitted to the spindle.
ERC 32

ERC 40

6 20

6 25

46

15 16

34

For ERC 32 type collets the shank diameter is


between 6 and 20 mm and the minimum
length must be 40 mm.

ERC 25

40

For ERC 25 type collets the shank diameter is


between 15 and 16 mm and the minimum
length must be 34 mm.

For ERC 40 type collets the shank diameter is


between 6 and 25 mm and the minimum
length must be 46 mm.

It is also possible to use tools with couplings of


type ISO 30, HSK F50 or HSK F63 with shaft.
These tools are fitted directly to an
electrospindle with the same type of coupling.

4-2

ISO 30

HSK F50/F63

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

The diameter (D) of tools and their extension


from the nose of the spindle (L) can vary. Always
m ake sur e that they fall within the lim its
indicated in the following table. The values in the
table are expressed in millimetres.
ROVER 30 L2, ROVER 30 S2
Unit

D max

L max

160

110

30

130

30

78,5

30

61,5

25

66,5

25

74

30

130

ROVER 30 L3, ROVER 30 S3


Unit

D max

L max

160

110

30

130

30

53,5

30

36,5

25

41,6

25

49

30

130

In the table of limits for the models ROVER 30 L3 and ROVER 30 S3, the values L max indicated
for units B to G are only valid for slot B. When using these units in other slots, comply with the
limits given below:
Slot A; it is possible to use tools with L max, calculated from the axis of the unit itself, of less than
80 mm.
Slot C; it is possible to use tools with L max, calculated from the axis of the unit itself, of less than
115 mm.
Slot B 1; it is possible to use tools with L max as indicated in the table for ROVER 30 L2 and
ROVER 30 S2.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4-3

Chapter 4.
Setting-up

For tools with coupling of type ISO 30, HSK F50 or HSK F63 with shaft, these tools comply with
the following limits:

max 160

PANEL

max 182

min 72
max 178

max 167

PANEL

PANEL

max 160

max 160

&LUFXODUEODGHWRROV

The circular blade tools are fitted on a shaft and


locked in place using a flange. The hole in the
blade must have a diameter of 35 mm and the
thickness must be between 2.8 and 6 mm.
These tools must also have a hole with a
diameter of 6 for the anti-rotation pin. The axis
of the hole for the anti-rotation pin must be at 23,
25 or 26.5 mm from the axis of the blade centre
hole, according to the unit on which it is to be
fitted.

6
2,8 6
35



HSK F63

min 68

HSK F50

min 57

ISO 30

23 / 25 / 26,5

The diameter (D) and thickness (L) of tools and


the maximum machining depth (PRF) may vary.
Always comply with the limits given in the
following tables. The values in the tables are
expressed in millimetres.

PRF

PANEL

4-4

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

Unit

D max

L max

PRF max

180

4 10

52

120

4 10

26

120

4 10

22

180

4 10

52

180

4 10

52

180

4 10

52

250

4 10

82

For the circular blade tool unit on the boring


head BH 43 use the values indicated for unit B.



)LWWLQJWRROVRQWKHERULQJKHDG
CAUTION

Before fitting the tool check the direction of rotation. The slot on the body of the spindle
identifies those rotating to the left.
1.

Position the operating section at a point in the machine where access to the boring head will
be best.

2.

Turn the Tooling selector on the operator control panel and remove the key to prevent the
machine from being turned on accidentally.

3.

Force descent of the spindle involved in the


tooling-up procedure.

4.

Insert the tool in the spindle, directing the


attachment plane A towards the hole B.

5.

Lock the tool with the lock screw C.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

B
C

4-5

Chapter 4.
Setting-up

)LWWLQJWKHFLUFXODUEODGHWRRORQERULQJKHDG%+
1.

Block the shaft A using a hexagon spanner.

2.

Unscrew the flange B.

3.

Fit the blade onto the spindle.

4.

Screw up the flange B until it locks.

A
B



)LWWLQJWRROVRQSLQFHUW\SHVSLQGOHV
DANGER

For safety reasons, all the pincer-type spindles used on the machine must be supplied by
BIESSE S.p.A. or by an authorised dealer.
CAUTION

Before fitting the tool check the direction of rotation. The slot on the body of the spindle
identifies those rotating to the left.
The procedures for inserting tools vary according to the type of pincer-type spindle used.
For ISO 30 pincer-type spindles:
1.

To carry out this operation a special device


A is provided, and this must be anchored to
a work bench using the holes provided.

4-6

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

2.

3.

4.

Position the spindle cone B in the device,


as shown in the figure.

C D
E

Turn the bracket C until it is over the


spindle, and lock it by turnings screws D
and E.

Insert the pincer F in the seating on the ring


G.

5.

6.

Screw the ring G onto the cone, without


locking.

Insert the tool shank into the pincer and


tighten the ring fully.

For HSK F50 or HSK F63 pincer-type spindles


1.

To carry out this operation a special device


A is provided, and this must be anchored to
a work bench using the holes provided.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4-7

Chapter 4.
Setting-up

2.

Position the coupling of spindle B in the


device, as shown in the figure.

3.

Tighten the lock screw C to lock the spindle


C
B

4.

Insert the pincer F in the seating on the ring


G.
G

5.

Screw the ring G onto the cone, without


locking.

6.

Insert the tool shank into the pincer and


tighten the ring fully.



)LWWLQJWRROVLQDJJUHJDWHV

To carry out this operation use the same device provided to insert tools on the pincer-type spindles
(see page 4 - 6). To block the chuck in the device various methods can be used, according to the
type of chuck.
To block chucks with ISO 30 cone coupling:
1.

4-8

Unfasten the pincer-type spindle fixing


mechanism by unscrewing the screw A.

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

2.

Turn the aggregate upside down and insert


it in the device as shown in the figure.

To block chucks with HSK F50 or HSK F63 cone coupling:


1.

Turn the blocking device A over as shown


in the figure.

2.

Turn the aggregate upside down and insert


it in the device as shown in the figure.

The following instructions explain how to insert a tool on the various types of aggregate.
For aggregates with spindles for boring tools:
1.

Insert the tool in the spindle, directing the


attachment plane A towards the hole B.

2.

Lock the tool with the lock screw C.

B
C

For aggregates with spindles for circular blade


tools:
1.

Block the mill shaft A with a hexagon


spanner.

2.

Unscrew the flange B.

3.

Fit the blade onto the spindle.

4.

Screw up the flange B until it locks.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4-9

Chapter 4.
Setting-up

For aggregates with spindles for pincer- type


coupling spindles:
1.

Block the shaft in the spanner hold groove


A.

2.

Unscrew the threaded ring B.

3.

Insert the collet C in its seat on threaded


ring B.

4.

Screw the threaded ring B back onto the


aggregate, without tightening completely.

5.

Insert the tool shank into the collet and tighten the threaded ring until it locks.



(OHFWURVSLQGOH

The electrospindle is fitted by performing the following operations:


q

Fitting the pincer-type spindles and aggregates

Heating

)LWWLQJSLQFHUW\SHVSLQGOHVDQGDJJUHJDWHV
It is possible to outfit the electrospindles with pincer-type spindles or aggregates that have been
tooled-up as described above. In general, the fitting is automatic and utilises the tool magazine. If
the tool is to be fitted manually, proceed as follows.
1.

Position the operating section at a point of the machine where access to the electrospindle is
best.

2.

Lower the electrospindle.

3.

Turn the Tooling selector on the operator control panel to the right and take out the key to
prevent the machine from being turned on accidentally.

4.

Press the button on the operating section unlocking tools in the electrospindle.The unlocking
button, to be used for the electrospindle situated in slot C, is located directly on the
electrospindle.

5.

Insert the spindle cone all the way into the seat and lock it by releasing the button.
CAUTION

In order to protect internal organs from dust, the electrospindle must always be fitted with a
tool spindle.

4 - 10

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

+HDWLQJ
During each daily initial starting phase users are advised make the unit run a brief warming-up
cycle so as to allow the bearings to reach a uniform working temperature gradually. To do this a
work program should be created in which each electrospindle operates as follows:
1.

50% of rated max speed for 2 minutes.

2.

75% of rated max speed for 2 minutes.

3.

100% of rated max speed for 1 minute.



5HYROYHUWRROPDJD]LQH

The following gives a description of the procedures and rules to be followed when installing tools in
the magazine. After the tools have been installed it will be necessary to input the data in the
numerical control. To do this, consult the Users and Programming Manual. The magazine can
house 7 tools with a maximum diameter of 140 mm without any problem. It is also possible to
install aggregates, which must be appropriately positioned. If large tools (max 160 mm) or
aggregates are installed it will be necessary to check that they are compatible with the tools fitted
in adjacent holders. There are also limits to the maximum working dimensions of tools.
To position a tool, proceed as follows.
1.

Using the manual movements performed by the numerical control, move the operating
section to a position allowing easy access to the magazine. The best position is the one
furthest to the left, furthest forward and furthest down.

2.

Turn the Tooling selector on the control panel to the right and remove the key to prevent the
machine from being put into operation accidentally.

3.

Go to the magazine and select a free tool


holder.

4.

Insert the coupling in the housing provided,


as shown in the figure.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 11

Chapter 4.
Setting-up

,QVWDOODWLRQRIWKHDJJUHJDWH
The aggregates that can be installed in the magazine are the ones shown in the figure. It is
possible to install an aggregate in any free tool holder, making sure that it faces in the direction
shown in the figure. When the aggregate is purchased together with the machine it will be set up
for installation in a specific tool holder, and will carry an adhesive label indicating the tool holder to
be used. In this way it will not be necessary to input some of the tooling data into the numerical
control.

X
Y

Each aggregate is provided with bores A which


are used to give precise orientation when the
aggregate is in the magazine. The number of
bores will vary according to the type of
aggregate. One of these bores must coincide
with the pin on the tool holder. The figure (top
view of the upper part of an aggregate) shows
how these bores are arranged.

A
90

90

90

90

&RPSDWLELOLW\RIWRROV
The following information indicates to the operator whether or not a tool is compatible with another
tool, that is to say if they can be installed in adjacent positions. The following criteria is used: the
tools are divided into categories and, in the chart below, yes and no indicate compatibility. Also
in the chart, the line +1 indicates the next adjacent position, while the line -1 indicates the
preceding adjacent position.

4 - 12

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

Tool categories:
A = tool with maximum diameter of 60 mm;
B = tool with diameter of between 60 and 120 mm;
C = tool with diameter of between 120 and 140 mm;
D = tool with diameter of between 140 and 160 mm;
E, F, G, H, L = aggregates.
A

+1

yes

yes

yes

yes

yes

yes

yes

yes

yes

-1

yes

yes

yes

yes

yes

no

yes

yes

no

+1

yes

yes

yes

yes

no

yes

yes

yes

yes

-1

yes

yes

yes

yes

no

no

yes

yes

no

+1

yes

yes

yes

no

no

no

yes

no

no

-1

yes

yes

yes

no

no

no

yes

no

no

+1

yes

yes

no

no

no

no

no

no

no

-1

yes

yes

no

no

no

no

no

no

no

+1

yes

no

no

no

no

no

no

no

no

-1

yes

no

no

no

no

no

no

no

no

+1

yes

yes

no

no

no

no

no

no

no

-1

no

no

no

no

no

no

no

no

no

+1

yes

yes

yes

no

no

no

no

no

no

-1

yes

yes

yes

no

no

no

no

no

no

+1

yes

yes

no

no

no

no

no

no

no

-1

yes

yes

no

no

no

no

no

no

no

+1

yes

yes

no

no

no

no

no

no

no

-1

no

no

no

no

no

no

no

no

no

Note: if aggregate E is fitted with a circular blade tool, consider the compatibilities indicated for
aggregate H.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 13

Chapter 4.
Setting-up

Example to clarify the chart given above


When considering column L it will be seen that yes only appears in lines +1 for A and B. This
means that the aggregate L can only be installed if the next adjacent position is occupied by a tool
of category A or B and if the preceding adjacent position is empty.

/LPLWVIRUWRROVWREHXVHGLQWKHPDJD]LQH
The following figure indicates the position of tools along axis Z when they are in the magazine, and
their maximum dimensions.
X
Z

A-D

The dotted line indicates a limit position (338) that guarantees the rated maximum thickness of the
piece, even during an automatic tool change operation performed using the belt tool magazine.
During this operation, in fact, the operating section drops slightly and the revolver tool magazine
drops with it. Therefore, if a tool on the revolver tool magazine is below this limit, it must be
remembered that the maximum thickness of the piece will be reduced by a value equal to the
difference between 338 and the position in question. In the figure the positions followed by an
asterisk (*) are the ones that exceed the limit position.

4 - 14

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up



%HOWWRROPDJD]LQH

The following gives a description of the procedures and rules to be followed when installing tools in
the magazine. After the tools have been installed it will be necessary to input the data in the
numerical control. To do this, consult the Users and Programming Manual. The magazine can
house 12 tools with a maximum diameter of 160 mm without any problem, or 18 tools with a
maximum diameter of 110 mm in the optional magazine. It is also possible to install aggregates,
which must be appropriately positioned. If large tools (max 160 mm) or aggregates are installed
it will be necessary to check that they are compatible with the tools fitted in adjacent holders.
There are also limits to the maximum working dimensions of tools.
To position a tool, proceed as follows.
1.

Using the manual movements performed by the numerical control, move the magazine
towards the right hand side of the machine and move the operating section away from the
magazine area.

2.

Carry out the numerical control operations necessary to bring the magazine to the rest
position.

3.

Turn the Tooling selector on the control panel to the right and remove the key to prevent the
machine from being put into operation accidentally.

4.

Go to the magazine and select a free tool holder.

5.

Turn the magazine until the chosen tool


holder is positioned at point A, using the
controls on the supplementary rear button
pad.

6.

Press the tool unlock button on the


magazine.

7.

Insert the spindle coupling all the way into


the housing, and block it by releasing the
tool unlock button.

CAUTION

In order to protect the internal organs from dust, all tool holders must always be fitted with
a collet spindle or with the special plug provided.

,QVWDOODWLRQRIWKHDJJUHJDWH
The aggregates that can be installed in the magazine are the ones shown in the figure. It is
possible to install an aggregate in any free tool holder, making sure that it faces in the direction
shown in the figure. When the aggregate is purchased together with the machine it will be set up
for installation in a specific tool holder, and will carry an adhesive label indicating the tool holder to
be used. In this way it will not be necessary to input some of the tooling data into the numerical

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 15

Chapter 4.
Setting-up

control. The anti-rotation pin R, which is present on all aggregates, must coincide with the bore S
present on each tool holder.

Y
S

rear view of magazine

&RPSDWLELOLW\RIWRROV
The following information indicates to the operator whether or not a tool is compatible with another
tool, that is to say if they can be installed in adjacent positions. The following criteria is used: the
tools are divided into categories and, in the chart below, yes and no indicate compatibility.
Tool categories:
1 = tool with maximum diameter of 60 mm;
2 = tool with diameter of between 60 and 110 mm;
3 = tool or aggregate with diameter of between 110 and 160 mm;
4 = aggregate with diameter of over 160.

12 tool magazine

18 tool magazine

yes

yes

yes

yes

yes

yes

yes

yes

yes

yes

no

4 - 16

yes

yes

yes

no

no

yes

yes

no

no

no

no

yes

no

no

no

no

no

no

no

no

no

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

Example to clarify the chart given above


When considering column 4 it will be seen that yes only appears in line 1. This means that the
category 4 aggregate can only be installed if the adjacent positions are occupied by tools of
category 1, or if these positions are empty.

/LPLWVIRUWRROVWREHXVHGLQWKHPDJD]LQH

max 215 mm

The working dimensions of the aggregate, including those of the tool fitted to it, must not exceed
the limits indicated below:

max 270 mm

In aggregates with inclining spindles, the inclination of the spindle must never exceed 45.

ax
m

ax
m

45

45



5DFNWRROPDJD]LQH

The following gives a description of the procedures and rules to be followed when installing tools in
the magazine. After the tools have been installed it will be necessary to input the data in the
numerical control. To do this, consult the Users and Programming Manual. The magazine can
house tools with a maximum diameter of 160 mm without any problem. It is also possible to
install aggregates, which must be appropriately positioned.
To position a tool, proceed as follows.
1.

If necessary, using the manual movements performed by the numerical control, move the
operating section away from the magazine area.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 17

Chapter 4.
Setting-up

2.

Turn the Tooling selector on the control panel to the right and remove the key to prevent the
machine from being put into operation accidentally.

3.

Open the magazine cover using the soft-key on the PLC keyboard.

4.

Use the numerical control to raise the tool holder (see Users and Programming Manual).

5.

Insert the coupling in the housing provided,


as shown in the figure.

,QVWDOODWLRQRIWKHDJJUHJDWH
The aggregates that can be installed in the magazine are the ones shown in the figure. It is
possible to install an aggregate in any free tool holder on the 3 holder rack, making sure that it
faces in the direction shown in the figure. When the aggregate is purchased together with the
machine it will be set up for installation in a specific tool holder, and will carry an adhesive label
indicating the tool holder to be used. In this way it will not be necessary to input some of the tooling
data into the numerical control.

X
Y

4 - 18

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

If more than one aggregate is installed at a time, use one of the following combinations:

Y
4
1

2
5

5
7
3
8

3
6

Each aggregate is provided with bores A which


are used to give precise orientation when the
aggregate is in the magazine. The number of
bores will vary according to the type of
aggregate. One of these bores must coincide
with the pin on the tool holder. The figure (top
view of the upper part of an aggregate) shows
how these bores are arranged.

A
90

90

90

90

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 19

Chapter 4.
Setting-up



:RUNLQJWDEOH

Prepare the working table so that the positions of the various objects ((jigs, stops) do not interfere
with the tools during machining. The millimetre rules on the various working tables and at the front
guide allow the positions of the various objects to be determined. Always use a sufficient number
of jigs, suitably positioned with respect to the piece being machined. Assess the use of auxiliary
locking devices (clamps, front pushers), if the characteristics of the piece do not allow safe
clamping using the jigs alone.

3RVLWLRQLQJWKHPRELOHVXSSRUW
Each table slides on two round guides along the X-axis. To position the table:
1.

Grasp the handle and press button A.

2.

Position the support at the point required.

3.

To lock the table in position, release the


button.
A

Working tables equipped with central stops, if


used to supply the machining origins, must be
locked at the appropriate reference B.

4 - 20

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

3RVLWLRQLQJWKHFHQWUDODQGVLGHVWRSV
1.

Release the stop by rotating both handles


A to the right.

2.

Move the stop to the required position.

3.

Lock the stop in position by rotating the


handles to the left.

A
A

3RVLWLRQLQJWKHVKDSHDEOHVXFWLRQFXS
The method to be used when positioning the shapeable suction cup varies according to its type.
Normal shapeable suction cup
1.

Unlock the suction cup by pressing button


A.

2.

Position the suction cup at the point


required.

3.

Lock the suction cup again by releasing the


above button.

4.
Small shapeable suction cup
1.

Unlock the suction cup by pressing button


B.

2.

Position the suction cup at the point


required.

3.

Lock the suction cup again by releasing the


above button.

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 21

Chapter 4.
Setting-up

)LWWLQJWKHVHDOHOHPHQWRQWKHVKDSHDEOHVXFWLRQFXS
Fit the seal element in the grooves formed on the suction cup so as to create an area around the
vacuum hole. The figure below gives some examples.

vacuum hole

DANGER

The seal element must be perfectly joined at the connection point.

OK

)LWWLQJFODPSVRQWKHVWRSV
1.

2.

With the aid of a screwdriver, unscrew the


screw plug A.
Position the clamp B on the stop and fix it in
position using screw C.

4 - 22

C
A
B

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

8VHRIWKHHOHFWURQLFSRVLWLRQGLVSOD\GHYLFH
Preparation of the working table using this device is performed in two stages. In the first stage, the
operator tools-up the working table on the numerical control, where he positions the various
objects in the most suitable position (see Users and Programming Manual) and sends the
positions to the electronic position display devices. In the second stage, the objects are positioned
using the positions indicated on the displays.

&

'

$
TABLE
S.CUPS
STOP
.............

Display A shows the positions of the various objects on the working table. The position displayed
changes each time button B is pressed. Display C and LEDs D identify the object selected. For
example, if the number 2 appears on display C and LED D S.CUPS is lit, this means that display A
is displaying the Y position of suction cup 2.
The following list shows the positions indicated on display A and the respective combinations of
display C and LEDs D.
position indicated on display A

Number in display C

LED D illuminated

position in X of the mobile support

none

TABLE

position in Y of suction cup 1

S.CUPS

position in Y of suction cup 2

S.CUPS

position in Y of suction cup 3

S.CUPS

position in Y of suction cup 4

S.CUPS

position in Y of stop 1

STOP

position in Y of stop 2

STOP

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 23

Chapter 4.
Setting-up

Sending positions and positioning of the objects


The positions are sent automatically when the
program is run (see Users and Programming
Manual). All displays which flash indicate that
the position of one or more objects has changed
with respect to the last program run. If no
displays are flashing, this means that the
position of the objects has not changed. The
various objects are positioned manually, as
described in the previous paragraphs, reading
the position on the electronic position display
device and using the millimetre rules on the
working table.

position Y of suction cup 1

position Y of suction cup 2


position Y of stop 1
position Y of suction cup 3

position Y of suction cup 4


position Y of stop 2
position X of the mobile support

6ROLGZRUNWDEOH
A vacuum area of a shape and size suited to the piece to be locked must be formed on the table.
The vacuum area is formed by inserting the seal element in the slots on the table and removing the
plugs within that area. To remove the plugs, proceed as shown in the figure.

4 - 24

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 4.
Setting-up

Suction cups and stops


If these accessories are to be used, position them on the table at the points required,
corresponding to the vacuum holes. For the stops, define the new coordinates for the piece origin
in the machine data tables (see Users and Programming Manual).

BIESSE S.p.A. Woodworking Machinery


(a105h002.fm-210300)

4 - 25

Chapter 4.
Setting-up

4 - 26

BIESSE S.p.A.

Woodworking Machinery
(a105h002.fm-210300)

Chapter 5.

&KDSWHU

0DFKLQLQJ

The main stages of the work cycle are as follows:


1.

creating and running the work program (all the procedures are described in the Users and
Programming Manual);

2.

selecting the work area (see paragraph 5.1 Selecting the origin);

3.

locking the piece in position (see paragraph 5.2 Locking the piece in position);

4.

starting machining (see paragraph 5.3 Starting machining)



6HOHFWLQJWKHRULJLQ

According to the width of the piece, which is defined in the program being run, the machine will
automatically enable the origins on which it is possible to perform machining operations, lighting
up the Select Origin buttons on the supplementary front button pads. If the machine is fitted with
one row of stops, merely press the respective Select Origin button to select an origin. If the
machine is fitted with a number of rows of stops it will be necessary to enable the row of stops
containing the origin to be selected, before executing the program. Once this has been done,
proceed as follows to select the origin:
1.

To select origin 1, 5 or 9 press the Select Origin button START 1.

2.

To select origin 2, 6 or 10 press the Select Origin button START 2.

3.

To select origin 3, 7 or 11 press the Select Origin button START 3.

4.

To select origin 4, 8 or 12 press the Select Origin button START 4.

If the clamp locking function is not enabled the respective stops will rise when the origin is
selected. If the operating section is close to the origin selected, wait until it has moved away and
come to a complete standstill before stepping on the contact mats.



/RFNLQJWKHSLHFHLQSRVLWLRQ

Before locking the piece, clean the surface of the suction cups involved. Each time the piece is
locked, press the piece to ensure that it adheres perfectly to the suction cups, and check the seal.
Should it be necessary to reposition the piece after locking, it can be unlocked momentarily by
pressing and holding the pedal. The piece can be locked in a number of ways. The procedures to
be used for each of the locking methods foreseen are described below.

BIESSE S.p.A. Woodworking Machinery


(a106h002.fm-210300)

5-1

Chapter 5.
Machining

1RUPDOORFNLQJ
This type of locking uses the suction cups. To lock the piece in this way, merely press the pedal
controlling the area in question.

/RFNLQJZLWKFODPSV
DANGER

Always keep your hands well clear of the clamps when locking.
1.

Install the clamps on the stops as described on page 4 - 22.

2.

Select clamp locking mode using the soft-key on the PLC keyboard. Clamp locking mode can
also be input in the program.

3.

Press and hold the pedal locking the area involved; the stops will rise up.

4.

Position the piece against the stops.

5.

Release the pedal; the stops will drop down and the piece will be clamped in position.

/RFNLQJZLWKDX[LOLDU\YDFXXPV\VWHP
The auxiliary vacuum system is normally used for routing along the edges of specially shaped
panels. ToTo lock these pieces it is necessary to construct a special jig and fix it to the working
table using the normal locking method. The auxiliary vacuum system then provides the vacuum
required to lock the piece to be worked in position.
1.

Select the work area required.

2.

Rest the special jig on the work table in the area selected and connect it to the auxiliary
vacuum system. The connection points on the machine are situated on the base under the
work table.

3.

Bring the special jig up to the reference stops and lock it to the work table by turning the
Auxiliary vacuum system selector on the supplementary front button pad to the right.

4.

Remove the key from the selector to prevent tampering.

5.

Position the piece to be worked on the special jig at the clamping point provided.

6.

Press the pedal; the panel will be locked in position.

5-2

BIESSE S.p.A.

Woodworking Machinery
(a106h002.fm-210300)

Chapter 5.
Machining



6WDUWLQJPDFKLQLQJ

To start machining, simply press the Select Origin button on the supplementary front button pad.
Once the piece has been machined, it is unlocked automatically. If the piece has been locked
using the clamps, it must be removed by lifting the stops, pressing and holding the pedal.

5HVWDUWLQJPDFKLQLQJDIWHUDVXVSHQVLRQ
Within a program, it is possible to insert instructions that suspend machining to allow operations to
be performed on the piece being machined. To insert the suspensions in the program, consult the
Users and Programming Manual. The following gives an explanation of how to proceed to re-start
machining for each of the available suspension types.
M200; used to unlock the piece and continue machining on the underside. When the machine
suspends machining the piece is unlocked and the Select Origin button starts to flash. After the
piece has been turned over and locked again, simply press the flashing Select Origin button to
restart machining.
M201; used to unlock the piece and continue machining on the mirror origin. When the machine
suspends machining the piece is unlocked and the Select Origin button for the mirror origin starts
to flash. After the piece has been moved and locked again, simply press the flashing Select Origin
button to restart machining.
M203; used to unlock the piece and continue machining on the origin for the next row of stops.
When the machine suspends machining the piece is unlocked and the Select Origin button starts
to flash. After the piece has been moved and locked again, simply press the flashing Select Origin
button to restart machining.
M212; used to allow cleaning of the piece being machined. When the machine suspends
machining the piece remains locked and the Select Origin button starts to flash. After the piece has
been cleaned, merely press the flashing Select Origin button to restart machining.



3HQGXODUPDFKLQLQJ

It is only possible to use this mode if the dimensions of the piece along axis X allow it. Using this
mode the machining time and loading/unloading times overlap. While the operating section
machines in one working area, the operator can load a piece into another enabled area. In this
way it is possible to reduce production times considerably.

3HQGXODUPDFKLQLQJZLWKVXVSHQVLRQ
This method makes it possible to perform pendular machining operations on pieces with larger
dimensions (up to the limit indicated). It is necessary to bear in mind that if during machining the
operating section has to move beyond the pendular machining limits while the operator is in the
process of loading the other working area, machining will be suspended until the operator leaves

BIESSE S.p.A. Woodworking Machinery


(a106h002.fm-210300)

5-3

Chapter 5.
Machining

the area protected by the contact mats. It can therefore be used without problems when
performing boring operations. For milling operations on the other hand it will be necessary to
check that the pendular machining limit is never exceeded so that there is no risk of spoiling the
piece.



5HVWDUWLQJWKHPDFKLQHDIWHUDQHPHUJHQF\VWRS

First of all, de-activate the emergency device and then press the start button. If the emergency
stop was activated while the tool was machining or during an automatic tool change, to return the
machine to normal operation follow the instructions given below.
Restarting the machine in case of an emergency stop with the tool machining
If the emergency stop occurred while the tool was machining, the Reset Slot soft-key indicator on
the PLC keyboard will start to flash. To return the machine to normal operation follow the
instructions given below:
1.

Press the STOP button and then the RESET button on the numerical control module.

2.

Press the Reset Slot soft-key on the PLC keyboard. The electrospindle will rise.
CAUTION

Before pressing the Reset Slot soft-key, check that the piece being machined is not
damaged as the electro-spindle is raised. If necessary, before pressing the soft-key, move
the axes or remove the piece by hand.
Restarting in case of an emergency stop during an automatic tool change
If the emergency stop occurred during an automatic tool change operation, the Reset Slot for tool
change soft-key indicator on the PLC keyboard will start to flash. To return the machine to normal
operation follow the instructions given below:
1.

Press the STOP button and then the RESET button on the numerical control module.

2.

Access the area from which the axes can be moved manually.

3.

Press the Reset Slot for tool change soft-key on the PLC keyboard. A reset cycle will be
started.
CAUTION

If the emergency stop occurred during an automatic tool change operation in the rack tool
magazine, before pressing the Reset Slot for tool change soft-key, make sure that the tool
holder will not be damaged when the electrospindle rises. If necessary, move the axes
manually before pressing the soft-key.

5-4

BIESSE S.p.A.

Woodworking Machinery
(a106h002.fm-210300)

Chapter 5.
Machining



5HVWDUWLQJWKHPDFKLQHDIWHUDSRZHUFXW

When the machine switches back on again, the numerical control executes an automatic reset
procedure during which the machine remains stopped. A message may appear on the display
requesting the operator to switch off the numerical control again. When the numerical control has
restarted, to recommence normal operation, press the start button. If the shutdown occurred while
the tool was machining or during an automatic tool change operation, follow the instructions given
below to restart the machine.
Restarting in case of an unexpected shutdown with the tool machining
If the shutdown occurred while the tool was machining, the Reset Slot soft-key indicator on the
PLC keyboard will start to flash. To restart normal operation proceed as follows:
1.

Press the STOP button and then the RESET button on the numerical control module.

2.

Press the Reset Slot soft-key on the PLC keyboard. The electrospindle will rise.
CAUTION

Before pressing the Reset Slot soft-key, check that the piece being machined is not
damaged as the electro-spindle is raised. If necessary, before pressing the soft-key, move
the axes or remove the piece by hand.
3.

Perform an automatic reset on all the axes.

Restarting in case of an unexpected shutdown during an automatic tool change


If the shutdown occurred during an automatic tool change operation, the Reset Slot for tool change
soft-key indicator on the PLC keyboard will start to flash. To restart normal operation proceed as
follows:
1.

On the numerical control, access the environment allowing manual movement of the axes.

2.

If necessary, move the operating section out of the tool change area.

3.

If necessary, remove tools from the belt tool magazine automatic tool change device and
return them to their place in the magazine.

4.

Check that the tooling-up described on the numerical control corresponds with that present on
the machine.

5.

Press the STOP button and then the RESET button on the numerical control module.

6.

Press the Reset Slot for tool change soft-key on the PLC keyboard. A reset cycle will be
started.

BIESSE S.p.A. Woodworking Machinery


(a106h002.fm-210300)

5-5

Chapter 5.
Machining



0DFKLQLQJZLWKWKHFXUYHGGRRUDQGZLQGRZIUDPHNLW

A special optional kit is used to machine curved door and window frame. This kit comprises a
series of clamps and stops constructed and arranged so as to allow the pieces forming a curved
door or window frame to be positioned and locked. The following paragraph explains how to make
the best use of the various elements in this kit. The pieces that go to form the curved door or
window frame are the following:
A - cross-piece;
B - left upright;
D

C - right upright;
D - arch.

The kit permits machining of all the pieces making up the frame, but is used in particular to
machine the arch. By performing certain operations it is possible to disable the kit and use the
machine as normal.
DANGER

Always keep your hands well clear of the clamps when locking.

0DFKLQLQJWKHDUFK
There are 3 main steps involved in machining the arch.
1.

Machining the pieces that, when


assembled, will form the rough outline of
the arch.

2.

Machining the points at which the arch


connects to the uprights and the inside of
the arch.

3.

Machining the outside of the arch.

5-6

BIESSE S.p.A.

Woodworking Machinery
(a106h002.fm-210300)

Chapter 5.
Machining

Before proceeding, ensure that the Special clamps selector on the control panel has been turned
to the right.
Machining the pieces forming the rough outline of the arch (step 1)
The pieces that, when assembled, will form the
rough outline of the arch are machined starting
from rectangular pieces of wood. Machining
consists in forming joints A at an appropriate
angle. The angles and the number of pieces will
depend on the shape and size of the arch. There
are also (optional) software packages available
which speed up the calculations required.

Joints A on the pieces are usually worked with a


tool that machines Minizinchen type joints, to
improve glue bonding.

Minizinchen joint

To machine the pieces, proceed as follows.


1.

Create the program and run it (all the procedures involved are described in the Users and
Programming Manual).

2.

Select origin 1 or 3.

3.

Move the piece A up against the stop B and position the clamps C as shown in the figure.
X
A

B
A

4.

Press the pedal to lock the piece.

5.

Turn stop B.

6.

Start machining operations. When machining has been completed the piece will be unlocked
automatically. If the size of the piece allows it, pendular machining mode can also be used.

BIESSE S.p.A. Woodworking Machinery


(a106h002.fm-210300)

5-7

Chapter 5.
Machining

Machining the points at which the arch connects to the uprights and the inside of the arch
(step 2)
1.

Create the program and run it (all the procedures involved are described in the Users and
Programming Manual).

2.

Select origin 1 or 3.

3.

Bring the piece A up against the stops B and C and position the clamps D as shown in the
figure.
X
Y

D
A
B

C
E

4.

Press the pedal to lock the piece.

5.

Turn the stop B and remove stop C.

6.

Before starting machining which method to use when machining the outside of the arch (step
3). If you decide to use the first method (1 ), start machining without performing any other
operations. If you decide to use the second method (2 ), turn the selector E for each mobile
support involved to the right before starting machining operations. This operation will not
allow the piece to unlock when machining has been completed. If the size of the piece allows
it, pendular machining mode can also be used.

Machining the outside of the arch (step 3)


This step can be carried out in one of 2 ways. The first method (1 ) consists of performing
machining operations after fitting the piece in the door or window frame. The second method (2 )
consists in performing machining operations without moving the piece from the machine. If you
decide to use the second method, the machine must be set up so that during the preceding stop it
does not unlock the piece at the end of machining operations.
1

5-8

BIESSE S.p.A.

Woodworking Machinery
(a106h002.fm-210300)

Chapter 5.
Machining

When using the first method (1 ), proceed as follows:


1.

Fit stop A at the point indicated in the figure. At this point the mobile support has references
for installation of the stop and a switch detecting its presence.

2.

Position and lock the mobile support fitted with stop A, in correspondence with the special
reference B.

3.

Remove stop C.
X
Y

4.

Create the program and run it (all the procedures involved are described in the Users and
Programming Manual).

5.

Select origin 1.

6.

Bring the inside edges of the piece D up against the stops A and E.

7.

Position the clamps F as shown in the figure.


X
F

D
Y

A E

8.

Press the pedal to lock the piece.

9.

Start machining operations. When machining has been completed the piece will be unlocked
automatically.

BIESSE S.p.A. Woodworking Machinery


(a106h002.fm-210300)

5-9

Chapter 5.
Machining

When using the second method (2), proceed as follows:


1.

Remove the clamps situated on the outside of the piece and position others on the inside.
This operation is carried out using selector A. This selector disables and enables locking of
the clamps on the corresponding mobile support. When the selector is turned to the left, the
clamps unlock the piece. When it is turned to the right the clamps lock the piece again. To
ensure that the piece does not move, carry out this operation on one mobile support at a time,
making sure that you re-lock the piece before unlocking the next mobile support.
X
Y

A
2.

Start machining operations. When machining has been completed, unlock the piece by
turning the relative selectors A to the right.

'LVDEOLQJWKHNLWWRDOORZQRUPDOXVHRIWKHPDFKLQH
To disable the kit and use the machine for normal operations, perform the operations listed below.
1.

2.

Remove the clamps. To do this, block stem


A using a spanner, unscrew screw B and
remove parts C and D.

Turn the Special clamps selector on the


control panel to the left. The pistons E drop
and the machine is ready for normal use.

A
D

5 - 10

BIESSE S.p.A.

Woodworking Machinery
(a106h002.fm-210300)

Chapter 6.

&KDSWHU

0DLQWHQDQFH

DANGER

Before carrying out any maintenance operations or repairs to the machine, unless
otherwise specified, switch off the machine and remove any air from the pneumatic plant.
Lock the main switch and cutout valve with the padlocks supplied to prevent anyone
restarting the machine.



7DEOHRIPDLQWHQDQFHRSHUDWLRQV

The following table gives a summary of all the maintenance operations foreseen, indicating the
frequency with which they must be carried out (the value is expressed in working hours unless
otherwise indicated). The last column indicates the number of the page on which a description of
the procedure to be followed when carrying out these operations can be found. If no page number
is indicated, this means that no particular procedures are required to carry out this operation.
Frequency
8

40

Parts involved

Operation

Page

Whole machine

Cleaning

6-4

FRL Unit

Check condensation in tray; drain if


necessary

6-4

Belt tool magazine

Cleaning

6-5

Electrospindle

Check tool lock

6-5

Curtain guards

Check conditions; replace if


necessary

Shapeable suction cup

Check conditions of seal element;


replace if necessary

Vacuum pump

Cleaning

6-6

Guides and racks on axes


X, Y and Z

Cleaning and lubrication

6-6

Belt tool magazine

Lubrication

6-7

Pneumatic and vacuum


systems

Check pressures

6-7

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6-1

Chapter 6.
Maintenance

Frequency
100

Parts involved

Operation

Page

Electrospindle

Cleaning

6-8

ISO30
pincer-type
electrospindle

Cleaning

6-9

HSK F50, F63 pincer-type


electrospindle

Cleaning and lubrication

6 - 10

Milling unit with circular


blade tool

Lubrication

6 - 10

Aggregates

Lubrication and cleaning

6 - 10

Boring head BH 43

Lubrication of the circular blade tool


unit

6 - 10

200

Boring head

Lubrication and cleaning

6 - 10

5000

Vacuum pump

Replace dust separator and check


wear in blades

6 - 13

FRL Unit

Top-up with lubricant

6 - 14

Central lubrication grease


pump

Top-up with lubricant

6 - 14

(*)

(*). The unit is fitted with a sensor controlling the lubricant level. If the minimum level is reached a
message appears on the numerical control monitor signalling the operator to top up with lubricant.



&KDUDFWHULVWLFVRIOXEULFDQWV

Always use the lubricants indicated by BIESSE. Only use the equivalent alternatives if the
lubricant indicated by BIESSE is difficult or impossible to obtain. When replacing the original
lubricant with one of an equivalent kind, clean the parts carefully to remove any residual product, in
order to avoid any chemical reaction that might damage the machine.
Lubricant used by BIESSE
name
MOBIL DTE 24

chemical and physical characteristics


category: OIL
volume mass: 0.869 kg/cu.dm at 15 C
vapour pressure: <0.1 mm Hg, at 20 C
viscosity: 32,5 cSt, at 40 C
5,5 cSt, at 100 C
pour point: -27 C
boiling point: >315 C

6-2

Equivalents

AGIP OSO 32
BP ENERGOL HLP 32
CASTROL HYPIN AWS 32
ELF ELFOLNA 32
ESSO NUTO H 32
KLBER LAMORA 32
Q8 HAYDN 32
ROL LI 32
SHELL TELLUS OIL 32
TAMOIL HYDRAULIC OIL 32
TEXACO RANDO OIL HD 32
TOTAL AZOLLA ZS 32

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance

Lubricant used by BIESSE


name
MOBILTEMP
SHC 100

Equivalents

chemical and physical characteristics


category: GREASE

MOBILTEMP SHC 32

volume mass: 1,0 kg/dmc at 15 C


vapour pressure: <0,1 mm Hg, at 20 C
viscosity: 87 cSt, at 40 C
13 cSt, at 100 C
dropping point: >260 C
boiling point: >315 C
MOBILUX EP 0

category: GREASE
volume mass: 0,879 kg/dmc at 15 C

ESSO BEACON EP 0
KLBER TRIBOSTAR 0 EP(*)
KLBER CENTOPLEX 0 EP(**)

vapour pressure: <0,1 mm Hg, at 20 C


viscosity: 150 cSt, at 40 C
11,8 cSt, at 100 C
dropping point: 190 C
boiling point: >315 C
MOBILUX EP 1

category: GREASE
volume mass: 0,879 kg/dmc at 15 C
vapour pressure: <0,1 mm Hg, at 20 C

AGIP GR LP 1
BP GREASE LTX EP1
ESSO BEACON EP 1
SHELL EP 1
TAMOIL TAMLITH GR EP 1
TOTAL MULTIS EP 1

viscosity: 150 cSt, at 40 C


11,8 cSt, at 100 C
dropping point: 190 C
boiling point: >315 C
MOBIL
RUBREX 100

categoria: OIL
volume mass: 0,860 kg/dmc at 15 C

AGIP MAG 22
ROL LEMANIA 22
SHELL CARNEA 21
TAMOIL TAMLUBE OIL 22

vapour pressure: <0,1 mm Hg, at 20 C


viscosity: 21 cSt, at 40 C
4,2 cSt, at 100 C
pour point: -6 C
boiling point: >315 C

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6-3

Chapter 6.
Maintenance

Lubricant used by BIESSE


name

Equivalents

chemical and physical characteristics

KLBER
AMBLYGON TA 15/2

category: GREASE

KLBER
ISOFLEX NBU
15

category: GREASE

product with no equivalent

inflammability COC - ASTM D92C: sup.


220
product with no equivalent

density with respect to water:


0,9 g/cm3 a 20 C
melting point:
sup. 200 C

KLBER
ISOFLEX
TOPAS NB 52

category: GREASE

product with no equivalent

density at 20C ASTM D4052: approx.


0.96
inflammability (DIN ISO 2176 basic oil:
>200C
melting point (DIN ISO basic oil):
>200C

KLBER LUSIN
PROTECT G31

category: PROTECTIVE LUBRICANT

product with no equivalent

(*). available on the Italian market only.


(**). available on the international market.



*HQHUDOFOHDQLQJRIWKHPDFKLQH

If the machine and the surrounding area are kept clean and tidy this will make the working area
safer and more healthy, and will enable commands and indications to be made easily and without
errors. The chips produced during machining can also make the floor slippery.



'UDLQLQJFRQGHQVDWLRQIURPWKH)5/XQLW
INFORMATION

7RFDUU\RXWWKLVRSHUDWLRQVZLWFKWKHPDFKLQHRQDQGWXUQWKH7RROLQJVHOHFWRUWRWKHULJKW.

6-4

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance

The FRL unit is equipped with a tank to collect condensation. Check the amount of condensation
that has formed and if necessary drain the tank as described below.

1.

Remove the casing A.

2.

Place a tin under the bleeder valve B.

3.

Press the bleeder valve B upwards, until all the condensation has drained out.

4.

Replace the casing A.



&OHDQLQJWKHEHOWWRROPDJD]LQH

Clean the tool magazine and the automatic tool change device using compressed air and clean,
dry cloths, taking care that you clean the bearings and guides well.



&KHFNLQJWRROORFNRQWKHHOHFWURVSLQGOH
INFORMATION

To carry out this operation, switch the machine on and turn the Tooling selector to the right.
Check that the electrospindle locks the tool properly. To do this, insert a collet spindle with no tool
fitted into the electrospindle and check manually that it is perfectly locked.

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6-5

Chapter 6.
Maintenance



&OHDQLQJWKHYDFXXPSXPS

Clean the vacuum pump as described below.


B

A
D

C
B
B

1.

Unscrew the screw A to eliminate any residual vacuum inside the pump.

2.

Remove the filter covers B.

3.

Remove each air filter C and clean it using a jet of compressed air and blowing from the
inside out. Replace blocked or greasy filters.

4.

Clean the cooling slots D, using a jet of compressed air.



&OHDQLQJWKHJXLGHVDQGUDFNV

Clean all the guides and racks moving axes X, Y and Z using clean dry cloths. In case of
particularly stubborn deposits use a bronze wire brush.
Brush a thin layer of MOBILUX EP0 lubricant onto each rack.

6-6

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance



/XEULFDWLRQRIWKHEHOWWRROPDJD]LQH

Lubricate each point A on the automatic tool


change device, applying a thin layer of
MOBILUX EP0 lubricant.



&KHFNLQJSUHVVXUH

The machine is equipped with a number of pressure gauges to control the working pressure. Any
adjustments can only be made to the pneumatic system supply pressure (see Appendix C.
Transport and Installation). If any of the other pressures are not found to be correct, please
contact the BIESSE service department.

Pneumatic system
A - Pressure gauge indicating the supply pressure = 6 - 7 bar.
B - Pressure gauge indicating the compensation pressure for axis Z = 5 - 6 bar.
C - Pressure gauge indicating the raising pressure for the drilling head horizontal spindles = 3,5 4 bar.
D - Pressure gauge indicating the copier compensation pressure = 2 - 3 bar.
E - Pressure gauge indicating the copier lowering pressure = 2 - 3 bar.

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6-7

Chapter 6.
Maintenance

INFORMATION

To check the copier pressure, turn the machine on, turn the Tooling selector to the right and lower
the electrospindle on which this device is installed.
Vacuum system
F - Pressure gauge indicating the vacuum produced by the pump = - 65 cm Hg (approx.). There
is one pressure gauge for each vacuum pump.
INFORMATION

To check the vacuum level produced by the pump, turn the machine on and turn the Tooling
selector to the right.



&OHDQLQJWKHHOHFWURVSLQGOH

Clean every electrospindle as described below.


1.

Clean the guides on slide A using clean, dry cloths. In the presence of encrusted dirt, use a
brush with bronze bristles.

2.

Clean the outside of the electrospindle using a jet of compressed air.


CAUTION

Never carry out this operation without the pincer-type spindle inserted.

6-8

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance

3.

Clean the conical surfaces B of the coupling using a clean, soft cloth soaked in denatured
alcohol or trichlorethylene.

A
A



&OHDQLQJWKH,62SLQFHUW\SHVSLQGOH

Carefully clean surfaces A of the pincer-type


spindle using a soft clean cloth soaked with
denatured alcohol or trichloroethylene.
A

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6-9

Chapter 6.
Maintenance



&OHDQLQJDQGOXEULFDWLQJWKH+6.))SLQFHUW\SH
VSLQGOH

Carefully clean surfaces A of the pincer-type


spindle using a soft clean cloth soaked with
denatured alcohol or trichloroethylene.

CAUTION

After cleaning, to prevent the spindle from remaining locked in the electrospindle with the
resulting risk of breakage of the tool change mechanism, spray surfaces A with the product
KLBER LUSIN PROTECT G 31.



/XEULFDWLRQRIWKHPLOOLQJXQLWZLWKFLUFXODUEODGHWRRO

Lubricate this group using lubricating nipples A and B. Lubricating nipple B is only present if the
group is fitted with an automatic tool swivelling device. Lubricate as described below.
1.

Turn the tool in the group and position it as


shown in the figure.

2.

Open the suction guard casing.

3.

Fill the pump provided with MOBILTEMP


SHC 100 lubricant.
B

4.

Connect the pump to the lubricating nipple


A and insert 3 grams (1 or 2 strokes of the
pump) of lubricant.

5.

Repeat the operations described in point 4.


on lubricating nipple B.



/XEULFDWLRQDQGFOHDQLQJRIWKHDJJUHJDWH

Lubricate every aggregate using the lubricating nipple provided. Proceed as described below.
1.

Rest the aggregate on a work bench.

2.

Fill the grease pump provided with KLBER ISOFLEX NBU 15 lubricant. For aggregates with
inclining spindle, use the special pressure syringe provided, filling it with KLBER ISOFLEX
TOPAS NB 52 lubricant.

3.

Insert the pump into the lubricating nipple and pump in 3 grams (1 or 2 strokes of the pump) of
lubricant.

6 - 10

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance

Clean surface A of the coupling using a soft clean cloth soaked with denatured alcohol or
trichloroethylene.

CAUTION

After cleaning, to prevent the coupling from locking in the electrospindle avoid any risk of
breaking the tool change device, spray some KLBER LUSIN PROTECT G 31 on surfaces A
of the HSK F50 and F63 type couplings.



/XEULFDWLRQRIWKHFLUFXODUEODGHWRROXQLWRQERULQJKHDG%+


Lubricate the unit using the lubricating nipple provided. Proceed as described below.
1.

Fill the grease pump provided with


KLBER ISOFLEX NBU 15 lubricant.

2.

Insert the pump into the lubricating nipple A


and pump in 3 grams (1 or 2 strokes of the
pump) of lubricant.
A

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6 - 11

Chapter 6.
Maintenance



/XEULFDWLQJRIWKHERULQJKHDGDQGFOHDQLQJWKHVSLQGOHV

Lubricate the boring head using the two lubricating nipples A and B. Proceed as described below.
Also clean away any oxides from the outside of the spindles and spray the area with a Teflon
spray. If a spindle is not used frequently it can oxidize. If this happens it will not descend properly,
and can even become blocked.
1.

Fill the grease pump provided with MOBILTEMP SHC 100 lubricant.

2.

Insert the pump in the lubricating nipple A and pump i n 8 grams (approximately 3 or 4 strokes
of the pump) of lubricant.

3.

Repeat the operations described in point 2 on lubricating nipple B.

BH 43

A
A

6 - 12

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance



&KHFNLQJZHDURQWKHEODGHVDQGUHSODFLQJWKHGXVW
VHSDUDWRU

Because they are continually rubbing against the inside of the body, the blades can become worn.
Check the width of the blades and replace them if they have reached the minimum width of 26 mm.
Take the opportunity to check the conditions of the bearing on the inside of the cover C. If it is dry,
lubricate with KLBER AMBLYGON TA 15/2 type grease.

D
E

1.

Unscrew screw A to discharge any residual vacuum in the pump.

2.

Remove the covers B and C.

3.

Take out the blades D and check them for wear; replace if necessary.

4.

Remove the covers E.

5.

Replace the dust separator F.

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6 - 13

Chapter 6.
Maintenance



7RSSLQJXSOXEULFDQWLQWKH)5/XQLW

If the lubricant in the FRL unit has reached the minimum level a message will be displayed on the
numerical control. If this is the case, top-up the lubricant as described below.

1.

Turn off the tap upstream of the FRL unit, to stop the flow of compressed air.

2.

Pull the handle A upwards and unscrew it completely to eliminate any residual air pressure.

3.

Remove casing B.

4.

Unfasten screw C.

5.

Pour in MOBIL DTE 24 lubricant until reaching the maximum level.

6.

Replace screw C and tighten well, replace casing B and bring the supply pressure back up to
the correct level.

6 - 14

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 6.
Maintenance



7RSSLQJXSOXEULFDQWLQWKHFHQWUDOJUHDVLQJV\VWHP

If the lubricant in the pump reaches the minimum level a message is displayed on the numerical
control. If this is the case, top-up the lubricant as described below.

1.

Fill the grease pump provided with MOBILUX EP0 lubricant.

2.

Insert the pump into the lubricating nipple A and pump in lubricant until reaching the
maximum level, indicated by the fact that the lubricant starts to come out of drainage hole B.

BIESSE S.p.A. Woodworking Machinery


(a107h002.fm-210300)

6 - 15

Chapter 6.
Maintenance

6 - 16

BIESSE S.p.A.

Woodworking Machinery
(a107h002.fm-210300)

Chapter 7.

&KDSWHU



7URXEOHVKRRWLQJ

3UREOHPVFDXVHVDQGVROXWLRQV

Whenever a problem occurs, check for messages on the numerical control. If there are no
messages to help solve the problem, consult the table given below. If the problem is not among the
ones indicated here, contact the BIESSE service department
Problem
The numerical control
does not turn on.

Cause

Solution

There is no electrical power


supply.

Check that the machines main


power switch is turned to 1 (ON).

A thermal cutout switch in the


wiring cabinet has triggered.

Reset the cutout switch.

There are emergency devices


active.

Check the emergency button.

The bulb is broken.

Replace the bulb.

The suction cup tubes


connected to the vacuum
system are damaged.

If bent, straighten them manually


and check sealing capacity. If
broken, replace with new tubes.
Do not attempt to repair them
with adhesive tape or glue.

The vacuum pump motor turns


backwards.

Do not use the machine, and


report the problem immediately
to BIESSEs Service
Department.

The Auxiliary vacuum selector,


on the supplementary front
button pad, is set to OFF.

Turn the selector to the left or to


the right.

The axis carriages do


not move but no error
messages are
displayed.

The Override knob is set to


minimum.

Turn the knob slowly until it is in


the correct position.

During a work cycle,


some of the spindles in
the boring head do not
descend when invoked
by the program.

The spindle shaft is dirty or


oxidized. This can happen
when they are not used very
much.

Clean the spindle shaft.

There may be problems in the


electric or pneumatic system.

Refer to the Circuit Diagrams.

The start button on the


operator control panel
does not light up.
The panel does not
remain locked on the
work table.

BIESSE S.p.A. Woodworking Machinery


(a108h002.fm-210300)

Check the emergency cords.

7-1

Chapter 7.
Troubleshooting

Problem
During the work cycle
the stops do not move
into position or do not
descend.

Cause

Solution

There are deposits on the rods.

Remove the deposits with a


clean dry cloth or a bronze wire
brush.

The piece has been pressed too


hard against the stops.

Unlock the piece and repeat the


positioning operation.

There may be problems in the


electric or pneumatic system.

Refer to the Circuit Diagrams.

Deposits have formed along the


slide bars.

Remove the deposits with a


clean dry cloth or bronze wire
brush.

Problems with the locking


piston.

Contact the Service department.

The spindles on the


boring head rotate in the
wrong direction.

The live wires in the power


supply terminals, inside the
electrical cabinet, are inserted
in the wrong order.

Turn the machine off and invert


at least two of the three live wires
in the power supply terminals.

During emergency
shut-down of the
machine, the operating
section descends
through the Z axis.

Insufficient pressure for the


compensation cylinder of the Z
axis.

Check the pressure indicated on


the pressure gauge.

There may be problems in the


pneumatic circuit.

Contact Biesse S.p.A. Service


department.

The quality of results


obtained on the
machine is poor.

The tool is not suitable for the


type of work being carried out,
or the tool is worn.

Replace with a new tool.

The tool speed of movement


and/or the tool rotation speed is
not suitable for the type of
material being worked.

Adjust the parameters of the


speed of movement and/or tool
rotation speed.

The panel support


cannot be positioned or
cannot be locked.

7-2

BIESSE S.p.A.

Woodworking Machinery
(a108h002.fm-210300)

$SSHQGLFHV

BIESSE S.p.A. Woodworking Machinery


(a306h001.fm-210300)

BIESSE S.p.A.

Woodworking Machinery
(a306h001.fm-210300)

Appendix A.

$SSHQGL[$

6DIHW\LQIRUPDWLRQ

The machine will operate in safety if it is used by qualified personnel in compliance with the
recommendations and instructions provided in this manual. BIESSE declines all responsibility for
any damage to persons or goods resulting from use of the machine by unqualified operators or
from failure to observe the following recommendations.
Never remove or tamper with guards and protections in order to carry out unforeseen operations,
as this will result in serious risks for the operator. BIESSE declines all responsibility for damage to
persons or goods resulting from incorrect use or deliberate misuse of the machine.

$

7UDQVSRUWDQGPRYLQJ

1.

When lifting and moving the machine, either as a whole or in part, operations must always be
carried out by suitably qualified and experienced personnel, using lifting devices with an
adequate capacity.

2.

Never stand within range of the crane when the machine is being lifted.

3.

Only lift the machine as described in this manual.

$

,QVWDOODWLRQ

1.

Installation operations must always be carried out by qualified personnel who have been
authorised to do so by BIESSE.

2.

Before starting work, check that the various parts of the machine are free from any physical
damage caused by bumping, tearing or abrasion. Damage to electrical cables or sheathing
will compromise the safety of the machines electrical system.

$

7RROV

When choosing tools to be installed in the machine, the operator is advised to follow the
recommendations given below.
1.

Never use deformed or cracked rotating tools.

2.

Check for perfect balance of rotating tools and make sure they are perfectly sharp and
suitable for the work to be performed.

BIESSE S.p.A. Woodworking Machinery


(a109h001.fm-210300)

A-1

Appendix A.
Safety information

3.

Never use tools beyond their speed limit, which is impressed on the surface of the tool or
indicated in some way by the manufacturer.

4.

Before installing any tool in its seating make sure that the guide and centring surfaces have
no dents and are perfectly clean.

5.

In each tool apply only the prescribed torque to screws, bolts, nuts and rings.

6.

Always make sure that the direction of rotation of the tool is the same as that of the spindle in
which it is mounted.

7.

Never exceed the limits indicated in this manual or otherwise prescribed by BIESSE.

$

3UHSDUDWLRQDQGPDFKLQLQJ

1.

Wear protective clothing of the approved type (glasses, gloves, helmet and footwear).

2.

Never attempt to modify the programs managing safety devices. BIESSE declines all
responsibility for any damage to persons or goods resulting from unauthorised modifications
of this kind.

3.

The machine must be set up by one person only. Ensure that nobody else approaches the
machine during setting up operations.

4.

When entering the area inside the guard, first take the key out of the safety microswitch on
the door, to prevent anybody from starting the machine by accident.

5.

Never leave tools on the machine when setting up has been completed.

6.

Before starting work, check that there is nobody within the danger area.

7.

Make sure that nothing is likely to impede normal movement of the machine along the axes,
and that all casings, doors and protective covers are properly in place and safely fastened.

8.

When the machine is working it creates dust. Wear a suitable face mask to avoid inhaling.

9.

Before starting work, check to make sure that the tools installed in the machine have not been
tampered with in any way.

10. Never operate the machine while under the influence of any medicine, drugs or drink that may
reduce levels of vigilance and reflexes.
11. Always keep the working area clean and tidy.
12. Never lean against or climb onto the machine.
13. Should a power cut occur for any reason during operation, the electro-spindle may continue
to turn. Wait for a few minutes before approaching the tools installed on the spindles and
always make sure that the tool has come to a standstill first.

A-2

BIESSE S.p.A.

Woodworking Machinery
(a109h001.fm-210300)

Appendix A.
Safety information

$

0DLQWHQDQFH

1.

Wait for at least 5 minutes before approaching electronic devices, to give the capacitors time
to discharge any residual energy.

2.

Do not eat, drink or smoke when handling lubricants. Always comply with current safety
regulations when handling mineral oils and greases.

3.

In order to prevent irritation or allergy, always wear protective glasses or mask, oil-proof
gloves and an oil-proof overall when handling lubricants.

4.

Store lubricants in a naturally ventilated room away from heat sources (electric panels, live
flames, etc.).

5.

Avoid any direct contact with pure oxygen and acids.

6.

All lubricants must be handed over to authorised Used Oil Collection centres for disposal.

7.

Always wear suitable clothing. Use sand to absorb the product or collect it with a scraper.
Wash surfaces with solvents (chlorinated or aliphatic) taking care that the fumes are not
allowed to accumulate in the working area. Send the material used for cleaning to an
authorised disposal centre (SPECIAL WASTE) for incineration. Inform the authorities of what
has occurred.

8.

An allergic reaction or oil-induced acne can be caused in particularly sensitive persons,


especially in case of prior skin damage, due to abrasion (e.g. hand cleaning paste, small cuts
and grazes) or contact with chemicals (e.g. solvents, strongly alkaline detergents, high-grade
surfactants). Contact with the eyes can cause irritation.

9.

There is also a risk of side effects due to excessive exposure, such as slight irritation of the
eyes and moderate skin irritation, due to incorrect handling of lubricants. In situations of this
kind, avoid further exposure to the product and request medical treatment.

10. If the product comes in contact with the skin wash thoroughly with soap and water.
11. If the product comes in contact with the eyes rinse thoroughly with water only.
12. If a lubricant in the oil category is swallowed do not induce vomiting and call a doctor
immediately.
13. If a small amount of lubricant in the grease category is swallowed call a doctor immediately.
If the amount swallowed exceeds 1/2 a litre, administer 1 or 2 glasses of water and call a
doctor immediately. Do not induce vomiting or attempt to make the patient drink anything if he
or she has fainted.

$
1.

'HPROLWLRQ

All operations must be carried out by qualified personnel only.

BIESSE S.p.A. Woodworking Machinery


(a109h001.fm-210300)

A-3

Appendix A.
Safety information

2.

Turn the machine off, disconnect it from the power supply and discharge all the air from the
pneumatic system.

3.

Remove any tools that may still be installed and put them away.

4.

Fix all parts capable of moving by inertia or by gravity.

A-4

BIESSE S.p.A.

Woodworking Machinery
(a109h001.fm-210300)

Appendix B.

$SSHQGL[%

%

7HFKQLFDOFKDUDFWHULVWLFV

*HQHUDOLQIRUPDWLRQ

Boring head
q

Motor: 1.7 kW (2,3 HP).

Maximum rotation speed for left-hand spindles: 3368 rpm

Maximum rotation speed for right-hand spindles: 3528 rpm

Boring head BH 43
q

Motor: two 1.7 kW (2.3 HP) motors

Maximum rotation speed for left-hand spindles: 3368 rpm

Maximum rotation speed for right-hand spindles: 3528 rpm

Electrospindle
q

Motor: 7.7 - 8 kW (10.5 - 10.9 HP)

Maximum rotation speed of 7.7 kW electrospindle: 1000 24000 rpm

Maximum rotation speed of 8 kW electrospindle: 1000 20000 rpm

Milling unit with 1 horizontal spindle for circular blade tools


q

Motor: 3.7 kW (5 HP).

Rotation speed: 1000 11500 rpm.

Transmission ratio: 0.7

Milling unit with 1 ERC 32 collet coupling horizontal spindle


q

Motor: 3.7 kW (5 HP).

Rotation speed: 1000 12000 rpm.

Transmission ratio: 1.5

Revolver tool magazine


q

Maximum weight of a collet spindle complete with tool: 2 kg

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B-1

Appendix B.
Technical characteristics

Maximum weight of an aggregate complete with tool: 4 kg

Belt tool magazine


q

Maximum weight of a pincer-type spindle or of a chuck complete with tool: 7 kg.

Maximum overall weight of two tools fitted simultaneously in the automatic tool change
device: 9 kg.

Axes X, Y and Z
q

Maximum speed setting


axis X: 70 m/min;
axis Y: 70 m/min;
axis Z: 30 m/min.

Acceleration
axis X: 4 m/s2
axis Y: 5 m/s2
axis Z: 7 m/s2

B-2

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

%

3RVLWLRQRIRSHUDWLQJVHFWLRQXQLWVDORQJD[HV;<

ROVER 30 L2, ROVER 30 S2

X
Y

A = electrospindle (optional)
A = milling unit with 1 horizontal spindle for circular blade tool (optional)
A = electrospindle with 1 ERC 32 collet coupling horizontal spindle (optional)
B = electrospindle
C = boring head BH 43 (optional)

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B-3

Appendix B.
Technical characteristics

ROVER 30 L3, ROVER 30 S3


X
Y

A = electrospindle (optional)
B = electrospindle
B = electrospindle (optional)
C = electrospindle (optional
C = milling unit with 1 horizontal spindle for circular blade tool (optional)
C = electrospindle with 1 ERC 32 collet coupling horizontal spindle (optional)

B-4

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

%

3RVLWLRQRIRSHUDWLQJVHFWLRQXQLWVDORQJD[LV=

The positions along axis Z refer to the work table zero position.
Boring head
X
Z

unit with circular blade tool for boring head


BH 43

Electrospindle
ISO 30

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

HSK F50

HSK F63

B-5

Appendix B.
Technical characteristics

Milling unit

%

:RUNLQJUDQJH

The following pages show the working range for the various models. The symbols used in the
working ranges represent the following:
stop
double movement stop
start suspension

List of working ranges:


ROVER 30 L2

page B - 8

ROVER 30 L2 CE

page B - 9

ROVER 30 L2 with solid work table

page B - 10

ROVER 30 L2 CE with solid work table

page B - 11

ROVER 30 S2

page B - 12

ROVER 30 S2 CE

page B - 13

ROVER 30 S2 with solid work table

page B - 14

ROVER 30 S2 CE with solid work table

page B - 15

ROVER 30 L3

page B - 16

ROVER 30 L3 CE

page B - 17

ROVER 30 L3 with solid work table

page B - 18

B-6

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L3 CE with solid work table

page B - 19

ROVER 30 S3

page B - 20

ROVER 30 S3 CE

page B - 21

ROVER 30 S3 with solid work table

page B - 22

ROVER 30 S3 CE with solid work table

page B - 23

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B-7

Appendix B.
Technical characteristics

ROVER 30 L2
Y
X

B-8

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L2 CE
Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B-9

Appendix B.
Technical characteristics

ROVER 30 L2 with solid work table


Y
X

B - 10

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L2 CE with solid work table


Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 11

Appendix B.
Technical characteristics

ROVER 30 S2
Y
X

B - 12

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S2 CE
Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 13

Appendix B.
Technical characteristics

ROVER 30 S2 with solid work table


Y
X

B - 14

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S2CE with solid work table


Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 15

Appendix B.
Technical characteristics

ROVER 30 L3
Y
X

B - 16

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L3 CE
Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 17

Appendix B.
Technical characteristics

ROVER 30 L3 with solid work table


Y
X

B - 18

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L3 CE with solid work table


Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 19

Appendix B.
Technical characteristics

ROVER 30 S3
Y
X

B - 20

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S3 CE
Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 21

Appendix B.
Technical characteristics

ROVER 30 S3 with solid work table


Y
X

B - 22

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S3 CE with solid work table


Y
X

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 23

Appendix B.
Technical characteristics

%

(OHFWURVSLQGOHDJJUHJDWHV
Aggregate

Characteristics

102,9
0

32

96
32

32

32

95
111

101,9
117,9
55

55

55

55

95
122

101,9
128,9
71,5

76,5

76,5

71,5

80

B - 24

86,9
51

71.5

51

113,9
0

71.5

107

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

Aggregate

Characteristics

95
118,3

101,9
125,2

88,4

88,4

88,4

88,4

88,4

88,4

88,4

88,4

101,9
133,9
93,5

95
127
0

65,9

93,5

65,9

81

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

100,1

107

81

B - 25

Appendix B.
Technical characteristics

Aggregate

Characteristics

H
0

100,1

107
66

66

116,9
150,4
59,5

110
143,5
0

71,5

59,4

71,5

151,9
185,4
59,5

145
178,5
0

71,5

59,4

71,5

B - 26

183,5
215,5

190,4
222,4
0

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

Aggregate

Max electrospindle
rotation speed

Max tool rotation speed

Transmission
ratio

6000 rpm

6000 rpm

6000 rpm

6000 rpm

12000 rpm

12000 rpm

11500 rpm

8050 rpm

0,7

8400 rpm

12000 rpm

1,4285

12000 rpm

8400 rpm

0,7

12000 rpm

12000 rpm

8000 rpm

8000 rpm

11500 rpm

8050 rpm

0,7

8300 rpm

5800 rpm

0,7

12000 rpm

18000 rpm

1,5

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 27

Appendix B.
Technical characteristics

%

/D\RXWRIWKHPDFKLQHFRQQHFWLRQSRLQWVDQGZRUNLQJ
GLPHQVLRQV

The following pages show the layout of the various models, with indications of the machine layout,
points of connection to the power systems and working dimensions. The symbols used in the
layouts represent the following:

point of connection to the electrical system

vacuum pump

point of connection to the pneumatic system

entrance door

point of connection to the suction system

supplementary button pad

The positions followed by the symbol () indicate the distance between the centres of fixing holes.
List of layouts
ROVER 30 L2

page B - 29

ROVER 30 L2 CE

page B - 30

ROVER 30 L2 with belt tool magazine

page B - 31

ROVER 30 L2 CE with belt tool magazine

page B - 32

ROVER 30 S2

page B - 33

ROVER 30 S2 CE

page B - 34

ROVER 30 S2 with belt tool magazine

page B - 35

ROVER 30 S2 CE with belt tool magazine

page B - 36

ROVER 30 L3

page B - 37

ROVER 30 L3 CE

page B - 38

ROVER 30 S3

page B - 39

ROVER 30 S3 CE

page B - 40

B - 28

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L2
Y
X

height from the ground of


connection points:

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

700

B = 2720
C = 500

B - 29

Appendix B.
Technical characteristics

ROVER 30 L2 CE
Y
X

height from the ground of


connection points:

B - 30

700

B = 2720
C = 500

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L2 with belt tool magazine


Y
X

height from the ground of


connection points:

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

700

B = 2720
C = 500

B - 31

Appendix B.
Technical characteristics

ROVER 30 L2 CE with belt tool magazine


Y
X

height from the ground of


connection points:

B - 32

700

B = 2720
C = 500

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S2
Y
X

height from the ground of


connection points:

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

700

B = 2720
C = 500

B - 33

Appendix B.
Technical characteristics

ROVER 30 S2 CE
Y
X

height from the ground of


connection points:

B - 34

700

B = 2720
C = 500

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S2 with belt tool magazine


Y
X

height from the ground of


connection points:

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

700

B = 2720
C = 500

B - 35

Appendix B.
Technical characteristics

ROVER 30 S2 CE with belt tool magazine


Y
X

height from the ground of


connection points:

B - 36

700

B = 2720
C = 500

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 L3
Y
X

height from the ground of


connection points:

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

700

B = 2550 (2720 with 10 kW electrospindle)


C = 500

B - 37

Appendix B.
Technical characteristics

ROVER 30 L3 CE
Y
X

height from the ground of


connection points:

B - 38

700

B = 2550 (2720 with 10 kW electrospindle)


C = 500

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

ROVER 30 S3
Y
X

height from the ground of


connection points:

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

700

B = 2550 (2720 with 10 kW electrospindle)


C = 500

B - 39

Appendix B.
Technical characteristics

ROVER 30 S3 CE
Y
X

height from the ground of


connection points:

B - 40

700

B = 2550 (2720 with 10 kW electrospindle)


C = 500

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix B.
Technical characteristics

%

1RLVHOHYHO

The correct noise level, measured from the position of the operator, is as follows:
q

80 dB (A), during boring

81 dB (A), during milling

Noise level tests were conducted as described in: EN 31202 - ISO 7960 - prEN 848.
Materials worked: chipboard covered with melamine, thickness 18 mm.
Instruments: phonometer BK 2230
K1= Background noise correction factor lower than 4 dB (A)
K3= Background environment correction factor lower than 4 dB (A)
The noise levels indicated are output levels and do not necessarily represent safe operational
levels. Although there is a relationship between output levels and exposure levels, the output
levels cannot be reliably used to determine whether additional precautions are necessary or not.
The factors determining the noise levels to which the operative personnel is exposed, include the
length of exposure, the characteristics of the work area, as well as other sources of dust and
noise, etc. i.e. the number of machines and processes concurrently operating in the vicinity. In any
case, the information supplied will help the user of the machine to better assess the danger and
the risks involved.
Working data
Boring

Milling

4000

18000

speed of movement (m/min)

working depth (mm)

10

10 (8)

1 (25)

tool cutters (n)

tool cutter length (mm)

40

tool rotation speed (rpm)

tools used for operation (n)

BIESSE S.p.A. Woodworking Machinery


(a110h002.fm-210300)

B - 41

Appendix B.
Technical characteristics

B - 42

BIESSE S.p.A.

Woodworking Machinery
(a110h002.fm-210300)

Appendix C.

$SSHQGL[&

7UDQVSRUWDQG,QVWDOODWLRQ

DANGER

Transport and installation of the machine must be carried out by expert and qualified
personnel according to the instructions provided in this appendix.

&

/LVWRISDUWVWREHWUDQVSRUWHG

To facilitate transport, the machine is divided into a number of parts. The following is a list of the
dimensions and weight of each of these parts.

E
B

Machine part

Dimensions (mm)

Weight (kg)

A - Main structure
ROVER 30 L2, ROVER 30 L3
ROVER 30 S2, ROVER 30 S3

6400 x 2300 x H 2300


5400 x 2300 x H 2300

6200
5700

B - Mesh guard

2450 x 400 x H 2300

250

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C-1

Appendix C.
Transport and Installation

Machine part

Dimensions (mm)

Weight (kg)

3950 x 100 x H 1650


3450 x 100 x H 1650

220
180

D - Vacuum pump

800 x 470 x H 720

100

E - Box of material supplied with the machine

1000 x 620 x H 640

70

C - Contact mats (non-CE version)


ROVER 30 L2, ROVER 30 L3
ROVER 30 S2, ROVER 30 S3

&

/LIWLQJ

The following is the procedure to be used when lifting the various parts of the machine.

0DLQVWUXFWXUH
The main structure can be lifted using a crane or bridge crane, following the method described
below.
The following material is provided to lift the structure:
A - Bottom bars; these are positioned in the
holes provided at the bottom of the base.

B - Top bar.

The operator in charge of unloading the machine must be provided with the following materials:
C - 2 belts 1000 mm long (capacity load 5000
kg).

5000 kg

C
1000 mm

D - 4 belts 2500 mm long (capacity load 3000


kg).

3000 kg

D
2500 mm

F - 2 pieces of wood of suitable size.

C-2

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

Position the material listed above, as follows:

B
D
E

D
E

Before lifting the machine, and with the belts under slight tension, position two pieces of wood ) in
the points indicated in the figure, and check that there is no risk of the belt ' damaging the grease
pump * in any way.

D
F

G
Instructions for lifting the machine placed in a container
If the machine has been placed in a container, the dimensions do not allow it to be unloaded from
the top. The machine can only be unloaded from the back.

OK

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C-3

Appendix C.
Transport and Installation

0HVKJXDUG
Use the following methods to lift this component.
A

A - Using a crane, bridge crane or similar


device.
B - Using a fork lift truck.

&RQWDFWPDWV
Use the following methods to lift this component.
A - Using a crane, bridge crane or similar
device.
B - Using a fork lift truck.

9DFXXPSXPSDQGER[RIPDWHULDOVXSSOLHGZLWKWKHPDFKLQH
No special procedures are required when lifting these components. The pump is hooked to the eye
bolt provided and can be lifted by any suitable means. The box of material supplied with the
machine can easily be lifted by a fork lift truck.

C-4

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

&

0RYLQJ

The following indicates how the main structure should be moved. For the other parts, use a fork lift
truck and the lifting method described above.

0DLQVWUXFWXUH
1.

With the aid of a fork lift truck, lift the machine at one side and insert devices similar to the
ones illustrated in the figure (see reference A) under the base, in the positions indicated.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C-5

Appendix C.
Transport and Installation

2.

Move the fork lift truck to the opposite side of the structure and lift the machine until it is in an
horizontal position.

3.

Keeping the machine horizontal, manoeuvre it into the position required.

&

,QVWDOODWLRQDUHD

The installation area must have adequate lighting and ventilation. As well as the working
dimensions of the machine it is necessary to foresee sufficient space around the machine to
enable personnel to perform maintenance operations in comfort and safety. The installation area
must also comply with the requirements listed below.

(OHFWULFDOV\VWHPUHTXLUHPHQWV
The quality of the electrical system must guarantee the basic requirements listed in the following
standards: CEI 60204-1, IEC 204-1, unless otherwise agreed with the client.
q

Supply voltage: (see rating plate) tolerance 10%

Frequency of power supplied: (see rating plate) tolerance 2%

Maximum absorbed power: (see rating plate)

Harmonic distortion: from second to fifth < 10% + from sixth to thirtieth < 2%

Voltage imbalance in three-phase power supply: < 2%

Pulse rate: duration of under 1.5 ms and < than 200% of the supply voltage

C-6

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

Voltage breaks: duration < 3 ms; period > 1 second

Voltage drops: value < 20% of peak supply voltage; period > 1 second

The system must comply with the following standards: CEI 64-8, IEC 364

The protection of the machine against indirect contact has been designed for type TN power
supply, therefore no differential protection has been provided. In case of connection to different
types of grids (TT, IT), or if required by local laws or standards, differential protection must be
provided based on the characteristics of the plant and taking the following conditions into account:
1.

The measures used to contain electromagnetic interference can produce high dispersion
currents of high frequency on the earthing conductor, therefore use a differential switch which
is not influenced by high frequencies.

2.

Faults to earth on the machine may also occur in direct current (IEC 755).

3.

The differential switch must be of the type highly resistant to pulse type overvoltages resulting
from atmospheric and moving sources (EN 61008-1) and testing with a 8/20 s >1000A (VDE
0432 T2) wave.

It is advisable to use differential switch type SIEMENS 5SZ3466-0KG00 or 5SZ6466-0KG00


following the SIEMENS installation instructions or other available switches possessing the above
characteristics.
For connection voltages up to 400 V, the electrical cabinet has an automatic main trip switch for
short-circuit currents up to 10 KA R.M.S. or 17 KA peak.
For connection voltages greater than 415 V, the cut-out switch is capable of supporting
short-circuit currents up to 4 KA.
If the presumed short-circuit current at the feed points is higher, it must be limited.

3QHXPDWLFV\VWHPUHTXLUHPHQWV
q

Working pressure: 6 bar

Compressed air consumption: 75 NL/min

Socket for connection to network: 3/8G

6XFWLRQV\VWHPUHTXLUHPHQWV
q

Minimum flow rate: 30 m/sec

Air consumption for suction:


during machining operations with units fitted in slots A and B = 7634 m3/h;

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C-7

Appendix C.
Transport and Installation

during machining operations with unit fitted in slot C = 1910 m3/h;


during boring operations with the boring head = 1910 m3/h.
q

Connection port: 300 mm

)ORRULQJUHTXLUHPHQWV
30

Cross-section of flooring

30

B - Grill.

B
A
B

300

A - Concrete.

250

10

250

Vertical forces
q

Maximum static load on each support pad: 1500 kg.

Maximum unitary static load on each support pad: 3 N/mm2.

Maximum dynamic load on each support pad: 480 kg.

Maximum unitary dynamic load on each support pad: 1 N/mm2.

Maximum static load created by tie rod on each support pad: 1500 kg.

Maximum unitary dynamic load created by tie rod on each support pad: 3 N/mm2.

Maximum unitary load on each support pad: (3+1+3) N/mm2 = 7 N/mm2.

Horizontal forces
q

Tangential dynamic load on each support pad: 250 kg.

Levelling
q

Maximum planar error of flooring: 25 mm/m (not cumulative).

Maximum inclination of the floor in all directions: 0.4%.

C-8

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

(QYLURQPHQWDOUHTXLUHPHQWV
q

Temperature: from 0 to +35 C (with air conditioner from 0 to +50 C)

Maximum relative humidity: 90% (without condensation)

Maximum altitude: 1000 m (unless agreed otherwise with client)

&

$QFKRULQJWKHPDFKLQHWRWKHJURXQG

Anchoring to the ground is an essential operation required to guarantee perfect operation of the
machine.
1.

Drill a hole, of the diameter and depth foreseen (see page C - 9), for each anchor point (see
page C - 11 or C - 12).

2.

Remove any dust and rubbish from the holes by brushing and blowing with compressed air.

3.

Take the cartridge provided containing the


chemical anchoring agent (see page C 13), unscrew the cap and screw on one of
the mixer nozzles.

4.

Place the cartridge in the gun, inserting the


special piston at the back.

5.

Work the gun until the chemical anchoring


agent coming out of the nozzle is a uniform
grey colour.

6.

Inject the chemical anchoring agent into


one of the anchor holes (until the hole is
approximately half full).

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C-9

Appendix C.
Transport and Installation

7.

Insert the threaded bar into the hole before


the compound hardens, turning the bar as
you do so.

8.

Repeat points 6. and 7. for each of the


anchor holes.

9.

Wait until the chemical anchoring agent has


had time to harden (see table on page C 13).

10. Anchor the machine to each threaded bar,


as shown in the figure.

Characteristics of the holes to be drilled in the floor

230

18

C - 10

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

Anchor points for ROVER 30 L2, ROVER 30 L3

A = anchor points

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 11

Appendix C.
Transport and Installation

Anchor points for ROVER 30 S2, ROVER 30 S3

A = anchor points

C - 12

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

Materials provided
B - 6 threaded bars, each bar is fitted with 1 nut
and 1 washer.

C - 2 cartridges with chemical anchoring agent.


D - 4 mixer nozzles.
E - 6 washers.

F - 2 pistons.
G

G - 1 gun.

Solidification time
The following table gives the times required for the compound to harden and the times to be
allowed before a load is applied (expressed in minutes) according to the room temperature:
Room temperature

Hardening time

Time before application of


load

5C

30

240

10C

15

120

20C

10

60

25C

50

30C

40

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 13

Appendix C.
Transport and Installation

&

5HPRYLQJDQGSRVLWLRQLQJWKHHOHFWULFDOFRQWUROFDELQHW

To remove and position the electrical cabinet, proceed as follows.


1.

Unscrew the screws A.

2.

With the aid of a fork lift truck, lift the electrical cabinet support frame and place it on the
ground, inserting the forks at the points indicated in the figure. Alternatively, the frame can be
connected to belts and lifted in this way.

600 kg

C - 14

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

3.

Place 2 pieces of wood B on the ground as shown in the figure, and raise the cabinet into a
vertical position by lifting from one side only.

4.

Unscrew the screws C, the eye bolts D, the screws E, the screws F and remove the top part
of the frame G.
D

G
E

5.

Screw the eye bolts D back onto the cabinet.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 15

Appendix C.
Transport and Installation

6.

Fix the belts to the eye bolts and lift the cabinet slowly.

500 kg

7.

Position the electrical cabinet as indicated in par. B.6 Layout of the machine, connection
points and working dimensions on page B - 28, bearing in mind the working dimensions of
the machine when fully assembled. It is recommended that a sheet of elastic insulating
material be laid between the electrical cabinet and the flooring.

&

5HPRYLQJWKHEORFNLQJGHYLFHVXVHGIRUWUDQVSRUW

The machine is provided with blocking devices to prevent any movement of the mobile parts
during transport. These blocking devices consist of brackets, which are painted red and arranged
in suitable positions. All these blocking devices must be removed. The following figure illustrates
the position of the blocking devices.
A - Bracket blocking X axis carriage.

C - 16

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

CAUTION

To install one of the two brackets A, pad B must be removed. Before using the machine,
replace pad B.

A
A

C - Y-axis beam fixing bracket.


D - Y-axis carriage fixing brackets.
E - Z-axis carriage fixing bracket.

D
E
D
C

F - Revolver tool magazine fixing bracket

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 17

Appendix C.
Transport and Installation

&

5HILWWLQJWKHWRROPDJD]LQHDQGDXWRPDWLFWRROFKDQJH
GHYLFH

Both the tool magazine A and the automatic tool change device B are removed and set in a
different position in order to reduce the dimensions of the machine to a minimum during transport.
These devices must be removed and refitted in the correct position, as shown in the figure.

A
B

&

5HSRVLWLRQLQJWKHFDEOHFDUULHUFKDLQIRUD[LV<

To reduce the dimensions of the machine during transport, the position of the cable-carrier chain A
is changed. Replace the chain in the correct position as shown in the figure.

A
A

C - 18

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

&

/HYHOOLQJWKHPDFKLQH

To level the machine, manually position the operating section at the centre of the machine. The
spirit level must have a sensitivity of at least 0.05 mm per meter.
1.

Loosen all the support pad lock nuts.

2.

Level the machine by adjusting all the support pads, positioning the spirit level as indicated in
the figure.

3.

When the machine is level, lock all the lock nuts again.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 19

Appendix C.
Transport and Installation

&

$VVHPEOLQJWKHPHVKJXDUG

The first operation to be performed is assembly


of the casing E, using the holes situated on the
base of the machine. Then take a support A
(with parts F, G, H pre-assembled) and fix it to
the casing E.

M6 x 10 TCEI

E
M6 x 10 TCEI

H
G

Complete by assembling the mesh guard, using


the pre-assembled support $ as a starting point.
The following descr ibes how the vario us
components in the mesh guard must be
arranged, and how to assemble the door. When
assembly of the mesh guard has been
completed, anchor it to the floor as described on
page C - 23.

M6 x 35 TCEI

$UUDQJHPHQWRIWKHFRPSRQHQWVIRUPLQJWKHPHVKJXDUG
The following diagram indicates the arrangement of the components forming the mesh guard.
Particular note should be taken of the dimensions of panels, to ensure they are assembled at the
point foreseen. Also check the position of the door and identify the components forming it (see
Door assembly plan on page C - 22) so that they are not confused with the others. All the mesh
guard supports are identical, with the exception of the ones used for the door.
A - door
B - casing
C - guard panel L = 1000 mm
D - guard panel L = 500 mm

C - 20

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

E - guard panel L = 650 mm


F - guard panel L = 860 mm
A

mesh guard for machine with


belt tool magazine

E
F

C
C
C

C
C
C
NO S2, S3

D
C

B
A
C
C
C

C
C

mesh guard for machine without


belt tool magazine

F
C
C

C
C
C
NO S2, S3

B
A
C
C
C

INFORMATION

For models ROVER 30 S2 and ROVER 30 S3 the panel and the support marked NO S2, S3 must
not be installed.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 21

Appendix C.
Transport and Installation

'RRUDVVHPEO\SODQ
Assemble the door components as shown in the figure. Components V and W might be the wrong
way round with respect to the position of the door. If this is the case, remove these components
and replace them the right way round. After assembly of both the doors, anchor the mesh guard to
the ground as illustrated in the following diagram.

15 mm

M5 x 50 TCEI

P
T

P
U

M5 x 14 TCEI

W
L

M5 x 14 TCEI

Q
S
M
R
M5 x 14 TCEI

L - support
M - door
N-

bar

P - carriage
Q - support
R - guide
S - buffer
T - safety microswitch
U - key for safety microswitch

C - 22

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

'LDJUDPRIKRZWRDQFKRUWKHPHVKJXDUGWRWKHIORRU
Once all the components have been assembled and levelled, the mesh guard must be anchored to
the floor. This is done with the support feet F, using only one of the two holes provided.
1.

Check the size of the brass plugs V and fit


the drill with a bit of a suitable size .

2.

Drill the floor at the necessary points.

3.

Insert a brass plug V into each of the holes


in the floor, fit a screw into it and screw
down tightly.

&

M8 x 40 TE

V
F

$VVHPEOLQJWKHFKDLQVXSSRUWV

To assemble the chain supports, refer to the figure below.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 23

Appendix C.
Transport and Installation

&

$VVHPEOLQJWKHPDLQVXFWLRQFRQYH\RUDQGFXUWDLQJXDUGV

In order to transport the machine by container, the main suction conveyor and the curtain guards
are dismantled. To assemble them, proceed as follows.
1.

Fix the main conveyor A.

2.

Connect pipes B in the respective collectors, fixing them with the appropriate clips.

3.

Connect the pipes in the respective fittings on each piston C:


D - red pipe;
E - white pipe.

ROVER 30 L2, ROVER 30 S2

ROVER 30 L3, ROVER 30 S3

A
D

A
E

B
B

C - 24

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

4.

Assemble the guide support F.

5.

Assemble the curtain guards G.

&

)L[LQJWKHFRQWDFWPDWV

CAUTION

Handle the contact mats with care, following the indications provided on the packing.
1.

Position the mats as indicated in par. B.6 Layout of the machine, connection points and
working dimensions on page B - 28.

2.

Check the size of the brass plugs A and fit


the drill with a bit of a suitable size.

3.

Drill the floor at a point corresponding to each of the fixing holes B.

4.

Insert a brass plug A into each of the fixing holes on the floor, and fix using the relative screw.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 25

Appendix C.
Transport and Installation

5.

Connect the contact mats to the machine at the sockets provided in box C.

CE version

non-CE version

C
B

&

,QVWDOODWLRQRIWKHDGGLWLRQDOEXWWRQSDGV

1.

Position the button pads as indicated in par. B.6 Layout of the machine, connection points
and working dimensions on page B - 28.

2.

Check the size of the brass plugs A and fit


the drill with a bit of a suitable size.

3.

Drill the floor at a point corresponding to


each of the fixing holes.

4.

Insert a brass plug A into each of the fixing


holes on the floor, and fix using the relative
screw.

M8 x 50 TCEI

C - 26

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

&

,QVWDOODWLRQRIWKHYDFXXPSXPS

DANGER

Make sure that the machine is switched off before connecting the electricity supply cable.
1.

Position the vacuum pump as indicated in par. B.6 Layout of the machine, connection points
and working dimensions on page B - 28.

2.

Take the vacuum system connecting hose and bring it up to the vacuum pump.

3.

Back off the tube clamp on the end of the hose and connect it to the connector provided.
DANGER

Make sure that the machine is switched off before connecting the vacuum pump electricity
supply cable.
4.

Connect the electricity supply cables to the respective connection sockets on the base.

&

(OHFWULFDOV\VWHPFRQQHFWLRQ

DANGER

Connection of the machine earth line is strictly compulsory. The connection must be made
before the live wires are connected.
CAUTION

Check that the line voltage and the rated voltage of the machine are the same.
The cable used to connect the machine to the mains power supply must be screened or pass
through a metal raceway to reduce electromagnetic interference. The screening or the metal
raceway must be connected to earth. The minimum section of the connection wire is: 25 mm2 (220
V - 230 V), 16 mm2 (400 V).
1.

Turn the workshop cut-out switch to which the machine is to be connected to 0 (zero) OFF
position.

2.

Make sure that the machine master switch is turned to 0 (zero) OFF position, and open the
door.

3.

Insert the three-phase power supply cable A through the hole on the top of the electrical
cabinet.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 27

Appendix C.
Transport and Installation

4.

Connect the earth wire B (yellow and green) and the three live wires C, as illustrated in the
figure.

rear view of the electrical cabinet

5.

Make sure that the live wires are connected in the correct sequence. To do this, complete
installation, turn the machine on and start the boring head spindles.

6.

If the spindles turn in the wrong direction, switch the machine off again, open the rear door
and exchange two of the three live wires C.

&

&RQQHFWLQJWKHSQHXPDWLFV\VWHP

If not already provided, fit a lockable supply tap at the point where the machine is to be connected.
1.

Connect the pneumatic supply hose to the connection A on the FRL unit.

2.

Fix the hose in position using a screw clamp or automatic connector.

Pressure adjustment
To adjust the pressure proceed as follows:
1.

Take hold of the knob B and pull it up until it is released.

C - 28

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix C.
Transport and Installation

2.

Screw it up to increase the pressure and unscrew it to reduce the pressure. The supply
pressure is displayed on the pressure gauge & and should be approximately 6 bar.

3.

After making the adjustment, press the knob to lock it and prevent further turning.

&

&RQQHFWLQJWKHFKLSVXFWLRQV\VWHP

The suction system must be permanently connected to the machine and operate with it. It must be
capable of providing the specified performance constantly and be maintained in good working
order.
DANGER

Inadequate system performance may lead to poor processing quality and damage to the
machine and the health of operators and other persons exposed to the machine.
The pipe connecting the suction system to the machine must be fitted with a cut-off gate valve, to
allow the machine to be disconnected from the main system. This valve must be in an easily
accessible position visible to the operator.
1.

Connect the suction pipe to the connection point on the suction manifold (see par. B.6
Layout of the machine, connection points and working dimensions on page B - 28) and lock
the pipe in position using a screw clamp.

BIESSE S.p.A. Woodworking Machinery


(a111h002.fm-210300)

C - 29

Appendix C.
Transport and Installation

C - 30

BIESSE S.p.A.

Woodworking Machinery
(a111h002.fm-210300)

Appendix D.

$SSHQGL['

'HFRPPLVVLRQLQJ'HPROLWLRQ

During the life cycle of the machine it may become necessary to dismantle it for transfer to another
site. If this is the case, proceed as indicated below.
1.

Turn the machine off and disconnect it from all power sources.

2.

Remove and put away all the tools that are in the machine.

3.

Clean the machine and protect parts that are subject to corrosion using suitable products.

4.

For transport and installation of the machine at the new site, use the methods and procedures
described in this manual.

The machine uses lubricating oil and grease. To neutralize the lubricant fluids which remain
attached to parts of the machine and cannot be re-used, use degradable solvents of an approved
type. For evacuation of recoverable lubricant fluids empty the tanks and deliver the fluids to the
local authority in charge of disposal. Also arrange for suitable disposal of any batteries,
accumulators, buffer batteries from the circuit boards in the machine.
When the machine reaches the end of its technical working life it must be totally decommissioned
so that it can no longer be used for the purposes for which it was designed and built. This
procedure allows for re-use of the parts and raw materials contained in the machine. If any parts
are used again it must be for purposes other than those for which the machine was originally
constructed.
BIESSE declines all liability for damage to persons of things that may derive from any secondary
use of single parts of the machine for functions or assemblies other than those originally
contemplated. BIESSE recognizes no implicit or explicit suitability for specific purposes of any
parts of the machine which are used again after final decommissioning in view of demolition.

BIESSE S.p.A. Woodworking Machinery


(a112h002.fm-210300)

D-1

Appendix D.
Decommissioning - Demolition

D-2

BIESSE S.p.A.

Woodworking Machinery
(a112h002.fm-210300)

Appendix E.

$SSHQGL[(

(

*XDUDQWHHDQGFOLHQWVHUYLFLQJ

&RQGLWLRQVRIWKHJXDUDQWHH

BIESSE S.p.a. guarantees that the machine was tested at its own premises and that a positive
result was obtained.
The guarantee shall remain valid for a period of 6 months starting from the date of delivery unless
there is an agreement between BIESSE S.p.a. and the purchaser to define the commissioning of
the machine at the latters premises. When, however, it is agreed between both parties that
commissioning shall be performed at the purchasers premises, the guarantee shall be valid for a
period of 6 months starting from the date of commissioning of the machine at the purchasers
premises and, in any case, for a period of no longer than 9 months following the date of delivery.
Working hours over 48 hrs./week shall result in corresponding reductions in the period of validity of
this guarantee.
BIESSE S.p.a. shall be also considered liable for defects in electric and electronic parts of the
machine. The guarantee shall not cover defects caused by normal wear and consumption of those
parts which, by their very nature, are subject to rapid and continuous consumption e.g. gaskets,
belts, brushes, fuses etc. The guarantee for replaced or repaired components shall expire on the
same as expiry of the guarantee of the machine itself.
Furthermore BIESSE S.p.a. shall not be liable for any lack of conformity of the machine deriving
from a failure to observe regulations indicated in the instructions manuals and in any case due to
inappropriate use or treatment of the machine. The purchaser may thus demand that any parts
found to be faulty be replaced provided that such faults are not attributed to mis-handling and, in
the case of modification, provided that BIESSE S.p.a. has issued prior written consent.
The purchaser shall lose any right to this guarantee if he or she does not provide BIESSE S.p.a.
with a detailed written account of the nature of any defects of conformity found in the machine
within 15 days following discovery of the fact. Moreover, the purchaser shall lose his or her right to
this guarantee if he or she does not allow the vendor to perform all checks required or if, the
vendor having requested the return of a faulty component at its own expense, the purchaser fails
to return the component as soon as possible after such a request.
The technical documents which accompany the machine are prepared with close reference to the
content of the corresponding Directives and current safety regulations. It is therefore of the utmost
importance that the user read completely all volumes of the same in order to obtain from the
machine the best possible performance and to ensure the maximum lifetime to its component
parts.
The configuration of some parts or devices described or illustrated in the documents may differ
from the configuration actually present in the machine in a specific version designed and prepared
for particular requirements or safety standards. In this case, certain descriptions, references or
advised procedure may be of a generic nature although their effectiveness shall remain valid. The
supply of tools or special equipment with the machine is conditioned by the specific characteristics
and safety regulations in force in each country. The drawings and photographs are supplied with

BIESSE S.p.A. Woodworking Machinery


(a113h001.fm-210300)

E-1

Appendix E.
Guarantee and client servicing

the sole aim of providing examples as a point of reference for a more complete understanding of
the text.
BIESSE products are constantly developed and updated and therefore the firm reserves the right
to modify functional or aesthetic characteristics of its machinery, to make variations in drawings of
any functional part or accessory or suspend production and supply without giving prior notice to
anyone and without incurring any obligation. BIESSE S.p.a. furthermore reserves the right to make
any structural or functional modification besides modifying the supply of spare parts and
accessories without any obligation on its part to inform anyone for any reason whatsoever of such
changes.

(

&OLHQWVHUYLFLQJ

BIESSE S.p.A. provides a service department for clients, based in Pesaro, ITALY, which also has
service workshops all over the world (BIESSE Authorised Service Centres).
The whole structure forms a highly efficient integrated network, which the client can contact for any
problem, information, advice or news.
The service department employs technicians with a high level of knowledge and experience on the
models manufactured, obtained through special training in our factory, who are able to service
machines on site.
The BIESSE Authorised Service Centres are listed in the introduction the machines Spare parts
catalogue.
For further information, please send a fax message to the BIESSE Service Department, at the
following number: (+39) - 0721 - 451820.

E-2

BIESSE S.p.A.

Woodworking Machinery
(a113h001.fm-210300)

Analytical Index

$QDO\WLFDO,QGH[

6-11

lubrication of boring head BH 43


position along axis Z B-5
technical information B-1
tool characteristics 4-1

&
$

central greasing system


topping-up lubricant

additional button pads


installation C-26

characteristics of the installation area

aggregate
aggregates available 1-18
fitting the tool 4-8
installation in the belt tool magazine 4-15
installation in the rack tool magazine
4-18
installation in the revolver tool magazine
4-12
aggregates
lubrication and cleaning

anchoring the machine to the ground C-9


dimensions of holes C-10
material provided C-13
position of holes for models L2 and L3
C-11
position of holes for models S2 and S3
C-12
solidification time C-13

%
base
blower

1-2
1-18

boring head 1-5


BH 43 1-17
fitting tools 4-5
lubrication and cleaning

BIESSE S.p.A. Woodworking Machinery


(5801a0103ix.fm-210300)

6-12

client service department

C-6

1-17
E-2

collet spindle 1-6


acceptable types of collet and shank
types of collet spindle 1-18
connection points on the machine

4-2

B-28

contact mats 1-8


fixing C-25

6-10

axes
axes X, Y and Z 3-2
axis C 3-3
axis Cr 3-3
maximum speed and acceleration

chip removal conveyor

6-15

B-2

control area

1-13

control panel

1-2

controls
auxiliary vacuum system selector 2-6
belt tool magazine button 2-7
control panel 2-4
direction selector 2-6
double movement stops selector 2-5
electrospindle button 2-7
emergency button 2-4, 2-6, 2-7
layout of controls 2-1
main switch 2-2
movement buttons 2-6
numerical control module 2-2
override 2-4, 2-7
pedals 2-6
PLC keyboard 2-3
portable supplementary button pad 2-7
select origin button 2-5
special clamps selector 2-5
start button 2-4
supplementary front button pads 2-5
supplementary rear button pad 2-6
tooling selector 2-5

Analytical Index

vacuum pump selector


copier

2-5

technical data B-1


tool characteristics 4-2
types of electrospindle 1-18

1-21

curtain guards 1-8


periodic control 6-1
repositioning the curtain guards

C-24

curved door and window frame machining kit


1-17
using the kit 5-6
cut off valve

1-8

'
danger area
demolition

emergency
deactivating the emergency devices 3-2
restarting the machine after an emergency
stop 5-4
stopping in an emergency 3-1
emergency cord

1-8

emergency stop

3-1

)
1-14

flooring in the installation area

D-1

device
for automatic tool orientation
position display 1-14
safety 1-8

C-8

FRL unit
draining condensation 6-4
topping-up with lubricant 6-14

1-18

dimensions
of boring tools 4-1
of circular blade tools 4-4
of milling tools 4-3
of parts to be transported C-1
of workable materials 1-10
working dimensions of machine

*
guarantee
guides
cleaning

E-1

6-6

B-28

+
(

humidity in the installation area

electrical cabinet 1-2


lifting C-14
weight C-14

electrospindle 1-5
aggregate 1-18
automatic tool orientation device
blower 1-18
checking tool lock 6-5
cleaning 6-8
copier 1-21
fitting the tool 4-10
heating 4-11
position along axis Z B-5

ii

identification plate

C-9

1-2

1-18

/
layout of the machine

B-28

levelling the machine

C-19

BIESSE S.p.A.

Woodworking Machinery
(5801a0103ix.fm-210300)

Analytical Index

milling unit 1-21


lubrication 6-10
position along axis Z
technical data B-1

lifting
the contact mats C-4
the machine C-2
the mesh guard C-4
the vacuum pump C-4

moving the machine


locking the piece 5-1
normal method 5-2
with auxiliary vacuum system
with clamp stops 5-2
lubricants

5-2

B-6

C-5

6-2

noise level

B-41

noise produced by the machine

numerical control 1-2


XNC numerical control module

machine model
identification of model (see identification
plate)
machine serial number (see identification
plate)
machining 1-11
pendular machining 5-3
pendular machining with suspension 5-3
restarting after a suspension 5-3
restarting after an emergency stop 5-4
restarting after an unexpected shutdown
5-5
starting 5-3
with the curved door and window frame
kit 5-6
machining operations possible
cutting 1-13
horizontal boring 1-12
inclined boring and milling 1-12
vertical and horizontal milling 1-12
vertical boring 1-11
main switch

B-41

2-2

maintenance operations

6-1

manufacturers address (see identification


plate)
maximum altitude of the installation area
mesh guard 1-8
assembly C-20

BIESSE S.p.A. Woodworking Machinery


(5801a0103ix.fm-210300)

C-9

2-2

2
operating section 1-2, 1-5
additional electrospindles 1-18
aggregate 1-18
assembling the main suction conveyor
C-24
automatic tool orientation device 1-18
blower 1-18
boring head 1-5
boring head BH 43 1-17
collet spindle 1-6
collet spindles available 1-18
copier 1-21
electrospindle 1-5
milling units 1-21
optionals available 1-17
position of blocking devices for transport
C-16
position of units along axes X - Y B-3
position of units along axis Z B-5
repositioning the cable-carrier chain
C-18
slot 1-5
suction information C-7
thickness tracer 1-21
working range B-6
optionals
for the operating section 1-17
for the tool magazine 1-22
for the work table 1-14

iii

Analytical Index

origin 3-4
machine 3-4
mirror 3-5
selecting 5-1
straight 3-5
work table 3-5

racks
lubrication and cleaning

override
on the numerical control
remote 2-7

2-4

safety

A-1

shutdown
restarting after an unexpected shutdown
5-5

3
pedals

6-6

2-6

slot

pendular (see machining)

1-5

solid work table 1-16


use of the solid work table

4-24

pincer-type spindles
fitting the tool 4-6
maintenance of type HSK 6-10
maintenance of type ISO 30 6-9

sound-proof casing

PLC keyboard 2-3


bar supports soft-key 2-3
chip conveyor soft-key 2-3
clamp stops soft-key 2-3
magazine cover soft-key 2-3
reset slot for tool change soft-key
reset slot soft-key 2-3
stop row soft-keys 2-3
test cones soft-key 2-3

stops
additional rows of stops 1-14
double movement 1-14
fitting clamps 4-22
for solid work table 1-16
positioning 4-21
row of stops 3-4
types of stop 1-3

pneumatic system
basic requirements

starting machining

2-4

C-7

pressure
periodic control 6-7
pressure gauge indicating compensation
pressure for axis Z 6-7
pressure gauge indicating copier
compensation pressure 6-7
pressure gauge indicating copier lowering
pressure 6-7
pressure gauge indicating horizontal
spindles pressure 6-7
pressure gauge indicating supply
pressure 6-7
vacuum pump pressure gauge 6-8
problems

iv

7-1

1-8
5-3

suction cup
additional suction cups 1-14
fitting the seal element on the shapeable
suction cup 4-22
for solid work table 1-16
periodic control of seal element 6-1
positioning the shapeable suction cup
4-21
shapeable 1-3
supplementary button pads
front 2-5
portable 2-7
rear 2-6
support
assembling the chain supports
ball 1-15
bar 1-3
chain 1-8

BIESSE S.p.A.

C-23

Woodworking Machinery
(5801a0103ix.fm-210300)

Analytical Index

fixed 1-3
mobile 1-3

C-16
rack 1-22
repositioning the belt tool magazine during
installation C-18
restarting after a power cut 5-5
restarting the machine after an emergency
stop 5-4
revolver 1-7
technical data B-1
tool limits for the belt tool magazine 4-17
tool limits for the revolver tool magazine
4-14

suspending machining
within a program 5-3
suspension
during pendular machining
switching the machine off

3-1

switching the machine on

3-1

5-3

systems
adjusting pressure in the pneumatic
system C-28
connecting up the electrical system C-27
connecting up the pneumatic system
C-28
connecting up the suction system C-29
electrical system requirements C-6
suction system requirements C-7

tools
boring 4-1
circular blade
milling 4-2

9
vacuum indicator

7
temperature in the installation area
thickness tracer

C-9

1-21

tool magazine 1-2


belt 1-7
cleaning the belt tool magazine 6-5
compatibility of tools in the belt tool
magazine 4-16
compatibility of tools in the revolver tool
magazine 4-12
installation of the aggregate in the belt tool
magazine 4-15
installation of the aggregate in the rack tool
magazine 4-18
installation of the aggregate in the revolver
tool magazine 4-12
installation of the tool in the rack tool
magazine 4-17
installation of tools in the belt tool
magazine 4-15
installation of tools in the revolver tool
magazine 4-11
lubrication of the belt tool magazine 6-7
optionals available 1-22
position of blocking devices for transport

BIESSE S.p.A. Woodworking Machinery


(5801a0103ix.fm-210300)

4-4

2-4

vacuum pump 1-2


cleaning 6-6
installation C-27
pressure gauge indicating pressure
replacing blades 6-13
replacing dust separator 6-13

6-8

:
weight

C-1

what the machine is designed to do

1-10

work table 1-2


additional rows of stops 1-14
additional suction cups 1-14
arrangement of parts on the larger work
table 1-15
ball support 1-15
bar support 1-3
chip removal conveyor 1-17
clamp 1-3
curved door and window frame machining
kit 1-17
double movement stop 1-14
electronic position display device 1-14
fitting clamps on the stops 4-22

Analytical Index

fitting the seal element on the shapeable


suction cup 4-22
fixed support 1-3
larger 1-15
mobile support 1-3
optionals available 1-14
position of parts 1-3
positioning the mobile support 4-20
positioning the shapeable suction cup
4-21
positioning the stops 4-21
preparation 4-20
shapeable suction cup work table
stops 1-3
solid 1-16
stop for solid work table 1-16
suction cup for solid work table 1-16
use of the electronic position display
device 4-23
workable materials 1-10
dimensions 1-10
workable panel (see workable materials)
working area

vi

3-3

BIESSE S.p.A.

Woodworking Machinery
(5801a0103ix.fm-210300)

BIESSE

S.p.A.

WOODWORKING
MACHINERY

Via Toscana, 75
61100 Pesaro ITALIA
Tel. (+39) - (0)721 - 4391
Fax Sales (+39) - (0)721 - 453248
E-Mail: sales@biesse.it
WEB Site: http://www.biesse.it

481/96