Carvell Consulting HQ

2207 Concord Pike # 708

Wilmington, DE 19803
Tel: +1 302-351-5955
Fax: +1 302-351-5956
UAE +971 566957624

Introduction Letter

For

Iraq Ministries of Interior and Defense

AUTHORIZED NEGOTIATOR: Carvell Consulting

Mr. Rodney C. Mayse
AUTHORIZED NEGOTIATOR: SAM: 079253764
Chief Executive Officer (CEO) Cage Code: 7LFN4
Mr. Rodney
HQ C. Mayse
Tel: +1 302-351-5955 Iraq License: 4878
Chief Executive Officer (CEO)
US Mobile: +1 256-282-7189 UAE License: MC-11694
HQ Tel: +1 302-351-5955
UAE Mobile: +971 566957624
US Mobile:
Fax: +1 256-282-7189
+1 302-351-5956 Address:
UAE Mobile: +971 566957624
RMayse@Carvell-Consulting.com 407 Dink Moore Dr.
Fax: +1 302-351-5956 Piedmont, AL 36272
RMayse@Carvell-Consulting.com

MANAGEMENT, CONSULTING AND SUPPLY SERVICES

This proposal or quotation includes data that shall not be disclosed outside the Government and shall not be duplicated, used, or disclosed--in whole or in
part--for any purpose other than to evaluate this proposal or quotation. If, however, a contract is awarded to this offeror or quoter as a result of--or in
connection with--the submission of this data, the Government shall have the right to duplicate, use, or disclose the data to the extent provided in the
resulting contract. This restriction does not limit the Government's right to use information contained in this data if it is obtained from another source
without restriction. The data subject to this restriction are contained in sheets [insert numbers or other identification of sheets]

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or
quotation.
02/17/2017 Introduction Letter Page i
 Carvell Consulting HQ
2207 Concord Pike # 708
Wilmington, DE 19803
Tel: +1 302-351-5955
Fax: +1 302-351-5956
UAE +971 566957624

February 17, 2017

To Whom It May Concern

Subject: Introduction Letter Carvell Consulting

Greetings:

Carvell Consulting, (CC) is pleased to submit the enclosed Capabilities Statement for
the Iraqi Ministry of Interior and Defense. This Capabilities Statement is in regards to
the supply of various Weapons Systems and Equipment.

We wish to present our company to support you in supplying of various equipment that
the Ministries may need in the field of defense services.

We are established and specializing in security and defense services and supply. Our
network of local, (Dijlah & Furat) and International (Wells Fargo, USA and Emirates
NBD, UAE), Banks are willing to support our operations and awarded Tenders.

Our Headquarters, located in Delaware, USA, with Branch Offices in Alabama, USA,
Baghdad, Iraq, Abu Dhabi, UAE, and soon to open offices in Manila, Philippines, and
Kabul, Afghanistan. As a distinguished supply and service company, we have the
ability to supply the below products from various American, European, and Asian
manufacturers:

1. Light Arms (5.56, 7.62, and .50 Cal)

2. Riot Gear
3. Ammunitions Systems
4. Drones
5. Weapons Maintenance
6. Training Services
We appreciate your consideration of this Capabilities Statement for a favorable
outcome. Should you have any questions, please do not hesitate to contact me.

Sincerely,

Rodney C. Mayse
CEO
Carvell Consulting

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or
quotation.
02/17/2017 Introduction Letter Page ii
 

0$1$*(0(17&2168/7,1*$1'6833/<6(59,&(6

MODEL 82A1

MODEL 95

8VHRUGLVFORVXUHRIGDWDFRQWDLQHGRQWKLVVKHHWLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDORUTXRWDWLRQ
7  3DJH
MODEL 82A1
After 30-plus years of making history, the powerhouse rifle that started it all is still
leading the pack. With its low felt recoil and self-loading action, the Model 82A1 offers
rapid, accurate firepower that never slows down. 4

3 5
2
1

12
13

11
F E AT U R E S
1. Front and rear sling loops 6. Accepts side accessory rails 10. Combat ready extractor and ejector

2. Steel receivers with durable parkerized finish 7. 20 (50.8 cm) or 29 (73.66 cm)* match grade 11. 10-round steel magazine (Available with non
(Cerakote Tan available*) fluted barrel detachable magazine for regulated states)

3. Flip up iron sites 8. Chrome line chamber and bore 12. Rear hand grip accepts adjustable monopod

4. 18 (45.72 cm) 27 MOA rail accepts carrying handle 9. High efficiency iconic arrowhead 2-port brake for 13. Ultra absorbent Sorbothane recoil pad
.50 BMG and cylindrical 3-port brake* for .416
5. Semi automatic recoil operated Barrett
 6
9
7 8

10

COMES WITH
10-round steel magazine

Carrying handle

Quick detach adjustable bipod

Pelican case with custom insert

Operators manual *Shown with Cerakote Tan finish in .416 Barrett and 29 fluted barrel
MODEL 82A1
Three Decades Down Range S p ecificatio n s
For more than three decades, the Model 82A1 has Model:
been carefully honed, studied and then refined again. 82A1
The result is a feat of engineering so infinitely precise
it is hard to believe its man-made.
Calibers:
As the first and only semi-automatic .50 caliber .50 BMG
rifle available, the Model 82A1 continues to blaze .416 Barrett
new territory. Its chamber is chrome-plated
and dimensioned for both civilian and military Operation:
ammunition. The extractor and ejector are proven Semi-Automatic
to work under any condition, and close tolerances on
every part allow it to function in all environments. Barrel Lengths:
The muzzle brake, dual barrel springs and long .50 BMG
mainspring design make this iconic rifle comfortable 20 (50.8 cm)
and exciting to shoot. 29 (73.7 cm)
.416 Barrett
The .416 Barrett caliber brings new levels of precision Optimizing recoil reduction, the Model 82A1 features a caliber
29 (73.7 cm)
shooting to the Model 82A1. With the enhanced specific muzzle brake. All .50 BMG configurations feature the
accuracy and increased velocity of the .416 Barrett iconic 2-port brake and .416 Barrett configurations are fitted
Barrel Twist Rate:
cartridge, this rifle offers incredible long-range with a cylindrical 3-port brake.
precision. The Model 82A1 .416 is also available with 1 turn in 12 (30.5 cm) for .416 Barrett
a non-detachable magazine for state compliance 1 turn in 15 (38.1 cm) for .50 BMG
purposes in which the magazine can easily be
accessed for loading with a simple tool. For owners Overall Length:
that want to swap their .50 caliber configurations to 48 (121.9 cm)
.416 caliber, upper conversion units are available on 57 (145 cm)
the Barrett web site.
Rail Length/MOA:
The Model 82A1 fits into a regular sized carrying case. 18 (45.72 cm) 27 MOA
Although its transported as a disassembled upper
and lower receiver, it can be ready to fire in under a Weight:
minute. The scope remains mounted on the upper 31.45 lbs (14 kg)
receiver, maintaining zero. The rifles M1913 optics 32.71 lbs (14.8 kg)
rail has a 27 MOA taper to take full advantage of the
scopes elevation travel. Magazine Capacity:
Back up iron sights provided. Nerves of steel are not. 10 Rounds

Parts, accessories and more found at barrett.net

 Model 82A1

Model 82A1 .416 Barrett

Perfection isnt accomplished overnight. Nowhere is this more
apparent than in the Model 82A1. For more than two decades, this
short-recoil, semi-automatic series rifle has been carefully honed,
studied and then refined again. The result is a feat of engineering
so impossibly precise, its hard to believe its man-made.
a significantly higher muzzle velocity, the .416 offers incredible
long-range precision.
The muzzle brake, dual barrel springs and long mainspring design
make the 82A1 comfortable and exciting to shoot.

Unlike other semi-automatic .50 BMG rifles, the Model 82A1 is
completely reliable. Its chamber is chrome-plated and dimensioned
for both civilian and military ammunition. The extractor and ejector
are proven to work under any condition, and close tolerances on
every part allow it to function in all environments.
The new .416 caliber alternative further adds to the allure of the
Model 82A1. With enhanced accuracy and stability, not to mention
The Model 82A1 fits into a regular sized carrying case. Although its
transported as a disassembled upper and lower receiver, it can be
ready to fire in under a minute by simply inserting two assembly
pins through both receivers. The scope remains mounted on the
upper receiver, maintaining scope zero. The rifles M1913 optics rail is
tapered 27 MOA to take full advantage of the scopes elevation travel.
Emergency iron sights provided. Nerves of steel are not.

S pe c ifi c ations

Model: Model 82A1 and M82A1 CQ Rifle Weight: 30.9 lbs (14 kg) or 29.7 lbs (13.5 kg)
Caliber: .416 Barrett or .50 BMG Safety: Manual Thumb Lever
Rifle Operation: Semi-Automatic Sights: Flip-Up Iron Sights
Overall Length: 57 (145 cm) or 48 (122 cm) Optics Rail: 18.125 (46.03 cm)
Barrel Length: 29 (73.7 cm) or 20 (50.8 cm) Magazine: 10-Round Capacity
Rifling Twist: 1 in 12 (.416 Barrett) or 1 in 15 (.50 BMG) MSRP Starting at: $9,345.00

Configurations

Part No.
Model 82A1 .416 Barrett Rifle System: 29 chrome-lined barrel, Pelican case, one 10-round magazine, carry
* M82A1 416-SYS handle, flip-up iron sights, M1913 optics rail, detachable adjustable bipod legs, sling attach points, cleaning kit
and owners manual.
Model 82A1 .416 Barrett Rifle System, Non-Detachable Magazine: 29 barrel, Pelican case, one 10-round
* 12353 magazine, carry handle, flip-up iron sights, M1913 optics rail, detachable adjustable bipod legs, sling attach
points, cleaning kit and owners manual.
Model 82A1 .50 BMG Rifle System: 29 barrel, Pelican case, one 10-round magazine, carry handle, flip-up
M82A1-SYS iron sights, M1913 optics rail, detachable adjustable bipod legs, sling attach points, cleaning kit
and owners manual.
Model 82A1 .50 BMG Rifle System: 29 barrel, Leupold Mark 4 4.5-14x50, ZERO-GAP Ultra High rings, Pelican
M82A1-K1 case, one 10-round magazine, carry handle, flip-up iron sights, M1913 optics rail, detachable adjustable bipod
legs, monopod, sling attach points, cleaning kit and owners manual.
Model 82A1 .50 BMG Rifle System: 20 barrel, Pelican case, one 10-round magazine, carry handle, flip-up iron
M82A1CQ-SYS
sights, M1913 optics rail, detachable adjustable bipod legs, sling attach points, cleaning kit and owners manual.

* New product for 2010

 barrett.net

ITEM NO. DESCRIPTION QTY. ITEM NO. DESCRIPTION QTY.

100 101 1 Lower Receiver Complete 1 61 Upper Receiver Complete 1

102

M82A1 - .50 BMG

2 Trigger 1 62 Front Sight 1
103 104
105 3 Disconnector 1 63 Front Sight Spring 1
4 Trigger Spring 1 64 Front Sight Catch 1
106
77 5 Disconnector Spring 1 65 Front Sight Catch Pin 1
62 6 Trigger Housing Pin 1 66 Front Sight Pin 1
73
75 80 79 7 Transfer Bar Pin 1 67 Rear Sight Base Detent 1
63
78
74 66 8 Safety 1 68 Rear Sight Spring 1
64
76 65 9 Transfer Bar 1 69 Windage Knob 1
67 113 86 2X
83 4X 10 Transfer Bar Detent 1 70 Windage Screw 1
68 85 11 Transfer Bar Spring 1 71 Windage Screw Spring 1
88 12 Safety Detent 1 72 Windage Knob Pin 1
69 2X
13 Safety Spring 1 73 Rear Sight Body 1
72 82 99
84 87 14 Pistol Grip Screw 1 74 Rear Sight Apeture 1
15 Pistol Grip Stock Washer 1 75 Rear Sight Scale 1
81
71 16 Pistol Grip 1 76 Rear Sight Scale Screw 1
61 58 54 51 17 Recoil Pad Screw 2 77 Elevation Screw 1
70
2X 108 18 Recoil Pad 1 78 Elevation Screw Ball 1
19 Bipod Shim Bushing 2 79 Elevation Screw Spring 1
107 83 52 20 Yoke Mount Washer 2 80 Elevation Screw Pin 1
9X
53 21 Yoke mount Nut 2 81 Barrel Key 1
55
22 Bipod Yoke 1 82 Barrel Spring Assembly 2
50 23 Bipod Leg Complete 2 83 Barrel Spring Screw 4
117
118
.50 BMG Barrel Assembly
30 45 24 Bipod Screw 2 84 1
119 (Includes Bolt - 82101, #50)
33 32
46 25 Bipod Detent 2 85 Muzzle Brake 1
49 31 44
2X 43
2X 26 Bipod Spring 2 86 Muzzle Brake Screw 2
36 35 21
114 27 Bipod Pin 2 87 Battery Bumper 1
29 28 Rear Lock Pin 2 88 Impact, Barrel Bumper 1
20 2X 29 Main Spring Buffer 1 89 Magazine 1
39
49 3X 34 30 Bolt Carrier 1 90 Magazine Follower 1
38
56 3 47 1 31 Accelerator Spring 1 91 Mag. Floor Plate 1
5
4 48
32 Accelerator Spring Screw 1 92 Magazine Spring 1
6
7 41 33 Cam / Ejector Pin 2 93 Monopod Elevation Screw 1
37 2X
11 42 34 Cam Pin Assembly 1 94 Elevation Collar 1
10 40 116
57 35 Accelerator 1 95 Monopod Foot Washer 1
2
36 Accelerator Rod 1 96 Monopod Foot 1
109 2X 9
37 Sear Spring 1 97 Monopod Foot Screw 1
112
28 38 Sear Housing 1 98 Monopod Lock Knob 1
19 2X 39 Sear 1 99 Muzzle Brake Shim Kit 1
59 2X
40 Sear Lever 1 100 Carrying Handle Complete 1
58 24
60 41 Sear Pin 1 101 Scope Ring Bolt 1
2X
8 12 42 Sear Lever Pin 1 102 Carrying Handle Pin 1
27
2X 17 13 2X
43 Firing Pin Extension 1 103 Carrying Handle Mount 1
110 22
44 Firing Pin Pin 2 104 Carrying Handle Clamp 1
45 Firing Pin 1 105 Scope Ring Washer 1
98 25
26 46 Firing Pin Extension Spring 1 106 Carrying Handle Nut 1
2X
18 16 2X
47 Cocking Lever 1 107 Scope Base Screw 9
23
111
89 2X 48 Cocking Lever Spring 1 108 Muzzle Brake Screw Washer 2

93 28 49 Bolt Carrier Pin 3 109 Left Rear Hand Grip 1

15 115
2X 50 Bolt 1 110 Right Rear Hand Grip 1

14 51 Ejector 1 111 Rear Hand Grip Screw 2

90 52 Extractor 1 112 Rear Hand Grip Nut 2
94 53 Extractor Plunger 1 113 Scope Base Complete 1
54 Ejector Spring 1 114 Bolt Spring 1
(Optional) Bipod leg Complete,
55 Extractor Spring 1 115 2
95 Spike
91
56 Main Spring 1 116 Mount, Bipod Yoke 2
96
57 Midlock Pin 1 117 Latch, Bolt 1
97 92 58 Mag. Catch 1 118 Spring, Latch, Bolt 1
59 Magazine Catch Pin 1 Pin, Latch, Bolt 1
60 Magazine Catch Spring 1

1/2016
MODEL 95 TM

The Model 95 may weigh in at a smaller class, but packed into its lightweight bullpup
design is the intense power of a .50 caliber magazine-fed weapon, the pinpoint accuracy
of a bolt-action rifle and the effortless functionality of a perfectly designed machine.
5
4
2
1 3

9
8
10
F E AT U R E S
1. Compact, lightweight bullpup design 5. 11.25 (29.85 cm) 27 MOA M1913 rail 9. Accepts rear adjustable monopod

2. Simplistic bolt carrier assembly with quick release 6. Chrome-chambered 29 (73.6 cm) steel fluted 10. Ultra absorbent Sorbothane recoil pad
lever barrel

3. Ergonomic bolt handle design 7. 3-port high efficiency fanned muzzle brake

4. Durable parkerized finish 8. 5-round steel magazine

 7
6

COMES WITH
Quick detach adjustable bipod

Pelican case with custom insert

Operators Manual

5- round steel magazine

MODEL 95 TM

Fully loaded. S P EC I F I C AT I O N S
This compact rifle offers the velocity and accuracy Model:
of a 29-inch barrel in a lightweight package with an 95
overall length of just 45 inches. The Model 95 is made
for those who refuse to sacrifice accuracy for power
Calibers:
while allowing the shooter to quickly and accurately
.50 BMG
fire five rounds, reload with a fresh magazine and get
back on target in seconds.
Operation:
Its buttplate, magazine well and trigger housing are Bolt Action
unitized, helping to stiffen the steel lower receiver.
The steel upper receiver is reinforced with an M1913 Barrel Lengths/Types:
Designed specifically for the bolt-action power of a .50 caliber
rail and supports the chrome-chambered, fluted 29 Fluted (73.6 cm)
rifle, the Model 95 high efficiency 3-port fanned muzzle brake
barrel. All Barrett rifles are designed for easy field
tames recoil.
stripping, so the two receivers can be assembled in Barrel Twist Rate:
less than 60 seconds without the use of tools. 1 turn in 15 (38.1 cm)
The bolt carrier itself is a study in innovation Overall Length:
designed for speed, reliability and safety. It slides
45 (114.3 cm)
effortlessly on machined-smooth rails, transporting
a large bolt that locks into the barrel extension on
Rail Length/MOA:
three lugs. This bolt carrier assembly is a simplistic
design with a quick release lever for fast disassembly. 11.75 (29.85 cm ) 27 MOA
The firing pin is driven by dual springs designed for
consistency and lightning-quick lock time. Weight:
23.5 lbs (10.7 kg)
Adopted by militaries all over the world, the Model 95
is not just proven in battle, its also fun to shoot. This bolt carrier assembly is a simplistic design with Magazine Capacity:
a quick release lever for fast disassembly. 5 Rounds

Muzzle break adapter available for QDL suppressor.

Parts, accessories and more found at barrett.net

 barrett.net
PART NO. DESCRIPTION QTY.
1 Rear Lock Pin 2
2 Upper Receiver 1
3 Barrel Extension Screw 2
4 Elevated Scope Base 1

Model 95 3
6
5

7
Scope Base Screw
Barrel Screw
Barrel Screw
8
2
2
4 8 DP .125 x .4375 1
2 9 Cocking Piece 1
24 25 10 Firing Pin 1
1
11 Bolt Carrier 1
12 RP .093 x .375 1
7 5 13 Bolt Pin Lever 1
6 14 Firing Spring 2
15 Bolt Pin 1
16 Cam Pin Pin 2
17 Bolt 1
19 18 Ejector Spring 1
18 26 27 19 Ejector 1
12 13 16 17
14 20 Extractor Spring 1
23
21 Extractor Plunger 1
10
8 22 Extractor 1
35 36 23 Barrel Complete 1
34 38
22 63
24 Barrel Lock Nut 1
20 21 25 Muzzle Brake Shim 1
26 Muzzle Brake 1
37 27 Muzzle Brake Screw 1
15 33
11 64 28 Recoil Pad Screw 2
1 29 Recoil Pad 1
9 39
32 16 30 Lower Receiver 1
30 31 Safety 1
29 31 32 Sear Spring 1
33 Sear 1
34 Trigger Spring 1
41 65 35 Trigger 1
40 36 Trigger Overtravel Screw 1
49 37 Front Lock Pin 1
42
28 38 Yoke Mount Nut 2
50 66 39 Yoke Mount Washer 2
48 43
40 Yoke Mount 2
41 Bipod Shim Bushing 2
44
54 51 42 Bipod Screw 2
57 47
43 Bipod Spring 2
55 45
44 Bipod Detent 2
45 Bipod Pin 2
56 52
46 Bipod Leg Complete 2
46 47 Bipod Yoke 1
58
53 48 Trigger Housing Pin 2
49 Safety Detent 1
50 Safety Spring 1
51 Pistol Grip 1
52 Pistol Grip Stock Washer 1
59 53 Pistol Grip Screw 1
54 Magazine Catch Pin 1
55 Magazine Catch 1
56 Magazine Catch Spring 1
57 Monopod Lock Knob 1
60
58 Monopod Elevation Screw 1
61 59 Elevation Collar 1
60 Monopod Foot Washer 1
61 Monopod Foot 1
62
62 Monopod Screw 1
63 Magazine Complete 1
64 Magazine Floor Plate 1
65 Magazine Follower 1
66 Magazine Spring 1

1/2016
 MANAGEMENT, CONSULTING AND SUPPLY SERVICES

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 1
 Classification: Semi-automatic pistol, M1911

Operating System
- Recoil operated, closed breech, single action
Trigger / Action
- Fires one round each time the single action trigger is squeezed and the hammer is
cocked by the action of the slide.
Cartridge/s
- .45 ACP, .40 S&W and 9mm, Super .38
Barrel Type/s
- Standard with barrel bushing, no ramp, AISI-416 stainless steel
- Bull barrel, no bushing, with ramp, AISI-416 stainless steel
Barrel Length
- 5 inches
Rifling & Grooves
- 1 x 16 twist rate, 6 grooves
Velocity
- Approximately 825 ft/sec (230 grains FMJ)
Energy
-483 J (356 ftlb)
Maximum Effective Range (MER)
- 100 yards depending on wind and drift, 5-inch barrel
Weight (as pictured, magazine empty)
- Approximately 1.2 kg
Length (as pictured)
- 8.25 inches (5-inch barrel)
Height (as pictured)
- 5.25 inches (excluding magazine base pad)
Feed System
- 8+1 rounds, detachable single stack magazine
Body Color / Finish (as pictured)
- Silver hard chrome

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 2
 Classification: Semi-automatic pistol, M1911

The UDMC 1911 Officer's Model Pistol in caliber .45 single stack with a 3.5-inch bull barrel, double action spring,
Laser Aim sights on the rubber grip, Bomar tritium rear sights, fiber optic front sights and an overall dark matte nickel
finish.

Operating System
- Recoil operated, closed breech, single action
Trigger / Action
- Fires one round each time the single action trigger is squeezed and the hammer is cocked by the action of the slide.
Cartridge/s
- .45 ACP, .40 S&W and 9mm, Super .38
Barrel Type/s
- Standard with barrel bushing, no ramp, AISI-416 stainless steel
- Bull barrel, no bushing, with ramp, AISI-416 stainless steel
Barrel Length
- 5 inches
Rifling & Grooves
- 1 x 16 twist rate, 6 grooves
Velocity
- Approximately 825 ft/sec (230 grains FMJ)
Energy
-483 J (356 ftlb)
Maximum Effective Range (MER)
- 100 yards depending on wind and drift, 5-inch barrel
Weight (as pictured, magazine empty)
- Approximately 1.2 kg
Length (as pictured)
- 8.25 inches (5-inch barrel)
Height (as pictured)
- 5.25 inches (excluding magazine base pad)
Feed System
- 8+1 rounds, detachable single stack magazine
Body Color / Finish (as pictured)
- Silver hard chrome

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 3
 Classification: Assault Rifle (F-series), Commercial Sporting Rifle (S-series)

United Defense Mfg Corps F5-PVAR, S5-PVAR, F5-DGIS and S5-DGIS rifles are variants of the M4 and comes in two
types: The F-series are the full automatic for military, police and law enforcement use, and the S-series are the semi-
automatic for commercial, civilian and security agency use. These rifles are chambered in the time-tested 5.56 x 45mm
NATO round and designed to hit point targets at 500 meters (MER). The F5 and S5 series take after the M4 and M16 battle
rifle designed by Eugene Stoner. They use two different action designs, the Direct Gas Impingement System (DGIS). The
DGIS is the simpler design between the two as it has less parts and uses the hot gases coming from the gas port of the barrel
and through a gas tube the hot gases are rammed into the bolt carrier group to cycle the round. On the other hand, the
Pneumatic Valve and Rod (PVAR) gas-piston or simply the patented PVAR system. The PVAR or Pneumatic Valve and
Rod System is a bare bones, no frills and very simple designed gas and piston operating system that utilizes a combination
of gas and mechanical energy for a more effective and reliable cycling of the weapon. The PVAR design prevents hot and
high-pressured gases from reaching the bolt assembly and the chamber. This results in a cleaner and reliable operation, as
well as minimal maintenance even in the most rugged environments such as jungles, deserts, snow and salt-water
conditions. This means reduced cleaning time and overall longer rifle life span. The PVARs simplified parts and
mechanism allows reduced recoil and reduced muzzle rise, which enables the firer to refocus instantly on the target for
each and every round fired! The DGIS uses a lightweight thermoplastic handguard and the PVAR uses a one-piece
handguard with a military standard 1913 Pica tinny top rail held securely only at the barrel extension which allows the
barrel to float and reduce barrel vibration while in battery. This allows for greater accuracy and consistency. As designed,
the barrel does not touch any part of the entire length of the handguard except at the barrel extension. The barrel comes in
different lengths: 7.5, 10.5, 11.5, 14.5 and 20 inches.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/15/2017 Page 4
 Classification: Assault Rifle (F-series), Commercial Sporting Rifle (S-series)

Designed
- 2009 for the PVAR series
Manufacturer
- United Defense Mfg Corp, Philippines
Operating System
- PVAR gas and piston, rotating bolt head, Letters of Patent Nos. 1-2009-000176 and 1-2011-000062,
Philippines or the DGIS, rotating bolt head, conventional direct gas impingement system
Bolt Carrier
- Monolithic one piece with a solid punch key for the PVAR and two piece with gas key for the DGIS
Cartridge
- 5.56 x 45mm (NATO)
Barrel Type
- Non-Glare, matte stainless steel bull barrel, AISI-416 Premium or the black parkerized 4140
ordnance grade.
Barrel Length
- 14.5 inches
Rifling & Grooves
- 1 x 7, 1 x 8 or 1 x 9 twist
Muzzle Velocity
- Approximately 3,100 ft/sec (M855)
Maximum Effective Range
- 500 meters (point target) and 600 meters (area target)
Accuracy
- Maximum 1.0 Minute of Angle (MOA) using a match grade ammunition at 100 meters, at bench rest.
Trigger
- Single stage, with option for two-stage for semi-auto precision use.
Flash Hider
- Choice of SHURIKEN flash hider (Letter of Patent No. 1-2013-000230, Philippines) or any type of
tactical compensator or flash hider.
Weight
- 4.5 kg to 5.5 kg depending on barrel length for the PVAR. 3.5 kg to 4.5 kg for the DGIS as it uses a
thermoplastic handguard.
Length
- Depends on buttstock and barrel length
Rate of Fire
- Full-automatic (F-series) and Semi-automatic (S-series)
Feed System
- 30-round detachable magazine
Body Color
- Anodized black

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
 Classification: Precision Rifle

The S7 rifle series take after the M110 battle rifle designed by Eugene Stoner. The S7 uses two action designs, the Direct Gas
Impingement System (DGIS) and the patented Pneumatic Valve and Rod System (PVAR). The DGIS has a simpler design between the
two as it has less parts and uses the hot gases coming from the gas port of the barrel and through a gas tube the hot gases are rammed
into the bolt carrier group to cycle the round. The PVAR or Pneumatic Valve and Rod System is a bare bones, no frills and very simple
designed gas and piston operating system that utilizes a combination of gas and mechanical energy for a more effective and reliable
cycling of the weapon. The PVAR design prevents hot and high-pressured gases from reaching the bolt assembly and the chamber. This
results in a cleaner and reliable operation, as well as minimal maintenance even in the most rugged environments such as jungles, deserts,
snow and salt-water conditions. This means reduced cleaning time and overall longer rifle life span. The S7-PVARs simplified parts
and mechanism allows reduced recoil and reduced muzzle rise, which enables the sniper to refocus instantly on the target for each and
every round fired! The PVAR uses a one-piece handguard with a military standard 1913 Pica tinny top rail held securely only at the
barrel extension which allows the barrel to float and preserve barrel harmonics while in battery. This allows for greater accuracy and
consistency. As designed, the barrel does not touch any part of the entire length of the handguard except at the barrel extension. For both
the DGIS and PVAR, the barrel comes in different lengths: 18, 20, 22, 24 and 25 inches. For special orders, UDMC can also produce the
M110-CSASS or the compact SASS with a retractable buttstock and sound suppressor with a barrel length of 14.5 inches. The non-
glare, matte finish of the stainless steel barrel is also an alternative to the standard chrome moly vanadium in black manganese finish.
The two-stage trigger is as crisp as it can be.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
 Classification: Precision Rifle

Designed:
- 2013 for the S7-PVAR
Manufacturer:
- United Defense Mfg Corp, Philippines
Operating System:
- PVAR gas and piston, rotating bolt head, Letters of Patent Nos. 1-2009-000176 and 1-2011-000062, Philippines or the DGIS,
conventional direct gas impingement system
Bolt Carrier:
- Monolithic one piece with a solid punch key for the PVAR and two piece with gas key for the DGIS
Cartridge:
- 7.62 x 51mm NATO
Barrel Type:
- Non-Glare, matte stainless steel bull barrel, AISI-416 Premium or the black parkerized 4150 ordnance grade.
Barrel Length:
- Choice of 14.5, 16, 18, 20, 22, 24 and 25 inches
Rifling:
- 1 x 12 twist or 1 x 10 twist
Muzzle Velocity:
- Approximately 2,600 ft/sec
Maximum Effective Range (20-inch barrel):
- 800 meters (point target) and 1,000 meters (area target)
Accuracy:
- Maximum 1.0 Minute of Angle (MOA) using a match grade ammunition at 100 meters, at bench rest.
Trigger:
- Two-stage match grade
Flash Hider:
- Choice of SHURIKEN flash hider (Letter of Patent No. 1-2013-000230, Philippines) or any type of tactical compensator.
Weight:
- Around 7.5 kg for the PVAR, inclusive of the floating Picatinny rail handguard, scope, bipod and a loaded 20-round
detachable box magazine. Weight will be less depending on barrel length and type of scope. 5.5 kg to 6.5 kg for the DGIS as it
uses a polymer handguard.
Length:
- 44 inches (22-inch barrel)
Rate of Fire:
- Semi-automatic or Bolt Action. (Note: However, when Made-to-Order, we can also produce the F7 battle rifle series which
is the full automatic version for use by the Spotter in tandem with the Sniper who uses the Semi-Automatic/ Bolt Action
version.)
Feed System:
- 10 or 20-round detachable magazine

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
 MANAGEMENT, CONSULTING AND SUPPLY SERVICES

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
FlexForce Riot Control Suit

The #FX-1 FlexForce Modular Hard Shell Crowd Control System is the ultimate high-threat level
riot control, domestic disturbance, and cell extraction suit. The FlexForce design provides
substantial protection from blunt force trauma without sacrificing the fit or comfort. The suit is
lightweight and ranks highest in easy to put on or take off in a moments notice. The front and back
hard shell panels have a modular flex design allowing for all shapes and sizes to fit comfortably with
out sacrificing much needed mobility. The forearm guard offers a much more comfortable elbow
portion of the pad, which allows more flexibility. The knee/shin guard has a non-slip surface, which
keeps you planted in position.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
 Upper Body and Shoulder Protection
Hard shell front and back panels feature a unique Damascus 3-panel flex design for optimum
movement, fit and comfort
3mm Electrum XK8 hard shell front and back panels
Modular front and back panels are steel riveted together with Cordura nylon connector straps
which attach by Velcro
Shock absorbing Protium foam with a Polyester mesh covers the chest, back, shoulder and upper
arm
Electrum XK8 plate with shock absorbing Protium foam covers both top of shoulder and upper
arm
Polyester mesh lines the inside of the upper body and shoulder portion which offers comfort and
breathability for long term wear
Reflective Name Plate ID labels can be attached to the front panel for identification (sold separately)
Adjustable Straps fasten with durable nylon elastic and Velcro

Thigh and Groin Protector

Hard Electrum XK8 outer shell on thigh and hip sections
Shock absorbing Protium foam with 150 denier Cordura nylon covers the entire outside
Polyester mesh lines the inside which offers comfort and breathability
Tailbone pad has an Electrum XK8 plastic plate laminated to the Protium foam
Groin section has an inner Electrum XK8 shell with a Protium foam padding and mesh cover
Adjustable Straps fasten with durable nylon elastic and Velcro

Knee and Shin Guards

Hard Electrum XK8 knee caps with super non-slip grip
Hard shell Electrum XK8 shin plates with dull Black finish to avoid reflection
Heavy-duty reinforced Protium foam padded nylon inner support
Inner support riveted to the shin plates for ultimate durability
Multiple adjustable nylon elastic and Velcro straps give a secure fit
Removable adjustable foot guards

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
 Sizing
Each piece of the suit fastens and adjusts quickly with durable nylon straps, Velcro and quick
connect clips which allows each individual a custom fit
Available in sizes MD, LG, XLG, XXLG, XXXLG

Measurements by chest size:

Medium: 38"-42" (96.5 107 cm)
Large: 42"-46" (107 117 cm)
X-Large: 46"-52" (117 132 cm)
XX-Large: 52"-56" (132 142 cm)
XXX-Large: 56"-60" (142 152 cm)

Gear Bag
Total Dimensions 24"L x 19"W x 15" H
Interior Dimensions - 24"L x 15"W x 15" H
Two Velcro storage compartments in the front of the bag
Sides of the bag have envelope pouches
Removable padded shoulder strap

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
 Extrication & Rescue Gloves w/ Hard Knuckles

Hipora waterproof barrier liner with breathable insulation

Extremely abrasion and tear resistant reinforced palm, knuckle and finger plates with Kevlar
Protective hard-shell knuckle guards and back of finger rubberized guards
Terry-cloth brow wipe on thumbs
Reflective finger tips and trim
Flex form fitting extrication / rescue gloves
Elastic wrist
Size range: Mens SM to XXLG
Colors and Style #s:
#D90X-B (Black)
#D90X-Y (Yellow)

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
 Knee & Elbow Protection

Created by Damascus Gear, leaders in full body protective gear for law enforcement, military,
etc. The most comfortable hybrid knee pad ever built specifically for Law Enforcement or Military use
just so happens to offer some serious impact protection. They have a unique hybrid construction
which combines high and low density materials to deliver maximum "cush", while the contoured
ergonomic shape offers superior knee pad support. Part of the DKX-1s secret is its GEL and GEL
foam center cores which contain two types of shock-absorbing gels bonded together to create
unsurpassed comfort. The GEL also absorbs body weight and disperses it within the pad. One size
fits all. Sold as pair. Available colors include: Black, OD Green
Heavy-duty, hard-shell composite cap which is truly NON-SLIP and plants you firmly on any surface.
The GEL cores and the unique caps then work together to produce the best possible knee zone
protection from blunt force trauma.
Perforated breathable neoprene coated with silicon at the tops of the pads hug the leg above the knee.
1000 denier nylon Cordura braces and protects the rest of the knee area.
Both straps feature silicone coated strips to prevent pads from slipping in motion, and reinforced rivets.
The ergonomic design of the DKX-1 as a unit conforms to the knees like no other and produces superb
mobility. The pads have been extensively designed specifically for law enforcement and military to
produce the highest level of durability and extended knee pad life.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
 SWAT Hoods & Sleeves

NOMEX: Created by Damascus Protective Gear, leaders in full body protective gear for law
enforcement, military, and beyond. This Damascus hood (also sometimes called balaclavas) was
designed to provide heat and flame protection and comfort to the head and neck in SWAT and other
tactical situations. It is made entirely 100% DuPont NOMEX, a fire retardant material that will not
sustain a flame. These properties have made NOMEX a requirement or standard in many industries
such as firefighting, motorsports and industrial safety. It is ideal for heat and flash protection when
deploying flash bangs.
3 ounce 100% Nomex
Approximately 18 (45cm)
Made in North America
Size: One size fits all
Black

Kevlar 2-Layer Sleeves

2-ply 100% Kevlar to resist blades and scratches
Can be worn under or over clothing
Thumb holes
Heat and flash resistant
Made in the USA
Sold in pairs
Size: SM/MD 16" length (40cm) OR LG/XLG 19" length (47.5cm)

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
 MANAGEMENT, CONSULTING AND SUPPLY SERVICES

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
 906 TAC-ELITE RIOT HELMET WITH CLEAR FACE SHIELD

Monadnock non-ballistic tactical helmets

offer the critical features and protection
required by response teams today. They
meet or exceed the NIJ 0104.02 (Riot) and
NIJ 0105.01 (Crash) standards. Quick
release buckle with high retention strap
system and soft, flexible chin cup Injection
molded neck protector with high density foam
padding for added comfort Weight:
Approximately 3.1 lbs.

CENTURION UPPER BODY & SHOULDER PROTECTION

The Centurion CPX2500 provides upper

body protection from blunt force trauma with
durable EVA foam. All padding is encased in
black polyester mesh rigging. Adjustable
hook and loop closure and fasteners. Color:
Black

PEACEKEEPER CLEAR RIOT SHIELD W/ CUSTOM-

MOLDED AMBIDEXTROUS HANDLE, 20" X 36"
The Peacekeeper 2036H riot shield is constructed of polycarbonate
and is durable and lightweight. Comfort molded handle.
Ambidextrous operation. Size: 20 in. x 36 in. Optional decals
available for POLICE (H7000), SHERIFF (H7001), CORRECTIONS
(H7002) and POLICIA (H7002).

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
 EXOTECH UPPER BODY & SHOULDER PROTECTION

The ExoTech Upper Body/Shoulder system offers a

3 mm polyethylene hard shell for protection from blunt
force trauma. EVA foam inner padding cushions the
body and soft brushed tricot and mesh lines the
inside. Each piece of the system fastens and adjusts
with durable connector straps with hook and loop
closure, allowing a custom fit for a wide variety of
body types. Reflective POLICE, SHERIFF or
CORRECTIONS labels are available and can be
affixed to the front of the system. Sizing is required.

Features:

Polyethylene outer shell

L2500 EVA foam & 3mm polyethylene plate chest/back/arm padding
EVA foam & polyethylene plate shoulder padding
Sponge foam & polyester tricot chest/back/shoulder lining
Mesh chest/back/shoulder outer covering
Mesh arm protector lining
Moisture-wicking fabric for comfort
Double riveted polypropylene connector straps and hook and loop fasteners
Commercial-grade elastic adjustment straps with hook and loop fasteners
Optional reflective POLICE, SHERIFF or CORRECTIONS labels are available and can
be affixed to the front of the system. See page 216 Sizes S, M, L, XL

906 TAC-ELITE RIOT HELMET WITH GRID FACE SHIELD

Monadnock non-ballistic polycarbonate tactical helmets

offer the critical features and protection required by
response teams today. They meet or exceed theNIJ
0104.02 (Riot) and NIJ 0105.01 (Crash) standards. Quick
release buckle with high retention strap system and soft,
flexible chin cup Injection molded neck protector with high
density foam padding for added comfort Weight:
Approximately 3.7 lbs.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
 EXOTECH ELBOW & FOREARM PROTECTOR
The EFP150 Elbow and Forearm Protector is designed to
work with the ExoTech System and features polyethylene
hard-shell protection against blunt force trauma. The interior
has EVA foam padding and polyurethane sponge padding for
comfort, and includes a mesh inner lining. The outer covering
is made of 420-denier nylon for durability and abrasion
resistance. It also features commercial-grade adjusters with
hook and loop fasteners. Available in three sizes: XS/S, M/L,
XL/XXL

RIOT SUIT CHEST PROTECTOR

The Centurion CPX2500 provides upper body

protection from blunt force trauma with durable EVA
foam. The shoulder pads feature hard-shell plastic
plates with durable foam padding and the
adjustable shoulder straps, waist straps and
contoured design offer a secure fit. All padding is
encased in black polyester mesh rigging. The
interior is coated with polyester brushed tricot for
comfort. Adjustable hook and loop closure and
fasteners. Color: Black

Features:

Torso protection consists of durable EVA foam with 7mm sponge foam on the interior for comfort
Shoulder pad features hard-shell plastic plates with durable foam padding
The neck roll consists of 40mm high-density sponge foam
All padding is encased in black polyester mesh rigging. The interior is coated with polyester brushed
tricot for comfort
Adjustable shoulder straps, waist straps and contoured design allow a secure fit comfortable enough
for long-term wear
Will safely absorb blows delivered from blunt objects, but does not provide ballistic protection
Adjustable hook and loop closures and fasteners
Weighs approximately 2 lbs. (.9kg) and packaged in a nylon drawstring bag for convenient storage
Optional reflective POLICE, SHERIFF, or CORRECTIONS labels are available and can be affixed to
the front or rear of the system (see above)
Dimensions: 8.625" L x 3 W x .125 D (21.9cm x 7.6cm x .3cm)
Sizes S, M, L, XL, XL

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
EXOTECH HARD-SHELL SHIN GUARDS
The TS70 EXOTECH Hard-Shell Shin Guards feature built-in
knee pads and an upper knee stabilizing strap with protective
padding. Three hook and loop elastic straps on the backside of the
leg provide a secure fit. Three sizes.

EXOTECH THIGH & GROIN PROTECTION

The ETP200 is a combination piece designed to protect the thigh
& groin. It has adjustable elastic straps with hook and loop
fasteners. The groin section features EVA foam padding with a
mesh outer covering and an inner polyethylene shell. Three sizes.

CENTURION THIGH & GROIN PROTECTION SYSTEM

The TPX200 Centurion Thigh/Groin Protection System

was designed for blunt trauma protection during riot control
situations. The groin protector is adjustable and removable.
The system provides excellent shock-absorbing protection,
and is flexible and comfortable. Four inch elastic straps with
hook and loop wrap around thigh for secure attachment, and
a web belt secures the system to the waist.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
 MANAGEMENT, CONSULTING AND SUPPLY SERVICES

SECPRO
Anti-Riot Gear

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
SECPRO POLICE RIOT GLOVES

DESCRIPTION:

Latest high-threat-level glove! Ideal for riot control,

domestic disturbances and cell extraction.
Advanced DuPont Kevlar technology for maximum
protection and defense. Deflect blows and debris with
ease wrist and knuckles are foam-injected for
additional protection. Made out of high quality leather,
reinforced palms, breathable liner, elasticized wrists,
and Velcro closures.

SECPRO NOMEX PROTECTION HOOD

DESCRIPTION:

This is a lightweight version hood. It provides moderate

amount of heat and flash protection to the head and
neck. The hood is made with three-ounce lightweight
100% NOMEX, which keeps the protected area cooler.

NOMEX fire retardant property have made it a

standard in many industries such as firefighting,
motorsports, and industrial safety. Ideal for use when
deploying flash bangs.
Length: 18 inches
Heat and flash protection
100% NOMEX material and thread
One size fits all

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
SECPRO POLICE RIOT HELMET

DESCRIPTION:

The SecPro Police Riot helmet is a lightweight and

super tough protective helmet for military and law
enforcement. Whether its crowd, riot, or
corrections control, the high density thermo
composite shell combined with the Lexan
polycarbonate face shield provides full head and
face protection against almost all non-ballistic
threats, such as chemicals, rocks, bottles and
other projectiles.

Moisture wicking felt liner system absorbs

heat for a cool, comfortable feel
Flip-up, polycarbonate, gasket-sealed face shield has clear optical grade finish
3/4" chin strap with quick release buckle and soft rubber chin cup
Removable neck protector
Accepts most gas masks
Shell edge is finished with a tough molded trim
Scratch-resistant flat black finish

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
SECPRO POLICE RIOT SHIN GUARD

DESCRIPTION:

The effective and reliable SecPro Police Ultimate Anti-Riot Shin Guard is easily deployed
and or removed for riot control, cell extractions or other tactical situations. The SecPro
Police Ultimate Anti-Riot Shin Guard provides substantial protection from blunt force
trauma.
The contour molded outer shell features impact ridges that disperse the brunt of the
blows, while foam inner padding cushions the body. Soft brush and mesh line the inside
to reduce abrasion and provide long-term comfort.
The hard shell protectors are used for covering and protecting the waist and groin areas.
They are designed to withstand hard blow, and prevent penetration or stabbing by sharp
tools, anti-fire and anti-acidity. SecPro Ultimate Anti-Riot Shin Guard is currently deployed
and passes the rigorous standards of our most elite law enforcement agencies, for quality,
operational flexibility, protection area, energy absorbency, and flame resistance
performance.
Simplicity is the important factor. Each piece of the SecPro Police Ultimate Anti-Riot Shin
Guard fastens and deploys quickly with durable nylon straps and Velcro closures,
allowing a custom fit for a wide variety of body types.

Features:
EVA foam knee padding
Black polyester outer covering
Tricot and sponge knee/foot protector inner lining
Polyethylene knee and foot protector outer shell
PVC knee cap
PVC padded suspension braces
Polyester adjusters with hook and loop fasteners
Moisture-wicking fabric allows maximum comfort
Padded ankle protector
Foot protector fully adjustable/removable
Components securely riveted to outside shell with hook & loop fasteners

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
SECPRO POLICE RIOT VEST - SHOULDERS - ARMS

DESCRIPTION:
The effective and consistently reliable SecPro Police Ultimate Anti-Riot Vest is easily
deployed and or removed for riot control, cell extractions or other tactical situations. The
SecPro Police Ultimate Anti-Riot Vest provides substantial protection from blunt force
trauma.
The contour molded outer shell features impact ridges that disperse the brunt of the
blows, while foam inner padding cushions the body. Soft brush and mesh line the inside
to reduce abrasion and provide long-term
comfort.
The hard shell protectors are used for
covering and protecting the shoulder and
arm areas. They are designed to withstand
hard blow, and prevent penetration or
stabbing by sharp tools, anti-fire and anti-
acidity. SecPro Ultimate Anti-Riot Vest is
currently deployed and passes the
rigorous standards of our most elite law
enforcement agencies, for quality,
operational flexibility, protection area,
energy absorbency, and flame resistance
performance.
Simplicity is the important factor. Each
piece of the SecPro Police Ultimate Anti-
Riot Vest fastens and deploys quickly with
durable nylon straps and Velcro closures,
allowing a custom fit for a wide variety of
body types.

Features:
Polyethlyene outer shell
L2500 EVA foam &3mm polyethlyene plate chest/back/arm padding
Sponge foam & polyester tricot chest/back/shoulder lining
Mesh chest/back/shoulder outer covering
Mesh arm protector lining
Moisture-wicking fabric for comfort
Double-riveted polypropylene connector straps with hook & loop fasteners
Commercial-grade elastic adjustment straps with hook and loop fasteners

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
SECPRO POLICE RIOT WAIST GROIN PROTECTION

DESCRIPTION:
The effective and consistently reliable SecPro Police Ultimate Anti-Riot Suit is easily deployed
and or removed for riot control, cell extractions or other tactical situations. The SecPro Police
Ultimate Anti-Riot Suit provides substantial protection from blunt force trauma.
The contour molded outer shell features impact ridges that disperse the brunt of the blows, while
foam inner padding cushions the body. Soft brush and mesh line the inside to reduce abrasion
and provide long-term comfort.
The hard shell protectors are used for covering and protecting the waist and groin areas. They
are designed to withstand hard blow, and prevent penetration or stabbing by sharp tools, anti-fire
and anti-acidity. SecPro Ultimate Anti-Riot Suit is currently deployed and passes the rigorous
standards of our most elite law enforcement agencies, for quality, operational flexibility, protection
area, energy absorbency, and flame resistance performance.
Simplicity is the important factor. Each piece of the SecPro Police Ultimate Anti-Riot Suit fastens
and deploys quickly with durable nylon straps and Velcro closures, allowing a custom fit for a wide
variety of body types.
IMPORTANCE OF RIOT GEAR Quality riot gear is essential in many tactical situations, such as
cell extractions, riot control and other domestic disturbance situations. In military settings, this
gear is often worn by military police as well. The tactical riot suit offers maximum protection for
the suit wearer, but is also designed to offer protection for contact persons as well, minimizing
severe injuries that occur in these tactical situations. It provides officer protection in urban
environments, using intimidation instead of excessive physical force. When this gear is used in
tactical situations, it is designed to offer protection while doing little physical damage to others.
Without the presence of quality riot gear like the SecPro Riot Gear System, tactical teams are
susceptible to blunt force trauma, serious blows and even injury from blades. A riot suit, ensuring
that blades are stopped and wearers are protected from blunt force trauma, offers full waist and
groin protection. The gear also helps to disperse the brunt of blows taken, offering further
protection from injury. Quality systems also include inner padding that keeps the body cushioned,
using lining materials that offer long term comfort while helping to reduce the risk of abrasions.
Features:
THIGH SECTION
Polyethlene outer shell
Laminated EVA foam & L2500 EVA foam
Mesh inner lining
Elastic adjuster with hook and loop fasteners

GROIN SECTION
EVA foam padding with mesh outer covering
Inner Polyethylene shell
Commercial-grade elastic adjusters and connectors

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
SECPRO STUN TECH ANTI-RIOT SHIELD

DESCRIPTION:

Our SecPro Stun Tech Anti-Riot Shield is a

non-lethal deterrent that's ideal for passive
crowd control and VIP protection and entry
shield.

Designed to quell a riot or a disturbance with

electric shock. Structured with shatter-
resistant clear poly-carbonate. Protection of
body safe and completely from the impact of
stones or stick and from the threat of acid or
incendiary liquid. Transparent poly-
carbonate sheet providing wide vision.

Features
High voltage, non-lethal, safe yet effective shock conducted via securely fitted
conductors all over the front area of the shield. Visible shock sparks act as an added
deterrent.
Lightweight, 4mm Thick polycarbonate shield.
Guard in full control with press button operation situated in molded handle as well as
on/off indication L.E.D.
Fully rechargeable including nickel-cadmium rechargeable battery with AC/ DC charger
as well as L.E.D indicators.
Optional multi charging stand that holds and charge up to five shields simultaneously.
Sealed detachable electronic housing for easy maintenance.
Fully warranted in accordance with the Force Manufacturers warranty.
Unlike with use of firearms or Batons, no permanent damage or use of unnecessary
force.
SABS tested shock and SABS Tested and Approved Armour.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
SECPRO CORRECTIONS RIOT SHIELD

DESCRIPTION:
Protect your vital areas with this strong, durable Lexan plastic Riot Shield.

Lexan plastic construction

Lightweight and easy to use
Solid aluminum handle with foam grip
Quick release strap system
Extra Foam padding to protect the forearm
36"H x 24"W x 1/8"D
Weighs 7.3 lbs

SECPRO POLICE RIOT SHIELD

DESCRIPTION:

Protect your vital areas with this strong, durable Lexan plastic Riot Shield.

Lexan plastic construction

Lightweight and easy to use

Solid aluminum handle

Quick release strap system

36"H x 24"W x 1/8"D

Weighs 7.2 lbs

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 8
 MANAGEMENT, CONSULTING AND SUPPLY SERVICES

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 1
2100 Series Pistol Loading Machine
The Camdex 2100 Series Loading Machine is speed adjustable to 4400 cycles per hour. The 2100
series will stop for and indicate on the touch screen control if any of ten faults have occurred. The
2100 Series features a total redesign of the control and monitoring system to enhance operator use
and make fault correction fast and easy.

The 2100 Series Loader can

produce ammunition in any
NATO or commercial handgun
caliber. Conversion packages
are available to allow the
machine to load more than one
caliber of ammunition. It is
shipped complete in one
caliber. As with all Camdex
products the 2100, Series
Loader is backed by a one-year
warranty on materials and
workmanship.

100 Series Standard Features

Our state of the art control

system monitors 10 functions
simultaneously to ensure that
the finished ammunition will be
of the highest quality. An
automatic 14-inch case feeder
and a 14-inch variable speed
bullet feeder are standard
equipment. The automatic
primer feed system is assisted
and monitored by an
Air/Vacuum system.

Monitoring Features

CASE LEVEL - Low case level in feed tube automatically shuts off machine.
CASE PROBE - Checks for case feeding, foreign particles and live rounds.
PRIMER POCKET PROBE - Mechanically checks the primer pocket for ringers.
PRIMER SLIDE - Shuts off the machine should a primer jam occur due to dirt or high
anvils.
PRIMER FEED - Shuts off machine should it run out of primers.
PRIMER LEVEL Fiber Optics automatically maintain approximately 60 primers in feed
system

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 2
 POWDER PROBE - Checks for both high and low powder charges.
BULLET FAULT - If the machine fails to feed or runs out of bullets, the machine shuts
off.
VACUUM SYSTEM - Checks vacuum pressure to assure primer feeding.
CURRENT SENSOR - Any increase in preset amperage shuts off the machine.

The Camdex 2100 Series

Loader has automatic
primer feeding to improve
production rates and
simplify the loading
process. Just put up to 400
primers in the bowl at one
time and the feeder will
supply the machine
automatically. The primer
feeder is controlled by a
fiber optic monitoring
system, which allows
approximately 60 primers
into the feed tube. When the
primer level falls below this
amount, the fiber optics will
turn the feeder on. When the
level has returned, the
primer feeder will shut off.
The feeder will also orient
the primer to feed with the
proper side up.

The priming system is also monitored by a vacuum system, which will shut the machine off

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 3
 should the machine run out of
primers. The vacuum system is
monitored by the Smart Panel,
which informs the operator of the
location of any of the monitored
faults.

The Camdex 2100 Series and the

Camdex 2200 Series Rifle Loader
both use the SmartPanel and make
the machines extremely user
friendly. The electric current is
120 volts/60 Hz (also available in
220v/50hz) with 24V DC control
circuitry to all external micro
switches. All of the controlled
functions of the machine are
easily monitored on the touch-
sensitive screen directing the
operator to the location of any
fault that occurs.

The 2100 Series control panel not

only monitors 10 machine
functions, it also provides easy
access to all of the feeder
controls. The vacuum pump is
controlled through the PLC by
way of the touch-sensitive screen
and the power and speed controls
for the case, primer and bullet
feeders are located on the face of
the panel.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 4
THE LOADING PROCESS

The Camdex 2100 Series

Loader has 11 stations in line. It
sequentially moves the case
from left to right. Each station
performs a process or
inspection for the succeeding
station, until the cycling of the
machine produces a finished
cartridge with each cycle. After
the case leaves the case entry
tube it moves to the first station
where the machine probes for a
case with nothing inside of it.
This starts the progression as
follows: size and deprime,
primer pocket probe to assure
the entire primer has been
removed from the primer
pocket, prime, powder drop,
powder probe (for over and
under charge) and case-mouth
bell, initial bullet seating,
finish-depth bullet seating and
final sizing, crimp and bullet
check. When the round exits the
machine, it is ready to fire.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 5
2300 Series Large Rifle Loading Machine
Large Rifle Caliber Loader for 300 WIN MAG to 50 BMG. Camdex PLC control panel with
variable speed motor. Automatic case and bullet feeders. Sequence of machine functions.
Automatic case and bullet feeders

Case Presence
Fiber Optic Primer Detection
Case Neck Rounding
Case neck OD size - carbide
Large Size Powder Canister
Powder drop accuracy +/-
0.15 grains
Adjustable belling
Powder probe
Automatic bullet feeding and
seating single drop
mechanism
Secondary bullet seating
Adjustable crimp
Bullet presence
Fiber Optic Cartridge
Counter at Exit

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 6
Case Sorting Machine

The Sorter is capable of separating all

sizing of range brass. Its six-foot-long
rollers allows for fine adjustment for
accurate sorting. The Sorter is capable of
sorting a five-gallon bucket in 18 minutes.
It is completely self-contained. Cases are
dumped into the .8 cubic foot hopper and
are automatically fed into the rotating
cylinders. They are at approximately a 15-
degree angle to the base.
Cases move along the roller path by the
rotation and angle of the unit. One roller is
in a fixed position and one roller can be
adjusted to vary the angle or opening
between the rollers.
The cases are sorted by diameter and fall
into plastic bins which direct the cases out
from both sides of the rollers to their
respective containers.
The hopper has a rheostat control to
regulate the feed rate. The rollers are a
fixed speed and have a separate on/off
control from the hopper feed unit.

Use or disclosure of data contained on this sheet is subject to the restriction on the title page of this proposal or quotation.
02/17/2017 Page 7
  0$1$*(0(17&2168/7,1*$1'6833/<6(59,&(6

UAV Helicopter Drones by

Homeland Surveillance &
Electronics LLC
8VHRUGLVFORVXUHRIGDWDFRQWDLQHGRQWKLVVKHHWLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDORUTXRWDWLRQ
7  3DJH
 UAV Helicopter Drones
HSE-UAV by Homeland Surveillance &
Electronics LLC

Law Enforcement, Military,Fire &

SWAT

Mr. Rodney C. Mayse Carvell Consulting

Chief Executive Officer (CEO)
Tel: +1 302-351-5955
Mobile: +1 256-282-7189
Fax: +1 302-351-5956
RMayse@Carvell-Consulting.com
SAM: 079253764
Cage Code: 7LFN4
Iraq License: 4878
UAE License: MC-11694
Address:
407 Dink Moore Dr.
Piedmont, AL 36272

MANAGEMENT, CONSULTING AND SUPPLY SERVICES

AGENDA

Overview
Airframes
AVENGER
RDASS
System Elements
Autopilot
Cameras
Communications
Forensic Overview
 Forensic - Equipment
Fully Mobility : All operations systems are integrated into Trooper Vehicles
including Helicopters, Video and Battery Equipment
Response Time : Ability to be In the Air in under 5 minutes
Ease : Quick Release Batteries, Cameras, and gimbals for all situations
Training : 5 Day Rapid Training, or 1 2 week safety and operation training

Property UHWP Property UHWP

3 | 2015 Confidential HSE-UAV - All Rights Reserved.

 Forensic PhotoGrammetry
Reconstruction : Mapping in CAD or 3D Visuals
Accuracy : Ability to generate mm level distances and measurements
Calibration : Ability to digitally render entire accident scene into CAD
drawings for admission into court or case files
Property UHWP

Property UHWP

4 | 2015 Confidential HSE-UAV - All Rights Reserved.

 Police - SWAT
Quiet: At 100 300 Ft minimal sight and sound recognition
Eyes On: Ability to zoom remotely and take HD Video or photos
Night and Infra-red Options: Ability to see and view FLIR with night vision
and custom payloads for SWAT uses

9 | 2015 Confidential HSE-UAV - All Rights Reserved.

 Police - Surveillance/Search
Rapid Deployment: Ability to launch in less than 5 minutes
Coverage Area: Search large areas quickly, HD Video with GPS
Eyes On: Ability to zoom with HD Video or photos of subjects in difficult
areas (Rooftops, License Plates, Buildings, Cars, etc.)
 HazMat Gas Pipelines
Leak Detection: Active video of Leaks (Carbon gases)
EPA : Ability to digitally document all valves, pipes and fittings. Ability to
lower costs and fines with ability to find leaks ahead of time
High Quality: 1080i and 15 20 Megapixel for HD resolution and zoom and
Infrared for specific Crop Analysis

11 | 2015 Confidential HSE-UAV - All Rights Reserved.

Contact Us

HSE-UAV

Homeland Surveillance & Electronics, LLC

 Forensic - Accident Reconstruction
Fast: Take 100+ pictures accurately in 5 10 minutes (Instead of ~45
mins)
Calibration: Ability to digitally render entire accident scene into CAD
drawings for admission into court or case files
High Quality: 15 20 Megapixel for HD resolution and zoom

5 | 2015 Confidential HSE-UAV - All Rights Reserved.

 Forensic - Accident Reconstruction
Save Lives: Reduce Officer exposure
Risk Reduction: Officers 40% more likely to be in secondary accident for
investigations on roadways for longer than 30 mins.
Court Approved: Admissible in court for hard evidence
Forensic - Accident Reconstruction

7 | 2015 Confidential HSE-UAV - All Rights Reserved.

 Forensic - Arson Reconstruction
Overhead Perspectives: Identify Burn Origins and cover large areas
Fast: Take 100 pictures accurately in 5 10 minutes (Instead of ~45 mins)
Calibration : Ability to digitally render entire accident scene into CAD
drawings for admission into court or case files
High Quality: 15 20 Megapixel for HD resolution and zoom

8 | 2015 Confidential HSE-UAV - All Rights Reserved.

 HSE-UAV
RDASS Law Enforcement, Fire & SWAT

Capabilities

RDASS HD (High Definition) RDASS HP (High Precision)

Flight Time 20 minutes (electric, longer for

hovering)*
Range 1+mi STD, 20+mi with RDASS HP &
Ground Station
Payload 1.75+lbs*

Cameras COTS Included Gyro Stabilized HD

GoPro 4k. Optional simultaneous stabilized FLIR
thermal, Sony A6000, or MicaSense RedEdge
Live Video Feed 12 HD Encrypted Ground
Video Station. Optional add stand-alone HDMI output
(single or dual), Ethernet, or Cellular Streaming.
Simple integration for Mobile Command
Industrial Avionics Industrial autopilot with
full-time GPS and encrypted communications.
Extensive safety features and optional Ground Station
for fully autonomous flights. RDASS HP: military-
grade, encrypted & anti-jamming GPS, Target
Tracking, 1-10cm accuracy, 500 corrections/second
Rapid Deploy 3 minutes

All Weather Extreme Weather Ready and rated

for wind up to 45mph & up to 12,000ft. MSL with no
loss of lift
Extremely Portable Yes, all-in-one
Pelican case, TSA approved
Dimensions 15 x 15
Weight 7lbs (dry)
Charge Time 20-40mins (field or office)

*Please Note: weather, payload and other variables will alter flight times; your flight times will vary
Ground Control Station Create, edit & save GPS flight
plans including auto-launch, headings, altitude, timed-hovers, no-fly-
zones & more. Switch between GS & handheld controller during flight
and incorporate additional map layers. RDASS HP: extreme Tough
Book and military-grade software with available Target Tracking.

Dual Thermal/Optical Custom 3D Stabilized

camera mount with High Resolution FLIR, and GoPro HERO 4k.
Switchable Live Video stream to the ground. Options for 9mm or
19mm zoom lenses, Standard or Pro. Integrated and Ready to Fly.

Stand-alone Video Output Additional HD and

encrypted Live Video Output for Mobile Command Vehicle, live
streaming or network system access. Custom enclosure with
antennas and all required connections. Options for single or dual
HDMI, Ethernet or Cellular Streaming Modem.

Navigation and Emergency LEDs Custom

integration with aviational high-intensity LEDs or separate Emergency
blue and red LED light bar. Long-range visibile, low power
consumption and fully integrated.

RDASS Package Pricing

RDASS HD Includes: RDASS HD Quadcopter, GoPro 4k on stabilized mount, 2x Flight
Batteries, RC Controller, 12 HD HiBright Display with tripod, Charger, All-in-one Tough Case
and Maintenance Kit.

RDASS HP Includes: RDASS HP mil-spec Quadcopter, GoPro 4k on stabilized mount,

2x Flight Batteries, RC Controller, mil-spec Ground Station, 12 HD HiBright Display with
tripod, Charger, All-in-one Tough Case and Maintenance Kit.
 













  0$1$*(0(17&2168/7,1*$1'6833/<6(59,&(6



8QPDQQHG$LUFUDIW6\VWHP
'521(

8VHRUGLVFORVXUHRIGDWDFRQWDLQHGRQWKLVVKHHWLVVXEMHFWWRWKHUHVWULFWLRQRQWKHWLWOHSDJHRIWKLVSURSRVDORUTXRWDWLRQ
7  3DJH
Unmanned Aircraft System

DRONE
Fixed Wing

Maximum Photogrammetric Accuracy

THAT CAPTURE ALL DATA IN CONTENT RICH DETAIL

A new standard in accuracy, robustness and performance for photogrammetric aerial mapping
allowing you to focus on important issues and make better, and faster decisions.

iiNteractive
t ti Monitoring
it i and
d Operation
O ti Center
C t | Universal
i l Visual
i l Communication | Unified Communication & Collaboration | Automation | CAAS | Professional Service

Our Value
Proposition
 High-performance UAS GNSS receiver with
P PK tec hn o logy
 36MP, full-frame, h ig h resol uti on
ca me ra
 Orthomosaics r es ol utio n do wn to 1
cm & 3D models with up to 1,000 pts/m2
 Survey quality accuracy w ith ou t g rou nd
co nt ro l
 Ful ly aut om at ed U A S A ccess
w orkf lo ws for ease of-use and safe
operation
 S im ple dat a proce ssi ng with UAS
Business Center photogrammetry module
 A dv an ced d ata p ro cessin g with
UASMaster
 Ideal for S urve yin g, C on struc tio n,
A gric ult ure, Min in g, D isa ster
Mo ni torin g a nd R el ie f,
Co ns erv ati on , En gi neering, Forestry
an d G ov ern m en t G eo gra ph ic
Ma ppin g

High Precision Mapping and Surveying Solution
Unmanned Aircraft System (UAS) is an easy to use, fully
automated, high precision system capable of capturing
aerial photography with resolutions down to 1 cm.
Featuring Aerial Imaging field software and Business
Center office software, this complete system provides an
intuitive workflow that allows you to quickly create the
highest quality orthomosaics and 3D models for
applications such as survey grade mapping, coastal areas
and power line monitoring, field leveling, site and route
planning, progress monitoring and asset mapping, and
disaster assessment.
Superior Image Acquisition and Accuracy
The UAS delivers precise data by integrating a high-
performance GNSS receiver and a superior camera. Post-
Processed Kinematic (PPK) GNSS technology is used to
establish very accurate image locations in absolute
coordinate systems, eliminating the need for ground
control. As a result, less time is spent in the field and high
precision results can be achieved even in the most
inaccessible areas. With PPK, georeferencing aerial data is
more robust and accurate providing a superior level of
reliability and accuracy. Use either your own base station
or work with data from reference stations to georeference
your deliverables with the highest accuracy possible.
The UAS features an industry-leading 36 MP full-frame
sensor camera capable of capturing sharp, high resolution
images. The camera achieves a leading level of image
resolutionorthomosaics down to 1 cm GSD and point
clouds up to several thousands points per square meter.
Configure for the Job
No one project is ever the same that is why you can
select a camera and lens combination that match your
project needs. You have the flexibility to choose
between a near infrared or RGB sensor system, and a
selection of lenses. The lenses include a 35 mm lens
for high accuracy, a 15 mm wide angle lens for
increased flight coverage or a 25 mm lens delivering
both accuracy and increased flight coverage.
Trusted Performance
The UAS is an extremely safe and durable system,
made from impact resistant foam, that can withstand
extreme temperatures, winds up to 55 km/h, and light
rainmaking it ideal for use in conditions that most
unmanned aircrafts struggle to operate in.
Intuitive Workflows with Trimble Access
The Aerial Imaging application loaded onto the UAS
Tablet Rugged controller operates the UAS system
and is a single software tool for planning your aerial
missions, performing pre-flight checks and monitoring
your flights. Now you can map corridors, cover
disconnected areas in a single flight, import multiple
map layers, fly irregular shaped areas and heights, plan
or change multiple takeoff and landing locations
during flight, and perform flight simulations to
confirm the plan. The export functionality gathers all
required data into a single file that can be imported
into UAS Business Center.
Valuable Photogrammetry Deliverables
Optimized to process data from the UAS, the Business
Center Photogrammetry Module creates impressive
deliverables. With a single drag- and-drop, imported
GNSS information, base station or reference station
data, and onboard images are processed in Business
Center to produce a scaled orthophoto, point clouds,
Triangulated Irregular Network (TIN) models and
contour maps of the area flown. These can then be
used in planning a project, calculating volumes,
excavation planning, drainage planning, disaster or
property damages and many other functions.
Alternatively, UASMaster provides the power user or
photogrammetrist with the right set of tools to use
the full potential of aerial data. With feature- based
seamline-finding, terrain editing capabilities, state-of-
the-art DTM generation, classification and filtering,
even the most challenging projects can be processed.
HARDWARE
Type Fixed Wing
Weight.2.9 kg (6.4 lb)
Wing Span ..1m(3.3ft)
Wing Area 34dm2
Dimensions ..100cmx65cmX10.5cm(39.4inx25.6inx4.1in)
Materials ..EPP foam; Carbon frame structure; Composite
elements
Propulsion Electric pusher propeller; brushless 1400 W
Battery 14.8V,6600mAh
Camera 36MP Mirrorless Full Frame
GNSS Receiver.. L1/L2 GNSS (GPS, Glonass, Beidou, Galileo)
Controller..UAS Tablet Rugged PC
Solution Applications
o Executive and Command o Surveillance of Coastal or Regions
o Emergency and Disaster o Forestry Manning
Preparedness o Monitoring Reserve Parks &
o Lives and Property Monitoring Protected Areas
o Evacuation and Relief Monitoring o Dam and Utility Grid Monitoring
o Determining the Effect of o Monitoring Illegal Mining Activity
Catastrophy o Border Surveillance
o Search and Rescue o Anti-Piracy Operations
o Surveillance and Monitoring o Geographical Mapping
o Tactical Operations o Multi-Function & Multi-Applications
o Mission Planning o Aerial HD Photography
o Field Operations & Investigations o Aerial HD Video Recording
o Intel Analysis

PERFORMANCE SPECIFICATIONS
Maximized image footprint without compromising
resolution, obtained with a custom wide-angle lens
and APSC-type sensor.
Maximized coverage per flight and per hour due to
large image footprint, sharp turning capability and
high cruise speed.
Reversed thrust technology for a short and steep
landing circuit.
Powerful propulsion system for steep climbs and high
altitude flights.
High airframe service life due to wing robustness and
maintainability.
Short setup time with automated procedures in UAS
Access field software.
Self-check and failsafe procedures for safe operation.
One-button export to UAS Business Center to create
deliverables.
Optimized data accuracy when processed with UAS
Business Center.
High Precision GNSS receiver to georeference
deliverables accurately and easily.
SOFTWARE
U AS Acces s Ae ria l Im agi ng appl icat ion
Project management
Mission planning with option for multiple flights
Automated pre-flight checks
Automatic takeoff, flight and landing
Autonomous camera triggering
Automated fail-safe routines
User controlled fail-safe commands
Automated data consistency checks
Export to UAS Business Center
OPERATION
Unmanned Aircraft System
Endurance,........................................................ 40minutes
Range....................................................................52km(32mi)
Cruise Speed.............................................. ..85kph(53mph)
Maximum Ceiling ......................................5000m(16,404ft)
Pre-Flight System Setup Time..............5minutes T ake off
Type ................................................Catapultlaunch
Angle........................................30 Degrees Landing
Type ................................................ .Bellylanding
Angle........................................................14 Degrees
Landing space (L x W)3
Typical..20 m x 6 m (66 ft x 20 ft)
Recommended..50 m x 30 m (164 ft x 98 ft)
Weather limit.55 km/h (34 mph) and Light Rain
Communication & Control Frequency...........2.4GHz(FHSS)
Communication & Control Range .........Up to 5km(3.10mi)
ACQUISITION PERFORMANCE
Resolution(GSD) ...........................1cmto25cm(0.4into9.9in)
Height above Take-off location (AGL).. 75 m to 750 m
(246 ft to 2,460 ft)
Absolute Accuracy XYZ(no ground control points).
Down to 25cm (0.8 2 in)
Relative Orthomosaic/3D Model Accuracy . (1-2x/1-5xGSD)
+
Technology Platform for Proactive
Monitoring and Control

+Asservio Philippines Inc.

For Solution Workshop and Presentation

iNteractive Monitoring Operation and Control Center | Universal Visual Communication | Unified Communication & Collaboration | Automation| CAAS | Professional Service
Unmanned Aircraft System

DRONE
Hover

Explore, Examine, Investigate

THAT CAPTURE ALL DATA IN CONTENT RICH DETAIL
A small vertical take-off and landing(VTOL) unmanned aircraft system that provide real-time airborne
situational awareness, scenarios and environments, an eye-in-the-sky in just minutes, allowing you to
focus on important issues and make better, and faster decisions on the fly.

iiNteractive
t ti Monitoring
it i and
d Operation
O ti Center
C t | Universal
i l Visual
i l Communication | Unified Communication & Collaboration | Automation | CAAS | Professional Service

Our Value
Proposition
 M an packable, compact folding design
 Setup in 60 seconds, a irborne in 2.5
minutes
 Flight Time 4 5 minutes Airborne
 Max of 3 Km coverage with long range
antenna
 Cruise Speed support up to 3 5mph
 Support for H D Pictures and 1080p
FHD Video recording
 AES 256 Encrypted digital Radio
 Whisper quiet, rugged, all-weather
capability
 Configurable F ailsafe behaviors
 Operation via H andcontroller and/or
f ull Virtual
 Cockpit GCS
 Hot-swappable payload options
 Industry-leading image stabilization
 Ideal for C oastal Monitoring,
Surveying, Construction,
Agriculture, Mining, Disaster and
Relie f Monitoring, Conservation,
Engineering, Forestry
Everything You Need for Aerial Data Capture
Multirotor is built to execute tough, everyday jobs quickly,
even in tight spaces. It requires no launcher, is easy to
assemble and includes everything you need to capture
high quality georeferenced photos for applications such as
aerial mapping, inspections and investigation.
Optionally, the system can be equipped to capture live
video imagery for inspection applications such as civil
infrastructure, forensic investigation, disaster effect and
affected areas, relief and evacuation operations, utilities-
maintenance operation, and oil & gas pipelines. Youll also
find it offers simple field-to-office workflows.
Work Fast | Get In and Out Quickly
Unmanned Aircraft System (VTOL) features an extended
hover and fast forward flight capability that provides
military, civil and commercial customers with aerial
reconnaissance in crowded areas unreachable by fixed-
wing unmanned aircraft systems. The VTOL payload
system features a quick disconnect adapter which allows
the operator to choose the appropriate payload for the
mission. There are payloads available for a variety of
different applications including: for applications such as
survey grade mapping, coastal areas and power line
monitoring, field leveling, site and route planning,
progress monitoring and asset mapping, and disaster
assessment, relief and evacuation monitoring, agricultural
and real estate.
Wireless Controller
The VTOL system includes a wireless hand controller,
which provides an easy-to-use interface for intuitive,
untethered vehicle operation. It can fly by remote control
or automatically using VTOLs GPS navigation software.
For full ground control station capabilities, the Virtual
Cockpit features a user-friendly mapping interface,
powerful mission planning tools, in-flight re-tasking and
full navigation available to any windows based computer.
Most Advance Platform
VTOL hover type drone is a professional quality,
powerful, easy to fly aerial platform specifically
designed for Public Safety use. The aircraft is reliable
because it's constructed using high quality carbon
fiber and injection molded components meaning that
when you need to fly, the aircraft will perform.
Incredible Aerial Photos & Video
The VTOL hover system delivers a high quality digital
video from a wide variety of cameras. When flying a
digital IP camera payload the system is delivering High
Definition(HD) live video providing razor sharp real-
time video. We can deliver this quality because the
camera gimble is gyro stabilized in the pitch and roll
axis, the camera is vibration isolated and the video
data is delivered through a dedicated digital
communications channel. This combination helps
keep the camera on target and provides highly detailed
results.
Just Grab and Go . . .
A good quality folding frame means you have a strong
aerial platform that you can easily pack into the back
seat or trunk of an automobile. The easier the aircraft
is to transport, the faster you can get from one job to
another. When packed in it's rugged transport
backpack case the complete helicopter system meets
airline baggage size requirements meaning it saves you
from those expensive over-size charges.
Durable and Safe
Constructed from high quality carbon fiber, the
strength to weight ratio of the aircraft is very high,
coupled with a strong folding frame helps reduce
damage in the event of a hard landing or hitting an
obstruction. Bottom line this level of quality protects
your investment.
Easy to Fly and Maintain
Because the VTOL hover system is designed and
manufactured in-house we control the quality, design,
software and systems integration delivering a hover
system that is inherently stable making this a dream
to fly. The onboard computer and sensors keep the
hover level in real-time and pointed in the right
direction so when you "park" the hover in the air using
the GPS position hold function you can shift your
attention to getting the photos you need. Even in a
GPS position hold you can reposition the aircraft,
continue shooting photos and meanwhile in real-time,
the telemetry data system is monitoring aircraft
battery health, heading, bearing, altitude and both
audibly and visually alerting you to any aircraft
warnings making this aircraft easy to fly and maintain.
Solution Applications
o Monitoring Intl Summit Meetings o Perimeter Surveillance
o Emergency and Disaster o Anti-Piracy Operations
Preparedness o Forestry Manning
o Lives and Property Monitoring o Monitoring Reserve Parks &
o Evacuation and Relief Monitoring Protected Areas
o Determining the Effect of o Traffic Monitoring
Catastrophy o Dam, River and Utility Grid
o Search and Rescue Monitoring
o Peace and Order o Real Estate
o Law Enforcement o Monitoring Illegal Mining Activity
o Field Operations & Investigations o Repair and Maintenance
o Forensic Examination | SOCO o Protecting Cultural Heritage
o Mission Planning o Multi-Function & Multi-Applications
o Intel Analysis o Aerial HD Photography
o Surveillance of Coastal Areas o Aerial HD Video Recording

FEATURES SPECIFICATIONS
Man packable, compact folding design
Setup in 60 seconds, airborne in 2.5 minutes
Whisper quiet, rugged, all-weather capability
Configurable Failsafe behaviors
Operation via handcontroller and/or full Virtual
Cockpit GCS
Hot-swappable payload options
Industry-leading image stabilization

CONTROLLER FEATURES
For small UAS; fixed wing and VTOL
Stand-alone, untethered operation
OPERATION
Analog or digital link options
E nd urance: 40 min (w/ 200g payload)
Supports synchronized metadata stream
Payload: Multiple, hot-swappable payloads
Onboard video recording and stills to SD card
R ange: 2km line-of-sight, 5km+ with external patch
Small ergonomic design with large outdoor
antennas
readable touchscreen
W eight : 4.85lbs (2,220g) with payload
Wi-Fi link to laptop and video dissemination
Dime nsions (LxWxH)::
Op en: 32x32x7 inches
Ruggedized and weather resistant
Fol ded: 12x9x6 inches Lightweight: 3.5 lb
Ope rating A ltitude : 10-500ft AGL (typical) Long run time (4 hours)
GCS touchscreen handcontroller or laptop-based
Virtual Cockpit
+
Technology Platform for Proactive
Monitoring and Control

+Asservio Philippines Inc.

For Solution Workshop and Presentation

iNteractive Monitoring Operation and Control Center | Universal Visual Communication | Unified Communication & Collaboration | Automation| CAAS | Professional Service