Sie sind auf Seite 1von 16

7+(2/'(67:((.

/<1(:63$3(5,17+(&$1$',$1:(67

7ULEXQH
7KH 0LQQHGRVD

6LQFH
Volume 134 Issue 07 Friday, April 28, 2017 www.minnedosatribune.com 90 cents plus tax

Town Budget Rotary Donates Zodiac


Proposed At Over
$5 Million To Fire Department
By DARRYL HOLYK

T he Town of Minnedosa has finalized its first


budget/financial plan since the order was made
to pay back a portion of taxes collected from Hus-
ky over the past few years. This scenario created a
major challenge for The Town as it reduced the tax
base. We not only have to contend with the pay-
ment we have to make back (to Husky) but we also
have to contend with the reduced tax money com-
ing in from them (Husky), stated Mayor Ray Orr.
The Towns balanced Financial Plan for 2017
comes in at just over $5 million and a proposed mu-
nicipal tax increase of approximately 1.9 percent.
Town Assistant Chief Administrative Officer, Chris
Yuen explained that had the assessment base and
school taxes stayed the same as last year, the overall
increase would have been just over half of one per-
cent. But, this years increase reflects a lower assess-
ment base and the school tax increase from Rolling
River School Division of close to six percent. The
overall increase, combined (municipal and school
taxes), is a proposed 3.27 percent increase from last
year, stated Yuen.
Just over $1.6 million has been budgeted for Members of Minnedosa Rotary Club
capital expenditures planned for 2017. $466,000 is
present a new Zodiac to members of
budgeted for paving projects along 6th Ave. N.W.
and 4th Street S.W. with $440,000 budgeted for up- the Minnedosa Fire Department.
grades to the sewer lagoon. Some other big ticket
expenditure for this year include $200,000 for re-
placement of the Towns loader, $150,000 for the Photo by Hillary Campbell
expansion of the Fire Hall, $130,000 towards the
Primary Care Centre (new clinic) and $100,000 for By HILLARY CAMPBELL tary Club. The Rotary Club the zodiac, and our emer- tion to viewing the zodiac,
arena repairs. Smaller expenditures coming in at has recently gifted the Fire gency suit, said Fire Chief Jordan also offered to take
less than $100,000 each include such things as re-
mediation of the former Public Works site on Armit-
age Ave, demolition of the white display building
O n Thursday, April
20th, the Minnedosa
Fire Department served
Department with a new
Zodiac.
The scent of pulled
Dean Jordan, we certainly
appreciate the support.
Each of the two items
Rotary members in smaller
groups through the hall to
see the other equipment,
at the former fairgrounds, water main and service a delicious meal for their pork filled the fire hall, that were donated were such as the trucks used in
line replacements and the construction of a coverall friends at the Minnedosa and showed the effort and on display in the fire hall, emergencies.
type sand shed for the Public Works Department. Rotary Club. The reason gratitude of the fire depart- giving Rotary Club mem-
for the generosity was ment. We just wanted to bers the opportunity to Continued on
Continued on Page 3 the generosity they were say thanks to Rotary for see what their fundraising Page 5
shown initially by the Ro- donating money towards efforts achieved. In addi-

X W ,Q ) U RQW
Book This Space For

6WD QG  2 Your Next Ad


&RQWDFW7KH7ULEXQH

DGVDOHV#PLQQHGRVDWULEXQHFRP
2 Friday, April 28, 2017 The Minnedosa Tribune

Heritage Village AGM Latest Happenings


tion to visitors from across
Canada and throughout
held for the museum last
year its annual Heritage
With New Clinic
the United States, other vis- Day celebration in Au-
By HILLARY CAMPBELL hardworking committee
itors who signed the guest gust, a fall flea market in
members are hoping there
book were from Africa, Ice- September and Heritage
land and the Netherlands.
The village also hosted a
Memory Lights during the
holiday season at years
I t has been some time
since there has been
news regarding the new
will be some who consider
donating a second time.
For anyone who is so in-
number of group tours, one end.
Dr. Ajai Khandelwal Pri- clined, the group has an
wedding and was again Looking forward to
mary Care Centre. No, account set up with RBC
a popular spot for family, the coming year, the Mu-
progress has not halted, Dominion Securities, so
graduation and wedding seum and Heritage Village
although the committee anyone wishing to donate
photo shoots. currently has three large
members for the project in the form of shares can
In addition to one-time school tours Grades 1 to 4
have noted that donations do so. They have had par-
admission fees for tours, from Brandon booked for
have begun to subside. ticipation in this option
the museum board intro- June and a visit by mem-
The financial goal for already.
duced season passes last bers of Basswood W.I. Two
the project is $2.2 million, The committee is
year. Individual passes sold summer students have
and currently the project anxious to break ground
for $25 with Family passes been hired for staff and
Photo by Darryl Holyk is sitting at $1,659,000. on the project, especially
at $30 and allowed the card the Heritage Village will be
Gordon Goldsborough shares interesting stories Of this amount, $810,000 since all of the ground-
holder to tour the museum open daily 10 a.m. to 4 p.m.
has been donated by the work aside from fundrais-
about abandoned places in Manitoba. building at their own lei- during July and August as
towns and municipalities ing has been completed.
sure, whenever they want- well as through the Labour
in the surrounding area, They have an estimated
ed throughout the regular Day long weekend. Plan-
By DARRYL HOLYK Minnedosa District Mu- in a combination of the cost for the project, which,
open summer season. Due ning is underway for Heri-
seum and Heritage Village R.M. of Minto-Odanah, coupled with a mortgage
to the success of the pass- tage Day which will be held
the R.M. of Harrison Park, at the right time will hope-
A bout 20 people gath-
ered at the 50+ Centre
on the evening of Thurs-
Corp.
2016 was a successful
year for the local museum
es last year, the board will
continue this practice for
the coming year.
on August 20th with a focus
of more hands-on demon-
strations and exhibits to
the R.M. of Oakview, and
the Town of Minnedosa.
fully allow them to break
ground in the next two or
day, April 20th for the An- with over 600 visitors to Further to this, three months. The hope is
Three major success- make it more attractive for
nual General Meeting of Heritage Village. In addi- $578,000 has been do- that if construction starts
ful fundraising events were families to attend.
nated by businesses, clubs mid-summer, then the
Following the business
and organizations, and building will be enclosed
portion of the AGM, those
$271,000 has been do- for winter construction.
in attendance enjoyed a
nated by private and per- However, the group
presentation titled Mani-
sonal donors. This leaves is hoping that the wan-
tobas Abandoned Past by
$540,873 to be raised be- ing donations will begin
keynote speaker, Gordon
fore they meet their bud- to pick up. They are also
Goldsborough. Gordon is a
get goal. currently awaiting a re-
regular on CBC Radio One,
However, with the tax quest that has been sent
a professor, member of the
season closing out, many to Manitoba Health. The
Manitoba Historical Society
people have closed their provincial health depart-
and author. He had copies
chequebooks for the year, ment has contributed to
of his recent book, Aban-
waiting until year-end other, similar projects
doned Manitoba available
before making another in the province, and the
for purchase at the meet-
financial donation. Tax- committee hopes that
ing and indicated he is cur-
wise for donations, there they will not be left out of
rently working on research
was a big push in Novem- that consideration.
for his fourth book. His pre-
ber and December for The group also
sentation revolved around
the year-end for a lot of stressed that just because
a six-year project through
people, so at this time its the shovels are in the
the Manitoba Historical
not a prime concern for a ground, it does not mean
Society to map over 6,000
lot of people in regards to that they have all of the
historic places throughout
charitable donation sta- finances they need, as op-
the province, many of them
tus, noted John Mendri- erating with a mortgage
now abandoned, and what
kis, committee member isnt going to be sustain-
each of them reveals about
for the new Primary Care able forever.
changes in our communi-
Centre. TL Penner, out of
ties and province.
However, we are in Virden, has been hired as
a new tax year, and the the project manager, and
will act on behalf of the
committee to conduct all
legal work on the con-
struction side of things,
getting committee ap-
proval as needed.
Mayor Ray Orr noted
that this project was near
and dear to our former
chairmans (Wayne Cur-
"Helping you honour your rah) heart, he was cer-
tainly a promoter of this.
loved ones since 1905" The project will benefit the
We Pay the Taxes community in so many
ways, and with communi-
Sale on now until April 30th. ty assistance, it will hope-
fully be underway soon.

204-476-2903 
The Minnedosa Tribune Friday, April 28, 2017 3

$40,000 To Canadian Foodgrains Bank From Local Crop


By HILLARY CAMPBELL gave a report on the 2016 Winnipeg then took the
year. The group grew cano- floor, and spoke on behalf

M innedosas chap-
ter of Canadian
Foodgrains Bank held its
la in various locations.
They farm just shy of 120
acres, and sowed Omega
of CFGB. He noted that
there are over 200 proj-
ects similar to the one in
Annual Meeting on Sun- Nine canola, which is Minnedosa that are across
day, April 23rd. The event heart healthy. The canola Canada.
was held at the Minnedo- seed was donated by Dow After Balouns speech,
sa Community Confer- Agro Sciences, for which Ryan Martens and his
ence Centre, which held the Grain Growing Project cousin Jill Martens came
many a charitable person group is very thankful. He up to speak about their
that night. noted that Michael King- trip to Rwanda, where
After the delicious don sowed the canola last they were able to go on a
pork dinner, the meet- June, and they combined food tour, seeing the ben-
ing portion of the eve- it on November 9th. efits to the Grain Growing
ning began. The emcee Galbraith also cited projects. The two youths
for the event was Barry other donors to the proj- are both farmers in the
McNabb. To kick off the ect, which were Clark Boissevain area, and are
evening, a representative McNabb Custom Spray- involved in Boissevains
from the Minnedosa Col- ing, CPS Basswood, Heri- Grain Growing project.
Photo by Hillary Campbell
legiate CHANGE group, tage Co-op, MASC, Mo- Th ey showed pictures
Levi Gregorash, spoke on saic Fertilizer, Richardson from their trip, which in-
(L-R) Michael Kingdon, Tammy Sillen, Ray Dyck, John Mendrikis,
the merits of the CHANGE Pioneer, Parrish and cluded photos of some of
group. We are sort of like Heimbecker, and Redfern the beneficiaries and how Mark Donohoe, Glenn Friesen, Neil Galbraith and Barry McNabb.
Rotary, a Rotary for high Farm Services. He expects they have benefited from

Town Financial Plan


school students, said that these donors will be the project. They also
Gregorash. providing the same ser- highlighted some of the
He then gave a sum- vices and materials again key differences between
mary of what the group this year. our two worlds, and the
accomplished over the Off of the field, Gal- diffi culties that are often
past year. This included braith said they sold ap- faced by the people in Continued from Page 1 every new project pro- the Town has provided
monthly bake sales, Kiva proximately $50,000 need of assistance in other posed for this year is being an example. A residential
(an online lending plat- worth of canola. Of this countries. $20,000 has been fi nanced from reserves. property with a portioned
form), a family carnival amount, after expenses The Canadian pencilled in for upgrades In addition to the general assessment of $104,000 is
(still to come), and a sock were paid, they were able Foodgrains Bank provides to the Towns Emergency reserve, Minnedosa has expected to see its taxes
drive for homeless people to donate $40,000 to the assistance in forty coun- Alert System (warning si- specific reserves for equip- increase from $2,928 last
where they collected 36 Canadian Foodgrains tries across the world. ren) with $15,000 set aside ment, the arena, the hall, year to $3,044 this year.
pairs of socks. Bank. He also noted that Their help comes in three for the purchase of ad- the fi re department, the Th e 2017 Financial
Following this, he does not recall a year in diff erent ways, food as- ditional Christmas light community complex (curl- Plan is available for review
McNabb introduced the the projects history where sistance, agriculture and decorations for main side ing rink), water utility and at the Town office. A pub-
rest of the Grain Growing they were able to raise as livelihoods and nutrition. streets to follow the theme a reserve for gas tax fund- lic hearing to present this
Project committee. The much money as they did Over the last year, they of the new lights along ing. years budget will be held
vice-chair for the commit- this year. have budgeted more than Main Street. $15,000 has For ratepayers won- in Council Chambers at
tee is Raymond Dyck, the Th is year, the group $43 million, and provided also been budgeted for dering what this years 5:30 p.m. on Tuesday, May
secretary is Gord Kingdon, will sow a wheat crop. We assistance to over one repairs to the Minnedosa increase will mean for 9th.
the treasurer is John Men- are just waiting for mother million people. The dedi- Community Conference their own property taxes,
drikis, the farm manager nature to warm up, said cated group in Minnedosa Centre.
is Neil Galbraith, Tammy Galbraith. has helped with these The Mayor and ACAO
Sillen, Mark Donohoe and Ray Baloun, board amounts, and make our indicated that every year,
Glenn Friesen. member for the Cana- community proud. they put a good amount
Neil Galbraith then dian Foodgrains Bank in of money into the Towns
various reserves and that

([SUHVVLYH'DQFHZLWK&U\VWDOSUHVHQWV
$VWRU\OLQHZKLFKIHDWXUHVGDQFLQJ DFWLQJ 38%/,&127,&(
:ULWHU'LUHFWRU&KRUHRJUDSKHUDQG,QVWUXFWRUr&U\VWDO6FRWW 5HJDUGLQJWKH)LQDQFLDO3ODQ
6LGHVKRZ&LUFXV 38%/,& 127,&( LV KHUHE\ JLYHQ SXUVXDQW WR
6XEVHFWLRQ    RI 7KH 0XQLFLSDO $FW WKDW WKH
Watch Out! An accidental spill in the Mad Scientists &RXQFLORIWKH7RZQRI0LQQHGRVDLQWHQGVWRSUHVHQW
lab has caused a growth altering reaction. LWV)LQDQFLDO3ODQIRUWKH\HDUDWDSXEOLFKHDULQJ

Minnedosa Minor Hockey


Can Mabel and the animal puppets find WR EH KHOG LQ WKH 7RZQ &RXQFLO &KDPEHUV ORFDWHG LQ
a soultion to their dilemma?
WKH0LQQHGRVD&LYLF&HQWUH0DLQ6WUHHW6RXWKRQ
7XHVGD\0D\DWSP&RXQFLOZLOOKHDU
28th Annual Dance Shows
Spring Registration 2016-2017
DQ\SHUVRQZKRZLVKHVWRPDNHDUHSUHVHQWDWLRQDVN
TXHVWLRQVRUUHJLVWHUDQREMHFWLRQWRWKH)LQDQFLDO3ODQ
May 1 - June 30 Friday, May 12th at 7:00 p.m. DVSURYLGHG

Save money and complete your childs Saturday, May 13th at 1:00 p.m. &RSLHV RI WKH )LQDQFLDO 3ODQ DUH DYDLODEOH IRU UHYLHZ
DQG PD\ EH H[DPLQHG E\ DQ\ SHUVRQ GXULQJ UHJXODU
at the Strathclair Bend Th eatre
hockey registration now! RIFHKRXUVRIWKH7RZQ2IFHORFDWHGDVQRWHGDERYH
LQ WKH 0LQQHGRVD &LYLF &HQWUH DW  0DLQ 6WUHHW
Purchase tickets in advance:
Friday, April 28th 6RXWK0LQQHGRVD
8:00 a.m. 6:00 p.m.
Details available starting May 1 at: Saturday, April 29th 9:00 a.m. 12 noon
'DWHGWKLVVWGD\RI0DUFK$'
Main Floor and Balcony $10.00 .HQ*-HQNLQV
minnedosaminorhockey.com Come buy reserved seat tickets at Crystals Dance Studio in Minnedosa
(102 3rd Ave NW) or call 204-867-2446 (starting at 1:00 p.m. on April 28th).
&KLHI$GPLQLVWUDWLYH2IFHU
Tickets might be available at the door, but dont wait til its too late!
7KH7RZQRI0LQQHGRVD

4 Friday, April 28, 2017 The Minnedosa Tribune

V DARRYL A.HOLYK - PUBLISHER AND EDITOR

Around Letters to the Editor


Town...
Dear Editor, Dear Friends: unteers have devoted many hours
The executive and board mem- of volunteer time to upgrade and

A letter was sent out to the area


residents of the Franklin area
to encourage attendance at the
bers of the Franklin Memorial Hall
wish to invite all area residents to
attend a general meeting to discuss
maintain the building and grounds.
It is our wish that more community
citizens would step up to continue
By Darryl Holyk meeting on April 10, 2017. It served the past and future of the hall. We the effort for future generations and
its purpose and went very well. feel that the community should be especially for the remembrance of
The following is here for you to be- more informed about the activities the soldiers who gave their lives for

National Anthem Test come aware of whatwe, as a group,


have and hope to achieve. We are
and fi nances concerning the hall.
In the past 20 years many projects
our freedom
If you are unable to attend the
While compiling this weeks Ye Old Trib I noticed a charitable organization which al- have been completed and many meeting, please record your con-
an interesting piece that still rings true today. 50 years lows us to issue tax receipts. more need to be done in order to cerns and opinions and drop them
ago, for Canadas Centennial, a Calgary high school maintain the necessary standards off at the (Franklin) Post Office.
teacher asked his pupils to write out the correct words Signed, of the building. Grants, donations Signature not required.
to our national anthem. Here are some of the incor- and fund raising activities have
rect responses, True pastirate lone in all our sons Beryl Parrott kept the books running smoothly. Sincerely,
command, With crawling hearts we see the rise Franklin, MB The clientele who frequent the hall
and Our true nor strong and free. I wonder, today, as constantly remark on the quality of Franklin Memorial Hall
we prepare to celebrate Canadas 150th birthday, how Excerpts from the letter, dated the facility and the uniqueness of a Association Inc.
many students or even adults could correctly write March 13th, that was sent out to memorial hall of historic value in Box 17
out the words to O Canada? Can you? area residents: our area. Franklin, MB R0J 0S0
Our present board and vol-
Sports Dinner
A few weeks ago we announced Dennis Hull as
one of the guest speakers at Octobers 20th annual
Sports Dinner. Former local figure skating champion,
Diane Hextall (nee Ogibowski), has been added as
Around the Region
a keynote speaker. Funding grants totalling $9,132
from the 2016 Sports Dinner were recently presented
Boissevain Recorder Manitoba Hydro has an- Melita New Era The 22nd Annual CCA/MRCA Ap-
to eight local applicants. Recipients included Rivers
nounced that it will be closing 12 district offices in proved Pierson Indoor Rodeo was held April 15th and
Edge, Kayak Club, Rodeo, the Personal Care Home
southern Manitoba in May. Boissevain is on that list. 16th. The rodeo opened with 3D MBRA Sanctioned Bar-
Patio Project, Sharks Rugby, Minnedosa Bowl, Erick-
The offi ces three employees, two gas field workers and rels Friday morning and concluded with the High School
son 4-H Beef and Tanners Crossing School Parent
one administrative representative will be working out of rodeo on Sunday. The Arena was packed through the ro-
Advisory Council.
the Killarney office. deo weekend.

Week of the ECE Carberry News-Express Council approved re-zon- Deloraine Times And Star Keith and Lisa Vanbese-
The week of April 23rd to 29th has been desig- ing to allow for the development of two multi-family laere won $20,000 in the Bayer Pay it Forward Contest, for
nated Week of the Early Childhood Educator (ECE) in residential units and a small park and playground south growing InVigor hybrid canola for 20 years. They paid it
Manitoba. Before kindergarten, children learn from of the existing eight-plex units. A nearby property was forward and donated their $20,000 prize to the Deloraine
ECEs, Child Care Assistants or licensed family child also re-zoned to allow for future commercial develop- Cancer Care Unit in honour of family members who have
care providers. ECEs are not just a babysitter, they ment. battled or lost their fight with cancer.
provide warm, caring, interactive care and learning
opportunities for youngsters pre-kindergarten. Their Souris Plaindealer The $9 million hotel and apart- Dauphin Herald Parkland Campus of Assiniboine
expertise, dedication and loyalty to children and their ment complex, currently under construction, is expect- Community College is now the permanent home of the
families help mold young children and prepare them ed to be completed in October. The building will feature Practical Nursing program.
for their future. Hats off to all of our ECEs and thank a 30-room hotel and as many as 18 apartments for se-
you for the care and education you provide to young niors. The apartments will be completed fi rst followed Roblin Review Some 104 members of the Catalyst
children in our communities! by the hotel accommodations. Currently, six apartment Credit Union gathered for the AGM. The year included
contracts have been signed with another eight possible the closure of the Pine River branch but also a merger
tenants who are very interested. with Rorketon which resulted in an additional $18 mil-
lion in assets and 1,000 new members.

The Minnedosa Tribune Ltd. The Minnedosa Tribune is independently owned and is the
oldest weekly newspaper in the Canadian West and has
Th e Minnedosa Tribune Ltd. does
guarantee the publication of all submitted articles and
not

published continuously from the same premises since photographs. These submissions, are at the discretion of the
Box 930 Minnedosa, MB R0J 1E0
March of 1883. We acknowledge the financial support of the
Published Friday of each week from the premises of publisher and will appear as space permits. The Minnedosa
Government of Canada through the Canada Periodical Fund
The Minnedosa Tribune Ltd. 14 - 3rd Ave. S.W. (CPF) for our publishing activities.
Tribune reserves the right to edit any submission as deemed
Minnedosa, MB. R0J 1E0 necessary by the publisher.
E-Mail Addresses: We are not responsible for fax transmissions or email
Member of Manitoba Community Newspapers Association
and Newspapers Canada General: editor@minnedosatribune.com submissions that are not received. To guarantee that such
Audited twice a year by Canadian Media Circulation Audit Ads/printing: adsales@minnedosatribune.com
submissions have been received please confirm with a phone
call or in person.
Phone: (204) 867-3816 Classifieds: class@minnedosatribune.com
Fax: (204) 867-5171 All contents copyright 2017
www.minnedosatribune.com
Cell: (204) 867 - 7000 TRUSTED CONNECTED TARGETED
The Minnedosa Tribune Friday, April 28, 2017 5

Demontigny Elected Golf Course President


By HILLARY CAMPBELL behind the scenes things
went on this year.
not, however, there will be
many other tournaments
Ye O l d
T he Minnedosa Golf However, some
Course held its An- changes over the past year
throughout the year.
Looking forward for

r i b
nual General Meeting on were up-front and centre. the 2017 year, there will

T
Tuesday, April 18th. One Over the past year, the golf not be any major proj-
of the major events of that course purchased a new ects overseen, as much of
meeting was the election beverage cart, as well as a the work to be done will
of the new president of the new fleet of cart rentals. be carry-over work from
board, Scott Demontigny. Demontigny felt that the previous years large
Demontigny is walk- the past year was a suc- projects. The long-term
ing into his presidency cessful one, and confi- goals that the club has are
in the midst of some big dently looks forward to the to continue to grow the 1887 The school building being a little out of the way,
changes that the golf same again this year. We membership base and to Facebook Photo the children are now allowed one and a half hours for
course has recently imple- are in full swing with our find new opportunities for dinner.
mented. Over the past tournaments, we have the generating revenue. As the rently open for the top
year, the golf course has largest Rockin the Fields newly elected president, nine holes, and is available 1897 The river, near the bridge, was this week fi lled
implemented upgrades to Tournament booked for Demontigny noted that his to members. Demontigny with logs on their way to saw mills at Brandon and Rapid
its watering system, put in May 27th. Th is year, as op- own goals are to just get noted that they are unsure City. Also, three carloads of stones went west from Rapid
a new till system with debit posed to the 156 spots in a better understanding of of when they will be able City to Westbourne.
machines to match, and the tournament, they have the ins and outs of the op- to open the bottom nine
set up an online booking made room for 180 golfers, eration and see where we holes, because of the high
system. It was a big year, and each spot has already can maximize our facility. river level and seepage is-
1907 Evidently, the great body of people in this vicin-
ity believe a hospital is a necessary institution in a town
said Demontigny, a lot of been spoken for. Fear The golf course is cur- sues.
of the importance as Minnedosa, as is demonstrated by

Zodiac for Fire Department


the liberal financial aid so recently accrued and the ac-
tive work being done by ladies and gentlemen to further
the object.

Continued from Page 1 sa but also on the larger anywhere they need it to however Jordan seems 1917 Dr. Lawson, of Newdale, came from that village
bodies of water throughout go. The capacity for the zo- confident that this will not on Monday by motor car. Remaining in town till Tuesday
The benefi t of the zo- the R.M.s we serve, added diac is approximately eight be needed. morning, he was compelled to leave the car behind and
diac, according to Jordan, Jordan. people, which will include Th e emergency suit return home by train, owing to several inches of snow
is that it better equips All of these reasons at least two fire depart- that was also provided is a that fell.
the department to handle show huge benefi t to the ment members, two EMS dry suit, which will mean
water rescue and recovery communities that the fire workers, and the person or that when it goes into the 1937 A 71-year-old famer died early Saturday morn-
situations. Before the zo- department serves, not to people that they are trying water it gets wet, but the ing in a traffi c accident on Main Street. A passing car
diac joined the team, the mention the water training to rescue. wearer will not get cold. grazed his buggy and frightened his horses. He suffered
fi re department were us- opportunities that it will The zodiac has a solid The fi re department is a dislocated neck when thrown from his buggy in front of
ing personal boats to at- allow our dedicated volun- aluminum bottom, which extremely grateful to the Wong Sings caf.
tend these situations. The teers. is reinforced underneath Rotary Club for their gen-
zodiac will enable the fire Soon, the fi re depart- to ensure durability even if erosity, and looks forward
department to respond ment will have a trailer it has to be dragged. It also to getting the zodiac on the 1957 The Manitoba Sugar Company advertises Gold-
quickly to any water situa- ready, which will allow has a five-yearwarranty, water. en Yellow Sugar now in polyethylene bags stating No
tion, not only in Minnedo- them to get the zodiac more hard, dried-out brown sugar.

1967 The Scandinavian Lutheran Manse has been


Residential School Display moved into the Centennial Grounds in Erickson. The
two-storey log house was built in the 1890s and will likely

Coming To Town
become a museum.

1987 The 1987 Big Game Deer Trophy Awards were


SUBMITTED Brandon to consider ways presented. Eric Abel took best overall, Ian Delmage got
to educate our community best non-typical, Charlie Richards won best typical and

T he Brandon Indian about the history of the


Residential School Mo- school and connect with
Pete Stevenson won most symmetrical.

bile Learning Centre is a the work of the Truth and 1997 The Town is expected to be off ering up to 200
display of 27 large format Reconciliation Commis- campsites at the fairgrounds to be available almost im-
photos, which span the his- sion of Canada. The team mediately for Manitoba flood victims.
tory of the school. included participants from
Th e Brandon Indian Brandon University, Sioux

TOP RATE
Residential School oper- Valley, a survivor, and the
ated from 1895-1972 at a United Church of Canada.
site just west of the current These photographs
location of the Brandon Re- with descriptions will be 1 year

1.7%*
search and Development on display in the Minnedo-
Centre on Grand Valley sa United Church Hall . *Rates subject to change
Certain conditions may apply
Road. It was administered Th e public is invited to
fi rst by the Mission Board view the display and learn 3 year 5 year
of the Methodist Church about the ongoing effects
and after 1925 by the Unit- of Residential Schools; on
ed Church of Canada. A for- Friday, May 12th and Sat-
John Loregio of the Canadian Daibetes Association
is accepting funds to send a child from the Westman 2.0%* 2.4%*
mal apology was issued in urday, May 13th (watch area to a special diabetes camp. %UXFH0F1DEE
1998 by the Church to for- for more details in upcom- Harvey Wedgewood of the Minnedosa & District Call For More Terms & Rates 867-3946
mer students, and to their ing Coming Events). Lo-
families, and communities. cal school groups will be
Foundation is presenting the cheque
In 2014 a planning touring the display on May
For more info or to make a donation to the Foundation go to
team was organized in 16th to 18th.
www.minnedosafoundation.com.
6 Friday, April 28, 2017 The Minnedosa Tribune

Wasagaming Campground Refreshed For New Season


SUBMITTED tion, all 30 oTENTiks were ing Campground, avail- ties and events you could
equipped with electricity, able for rent beginning ask for making it the prime

P arks Canada contin- and five of them were win-


ues to improve its terized to meet the ever-
visitor experience with increasing demand for this
May 2017.
Further improve-
ments in Wasagaming
tourism destination in
Manitoba. With free entry
to National Parks in 2017
investments in infra- style of comfort camping. Campground include we are very excited about
structure particularly Th e perfect combi- eight renovated wash- offering new and returning
in campgrounds and day nation of a tent and an A- room/shower buildings visitors a great experience
use-areas, the addition of frame cabin, a Parks Can- and newly surfaced roads and a chance to connect
oTENTik accommodations ada oTENTik is a unique throughout. with Riding Mountain Na-
across the country, and concept for visitors to en- Wasagaming Camp- tional Park in 2017, added
even more innovative and joy camping with the com- ground is evolving and Tovell.
educational events and ac- fort of a bed and a campsite improving to ensure we As visitation levels in-
tivities. Riding Mountain already set up and ready are meeting the expecta- crease and Parks Canada
National Park is no excep- to go. Each unit includes tions of our visitors, espe- welcomes more people
tion as the Wasagaming three beds for up to six cially in this exciting year to our national parks this Photo Submitted
Campground continues people, electric heat, in- of Canada 150, comment- year, staff are encouraging
to expand its popularity terior lighting, USB plugs, ed Dave Tovell, Acting Vis- shoulder season camping. Parks Canada is testing a variety of other new
with a variety of camping interior and exterior elec- itor Experience Manager. And, during peak periods, accommodations and has added some two
enthusiasts thanks to the trical outlets, a table and Wasagaming Camp- Parks Canada staff will person pilot accommodations, one of which is
completion of several chairs, and a propane bar- ground off ers 427 camp- help direct visitors to less- the Micro Cube, to the Wasagaming
projects, which are part beque. The fi ve winterized sites, 30 oTENTiks, a Yurt, frequented but equally Campground, available for rent in May 2017.
of Parks Canadas unprec- oTENTiks include electric the Micro-Cube and the compelling and breath-
edented $3 billion Federal heat as well as a wood Double Tent. It is nestled taking non-serviced sites
adas unprecedented $3 ensure the quality and re-
Infrastructure Investment burning stove to make the in the resort community at Lake Audy, Moon Lake,
billion dollars investment liability of visitor facilities
program. Manitoba fall and winter of Wasagaming on the Deep Lake and Whirlpool
over fi ve years to support and continue to allow Ca-
Last summer, 128 nights just a little cozier. shores of Clear Lake in Lake.
infrastructure work to nadians to connect with
campsites were upgraded Parks Canada is also Riding Mountain National There are also many
heritage, visitor, waterway nature.
with the addition of electric testing a variety of other Park, and is within walk- beautiful backcountry
and highway assets locat- Park visitors are re-
and/or water services, as new accommodations and ing and cycling distance of sites that allow the visitor
ed within national historic minded that while Parks
well as numerous site en- has added some two per- all that Wasagaming has to to experience the park in
sites, national parks, and Canada is offering free
hancements including site son pilot accommodations offer: the main beach, res- an entirely unique way.
national marine conser- access to national parks
leveling and an increase in - the Micro Cube and Dou- taurants, shopping, tennis Th ese backcountry sites
vation areas across Cana- as part of the Canada 150
accessible sites. In addi- ble Tent - to the Wasagam- courts, playground, mini will be available to reserve
da. Investments in visitor celebrations, provincial
golf and much more. online in May through the
infrastructure such as park entry fees will still
Riding Mountain Na- reservation system.
the campground upgrades apply.
tional Park provides all the These improvements
CADURCIS NEWS amenities, outdoor activi- are a result of Parks Can-
in Riding Mountain will

By DOREEN TROTT Jim and Nancy Greer


have returned from a trip
SANDY LAKE NEWS
O ur sympathy to Mar-
garet and Clayton
Wareham and family on
to Boyle, AB, where they
visited with Don and Wy-
att Greer. They spent Eas- By DIANE BACHEWICH Personal Care Home. Max- is extended to Rudy and Westman fl oor curling fi-
the passing of brother and ter Sunday in Edmonton ine was the former wife of Marion Usick and fam- nals in Birtle on Thursday.
uncle Murray Abel. He will
be missed.
A number attended
where they visited the very
impressive Muttard Con-
servatory. Both going and
V alery Goold of Kelow-
na, BC surprised her
mother Bev Marischuk
the late John Klym. Funer-
al planned for a later date.
Danny and Darlene
ily on the sudden passing
of their son-in law Mike
Rattie age 54, husband of
All had good games and
fun but didnt come home
with any top winners.
the Spring Smorg at Rapid coming they ran into snow when she arrived at her Nechwediuk returned re- Judy, of Fort McMurray, Peter and Pat Prokop-
City United Church on storms, which made driv- door step on her moms cently from visiting their AB. chuck and Elsie Spitula
Sunday. ing interesting. birthday. Happy belated daughter Carla and family Dennis and Dorothy and Walter Spitula attend-
Birthday Bev. in Kelowna, BC, daughter Johnson, Lorrie and Ollie ed the funeral of the late
Sympathy to the Klym Tanya in High River, AB Lewandoski, Veralynn Le- Sid Prokopchuk in Roblin
family on the passing of and Sister Bev and brother ganchuk, Linda Sichwiski on Tuesday.
Maxine Klym at the age Norman in Calgary. and Cliff and Diane Lungal Condolences going
of 85 at the Gilbert Plains Sincere Sympathy took in the North/South out to the Usick and Bach-
ewich families on the pass-
ing of Florence Usick in
Minnedosa Hospital. Flor-
,19,7$7,21727(1'(5 BASSWOOD NEWS ence was the wife of the
late Adam Usick.
Sympathy to the fami-
7KH 7RZQ RI 0LQQHGRVD ZLOO EH ly of Bert Woychyshyn who
By ZELDA FIRBY and families. A large crowd supper, guest speaker and
DFFHSWLQJSURSRVDOVIRUWKHWK$YH1: attended the funeral on the opportunity to have passed away in Neepawa.
:DWHU0DLQ5HSODFHPHQWXQWLO30
)ULGD\0D\ T homas Parish returned
recently from New
Zealand after spending a
Monday in Minnedosa.
Family and friends
helped Sylvia Firby cel-
our charitable dollars
matched 4-1 by the Fed-
eral Government. Stacie
few months there. ebrate a Special Birthday Cardy was lucky to get a If your label reads
,QIRUPDWLRQ FDQ EH SLFNHG XS DW WKH7RZQ
RI 0LQQHGRVD RIFH  0DLQ 6W 6RXWK
Deepest sympathy is
extended to Brenda Abel
on Friday evening. half dozen of Zelda Firbys
raisin tarts for $80.00 What 17 /04 /30
SKRQH    RU HPDLO NPR\HU# and family on the pass- By STACIE CARDY a treat! Brent Cardy was Its time to renew
ing of husband, father and heard saying those are ri-
PLQQHGRVDFRP your subscription!
grandfather Murray Abel. Many from the area diculously good, why dont
Condolences go out also supported the Canadian you make some Mom?
7KH7RZQRI0LQQHGRVD to Alex Abel (Murrays fa- Food Grain Bank on Sun- and he doesnt even like 204-867-3816
ther), Murrays siblings day night enjoying a lovely raisins!!!

The Minnedosa Tribune Friday, April 28, 2017 7

Heritage Co-op Celebrates Successful Year


By HILLARY CAMPBELL directors, as she and her gram, which is designed
family truly believe that to raise the competencies

O n April 20th, at the the Co-op is, an important


Minnedosa Commu- part of all the communities
nity and Conference Cen- its involved in.
of the board. This pro-
gram is a combination of
both online and classroom
tre, the Annual General As well as Campbells courses, with the end goal
Meeting was held for Heri- welcome addition to the of helping individuals and
tage Co-op. board of directors, there boards with the ever-in-
The emcee for the eve- are also three members creasing complexity of the
ning was the Co-op Board who are renewing their business decisions facing
President, Ken Jenner, who terms with Heritage Co- us into the future, said
led the group efficiently op: Ken Jenner, Tamra Jenner.
through the meeting. Rapsky and Bill Wynn. Th e progress of the
Members of the head table Looking forward, the new Administration Build-
included Lorne Zacharias board will be changing its ing, which has recently
(General Manager), Ray cash back policy. It will been erected on Main
Morgan (Controller) and be adding a new category. Street in Minnedosa, was
Sherian Chemerika (Re- Previously, the top catego- discussed. The building
cording Secretary). ry was one in which every came in on budget and is
It was noted that long- member who had an eq- about a week ahead of the Photo By Hillary Campbell
time board member, Larry uity account of more than original schedule, and is
Chemerika, has decided to $10,000 would receive 80% pretty much complete with (L-R)Heritage Co-op President Ken Jenner addresses the crowd, while
step down, leaving a por- of the years allocation in a few finishing touches re- General Manager Lorne Zacharias and Controller Ray Morgan look on.
tion of his term to be filled. cash. The new category maining. The interior fur-
Chemerika served on the will allow members with nishings, window cover- sults ability to bounce back proof of that, said Zacha- they off er to their mem-
board for 30 years, and was an equity account of over ings, as well as the removal in what he referred to as a rias. The plan for 2017 is bers and customers alike.
a valued member of the $35,000 will receive 90% of of the present MNP build- soft economy. He noted also to update the Point of With the added space
team. He was thanked by their current years alloca- ing and landscaping will that the biggest growth Sale systems. in the new administration
the board during the nom- tion in cash. This would complete the construction came from the Brandon Ag He mentioned the building, Zacharias also
ination report for his dedi- slow the rate of growth plan, Jenner explained. Site, which exceeded our projects that Heritage made note of plans to re-
cated service. and mitigate the risk of Th is year, the board expectations through sales Co-op has underway. He cruit a Finance Operations
Sarah Campbell from any one members equity will also be focused on growth. He noted that noted the goal of Corpo- Manager, an Asset Protec-
BDO Canada, stepped account growing too large an upgrade of the Bran- the numbers in 2015 were rate Performance Manage- tion Expert and a Market-
in to fi ll the void left by and aff ecting our ability don food store, as it has lower due to one-time ex- ment, which is meant to ing and Communications
Chemerika. Campbell has to maintain our cash back changed very little since it penses, and that in 2016 focus the group on meet- Manager.
worked for BDO for over program in the future, opened in 2003. they are back to where ing their long-term goals. Th e Heritage Co-op
10 years, and specializes said Jenner. Following the Board they would like to be. We As a part of our 2017 goal had another successful
in agriculture, working in Jenner also reported Report, Lorne Zacharias are very fortunate to have setting process, we are put- year, which was reflected
the Brandon, Erickson and that four of their directors took the floor, and gave his the ability to make long- ting some added focus on upon at the meeting. Go-
Minnedosa offices, and have completed the level General Managers report. term decisions and not be things like communicating ing forward, there are
will bring knowledge and one training in the Direc- He commented on Heri- bound by short-term re- with members, said Zach- many exciting new proj-
expertise to the board of tor Development Pro- tage Co-ops operating re- sults, and this is certainly arias. One of the challeng- ects in the works, which
es that Heritage Co-op is will continue to add to the

Waves Of Hope Gearing Up for 15th Annual Fashion Show


facing is communication success of the organiza-
with its members, and re- tion.
laying the advantages that

SUBMITTED Baldur, Nesbitt, Brandon team can launch their be- breast cancer who would
and Basswood. loved boat Kindred Spirit like to try dragon boating.

W aves of Hope is one


of the many breast
cancer teams from around
Advance Only Tickets
for the 2 p.m. and 7 p.m.
shows are available from
for the season. Practices
are Wednesday evening
all summer. Come N Try
For more information con-
tact Kathy at 204-728-0764.
Visit our website www.
585$/081,&,3$/,7<2)2$.9,(:
38%/,&127,&(
the world whose collective any Waves of Hope team sessions are offered for wavesofhope.caor visit us 5(*$5',1*7+(
mission is to raise aware- member. anyone diagnosed with on Facebook. ),1$1&,$/3/$1
ness for early detection of Proceeds from show
breast cancer and promote help Waves of Hope raise      38%/,& 127,&( LV KHUHE\ JLYHQ SXUVXDQW WR
activity to gain strength. awareness for early detec- 6XEVHFWLRQ    RI 7KH 0XQLFLSDO $FW WKDW WKH
We provide outreach, in- tion of breast cancer and &RXQFLO RI WKH 5 0 RI 2DNYLHZ LQWHQGV WR SUHVHQW
formation, hope and sup- provide hope to men and LWV QDQFLDO SODQ IRU WKH VFDO \HDU  DW D SXEOLF
port to women in Western women after diagnosis. KHDULQJ LQ WKH 5 0 RI 2DNYLHZ FRXQFLO FKDPEHUV
Manitoba. Dragon boating is a great RQ 7XHVGD\ WKH WK GD\ RI 0D\  DW  SP
Waves of Hope is hold- form of exercise for the up- &RXQFLO ZLOO KHDU DQ\ SHUVRQ ZKR ZLVKHV WR PDNH D
ing its 15th Annual Spring per body. UHSUHVHQWDWLRQDVNTXHVWLRQVRUUHJLVWHUDQREMHFWLRQ
Fashion Show May 10th Waves of Hope con- WRWKHQDQFLDOSODQDVSURYLGHG
in the UCT Pavilion in the sists of paddle members,
Brandon Keystone Centre. steers person, drummers       &RSLHV RI WKH SURSRVHG QDQFLDO SODQ ZLOO EH
Waves of Hope team mem- as well as support people DYDLODEOH IRU UHYLHZ FRPPHQFLQJ RQ WKH UG GD\
bers, children, grand and on shore who help in many
17044gm1 RI 0D\  DQG PD\ EH H[DPLQHG E\ DQ\ SHUVRQ
great grandchildren, a few ways. Together members GXULQJUHJXODURIFHKRXUVRIWKH0XQLFLSDORIFHDW
spouse and volunteers will demonstrate the health 2DN5LYHURU5DSLG&LW\
be modeling from various and fitness benefi ts plus
'LDQH.XFXO\P
venues. support for one another.
&KLHI$GPLQLVWUDWLYH2IFHU
Waves of Hope mem- The season begins in
50RI2DNYLHZ
bers travel from Forrest, April with dry land training
(PDLORDNYLHZFDR#P\PWVQHW
Onanole, Ethelbert, Dau- at Healthy LivingCentre in
3KRQH
phin, Neepawa, Erickson, Brandon. Once the ice is
$SULOWK
Minnedosa, Sandy Lake, off Minnedosa Lake the

8 Friday, April 28, 2017 The Minnedosa Tribune

Caring and Sharing At TCS Combating


rest of the school to kick
off Free the Childrens
by and watches bullying,
is thus also participating
Senior Isolation
WE Are Silent campaign. in that bullying. By HILLARY CAMPBELL lies who live out of town,
In addition to this, they A highlight of the af- or have difficulty getting
also presented on the Red
Cross Pink Day. As a re-
sult of the assemblys pre-
ternoon, which was un-
known to the majority of
attendees was when TCS
O n May 12th, the 50+ out into the community.
Centre will be host- Woodcock suggested that,
ing an event with the pur- something that Services
sentation, the following Teacher Wendy Radcliffe pose of getting seniors out to Seniors would like to
day, students and staff all walked to the centre of of isolation. The event is start is a friendly phone
wore pink to school. the pit, sat on a stool, part of the Let No One call, or possibly a friendly
According to TCS and had her long hair cut Be Alone Week initiative, visit.
teacher, Kerry Morrice, short, in order to donate which was started in 2012 Currently, there are
the purpose of the WE it. The purpose of this was by Brenda Tonn, of Plu- over 50 communities
Are Silent Campain is to to show the students how mas. across Manitoba that have
bring awareness of the they can give in a different Services To Seniors undertaken this initiative,
struggles of children here way. Co-ordinator, Maxine which started with Tonn
and around the world who Th e most surpris- Woodcock, believes the only five years ago.
are fighting for their basic ing moment came when event is important for the Many of Minnedosas
human rights. To hon- Radcliff e asked students community, in that, even seniors were relocated
our this, students took a to come up to the front of in Minnedosa, I dont with the renovations at
vow of silence for the day, the room if they had ever think people realize how Townview Manor, which
showing their support for made that kind of a do- many people in this town could have added to the
those children. nation before, and many are isolated by not being isolation felt by some of
For Pink Day, staff of the students stood able to get out and about. Minnedosas older com-
and students alike showed up, showing the gener- Th e issue is that often munity members. Being
up in all shades of pink ous spirit of Minnedosas these people are forgot- lonely and socially isolated
to show their support children. After this, the ten by their community can have a negative impact
Photo By Hillary Campbell
to the victims of bullying assembly adjourned, and members, and the longer on the health of an older
Wendy Radcliffe donates her hair in and provided awareness students and teachers they remain isolated, the person.
front of the TCS Assembly. to students on how they walked back to their class- more this can become the Social networks, so-
could stand up to bullies rooms, and the world was case. We live in a very fast cial participation, and feel-
By HILLARY CAMPBELL assembly in the pit on and make a difference in a better place. paced society now and we ings of belonging are im-
Monday, April 24th. Stu- someones life, said Mor- forget about those people, portant to healthy living,

S tudents at Tanners
Crossing Elementary
School gathered for an
dents from the service
learning group LS!N pre-
sented information to the
rice. One student noted
during the presentation Club 55 its actually very sad, add- disease prevention, and
ed Woodcock. the prevention of isolation
that anyone who stands For many seniors in among older adults, said
Golden Agers Manitoba and across Can- Woodcock, we know that
ada, feeling lonely is a real- older people who remain

Bowling ity. Woodcock noted that active in society and so-

:HGGLQJ
people who experience cially connected are hap-
loneliness often feel a gen- pier, mentally and physi-

7KHSHUIHFW Bowling Wrap up eral sense of emptiness, do cally healthier, and better
not have people that they able to cope with lifes ups
feel close to, miss having and downs.
L eague bowling is over

LQYLWDWLRQLVWKHVWDUWRI
for another year. We people around and often Woodcock stressed
had a lovely lunch and fun feel rejected. According that people are very much
bowling. A good time was to the 2007 General So- encouraged to attend the

VRPHWKLQJEHDXWLIXO
had by all. cial Survey, 35.9% of older afternoon on May 12th,
Awards were handed Manitobans reported feel- but when they come,
out: Top Average was Shir- ings of loneliness. There- bring a friend. It will be
ley Mickoski 180 and Rob- fore, this is an issue that is a short afternoon, with
ert Hendry 179. Hi Triple very much a reality in our something a little bit dif-
,QYLWDWLRQVDQG was Debbie Tarn 625 and community. ferent for attendees, and
The benefi t to the Let will give them a chance to
(QYHORSHV Alan Tarn 686. Hi Single
was Rosemary Hamilton, No One Be Alone initia- rekindle their connection
Vivian Cullen 261 and Bud tive is that it has people to their community, as
(QYHORSH6HDOV Amy 277. Hi Triple HDCP making a conscious ef- well as other likeminded
was Hazel Stonehouse fort to touch base with se- people.
6FUROO5LQJV +876 and Paul Chapski niors who may have fami-
+960. Hi Single HDCP was

STAMPS
7KDQN\RXQRWHV Gladys Murray +335 and
Ray Criddle +345. Most
.HHSVDNHERRNPDUNV Improved Bowler was Ly-
nette Johnson +12 and
3ODFH&DUGV Bud Amy +10. Bowlers of
the Year were Hazel Stone- Rubber or
&RQIHWWL&DUGV house +95 and Robert

3HUVRQDOL]HG
Hendry +54. Overall Win-
ners were Als Gals and the
Playoff Winners were Hits
Self-inking
QDSNLQV
7+(2/'(67:((./<1(:63$3(5,17+(&$1$',$1:(67

7ULEXQH
and Misses. 7KH 0LQQHGRVD
Good luck to out two
3HUVRQDOL]HG teams going to Winnipeg
6LQFH

PDWFKERRNV The Minnedosa Tribune May 3 rd for the provincial


championship. Have a
DQGER[HV 14 3rd Avenue SW great summer and see you
204-867-3816 in September! 204-867-3816
The Minnedosa Tribune Friday, April 28, 2017 9

Preparing To Battle Garden Weeds


Premium Orange Juice; stipple in their home; I with a clean damp dish Boiling water is the
Solutions and manufacturers often add
a chemical flavoring com-
advise that they test the
ceiling stipple for asbestos
cloth to remove the soap
residue. Environmentally
easiest solution for kill-
ing weeds. If you want
Substitutions pound known as Ethyl
butyrate to orange juice
first, then remove it using
hazardous waste proto-
friendly and doesnt stink
up the house. Sandra
an extra strong solution,
pour 50/50 boiling water
By to enhance the flavour of cols. Contact a profession- and pickling vinegar onto
REENA NERBAS the drink. The easiest ob-
servation of this may be
al or do it yourself (I have
tested my own ceiling)
Re: Icy Porch Steps
I read your tips in pre-
weeds. Submitted by Au-
drey
done with your own sim- Robert vious years for combat- Choke out weeds by
ple experiment. Squeeze ting icy porch steps. The laying newspaper be-
Dear Reena, with masking tape. Leave enough oranges into a Re: Cleaning an Oven following is a recipe that tween garden rows. Cover
We moved into a for 12 hours and wipe. Or cup to give yourself a few Safely and Easily I use each year (multiple with garden mulch or ce-
house that has stains on purchase an etching re- sips. Next pour yourself a Read the concern Kar- times) to prevent my steps dar wood chips. Submit-
the marble flooring in the mover/marble restoration cup of your favourite store en had about her negative from becoming dangerous ted by Caleb
bathroom. Ive tried ev- kit at your local hardware bought orange juice. Smell experience cleaning her slabs of ice. Into a gallon
erything I can think of in- store. the diff erence? When fla- oven. I stumbled upon the jug I add: 1 tbsp. rubbing Note: Every user as-
cluding professional prod- vour packs are added to perfect oven cleaner when alcohol, 1 tsp. Dawn dish sumes all risks of injury
ucts but nothing seems to Dear Reena, fresh orange juice, it turkey juice burned onto soap and half gallon hot or damage resulting from
work. Do you have any Part of my grocery bill gives consumers the illu- my oven. I used Dawn water. Pour the concoc- the implementation of
suggestions? Susan each week is spent on pre- sion that the oranges are Ultra Platinum dish soap. tion onto cement. Within any suggestions in this
mium orange juice. So, I freshly squeezed. When I mixed one fourth cup a few hours, ice turns to column. Test all products
Dear Susan, want to confirm that 100% compared side by side, of Dawn with 1 cup hot slush making the area saf- on an inconspicuous area
There is a chance that orange juice is made with most people notice a dif- water, stirred it up and er for walking. Ruby first.
the stains are permanent, oranges alone because ference between fresh and poured it onto the bot-
and you may wish to con- the carton says never any store bought juice. tom of my oven, and let it Prepare for Garden Reena Nerbas is a
tact a professional marble water or sugar added. Is set for about 30 minutes Weeds popular motivational pre-
expert to grind the marble there anything at all add- Experienced with the oven door closed. senter for large and small
and restore it. The easiest ed to the oranges? Simone After 30 minutes, I took a groups; check out her web-
Readers Share I sprinkle cornmeal
DIY solutions is to make a plastic scrubber to it and onto weeds to discourage site: reena.ca. Ask a ques-
thick paste of baking soda Dear Simone, the yuck came off like tion or share a tip at reena.
Re: Cleaning Stipple them. Cornmeal is inex-
and water. Cover the stains While many orange
Regarding the home- magic. I then mopped up pensive and biodegrad- ca
with plastic wrap. Tape juice cartons/bottles the rest of the soapy water
owner who wants to clean able. Submitted by Sanjay
the edges of the plastic claim to be 100% Pure in my oven, wiped it down

7+(2/'(67:((./<1(:63$3(5,17+(&$1$',$1:(67

7ULEXQH
Graph Invoice 7KH 0LQQHGRVD
Paper Book
Notebook Duplicate or 6LQFH
Triplicate
80 page Expressions Tape
$2.09 $2.99 $5.99 Check out our
selection of
Home and
Tin of Office supplies:
Single
Crayola Envelopes *Pens
Hole Specialty *Pencils
Punch Crayons Paper
*Highlighters
8 crayons 50 pack
*Markers
$2.59 $2.59 $7.99 *Crayons
*Pencil Crayons
*Binders
*Notebooks
Cardstock DVD BIC *File Folders
Paper Lens Shimmers *Report Covers
50 sheet Pens *Scotch Tape
Various colours Cleaner 14 Pack *Envelopes
*File Storage
$5.99 $6.99 $2.49 *Photo Paper
*Scrapbook Paper
*Desk Accessories
Music Pip Scotch *Thank You Notes
*Post-It Notes
Dictation Squeaks Tape *Till Rolls
Book Marker Dispenser *Pocket Folders
*Glue Bottle/Stick
$2.99 $2.29 $5.49 *Staplers
*Kids Activity Sets
10 Friday, April 28, 2017 The Minnedosa Tribune

TO PLACE AN AD FOR SALE REAL ESTATE


BY PHONE Call 204-867-3816
Hours to place, correct or cancel ads: HARDY TREE, SHRUB, Have something to sell?
Monday - Friday 9 a.m. - 4 p.m. and berry seedlings deliv- Let our readers know. Clas-
ered. Order online at www. sified word ads starting at
BY MAIL CLASSIFIED ADVERTISING treetime.ca or call 1-866-873- $9.00. Call 204-867-3816 or
The Minnedosa Tribune, P.O. Box 930, 3846. New growth guaran- email ad to class@minnedosa-
Minnedosa, Manitoba R0J 1E0 teed. tribune.com.
BY FAX 204-8675171
Office supplies, school New 12x12 L-shaped
BY E-MAIL class@minnedosatribune.com supplies and childrens craft maple shaker espresso kitch-
supplies available at The en $3900. Cappuccino 33

OP HOUS
Minnedosa Tribune. Feature bath vanity with soft close
Open House
USE
SE
The Minnedosa Tribune Ltd. reserves the right to item: Elmers Foam Sheets $250. Granite 25x84 tops
delete any words or phrases deemed by The Minnedosa (50 pack bright colour assort- for $175 each Fehrs Cabinet
Tribune Ltd. to be objectionable, or to refuse to publish any Sunday, April 30, 2017
ment) $5.99. Warehouse 1-800-758-6924
advertisement. The Minnedosa Tribune Ltd. shall not be from 2-4 p.m.
responsible for any loss or damage to any advertiser or third Parts and full trailer re-
party resulting from the failure of an advertisement to appear pair, trailer safeties and Au-
REAL ESTATE See our South facing
in The Minnedosa Tribune Ltd. or from any error or omission topac Trailer Repair. Sales,
2 Bedroom apartment
in any advertisement which is published. Leasing and Financing of flat- now available
deck, dumpbox, cargo, goose- Or plan for your future
RATES neck and utility trailers and
Add your name to
truck beds. Kaldeck Truck
$9.00 for first 40 words, additional words .10 each. our waiting list!
and Trailer, Hwy #1 Mac-
Repeat ads - Half Price. Gregor, MB. 1-888-685-3127. :HVWFUHHN&UHVHQW1HHSDZD
Classified Display - $9.00/col. inch each insert. (Incl. logo, box
& bolding, and centering). FLOOR MODEL LIQ-
UIDATION SALE! Biggest
Jo-R$QQ/\WOH
Ann Lytle 204-212-1130 30
Happy Snaps: (Birthday, Engagement, Wedding, Birth, & savings of the year on floor
Graduation) - $16.00 for the first 20 words and the picture. model suites storewide in
FOR RENT BABY
Obituaries: - $6.50 per col. inch. bedroom, upholstery, leather SHOWER
and table sets. Save 20-65%!
Reach the entire province (50 weekly newspapers) $189.00
Some sample specials in- One level 4 plex suite This is an invitation to a
Westman and Eastman: $119.00
clude; 4 piece England (a available to rent. 263 2nd baby shower held in honour
All Ads plus 5% G.S.T. Lay-z-boy Company) Sec- Street N.W. 1,100 sq/ft, of Scott and Becky Kowalicks
tional $2,195, save $750. Five 2 bedroom, full laundry (nee Bullock) soon to be here
Deadlines rocker recliner fabric chairs (washer,dryer), stove, fridge, bundle of joy. Sunday, April
Classified advertisements must be submitted no later by England Furniture $599 microwave, dishwasher, air 30th from 2:00 5:00 p.m at
than noon Tuesday for insertion in the following Fridays each. England power reclin- conditioning, 30x40 fenced in he 50+ Centre in Minnedosa.
edition. All classified advertisements must be prepaid ing sofa and matching reclin- backyard. Call (204) 210-2910 Everyone Welcome. x
BEFORE insertion. ing chair, $2,695, save $850, PRICE REDUCED for more details. (5-3) x
2 six-piece youth bedroom 3.74 acres with an older If your label reads
The Minnedosa Tribune is not responsible for suites from $895-$1,099, save For Rent. 2 bedroom
typographical errors published AFTER the first insertion, nor $475 per suite. 8 piece solid
storey and a half house includ-
ing a newer 34 x 34 open con- apartment at William Rose 17 /04 /30
does it assume responsibility for errors published as a result of oak 96 inch table set, $2,495, Apartments. Mature clean Its time to renew
cept addition, appox. 1800 sq.
an advertisement placed, changed, or cancelled, by telephone. save $800. Seven piece queen ft. total. 3 bedroom, could eas- adults only. Call 204-867-7360. your subscription!
To ensure your advertisement appears correctly please solid wood bedroom suite
submit it in person, by fax, mail, or email. $2499, save $1,000. 8 piece
ily be four with minor changes,
BRIDAL 204-867-3816
2 bathrooms. Renovations are
queen solid wood bedroom started in the older part, leav- SHOWER
suite for $2,895, save $1,150. ing lots of potential for the new
SERVICES FOR SALE TAXES INCLUDED IN ALL owners. Large double level deck A bridal shower hon- COMING EVENTS
FLOORMODEL SUITES. with a modern outdoor hot tub. ouring Jessica McCharles,
Other April specials include Fenced pasture with a nice little bride to be of Michael Jury,
BATTERIES FOR EVERY- queen pillow top pocket coil barn as well as outdoor riding will be held on April 29th, WINNIPEG
Hip or knee THING. Automotive, farm, mattress set $499 and 3 piece PHILATELIC
ring. A newer 16 x 24 stor- 2017 from 2:00 4:00 p.m. at
replacement? construction, ATV, marine, occasional set (3 choices) for SOCIETY
age shed and a couple smaller the Minnedosa 50+ Centre.
Other medical conditions motorcycle, golf carts, phones, $299 per set. Solid wood sin- sheds. Detached heated garage/ Michael and Jessica are regis-
Annual Stamp
that lead to Restrictions
in Walking or Dressing?
tools, radios, computers etc. gle over single bunk set $699 shop. Sheltered and well-main- tered at Minnedosa Home & Coin Show
Reconditioned, obsolete and and single over double bunk tained yard. Just 15 minutes Hardware. Everyone Wel- Friday, May 5
The disability tax credit
allows for a:
hard-to-find batteries. SOLAR set $799, both in espresso co- North of Minnedosa. $249,000. come. (6-2) x 1 - 6pm
systems. The Battery Man. lour. Sale ends April 30th. See For more information call or text Saturday, May 6
$2,000 Winnipeg. 1.877.775.8271 staff or contact KDL for more 10 - 6pm
204-868-5413. (49-tfn) x
Yearly Tax Credit www.batteryman.ca. information. Mon-Fri 10-8, HAY LAND Sunday, May 7
10 - 4pm
$40,000 Sat 10-6 & Sun 11-5. Call KDL
Lump Sum Refund PROVINCE-WIDE Furniture at 204-571-1971. FOR RENT Sunova Centre
and Rebates CLASSIFIEDS. Reach over 660 Highland Ave., South side (West St. Paul)
80 acres of high quality al-
400,000 readers weekly. Call of #1 Hwy., Brandon. Main St. & North
For Expert Help falfa and grass. Located South Perimeter
this newspaper NOW or
204-453-5372 East of Rapid City. SW 14-13- www.wps.mb.ca
email classified@mcna.com 19W. Call 294-482-5782. (4-4) x
for details. 204-582-1334
The Minnedosa Tribune Friday, April 28, 2017 11

COMING EVENTS HAPPY BIRTHDAY BIRTH OBITUARY


ANNOUNCEMENTS

0RWKHUV'D\%UXQFK
VELMA LORRAINE WAYNE
July 4th, 1931 April 14th, 2017

May 14th, 2017 It is with great sadness


1:00 p.m. and heavy hearts that we an-
nounce the passing of Velma Lor-
Polonia Community Hall raine Wayne (Gowing). Velma
Eggs, Nalysnyky, Bacon, Hashbrowns,
was born in Winnipeg. She at-
Ham, Sausage, Croissants, Salad and
fruit bar , Dessert table tended school in Minnedosa,
Tickets available at the door. then business college in Saska-
Adults $15 toon. In Minnedosa she worked
as a legal secretary and also at
6 to 12 years $10
Agristeel. As her career advanced
Children under 6 free  Isnt it Nifty...
she taught at Minnedosa Collegiate
Sylvia is 50! Parents Tom and Vanessa
Expressive Dance with Let No One Be Alone Matthews of Winnipeg while attaining her Education Degree
Congrats!
Crystal presents... A storyline - Come, bring a friend and would like to announce the from the University of Manitoba. She also
which features dancing and enjoy an afternoon presenta- arrival of their son volunteered to teach in the Caribbean on the island of St. Kitts
Love from your family.
acting. Writer, Director, Chor- tion about Heritage Village. Russell Levi Matthews. for a few summers. She retired from her teaching position at the
x
eographer and Instructor Friday, May 12th, 2017 at the Russell was born age of 59. Velma married Johnnie Wayne on August 2, 1952 and
Crystal Scott. Sideshow Cir- 50+ Centre at 2:00 p.m. Re- Wednesday, March 29th, 2017 together had two children, Cheryl and Jeff. Following retire-
cus. Watch Out! An accidental freshments served. (7-2) x at 1:08 a.m. weighing 7lb 9oz ment, Johnnie and Velma spent nine years wintering in Texas
spill in the mad scientists lab and measured 19.75 inches and travelling throughout the U.S. including Alaska. They trav-
has caused a growth altering Minnedosa Fun Fests long. Grandparents are elled together from coast to coast in Canada, Europe, the British
reaction. Can Mabel and the Spring Market. Shop from Jim and Marlene Isles, Portugal, Bermuda, and Mexico, making lifelong friends.
animal puppets find a solu- 40+ crafters, artisans and di- Krutkewich of Minnedosa, After Johnnie died in July 2004 she continued her passion for
tion to their dilemma? 28th rect sellers at the Minnedosa Bob and Donna Matthews travel going back to England, then New Zealand, Hawaii, and
Annual Dance Shows 2016 Community Conference Cen- of Portage, and Roger and South America.
2017 Friday, May 12th at 7:00 tre on May 13th, 2017 from 10 Angela Gobeil of Winnipeg. Music was a big part of her life. She played piano for the
p.m. and Saturday, May 13th a.m.-3 p.m.! Admission is $2, A baby shower will be held Monterey Jammers and the Golden Gals, and volunteered
at 1:00 p.m. at the Strathclair children under 12 are free. at Dancing Fish Yoga Studio at many nursing homes in Brandon. Family was very im-
Bend Theatre. Purchase tick- Kids can make Mothers Day in Minnedosa on Sunday, portant to her. She loved to make cakes, prepare meals, and
ets in advance Friday, April Cards and other spring in- April 30thfrom 1:00-3:00 p.m. plan for family celebrations hosting many events. She cher-
Hard to believe
28th 8:00 a.m. 6:00 p.m. and spired crafts at the supervised In lieu of a card guests are ished the grandchildren, great grandchildren and the family
how fast time flies!
Saturday, April 29th 9:00 a.m. kids craft area so that parents encouraged to bring a book dogs. She was readily available to look after the dogs using
Happy 18th Ryan!
12 noon. Main Floor and can browse the market. There to start a library for Russell. it as a reason to relax and put her feet up. Nan was a Bran-
We are so proud of you!
Balcony $10.00. Come buy re- will be face painting, raffle (6-2) x don Wheat King season ticket holder for many years. She
served seat tickets at Crystals prizes and more! Everyone will be missed, and the memories will be with us all forever.
Love from your family.
Dance Studio in Minnedosa that comes through the door
x ENGAGEMENT Velma was predeceased by her parents Leila and Ted Gowing,
(102 3rd Ave. N.W.) or call
204-867-2446 (starting 1:00
will be entered into a free
draw for $20 gift certificates to
ANNOUNCEMENT husband Johnnie, sister Arla as well as brothers and sisters in-law.
Left to mourn are daughter Cheryl (Craig), son Jeff, grandchil-
BUSINESS
p.m. on April 28th). Tickets be used at the market. There dren Cara (Dwayne), Steven (Melissa), Jodi (Kent), great grand-
OPPORTUNITY
might be available at the door will be three draws through- children Madie, Emma, and Nickolas, William, and Norah.
but dont wait until its too out the day and you must be Minnedosa Funeral Service in care of arrangements.
CASH CASH CASH 24/7
late! (6-4) x in attendance to win. Lunch,
From Your MONEY MAG-
Florence Nightingale
snacks and refreshments will
be available from the Beach
NETS - Work only 1 Day Per IN MEMORIAM
Month, Earn $100,000.00 +
Luncheon and Bake Sale Enhancement Committee.
per Year. Canadian Manu-
sponsored by Minnedosa (7-3) x In Loving Memory of
facturer In Business Over
Health District Auxiliary. MICHAEL BACHEWICH
Minnedosa Fun Fest 33 Years. Full Details CALL
Minnedosa Legion Club- 1997 2017
Presents: Multimedia Paint NOW 1-866-668-6629 Website
room Friday, May 5th, 2017 at
Night. Thursday, May 18th, www.tcvend.com.
11:30 a.m. to 1:00 p.m. Adults 20 years have passed since God called him home.
$10.00, 6-12 years $5.00, pre- 2016 from 7 p.m.-10 p.m.
EMPLOYMENT
school free. (6-3) x at the Minnedosa United Jim and Marlene
Church Hall. Come with a OPPORTUNITY
Krutkewich along with
Minnedosa May Long quote or word in mind, let Deb and Werner Froese
Town Wide Garage Sales. your imagination run wild Farm Help are thrilled to announce
Saturday, May 20th Rain or and leave with your own Wanted the engagement
Shine! To list your sale call original piece! Throughout of their children
the Minnedosa Tribune at the night you will learn differ- Farm help operating
and maintaining farm Nick Krutkewich
(204) 867-3816 or email your ent painting techniques from and
equipment.
name and address to class@ Marlies Soltys and try differ- Kenzie Froese.
m i n n e d o s a t r i b u n e. c o m . ent mediums such as modge Experience in
operating modern Please join us for a wedding
Sponsored by the Minnedosa podge, texture and more. social in their honour at the
equipment an asset.
Chamber of Commerce Retail Bring your friends, enjoy a Minnedosa Community
Committee. ( 6-4) x glass of wine and create your Class 1 drivers licence
an asset. Conference Centre on
masterpiece! Registration April 29th. Please Drink
Minnedosa Health is $50 and includes all your Class 5 required.
Responsibly. (6-2) x
District Auxiliary Quarterly supplies. Please register by Seasonal and full-time
Meeting Monday, May 8th May 15th at Inspire Studio in positions available.
7:30 p.m. at Minnedosa Dis- Minnedosa. (7-3) x
MANUFACTURED
Call 204-365-0321
trict Hospital Board Room. or 204-365-0364 HOMES
(7-2) x Minnedosa Adult Learn-
ing Centre will be open Satur- 3 ONLY 16 x 80, 3 Bed, 2
Minnedosa United day mornings from 9 a.m. to Bath. Starting at $89,900. Alto-
Church Spring Supper Smorg. 12 p.m. starting Saturday April na Mobile Homes, 1-800-582-
Sunday, May 7th, 2017 at the 29th. Contact Val Gawel at 131 NOW HIRING 4036, 1-204-324-6776 Email
United Church Hall. 4:30 Main St. S. 204-867-2519. (7-2) x Lease operators to help service amhl@mymts.net.
our expanding customer base
6:00 p.m. Adults $15.00, 11 in MB, SK, AB and ND.
and under $6.50, 5 and under RBC Royal Bank & We offer dedicated dispatch,
NEW MODULAR
free. (7-2) x RBC Dominion Securities well maintained equipment, HOMES starting under
present:Charitable Giving on-site wash and full service $90,000 delivered! Best Buy
For only $9.00 you can facility with qualied technicians,
Define Your Legacy. Tuesday, in-house training, and a very
Homes Winnipeg/Brandon/
let our readers know about May 9th, 2017 at 6:00 p.m. competitive compensation Grand Beach - WWW.BEST-
your upcoming event. Call Venue: Minnedosa 50+ Ac- package. BUYHOUSING.COM - Can-
The Minnedosa Tribune at tivity Centre 31 Main Street All dispatched miles paid. adas largest selection of in- Wife Diane and family.
204-867-3916 or email your South, Minnedosa, MB. Ap- FAST card or passport required stock homes, quick delivery x
Coming Event to class@ petizers and refreshments Contact: 204-571-0187 or email factory orders! Text/Call 204-
minnedosatribune.com. recruiting@renaissancetrans.ca
will be served. (7-2) 800-0065.
12 Friday, April 28, 2017 The Minnedosa Tribune

HELP WANTED

0LQQHGRVD+RPH+DUGZDUH
&XUUHQWO\KDVWKHIROORZLQJ 

 


)8//7,0(23325781,7< 
+HULWDJH&RRSLVSUHVHQWO\LQYLWLQJDSSOLFDWLRQVIRUD
6$/(6$662&,$7( 

6XFFHVVIXOFDQGLGDWHVZLOOKDYH Accepting applications for full time/seasonal: )8//7,0($'0,1&/(5.


)RURXU$GPLQLVWUDWLRQ2IILFHORFDWHGLQ0LQQHGRVD0%
 $IULHQGO\DQGKHOSIXODWWLWXGH Equipment Operators/Drivers 
WRZDUGVFXVWRPHUV Class 1 Driver License
 
3ULPDU\GXWLHVWRLQFOXGHFXVWRPHUVHUYLFHDQVZHULQJDQGGLUHFWLQJSKRQHFDOOVDQGKDQGOLQJ
 ([FHOOHQWFRPPXQLFDWLRQVNLOOV FXVWRPHULQTXLULHV2WKHUGXWLHVDVDVVLJQHGPD\LQFOXGHEXWQRWOLPLWHGWRGDWDHQWU\ILOLQJ
Min 3 years experience SURFHVVLQJLQYRLFHVDQGEDODQFLQJFDVK
 :LOOLQJQHVVWROHDUQ 
Clean Driving Abstract 4XDOLILFDWLRQV
:H RIIHU FRPSHWLWLYH ZDJHV EHQHW SDFNDJH  ([FHOOHQWFXVWRPHUVHUYLFHVNLOOV

WUDLQLQJ DQG HGXFDWLRQDO RSSRUWXQLWLHV D JUHDW For more details go to:  (IIHFWLYHLQWHUSHUVRQDODQGFRPPXQLFDWLRQVNLOOV
 +LJKO\HIILFLHQWRUJDQL]DWLRQDOVNLOOV
ZRUNLQJ HQYLURQPHQW DQG ZH DUH DOZD\V FORVHG http://jandg.ca/discover/careers  3URILFLHQF\LQDFFRXQWLQJFRQFHSWV
 6RXQGNQRZOHGJHRIFRPSXWHUVLQFOXGLQJ0LFURVRIW2IILFH
6XQGD\V Submit Applications to:  +LJKO\PRWLYDWHG

,I \RX DUH LQWHUHVWHG LQ MRLQLQJ RXU WHDP Email: norma@jandggroup.ca 
 3RVWVHFRQGDU\%XVLQHVV$GPLQLVWUDWLRQFRQVLGHUHGDQDVVHW

GURSRII\RXUUHVXPHLQSHUVRQWR Fax: 204-728-5036 :HRIIHUJUHDWDGYDQFHPHQWRSSRUWXQLWLHVZLWKLQRXURUJDQL]DWLRQDQGWKH&R


RSHUDWLYH5HWDLOLQJ6\VWHPFRPSHWLWLYHFRPSHQVDWLRQDQGEHQHILWVSDFNDJHFRPSDQ\
Drop off or mail to: PDWFKHGSHQVLRQSODQDQGDGLYHUVHDQGVXSSRUWLYHZRUNLQJHQYLURQPHQW

0LQQHGRVD+RPH+DUGZDUH 2404 Park Ave. ,I\RXDUHLQWHUHVWHGLQMRLQLQJRXUWHDPSOHDVHVHQG\RXUFRYHUOHWWHUDQGUHVXPHWR
0DLQ6W1RUWK 
0LQQHGRVD0%
Brandon, MB DKD\ZRRG#KHULWDJHFRRSFD

2UHPDLOLWWRJODQH#P\PWVQHW R7B 0S3 2UPDLOWR%R[0LQQHGRVD0%5-($WWQ$QQHWWH+D\ZRRG
 3URFHVVFORVHGDWH)ULGD\0D\WK
 


ZZZKHULWDJHFRRSFD
WEST REGION CHILD & FAMILY SERVICES INC. 
Employment Opportunity: 
invites applications for a  :(7+$1.$//&$1','$7(6)257+(,5,17(5(67+2:(9(5
Insurance Broker 21/<7+26(6(/(&7('72&217,18(,17+(6(/(&7,21352&(66:,//%(&217$&7(' 

Parkway Insurance Agency Urban Services CFS Worker (1 year term)


Winnipeg Sub Office
Parkway Insurance Agency is currently seeking a career
orientated, highly motivated team player to join our team of WRCFS is a mandated First Nations Child and Family Services Agency responsible
Insurance Broker professionals. to provide a full range of services, including statutory services, voluntary services and 
prevention services to the children and families of its nine First Nations, residing on and 

Reporting to the General Manager the successful individual will off reserve. The purpose of the programs of WRCFS is to sustain, support, and enhance 
possess: family and community life. The agencys mission is to work with our First Nations people +HULWDJH&RRS
to protect Aboriginal children, in keeping with our core values.
strong communication skills both oral and written LVSUHVHQWO\LQYLWLQJDSSOLFDWLRQVIRUD

Reporting to the Urban Services CFS Supervisor, the worker will be responsible to work
computer skills as part of a team in delivering a full range of child and family services with emphasis 3$577,0(352'8&(&/(5.
ability to build and maintain strong customer relationships on prevention and resource services as a frontline approach. Duties will include; the )RURXU3URGXFH'HSDUWPHQWORFDWHGLQ(ULFNVRQ0%

aspirations to pursue the career path of a general provision of a full range of statutory child welfare services that involves child protection; 

insurance broker court work; case management; intake; on-call; advocacy; special needs, age of majority 'XWLHVWRLQFOXGHEXWQRWOLPLWHGWRFXVWRPHUVHUYLFHSURGXFWSUHSDUDWLRQ
VWRFNLQJPHUFKDQGLVLQJSDFNDJLQJDQGJHQHUDOVDQLWDWLRQKRXVHNHHSLQJGXWLHV
and the application of the Structured Decision Making Assessment tools when working 
An Auto Broker or Canadian Accredited Insurance Broker with families. 4XDOLILFDWLRQV

License will be considered an asset. QUALIFICATIONS:  ([FHOOHQWFXVWRPHUVHUYLFHVNLOOV
BSW degree with two (2) years of child welfare experience, preferably in First  6WURQJFRPPXQLFDWLRQDQGLQWHUSHUVRQDOVNLOOV
A competitive salary, benefits and pension in a professional Nations child and family services. An equivalent combination of training and  +LJKO\PRWLYDWHG
 0XVWEHDYDLODEOHWRZRUNDYDULHW\RIVKLIWVLQFOXGLQJGD\VDQGZHHNHQGV
service oriented environment is offered. Interested candidates experience may be considered. 
Must have working knowledge of the CFS Act and a commitment to First Nations
should submit their resumes by Wednesday, May 10, 2017 to: child and family services, community based planning and service delivery.
:HRIIHUJUHDWDGYDQFHPHQWRSSRUWXQLWLHVFRPSHWLWLYHVDODU\FRPSDQ\
PDWFKHGSHQVLRQSODQDQGH[FHOOHQWWUDLQLQJRSSRUWXQLWLHV
Knowledge of and appreciation for Ojibway culture and aspirations are essential. 
7REHFRPHDPHPEHURIRXUWHDPSOHDVHVXEPLW\RXUFRYHUOHWWHUDQGUHVXPHWR
Stacy Gill The ability to speak Ojibway will be considered a definite asset. 
Human Resource & Marketing Manager Demonstrated ability to communicate effectively, both orally and in writing DKD\ZRRG#KHULWDJHFRRSFD
Must have demonstrated ability to work as part of a team and within a 
Vanguard Credit Union multi-disciplinary approach.
0DLOWR%R[0LQQHGRVD0%5-(
$WWHQWLRQ$QQHWWH+D\ZRRG+XPDQ5HVRXUFHV0DQDJHU
sgill@vanguardcu.mb.ca Must have good organizational skills 
Must be able to respond to completing deadlines in a fast paced work 2UDSSO\LQSHUVRQDWRXU(ULFNVRQ)RRG6WRUH
 environment 
Minnedosa Commun- Must have computer training and/or knowledge of Microsoft Office ZZZKHULWDJHFRRSFD
Have familiarity with the Structured Decision Making Assessment tools, Intake 
WANTED ity Child Care Co-op is cur-
& CFSIS. 
rently seeking a creative and  :(7+$1.$//&$1','$7(6)257+(,5,17(5(67+2:(9(5

enthusiastic individual for SALARY: Commensurate with experience and training and according to 21/<7+26(6(/(&7('72&217,18(,17+(6(/(&7,21352&(66:,//%(&217$&7('

WANTED: Someone to the position of full time Early Provincial pay scale.
cut grass at apartment block. Childhood Educator. The WRCFS offers a supportive, progressive and innovative work environment, competitive
Lawnmower and trimmer successful applicant must salaries, a great benefits package, and training opportunities. The successful applicant

DONT FORGET
provided. Please call Colleen have their ECE diploma and must provide WRCFS with a current criminal record check and child abuse registry
at 826-2184 for enquiries and current First Aid and CPR check and drivers abstract prior to commencement of employment. Travel is required.
details. (6-tfn) and will be subject to Crim- A valid drivers license and access to means of transportation for work is a condition of
inal Record and Child Abuse employment.
WANTED: OLD TUBE Registry Checks. The respon- Please submit your resumes with a covering letter to:
AUDIO EQUIPMENT. 40 years sibilities of this position in- Verna McIvor, BSW, RSW Advertising deadline is
or older. Amplifiers, Stereo, clude developing an emer- Director of Urban Services
Recording and Theatre Sound
Equipment. Hammond Or-
gent curriculum, providing West Region Child and Family Services, Inc.
255 Sherbrook St.
TUESDAYS AT 12 NOON
positive guidance, engaging
gans, any condition. CALL with families, basic cleaning, Winnipeg, MB.
Toll-Free 1-800-947-0393. etc. For more information re- R3C 2B8
garding this position contact
Fax: (204) 985-4079 Call
Looking for something? Teresa Guillas at 204-867- DEADLINE FOR APPLICATIONS IS May 5th, 2017
Our readers may have it! Place
a Wanted ad in The Tribune
3313. Please send resumes to We thank you for your interest in WRCFS; 204-867-3816
Box 1108 Minnedosa, MB R0J however only those selected for an interview will be contacted.
Classifieds. Call 204-867-
3816 or email ad to class@
1E0 or minnedosachildcare@ or email ads to
wcgwave.ca or drop off in per-
minnedosatribune.com. son at 49-2nd Ave NW Minne-
adsales@
dosa. Deadline: May 1, 2017. minnedosatribune.com
(6-2) x
The Minnedosa Tribune Friday, April 28, 2017 13

HELP WANTED CARD OF THANKS

Id like to thank every-


one that made my 90th birth-
Rolling River School Division 7UDQVSRUW/7'
day celebration a success
6WUDWKFODLU0% and a wonderful afternoon
Rolling River School Division is located in southwestern Manitoba, and evening. Thanks for all
A thriving trucking company since 1986 in Strathclair MB with its own maintenance shop in Newdale, MB
Canada in close proximity to Riding Mountain National Park and is hiring for the following full time positions in NEWDALE MB. the cards, gifts and especially
Brandon, Manitoba. the generous donation of
Heavy Duty Shop Manager $374.00 for the Kidney Foun-
Required to oversee budgets, maintenance and repair scheduling of the RTM Fleet and all outside customer. dation. It was wonderful to
Rolling River School Division invites applications for a This senior position will help grow customer relations and the newly added ag dept. parts sales.
see so many friends, people
1.0 FTE HIGH SCHOOL PRINCIPAL develop and implement the maintenance plan for equipment as well as ensure efficient management of the repairs and maintenance
and family that I havent
at Minnedosa Collegiate, budget.
The successful candidate will oversea the additional staff members scheduling, work load & staffing. seen for some time. Thanks
commencing September 5, 2017. again. Sincerely, Florence
Control the ordering of parts and inventory in conjunction with maintenance personnel to ensure spare parts are adequately stocked to
carry out maintenance operations. Haywood. x
Minnedosa Collegiate, located in Minnedosa, Manitoba, is a Review systems on a regular basis to ensure they are working effectively and make alterations or improvement where required.
High School (9-12) with a student population of 170. Work within budgetary guidelines and carry out maintenance in a cost-effective manner. EMPLOYMENT
Provide leadership and direction to all employees working within your department.
OPPORTUNITY
Suggest design improvements and cost saving initiatives that may constitute safer and more efficient operation of the equipment.
APPLICATION DEADLINE: Monday, May 8, 2017 at 12 Noon Provide the General Manager with information and reports upon request or on a periodic basis as specified.
The Ideal Candidate:
MEDICAL TRANSCRIP-
TION! In-demand career! Em-
For more details and application information, please visit our website at Mechanical background, preference will be given to those with Heavy Duty Mechanic Training.
Strong computer skills. ployers have work-at-home
www.rrsd.mb.ca select Employment then Teaching Positions.
Ability to travel (15-20%). positions available. Get on-
line training you need from an
Thank you to all applicants for their interest in Parts Department employer-trusted program.
Responsibilities:
Rolling River School Division. Visit: CareerStep.ca/MT or
Selling and ordering parts for customers including pricing.
Only those candidates selected for interviews will be contacted. Use computerized inventory system. 1-855-768-3362 to start train-
Process in-house Parts Request Forms, packing slips. ing for your work-at-home ca-
Place orders with vendors for parts and supplies. reer today!
Prepare purchase orders.
Rolling River School Division Issue and distribute parts and supplies for internal usage.
HEALTH
Receive, sort and count incoming shipments and store in an orderly and organized manner.
Rolling River School Division is located in Perform inventory counts and maintain up-to-date accurate data.
Maintain a clean and safe work environment.
southwestern Manitoba, Canada in close proximity to Comply with all relevant Health and Safety and Environmental policies and procedures.
CANADA BENEFIT
Riding Mountain National Park and Brandon, Manitoba. Requirements: GROUP Attention Manitoba
Minimum 1 year experience in automotive, truck, ag or related industry. residents: Do you or some-
Teachers Required Must be physically fit and have experience working in a shop environment. one you know suffer from a
Basic mechanical aptitude. disability? Get up to $40,000
Onanole Elementary - Gr 7/8 Must have valid and clean drivers license. from the Canadian Govern-
(French & Resource an asset) Excellent communication skills in both oral and written. ment. Toll-free 1-888-511-
Forrest/Elton - Gr 7/8 Classroom & HS Band/Choir Able to work independently, as well as in a team environment. Self-starter with the ability to work unsupervised.
2250 or www.canadabenefit.
Oak River School - Primary Grades Able to work in a fast-paced environment.
Must be willing to work some Saturdays
ca/free-assessment.
Tanners Crossing - Gr 1/2 Able to work overtime and/or weekends when required to complete necessary tasks
Tanners Crossing - Grade 5/6
Rivers Elementary - Grade 3/4 & Phys Ed Journeyman Mechanic TENDERS
Applicant must have own tools and be prepared to work some Saturdays.
For more details and application information, please Ensure equipment, tools and work areas are organized
Test drive units as required Written tenders for mow-
visit our website at www.rrsd.mb.ca select
Assist Foreman in organizing day to day work load for the repair shop ing and trimming the Fair-
Employment then Teaching Positions. Assist Foreman in prioritizing tasks for shop staff mount Cemetery and School
Assign work to shop staff according to skill and proficiency Cairn for the 2017 season. Ap-
Thank you to all applicants for their interest in Ensure quality control throughout the repair process plicant is to supply all equip-
Rolling River School Division. Conduct final inspection of completed repairs ment and fuel. Lowest or any
Only those candidates selected for interviews will be contacted. Perform diagnostics for shop & customers-mechanical, electrical, computer
tender not necessarily ac-
Maintain a high level of employee productivity at all times
Maintain open communication with Service staff, Parts Staff and Management cepted. Please send tenders to
Communicate updates, deficiencies, and additional requirements to Customers Bob Currah, Box 1354, Minne-
Conduct regular shop meetings with staff dosa, MB R0J 1E0. (6-2) x
Communicate, support and promote company policy changes


Maintain a high level of ethics and integrity within the service department and with customers. Tender grass cutting Bass-
Any other duties assigned by the supervisor not far outside your expertise and training. wood Cemetery for 2017 sea-
+HULWDJH&RRS son with option of 3 years if the
LVSUHVHQWO\LQYLWLQJDSSOLFDWLRQVIRUD All Wages are negotiable and will be based on experience. We also offer a competitive benefits package and RRSP Program.

board is satisfied with the job.
),1$1&(23(5$7,2160$1$*(5 Only selected applicants will be contacted. Tender per cut basis to be sub-
)RURXU$GPLQLVWUDWLRQ'HSDUWPHQWLQ0LQQHGRVD0% Please send resume to: mitted to P.O. Box 63 Minneod-

5HSRUWLQJWRWKH*HQHUDO0DQDJHUWKHLQFXPEHQWZLOORYHUVHHDOOWKHILQDQFLDODQG RTM Transport Ltd. sa, Manitoba, R0J 1E0 by May
DFFRXQWLQJRSHUDWLRQVDQGSURFHVVHVDQGVXSSRUWWKHNH\EXVLQHVVJHQHUDODQG Box 245 Strathclair, MB R0J 2C0 4th, 2017. Inquiries please call
DGPLQLVWUDWLYHIXQFWLRQVIRU+HULWDJH&RRS7KHLQFXPEHQWZLOOZRUNFORVHO\ZLWKDOO
OHYHOVRIPDQDJHPHQWWRHQVXUHDOOILQDQFLDOPDWWHUVDUHSURSHUO\H[HFXWHG Fax: 204-365-4753 David Brown after 5:00 p.m. at
 Email: rtmkenwozney@gmail.com 204-874-2341. (6-2) x
4XDOLILFDWLRQV 

:HDUHORRNLQJIRUDSURJUHVVLYHWHDPSOD\HUZLWK\HDUVRIVHQLRUOHYHO

STAMPS
DFFRXQWLQJILQDQFHH[SHULHQFH LGHDOO\LQDFRPELQDWLRQZLWKEXVLQHVVPDQDJHPHQWRU

Its not a thing


EXVLQHVVDGPLQLVWUDWLRQH[SHULHQFH ZLWKD&3$&$RU&0$GHVLJQDWLRQ$VWURQJFRPSXWHU
DQGWHFKQLFDOEDFNJURXQGLQFOXGLQJHIIHFWLYHZRUNLQJVNLOOVRI0LFURVRIW2IILFHDQGHPDLOLV
UHTXLUHG:HDUHVHHNLQJDVWURQJOHDGHUZKRFDQZRUNDVSDUWRIDWHDPDVZHOODV
LQGHSHQGHQWO\7LPHDQGSURMHFWPDQDJHPHQWVNLOOVDUHHVVHQWLDOWRWKLVSRVLWLRQDORQJZLWKWKH
DELOLW\WRLQWHUSUHWDQGLPSOHPHQWFRPSDQ\SROLFLHVDQGSURFHGXUHV
7KHVXFFHVVIXOFDQGLGDWHZLOOGHPRQVWUDWHHIIHFWLYHFRPPXQLFDWLRQVNLOOVH[FHSWLRQDO

of the past!
VXSHUYLVRU\DQGRUJDQL]DWLRQDOVNLOOVLQDGGLWLRQWRVWURQJSUREOHPVROYLQJDQGLGHQWLILFDWLRQ

Rubber or
VNLOOV

:HRIIHUJUHDWDGYDQFHPHQWRSSRUWXQLWLHVFRPSHWLWLYHVDODU\FRPSUHKHQVLYHEHQHILWV
SDFNDJHFRPSDQ\PDWFKHGSHQVLRQSODQDQGH[FHOOHQWOHDUQLQJGHYHORSPHQW
RSSRUWXQLWLHV



7REHFRPHDPHPEHURIRXUWHDPSOHDVHVXEPLW\RXUFRYHUOHWWHUDQGUHVXPHWR

DKD\ZRRG#KHULWDJHFRRSFD
If you are reading this ad Self-inking
 we have just proven that 7+(2/'(67:((./<1(:63$3(5,17+(&$1$',$1:(67

7ULEXQH
0DLOWR%R[0LQQHGRVD0%5-( 7KH 0LQQHGRVD
$WWHQWLRQ$QQHWWH+D\ZRRG+XPDQ5HVRXUFHV0DQDJHU
3KRQH  
3URFHVVFORVHGDWH0D\WK
newspaper advertising
6LQFH

 still works!
ZZZKHULWDJHFRRSFD

 :(7+$1.$//&$1','$7(6)257+(,5,17(5(67+2:(9(5
21/<7+26(6(/(&7('72&217,18(,17+(6(/(&7,21352&(66:,//%(&217$&7(' 
The Minnedosa Tribune
204-867-3816 adsales@minnedosatribune.com 204-867-3816
14 Friday, April 28, 2017 The Minnedosa Tribune

PROPERTIES FOR SALE

/LYLQJLQ\RXU
&RPPXQLW\
3URXG6XSSRUWHU
ACCOUNTING CONSTRUCTION CONSTRUCTION
Rick Taylor 867-7551
ricktaylor@remax.net

(99,5,9
*HRUJH$OODUG)&*$
*65Avv:aaii;lala9blble<fofo*r:r ;065
*DWHZD\6WUHHW Ind
Ind
dooroorr Re
oo Renovvatitions
on
ons
ns
2QDQROH0% Deccks
De
Decckkss LLandand
an
anddscaapini g
 Soff
offfffit,
o iitt,
t, Fa
Fasc
scia,
a, Sid
id
diing
in
ng
n g
204-21
20 4-21100--12
4- 1274
74 Specializing in water & sewer
1(:/,67,1* +RZDUG:LUFK&*$
Minn
Mi nned
nn edosa,
ossa,
a, MB
installation & repair
)$6+,21+286( WK$YH All types of excavation
5'$9(6: 7+$9(6: w rr
wa rren
ener
e co
ercons
ons
nstr
trrucction
tion
ti on@g
n@g
@gmail
maaill.ccom
m
0,11('26$
Basements, Demolition
6KRDO/DNH0% Snow removal
0,11('26$ 0,11('26$   Gravel, Topsoil
-XVWXQGHUVTIW VTIWEXQJDORZ VTIWEXQJDORZ Sales of septic tanks
GRZQWRZQ 'DXSKLQ2IFH ss  Kirk 867-0180
IHHWRIVWUHHWVLGHIURQWDJH
EHGURRPVZLWKQLVKHG
EDVHPHQW
EHGURRPVEDWKV
6LQJOHGHWDFKHGJDUDJH
VW$YH6:
3KRQH
 >>
2SHQRRUSODQSURYLGLQJ :RUNVKRSDQGEHDXWLIXO\DUG )D[ &
PDQ\RSWLRQV
0/6
0/6
0/6
'HQRWHV3URIHVVLRQDO&RUSRUDWLRQ 
Z
BIR CH
BIRCH
CONSTRUCTION LTD.
&
GENERAL
  CONTRACTORS
>s Commercial
K

Residential
Open 867-0400
8:30 -6:00 0r
7+$9(1( 5'671( 1( 116 Main Street 867-7506
0,11('26$ 0,11('26$ 502)0,1722'$1$+ BACKHOE & TRUCKING
Minnedosa
VTIWEHGURRP VTIWEXQJDORZ VTIWEXQJDORZ
204 867-5550 Parish Backhoe
Services
,PPDFXODWHFRQGLWLRQDQG ,PPDFXODWHFRQGLWLRQ DFUHV
ORWVRIXSGDWHV
+XJHORWZLWK[VKRS 0LQXWHVWR0LQQHGRVDDQG
6XQURRPDQGGRXEOH 1HHSDZD Septic Systems Weeping tiles
GHWDFKHGJDUDJH
0/6 BDO Canada, LLP Water Systems Basements
0/6 Chartered Accountants
0/6 All types of excavation
Considering listing your Property? and Advisors
Certified in waste
Call me today for great service at great rates! Farm, Business & Individual
water management
Professional Services:
~ Tax Call: Ian
PRAIRIE MOUNTAIN 3K 874-2134 or 867-0383
~ Accounting
Independently Owned *ZHQ8VLFN )D[
and Operated Broker Realtor
JZHQX#PWVQHW ~ Farm Programs
Sarah Campbell, CGA
39 Main Street South 7$*
Minnedosa 867-2957
&RQVWUXFWLRQ
$OO-REV5RRILQJ
Catharine 3DLQWLQJ Roofing Decks
Fencing Exterior Finishing
strathclair
[ 6LOYHUZRRG  PRELOH
M Gijsbers *HQHUDO5HSDLUV Renovations Repairs
minnedosa MINNEDOSA MINNEDOSA KRPHKDVDOOWKHFRQYHQLHQFHVRQ Chartered Professional DQG0DLQWHQDQFH
2SHQ FRQFHSW  EHGURRP :HOOPDLQWDLQHGEHGURRPEDWK (QMR\ WKH SDQRUDPLF YLHZV RI WKH OHYHO7KLVIXOOEDWKEHGURRP Accountant Inc. littlevalleyconstruction@live.ca
EXQJDORZZLWKSLHFHEDWKSDUWO\ KRPH ZLWK DWWDFKHG VLQJOH JDUDJH
ODNH KLOOVIURP\RXUODUJH/VKDSHG
OLYLQJURRP GLQLQJURRPIURP\RXU
KRPH IHDWXUHV ODUJH IR\HU XWLOLW\
URRP RYHUVL]HG PDVWHU ZLWK
Minnedosa $YDLODEOHIRUVQRZ 204-868-5980 or 204-867-5544
QLVKHG LQVXODWHG EDVHPHQW   *'2 )HDWXUHV LQFOXGH ODUJH
DSSOLDQFHV ODPLQDWH RRULQJ DQG GHFN FHQWUDO DLU  YDF [
ZDOO RI WULSOH SDQH ZLQGRZV LQ WKLV
ZHOO EXLOW  EHGURRP   EDWK
HQVXLWH  ZDONLQ FORVHW RSHQ 213 2nd St NE - Box 385 UHPRYDOZLWKLQ
FRQFHSWNLWFKHQOLYLQJURRPGLQLQJ
FXVWRP EXLOW NLWFKHQ FDELQHWV ZLWK VKHGSDUWO\IHQFHG\DUGYHJHWDEOH KRPH DWWDFKHG RYHUVL]HG GRXEOH T: 867-3884 C: 867-0190
SXOORXWVKHOYHV VRIWFORVHGRRUV JDUGHQ ZRUNVKRS LQ QLVKHG FDU JDUDJH ZLWK *'2V RQ D ODUJH URRPZLWKRDNFDELQHWV ODPLQDWH
WRZQOLPLWV
6LWXDWHGRQDODUJHORWVWRUDJHVKHG
FDUSDUNLQJSDG+RXVHKDV
VW\UR XQGHU YLQ\O VLGLQJ QHZHU
EDVHPHQW ZRRG VWRYH UHSODFH
VKLQJOHVLQDQGPXFKPRUH
FRUQHU ORW )HDWXUHV  IXOO HDW LQ
NLWFKHQVFHQWUDODLU+(JDVIXUQDFH
2FWUHWUDFWDEOHDZQLQJRQSDWLR
RRULQJ  6LWXDWHG RXW VNLUWV
RI WRZQ RQ D [ ORW 
LQFOXGHV[GHFN[VKHG
Email: Catharine@mts.net
&RQWDFW Book this spot
VKLQJOHVIDFLD VRIWV

Mls#1703000 $129,000 MLS#1630031 $239,900


YHJHWDEOHJDUGHQVKHGDQGPXFK
PXFKPRUH
MLS#1627818 $229,900
[ JUHHQKRXVH PDSOH WUHHV 
RUQDPHQWDOVKUXEV
MLS#1621802 $129,900 AUTO  $5.52/week
7DNHDWRXURQ5HDOWRUFDRURXUZHEVLWHZZZUHPD[SUDLULHPRXQWDLQQSZDPEFRP RU Call 204-867 3816

Subscribe to The Minnedosa Tribune


AC
MAIL THIS FORM WITH PAYMENT TO BOX 930,
MINNEDOSA, MB R0J 1E0 PHONE 204-867-3816
Local Trading Area: $43.11 NAME: M&M
(Minnedosa, Bethany, Clanwilliam,
Erickson, Onanole, Sandy Lake, Lake
AUTO BODY
Audy, Olha, Vista, Elphinstone,
All Auto Body Repairs
Newdale, Rapid City, Franklin, Ph: 867-2083 SEMI WITH LOW BED & END DUMP
Mountain Road and Neepawa)
ADDRESS: 5 Main St. North
Other Manitoba
locations: $50.31 CONSTRUCTION %ULDQV INSURANCE
Other Canadian
TOWN: PRAIRIE REDI-MIX 6NLG6WHHU
locations: $56.01 MINNEDOSA
Minnedosa - 867-3853
6HUYLFH INSURANCE SERVICES
PROVINCE: R eady Mix Conc rete
&RPSHWLWLYH5DWHV
Concrete forms, Rebar, Wire Mesh,
Weeping Tile, Concrete Sealer, Snap Ties Drivers Licenses, Autopac
Online subscriptions $35.00 General Insurance
www.minnedosatribune.com POSTAL CODE: All at Competitive
prices  Bruce McNabb broker
867-3946
The Minnedosa Tribune Friday, April 28, 2017 15

ELECTRICAL EAVESTROUGH LEGAL SALES SEPTIC SERVICES

SIMS & COMPA N Y Darwin /DNHVLGH


L a w O ffi c e Matthews
5 AND 6 continuous TV AND APPLIANCE 6HSWLF6HUYLFH
eavestrough
Norman H. Sims, Q.C. SALES AND SERVICE Potable water
Aerating
76 Main Street South Your Shaw Direct, Power Raking
Siding Roofing MINNEDOSA t 867-2717 delivery. Yard Clean Up
LG, Samsung, Bell
Soffit Fascia Lawn Mowing & Trimming
Closed cell Polyurethane Spray foam
Danby Dealer Book your portable
Hedge Trimming
*OHQ%XUJHVV Blow in Attic & Wall Fibre Insulation
Computer Sales and Service
Systems, Monitors &
toilets.
Erle Jury & Family
Small Branch Trimming
Fire Retardent Coating
(OHFWULFLDQ
Accessories Licensed Arborist Service
 PLUMBING Minnedosa, MB 867-2416
 Phone 867-3164 Cory Johnston Minnedosa
Email: mcreal@live.ca E-mail: darm112@mts.net Cell: 867-7558 (204) 476-4705
WAHOSKI www.johnstonyardcare.com
C. BURTON MECHANICAL LTD.
FERTILIZER
PLUMBING SELF-HELP RAINKIES
RAINKE'S
Enterprises Ltd. Sewage Service Prairie Mountain HVAC/R
Refridgeration Custom HEATING Heating
Air Conditioning,
Fertilizer GAS FITTING A.D.A.M. JIM BEAUMONT Ventilation/Air quality
Heating & Electrical
Floating AIR CONDITIONING
Anxiety Disorders 476-2483 Air Conditioning
30 Years
Call today to book your Association Owner/Operator Refrigeration
Ex perience!!
spring floating needs!
204-867-3121 of Manitoba Cell: 476-6591 Kitchen Equipment
or Commercial Gas Fitter
Bus : 867-3950 Darvin - 204-868-5869 204-476-5185 Support Group Dennis: 476-2766 Commercial & Residential
Fa x: 867-2340 service specialist
Robert - 204-867-7113 Meetings are held at
Neepawa Library 3rd Tuesday of
23 Hour Service Kent Brown
HILLSIDE the month 1 p.m. to 2:30 p.m. 1-204-867-7346
For more info call:
Plumbing & Heating Debbie Fisch
SERVICES
(204) 725-8550 LEONAS
Ty Burton St. Alphonsus Studio Of Image
ALCOHOLICS )DPLO\+DLU&DUH
&DOO*UHJJ
(48-4)
204-868-5358 ANONYMOUS
Catholic Church (PLQHQFH)DFLDOV
142
142 4th
4th St, NW.
GRAIN If you like to drink and can
St, NW. 3URGXFW
 HAULING That's your business
If you want to stop and can't
Minnedosa,MB
Minnedosa, MB 867-3831
867-3831
Mass Sunday 9:00 a.m.
3HGLFXUHV /&11DLOV
6SUD\7DQQLQJ
That's our business. 3LHUFLQJ
(\HODVK([WHQVLRQV
FINANCE Brian Horner Plumbing & Heating P.O. Box 36
or 867-3966 204-867-2287
Grain & Fertilizer Construction Alanon - 867-3308 67 Main St.
0LQQHGRVD Hauling MAIN OFFICE Alateen - 867-5121
&UHGLW8QLRQ 204-867-5458
copperwoodenterprise@gmail.com
867-3401 Minnedosa
Mtg. Times: 8:00 pm Tuesdays 3HRSOH+HOSLQJ3HRSOH TAC
PLUMBING & HEATING &RPPLWWHGWR&DULQJ Ventures Inc.
0DLQOLQH
Russ Huyghe
204-868-6376 Drug Problem? Phone (204) 857-6100 Waste
 CONSTRUCTION Narcotics Fax (204) 857-8389 Management &
%UDG5RVV Cody Huyghe cpcancerservices@shaw.ca
Anonymous can help Contracting

&DURO7D\ORU
204-867-7182 204-210-0502
OFFICE MANAGER Meetings every
www.centralplainscancercare.com
(204)476-0002
 Matt Saler
7HUU\0F/HQHKDQ
LEGAL 204-868-6886 Tuesday & Garbage Removal
Bin Rentals

Saturday at 7 p.m. Book this spot Construction Demolition
6XVDQ*ODVJRZ G ORD K E L LY Renovating

'HEELH6WUHOF]LN
Alexander Plumbing & Heating
at Calvary Temple,
221 Hamilton Street,
$5.52/week Household clean up
Estate clean ups

 Jackson Gas Fitting Neepawa, MB Call 204-867 3816


'DQ4XHVQHO
Law Office ph: 867-2084 TRADING

cell: 867-0346
6\OYLD)LUE\ B-116 Main St S
 Minnedosa, MB
&DQGLFH%URZQ
REAL ESTATE MLA FRONTIER
 867-3981
$OD\QD0F7DYLVK http://www.ajaxlaw.ca TRADING STORE
 CALL ME... FOR ALL YOUR
.LP5RELQVRQ 867-5551
REAL ESTATE NEEDS

7HUD3RSLHQ
Burgess Law Gently Used Furniture
 Office Clothing & Misc. Items
-RDQQH&ODUN
 51 Main Street S
204.759.3313 Donations
*D\OHQH-RKQVRQ
Minnedosa Toll Free 844.877.7767 Estate Sales

gregnesbittmla@mymts.net Pick-up & Deliveries
)D[ 867-2935
 burglaw@mts.net PETER HARRISON #7  515 4th Avenue
Phone/Text 867-5444 Burlington Place, Shoal Lake, MB
www.suttonharrison.com
16 Friday, April 28, 2017 The Minnedosa Tribune

Bridge Club
NEWDALE NEWS Results
By RAVENS GLEN WI graveside service con- eration. Along with her and congratulations to all Graham who underwent
ducted by Glenna Beau- Newdale Lamb relatives the cast, crew, musicians surgery recently in Win- April 20

W ed like to send our


sympathy to Nor-
man and Betty Jack and
champ of Rivers was held
at the Bend Cemetery on
Saturday April 22nd.
she leaves to mourn three
sons and their families.
Funeral service was held
and behind the scene
helpers, and it should be
an absolute blast!
nipeg. Our thoughts
are with you and Don as
you continue to recover
1st - Jim Burgess/
Lynn Burgess
family and to Annabelle The community for Florence on April 5th Susan and Ed LaSeuer Yvonne. 2nd - Albert Parsons/
and Ken Pirie of Strath- sends condolences to in Neepawa. of Brandon took our Sun- Dee McEachern is Linda Boys
clair on the passing of Jack and Xisra Lamb and Th e end of April day church service and visiting her children and 3rd - Doug Theissen/
their mother Jean Ger- family and to Jean Lamb means its drama time in we all enjoy the socializ- families in Strathclair and Boyd Grant
rard, last week, also to and family on the pass- Strathclair when Sister ing over coffeefollowing. then will be travelling to 4th - Carol Lonsdale/
brothers Delmar and Clar- ing of their Aunt Flor- Act hits the stage at the Their little granddaughter Carman on this weekend Lois Phillips
ence and their families. ence (Lamb) Bates of Bend Theatre for six nights Sage came along too. Did to enjoy a 45th Reunion 5th (Tie) - Wilf Taylor /
Jean had been in Morley Neepawa. Florence, age running. Months of work you see Eds picture in the of a community choir she Mel Harvey and
House PCH in Shoal Lake 97, was born in Newdale and rehearsals finally Brandon Sun last week sang with from its incep- Norman Peterson/
for some time. Jean cel- the youngest of six chil- end with another sold raking leaves in their yard? tion until she moved from John Cullen
ebrated her 99th birth- dren born to Watson and out crowd for this perfor- Wed like to send best the area. Theyll be per-
day last December 29th, Harriett Lamb and is the mance. This is the 35th wishes for continuing forming a concert to cel-
a wonderful long life. A last member of that gen- Production at the Bend good health to Yvonne ebrate with song!

*We accept Visa, Master Card & debit card purchases


Sale Dates: *We sell lottery tickets
*We deliver within town limits Monday - Friday at 4:00 p.m
($2 charge - $10 minimum order)
APRIL 28TH - MAY 4TH * Try one of our delicious BBQ chickens!
* We sell fruit, veggie & meat trays and fruit baskets
(STARTS FRIDAY9:00 A.M. - ENDS THURSDAY 9:00 P.M.) (24 hours notice is appreciated)
*Seniors Discount every Friday (65 & up) *We sell R.O. water

GROCERY
Kraft salad dressing asstd..................................................... 475ml ............. $2.49
FROZEN FOODS
FM pie lemon meringue ...........................................................1kg ............. $8.99
Kraft BBQ sauce asstd ............................455ml ..2/$3.00 Chapmans frozen yogurt asstd .................................................. 2lt ............. $4.49
Nestle Pure Life ............................................................... 24x500ml ............. $4.50 NN fruit punches, lemonade asstd.................................. 283ml ..........3/$2.00

MEATS
Sunlight, Purex detergent asstd ............................................ 1.47lt ............. $4.99
Mr. Clean ap cleaner summer citrus ...................................... 1.2lt ............. $3.79
GG canned vegetables asstd ................................................ 398ml ..........4/$5.00
Hellmanns real mayo/big squeeze mayo ....................890/750ml ............. $4.49
PC horseradish/roasted garlic mayo............................... 300ml ..........2/$5.00
Heinz picnic pack ............................. 3x375ml ...... $5.79 PC beef burgers asstd .......................................................1.36kg ........... $12.99
PC smokin stampede BBQ sauce .......................................... 1lt ............. $3.99 ML top dogs asstd ......................................450g ......$3.99
Diana sauce gourmet original/rib chicken ........................ 500ml ............. $2.99 PC smokies asstd ...................................................................1kg ............. $8.99
Frenchs mustard asstd......................................................... 400ml ..........2/$5.00 Pork shoulder blade steaks club pack ..................................................... $2.59/lb
Bicks relish bits squeeze ...................................................... 500ml ..........2/$6.00 Top Sirloin beef steak ........................................ $5.99/lb
HP steak sauce ...................................................................... 400ml ............. $3.99 Bone-in chicken breast ............................................................................ $3.49/lb

PRODUCE
Bicks pickles dill asstd..................................1lt..2/$7.00
Bicks sauerkraut wine ................................................................ 1lt ..........2/$7.00
Planters salted cashews ..........................................................225g ............. $4.49
NN marshmallows asstd .....................................................400g ............. $1.99
Nestle sparkling water lemon lime/raspberry lime ..... 12x355ml ............. $3.99
PC pop .....................................................................................2lt .............$0.99 Potatoes, Russet ...................................... 10lb ...... $3.99
NN ice cream cups ..............................................................36ea ............. $2.79 Iceberg lettuce ...............................................................................................$2.29
CSR freeze pops case ...................................................... 40x150ml ............. $8.99 Bartlett pears .............................................................................................$1.79/lb
Mr. Clean magic eraser original................................................2ea ............. $3.49 Red seedless grapes .................................................................................. $2.49/lb
Alcan foli wrap 50 .....................................................................1ea ............. $3.49 GH tomatoes on the vine ......................................................................... $1.79/lb
Tim Hortons orignal coffee tin ...............................................930g ...........$17.99 Pineapples ..............................................................$2.99
Miss Vickies chips asstd ..........................................................220g ............. $3.49 FM mini cucumbers ...................................................................8ct ............. $2.99
Smartfood asstd .......................................................................220g ..........2/$6.00 Broccoli .....................................................................................................$2.49/ea

BAKERY
Kool Aid jammers asstd ................................................. 10x181ml ............. $2.99
Fruite drinks, Tetley iced tea lemon asstd ............2lt ..3/$4.00
Sunlight hand dish detergent asstd..............................740-950ml ............. $2.49
Febreeze air effects asstd ........................................................275g .............$2.99
Glad easy tie garbage bags regular .........................................40ea ............. $9.99
NN 16oz blue beer cup ........................................................50pk ............. $3.99 Wonder bread, DItaliano buns asstd 450-568g ....$2.50
NN pickles asstd ..................................................................... 1lt ............. $2.99 Pizza crust asstd.......................................................................300g ............. $1.99
NN salad dressing asstd ................................................... 475ml ............. $1.99 Country Harvest bagel asstd ...................................................680g ............. $2.99
NN mayonnaise regular ................................................... 890ml ............. $3.49

/8&.<'2//$5
ALL PRICES ARE PLUS GST, PST & OTHER LEVIES WHERE APPLICABLE *WE RESERVE THE RIGHT TO LIMIT QUANTITIES
NN croutons asstd ...............................................................145g ..........2/$3.00
NN bbq sauce asstd .......................................................... 455ml ............. $1.49
NNmustard.......................................................................400ml.............$1.29
NN relish sweet green ...................................................... 375ml ............. $1.49

 ) 2 2 ' 6
NN olives green asstd ....................................................... 375ml ............. $1.99
NN cutlery asstd ..................................................................96ea .............$3.49
NN bar cheddar cheese asstd .............................................700g ............. $8.49
NN cheese slices asstd .............................500g ......$3.99 OPEN 9:00 AM - 9:00 PM, 7 DAYS A WEEK 70 Main Street South, Minnedosa 867-2821
NN sour cream asstd ........................................................ 500ml ............. $1.99 *PRICES AVAILABLE AT THE LUCKY DOLLAR IN MINNEDOSA ONLY

Das könnte Ihnen auch gefallen