Sie sind auf Seite 1von 63

MOVILIZACION:

Escherichia coli plasmid RSF1010, complete


sequence
GenBank: M28829.1

FASTA Graphics

Go to:
LOCUS RSFRMRA 8684 bp DNA linear BCT 23-JUL-2016
DEFINITION Escherichia coli plasmid RSF1010, complete sequence.
ACCESSION M28829
VERSION M28829.1 GI:152577
FEATURES Location/Qualifiers
source 1..8684
/organism="Escherichia coli"
/mol_type="genomic DNA"
/db_xref="taxon:562"
/plasmid="RSF1010"
CDS 63..866
/codon_start=1
/transl_table=11
/product="Sm resistance protein A"
/protein_id="AAA26442.1"
/db_xref="GI:551976"
/translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASR
RGELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAW
PSMGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPLHDLL
ARVERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLA
LMIANAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG"

CDS 866..1702
/codon_start=1
/transl_table=11
/product="Sm resistance protein B"
/protein_id="AAA26443.1"
/db_xref="GI:152579"
/translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLK
PIEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATE
IAAELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMM
SNASELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDP
RRIAQMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQT
SY"
NO NE NECESITA DELIMITAR DESDE 1702 PORQ EL MOBC ESTA EN LA BANDA NEGATIVA
CDS complement(2767..3051)
/codon_start=1
/transl_table=11
/product="mobilization protein C"
/protein_id="AAA26444.1" GEN AUXILIAR,ACCESORIO
/db_xref="GI:152580"
/translation="MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRR
KVLVGAMILAKVNSSEWPEDRLMAAMDAYLERDHDRALFGLPPRQKDEPG"
CDS 3250..5379
/codon_start=1
/transl_table=11
/product="mobilization protein A"
/protein_id="AAA26445.1" PUEDE SER LA RELAXAZA PPOR SU TAMAO
/db_xref="GI:152581"
/translation="MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAES
GHMPEFVERPADYWDAADLYERANGRLFKEVEFALPVELTLDQQKALASEFAQHLTGA
ERLPYTLAIHAGGGENPHCHLMISERINDGIERPAAQWFKRYNGKTPEKGGAQKTEAL
KPKAWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGPNVVEMEGR
GIRTDRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEH
GDTGRRSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERP
ERVAGVALEAMANRDAGFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRT
LQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKRMNAQGNDVYIR
PAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKNYQAWVKVADAAGGELRGQ
IARTLASEYDADPASADSRHYGRLAGFTNRKDKHTTRAGYQPWVLLRESKGKTATAGP
ALVQQAGQQIEQAQRQQEKARRLASLELPERQLSRHRRTALDEYRSEMAGLVKRFGDD
LSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKPGHEADYIERTVSKVMGLPSV
QLARAELARAPAPRQRGMDRGGPDFSM"
CDS 3998..4411
/codon_start=1
/transl_table=11
/product="mobilization protein B"
/protein_id="AAA26446.1"
/db_xref="GI:152582"
/translation="MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQA
SEAQAAEWLKAQRQTGAAWVELAKELREVAAEVSSAAQSARSASRGWHWKLWLTVMLA
SMMPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR"
CDS 4408..5379
/codon_start=1
/transl_table=11
/product="replication protein B"
/protein_id="AAA26447.1"
/db_xref="GI:152583"
/translation="MKNDRTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEV
LQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSP
KNYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKDKHTTRA
GYQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQEKARRLASLELPERQLSRHRR
TALDEYRSEMAGLVKRFGDDLSKCDFIAAQKLASRGRSAEEIGKAMAEASPALAERKP
GHEADYIERTVSKVMGLPSVQLARAELARAPAPRQRGMDRGGPDFSM"
REGION QU ECONTIENE LA MOBILIXACON 2767-5379

CDS 5440..5652 DESDE AQUI YA NO PERTENECE


/codon_start=1
/transl_table=11
/product="unknown protein E"
/protein_id="AAA26448.1"
/db_xref="GI:152584"
/translation="MEYEKSASGSVYLIKSDKGYWLPGGFGYTSNKAEAGRFSVADMA
SLNLDGCTLSLFREDKPFGPGKFLGD"
CDS 5654..5860
/note="putative; putative"
/codon_start=1
/transl_table=11
/product="repressor protein F"
/protein_id="AAA26449.1"
/db_xref="GI:152585"
/translation="MKDQKDKQTGDLLASPDAVRQARYAERMKAKGMRQRKFWLTDDE
YEALRECLEELRAAQGGGSDPASA"
CDS 5890..6729
/codon_start=1
/transl_table=11
/product="replication protein A"
/protein_id="AAA26450.1"
/db_xref="GI:152586"
/translation="MATHKPINILEAFAAAPPPLDYVLPNMVAGTVGALVSPGGAGKS
MLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAV
ADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVI
GRMEAIAADTGCSIVFLHHASKGAAMMGAGDQQQASRGSSVLVDNIRWQSYLSSMTSA
EAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHDGGVLKPAVLERQRKSKGVPR
GEA"
CDS 6716..7567
/codon_start=1
/transl_table=11
/product="replication protein C"
/protein_id="AAA26451.1"
/db_xref="GI:152587"
/translation="MVKPKNKHSLSHVRHDPAHCLAPGLFRALKRGERKRSKLDVTYD
YGDGKRIEFSGPEPLGADDLRILQGLVAMAGPNGLVLGPEPKTEGGRQLRLFLEPKWE
AVTAECHVVKGSYRALAKEIGAEVDSGGALKHIQDCIERLWKVSIIAQNGRKRQGFRL
LSEYASDEADGRLYVALNPLIAQAVMGGGQHVRISMDEVRALDSETARLLHQRLCGWI
DPGKTGKASIDTLCGYVWPSEASGSTMRKRRQRVREALPELVALGWTVTEFAAGKYDI
TRPKAAG"
CDS 7875..8663
/codon_start=1
/transl_table=11
/product="Su resistance protein"
/protein_id="AAA26452.1"
/db_xref="GI:152588"
/translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADV
IDLVRHPAIPTPRLFRPTQKSRVCAGAGRAQADGIPVSLDSYQPATQAYALSRGVAYL
NDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAAL
TGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRAL
TGRGPGVSGPRHSLQSLPPPQVELTSSAHTSRAPCATGWRYWRR"

S.agalactiae plasmid pMV158 repA, repB, tetL, pre


and mob genes
GenBank: X15669.1

FASTA Graphics

Go to:
LOCUS X15669 5541 bp DNA linear BCT 26-JUL-2016
DEFINITION S.agalactiae plasmid pMV158 repA, repB, tetL, pre and mob genes.
ACCESSION X15669
VERSION X15669.1 GI:46662
KEYWORDS plasmid; pre gene; repA gene; repB gene; tetL gene.
SOURCE Streptococcus agalactiae
kerklaan 30, 9751 NN Haren, Netherland
FEATURES Location/Qualifiers
source 1..5541
/organism="Streptococcus agalactiae"
/mol_type="genomic DNA"
/db_xref="taxon:1311"
/plasmid="pMV158"
CDS 655..792
/note="unnamed protein product; repA protein (AA 1-45)"
/codon_start=1
/transl_table=11
/protein_id="CAA33710.1"
/db_xref="GI:46663"
/db_xref="GOA:P13920"
/db_xref="InterPro:IPR002145"
/db_xref="InterPro:IPR010985"
/db_xref="InterPro:IPR013321"
/db_xref="PDB:1B01"
/db_xref="PDB:1EA4"
/db_xref="PDB:2CPG"
/db_xref="UniProtKB/Swiss-Prot:P13920"
/translation="MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQE
K"
CDS 853..1485
/note="unnamed protein product; repB protein (AA 1-210)"
/codon_start=1
/transl_table=11
/protein_id="CAA33711.1"
/db_xref="GI:46664"
/db_xref="GOA:P13921"
/db_xref="InterPro:IPR002631"
/db_xref="PDB:3DKX"
/db_xref="PDB:3DKY"
/db_xref="UniProtKB/Swiss-Prot:P13921"
/translation="MAKEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKS
SIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTH
ESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFD
LYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKRGTKNEER"
CDS 1736..3112
/note="unnamed protein product; tetL protein (AA 1-458)"
/codon_start=1
/transl_table=11
/protein_id="CAA33712.1"
/db_xref="GI:581578"
/db_xref="GOA:P13924"
/db_xref="InterPro:IPR001411"
/db_xref="InterPro:IPR011701"
/db_xref="InterPro:IPR016196"
/db_xref="InterPro:IPR020846"
/db_xref="UniProtKB/Swiss-Prot:P13924"
/translation="MNTSYSQSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDF
NKPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSF
FSLLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGVGPAIVG
MIAHYIHWSYLLLIPMITIITVPFLMKLLKKEVRIKGHFDIKGIILMSVGIVFFMLFT
TSYSISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNILFMIGVLCGGIIFGTVAGFV
SMVPYMMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLS
VSFLTAFFLLETTSWFMTIIIVFVLGGLSFTKTVIPTIVSSSLKQQEAGAGMSLLNFT
SFLSEGTGIAIVGGLLSIPLLDQRLLPMGVDQSTYLYSNLLLLFSGIIVISGLVTVNV
YKHSQRDF"
CDS 3733..5217
/note="unnamed protein product; pre protein (AA 1-494)"
/codon_start=1
/transl_table=11
/protein_id="CAA33713.1"
/db_xref="GI:46666"
/db_xref="GOA:P13925"
/db_xref="InterPro:IPR001668"
/db_xref="UniProtKB/Swiss-Prot:P13925"
/translation="MSYMVARMQKMKAGNLGGAFKHNERVFETHSNKDINPSRSHLNY
ELTDRDRSVSYEKQIKDYVNENKVSNRAIRKDAVLCDEWIITSDKDFFEKLDEEQTRT
FFETAKNYFAENYGESNIAYASVHLDESTPHMHMGVVPFENGKLSSKAMFDREELKHI
QEDLPRYMSDHGFELERGKLNSEAKHKTVAEFKRAMADMELKEELLEKYHAPPFVDER
TGELNNDTEAFWHEKEFADMFEVQSPIRETTNQEKMDWLRKQYQEELKKLESSKKPLE
DDLSHLEELLDKKTKEYIKIDSEASERASELSKAEGYINTLENHSKSLEAKIECLESD
NLQLEKQKATKLEAKALNESELRELKPKKNFLGKEHYELSPEQFEGLKAEVYRSRTLL
HHKDIELEQAKRQVSLRASKNYFTASLERAKEKAKGESIDRLKSEIKRLKNENSILRQ
QNDKMLGKLRELMPDKAFKNLLSELKAIKPIVNIIKKAIEKSLF"

unnamed protein product (plasmid) [Streptococcus


agalactiae]
GenBank: CAA33713.1

Identical Proteins FASTA Graphics

Go to:
LOCUS CAA33713 494 aa linear BCT 26-JUL-2016
DEFINITION unnamed protein product (plasmid) [Streptococcus agalactiae].
ACCESSION CAA33713

FEATURES Location/Qualifiers
source 1..494
/organism="Streptococcus agalactiae"
/db_xref="taxon:1311"
/plasmid="pMV158"
Protein 1..494
/name="unnamed protein product"
Region 1..193
/region_name="Mob_Pre"
/note="Plasmid recombination enzyme; pfam01076"
/db_xref="CDD:279423"
Region <258..307
/region_name="RRF"
/note="Ribosome recycling factor (RRF). Ribosome recycling
factor dissociates the posttermination complex, composed
of the ribosome, deacylated tRNA, and mRNA, after
termination of translation. Thus ribosomes are 'recycled'
and ready for another round of...; cl00240"
/db_xref="CDD:294170"
CDS 1..494
/coded_by="X15669.1:3733..5217"
/note="pre protein (AA 1-494)"
/transl_table=11
/db_xref="GOA:P13925"
/db_xref="InterPro:IPR001668"
/db_xref="UniProtKB/Swiss-Prot:P13925"
RUN BLAS

494aa
Prediccion: esta en laa region 3112-
373
La regin que contiene es la regin 5 prima y termina el 5217
Tipo de plasmido: movilizable

CUANDO ES CONJUGATIVO
Escherichia coli strain NCM3722 plasmid F, complete sequence

NCBI Reference Sequence: NZ_CP011496.1

FASTA Graphics

Go to:
LOCUS NZ_CP011496 67545 bp DNA circular CON 18-JUN-2016
DEFINITION Escherichia coli strain NCM3722 plasmid F, complete sequence.
ACCESSION NZ_CP011496
VERSION NZ_CP011496.1 GI:874443590
DBLINK BioProject: PRJNA224116
FEATURES Location/Qualifiers
source 1..67545
/organism="Escherichia coli"
/mol_type="genomic DNA"
/strain="NCM3722"
/isolate="K-12"
/host="Homo sapiens"
/db_xref="taxon:562"
/plasmid="F"
/country="USA: California"
/collection_date="24-May-2014"
gene 14..133
/locus_tag="AA953_RS23230"
/old_locus_tag="AA953_23295"
CDS 14..133
/locus_tag="AA953_RS23230"
/old_locus_tag="AA953_23295"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001302191.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_014106970.1"
/db_xref="GI:503872976"
/translation="MPLAAKVLKKVMVNTGGNKRQVPAKRQNRGSRNSKDDGG"
gene 158..445
/locus_tag="AA953_RS23235"
/old_locus_tag="AA953_23300"
CDS 158..445
/locus_tag="AA953_RS23235"
/old_locus_tag="AA953_23300"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000107535.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000107542.1"
/db_xref="GI:446029687"
/translation="MSTRNIHVNTASYTLLVAGKKKNTGEEWDVLEFSSLTELKKYRK
SHPEKMAFSYSYALSRGVDTQFRHINIAEADHFKQFLRQIKRAGLDIRAIC"
gene 480..1385
/locus_tag="AA953_RS23240"
/old_locus_tag="AA953_23305"
CDS 480..1385
/locus_tag="AA953_RS23240"
/old_locus_tag="AA953_23305"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001364563.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_061066766.1"
/db_xref="GI:992379438"
/translation="MLLIVTRGDDIKRKNFLLNLFFHKGVAVMRLASRFGRYNSIHRE
RPLTDDELMQFVPSVFSGDKHESRSERYTYIPTINIINKLRDEGFQPFFACQSRVRDL
GRREYSKHMLRLRREGHINGQEVPEIILLNSHDGSSSYQMIPGIFRFVCTNGLVCGNN
FGEIRVPHKGDIVGQVIEGAYEVLGVFDKVTDNMEAMKEIHLNSDEQHLFGRAALMVR
YEDENKTPVTPEQIITPRRWEDKQNDLWTTWQRVQENMIKGGLSGRSASGKNTRTRAI
TGIDGDIRINKALWVIAEQFRKWKS"
gene complement(1681..2190)
/locus_tag="AA953_RS23245"
/old_locus_tag="AA953_23310"
CDS complement(1681..2190)
/locus_tag="AA953_RS23245"
/old_locus_tag="AA953_23310"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P47737.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="X polypeptide"
/protein_id="WP_000759160.1"
/db_xref="GI:446681814"
/translation="MKKWMLAICLMFINEICHATDCFDLAGRDYKIDPDLLRAISWKE
SRYRVNAIGINPVTGYGSGLMQVDSQHFNELARYGIKPEHLTTDPCMNIYTGAYYLAI
AFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASDVYRIYTGIKSSKGIRIPATKKSL
PEINSVQNN"
gene 2604..2987 ESE GENE Y CDS NOS DA PRODUCTO TraM DE LA CONJUGACION
/locus_tag="AA953_RS23250"
/old_locus_tag="AA953_23315"
CDS 2604..2987 TIRA POSITIVA
/locus_tag="AA953_RS23250"
/old_locus_tag="AA953_23315"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001151524.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraM"
/protein_id="WP_001151527.1"
/db_xref="GI:447074271"
/translation="MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLE
LGLRVHEAQMERKESAFNQTEFNKLLLECVVKTQSSVAKILGIESLSPHVSGNSKFEY
ANMVEDIREKVSSEMERFFPKNDDE"
gene 3174..3863
/locus_tag="AA953_RS23255"
/old_locus_tag="AA953_23320"
CDS 3174..3863
/locus_tag="AA953_RS23255"
/old_locus_tag="AA953_23320"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000283385.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraJ"
/protein_id="WP_000283385.1"
/db_xref="GI:446205530"
/translation="MYPMDRIQQKHARQIDLLENLTAVIQDYPNPACIRDETGKFIFC
NTLFHESFLTQDQSAEKWLLSQRDFCELISVTEMEAYRNEHTHLNLVEDVFIQNRFWT
ISVQSFLNGHRNIILWQFYDAAHVRHKDSYNQKTIVSDDIRNIIRRMSDDSSVSSYVN
DVFYLYSTGISHNAIARILNISISTSKKHASLICDYFSVSNKDELIILLYNKKFIYYL
YEKAMCIINTR"
gene 3962..4357
/locus_tag="AA953_RS23260"
/old_locus_tag="AA953_23325"
CDS 3962..4357
/locus_tag="AA953_RS23260"
/old_locus_tag="AA953_23325"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001366159.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="relaxosome protein TraY"
/protein_id="WP_001309237.1"
/db_xref="GI:485668067"
/translation="MKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIR
LKDHLHRYPKFNRAGNIYGKSLVKYLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVI
DHLIKFPDFYNSEIFREADKEEDITFNTL"
gene 4390..4755
/locus_tag="AA953_RS23265"
/old_locus_tag="AA953_23330"
CDS 4390..4755
/locus_tag="AA953_RS23265"
/old_locus_tag="AA953_23330"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000994779.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="pilin"
/protein_id="WP_000994779.1"
/db_xref="GI:446917523"
/translation="MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMF
FPQLAMAAGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFL
AGFAIISVFIAVGMAVVGL"
gene 4770..5081
/locus_tag="AA953_RS23270"
/old_locus_tag="AA953_23335"
CDS 4770..5081
/locus_tag="AA953_RS23270"
/old_locus_tag="AA953_23335"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000012106.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer pilus assembly protein TraL"
/protein_id="WP_000012106.1"
/db_xref="GI:445934251"
/translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGITT
SKYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
K"
gene 5103..5669
/locus_tag="AA953_RS23275"
/old_locus_tag="AA953_23340"
CDS 5103..5669
/locus_tag="AA953_RS23275"
/old_locus_tag="AA953_23340"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_016235958.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraE"
/protein_id="WP_000399792.1"
/db_xref="GI:446321937"
/translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNVIQGVNNYRLQNE
QRTAVTPMAFNAPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRP
GAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
IKHYILILKRENGVTWLDNFGETDDEKK"
gene 5656..6384
/locus_tag="AA953_RS23280"
/old_locus_tag="AA953_23345"
CDS 5656..6384
/locus_tag="AA953_RS23280"
/old_locus_tag="AA953_23345"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001230787.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraK"
/protein_id="WP_001230787.1"
/db_xref="GI:447153531"
/translation="MRKNNTAIIFGSLFFSCSVMAANGTLAPTVVPMVNGGQASIAIS
NTSPNLFTVPGDRIIAVNSLDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLS
IQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQV
PVTKETLQAPAGLSSVADAVWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMF
SQPASQLLAGARMDVYVIRDGEGN"
gene 6384..7811
/locus_tag="AA953_RS23285"
/old_locus_tag="AA953_23350"
CDS 6384..7811
/locus_tag="AA953_RS23285"
/old_locus_tag="AA953_23350"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001553749.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraB"
/protein_id="WP_000146685.1"
/db_xref="GI:446068830"
/translation="MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGET
VAEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDD
QRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPP
QGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPSLPYIPSGS
FAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSS
ERAIVRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDG
IGQGMERASQPAVGLGATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIP
IGAGNEVTVVFQDGFQLKTVEEMALERTQSRAEEDNPESPVPVPPSAESHLNGFNTDQ
MLKQLGNLNPQQFMSGSQGGGNDGK"
gene 7801..8391
/locus_tag="AA953_RS23290"
/old_locus_tag="AA953_23355"
CDS 7801..8391
/locus_tag="AA953_RS23290"
/old_locus_tag="AA953_23355"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001528624.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraP"
/protein_id="WP_000002792.1"
/db_xref="GI:445924937"
/translation="MANNMSSRQACHAARYVVARVLRGLFWCLKYTVILPLATMALMA
LFVLWKDNTTPGKLLVKEINFVRQTAPAGQFPVSECWFSSSDSSGRSEIQGICHYRAA
DAADYVRETDRSLMQLVTALWATLALMYVSLAAITGKYPVRPGKMKCIRVVTADEHLK
EVYTEDASLPGKIRKCPVYLPDDRTNRNNGDKNEHA"
gene 8378..8575
/locus_tag="AA953_RS23295"
/old_locus_tag="AA953_23360"
CDS 8378..8575
/locus_tag="AA953_RS23295"
/old_locus_tag="AA953_23360"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001423674.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TrbD"
/protein_id="WP_001443030.1"
/db_xref="GI:485828212"
/translation="MNMRNINVITVLSVPGKTVSDDFMHAVLSNCATRIVLPAPEKFG
SESLPDNFNMTAVGVMKNSEI"
gene 8587..8838
/locus_tag="AA953_RS23300"
/old_locus_tag="AA953_23365"
CDS 8587..8838
/locus_tag="AA953_RS23300"
/old_locus_tag="AA953_23365"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001038337.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TrbG"
/protein_id="WP_001038342.1"
/db_xref="GI:446961086"
/translation="MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVA
YVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKGEGQ"
gene 8835..9350
/locus_tag="AA953_RS23305"
/old_locus_tag="AA953_23370"
CDS 8835..9350
/locus_tag="AA953_RS23305"
/old_locus_tag="AA953_23370"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_016233168.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraV"
/protein_id="WP_000809843.1"
/db_xref="GI:446732587"
/translation="MKQISFFIPLLGTLLLYGCAGTSTEFECNATTSDTCMTMEQANE
KAKKLERSSEAKPVAASLPRLAEGNFRTMPVQTVTATTPSGSRPAVTAHPEQKLLAPR
PLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVI
KPSAWGKPRIN"
gene 9866..12493
/locus_tag="AA953_RS23315"
/old_locus_tag="AA953_23380"
CDS 9866..12493
/locus_tag="AA953_RS23315"
/old_locus_tag="AA953_23380"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001064255.1"
/note="similar to VirB4; Derived by automated
computational analysis using gene prediction method:
Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraC"
/protein_id="WP_001064243.1"
/db_xref="GI:446986987"
/translation="MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLL
PYRDYNQESGLFMNDTTMGFMLEAIPINGANESIVEALDHMLRTKLPRGIPLCIHLMS
SQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAATQFPLPEGMNLPLTLRHYRV
FISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIVGEMINHNPD
SLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPE
IAFLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSY
AKWFPSVEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFR
KNGFELISPRFNHMRNFLTCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADNP
LTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSGG
FAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSVMASPNG
NLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIV
LLDQYTANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRM
YRTPRNLKKLNVIDEGWRLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSD
KASSAARAAWGNSSYKIILKQSAKEFAKYNQLYPDQFLPLQRDMIGKFGAAKDQWFSS
FLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGLSIHEAVWQLAWKKSGP
EMASLEAWLEEHEKYRSVA"
gene 12490..12876
/locus_tag="AA953_RS23320"
/old_locus_tag="AA953_23385"
CDS 12490..12876
/locus_tag="AA953_RS23320"
/old_locus_tag="AA953_23385"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000214080.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TrbI"
/protein_id="WP_000099690.1"
/db_xref="GI:446021835"
/translation="MSSTQKPADVTAERRSHWWWTVPGCLAMVLLNAAVSYGIVRLNA
PVTVAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVS
PAVVQGAPDITREIQQDIARRMRAEP"
gene 12873..13505
/locus_tag="AA953_RS23325"
/old_locus_tag="AA953_23390"
CDS 12873..13505
/locus_tag="AA953_RS23325"
/old_locus_tag="AA953_23390"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001203750.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraW"
/protein_id="WP_001203720.1"
/db_xref="GI:447126464"
/translation="MRCRGLIALLIWGQSVAAADLGTWGDLWPVKEPDMLTVIMQRLT
ALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYGSRLFDPSVRLAADIRDNEG
RVFARQGEVMNPLQYVPFNQTLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEM
QKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK"
gene 13502..14494
/locus_tag="AA953_RS23330"
/old_locus_tag="AA953_23395"
CDS 13502..14494
/locus_tag="AA953_RS23330"
/old_locus_tag="AA953_23395"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_004150659.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraU"
/protein_id="WP_000830185.1"
/db_xref="GI:446752929"
/translation="MKRRLWLLMLFLFAGHVPAASADSACEGRFVNPITDICWSCIFP
LSLGSIKVSQGKVPDTANPSMPIQICPAPPPLFRRIGLAIGYWEPMALTDVTRSPGCM
VNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYPLTYWLNIITSLGCLEGGDMD
IAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLDVLFWCAGS
QGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILP
KERWRYQMVNMYPDSGQCHPFGRSVTRWETGKNPPNTKKNFGYLMWRKRNCVFL"
gene 14503..15141
/locus_tag="AA953_RS23335"
/old_locus_tag="AA953_23400"
CDS 14503..15141
/locus_tag="AA953_RS23335"
/old_locus_tag="AA953_23400"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001553832.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="periplasmic protein TrbC"
/protein_id="WP_000777688.1"
/db_xref="GI:446700342"
/translation="MKLSMKSLAALLMMLNGAVMASENVNTPENRQFLKQQENLSRQL
REKPDHQLKAWAEKQVLENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPE
EGLKRMLGETRHFGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTLFSQYGI
RTVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDSGK"
gene 15138..16946
/locus_tag="AA953_RS23340"
/old_locus_tag="AA953_23405"
CDS 15138..16946
/locus_tag="AA953_RS23340"
/old_locus_tag="AA953_23405"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001756807.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraN"
/protein_id="WP_000821835.1"
/db_xref="GI:446744579"
/translation="MKRILPLILALVAGMAQADSNSDYRAGSDFAHQIKGQGSSSIQG
FKPQESIPGYNANPDETKYYGGVTAGGDGGLKNDGTTEWATGETGKTITESFMNKPKD
ILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQEISRSEYTNYTCERDLQVEQYCTRT
ARMELQGSTTWETRTLEYEMSQLPAREVNGQYVVSITSPVTGEIVDAHYSWSRTYLQK
SVPMTITVLGTPLSWNAKYSADASFTPVQKTLTAGVAFTSSHPVRVGNTKFKRHTAMK
LRLVVRVKKASYTPYVVWSESCPFSKELGKLTKTECTEAGGNRTLVKDGQSYSMYQSC
WAYRDTYVTQSADKGTCQTYTDNPACTLVSHQCAFYSEEGACLHEYATYSCESKTSGK
VMVCGGDVFCLDGECDKAQSGKSNDFAEAVSQLAALAAAGKDVAALNGVDVRAFTGQA
KFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLTVSVGEFCSKKVLGV
CLEKKRSYCQFDSKLAQIVQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQFNRLDF
TNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ"
gene 16973..17230
/locus_tag="AA953_RS23345"
/old_locus_tag="AA953_23410"
CDS 16973..17230
/locus_tag="AA953_RS23345"
/old_locus_tag="AA953_23410"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000864329.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TrbE"
/protein_id="WP_000864318.1"
/db_xref="GI:446787062"
/translation="MKVIFTSNRFIDFLIRLLITAIVISPVIIWSWDTVKETTADGML
AAAFVILYSGVLLFILYFCFSALTDLQKPDERKSDERNEDE"
gene 17223..17966
/locus_tag="AA953_RS23350"
/old_locus_tag="AA953_23415"
CDS 17223..17966
/locus_tag="AA953_RS23350"
/old_locus_tag="AA953_23415"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001030376.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraF"
/protein_id="WP_001030367.1"
/db_xref="GI:446953111"
/translation="MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAA
PRQEPDIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWAQQAGLFTMSARKA
MLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQL
AQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGS
VRPLSYGFISQDDLAKQFLNVSEDFKPNF"
gene 17982..18329
/locus_tag="AA953_RS23355"
/old_locus_tag="AA953_23420"
CDS 17982..18329
/locus_tag="AA953_RS23355"
/old_locus_tag="AA953_23420"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001287890.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TrbA"
/protein_id="WP_001287913.1"
/db_xref="GI:447210657"
/translation="MSEDYLKMFTGVVLLIFVIIAGYFFSERNDRKMFLLSSLVFLVV
NIACLYVLTASLWFLCGAIMSQGAALVVSIVAAALPDVTSFDRFRRIFICIMLSSVWS
GVMWFFIRGLMTG"
gene complement(18331..18645)
/locus_tag="AA953_RS23360"
/old_locus_tag="AA953_23425"
CDS complement(18331..18645)
/locus_tag="AA953_RS23360"
/old_locus_tag="AA953_23425"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001490797.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein ArtA"
/protein_id="WP_000415566.1"
/db_xref="GI:446337711"
/translation="MEKRSFKEKLEIIRNIIRESLLGNAAIIALIYAASHSLPVNAFP
DYLVISLLSIAAGIVVLWLFSIIYIYFCELFRSHWIAVWFIIWSSVINLIILYGFYDR
FI"
gene 18726..19010
/locus_tag="AA953_RS23365"
/old_locus_tag="AA953_23430"
CDS 18726..19010
/locus_tag="AA953_RS23365"
/old_locus_tag="AA953_23430"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001617873.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraQ"
/protein_id="WP_000624109.1"
/db_xref="GI:446546763"
/translation="MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLA
ELIAAILVLFGAYQVLDAWIARVSREEREALEARQQAMMEGQQEGGHVSH"
gene 18997..19542
/locus_tag="AA953_RS23370"
/old_locus_tag="AA953_23435"
CDS 18997..19542
/locus_tag="AA953_RS23370"
/old_locus_tag="AA953_23435"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000052622.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TrbB"
/protein_id="WP_000059850.1"
/db_xref="GI:445981995"
/translation="MSLTKSLLFTLLLSAAAVQASTRDEIERLWNPQGMATQPAQPAA
GTSARTAKPAPRWFRLSNGRQVNLADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSV
FSYTLDGQGDTAFPEALPVPPDVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGATDA
AGFMARVDTVLQMYGGKKGAK"
gene 19532..19813
/locus_tag="AA953_RS23375"
/old_locus_tag="AA953_23440"
CDS 19532..19813
/locus_tag="AA953_RS23375"
/old_locus_tag="AA953_23440"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_016233153.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TrbJ"
/protein_id="WP_001244898.1"
/db_xref="GI:447167642"
/translation="MRNKQVVLLIAGISGIVTGIIVSLNIPFIRQGLFYPASPVEIVV
SLSLTFSVSVVFFVGAIVGWISVSEIYYSRMTGLNESSEISEGTYNERK"
gene 19800..20180
/locus_tag="AA953_RS23380"
/old_locus_tag="AA953_23445"
CDS 19800..20180
/locus_tag="AA953_RS23380"
/old_locus_tag="AA953_23445"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001389370.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TrbF"
/protein_id="WP_001366201.1"
/db_xref="GI:485738971"
/translation="MRENKSNPELKIRSTERDYKYISRITGRYAGLSLVFLTAGIVLW
TVMDIIFDACIDSWKADPELNNSSYMWNILIYAIPYTLYALAAGFLVTFFSVPNVRIN
IRKYRDIPAEMSYAPGEHIKGGQE"
gene 20177..21553
/locus_tag="AA953_RS23385"
/old_locus_tag="AA953_23450"
CDS 20177..21553
/locus_tag="AA953_RS23385"
/old_locus_tag="AA953_23450"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P15069.2"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraH"
/protein_id="WP_000982831.1"
/db_xref="GI:446905575"
/translation="MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTT
QPGVWQGQAAGYAYGGSLYARTQVKNVQLISMTLPDINAGCGGIDAYLGSFSFINGEQ
LQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQKMASDINSMNLSSCQAAQGIIG
GLFPRTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGKSDSVRDKASDKDKERVTKN
INIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEG
GTAKISHCNDSDKCLKVVADTPVTISRDNALKSQITKLLASIQNKAVSDTPLDDKEKG
FISSTTIPVFKYLVDPQMLGVSNSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNY
DEAVIGHINDNMNDATRQIAAFQSQVQVQQDALLVVDRQMSYMRQQLSARMLSRYQNN
YHFGGSTL"
gene 21550..24366
/locus_tag="AA953_RS23390"
/old_locus_tag="AA953_23455"
CDS 21550..24366
/locus_tag="AA953_RS23390"
/old_locus_tag="AA953_23455"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P33790.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraG"
/protein_id="WP_001007055.1"
/db_xref="GI:446929799"
/translation="MNEVYVIAGGEWLRNNLNAIAAFMGTWTWDSIEKIALTLSVLAV
AVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPL
SLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGANLIVKSTDFLSRNPEIINLFQDY
VQNCVLGDIYLNHKYTLEDLMASADPYTLIFSRPSPLRGVYDNNNNFITCKDASVTLK
DRLNLDTKTGGKTWHYYVQQIFGGRPDPDLLFRQLVSDSYSYFYGSSQSASQIMRQNV
TMNALKEGITSNAARNGDTASLVSLATTSSMEKQRLAHVSIGHVTMRNLPMVQTILTG
IAIGIFPLLILAAVFNKLTLSVLKGYVFALMWLQTWPLLYAILNSAMTFYAKQNGAPV
VLSELSQIQLKYSNLASTAGYLSAMIPPLSWMMVKGLGAGFSSVYSHFASSSISPTAS
AAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDA
SGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNTLSQFGSNRG
SSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATRELASRSTNASLGLY
GDAYAKGHLGISVLGNGGGVGLQAGAKASIDGSDLDSHEASSGSRASHDARHDIDARA
TQDFKEASDYFTSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEY
AEMASRTESMSGQMSEDLSQQFAQYVMKNAPQDVEAILTNTSSPEIAERRRAMAWSFV
QEQVQPGVDNTWRESRRDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSNIRND
VKHQVDNMVTEYRGNIGDTQNSIRGEENIVKGQYSELQNHHKTEALTQNNKYNEEKLA
QERIPGADSPKELLEKAKSYQHKE"
gene 24693..24920
/locus_tag="AA953_RS23395"
/old_locus_tag="AA953_23460"
CDS 24693..24920
/locus_tag="AA953_RS23395"
/old_locus_tag="AA953_23460"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001594912.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraS"
/protein_id="WP_042047709.1"
/db_xref="GI:754666256"
/translation="MRVISSKLKVYFIVYMGVIFLWSFLGGGIIYGFGAILVTVIMAF
LIQLDIGRYQFVGVIDAINSYVKNKKLSRVK"
gene 24945..25676
/locus_tag="AA953_RS23400"
/old_locus_tag="AA953_23465"
CDS 24945..25676
/locus_tag="AA953_RS23400"
/old_locus_tag="AA953_23465"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000850426.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="conjugal transfer protein TraT"
/protein_id="WP_000850422.1"
/db_xref="GI:446773166"
/translation="MKTKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIW
LEPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKAD
KMDLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMVE
DVNYTMITDVQIAERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNAN
KVNLKFEEAKPVLEDQLAKSIANIL"
gene 25929..28082
/locus_tag="AA953_RS23405"
/old_locus_tag="AA953_23470"
CDS 25929..28082
/locus_tag="AA953_RS23405"
/old_locus_tag="AA953_23470"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000009324.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="coupling protein TraD"
/protein_id="WP_000009350.1"
/db_xref="GI:445931495"
/translation="MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLV
LWIKISWQTFVNGCIYWWCTTLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMI
WCSEQLWSAFVLAAVVALVICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVA
RMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVI
YDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDP
FWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIE
KTAISIRAVLTNYVKAIRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHA
SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCY
VFGIQSYAQLEDIYGEKAAASLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQ
YSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQTRP
KVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQ
PVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQ
QENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF"
gene complement(28091..28489)
/locus_tag="AA953_RS23410"
/old_locus_tag="AA953_23475"
CDS complement(28091..28489)
/locus_tag="AA953_RS23410"
/old_locus_tag="AA953_23475"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000911311.1"
/note="stability determinant protein; Derived by automated
computational analysis using gene prediction method:
Protein Homology."
/codon_start=1
/transl_table=11
/product="PIN domain-containing protein"
/protein_id="WP_000911324.1"
/db_xref="GI:446834068"
/translation="MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMEVI
YGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHTGQIRAELALQGRPVGPFDQMIA
GHARSRGLIIVTNNTREFERVGGLRIEDWS"
gene complement(28489..28716)
/locus_tag="AA953_RS23415"
/old_locus_tag="AA953_23480"
CDS complement(28489..28716)
/locus_tag="AA953_RS23415"
/old_locus_tag="AA953_23480"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000450523.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="antitoxin"
/protein_id="WP_000450532.1"
/db_xref="GI:446372677"
/translation="METTVFLSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAG
ETWDEWFDGNSVSADFMDNREQPGMQERESF"
gene 28798..34068
/locus_tag="AA953_RS23420"
/old_locus_tag="AA953_23485"
CDS 28798..34068 ES UNA PROTEINA MULTIFUNCIONAL EN LA CONJUGACION,MIDE
LA CANTIDAD DE aa Y VEMOS QUE SON MUCHOS (ESTA ES PROBABLE RELAXASA)
/locus_tag="AA953_RS23420"
/old_locus_tag="AA953_23485"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001463032.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="multifunctional conjugation protein TraI"
/protein_id="WP_000987005.1"
/db_xref="GI:446909749"
/translation="MMSIAQVRSAGSAGNYYTDKDNYYVLGSMGERWAGRGAEQLGLQ
GSVDKDVFTRLLEGRLPDGADLSRMQDGSNRHRPGYDLTFSAPKSVSMMAMLGGDKRL
IDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQEPQLHTHA
VVANVTQHNGEWKTLSSDKVGKTGFIENVYANQIAFGRLYREKLKEQVEALGYETEVV
GKHGMWEMPGVPVEAFSGRSQTIREAVGEDASLKSRDVAALDTRKSKQHVDPEIKMAE
WMQTLKETGFDIRAYRDAADQRADLRTLTPGPASQDGPDVQQAVTQAIAGLSERKVQF
TYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSV
RALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVA
ELVMMAREQGREVQIIAADRRSQMNMKQDERLSGELITGRRQLLEGMAFTPGSTVIVD
QGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQR
PATIISEPDRNVRYARLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVL
GLPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLT
LRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASV
SEDAMTVVVPGRAEPATLPVSDSPFTALKLENGWVETPGHSVSDSATVFASVTQMAMD
NATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQIKTRAGETSLETAISHQ
KSALHTPAQQAIHLALPVVESKKLAFSMVDLLTEAKSFAAEGTGFTELGGEINAQIKR
GDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVMPLMERVPGELMEKLTSG
QRAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPESERPRVVGLGPTHRAV
GEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIA
AGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVAIMKEIVRQTPELREAVYSLINR
DVERALSGLESVKPSQVPRQEGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGEAFPDV
PMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDVREKAGELGKEQVMVP
VLNTANIRDGELRRLSTWETHRDALVLVDNVYHRIAGISKDDGLITLQDAEGNTRLIS
PREAVAEGVTLYTPDTIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQ
QTREIRPGQEQAEQHIDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVAL
SRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVFEPKPDREVMNAERLFSTARELRDV
AAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGN
GLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEI
VRKMAENKPDLPDGKTEQAVREIAGQERDRAAITEREAALPEGVLREPQRVREAVREI
ARENLLQERLQQMERDMVRDLQKEKTLGGD"
gene 34088..34834
/locus_tag="AA953_RS23425"
/old_locus_tag="AA953_23490"
CDS 34088..34834
/locus_tag="AA953_RS23425"
/old_locus_tag="AA953_23490"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000205715.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein TraX"
/protein_id="WP_000205776.1"
/db_xref="GI:446127921"
/translation="MTTDNTNTTRNDSLVARTDTWLQSLLVWSPGQRDIIKTVALVLM
VLDHANRILHLDQSWMFLAGRGAFPLFALVWGLNLSRHAHIRQLAINRLWGWAVFSQF
WYYFAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILMMALWGPLSGTSYGIAG
LLMLAVSHRLYRAEDRMERLVLVACLLAVIPALNLATSDAAAVAGLVMTVLTVGLVSC
AGKLLSRFWPGDFFPTFYACHLAVLGVLAL"

A PARTIR DE ACA YA NO TIENE NADA QUE VER


NO INTERESA 3PRIMA
gene 34889..35449
/locus_tag="AA953_RS23430"
/old_locus_tag="AA953_23495"
CDS 34889..35449
/locus_tag="AA953_RS23430"
/old_locus_tag="AA953_23495"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000139365.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="fertility inhibition protein"
/protein_id="WP_000139310.1"
/db_xref="GI:446061455"
/translation="MTEQKRPVLTLKRKTEGETLVRSRKTIINVTTPPKWKVKKQKLA
EKAAREAELAAKKAQARQALSIYLNLPTLDDAVNTLKPWWPGLFDGDTPRLLACGIRD
VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEA
YAAERLDKIRRQNRIKAELQAVLDEK"
gene 35584..35772
/locus_tag="AA953_RS23435"
/old_locus_tag="AA953_23500"
CDS 35584..35772
/locus_tag="AA953_RS23435"
/old_locus_tag="AA953_23500"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001490801.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_001345829.1"
/db_xref="GI:485713633"
/translation="MNGFRNSSRNGQVWRWQRAGSRAVILEVSGRWMEAAEAWRRAAG
ERCNEKSSLHYSRSQKAE"
gene 35910..>36008
/locus_tag="AA953_RS23440"
/old_locus_tag="AA953_23505"
/pseudo
CDS 35910..>36008
/locus_tag="AA953_RS23440"
/old_locus_tag="AA953_23505"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_011379015.1"
/note="incomplete; partial in the middle of a contig;
missing stop; Derived by automated computational analysis
using gene prediction method: Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="nuclease"
gene complement(36237..36548)
/locus_tag="AA953_RS23445"
/old_locus_tag="AA953_23510"
CDS complement(36237..36548)
/locus_tag="AA953_RS23445"
/old_locus_tag="AA953_23510"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000802277.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000802277.1"
/db_xref="GI:446724964"
/translation="MKPGKLLAAATVLTITACAGKVEKDPQYVAAEKCADLVIIKSRA
LAEKGISGKYVLTSKLRTTSTSDGPFTSTKIRGIPYATSTFLDNGNEGSAWRKCMGQK
L"
gene 36892..37098
/locus_tag="AA953_RS23450"
/old_locus_tag="AA953_23515"
CDS 36892..37098
/locus_tag="AA953_RS23450"
/old_locus_tag="AA953_23515"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P13970.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein SrnB"
/protein_id="WP_001362723.1"
/db_xref="GI:485735449"
/translation="MKYLNTTDCSLFLAERSKFMTKYALIGLLAVCATVLCFSLIFRE
RLCELNIHRGNTVVQVTLAYEARK"
gene 37382..37639
/locus_tag="AA953_RS23455"
/old_locus_tag="AA953_23520"
CDS 37382..37639
/locus_tag="AA953_RS23455"
/old_locus_tag="AA953_23520"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P13959.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="replication regulatory protein RepA2"
/protein_id="WP_000083834.1"
/db_xref="GI:446005979"
/translation="MSQTENAVTSSSGNKRAYRKGNPVPARERQRASLARRSNTHKAF
HAVIQARLKDRLSELADEEGITQAQMLEKLIESELKRRATL"
gene 37873..37947
/locus_tag="AA953_RS23460"
/old_locus_tag="AA953_23525"
CDS 37873..37947
/locus_tag="AA953_RS23460"
/old_locus_tag="AA953_23525"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P56980.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="positive regulator of RepFIC repA1 expression"
/protein_id="WP_001442103.1"
/db_xref="GI:485826769"
/translation="MPGKVQDFFLCSLLLCIVSAGWCG"
gene 37928..38422
/locus_tag="AA953_RS23465"
/old_locus_tag="AA953_23530"
CDS 37928..38422
/locus_tag="AA953_RS23465"
/old_locus_tag="AA953_23530"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001324615.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_032221832.1"
/db_xref="GI:693053266"
/translation="MQDGVANHETHSVIAGGIESDLHIDSSKYPHPFCSLLQKRAHFD
SFKHLIFIRGLLVIAHGKRKNKISASMVSFYVSLVQVMCAHYIPDTNKVNLSVKELSV
CSGGSYTRVWRALKTLDNDLHLIAFDGGTIWFRPDMFETLRVGPDELVAARRRGNSVG
GGHG"
gene 38415..39272
/locus_tag="AA953_RS23470"
/old_locus_tag="AA953_23535"
CDS 38415..39272
/locus_tag="AA953_RS23470"
/old_locus_tag="AA953_23535"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000130945.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="replication initiation protein"
/protein_id="WP_000774301.1"
/db_xref="GI:446696955"
/translation="MADLLQKYYSQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSR
FDFAIHVAHARSKGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
LATESAAGKLSITRATRALTFLAELGLITYQTEYDPLIGCYIPTDITFTPALFAALDV
SEDAVVAARRSRVEWENRQRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIK
RARARRDANRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKDRMILSRNRN
YSRLATASP"
gene 40206..41090
/locus_tag="AA953_RS23475"
/old_locus_tag="AA953_23540"
CDS 40206..41090
/locus_tag="AA953_RS23475"
/old_locus_tag="AA953_23540"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001367286.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_001345827.1"
/db_xref="GI:485713631"
/translation="MDLYHFTAIPMLHSILASEGLREGYLTLYDGTILYNKVWLTTSP
LPYGHGLCNGTEKLSESEKSFMRRVGNISESTSINGTHNKKLIRLKIDTEWIKKQPGF
CSYKKLMRDLGQPKAYVKYVGAMGVEGARGMTDEQISKIMRKGNTKEDTWYIFNGVIP
PSKIVSVEYMETKDKYIPYDFELHGRGYIENSGIYPISSLLLSDLNHTMRNITFLPGS
VIAFCHKANSEENILFRHVLFTCSISLRNFSVLIATGDETSFYIHLDVLKSWTQKNSK
VLCQLFEKARESYHRYYG"
gene 41399..41743
/locus_tag="AA953_RS23480"
/old_locus_tag="AA953_23545"
CDS 41399..41743
/locus_tag="AA953_RS23480"
/old_locus_tag="AA953_23545"
/inference="COORDINATES: ab initio prediction:GeneMarkS+"
/note="Derived by automated computational analysis using
gene prediction method: GeneMarkS+."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_024187764.1"
/db_xref="GI:585300007"
/translation="MRYSKSDNLKAITADVKSAICILGLEFIHSNPRMQIAKNTYGGR
FAVYRIADCVPMREKRPLTSKQQLAGQRLSVLSRQKSSMARIFCFSVNMFHLLRVQEI
VRIPITVLYHWR"
gene complement(41848..44523)
/locus_tag="AA953_RS23485"
/old_locus_tag="AA953_23550"
CDS complement(41848..44523)
/locus_tag="AA953_RS23485"
/old_locus_tag="AA953_23550"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000233113.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000233113.1"
/db_xref="GI:446155258"
/translation="MVGSRWYKFDFHNHTPASHDYKIPDISPREWLLAYMKQHVDCVV
ISDHNSGAWVDVLKGELENMSRDASTGDLPEFRPLTLFPGVELTATGNVHILAVLHTH
STSADVERLLAQCNNNSPIPSEVPNHQLVLQLGPAGIISNIRRNPKAVCILAHIDAAK
GVLSLTNQAELTAAFQESPHAVEIRHRVEDITDGTRRRLIDNLPWLRGSDAHHPEQAG
VRTCWLKMSSPDFDGLRHALLDPENCVLFDQLPPEEPASYLRSLKFRTRHCHPVGQDS
ASVEFSPFYNAVIGSRGSGKSTLIESIRLAMRKTEGLTATQGSKLDQFIRTGMEADSF
IECIFHKEGTDFRLSWRPDSKHELHIFSDGEWMPDSHWSADRFPLSIYSQKMLYELAS
DTGAFLRVCDESPVVNKRAWKERWDQLEREYLNEQITLRGLRARQGSADSLRGELSDA
ERAVSQLQSSAYYPVCRQLALARNELSAATLPLEHFERRIAAIQALAEEPLQRSDIPP
EPSGLLMAFMARLSSVQQQYDQRLNTLLAEYAAELAGIRREQSFIALRTAVSDQETNV
ESEAVSLRARGLNPDVLNELMARCESLKNELRNYDGLDGAISASVARSEQLLAEMRAH
RMALTDNRKAFLSSLSLSALEIKILPLCAPYEDVISGYQTVTGISNFAERIYDNSDGS
GLLSDFISERPFSPLPAATEKKYRALDELKALHHSIRLDNSEAGAGLHGSFRNRLRSL
NDQQLDALQCWYPDDGIHIRYQTPGGQMEDIAFASPGQKGASMLQFLLSYGTDPLLLD
QPEDDLDCLMLSMSVIPAIMSNKKRRQLIIVSHSAPIVVNGDAEYVISMQHDRTGLYP
GLCGALQEAPMKALICRQMEGGEKAFRSRYERILS"
gene 44750..45040
/locus_tag="AA953_RS23490"
/old_locus_tag="AA953_23555"
CDS 44750..45040
/locus_tag="AA953_RS23490"
/old_locus_tag="AA953_23555"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:Q9JMR7.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000538310.1"
/db_xref="GI:446460456"
/translation="MGVKITGLDKMQKQLKEVERATEALNGSYDVRFDANDPSSIENA
IQEAYSMVDERASGYATNPMVSPLIEHMKENLRQQILDSAEQQRQESGQDGD"
gene 45030..45929
/locus_tag="AA953_RS23495"
/old_locus_tag="AA953_23560"
CDS 45030..45929
/locus_tag="AA953_RS23495"
/old_locus_tag="AA953_23560"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000963206.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000963206.1"
/db_xref="GI:446885950"
/translation="MAIDIFQSLKNCVFDLQRADVQNYQQPLKQLARLLNSENLQSVN
AHLTRNVELDTFLARSEDTESSMAGSAVLQWPDEPADILGLKLLLIEKMADDNNFSFN
FCHTFFYDRNIIESIRKFTSSLVAPFVRDYQLYVENQHDPEPAVFRPVSRKIFIVHGH
DNDALQSVARFISRIGLEEIILSERPDGSRTIIEKFEAESGDVSFAIVLMTPDDSGSA
LASESTRLRARQNVLYELGYFAGKLGRGKVLVLRKGDIEIPSDLAGVLYTELDEHGGW
KRKLLSELAYAGVPFDKDKALSA"
gene complement(45979..48204)
/locus_tag="AA953_RS23500"
/old_locus_tag="AA953_23565"
CDS complement(45979..48204)
/locus_tag="AA953_RS23500"
/old_locus_tag="AA953_23565"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000698737.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="phage T7 exclusion protein"
/protein_id="WP_000698737.1"
/db_xref="GI:446621391"
/translation="MKILRQLWNQKGLDAAVEDVPEDRYGFGNIAENISRSILTLPLE
ASNVVGIEGAWGSGKTSLLNLILRNLALKKDAHTHVLHISPWLSGGSPVEALFLPVAT
VIQQEMEIRYPPKGFKKLWRKYLLSPEAQKVIEYAQDTSSRVLPLVQYIGQFSSIINW
IAGGIKVFSDSRLAVDQKTTTKLRAEIAGQLVSLDLKFIVVMDDLDRLEPSQVAEVFR
LVRAVADLPRFTHILCYDRQIITHAVEHALNIEDGSRYLQKIIQLSFKLPRPEAFDLR
NEFRQRAEALYQQINNQPPDSGMVRDLIAVTDTYGAALSTPREIHQAINSLIFLYPGM
RDFVYFPDLCLLQLIRVTNPALYDWTEHYLTERSVIETGQGMLSDGEKADFREGLIRC
MKTFRASNADSFLTLADWIPGISGHNDEYLNLFEPVSEDFRHIQTTGKRLSSLTHWRY
YFAFSSPQNVLPPEFFRQLFEQAGVSEKQQQLSELLLSKINSVGSLSGTWFEHILSRL
TPGLIRERNFEECAGLVHFFFDHTDEVSTRFSIRNPWFSLREMAINEVVRHLLKHMQD
IDETRTITLMEKLIVTGASPFWIADFMRDLIWEHGLAQNAVPSPSDALFSRDITERLR
DRFAERMNQPELQQQLLLRKSLLGYLYAWRDMSSGETVKQWVREVTTTDEGLVNLLIR
LQTSVFSSHRGAYRRIARDQVSPFFDDWPAVEEKLKVMLSGNELTPEQEALKTALEND
D"
gene complement(48206..49294)
/locus_tag="AA953_RS23505"
/old_locus_tag="AA953_23570"
CDS complement(48206..49294)
/locus_tag="AA953_RS23505"
/old_locus_tag="AA953_23570"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000952219.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="transcriptional regulator"
/protein_id="WP_000952217.1"
/db_xref="GI:446874961"
/translation="MLSQLNLRFHKKLIEALKTRAGRENTSVNALAERFLDDGLKTVA
PGDGYFQLIADPEATVRQLYRHIILGQTFGTSALSRDELRFVLVHVREAFLRGHNRLA
TLPALDTLLDITGNLLAWQVEHDRPVDGHYLKGIFRLAGKNWTEEFEAFRAALRPVVD
QMYAEHLLRPLESDCFGLAEVPDAVLAEIFTLPRLKAVFPLMLRGLDWNTEQARTLAQ
ELRPVISAVTETIEAGTLRLEIRVDGQHPGERPGAWYTTPRLHLLITGQDFVVPYGWE
ALSELLGLFTLYARHPEALTHGHQGERVMFSPPGNVTPEGFFGIDGLRIFMPAEAFET
LVRELATRCQEGPLAEALTGLRCLYGDL"
gene 49874..50092
/locus_tag="AA953_RS23510"
/old_locus_tag="AA953_23575"
CDS 49874..50092
/locus_tag="AA953_RS23510"
/old_locus_tag="AA953_23575"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_016240352.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="antitoxin CcdA"
/protein_id="WP_000813634.1"
/db_xref="GI:446736378"
/translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
KAENQEGMAEVARFIEMNGSFADENRDW"
gene 50094..50399
/locus_tag="AA953_RS23515"
/old_locus_tag="AA953_23580"
CDS 50094..50399
/locus_tag="AA953_RS23515"
/old_locus_tag="AA953_23580"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001159860.1"
/note="controlled cell death protein; post-segregation
toxin; toxin addiction system; Derived by automated
computational analysis using gene prediction method:
Protein Homology."
/codon_start=1
/transl_table=11
/product="toxin CcdB"
/protein_id="WP_001159868.1"
/db_xref="GI:447082612"
/translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
KVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
gene 50400..51206
/locus_tag="AA953_RS23520"
/old_locus_tag="AA953_23585"
CDS 50400..51206
/locus_tag="AA953_RS23520"
/old_locus_tag="AA953_23585"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000016989.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="resolvase"
/protein_id="WP_000016982.1"
/db_xref="GI:445939127"
/translation="MSGSVIHSQSAVMVPAVYSAGQPASLPVAIDYPAALALRQMSMV
HDELPKYLLAPEVSALLHYVPDLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPF
VQLATLKQRTEKAARTAGRMPAGQQTHRLVPLSDSWYVSQLQTMVATLKIPMERRNRR
TGRTEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIP
LKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFAMPESDAVAMLKQLS"
gene 51980..52735
/locus_tag="AA953_RS23525"
/old_locus_tag="AA953_23590"
CDS 51980..52735
/locus_tag="AA953_RS23525"
/old_locus_tag="AA953_23590"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P03856.1"
/note="RepE; RepFIB; Derived by automated computational
analysis using gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="replication initiation protein"
/protein_id="WP_000852146.1"
/db_xref="GI:446774890"
/translation="MAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVD
QIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEED
AGDEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNP
YAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINS
RTPMRLSYIEKKKGRQTTHIVFSFRDITSMTTG"
gene 53323..54489
/locus_tag="AA953_RS23530"
/old_locus_tag="AA953_23595"
CDS 53323..54489
/locus_tag="AA953_RS23530"
/old_locus_tag="AA953_23595"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000523813.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein SopA" NECESITA AL sOPb ESTAN EN OPERONES
/protein_id="WP_000772446.1"
/db_xref="GI:446695100"
/translation="MKLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGE
AADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAE
DVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPT
DPHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQ
FFDMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRE
TDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
gene 54489..55460
/locus_tag="AA953_RS23535"
/old_locus_tag="AA953_23600"
CDS 54489..55460
/locus_tag="AA953_RS23535"
/old_locus_tag="AA953_23600"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P62558.1"
/note="SopB; Derived by automated computational analysis
using gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein SopB"
/protein_id="WP_000817031.1"
/db_xref="GI:446739775"
/translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGN
AITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQ
TPAFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSA
YERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSA
RSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLS
SRHQFAPGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"

ESTAN ORGANIZADOS EN OPERONES,ESTAN EN LA MISMA TIRA,CENTRO DE PARTICION ESTA EN LA MISMA


BANDA ANALIZAMOS CUANTAS BASES TIENE EL 3PRIMA.

gene 56389..57314
/locus_tag="AA953_RS23540"
/old_locus_tag="AA953_23605"
/pseudo
CDS 56389..57314
/locus_tag="AA953_RS23540"
/old_locus_tag="AA953_23605"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001134314.1"
/note="frameshifted; Derived by automated computational
analysis using gene prediction method: Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="hypothetical protein"
gene 57318..57623
/locus_tag="AA953_RS23545"
/old_locus_tag="AA953_23610"
CDS 57318..57623
/locus_tag="AA953_RS23545"
/old_locus_tag="AA953_23610"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_010891292.1"
/note="yfdB; Derived by automated computational analysis
using gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_010892536.1"
/db_xref="GI:499194996"
/translation="MTETGGQPPVSFPVKDVAGLLFLLRRLTRRGRNAACGQCPASGW
ARDGRFYRSRLASVTVYASPSPFSDERPSSRFRGIFSPSKRRRLRYSTVGLTRYRTR"
gene 57700..58383
/locus_tag="AA953_RS23550"
/old_locus_tag="AA953_23615"
CDS 57700..58383
/locus_tag="AA953_RS23550"
/old_locus_tag="AA953_23615"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_002211749.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="DNA methylase"
/protein_id="WP_000085939.1"
/db_xref="GI:446008084"
/translation="MSRFIQGDCVRVMATFPGNAVDFILTDPPYLVGFRDRQGRTIAG
DKTDEWLQPACNEMYRVLKKDALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKTYT
SKAAYVGYRHECAYILAKGRPALPQKPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
DDWFMPEAA"
gene 58384..58605
/locus_tag="AA953_RS23555"
/old_locus_tag="AA953_23620"
CDS 58384..58605
/locus_tag="AA953_RS23555"
/old_locus_tag="AA953_23620"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001104903.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_001104904.1"
/db_xref="GI:447027648"
/translation="MNYAGHKKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVER
LARQTLYRANRLFMEAYTEILELDACFKD"
gene 58619..59053
/locus_tag="AA953_RS23560"
/old_locus_tag="AA953_23625"
CDS 58619..59053
/locus_tag="AA953_RS23560"
/old_locus_tag="AA953_23625"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000274498.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000274477.1"
/db_xref="GI:446196622"
/translation="MYGTCETLCRELAAKYPGYTPLMLVIWSPEEIQALADGMDISLS
DPEIRTVLARLEDIPEDQRIESGISSAAAMEIISNVSENRQVTVPAELLASLIQTAEQ
ALWKREWAARDYGLAVPECVTRRQAVVNQARILLKNNTHENG"
gene 59099..59875
/locus_tag="AA953_RS23565"
/old_locus_tag="AA953_23630"
CDS 59099..59875
/locus_tag="AA953_RS23565"
/old_locus_tag="AA953_23630"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001005031.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_001005032.1"
/db_xref="GI:446927776"
/translation="MNENTTLNALICRHARNLLLAQGWPEETDVDQRNPKYPGWISIY
VLLDAPRLATLLVNRHGGVLPPHLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQV
SFPYAGEWLTEDEIRAVLAAVRDAVRSVSCRVAEDMRRIRAALTTTGQTLLTRQTRRF
RLVVKESDHPCWLDEDDENLPVVLDAILNRGARFSAVEMYLVSDCIEHILSSGLACDV
LRIPDEPPRQWFDRGVLREVVREARAEIRSMADALAKIRG"
gene 60289..60714
/locus_tag="AA953_RS23570"
/old_locus_tag="AA953_23635"
CDS 60289..60714
/locus_tag="AA953_RS23570"
/old_locus_tag="AA953_23635"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001198918.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="antirestriction protein YubI"
/protein_id="WP_001198920.1"
/db_xref="GI:447121664"
/translation="MQYAKPVTLNVEECDRLSFLPYLFGNDFLYAEAYVYALAQKMMP
EYQGGFWHFIRLPDGGGYMMPDGDRFHLVNGENWFDRTVSADAAGIILTSLVINRQLW
LYHDSGDVGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
gene 60761..61183
/locus_tag="AA953_RS23575"
/old_locus_tag="AA953_23640"
CDS 60761..61183
/locus_tag="AA953_RS23575"
/old_locus_tag="AA953_23640"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:O82902.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000271685.1"
/db_xref="GI:446193830"
/translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWNLSD
DELETVMQRLDDAFEYGADVSIVHDVVRELMEEKRASRQVTVPAVMLEKVMALAGSEM
KRLYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
gene 61180..61371
/locus_tag="AA953_RS23580"
/old_locus_tag="AA953_23645"
CDS 61180..61371
/locus_tag="AA953_RS23580"
/old_locus_tag="AA953_23645"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001027495.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_001027495.1"
/db_xref="GI:446950239"
/translation="MNISTETREILRNYKAVINARRREMGQKPLTTAQIVDEICDFVA
NQQAVFLGGHYILQGSRNR"
gene complement(61341..61697)
/locus_tag="AA953_RS23585"
/old_locus_tag="AA953_23650"
CDS complement(61341..61697)
/locus_tag="AA953_RS23585"
/old_locus_tag="AA953_23650"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000388247.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000388237.1"
/db_xref="GI:446310382"
/translation="MEARQGGDSFAGSVHDSPPHQGDARKSHKQERNGKKRKKRKKRK
RKKKKNSNRHGNHRKITSEKNIPDTSQTGRVTGDASAWPASLPAGVSLPGVFARADRR
PPPPALYHLFLLPCKM"
gene 62177..62716
/locus_tag="AA953_RS23590"
/old_locus_tag="AA953_23660"
CDS 62177..62716
/locus_tag="AA953_RS23590"
/old_locus_tag="AA953_23660"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001276120.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="plasmid-derived single-stranded DNA-binding
protein"
/protein_id="WP_000290801.1"
/db_xref="GI:446212946"
/translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDK
QTGEMREQTEWHRVVLFGKLAEVAGECLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
VKTTGTMQMLVRAAGAQTQPEEGQQFSGQPQPEPQAEAGTKKGGAKTKGRGRKAAQPE
PQPQPPEGDDYGFSDDIPF"
gene 62773..63006
/locus_tag="AA953_RS23595"
/old_locus_tag="AA953_23665"
CDS 62773..63006
/locus_tag="AA953_RS23595"
/old_locus_tag="AA953_23665"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000005990.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000005990.1"
/db_xref="GI:445928135"
/translation="MSEYFRILQGLPDGPFTRKHAEAVAAQYRNVFIEDDHGEQFRLV
VRNNGAMVWRTWNFEDGAGYWMNHVIRDFGILK"
gene 63072..65030
/locus_tag="AA953_RS23600"
/old_locus_tag="AA953_23670"
CDS 63072..65030
/locus_tag="AA953_RS23600"
/old_locus_tag="AA953_23670"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000117168.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000117173.1"
/db_xref="GI:446039318"
/translation="MSVTESKAKTERKSSRKPAKTQETVLSALLAQTEEVSVPLASLI
KSPLNVRTVPYSAESVSELADSIKGVGLLQNLVVHALPGDRYGVAAGGRRLAALNMLA
ERDIIQVDWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIG
DLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQ
SGWGGKPDVRVIRNLITESEVAVKDNTKFRFVGADAFSPDELRTDLFSDDEGGYVDCV
ALDAALLEKLQAVAEHLREAEGWEWCAGRMEPVGECREDSRAYRNLPEPEAVLTEAEE
ERLNELMMRYDALENQCEESDLLAAEMKLIDCMAKVRAWTPEMRAGSGVVVSWRYGNV
CVQRGVQLRSEDDVTDDADRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQPD
KSLALLTWTLCLNVFGSGAYSKPAQISLECKHYSLTSDAPSGKEGAAFMALMAEKARL
VVLLPEGWSRDMTTFLSLSQEVLLSLLSFCTACSIHGVQTRECGHTSRSPLDPLETAI
GFHMRDWWQPTKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEFHMKD
NRWVPGWMCAPRPQTDATERTDNLADAA"
gene 65085..65519
/gene="psiB"
/locus_tag="AA953_RS23605"
/old_locus_tag="AA953_23675"
CDS 65085..65519
/gene="psiB"
/locus_tag="AA953_RS23605"
/old_locus_tag="AA953_23675"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P10031.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="recombinase"
/protein_id="WP_000845928.1"
/db_xref="GI:446768672"
/translation="MKTELTLNVLQTMNAQEYEDIRAAGSDERRELTHAVMRELDAPD
NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
QVQRRFASEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
gene 65516..66235
/locus_tag="AA953_RS23610"
/old_locus_tag="AA953_23680"
CDS 65516..66235
/locus_tag="AA953_RS23610"
/old_locus_tag="AA953_23680"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001276238.1"
/note="PsiA; Derived by automated computational analysis
using gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein PsiA"
/protein_id="WP_000116348.1"
/db_xref="GI:446038493"
/translation="MSVRSQALVPLSTEQQAAWRAVAETEKRRHQGNTLAEYPYAGAF
FRCLNGSRRISLSDLRFFMPSLTAEELHGNRLQWLYAIDVLIETQGEVCLLPLPGDAA
ERLFPSVRFRVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPE
TVGSWHARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAARE
AGHAVREMERWMVPNKLREAA"
gene complement(66256..66466)
/locus_tag="AA953_RS23615"
/old_locus_tag="AA953_23685"
/pseudo
CDS complement(66256..66466)
/locus_tag="AA953_RS23615"
/old_locus_tag="AA953_23685"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P13971.2"
/note="frameshifted; internal stop; Derived by automated
computational analysis using gene prediction method:
Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="protein sok"
gene 66510..66668
/locus_tag="AA953_RS23620"
/old_locus_tag="AA953_23690"
CDS 66510..66668
/locus_tag="AA953_RS23620"
/old_locus_tag="AA953_23690"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_004160031.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="stable plasmid inheritance protein"
/protein_id="WP_001302184.1"
/db_xref="GI:485658258"
/translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAA
FMAYESGK"
gene complement(66906..67265)
/locus_tag="AA953_RS23625"
/old_locus_tag="AA953_23695"
/pseudo
CDS complement(66906..67265)
/locus_tag="AA953_RS23625"
/old_locus_tag="AA953_23695"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_001310283.1"
/note="frameshifted; Derived by automated computational
analysis using gene prediction method: Protein Homology."
/pseudo
/codon_start=1
/transl_table=11
/product="hypothetical protein"
gene 67335..67541
/locus_tag="AA953_RS23630"
/old_locus_tag="AA953_23700"
CDS 67335..67541
/locus_tag="AA953_RS23630"
/old_locus_tag="AA953_23700"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_019842804.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="WP_000547965.1"
/db_xref="GI:446470111"
/translation="MHIPQNFLPKSRQKVLRSAPGQSFPAVAVMPLAAKVLKKVMVNT
GGNKRQVPAKRQNRGSRNSKDDGG"

CLICK EN LA PROTEINA IN----


multifunctional conjugation protein TraI
[Escherichia coli]
NCBI Reference Sequence: WP_000987005.1

Identical Proteins FASTA Graphics

Go to:
LOCUS WP_000987005 1756 aa linear BCT 22-MAR-2015
DEFINITION multifunctional conjugation protein TraI [Escherichia coli].
ACCESSION WP_000987005
VERSION WP_000987005.1 GI:446909749
KEYWORDS RefSeq.
SOURCE Escherichia coli
ORGANISM Escherichia coli
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
Enterobacteriaceae; Escherichia.
COMMENT REFSEQ: This record represents a single, non-redundant, protein
sequence which may be annotated on many different RefSeq genomes
from the same, or different, species.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..1756
/organism="Escherichia coli"
/db_xref="taxon:562"
Protein 1..1756
/product="multifunctional conjugation protein TraI"
/calculated_mol_wt=191886
Region 2..1751
/region_name="PRK13709"
/note="conjugal transfer nickase/helicase TraI;
Provisional"
NICKASE:CORTE
/db_xref="CDD:237478"
Region 13..288
/region_name="relax_trwC"
/note="conjugative relaxase domain, TrwC/TraI family;
TIGR02686"
/db_xref="CDD:274258"
Region 968..1153
/region_name="AAA_30"
/note="AAA domain; pfam13604"
/db_xref="CDD:290335"
Region 1434..1553
/region_name="TraI"
/note="DNA helicase TraI; pfam07057"
/db_xref="CDD:284471"

GEN QUE CODIFICA LA PROTEINA INDISPENSABLE


EL ORIGEN E LA TRANSFERENCIA EST EN EL TRAI MULTIFUNCIONAL
DELIMITAMOS 52736..56388

Escherichia coli strain NCM3722 plasmid F,


complete sequence
NCBI Reference Sequence: NZ_CP011496.1

FASTA Graphics

Go to:
LOCUS NZ_CP011496 3653 bp DNA linear CON 18-JUN-2016
DEFINITION Escherichia coli strain NCM3722 plasmid F, complete sequence.
ACCESSION NZ_CP011496 REGION: 52736..56388
VERSION NZ_CP011496.1 GI:874443590
DBLINK BioProject: PRJNA224116
BioSample: SAMN03659038
Assembly: GCF_001043215.1
KEYWORDS RefSeq.
SOURCE Escherichia coli
ORGANISM Escherichia coli
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
Enterobacteriaceae; Escherichia.
REFERENCE 1 (bases 1 to 3653)
AUTHORS Brown,S.D. and Jun,S.
TITLE Complete Genome Sequence of Escherichia coli NCM3722
JOURNAL Genome Announc 3 (4) (2015)
PUBMED 26251500
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 3653)
AUTHORS Brown,S.D.
TITLE Direct Submission
JOURNAL Submitted (19-MAY-2015) Physics, University of California - San
Diego, 9500 Gilman Dr., San Diego, CA 92093, USA
COMMENT REFSEQ INFORMATION: The reference sequence was derived from
CP011496.
Annotation was added by the NCBI Prokaryotic Genome Annotation
Pipeline (released 2013). Information about the Pipeline can be
found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/

##Genome-Assembly-Data-START##
Assembly Date :: 2015
Assembly Method :: SPAdes v. 3.1.0
Genome Representation :: Full
Expected Final Version :: Yes
Genome Coverage :: 68.0x
Sequencing Technology :: PacBio; Illumina HiSeq
##Genome-Assembly-Data-END##

##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Date :: 06/18/2016 20:08:42
Annotation Pipeline :: NCBI Prokaryotic Genome
Annotation Pipeline
Annotation Method :: Best-placed reference protein
set; GeneMarkS+
Annotation Software revision :: 3.3
Features Annotated :: Gene; CDS; rRNA; tRNA; ncRNA;
repeat_region
Genes (total) :: 4,736
CDS (total) :: 4,604
Genes (coding) :: 4,522
CDS (coding) :: 4,522
Genes (RNA) :: 132
rRNAs :: 9, 8, 8 (5S, 16S, 23S)
complete rRNAs :: 9, 8, 8 (5S, 16S, 23S)
tRNAs :: 88
ncRNAs :: 19
Pseudo Genes (total) :: 82
Pseudo Genes (ambiguous residues) :: 0 of 82
Pseudo Genes (frameshifted) :: 35 of 82
Pseudo Genes (incomplete) :: 35 of 82
Pseudo Genes (internal stop) :: 27 of 82
Pseudo Genes (multiple problems) :: 14 of 82
CRISPR Arrays :: 2
##Genome-Annotation-Data-END##
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..3653
/organism="Escherichia coli"
/mol_type="genomic DNA"
/strain="NCM3722"
/isolate="K-12"
/host="Homo sapiens"
/db_xref="taxon:562"
/plasmid="F"
/country="USA: California"
/collection_date="24-May-2014"
gene 588..1754
/locus_tag="AA953_RS23530"
/old_locus_tag="AA953_23595"
CDS 588..1754
/locus_tag="AA953_RS23530"
/old_locus_tag="AA953_23595"
/inference="EXISTENCE: similar to AA
sequence:RefSeq:WP_000523813.1"
/note="Derived by automated computational analysis using
gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein SopA"
/protein_id="WP_000772446.1"
/db_xref="GI:446695100"
/translation="MKLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGE
AADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAE
DVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPT
DPHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQ
FFDMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRE
TDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
gene 1754..2725
/locus_tag="AA953_RS23535"
/old_locus_tag="AA953_23600"
CDS 1754..2725
/locus_tag="AA953_RS23535"
/old_locus_tag="AA953_23600"
/inference="EXISTENCE: similar to AA
sequence:SwissProt:P62558.1"
/note="SopB; Derived by automated computational analysis
using gene prediction method: Protein Homology."
/codon_start=1
/transl_table=11
/product="protein SopB"
/protein_id="WP_000817031.1"
/db_xref="GI:446739775"
/translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGN
AITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQ
TPAFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSA
YERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSA
RSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLS
SRHQFAPGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"

FASTA
>gi|874443590:52736-56388 Escherichia coli strain NCM3722 plasmid F, complete sequence
TCTGAGGGTTATCTGTCACAGATTTGAGGGTGGTTCGTCACATTTGTTCTGACCTACTGAGGGTAATTTG
TCACAGTTTTGCTGTTTCCTTCAGCCTGCATGGATTTTCTCATACTTTTTGAACTGTAATTTTTAAGGAA
GCCAAATTTGAGGGCAGTTTGTCACAGTTGATTTCCTTCTCTTTCCCTTCGTCATGTGACCTGATATCGG
GGGTTAGTTCGTCATCATTGATGAGGGTTGATTATCACAGTTTATTACTCTGAATTGGCTATCCGCGTGT
GTACCTCTACCTGGAGTTTTTCCCACGGTGGATATTTCTTCTTGCGCTGAGCGTAAGAGCTATCTGACAG
AACAGTTCTTCTTTGCTTCCTCGCCAGTTCGCTCGCTATGCTCGGTTACACGGCTGCGGCGAGCGCTAGT
GATAATAAGTGACTGAGGTATGTGCTCTTCTTATCTCCTTTTGTAGTGTTGCTCTTATTTTAAACAACTT
TGCGGTTTTTTGATGACTTTGCGATTTTGTTGTTGCTTTGCAGTAAATTGCAAGATTTAATAAAAAAACG
CAAAGCAATGATTAAAGGATGTTCAGAATGAAACTCATGGAAACACTTAACCAGTGCATAAACGCTGGTC
ATGAAATGACGAAGGCTATCGCCATTGCACAGTTTAATGATGACAGCCCGGAAGCGAGGAAAATAACCCG
GCGCTGGAGAATAGGTGAAGCAGCGGATTTAGTTGGGGTTTCTTCTCAGGCTATCAGAGATGCCGAGAAA
GCAGGGCGACTACCGCACCCGGATATGGAAATTCGAGGACGGGTTGAGCAACGTGTTGGTTATACAATTG
AACAAATTAATCATATGCGTGATGTGTTTGGTACGCGATTGCGACGTGCTGAAGACGTATTTCCACCGGT
GATCGGGGTTGCTGCCCATAAAGGTGGCGTTTACAAAACCTCAGTTTCTGTTCATCTTGCTCAGGATCTG
GCTCTGAAGGGGCTACGTGTTTTGCTCGTGGAAGGTAACGACCCCCAGGGAACAGCCTCAATGTATCACG
GATGGGTACCAGATCTTCATATTCATGCAGAAGACACTCTCCTGCCTTTCTATCTTGGGGAAAAGGACGA
TGTCACTTATGCAATAAAGCCCACTTGCTGGCCGGGGCTTGACATTATTCCTTCCTGTCTGGCTCTGCAC
CGTATTGAAACTGAGTTAATGGGCAAATTTGATGAAGGTAAACTGCCCACCGATCCACACCTGATGCTCC
GACTGGCCATTGAAACTGTTGCTCATGACTATGATGTCATAGTTATTGACAGCGCGCCTAACCTGGGTAT
CGGCACGATTAATGTCGTATGTGCTGCTGATGTGCTGATTGTTCCCACGCCTGCTGAGTTGTTTGACTAC
ACCTCCGCACTGCAGTTTTTCGATATGCTTCGTGATCTGCTCAAGAACGTTGATCTTAAAGGGTTCGAGC
CTGATGTACGTATTTTGCTTACCAAATACAGCAATAGTAATGGCTCTCAGTCCCCGTGGATGGAGGAGCA
AATTCGGGATGCCTGGGGAAGCATGGTTCTAAAAAATGTTGTACGTGAAACGGATGAAGTTGGTAAAGGT
CAGATCCGGATGAGAACTGTTTTTGAACAGGCCATTGATCAACGCTCTTCAACTGGTGCCTGGAGAAATG
CTCTTTCTATTTGGGAACCTGTCTGCAATGAAATTTTCGATCGTCTGATTAAACCACGCTGGGAGATTAG
ATAATGAAGCGTGCGCCTGTTATTCCAAAACATACGCTCAATACTCAACCGGTTGAAGATACTTCGTTAT
CGACACCAGCTGCCCCGATGGTGGATTCGTTAATTGCGCGCGTAGGAGTAATGGCTCGCGGTAATGCCAT
TACTTTGCCTGTATGTGGTCGGGATGTGAAGTTTACTCTTGAAGTGCTCCGGGGTGATAGTGTTGAGAAG
ACCTCTCGGGTATGGTCAGGTAATGAACGTGACCAGGAGCTGCTTACTGAGGACGCACTGGATGATCTCA
TCCCTTCTTTTCTACTGACTGGTCAACAGACACCGGCGTTCGGTCGAAGAGTATCTGGTGTCATAGAAAT
TGCCGATGGGAGTCGCCGTCGTAAAGCTGCTGCACTTACCGAAAGTGATTATCGTGTTCTGGTTGGCGAG
CTGGATGATGAGCAGATGGCTGCATTATCCAGATTGGGTAACGATTATCGCCCAACAAGTGCTTATGAAC
GTGGTCAGCGTTATGCAAGCCGATTGCAGAATGAATTTGCTGGAAATATTTCTGCGCTGGCTGATGCGGA
AAATATTTCACGTAAGATTATTACCCGCTGTATCAACACCGCCAAATTGCCTAAATCAGTTGTTGCTCTT
TTTTCTCACCCCGGTGAACTATCTGCCCGGTCAGGTGATGCACTTCAAAAAGCCTTTACAGATAAAGAGG
AATTACTTAAGCAGCAGGCATCTAACCTTCATGAGCAGAAAAAAGCTGGGGTGATATTTGAAGCTGAAGA
AGTTATCACTCTTTTAACTTCTGTGCTTAAAACGTCATCTGCATCAAGAACTAGTTTAAGCTCACGACAT
CAGTTTGCTCCTGGAGCGACAGTATTGTATAAGGGCGATAAAATGGTGCTTAACCTGGACAGGTCTCGTG
TTCCAACTGAGTGTATAGAGAAAATTGAGGCCATTCTTAAGGAACTTGAAAAGCCAGCACCCTGATGCGA
CCACGTTTTAGTCTACGTTTATCTGTCTTTACTTAATGTCCTTTGTTACAGGCCAGAAAGCATAACTGGC
CTGAATATTCTCTCTGGGCCCACTGTTCCACTTGTATCGTCGGTCTGATAATCAGACTGGGACCACGGTC
CCACTCGTATCGTCGGTCTGATTATTAGTCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTA
GTCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATAATCAGACTGGGACCACGGTCCCACTCGTATC
GTCGGTCTGATTATTAGTCTGGGACCATGGTCCCACTCGTATCGTCGGTCTGATTATTAGTCTGGGACCA
CGGTCCCACTCGTATCGTCGGTCTGATTATTAGTCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGAT
TATTAGTCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAGTCTGGGACCACGATCCCACTC
GTGTTGTCGGTCTGATTATCGGTCTGGGACCACGGTCCCACTTGTATTGTCGATCAGACTATCAGCGTGA
GACTACGATTCCATCAATGCCTGTCAAGGGCAAGTATTGACATGTCGTCGTAACCTGTAGAACGGAGTAA
CCTCGGTGTGCGGTTGTATGCCTGCTGTGGATTGCTGCTGTGTCCTGCTTATCCACAACATTTTGCGCAC
GGTTATGTGGACAAAATACCTGGTTACCCAGGCCGTGCCGGCACGTTAACCGGGCTGCATCCGATGCAAG
TGTGTCGCTGTCGACGGCCTCCTCACCCGGTCACGTTTCGTCGTTTCTCCTCCACGCGCTGCGGCTTCGG
GGCCGCACCTGCATTCGTATGCGGTCGCCCGGTTACAGGTGCGGCACGGCCTGATGGAGGCCGCATGTGA
GAGGAGAATTCCC

Tandem Repeats Finder Program written by:


Gary Benson
Program in Bioinformatics
Boston University
Version 4.09

Please cite:
G. Benson,
"Tandem repeats finder: a program to analyze DNA sequences"
Nucleic Acid Research(1999)
Vol. 27, No. 2, pp. 573-580.

Sequence: gi|874443590:52736-56388 Escherichia coli strain NCM3722 plasmid F, complete


sequence
Parameters: 2 7 7 80 10 50 500
Length: 3653
Tables: 1

This is table 1 of 1 ( 2 repeats found )


Click on indices to view alignment
Table Explanation

Period Copy Consensus Percent Percent Entropy


Indices Score A C G T
Size Number Size Matches Indels (0-2)
487--531 19 2.3 20 85 7 58 8 13 24 53 1.68
2813--3272 43 10.7 43 94 0 758 16 28 25 29 1.97
Tables: 1

The End!

2 SECUENCUIAS REPETIDAS
Found at i:509 original size:19 final size:20

Alignment explanation

Indices: 487--531 Score: 58


Period size: 19 Copynumber: 2.4 Consensus size: 20

477 ATTTTAAACA

*
487 ACTTTGCGGTTTT-TTGATG
1 ACTTTGCGATTTTGTTGATG

*
506 ACTTTGCGATTTTGTTGTTG
1 ACTTTGCGATTTTGTTGATG

526 -CTTTGC
1 ACTTTGC

532 AGTAAATTGC

Statistics
Matches: 23, Mismatches: 2, Indels: 2
0.85 0.07 0.07

Matches are distributed among these distances:


19 18 0.78
20 5 0.22

ACGTcount: A:0.09, C:0.13, G:0.24, T:0.53

Consensus pattern (20 bp):


ACTTTGCGATTTTGTTGATG

Found at i:2881 original size:43 final size:43

Alignment explanation

Indices: 2813--3272 Score: 758


Period TAMAO: 43 Copynumber: 10.7 Consensus size: 43

2803 GAATATTCTC

* * * * * *
2813 TCTGGGCCCACTGTTCCACTTGTATCGTCGGTCTGATAATCAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

*
2856 ACTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

2899 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

* *
2942 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATAATCAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

*
2985 ACTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

*
3028 TCTGGGACCATGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

3071 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

3114 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

3157 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

* * * **
3200 TCTGGGACCACGATCCCACTCGTGTTGTCGGTCTGATTATCGG
1 TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

* *
(3242)3243 TCTGGGACCACGGTCCCACTTGTATTGTCG
1 TCTGGGACCACGGTCCCACTCGTATCGTCG

3273 ATCAGACTAT

ESA ES LA REGION QUE CONTIENE AL CENTORMERO Y TIENE AL SopB


Statistics
Matches: 393, Mismatches: 24, Indels: 0
0.94 0.06 0.00

Matches are distributed among these distances:


43 393 1.00

ACGTcount: A:0.17, C:0.28, G:0.26, T:0.30

Consensus pattern (43 bp):


TCTGGGACCACGGTCCCACTCGTATCGTCGGTCTGATTATTAG

Done.
Consecuencia:
tiene tipo de repeticion tipo 1

Erwinia amylovora LebB66 plasmid pEL60, complete sequence

NCBI Reference Sequence: NC_005246.1

FASTA Graphics

Go to:
LOCUS NC_005246 60145 bp DNA circular CON 17-DEC-2014
DEFINITION Erwinia amylovora LebB66 plasmid pEL60, complete sequence.
ACCESSION NC_005246
VERSION NC_005246.1
DBLINK BioProject: PRJNA178873
KEYWORDS RefSeq.
SOURCE Erwinia amylovora
ORGANISM Erwinia amylovora
Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
Enterobacteriaceae; Erwinia.
REFERENCE 1 (bases 1 to 60145)
AUTHORS Foster,G.C., McGhee,G.C., Jones,A.L. and Sundin,G.W.
TITLE Nucleotide sequences, genetic organization, and distribution of
pEU30 and pEL60 from Erwinia amylovora
JOURNAL Appl. Environ. Microbiol. 70 (12), 7539-7544 (2004)
PUBMED 15574957
REFERENCE 2 (bases 1 to 60145)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (03-DEC-2003) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 60145)
AUTHORS Foster,G.C., McGhee,G.C., Jones,A.L. and Sundin,G.W.
TITLE Direct Submission
JOURNAL Submitted (24-SEP-2003) Plant Pathology, Michigan State University,
East Lansing, MI 48824, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from AY422214.
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..60145
/organism="Erwinia amylovora"
/mol_type="genomic DNA"
/strain="LebB66"
/isolation_source="apple"
/db_xref="taxon:552"
/plasmid="pEL60"
/country="Lebanon"
gene 11..664
/gene="tir"
/locus_tag="pEL60p01"
/db_xref="GeneID:2656888"
CDS 11..664
/gene="tir"
/locus_tag="pEL60p01"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to transfer inhibition protein Tir from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to Tir from plasmid R100 (NP_052992)"
/codon_start=1
/transl_table=11
/product="transfer inhibition protein"
/protein_id="NP_943200.1"
/db_xref="GeneID:2656888"
/translation="MIQSRNKYLQFMLVLLAAWAIAWGALFVMGQTVLLYGLGKNVMF
FSGCAVLVYLLCVFLVYRRWVAPLPVVGQLRNVGAPWLVGAMSVVYVGEFLLGKVLDL
PAEPFMTALFADKSIPDVILTLLAVFILAPLNEEILFRGIMLNVFRSRYRCTMWLGAL
ITSLLFAAAHSQYQNLLTLAEMFLVGMITSAARIRSGGLLLPVLLHMEATVLGLLLG"
gene 756..1013
/gene="pemI"
/locus_tag="pEL60p02"
/db_xref="GeneID:2656853"
CDS 756..1013
/gene="pemI"
/locus_tag="pEL60p02"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to stable inheritance protein PemI from
plasmid R100 (NP_052994)"
/codon_start=1
/transl_table=11
/product="stable inheritance protein"
/protein_id="NP_943201.1"
/db_xref="GeneID:2656853"
/translation="MHTTRLKKVGGSVMLTVPPALLNALSLGTDNEVGMVIDNGRLIV
EPHRRPQYSLAELLAQCDPNAEISAEEREWLDAPATGQEEI"
gene 946..1347
/gene="pemK"
/locus_tag="pEL60p03"
/db_xref="GeneID:2656889"
CDS 946..1347
/gene="pemK"
/locus_tag="pEL60p03"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to stable inheritance protein PemK from
plasmid R100(NP_052994)"
/codon_start=1
/transl_table=11
/product="stable inheritance protein"
/protein_id="NP_943202.1"
/db_xref="GeneID:2656889"
/translation="MLKSQLKNENGWMRRRLVRRKSDMERGEIWLVSLDPSAGHEQQG
TRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGAGIRTTGVVRCDQPRT
IDMKARGGKRLERVPETIMDDVLGRLATILT"
gene 1740..2174
/gene="mucA"
/locus_tag="pEL60p04"
/db_xref="GeneID:2656940"
CDS 1740..2174
/gene="mucA"
/locus_tag="pEL60p04"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to translesion synthesis protein MucA from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to MucA from plasmid R446b (AAC82517)"
/codon_start=1
/transl_table=11
/product="translesion synthesis protein"
/protein_id="NP_943203.1"
/db_xref="GeneID:2656940"
/translation="MALDLVYPRPSVEGAALPFFAEPVAAGFPSPAAGYEANELNLHD
YCVRRPAATYFLRVSGDSMRDARIHDGDVLVVDRAEEPRHGSIVIASIDNEFTVKQLQ
LRPYPCLMPLNPAFPPIRFDPEALQIWGVVTFTVMRHRPCTP"
gene 2123..3427
/gene="mucB"
/locus_tag="pEL60p05"
/db_xref="GeneID:2656887"
CDS 2123..3427
/gene="mucB"
/locus_tag="pEL60p05"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to translesion synthesis protein MucB from
plasmid R446b (AAC82518)"
/codon_start=1
/transl_table=11
/product="translesion synthesis protein"
/protein_id="NP_943204.1"
/db_xref="GeneID:2656887"
/translation="MGCGYVHCHETPPVYALIDVNSMYCSCEEAFRPDLRGRPVVVLS
NNDGALVAVNRAAKALGVRRGEPYFRCRRLLEQHNVAVFSSNYTLYASFSARFATVVE
SLAPRTFVYSIDELFADASHMEGVMTPQAFGQLLRAEVLRQTTLTCGVGVAPTKTLAK
LCNHAAKTWPATGGVVALSDAVRLKKLMSLVSAGDVWGVGHRTEKGLAAMGIKTALAL
AEMDIRLARRLYGVTLERTIRELRGEACFALEEGTGAKQQLVVSRSFGARVTQLAQMQ
QAVTKYATRAGEKLRQENRLAKVVTVFIRSSAYDAGGVPYSNQATEVLPVPSQDTRDI
IAAAQLGLSRIWREGVRYAKAGVMLSDLQGYETQLDLFSPAAVRPGSEKLMATIDKIN
REGRSRIFFAGEGIDPEYAMRREMLSPAYTTQWKDIPAAFMR"
gene complement(3450..4298)
/locus_tag="pEL60p06"
/db_xref="GeneID:2656942"
CDS complement(3450..4298)
/locus_tag="pEL60p06"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF6; similar to hypothetical protein Orf2 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein YacC from plasmid ColIb-P9
(NP_052452); orf6"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943205.1"
/db_xref="GeneID:2656942"
/translation="MKNDELATRRAEAIAGDRCFTKGRLRDEFRMKPAPGAEPVKWYK
SAYGGKYAVYRIADCVPMREKRPPTEKQQQAGLRLSVLSRLNNTSGRMARRAHDWLSL
APLFLDTETTGLGNTAEALEIGLTDAAGRVIFETRLKPTVAIEAQAAAVHGIDEPALS
GAPSWPDVALQLRHAIGARPVIIFNAPFDTRILKQTAAAHGDPADWLGELTVYCAMEL
AAGYFGATNRYGTISLASAASQAALTWEGEAHSAIADARMTAGVVNAIAAYHLALLQE
QERLQA"
gene complement(4295..4621)
/locus_tag="pEL60p07"
/db_xref="GeneID:2656939"
CDS complement(4295..4621)
/locus_tag="pEL60p07"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF7; similar to hypothetical protein Orf3 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein from Proteus vulgaris (NP_640006);
orf7"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943206.1"
/db_xref="GeneID:2656939"
/translation="MNNMQSKAPSMRLSGVQKDVLFVLYGLAERQLSGPFPAMQLFSI
LNKGRLQPVADTNFRRSCHTLNRHGLLSKYRDNQSLTLAFGLTEAGLEIAREVYHKRL
TEMEKS"
gene complement(5570..6214)
/locus_tag="pEL60p08"
/db_xref="GeneID:2656934"
CDS complement(5570..6214)
/locus_tag="pEL60p08"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF8; orf8"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943207.1"
/db_xref="GeneID:2656934"
/translation="MPYYKGRWHRYSEAERRAYGAAMREKASKAASAAWHREWISKTG
LRERLWTDRAIADFLKPPQKAGPVYAWKRKYILRVEQTPAFRAWMIQRQDWLMRRGKL
PASLQTGEDMTGLIGSGLTLRTVYENAQGEKRLIVSVTDNVVLWKTADPELPAGGKSQ
GSATLASFRRWIASEHPASGVELEAFDKVLHRRKYAQQTTREIRAMKNRIRQER"
gene complement(6797..7432)
/gene="kfrA"
/locus_tag="pEL60p09"
/db_xref="GeneID:2656944"
CDS complement(6797..7432)
/gene="kfrA"
/locus_tag="pEL60p09"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to plasmid maintenance protein KfrAs;
plasmid pO157 from Escherichia coli O157:H7 (NP_052633)"
/codon_start=1
/transl_table=11
/product="plasmid maintenance protein"
/protein_id="NP_943208.1"
/db_xref="GeneID:2656944"
/translation="MNISNDIRARIEAAAEALVSEGVNSPTNEQVRQKLGGGSLSHIS
PVMREWRRRLREQTDTPALPVPDKLQQLSADLAARLWQQARELAEADAAAVREQADAD
IAQADEQRDEALDEVRRLEAELTYLRGVADERDRLRGQLEETRAALAESRTNNAVLQA
TADAGTRQLDDTRAELKLAREDNKALQAELLQLARAAGRQPDPAQNKTGKE"
gene 8182..8526
/locus_tag="pEL60p10"
/db_xref="GeneID:2656938"
CDS 8182..8526
/locus_tag="pEL60p10"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF10; similar to hypothetical protein Orf10 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf10"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943209.1"
/db_xref="GeneID:2656938"
/translation="MEYEAYKVRGYGFGLKKEITGVLGRYPTQEEAQKVADDYTQACL
PDNLPDSYDMGMVRPVAAGEPAALDTDVFRGPGAPFMMDAGQLSTGQTVCLGKAADGK
RFFVGGEHSGGQ"
gene 8709..9293
/locus_tag="pEL60p11"
/db_xref="GeneID:2656937"
CDS 8709..9293
/locus_tag="pEL60p11"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF11; similar to hypothetical protein Orf11 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf11"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943210.1"
/db_xref="GeneID:2656937"
/translation="MATKHINDELWHRIEVLTVRANARQNLIRPVKEADVLHLVLQRG
LELLTDDDLLQLGKYRRPIGFVLRRPGMEMLKLDTLSVADAATILMRSGPATLCIWSR
DDILRQASEAVIRERLPETALLSEGDDRARFQTLLPGVWNAANRGETAVISLRADNAD
LAIARITDLMCESLLGYKGQRAYRADKDEQGKES"
gene complement(10073..10618)
/locus_tag="pEL60p12"
/db_xref="GeneID:2656936"
CDS complement(10073..10618)
/locus_tag="pEL60p12"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF12; similar to hypothetical protein Orf13 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf12"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943211.1"
/db_xref="GeneID:2656936"
/translation="MDINYYDKQQEEFEAVTLALKANLEEVWGSSLKNQGKSLDDQVT
YMKLFEELQYNLNPYYFKKYTSAKEMDEDKVAAFVARTRDYKHGITIKSWPGRPQKWL
KGRIKPLHPVEGTNLCWIDTSNIVHIGADRQFDDQYYLTVTTQNGQTYRVNDVLLPGR
LLDAAHEALFRALDSATGGNF"
gene 10759..11220
/locus_tag="pEL60p13"
/db_xref="GeneID:2656935"
CDS 10759..11220
/locus_tag="pEL60p13"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF13; similar to hypothetical protein Orf14 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf13"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943212.1"
/db_xref="GeneID:2656935"
/translation="MMKKPLIAGIMLVVAHTAGAAQGDDTDLQQIYTEAGIQGICSAG
MLAVPEEARDEVVPQNLRHLLVQCAYFDEQQLRRRAGLPAQTFSHWRDRNAVLNLSSD
QVSDALWLSAWRDFRAQLTSAYPATTEKKAQGKEAVPAGTKPGTEHGSAAD"
gene 11458..12045
/locus_tag="pEL60p14"
/db_xref="GeneID:2656933"
CDS 11458..12045
/locus_tag="pEL60p14"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF14; similar to hypothetical protein Orf16 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to putative membrane protein STY4561 from Salmonella
enterica subsp. enterica serovar Typhi (NP_458647); orf14"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943213.1"
/db_xref="GeneID:2656933"
/translation="MNESIHVVGSFILAGILLYGLWQGTRRRRRRHERKQASAVRVID
KINTFPHFGQKIAYLRKIDPFVFEELLLEGFERRGFEVIRNRRYTGDGGIDGRVKIDG
QTWLIQAKRYTSYIAVGHVRDFSDLLNATGARGFFCHTGKTREGTKSLIRGDSRMILV
SGQKLLDLIATDAPFIPYPGYRPPAEMVHPEQETT"
gene 12042..12527
/locus_tag="pEL60p15"
/db_xref="GeneID:2656932"
CDS 12042..12527
/locus_tag="pEL60p15"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF15; similar to hypothetical protein Orf17 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf15"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943214.1"
/db_xref="GeneID:2656932"
/translation="MKFKGYVAALPALLLTGCAMLPGQPTDYDRFCNVSGIASHGETY
RVSDSQDFWLTPNGRYLSQAEYSSPADTLQKLTGVVSGEDPDQVRKNAVRVRVFRVES
ENSHKGACLPVRYDDNGAQRKMDSLTNGRRMVVFSEDEGQSGQQIYNKSRGTGFSYRL
L"
gene 12791..13531
/gene="resD"
/locus_tag="pEL60p16"
/db_xref="GeneID:2656931"
CDS 12791..13531
/gene="resD"
/locus_tag="pEL60p16"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to resolvase ResD from Citrobacter freundii
plasmid pCTX-M3 (NC_004464); similar to resolvase ResD
from plasmid ColIBM-C1139 (P18021)"
/codon_start=1
/transl_table=11
/product="resolvase"
/protein_id="NP_943215.1"
/db_xref="GeneID:2656931"
/translation="MNTFPLQISQNSRSDAIGTGRVTYAYFDYADALALREMASQADL
PKYLLAPEVSVFLRYVPDLRQQVLFDTLWNTGARINEALALTGASFQLDGSRPFVRLK
TLKQRQRGRGRPGKDEEVFRLVPLTDPQYVRKVREFLTTLRIGKQQLLWPVQSDNTPR
NWIRKALDLAKRDSVTFSIPVTCHTFRHSFCMHLIQHGVPLKVVQAYAGHSRLETTET
YTRVFALDVGRQYGVRFSLPDSHLTLPE"
gene 13772..14746
/gene="parA"
/locus_tag="pEL60p17"
/db_xref="GeneID:2656941"
CDS 13772..14746
/gene="parA"
/locus_tag="pEL60p17"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to plasmid stability protein ParA from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to ParA from plasmid ColIb-P9 (NP_052472)"
/codon_start=1
/transl_table=11
/product="plasmid stability protein A"
/protein_id="NP_943216.1"
/db_xref="GeneID:2656941"
/translation="MRIFVDDGSTNIKLAWMEDGAVKTLISPNSFKPEWSMTLLTDSS
VPASANYEIDGEKYSFDQLSPDAVRTTETRYQYSDVNVVAIHHALMQSGIEPQPVDVV
VTLPLGEYLDENDQPNMANIERKKANVKRAVAVQGRESFTVRKVSVLPESVPAGFSVL
KDLDDLDSLLIVDIGGTTLDIAHVRSKMSGFTKTHCDPKTGVSIITEAVKHALDTSVS
TRTSSYFADRLIQARNDETFLSRYLQNADQRAQVMKVLHEREKALTHRVTDSVGRFAG
FTHVMVVGGGASLVAGAVKQATGVSDDRFFVSDNPQFDLVLGMVAMKG"
gene 14749..15192
/gene="parB"
/locus_tag="pEL60p18"
/db_xref="GeneID:2656928"
CDS 14749..15192
/gene="parB"
/locus_tag="pEL60p18"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to plasmid stability protein ParB from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to ParB from plasmid ColIb-P9 (NP_052473)"
/codon_start=1
/transl_table=11
/product="plasmid stability protein B"
/protein_id="NP_943217.1"
/db_xref="GeneID:2656928"
/translation="MTDNRKCSFYIYPERNAADRVADGFLEKLPQKERGRAMRAMMLC
GAALMKQDERLPFLIAEFLTESTSMQDIQRIISSTLPQQDTGEMARLVEAFLQATGGG
SNTVSPAGGAAPENSPAVAPEPAAPEDKNLEETRKNVQHLFPDDD"
gene 15202..15753
/gene="nuc"
/locus_tag="pEL60p19"
/db_xref="GeneID:2656930"
CDS 15202..15753
/gene="nuc"
/locus_tag="pEL60p19"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to hypothetical endonuclease Nuc from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to endonuclease YPTM1.73 from Yersinia pestis plasmid pMT1
(NP_395419)"
/codon_start=1
/transl_table=11
/product="endonuclease"
/protein_id="NP_943218.1"
/db_xref="GeneID:2656930"
/translation="MKKYVLLTLTLIAGAVAANPVTAAGNVQAQTATEVKTGFSPGGT
ALNLVLDSIDHAQHEILVAAYSLTSRPVAGALRAAKKRGVSVVVVADRKANDNRYTEV
NFLANNRVAVRINDNYEAMHDKFMVFDRRAVLTGSFNFSASADSRNAENVVLISGAPA
VTEAYVNEFSRLWGEGKDVAPRY"
gene 15871..16377
/locus_tag="pEL60p20"
/db_xref="GeneID:2656929"
CDS 15871..16377
/locus_tag="pEL60p20"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF20; similar to hypothetical protein Orf19 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf20"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943219.1"
/db_xref="GeneID:2656929"
/translation="MQSFPLFVSRVVPVITLSHCLRQRRWSLHNTPCQIDLRSGCHLR
SQPFGTLSRREISDRPPAMPRGYWFRQCSRDVMFTGRIDQADPMKQVYYNEGWSGPNK
YTFEVYQLENGSYRALARKWNGKINKVQQETQYLSDTREGLKHQDYPRTRQVKIFLNS
DFWEKGND"
gene 16370..16849
/locus_tag="pEL60p21"
/db_xref="GeneID:2656927"
CDS 16370..16849
/locus_tag="pEL60p21"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF21; similar to hypothetical protein Orf20 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf21"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943220.1"
/db_xref="GeneID:2656927"
/translation="MIKMVSVVPQPETVKTLREKMGMTETALGAVMGYELRAWQRKEA
ISDDLSQYNKTSLRPGEYNMLMLIAGVHPDYRLNRAFSPDDMVKDPATAEDVRRLRLA
LGLKHAEIAALFGYKPASWQTKEKAAQRGVKLKTGEFNFLLLLAGEHPSLQLVEKAK"
gene 16878..17288
/locus_tag="pEL60p22"
/db_xref="GeneID:2656926"
CDS 16878..17288
/locus_tag="pEL60p22"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF22; similar to hypothetical protein Orf21 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein R0167 from plasmid R27
(NP_058380); orf22"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943221.1"
/db_xref="GeneID:2656926"
/translation="MITTRRMLMLYACLVPVALTGCDLADYFPNVSQPVPVISPGYQV
DIDGHPVRISGFDDCPREKDEARHAAAQDEKGCIVLSAERSEVKVRLYQPAGAVTETW
RIIREKDARQNDIIRLQRPNGALVMQNLQGKESP"
gene 17406..17669
/locus_tag="pEL60p23"
/db_xref="GeneID:2656925"
CDS 17406..17669
/locus_tag="pEL60p23"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF23; similar to hypothetical protein Orf22 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to conserved hypothetical protein SO0799 from Shewanella
oneidensis MR-1 (NP_716430); orf23"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943222.1"
/db_xref="GeneID:2656925"
/translation="MTALNSQQQADVARYIREYGNKTVISPEWSLIYFSLCQCELHQS
HEAIIFHNGRPAGLFLLNETGELTELYLLGSLSDILTAAAVNK"
gene 17691..18053
/locus_tag="pEL60p24"
/db_xref="GeneID:2656924"
CDS 17691..18053
/locus_tag="pEL60p24"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF24; similar to hypothetical protein Orf23 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to conserved hypothetical protein STY4595 from Salmonella
enterica subsp. enterica serovar Typhi (NP_458679); orf24"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943223.1"
/db_xref="GeneID:2656924"
/translation="MTMQSELVFTDPMLNVVIAEVKRFNCPLLFVKDHGVYVMAAKGE
KNSNGMHNVCYANGFNPDTTDFDELWDRMRDACGGDDFCESLELDPRSIELLSRTKPC
LKIMLSETELEVIAGGQK"
gene 18175..18624
/locus_tag="pEL60p25"
/db_xref="GeneID:2656922"
CDS 18175..18624
/locus_tag="pEL60p25"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF25; similar to RadC-like DNA repair protein
Orf24 from Citrobacter freundii plasmid pCTX-M3
(NC_004464); similar to RadC-like protein YfjY from E.
coli K12 (NP_417131); orf25"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943224.1"
/db_xref="GeneID:2656922"
/translation="MKFSAEELNIIRQADAIIAGKITTTDFITGADAARSLLRFRLAA
EPRESFCAFFLNCHNGVIAFEELFKGTISSVTVHPRIVLQRALHHNAAAVVLAHNHPS
ANTTPSQADKLITERLAQVLGMVDVKVLDHLIVGGSDIYSFAEHGLI"
gene 18669..18935
/gene="korC"
/locus_tag="pEL60p26"
/db_xref="GeneID:2656923"
CDS 18669..18935
/gene="korC"
/locus_tag="pEL60p26"
/inference="non-experimental evidence, no additional
details recorded"
/note="KorC; similar to transcriptional repressor KorC
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to KorC from plasmid RK2 (Q52331)"
/codon_start=1
/transl_table=11
/product="transcriptional repressor"
/protein_id="NP_943225.1"
/db_xref="GeneID:2656923"
/translation="MGNKYTVPLNVGAIRESCFRPADKWTPPTGDELRYLLENVLNLS
QEGLARHVGVNGRTVRRWVNGESDIAYSVWCVLCIDAGLPPIWK"
gene 18999..20282
/locus_tag="pEL60p27"
/db_xref="GeneID:2656921"
CDS 18999..20282
/locus_tag="pEL60p27"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF27; similar to hypothetical protein Orf25 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
toputative bacteriophage protein STY1015 from Salmonella
enterica subsp. enterica serovar Typhi (NP_455494); orf27"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943226.1"
/db_xref="GeneID:2656921"
/translation="MNTDNYFFRVPATRGIQGGIEQYMLTVPMVVLRRILAMDNDGDV
MDRSQREANKTRAKKIRNYVAGATSKRAPYILPSITGNIDSHVEFLPSELSPAVGILK
IPMDADLKLFDGQHRALGIFEFVRDYSNTEDTISLLLTVGLPLELRQQFFADINNNAS
KPAAAISMAYNNNDPVNQLAMHLARTVTGLAGTVDFEHNVVPAKSSRLISFKALNDAT
KKMLNLRANSIPSPQQRDMAERLWTAWAQAMRWNDIAQDDIAAEYRQEALGLHGIMIN
AIGMATSRMLRHRTPESIENLLACAENGDNGFHYRESFVPECWEGKCVDPETGTIKTD
RRALEATAEALQKLVDPFADALWLRAYLSAEEASDAALLKYAADIESYKQRTADPMIN
IVEKLKALGDGEPQYRASVLASSEGLSRYLAGVEG"
gene 20888..21067
/gene="ccgAI"
/locus_tag="pEL60p28"
/db_xref="GeneID:2656920"
CDS 20888..21067
/gene="ccgAI"
/locus_tag="pEL60p28"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to CcgAI from plasmid R46 (NP_511209)"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943227.1"
/db_xref="GeneID:2656920"
/translation="MSKALTPSQLKAELDTQKDALLKACLYALNEIPNRRLSGPYSST
YALAAKLDQLLQSCK"
gene 21140..22000
/locus_tag="pEL60p29"
/db_xref="GeneID:2656919"
CDS 21140..22000
/locus_tag="pEL60p29"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF29; similar to conserved hypothetical protein
Orf26 from Citrobacter freundii plasmid pCTX-M3
(NC_004464); similar to conserved hypothetical protein
YdiA from plasmid ColIb-P9 (NP_052499); orf29"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943228.1"
/db_xref="GeneID:2656919"
/translation="MSSKNTLLSVDLMSCQHGGDVIPSIAIERIISLRDEGIRVYLDG
IDKLRKARDLMQQAGGCQYLYDYDKAVESAIKWSDTTPDQAETAISRVIDGKIWDRLM
TETGMYTLMSNKQRQEWDRQVAGKEMPPITLDNVMSTFRHLNASKADTFTQGLIDIFK
SLSWDYKTNNPCMFGKRIIIAPLLDVWRSGWVRFSSDGHTKIDDLARPFYVLDGRNVP
DYRVSDGAKLDAFFSENQFNGKVFECDYFSVRYYKKGSAHITFKRLDLVEKINNLVAS
HYPGMLPPRV"
gene 22191..22529
/locus_tag="pEL60p30"
/db_xref="GeneID:2656916"
CDS 22191..22529
/locus_tag="pEL60p30"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF30; similar to hypothetical protein Orf27 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein YagA from plasmid R721
(NP_065301); orf30"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943229.1"
/db_xref="GeneID:2656916"
/translation="MAIQSLQFRNGSVSLGDVFVSSWGYEQTNTCFYQVIALRGKKTA
VLRRIAAQQVKADSAMSGELKPVLNEFKGEPVTRRIRENHEHPSVSIDEYEQAYKTDP
NESHFYSTWG"
gene 23118..23348
/gene="rmoA"
/locus_tag="pEL60p31"
/db_xref="GeneID:2656918"
CDS 23118..23348
/gene="rmoA"
/locus_tag="pEL60p31"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to conserved regulatory protein RmoA from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to RmoA-like protein YdfA from plasmid R721 (NP_065337)"
/codon_start=1
/transl_table=11
/product="regulatory protein"
/protein_id="NP_943230.1"
/db_xref="GeneID:2656918"
/translation="MAETVYQARRRFYLLRFRRSRNPDTLEKMYESMRDRGQVPPEDT
EAFEAAADHRRAELASGRIWDKIPPHVWQYVK"
gene 23646..23882
/locus_tag="pEL60p32"
/db_xref="GeneID:2656917"
CDS 23646..23882
/locus_tag="pEL60p32"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF32; similar to hypothetical protein Orf28 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein c0276 from E. coli CFT073
(NP_752220); orf32"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943231.1"
/db_xref="GeneID:2656917"
/translation="MTTLHIREIPTDGAPPICAGRSISDDDLCASCQHLDYRPGHLSA
CLLSGCGRDDWPSELDANGYSVACSSYEREKSLD"
gene 23967..24377
/locus_tag="pEL60p33"
/db_xref="GeneID:2656886"
CDS 23967..24377
/locus_tag="pEL60p33"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF33; similar to hypothetical protein Orf29 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein YcgC from plasmid ColIb-P9
(NP_052486); orf33"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943232.1"
/db_xref="GeneID:2656886"
/translation="MHGNVNEICARLLDSFEPQQRISLLIWTAEDVHDCTSDMNLTDD
EAEAVLAEIAECSSHSRYGVGKDTVWSLAKQVREDAARDRKIEVNAEALQKVVALAAQ
FIRLEEIQSGEGAARRLYPQESEALECITKVING"
gene 24439..24744
/locus_tag="pEL60p34"
/db_xref="GeneID:2656885"
CDS 24439..24744
/locus_tag="pEL60p34"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF34; similar to hypothetical protein Orf30 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf34"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943233.1"
/db_xref="GeneID:2656885"
/translation="MSQNEAYYDTLALIEKGQWCFGSMDEENEERAIKAAKALALFAR
LNEQGSDGHPVSEIIVDFIANLMHLGEAINFRVLDEESAVIPLVRIAAVHFNAETKS"
gene 24943..25383
/gene="klcA"
/locus_tag="pEL60p35"
/db_xref="GeneID:2656915"
CDS 24943..25383
/gene="klcA"
/locus_tag="pEL60p35"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to hypothetical anti-restriction protein
KlcA from Citrobacter freundii plasmid pCTX-M3
(NC_004464); similar to KlcA from plasmid RK2 (P52603)"
/codon_start=1
/transl_table=11
/product="anti-restriction protein"
/protein_id="NP_943234.1"
/db_xref="GeneID:2656915"
/translation="MSTELNQPAITARIIPNNRRMAFLPRLFGAWYQNGQDRVFNYAK
SLCVGYEGGSWEFVELSCGSGFMYPLSAERFTVSVSGNWFEGELSAEATGIVLTLFTL
NHMIWHAHDAGYEHICDMLITQQEKLKLYADQHAEAGLIYRAID"
gene 25865..26086
/locus_tag="pEL60p36"
/db_xref="GeneID:2656884"
CDS 25865..26086
/locus_tag="pEL60p36"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF35; similar to hypothetical protein Orf32 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf35"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943235.1"
/db_xref="GeneID:2656884"
/translation="MKEADQKKVNAVMAIADYLGVKNQIEVIEYSAESVQVEWRNPKT
KQLIHRDYTFAISFVKDFEKALKSNVKFY"
gene 26158..26592
/gene="ssb"
/locus_tag="pEL60p37"
/db_xref="GeneID:2656883"
CDS 26158..26592
/gene="ssb"
/locus_tag="pEL60p37"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to single-stranded binding protein Ssb from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to Ssb from Shewanella oneidensis MR-1 (NP_719558)"
/codon_start=1
/transl_table=11
/product="single-stranded binding protein"
/protein_id="NP_943236.1"
/db_xref="GeneID:2656883"
/translation="MWKRGENKVILMGRAGKDAEVRYTPNGTAIASLTLATEISYSDN
EGKEQKETEWHDIVIFGKKAEAAGKYFKKGMMLYFVGRIRNNKWQGTDGKMRSNKEIV
IDNNGEMQMLPGAGPRNTSAEGLGGTENHDEPPFPDMNDYPQ"
gene 26649..26960
/locus_tag="pEL60p38"
/db_xref="GeneID:2656882"
CDS 26649..26960
/locus_tag="pEL60p38"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF37; similar to hypothetical protein Orf33 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to hypothetical protein HCM2.0094c from plasmid pHCM2 of
Salmonella enterica subsp. enterica serovar Typhi
(NP_569566); orf37"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943237.1"
/db_xref="GeneID:2656882"
/translation="MNISEQYRVAVVSTGHVKKEDAELLDKVCNDDLSGQGLFWIEKN
RYGWILRISATEQWREELTRAGVSASALDNIAALNGAGFDWIWFDRDAEQVPELTVWE
W"
gene 27093..27629
/locus_tag="pEL60p39"
/db_xref="GeneID:2656881"
CDS 27093..27629
/locus_tag="pEL60p39"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF38; similar to hypothetical protein Orf34 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf38"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943238.1"
/db_xref="GeneID:2656881"
/translation="MATLYPYEVYTLIVSELIVSHFNDVAMVYPGSEEIKKNYDSELS
AVQVVNGIREKLIEDGVIQCEQCPLLSEWDENKVINQLIKDYRLILNRDYELNRVRQQ
LAPELIAQIENWKEQKYSDSAKEYEVLYETININGKEVTGKLNVVAVSRFDAVFIVGQ
RHANDNFLVLDVKEVMNH"
gene complement(28130..28495)
/gene="mobC"
/locus_tag="pEL60p40"
/db_xref="GeneID:2656880"
CDS complement(28130..28495)
/gene="mobC"
/locus_tag="pEL60p40"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to hypothetical protein Orf35 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to MobC (PSPTOB0032) from plasmid pDC3000B of Pseudomonas
syringae pv. tomato DC3000 (NP_808620)"
/codon_start=1
/transl_table=11
/product="mobility protein C"
/protein_id="NP_943239.1"
/db_xref="GeneID:2656880"
/translation="MPAKKKAFYSSEDIGKFKSILDDLPDVTSERLEKKHVLDELKSD
IKKLKDSKGYEDKEILKFLNDAGFSDVTLRDIKEITVGRVGKKRTSNSRKKITGVDEE
QRTQNGSTGQNPDASGPQY"
gene 28770..29087
/gene="mobB"
/locus_tag="pEL60p41"
/db_xref="GeneID:2656879"
CDS 28770..29087
/gene="mobB"
/locus_tag="pEL60p41"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to NikA from Citrobacter freundii plasmid
pCTX-M3 (NC_004464); similar to MobB (PSPTO1092) from
Pseudomonas syringae pv. tomato DC3000 (NP_790926)"
/codon_start=1
/transl_table=11
/product="mobility protein B"
/protein_id="NP_943240.1"
/db_xref="GeneID:2656879"
/translation="MSRSESRKTDDRIQVRCSTEVKAKLTEKAHEAGLSLSQYLIKSG
LGKRIQSKGNYNALAALVKITALQKHLFNEGAGVHSKEYSEILIEVKKAAQKLQQEMD
GDT"
gene 29074..31053
/gene="mobA"
/locus_tag="pEL60p42"
/db_xref="GeneID:2656878"
CDS 29074..31053
/gene="mobA"
/locus_tag="pEL60p42"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to putative nickase NikB from Citrobacter
freundii plasmid pCTX-M3 (NC_004464); similar to MobA
(PSPTOA0029) from plasmid pDC3000A of Pseudomonas syringae
pv. tomato DC3000 (NP_808687)"
/codon_start=1
/transl_table=11
/product="mobility protein A"
/protein_id="NP_943241.1"
/db_xref="GeneID:2656878"
/translation="MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETAL
AVKSDMFEGLNNYLTRKQKVISTPVNVEPGVQRVVVGDVTCQYNTFSLDGAALEMNSV
SQQNTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLASMGMSDHQYVAAIHRDTDNL
HVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVNDRQQIVRNP
HSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWD
DVHKTFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEY
QPSHIEPAKVSVFKTAYTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYS
PDKDRIADEYRKIAQHTRLVKNNVRHSVSDPHTRKLMYNLAEFKRLQAVANLRLSLRE
ERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSSRKKEKYKQQLVEQIGFNR
TFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLTESNGID
KEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQ
QAYAQNEKHRLIREQNNSKNEMQFRSESDDKFNPK"
gene 31067..31567
/gene="traH"
/locus_tag="pEL60p43"
/db_xref="GeneID:2656877"
CDS 31067..31567
/gene="traH"
/locus_tag="pEL60p43"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraH; similar to conjugative transfer protein TraH
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraH (PSPTOA0043) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808701)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943242.1"
/db_xref="GeneID:2656877"
/translation="MKIKMQTVLAAVSVLALAGCASQSEKEKQISAQQLVDQELREQA
IKIKLAQDELYQAGAINRTRYKFPTIINANSQYVRVSWQGDAYELLEQLAKQRGLQFT
SQGIKLPLPLNIDVGGSKVTFEQLLTLIRQQTQYRATINQKPGELQLLYLTPSKKGSF
LRGTRP"

gene 31564..32343
/gene="traI"
/locus_tag="pEL60p44"
/db_xref="GeneID:2656876"
CDS 31564..32343
/gene="traI"
/locus_tag="pEL60p44"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraI; similar to conjugative transfer protein TraI
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraI (PSPTOA0044) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808702)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943243.1"
/db_xref="GeneID:2656876"
/translation="MKLKLIVLLTLPLLAANVARADDSDVKGLDYYMDPPSQSDDEAD
VTGSMLNDAARTIGFRGGKAERAKEIRAALENQRSNLDYMYSFQPLISSEGYLPPVIA
EAKDVAHITNEQIRTANRAYDIVVPARFVSNPPTWKSYLLTGLMAQRIELPEPAAMPK
DGKQRDIWKKAVALGWSDGRQKADEIFTANFNRLTRDYTGMLRYSTLLQQGMIKAPVI
TQQQQTVTGDKNRLMLGDKTKRMKQQAEFDINKRSWKPTIR"
gene 32354..33517
/gene="traJ"
/locus_tag="pEL60p45"
/db_xref="GeneID:2656875"
CDS 32354..33517
/gene="traJ"
/locus_tag="pEL60p45"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraJ; similar to conjugative transfer protein TraJ
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraJ (PSPTOA0045) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808703)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943244.1"
/db_xref="GeneID:2656875"
/translation="MEAFNFGPTLTPQTLERFLVHCSNNEVSDILLQGGDKIWVERHG
RQLPMTDYPIDTLELERTVDKVFGQEIKGILKSAAVVNTAIQLRGDEAGTIGLGRGET
RRFRANFTQADIYKTEAAMSLTLRVLNEFIPQLKQMGIEPDLFNSLLPAAGLGLICGE
TGSGKSTLMASIFQYCGETYQDRKIITIEDPIEYRLGSKDWIAPAPAQSQIGRDIDTF
HNFITLSGLRRSPKIMGVGELLKRPEFEAAVLAGKSGHFCLGTLHVKTVGEAISRALQ
NYPPEMREAGAFDLLSILSYIIVQRLLKTKDGRRKAVREYLVIDNSLRRKLYDVDYSK
WGRYIDDLLIAEKRSLIQNAWVMHQEGLIDEAEVIEVAGYMDYLALKEGKYGH"
gene 33792..37173
/gene="pri"
/locus_tag="pEL60p46"
/db_xref="GeneID:2656874"
CDS 33792..37172
/gene="pri"
/locus_tag="pEL60p46"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to DNA primase from Citrobacter freundii
plasmid pCTX-M3 (NC_004464); similar to DNA primase
(PSPTOA0049) from plasmid pDC3000A of Pseudomonas syringae
pv. tomato DC3000 (NP_808707)"
/codon_start=1
/transl_table=11
/product="DNA primase"
/protein_id="NP_943245.1"
/db_xref="GeneID:2656874"
/translation="MAKPEIATERTRLSIPFDDRQRAIRAAGKLADGSNALDYVKEEK
VWYAQPGANLSRLKEWIFDPNKVIEEPPLDIQAIEDEFTSWLEERGAVIKDPIEFDGQ
KHYVDTVDGKAGSRKGVYAAFLDGRPAGWYRDYKNGGEIQKWVSTGAAPNPEQMAMLR
ADAAARREQRAAAQADKFDQTANRLMEEYNRLPDATGDLAYLKNKQVIAANGLKADER
GNVVIPLFNADGEFRTLERIWADGSKHLEKDGQAWGSFFVVGGQLKDGDNLLYAEGYA
TAASISEAINQPVIMTVNAGNMVEVAGRLKDAFPNSTHYFLADNDIYKDENVGLEKAT
EAAELTAGHVLVPAFSNPKEGLTDYNDLHVSEGLKQVRLQVEGAINQINRVDTMPTDN
PNITDVNHSSTDSAAVAAPEKAAPVASAPAAAEPEETASVASAPAAAEPVEAAPVASA
PAAAEPEEAAPVASAPAAAEPVEAAPVASAPAAAEPEEAAQVASAPAAAEPEEAAPVA
SAPAAAEPVEAAQVVSAPAAAEPEEAAPVANAPAAAEPEYAAPTDRDGDDEESNSASD
LEAYAAMMAFGGETTDTAQQKPEGIAPSEPVANTAPAENETEEKKKTNEELENGIRWA
TNDNAETPPKERIDLEGLIARFGYRAEKDYTAYTLDGQDAFYDYGSHLRMATPEASQS
DEMILAAVLTADKQHHRGIEITGSDEFKERVFNLISEYNIEVKLTNPEQRVKLLELKK
ANETAKENVADSKANKQEGANEKANSSVQQNGMRWEESASVQPKKQNASDTQKEDKAA
GESWEKGVIVAHGRAKYEWKDDESMNYFVTLKNEHGEKTLWGKDLERAVKDAGVDTER
LVTVRKLGFVDVEVNAPVRDESNKIVRYETIQTKRNEWEVKPVYPQPTAGNEQAYKPS
ELVPYDAATFQKLRTTIQQITGVDLSREAVPEKELYWFLPNGKPAPESMTKPTGYKLP
QESKTAGTPLLVAPHKKGERPDYYLVESRKGFMQGIAKDKESGEYHSVIGKVNKRIDK
DGNWKTYMTLSAINKNSESGIVLHGYGHVDQGGKNLLYKNTIANEKQPQHLQPASDEV
KNKTVMKQLFHPSNAAKRKDDERREQTHAPVAKSAPRP"
gene 37096..37650
/gene="traL"
/locus_tag="pEL60p47"
/db_xref="GeneID:2656873"
CDS 37096..37650
/gene="traL"
/locus_tag="pEL60p47"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraL; similar to conjugative transfer protein TraL
from plasmid pACM1 of Klebsiella oxytoca (AAD33806)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943246.1"
/db_xref="GeneID:2656873"
/translation="MLQKEKMMKGENRLMHQSQSQRLGHKTKTLLVAVGFSCISVSSF
AATQTCAAYELAKAGADAAYKQEVERINNAAKSESSTSDSLGQCLGSLSVSLKIPQFP
SISDIIDKVKDEVCNTVKSKINEKWGSLTNTTLDPWSTISSRLPDTSGILPNASSKNV
QLNNPAAASGSGEDANSDAFPFHL"
gene 37616..38266
/locus_tag="pEL60p48"
/db_xref="GeneID:2656871"
CDS 37616..38266
/locus_tag="pEL60p48"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF47; similar to hypothetical protein Orf6 from
plasmid pACM1 of Klebsiella oxytoca (AAD33807); orf47"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943247.1"
/db_xref="GeneID:2656871"
/translation="MQTVMHSRSICNYRKSPFGILSNSLPVRISTRRCSAAVSKRINS
VAGRTSRFESTYVSSESSFMKRLTVCSQSSADFIFFELIVAHLGKRCRSATFSCPGYG
LSINFDPVLHFSKSGFTFRGRTKEIFEDLESFISRNIVFFHEPLCGCSFLFSGLLFFL
KFLDHSLCNVGPHINELFKVFWRDFAQNGGGFSSFAHDNCTGFVIIMFAHVYLIVH"
gene 38244..39026
/gene="traM"
/locus_tag="pEL60p49"
/db_xref="GeneID:2656872"
CDS 38244..39026
/gene="traM"
/locus_tag="pEL60p49"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraM; similar to conjugative transfer protein TraM
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraM (PSPTOA0051) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808709)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943248.1"
/db_xref="GeneID:2656872"
/translation="MYTSLFINDLRDFLTQTFEKRNSMKTQNGENIMDQTDSDQNSVV
DDDSNALAPALAEESNRTVQEIVSKHGLKVILIQTLIILVAIIIIGLQGYWLHQKKTK
YIATNGGMITEVHPTDEPAYTAEEVMDFANRTMIKSLSLNFVNYENQLTSVRGDFSAE
GYVSFRKALTDSGLLKDISEKRLNVKLSTTPGTLITEGLIRGTKTYAWQYRIPVTVQL
VGQAQDYRPQPYDLMVQVRRVKEDEDPRGIQVAQAILKPRNY"
gene 39035..40186
/gene="traN"
/locus_tag="pEL60p50"
/db_xref="GeneID:2656864"
CDS 39035..40186
/gene="traN"
/locus_tag="pEL60p50"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraN; similar to conjugative transfer protein TraN
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraN from plasmid ColIb-P9 (NP_052519)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943249.1"
/db_xref="GeneID:2656864"
/translation="MKIKLLTVLMAALFSANSASAADAPTGNGSPQQTAPAVPGGDIA
QWQQASSGLPVNQQSQVQQPPQQTAQEQGQQQAQGQQPQAQPQQRPTTALPPAPMPQI
PPPQQQVTHVNPQTLEELPAPVLQQIQPITPGQVRSARSAMEDMSAAAKTSPLTPIPR
ISSQTVSLSAGASIPQVRVFPNQATTVTFSDATGHPWVLGAPPYNSSPCASGGELCVG
YIPGSAVFTIQPTNAYASGNITVLLKGLATPVIINVKGAEPSVKSKTVDVDYRLDLRI
PKRSPDTPVYTATPEKKISLYDKQLQSVLDGIPPEDAQRLKLKNAPGSTKVWQIGDEL
YVRSNMQLQDEFEKTLSAIDGTHVYVLPATPVLTFSVNGQARDVEVELN"
gene 40198..41547
/gene="traO"
/locus_tag="pEL60p51"
/db_xref="GeneID:2656870"
CDS 40198..41547
/gene="traO"
/locus_tag="pEL60p51"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraO; similar to conjugative transfer protein TraQ
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraQ from plasmid ColIb-P9 (NP_052516)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943250.1"
/db_xref="GeneID:2656870"
/translation="MATDKGKETRKMMLYVGGAAAVVALLGGYWLFGSSDEPATGGSQ
VKAQGLEGKTGREKANDPQYNKLLNEWNADNSEKAALTGDSFISTLSASNPVAVDYGT
KAPPPKYSWESSAKPSGDNSKANDAEQKERERQAKAVATLLQKIDQARTPVVTGVALA
TSLGAEGNDKNGGTFSGWTDSVYPQNKKPDAEKQQGAKNKVKDKGARLVSAYTLVPAV
MDTAMDSDDQNSIAIAHVPTGAQAGAKFYSGQNRLAGDGIRIHFTGMELNGVQCKVDA
YGVASDSLRAAVSSNVNNRWFSRIILPAVANGLGRTGQLYADSNSQMIITDGGNAYRS
TGTPDGKAVAGTIIGGMGEQAGRVLADDAARLPIKQVTVDRNQLIGIQFVAPVYESDC
GENMENASAEQAQQQATPTLSSVQPQQMPQPPAPNYPQQNFPSYPGYGYGTNNPYYR"
gene 41559..42263
/gene="traP"
/locus_tag="pEL60p52"
/db_xref="GeneID:2656869"
CDS 41559..42263
/gene="traP"
/locus_tag="pEL60p52"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraP; similar to conjugative transfer protein TraP
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraP from plasmid ColIb-P9 (NP_052517)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943251.1"
/db_xref="GeneID:2656869"
/translation="MNLFEDDNKNEAAPAQEPVSAKPAEKPKPTVTPAAKASKKPLNI
SDYAWIGGIAVIAILLLVWLFGGADSDTAPATGNGAIQSSAQRPRVQSAPAGQDSGDF
REQISGILLQQKERLDAIESTSKNGMMILSSQLQSANEQIKNLNNQVQELKMKAAGYG
PSFGNQSGTISGSTSQALPLLRGFSINDLSGDLAWVKYKNQTYAVKVGSQLGGVTITG
IDTENRIVTTSKGLIR"
gene 42287..42817
/gene="traQ"
/locus_tag="pEL60p53"
/db_xref="GeneID:2656868"
CDS 42287..42817
/gene="traQ"
/locus_tag="pEL60p53"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraQ; similar to conjugative transfer protein TraQ
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
(NP_052516)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943252.1"
/db_xref="GeneID:2656868"
/translation="MDLESVLIQVANGGQEPLTRLIIGVAAVVGIIGVIGYLMSLRKQ
ARHSTKGVEVGRIFAGIIFCVCLITLKAQMNSGGATLGFGDVSFGPVSYASESTFGMG
AAAVNAVLGIVRILGAYFFYRGIKGLKDSYLEGHTELSASGTRGASIVKIVCGLLLMF
DTQTLDALQSTLNIHW"
gene 42834..43223
/gene="traR"
/locus_tag="pEL60p54"
/db_xref="GeneID:2656867"
CDS 42834..43223
/gene="traR"
/locus_tag="pEL60p54"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraR; similar to conjugative transfer protein TraR
from Citrobacter freundii plasmid pCTX-M3 (NC_004464)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943253.1"
/db_xref="GeneID:2656867"
/translation="MKIVKFIKDKALSASIAAYQLRGTVAKSLVVLPLALLSKEAAAE
TTVWEKINTFTEGMASTQPGLITAGKVVGVVCFIVGLVALWLKNKRGKDISGGFIFWS
MVVGACLVGLTAWISSVGSTVGVDATL"
gene 43269..43763
/locus_tag="pEL60p55"
/db_xref="GeneID:2656866"
CDS 43269..43763
/locus_tag="pEL60p55"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF54; similar to hypothetical protein Orf38 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf54"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943254.1"
/db_xref="GeneID:2656866"
/translation="MKDFKLTRNEQPARCHVCGIKSKDVFSLAEDGQKERMLCSVCLS
LEHPEKMKLETQTGLLLKRNTNRKLYSLLFRSIAKAEKSTDDSYREKAQKLKQILLST
TDVVLNETGSDDGYDLLHLIKKHHQLLPMNFDDEFVTSVSESDELPDVSDWNEIYKGK
RGFK"
gene 43760..46810
/gene="traU"
/locus_tag="pEL60p56"
/db_xref="GeneID:2656865"
CDS 43760..46810
/gene="traU"
/locus_tag="pEL60p56"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraU; similar to conjugative transfer protein TraU
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraU (PSPTOA0060) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808718)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943255.1"
/db_xref="GeneID:2656865"
/translation="MISFFEDVIEGISRNLTSNDSLKYCDLTTVVGLTSQDRVEHPEI
RAPYILTTKNNDFLTVIEVQGAKSSFDEKSFNDFIMHLSNSLSNSFINSGHKLSVVFE
RDFTKNQEELNNVYKPQVAAIERLQIDIKDLIADDAKKIAAHYSRERAYIVLYTSKGM
IAKDELKNEQAKAAGVMKDIPQTRFSQNPIEFQLEGLKITHDAMLWRLIGMLQGDDES
GMGLLVDVLDVKHAGAMMRQMLFRNSTSENWYPRTPFDQNLRVYGAPRKGNIDSVLPP
RLNIQIMEGELEEDGGLIYCDGKYYGSVALELPPLHPVKFKQLFNAINRKIPYRIKYD
FMGGGKKALFWPSVIISFLRFIPSLGTIARDMDYVGAQSETDPTAIMAINFATWGDTK
DEAKRNLAALTKAIEGWGVSGVSKTYGNPGSALIASVPGLTTATPGSLHYPPLSEGLR
MLPFERPASPWHGKGNINFITLDGKLFPYQIASPLQEKFTDVITGVPGSGKSVLANRL
NLSAIFRADKKLPYLTIIDKGYSAKGIADLIWAELPADLRHLVASITLNNDESHCINI
CDTQLGSRYLTQFEEVFLKQMLNAFCIDPAIGQPPDAMSVGQIVSKVVSRVYKAKAHS
DANKFKFNDPVVNEALKVSGLDTELGEDWFEKATWWEVVDKLFAKKYFHAATVAQRYA
VPTIYDFISELQEEGFSKQYADVKVNGSEPVVNFVARCFQAAAADYAIFSGITVYDFS
PETRIAILDMQNVLGDRTTPAGKLKSGIMYLFARQMAVRNYYLPQSAETFIPALPEQY
RAYHQARIRELSEEVKHTFYDECHNFAGIDFIQNALNTADLEDRKFNVRTAFSSQYLS
HMPSSVLKTMNSLFMMRLTEGDEEYLKQLEINIPADILRRFRQLPQGVYPDGSGTAFL
GIFKTKRGLICHILKNTLGPKLLWALNSSAKDRALRDVLYEELGTKQAREVLANRFPM
GSASSIIDEMVVNQGGERDSEEESQTMAMKLAKEIISDVRRGFR"
gene 46807..48015
/gene="traW"
/locus_tag="pEL60p57"
/db_xref="GeneID:2656863"
CDS 46807..48015
/gene="traW"
/locus_tag="pEL60p57"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraW; similar to conjugative transfer protein TraW
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraW (PSPTOA0062) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808720)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943256.1"
/db_xref="GeneID:2656863"
/translation="MIKIGKAKRSVMAVSILAFSVQSAFAYTVNVNSSIPISTQVMPA
LSTANGLLGNIQATLINIGTAISQQGDRQAALMQQVAETNRQFEVEQKRNDRLLQAQD
KYRVPDDICAQSIGGGAAGVSSAAAGGQRTLGSASSAKDVKAIFEVPARATDVDASST
AEVHSQYCDSSDYAAFGGTSFCPSVSDMPRADTSLSSLLYGAGKEGKAPDLTFTDEQT
DAALRYMKNTALRSAGRQLSRGEVKGASGRIYLGMIQQYQALTDAAAQPQMEMIANSK
PNPATDAALADARKVPEVESYFQATASNRAKQLNRMSAREFEEFEVGRRYSNPAYQAT
LTNKNTEDLMREQINIANLNNWLVLKTKQQLEKQNVLLGQILANDAYQTYKPMLAAQL
ESVNAGVSRK"
gene 48012..48662
/gene="traX"
/locus_tag="pEL60p58"
/db_xref="GeneID:2656856"
CDS 48012..48662
/gene="traX"
/locus_tag="pEL60p58"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraX; similar to conjugative transfer protein TraX
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraX (PSPTOA0063) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808721)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943257.1"
/db_xref="GeneID:2656856"
/translation="MTDENKTGDKDTVKSGKLKKGLDAVTGVNDLPEGRAKRTIYYIT
GISDIYFIIASVKQTFSLLFQRASFVKKQIKNLDGPPADSDANQPFAEVMKRSNRTIS
ELLDKASLYKKYWLCCFFALVLILLFLTSGYARLLVNGSPNMSLLRATLTCGVLFAAG
IFAFIKALTCEFMGWQLRNQAHSDAEKGTLRYFLNDGGVRNTFNFSQAGQERGPHE"
gene 48562..50836
/gene="traY"
/locus_tag="pEL60p59"
/db_xref="GeneID:2656859"
CDS 48562..50835
/gene="traY"
/locus_tag="pEL60p59"
/inference="non-experimental evidence, no additional
details recorded"
/note="TraY; similar to conjugative transfer protein TraY
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TraY from plasmid ColIb-P9 (NP_052508)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943258.1"
/db_xref="GeneID:2656859"
/translation="MQRKERYVISLMMGECVIHLIFRRLVKSGGHMSKLKRLLLSLFV
VASPSYSADLGIDGITEAAKRSGDLSRQMLHTVFGEVVNNPFSPSGDGLLNNVFFTVN
EVIAILALVYMGIISIKKLHQAGQLGSFIEGDGNNAFKIVKTTFGWLLLVPTVVGWSV
AQLLFLWCGSIIGVGSANVIADKTASELASGKAVYIAPVMPEMASVAKGMFETNLCAL
GVNQGIAQMEASGQHYENNARMQYQTGDSTYSISVNNGSAVCGTVSLPQRPAGWTSIF
ASGYADSVYSVQQQATDTLWGKMKTAAEQFNAAYMAKMRSGDGELPDVESAIQTAARD
YQLQVQHAANSAAGDDEIVQKMESDIKEKGWLYLGVYYHTLATANTEMKDVANLKPVV
SGMSNDGDIGSIDYFKGLFQAYHSQLKNSNYTPPLGTESNALARNIDQKSLENAATTG
DGTSLITKIFDFNVTNWLATSNYGTGDGYSDVTNPLLKMKAIGDYTLGVAEVGLASWT
AINVAVKVSEGKSLPGFAAGMMNKLTGIRDAIAGVLESVSFLVYPLFYSLFGIGLALS
IWLPFIPMIYWFVAMADWLVTLMTGVLASSLWAATHINIGQSNDERSTYGYVFLIDVM
IRPMLMVMGFIFASLAIVALGTALNMMFKFAMEQVQSDSFTGLLSSIGFLMLYARLCT
GMVARVFALPARMPNYVINWIGQKMNDSVLGDMQNHVHDIFAAFGRGAKNMNRNNPKQ
FNPDAGVDKSKDGIKGA"
gene 50838..51491
/gene="excA"
/locus_tag="pEL60p60"
/db_xref="GeneID:2656860"
CDS 50838..51491
/gene="excA"
/locus_tag="pEL60p60"
/inference="non-experimental evidence, no additional
details recorded"
/note="similar to exclusion-determining protein ExcA of
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to ExcA (PSPTOA0065) from plasmid pDC3000A of Pseudomonas
syringae pv. tomato DC3000 (NP_808723)"
/codon_start=1
/transl_table=11
/product="exclusion-determining protein"
/protein_id="NP_943259.1"
/db_xref="GeneID:2656860"
/translation="MNTLSNTDFKKISNNARPKRLGYYASWLWMMFVFLFLFVSAFVF
LSGLYWTIRDGSIQEHWFSTVGIFVIDAVLIWMLKKDFRSRKLYQVTASMKNSGLFEP
HKDCEHYDLARRTYIGFDFSTGIIGVASLYATSSIKRERLFFEAETVESWESVGRELI
INLRNTGLTTMTITAPNINKAYRDMEIICRTHKNRDENYQHLKSKLTDAGWFINSNY"
gene 51565..51795
/gene="repC"
/locus_tag="pEL60p61"
/db_xref="GeneID:2656861"
CDS 51565..51795
/gene="repC"
/locus_tag="pEL60p61"
/inference="non-experimental evidence, no additional
details recorded"
/note="RepC; similar to replication protein RepC from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); similar
to RepC from plasmid pMU407.1 of Klebsiella pneumoniae
(U27345)"
/codon_start=1
/transl_table=11
/product="putative replication protein"
/protein_id="NP_943260.1"
/db_xref="GeneID:2656861"
/translation="MNRVTERQEQKSNPEFQREYRNRIRETHDQLNLYLPKDAKRMLI
EITKVKKLTQAEVIEFLVKSYYDGLKFDDSEE"
gene 52093..53148
/gene="repA"
/locus_tag="pEL60p63"
/db_xref="GeneID:2656855"
CDS 52093..53148
/gene="repA"
/locus_tag="pEL60p63"
/inference="non-experimental evidence, no additional
details recorded"
/note="RepA; similar to replication protein RepA from
Citrobacter freundii plasmid pCTX-M3 (NC_004464) and
plasmid pMU407.1 of Klebsiella pneumoniae (AAA87028)"
/codon_start=1
/transl_table=11
/product="putative replication protein"
/protein_id="NP_943262.1"
/db_xref="GeneID:2656855"
/translation="MNQKNPYLQLSDIESVEGLSPEFISWLESQSPKESPRQLPLNEG
AEPARKTRRRRGTHSTACLCPEPSWYRPDNFKKLPGQLGHAYNRLVRRDRKTGALSLR
MRISRHPYFVQLREQAGRKRDFRPERENLLDAIVPLMVSTVDRATHIDTINLSKMAWQ
LSEKDSEGNVIRKVTVPRVCRLLQHMMEYGLLALPEGVTWDPFNRKWFPKHVVLTERL
WKIIGVDLDKLYAEQAEQVAAEAAGWITRDEHGQAEEISVKAARRRWYENMMHATLVR
RREAALKGKREKKLKALAEKPFDDRVYAMSVHLMRTLPKDELHALSPEQFTQRVFSHL
YQLDLGLEREAGPPAYH"
gene complement(54825..56912)
/gene="trbC"
/locus_tag="pEL60p64"
/db_xref="GeneID:2656852"
CDS complement(54825..56912)
/gene="trbC"
/locus_tag="pEL60p64"
/inference="non-experimental evidence, no additional
details recorded"
/note="TrbC; similar to conjugal transfer protein TrbC
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to conjugal transfer protein (PSPTOA0068) from
plasmid pDC3000A of Pseudomonas syringae pv. tomato DC3000
(NP_808661)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943263.1"
/db_xref="GeneID:2656852"
/translation="MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPF
TMLLSILILPPLMVAFTDRKFRPPLRMPKDCEMFDDTLTTETQAEYRLGPIRIPHKVR
ERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFGTTGSGKTETFYGFIVNFLLW
CRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVKQESIPAQS
NSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLL
SQRTIQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEAR
AFEQHNYMSRQFLKTLSLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRG
EAATLGHLYVTLQRMTISKDLGYQLEGKKEEVLLTHALNNQAPYGLIYDELGQYFTSG
MDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANTRVKYFESIEDRKTFEILR
ETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQGVISFQD
ALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAM
HFPPIKLFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFADWLDGTDTDDVL
YHQEDDLFPMIEM"
gene complement(56924..57944)
/gene="trbB"
/locus_tag="pEL60p65"
/db_xref="GeneID:2656943"
CDS complement(56925..57944)
/gene="trbB"
/locus_tag="pEL60p65"
/inference="non-experimental evidence, no additional
details recorded"
/note="TrbB; similar to conjugal transfer protein TrbB
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TrbB from plasmid ColIb-P9. (NP_052503)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943264.1"
/db_xref="GeneID:2656943"
/translation="MNRRRLNLCRQPVPITWNSKRGSMKLTVKTDRNTLYLSADGNYQ
EQALHSFPLSACHFGLGHDAGSGHILTHNTFSGEAVQLFRFENEYQAIEALNNIRKKL
KQQRGLNAVRRLSNFIFWPVAALGFIVSINGALMNMHQPAQPLQANSYAPAPGLQQPA
TAPEQLQVQAAPEAPKKLADNDLLSLKDAVTSGRFTISLSTGHKHTLYVFSDPMCPHC
RALEPRLQELSKRYNVEIFPVSVYGDLRSMVRAAPVLDTGKDTRLKSWEDTINMGYTT
MNPKIDDPKTAPDTTGARLVDANNMAFAKFGFIGTPSIVADSGDVIPVSVVKDDARLQ
QATGE"
gene complement(57885..59193)
/gene="trbA"
/locus_tag="pEL60p66"
/db_xref="GeneID:2656854"
CDS complement(57886..59193)
/gene="trbA"
/locus_tag="pEL60p66"
/inference="non-experimental evidence, no additional
details recorded"
/note="TrbA; similar to conjugal transfer protein TrbA
from Citrobacter freundii plasmid pCTX-M3 (NC_004464);
similar to TrbA (PSPTOA0066) from plasmid pDC3000A of
Pseudomonas syringae pv. tomato DC3000 (NP_808724)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943265.1"
/db_xref="GeneID:2656854"
/translation="MQNQPQRKGGGDDGLMIIGALLIMITVMWFGFRDYVIYGVCRLL
YWIYGVLPDAITPGNAAERRDMLLSAARYNHQVSLWDFISVMNDTASVLFPLFILIIG
LFVWVISRNPYYRLTRKLTIRNLPWVMVKNYPGIAHILARFGHLDQLLLNEDPEEARS
AQSPVEFAQEHNLIDTAKRRLRKKAAHKVFLSQVNLAPEGAALSLAPWEKALAASFVH
LRFMGDRPTAKSILDDLNRSCLRTKDGFPDYSLTAGLWTVASQCEAFREFAKGRRSSR
SLLYALFDDDLQLPSANFRWLKGVDRTLWYALSSAGRGKFFIEGGGVIAWSQCESYRL
TLDEEKAAKFPPTVRAAVLGLELDLLHYRHIDRRDPAIPVAHWQEDVIPPFAFESDAE
AEDEPATPPAAPHDTPNNSLRLTDDEPTPAKPLPATRPDHLEL"
gene complement(59192..59588)
/gene="trbN"
/locus_tag="pEL60p67"
/db_xref="GeneID:2656858"
CDS complement(59193..59588)
/gene="trbN"
/locus_tag="pEL60p67"
/inference="non-experimental evidence, no additional
details recorded"
/note="TrbN; similar to putative lytic transglycosylase
TrbN from Citrobacter freundii plasmid pCTX-M3
(NC_004464); similar to BfpH from plasmid pB171 of E. coli
(NP_053074)"
/codon_start=1
/transl_table=11
/product="conjugative transfer protein"
/protein_id="NP_943266.1"
/db_xref="GeneID:2656858"
/translation="MVDAPPSIPLPTCMIEAAQIYHIPLRGFLALWLTEGGKPGMKNK
NKNGTYDYGAFQINTIWANKLASDFGVKAEQLQHDFCASAMASAYILKYNIILEGGDF
WQGVGRYHSNTPARKAWYIGKVYQNSLRF"
gene complement(59692..60088)
/locus_tag="pEL60p68"
/db_xref="GeneID:2656857"
CDS complement(59693..60088)
/locus_tag="pEL60p68"
/inference="non-experimental evidence, no additional
details recorded"
/note="ORF67; similar to hypothetical protein Orf47 from
Citrobacter freundii plasmid pCTX-M3 (NC_004464); orf67"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="NP_943267.1"
/db_xref="GeneID:2656857"
/translation="MIQKMITVFFNGESEMKSNTKIALILTASVISCSAFAQSVSAPK
TDSLLSNILGEQVQTNQHLVQLLAKDQNAGLTLTPEQKKTACLYESHYYSSGAHITVG
KETLRCTLSGEIPTWENANEGNIVSVEGK"
ORIGIN