CSIR - UGC/JRE-NET PREVIOUS YEARS SOLVED QUESTION PAPERS Examinations for CSIR-UGC/JRF-NET/GATE/ICMR/DBT/TIFR/ JNU/AIIMS/ARS-NET/ISe./IASHFOS LIFE SCIENCES Dr. Poonam Sharma, M. Phil., Ph.D., (INU) Director, Gyan Bindu Academy Pvt. Ltd. GYAN BINDU PUBLICATIONSGYAN BINDU PUBLICATIONS Published in India by Gyan Bindu Publications 28A/IIA, Ground Floor, Jia Sarai (Near ITT Delhi, Hauz Kh New Delhi-L10016 India e-mail: gyanbinduacademy @gmail.com www.ayanbinduacademy.cont Copytigt © 2015, Gyan Bindu Publications ‘No part of the material protected by this copyright notice may be reproduced or utilized in any form or by any means, electronic or mechanical, including photocopying, recarding or by any information storage and retrieval system, without written permission from the copyright owner, who has also the sole right to grant ficenses for translation into other languages and publication thereof. All export rights for this edition vest exclusively with Gyan Bindu Publications. Unauthorized export is a violation of Copyright Law and is subject to legal action, ISBN 978-81-930247-2-0 vantPREFACE In recent years the importance of JRF-NET has grown tremendously and this book is compiled to cover the need of students preparing for the same organized by CSIR-UGC. There was not a single book of solved previous years JRF-NET life sciences question papers available in the market ‘% cater the need of students attempting to clear this prestigious exam. This is a nascent siiempt en sincere attempt to consolidate previous five years solved question papers of JRF-NET conducted by CSIR-UGC. The questions are sourced from memory based as well as original question papers. This book will also help the students to get a competitive edge inother competitive examinations such as GATE, TIFR, DBT, ICMR, ICAR, IISc, INU, BHU, DU, Civil services, Indian Fores! se PCS ete, Since the IRF-NET is conducted in June and December, twice in year so there are 2 total of tea question papers from June 2010 to June 2015. The June question paper is followed by the question paper of the same year. The answer key to each question paper is given at the end of paper individually. First and foremost I would like to acknowledge my revered parents who sacrificed lot for my education. My dear husband, Mr. Basant Sharma deserves a big thank for constantly =" » me, I must thank my sweet children, Prakhar and Shubhanan, whom I love and cherish. I would like to acknowledge the help of the entire team of Gyan Bindu Academy Pvt Ltd. and _ especially thank Mr. Ashish Sharma, Mr. Dhipragya Dwivedi, Mr. Jeetendra Nath Singh, Mr, Salman Ahmed Mustafe, Dr. Vishvanath Tripathi, I would like to specially thank Mr, Gopal Sharma. I welcome the comments and suggestions from the readers. I would like to expressmy graiit"- readers in advance for their feedback. With best wishes, Dr: Poonam “I M.Phil, Ph. D, GSU) Direwe Gyan Bindu Academy Py. LadS.No. Month & Year Page No. a JUNE - 2010 7 DECEMBER - 2010... ae JUNE - 2011. 4, DECEMBER - 2011 57-81 5. JUNE - 2012. . 82 - 109 65 DECEMBER - 2012 .... we 110 - 139 1 JUNE - 2013... .. 140-164 8. DECEMBER - 2013 .... ww 165 - 194 9. JUNE - 2014... iu. 195 - 223 10, DECEMBER - 2014 .... wwe 224 - 250 i. JUNE - 2015 .. 251-278CSIR NET LIFE SCIENCES (JUNE-2010) Part A 1. Copper sulphate in presence of excess of anuonia gives biue color. The blue is due to (@)_ Complex ligand formation ©) Cupericions (©) Cuperousions (@)_ Ammonium Sulphate 2. NH, +H, -» NHOH . ‘What would be weight of ammonia used for complete utilization of one litre of water for formation of ammonium hydroxide (@) 1000 ©) 9858 © 1178 @ 33g 3. Moon's centre do not show movement in its core, so it indiates (@)_ No gravitational force on moon ©) Nomagnetisin (©) Iewillfack atmosphere (@)_ Weill be heavily bombarded with meteors 4, HO > Ht+ OH IF[H] [OH] = 110M? and H,0 = 55 M. Then ratio of non ionized water to ionized water will be (@) 118% 107 () 1:18 10% © 118*108 @ 1:18 10" Amyopic person isalso suffering from astigmatism. To correc his vision which lens must be» (@)_ Plane Concave lens (0) Plane Convex tens (©) Cownbination of concave ancl cylindrical lens (2) Combination of convex and exlindrical lens 6. Four times the square of an integer is one greater than three times of an integer. The value of integer is @ 4 (o) -4 oH @- 7. Osidation of copper occurs in A CuSO, +Zn > Zn80,+ Cu B. Cut AgNO, -» CuNO, + Ag © Fe+ CuSO, - Fe/(S0,), + Cu D. Cu AuCl, > 3CuCL+ Au (@) AandB (0) Band (© BandD ( AantD 8. Twodiees are thrown having number | to 6. Maximum probability for getting sum of two dice will be @ 4 06 @7 ws 9, Blue color of sy is due 10 (2). Scaveringonty (0) Composition of suntight Doth 2 and b (2), Crompton ScatteringCSIR NET LIFESCIENCES SUNE:- 2030, 10, Thee balloons are filed with hydrogen (A), Helium (B) and CO, (C) respectively and then dipped in water, order ‘of buoyancy force operating on them will be @ A>B>C (0) C>B>A (9) A=BeC (@ A=Bo(l+2/ny" @ ¢ we @ etl @ 35, Tempovature deereasesat the rate of 6°C por Km wih altitudes. At what height there i least likeliness of water vapour toexis fa) 01Km 6) 1Km (© 2Km @ kw 36, 2h angled isosceles triangle with wait area willbe31. 38. 40. Th 2. 4, Among the following which is not a polymer ? (@)_ Polysterene (©) Vinylaloohol (© Polyethylene (@) Rubber Which is isomer of C,H,OH is (@) CH,CH,CHO (>) CH,CH, -O~ CH, (©) CH,-O~CH, (@ CH,CH,COOH Humans have originated in Aftica is supported by the fact that (@) Less variation in DNA of Aftican population (b) More variation in DNA of African population (©) More evidences of human fossil in Aftica (@) Conserved fossils in Aftica Ina take low nutrients occur in upper strata due to consumption by algae while high nutrients are present at bottom diueto activity of decomposers. Which score graphical representation of nutrients with depth for such hikes ter steady state) 2) Nutrient ©) Nutrient u Loi Depth co) Nutrient / (@) Nuisient Deptt Dept Part -B Motite zoospores occurs in (@) Basidiomycetes, () Ascomycetes (©) Zygomycetes (@) Chytridiomycetes Which ofthe following isa vascular plant pathogen? (a) Botrychiun () Claviceps (© Fesariun (@ Ferbarium Origin of tropical wood Equatorium odoratumis (@)_Ethopia (b) Peru {c) Mexico (@) Brazil Which statement is correct for AG =0 (a) Reaction isin equitorium () Operates only under constant Pand V (©) Follows PaV equation (@ Allofthe above Among the following maximum gioss productivity is observed at (a) Boreal forests (6) Temperate deciduous (e) Temperate conifers {@) Cold deciduousSIR NET LIFE! PO 46. Which biogeographical region covers maximum part of India? (@) Semiaria ) Deccan Peninsular (©) Gangetic Plains @) Bimatagas 47, Tigers donot occur in Sritanka while they areseen India While the leopards are seen in beth India and Srilanka. The ‘main reascm is (8) Tigers are not good swimmess (&)_Srilankans have removed tiger due to excessive hunting (©) India care more for tigers (@) Leopard originated before separation of India and Sritanka due to plate shifting 48, Churomatids appear in form af dyads during (2) Metaphase of Mitosis () Metaphase of Meiosis (©). Prophase of Mitosis (@) Anaphase of Mitosis 49, Meiosis produces n, n +1 and n~ 1 gametes. The probable reason is @) Non-disjunction uri metaphase (©) Non-isjuntion during metaphase It (©) Non-disunotion during metaphise ‘and! (@)_Non-tijunotion during Anaphase Land It 50, In Drosophila order of genes under investigation isas shown in igre bc! w test erosset what ¥ om w ir Prasophita with genotype eM 10M. b an w 8 em w ‘would be observed frequentey of progenies with genotyp assuming zero inesference? em w (@) 0005 ©) 05 (@ os @ 13 SI. Acrossbetween hons with different comb shape wascarred as shown in figure. Ross * Pea — 7 Walnut x Walnut ———— Walnut Rose Single ©) 6) ® ‘The conclusion which can be drawn is @ 8 (0) Twoindopendentsezreg le gene i involved for com shape ting genes areinvolved (9) Two genesare showing epistais (@)_ Four independent segregating alleles are involved 52, Mendel during his experiment on garden pea observed F, ratio of 3 : 1 on selfing round seed plants where 3 were sound and J was wrinkled. I'll round seed plans are seed to raise the F, generation the served ratio will be {@)_halfofplants with round seed and rest with wrinkled seod () %oFplants with round seed and ‘4 with wrinkled seeds (©) All planis with round seeds (418 ofplanis with round seeds and 2/3 of plants bearing round and wrinkled53. 56, 58, 59, cs a. 63. 4. Darwinian evolutionary fitness is measured in terms of @) Good health (©) Ability to fight with others (©) Reproductive success (A) Lesser mutations |. Hardy-Weinberg law will NOT operate under conditions, when €@} 3 allelesate involved (b) Weak selection of one of the allele (©) Skewed sex ratio (@ Mutatedalleleis not involved in sexual selection Reversal of sexual dimorphism is observed under condition (@)_ Strong female choice (b) Skewed sox ratio (©) Number of mates are very low (@) Maleand femates change ther roles The donor and acceptor of electron for cythf, are (@ PQand UQ () UQand Cc (© UQand PC (@ PQandPC ‘The chemical saicyl kydroxamic acid inhibits (3) Cytochrome oxidase (0) Alternate oxidase ’ (©) ATP synthese (d) NADH-debyrogenase Phytochoromes involved in red/far-ed response ate dimeric chromoproteins, The two sub-unit of pliyiselicornesare Tinked with (a) PAS domain (&) PTB domaia (©) Hinge region (@) Kinasedomain Which of te fllowing DO NOT oceut during seed develoment? @) Accumtation of storage proteins (b) Synthesis of LEA proteins (©) Desiccation (a) Synthesis of Gibbertic acid In signal transection pathway of which plant hormone, genes ‘ht’, ‘sp’ gay" are associated (@ Auxin (8) Giblerlic acid (©) Abscisic acid (@) Ethylene Most of DNA binding protein binds to DNA by particular motif to modulate gene expression. Genes regulation of gibberlic acd have GRE where, GREB binds. The motif in GREB is Lencine Zipper (b) bap (© Zinesfinger (2) Homeodomain In plants gene ‘sepallata'is NOT involved in formation of organ Sepals () Petals (© Stamens (@) Carpels ‘The lateral separation of amphibian embryo at two celled stage will result in (@) Identical twins (0) Two embryos joined at belly region © Single embryo (4) Two embryos missing various organs IC Hydra is fragmented into various parts, separate group of cells repattern themseves into various small Mee. Svoh an mode of development is termed as (a) Regeneration (b) Morphatfaxis (©) Epimorhogenesis (@)_ Morphallaxis and epimorphogenssis An embryo lacking biocidisinjocted with biocoid m-RNVA at middle portion. It will result into (a) Two heads and no trsons (0). Head in mile and tarsons at both end (©) Nolead and Tarson at batt ends (4) Normal phenotype _ a eee66. 6, 68, @. 7, n RB 14 Which ofthe following isa species specific protein in sea urchin which playsimportant role in recognization during acrosomal reaction (@) Bindin (b) Avigin (@ Festtin @ Cottical granule ‘nan experimental population the bith rates 18 per 1000 and death rte 4 per 3000. Size of populations 14,000 atime, then what willbe size of population atime “t+ 1 (@) 10,000 0) 10,040 (©) 10,140 (@ 11,040 Which isthe correct graphical representation of effect of disturbance on species diversity a per island biogeograply? @) o disturbance ) @ disturbance disturbance ‘Which statement is correct for -selected species? (@)_ Large number ofprogeny with large size (0). Small mumber of progeny with lange size () Large number of peagery with sta size (Small nsiberof progeny with large size Tocxplain o (a) Amino acids () Nucleic acids (©) Carbohyatrates @) Lipids of life, the first bfomolecule generated under lab conditions were |. Dinosaurs become extinct during (@) 16 billion years ago () 6.5billion years ago (2) 65 million years ago (©) 6.5 million years ago nd i sufers from wat When a new sitess because of ing is wansierred 10 soit, roots bave very loose comact with Soil particles. (2) Cavitation (&) Positive hydraulic Pressure (©) Capillary action (@) Loss of water from roots to soil K, for zyme is equal fo where a) Y, © =Y, © ,=V,, V,22V, During regulation of trp operon by attenuation there is a) immaturerermination of transtation (0) tmmature emination of transcription (6) termination of replication (4) ribosome fails to read transcript na experimental approach tap operon and lac operon were fused. Under what condition there would be expression of ~ galactosidase?(Low lactose and glucose (©) High lactose and glocose (6) Low tryptophan (@ High tryptophan 76. Which selectable marker gene is routinely used for selection of transgenic plant? (@) Amphicilia (0) Tetracyctin (© Hygromycin (@) Carbesicitin 77. Which inicrobe has been used against insect plant pathogens ? (8) Agrobacterium tumefaciens (b) Agrobacterium rhizogenes © Baciitusthuringenesis (8) Fusarium muctun 78. Which instrument is used to measure electrical activity of heart? (@)_Electrocardiograph ) Electrocardiogram (©) Splaygmmomunometer (@) Flectroencephalogram. 79. Flow cytometer used to measure the number of (Calls () DNA (© RNA (4) Proteins 80. lt bioinformatics for stricural proteomics, the structure of protein canbe deternned from @ PDB () EMBL, © NIH (@) Genebank 81. How many H atoms would replace CCI, in presence of ethanol during NMR spectrum @t © 2 ©3 @4 82. Polygalacalourinidase (PG) antisense RNA is used in reference to which phenomenon (@)_ Seed setting (0) Herbicide resistance © Viral resistance (A) FeuitRipening 83. Which of the following disease or pathogen have been completely eradicated from India ? (a) Small pox. Polio ())_ Yellow fever, Plaque (© Small pox, Guinea worm (A) Sleeping sickness, Yetlow fever 84. A person sulfeting from glucose-6-phosphate dehyidrogenase deficiency are found tobe resistant o €@) Plasmodtum () Fingus (©) Leishmania (@) Bacteria Which of the following cell has been proved in elucidation of tipi bilayer of plasma membrane? (@) Bacterial cel (b) Virus (© RBC (@ Kidney Cell 86, In FIV disgnosis technique based on western blotting, the patient samples sereened for @) Antigen 4) Antibody (©) Virus onter coat protein (a) Virus 87. In which cancer treatment exb-B antibodies are used @)_ Breast b) Oral (©) Prostate (@) Lung 88, Bel-2 and Bas proteins involved in apoptosis are (2) Proapopticand anti-apoptic (©) Both proapoptic (©) Botlanti-apoptic (4) Anti-apopticand Pro-poptic 89. 17/gone is one ofthe important regulatory gen in life evcle of HIV virus. was observed that HIV virus Hfgone fails to culture of norual T-helper eetls, The main reason is(ORAL OION ero (@_Vifgene helps in reverse transcription process (0) Vif gene helps in transport of HIV genome fo nucleus (Vit gene helps in insertion of viral genome into host genome (@)_ Vifprocuct targets the enzyme responsible for hypermutation to ubiquitination and cellular degradation 90, Nick transition means (@)_ Translation by cytosolic ribosome (0). Translation of protein from stalled sites, (©) Replication by DNA potymerase I after removing RNA primers, (@_ Replication of DNA by DNA polymerase I from nicks produced by DNase treatment 91. According to Holiday model if markers are present outside of crossover point, then recombinant ‘generated when (@ Theres no resolution (0) Always recombinant would be produced (© Nickison outerstrand during resolution _—_(@)-Nickis on inner strand during resolution 92. £.coli cells wre transformed with plasmid carrying tetracycline resistance gene and later on plated on LB medium and various colonies were observed but same number of colonies were observed for control non transformed E. cali calls. The probable reason is (@) No transformation has occurred (0). Bacteria are plated just after heat shock and incabation with plasiid (© E colicells werealready resistance to tetracyetine (@) Wrong plasmid was used 93, Which antibiotic is responsible for premature tenmination of transition in bacteria ? (@) Tetragytine (0) Chloramphenicol (©). Penicillin (@ Puromycin 54, Among the following which DNA polyoierase lacks proof reading activity? (@) DNA polymerase o () DNA polymerase § (©) DNA polymerase © (@) DNA polymerase o and ¢ 95, Which statement is correct for archaebacteria? (@®) lacks histone protein (0) have9 + 2arrangement in Nagetla (©). lacks introns ingenes ~ (@) Cell wall is made up of peptidoglycan 96, Ina m-RNA immature termination occuus from codon UAA. Which ofthe following transition mutation will ead to itsreversal (@) Change at first (©) Change at first A (©) Change at second A (@) Allofthe above 97, The major function of surfactart protein secreted by lungs is, @) Donat allow growth of bacteria (0) Stops entry of dust particles into lungs (©) Keepsalveoli inflated (@) Helps in absorption of oxygen 98. Inbrain meninges are absent at (a) Dura matter (0) Pia matter (© Grey unatter (6) Arachnoid matter 99, Which phylum is characterized by absence of boty symmetry, o issue or organ and lack of iervous stem? (@) Porifera (©) Chiari (2) Ctenophora (@) Rhizopoda 100, Secondary structure of RNA is stabilized by hydrogen bonding between (@) GCand AU ) GC and at ) GC. AU and GU () GC only102. 103. 104. 106, 107. 108, 109, 10, 10, bg @ V-c 6) C’-C © C-0 (@) N-H (On a Ramachandran plot glycine, D-Alanaine and D-ASP were ploted. Which statement is en-rec‘? (2) D-alanine will occupy greatest area (&) Allamino aids will occupy same area (©) D-alanineand glycine will occupy similar area (@). Smallest atea would be occupied by D-ASP Which of the following enzyme of nitrogen metabolism is located in plastid? (a) Nitrate reductase (b) Nitrite ratuetase (6) Aspartatesynthetase (@) Nitrogenase ABC transportersare NOT involved ie (@) Transport of chloroplast content for degradation in vacoule (b) Accumulation of pigment in plant vacoule (©) Secretion of mating factor in yeast (@)_ Uptake of phosphate by bacteria ‘Which plant has been used in phytoremediation for uptake of Cadmium from contaminated so (a) Helianthus annus (©) Brassica juncea (©) Silene vulgaris 7 (@) Oscimum basalicum What is basic assumptior for using molecular clocks for estimation of molecular evolution? (@) Rate of neutral mutation is constant over time (0) Rate of evotution is constant over time (©) DNA do not show variatious among organisins (@)_ Proteins are beter marker for phylogeny as compare to DNA Inn experiment bacterial ell was removed using enzymatic methods. It was observe that on cult for many generations cll wall was not seen. 1's proof to (@) Inheritance of acquired character (0) Recessive mutation (©) Reverse uation (@). Adaptive mutation ‘Most of nutrients are assorbed from intestine by co-transport. Which of he following mineral plays transport of aminoacids across imtestine epithelium? @ K OG (©) Na (4) Neamd Caboth Action potential sired afer threshold stimulus but onee the nerve impulse ours there isan interval a second action potential cannot be inkated. no matter how kargea stimulus is applied. This gap is cermes as sobieh {@) Absolute refractory period (b) Relative refractory period (©) Tiweshold period (a) Resting potential IF we compare convoluted tubule and ascending Hinnb of Houle of nephon respectively the fui is (2). Isotonie and hyporonic (0) Dilute aud typotonic (©) Dilotcand isotonic (@) [sotonic and hypertonic Which statement is NOT correct ry ding brown fa? (a) Lis present in lesser amount it aew born baby (b) Ut produces litle ATP(©) Itproduces more heat (@_InMitochondria electron transport chain and phosphorylation are uncoupled 112. Which molecule do not have sP° hybridization ? @ CH (o) NH, © HO (@ CHO 113, Consider the following coupled reaction. Acetaldchyde + 2H" + 2e" -» Ethanol Ag” = 0,16 NADH +H’ -» NAD + 2H’ + 2e AE” = 0.32. Thetransfer of electron is from (a) NAD to acetaldehyde (b) NADH to ethanol (9 NADU to scataliehyde (@ Bihanoli@ NADEL 114, Forfinal processing of antigen macrophage after phagocytosis direts engulfed material (0 t@ Aysosome tb) Proteasome (c). Peroxisome: (@ ER 115, Ina continuous fermenter iFinput supply is decreased, what wouldbe effect on standing biomass and rate of production? (@_ Standing biomass decreases and proxucivty increases (©) Standing bion (©) Both decreases (@) Both incre 116, Uricotelism isan adaptation for increases and productivity increases ses (@) Conserving water (©) Conserving salt (©) Highatitudes (@) Marine habitats 117, In prokaryotes which subunit of RNA polymerases released after initiation process? wo 0) p o K @o 118, In prokaryotes IF2 binds to {a}, ition ERNA-and GTP {0} Amino acyl FRNA and STP Ribosome and 1 © (@)_m-RNA and 30 S subunit of ribosome 119, In E.coli gal” and bio genes are located very near to each other on genome, Albacterium with F* gal? on conjugation with F- will lead to diploid condition for {@) wonly {b) bo only (© gaan bio bout (@ E.coli will always remain haploid 120, Hypertrophy in anterior pituitary in adults leads to @) Giganism (b) Dvarfism (c) Acromegly @) Cretinism 121, Which portion of antibodies is recognisoed by Fe receptor of macrophage? (@) i.-Chain () «= Chain Heavy Chau (@) 5-Chain Major function of Iynsphatic system is (a) Acquired immunity (6) Innate immunity ) Maintain fui batance (d) Phagocytosis 123 ation of ty Xanioeba ito slinte mould during formation of fruiting body is an example of (a) Multicliulanity (0) Social behaviour Embryonic devetopmet (4) Pattern formation ——— a eeino 124, Anterior-posterior limi axis and dorsal ventral nerve plate is determined by (@)Bicoid (b) Sonic hedgehog (© Paxs (@) Cactus 128, Which is NOT a strategy for adaptation to dry environment ? (@) C/CAM oyele (b) Low stomatal conductance (©) High hydraulic conductance (@) High rootto shoot ratio 126. Onthe basis of statement given below, the mode of inheritance is + Mostly males are sufferer of disease + All male children developed from affected mother are diseased + Females develop disease only when her father is diseased and mother is carrier Xelinked recessive (b) X-linked dominant (©) Autosomal dominant (4) Autosomal recessive 127. Which isa correct explanation for sibling species ? (a) Species which are morphotogically different but can interbreed ) (©). Species which are morphologically different and reproductively isolated Species which look morphologically similar but reproductively isolated (@)_ Species which are morphologically like and can intexbreed 128, Which is NOT tre in a process of succession from pioneering stage'a climax stage? (2) Biomass increases (b) Food chain to food web (©) Wide niche (@) Dependency on detritus chin increases 129, Which enzyme is used in estimation of ghicose from blood sample using biosensors? (@) Alkaline phosphatase (b) Glucose oxidase (6) Glucokinese (2) Glygoen phosphorylase 130, Which is best method for screening of plants for bioprospecting? (a) Ecological sndies (b) Ethno driven {6} Comparison of DNA sequence (4) Comparison of protein sequence 131, Minium resolution ofelectron microscope is (a) 0.2mm () 201m (© 100mm (4) 020m 132, In which case statistical approach analysis of variance can be applied (a) Productivity of lake isnot significantly different from other five lakes (b) Body weight is dependent on person height (©). Disibtes dependent on concentration of insulin in blood (a) Seed weight is influenced by calcium in soil 133. Linking number of DNA is 9 with writhe-1, then number of vist is fa 10 9 ou @ 2 134, The precur lost of phenolic secondary metabolites is (a) Phos alanine {©} sopents pyroposphate {o} Mevalonate (@) Geranyl phosphate 135. Which statement explains the phenomenon of character displacemen (a) Organise livetogether rent species are morpliologivally similar in di nt habitat but looks different where they136, 13, 138, 139, 140. (b) Organism of different species lok diferent where habitat do not overlap wie took entirely sila whe theirhabitat overlaps (6) Organisms phenotypically similar are genetically diferent (4). Organism develops various new characters in different habiatats Root cap cells originate from (@)_ Root epidermis (©) Columelta cells (©) Quiescent center (@ Vascular cambium ‘The function of telomerase is (@). Synthesis of DNA at ends of chromosome Qh). Synthesis at RNA primers (©). Replication of normal DNA (@) Reverse transcriptase of causing cancer Which af the following is a hydrated polymer ? (@) Celalose {b) Pectin (© Lignin (@) Callose Incorrect blood transfer to person leads to death ofa blood receptor. The major cause of death is (@)_ Agglutination of RBC (0). Precipitation of RBC in coronary arteries of heart (©). Failure of kinduey due to excess breakdown product of RBC (@)_ Hyperthermia due to release of pyrogers Hydrostatic opening of stomata is due fo (@)_Low water potential in wiesophiyll cells () Movement ofK ions into guard cells (6) Movernent of water into guard cells (@) Decreased concentration of ABA, Answer Key 3 0) 4@ so 60) n© 2 Bae Wb) 18 ® 19. (@) 0.0) © 2@ B 2. @) 28. (¢) 29. (a) 30. () 31. 36.0) 36} 3.) 38. (0) 4B. (0) 44. (d) 45. (b) 46. (b) 47. sl. (©) 2@ 3.0 54. (b) . 2) BO 6 aa 67. ) 8 @ 70.@ 1 8 %O 71.0 7B.) 7, @ . Bo — SL@ BL) 86. (0) 87. @ . 91. (0) 2) 93. @) 9a) 9. 7. 99.4) 100.) WL) 10 NB 103. (b) 107. (@) 108, (¢) 109. (a) 10.) MM, 113. (0) \. 115. (c), N16. (a) 117. @ 118. (a) 19, (a) m1.) 3.00) 2) 28.) HAD 129, (b) b) BL @ 132. (a) 133. (a) 134, (a) 135. (a) 137. (a) 38 139. (a) 140, (a)CSIR NET LIFE SCIENCES (DEC-2010) Part A 1. The correct configuration for given structure is. A ee NO, of Ys @ Loonfiguration (0) Deonfiguration (© Reonfiguration (a) Sconfiguration 2. Pumicaisthe nameof the most common volcanic rock that floats. I has variousair bubbles and capillaries which trap air. Which statement is correct for this sock (@)_Aircavitesare interconnected (0) Air cavities are not connected (©) Density of rock is more than water (@) Rockis very old 3. Forarcaction A ->B, the tate of reaction can be represented as. ; a = Ka-», were and (a) re conventaton of reactants a tie O and. Then the unit of K will be (a) MolL: (b) Mol*L* (© Lmols (@) Sec 4. Identify the graph ofthe logarithmic function /(2) = xe" (4 4 wt Lf © | @ ‘What amount has to be take fom 11 N HCl to make 50 ml of 2N HCL @ 10m! () 9.09. (©) 6.03 ml (a) 2.0m 6. High Biological oxygen demand in water body indicates (@)_ Cheinical pollution 0) Organicpoltstant (©). High photoautatroph (@) Pressure of heterotrophis 7. If standard entlalpies of formation for H,0 (g) ~ 242, CH, (g) -75 and CO, (g) is ~ LI iy Determine the heal of reaction of the folowing 1 CH, (g) + 2H,0 (g) > CO, (2) + 4H, (8) (a) -206 KI mot! (b) +206 KI mot! (6) ~448 J not KI mot — I =~ _ —8 Shope ofine given plot will be 2 “I @ -! () -12 © +12 @2 9, Itperiod of (x)= sinxeis 2x, then the period of g) = sin(2x) will be @ x ®) tn © x/2 @ an 10, Itispredicted that duc to global warming there would be rise level of oceans. Wradius of earth is Ran rise in level of water is “h’, then the volume of water will be @ arth ) Anh © 2h @ anrth 44, Wa rectangle is inscribed in circle of diameter ‘D’. Then the area of rectangle will be {a) Independent of length and breadth (D) Will be always smatier than D2 (©) Will be always smaller than D%4 (@) Will be always greater than mD? /4 12, Anacroplane flies with a ground speed of $00 knw and velocity of wind is constant 50 kravh. L's aeroplane flies ‘one hou upscane and one hour downtream of wind, Then total distance covered and average speed will be (@) 1600km and $00 km/h ©) 1650 km and $25 km/h (©) 1550bmand 775 km/h (@)- 1700 km and 850 kew/h 13. Which of te following ctemeut is required for production of thyroxin ? (Nach (©) lodive (© Bromine (@) Fluorine 14. "Temperature sbove witich gas cannot be liquefied even by applying pressure is termed as, (a). Critical temperature (b) Boyle temperature (o) Corie temperature (2) Charles temperature Ia nail is hammered in the bark of tree at height 4 m, after ton years the height of tec is doubled. Then the height of tail willbe @ 4m ©) 8m @ 16m @ 10m 16. Let £10, 1] >, e) boa continuous fnetion. Suppose /(0)= 1 and /(1)=7. Then (a) Fis uniformly comtinwous and is aot oni, (0) fisincscasing and /({0. 1)) = [1.7 (©) fismot uniformly continuans (d)_fis not bounded 17. Lasstigne’s testis exnployed to eet Cue presence of nitrogen, sulphur, halogens. and phosphorous in an organic compound. ‘These eleseuts are present in the covalent form in an organic compound, On teatment with sodium tah covalent cardon and nitrogen of organi ;econverted into which ion Form (@) Cyanide (©) Sulphide fe) Nitrate (@) CarbideSCIENCES DE 18. The net direction of force on charge placed at origin as shown in diagram will be in 2a ja 9 4 @ +Y 0) -Y © +x @ -x 19, Zinc oxide s thermochromic, changing from white to yetfow when heated at high temperature. “7's caused due to (Stoichiometric property of metal (©) Non-stoichiometric property of metal (©) Burning of oxygen (@) Fluorescence at high temperature 20, Avid form animal gives one egg and mutant form gives three eges per year respectively. [Pall parents and progenies survive, then what would be ratio of number of wild to motant after four years. @4 wr (co) 2e3x4 (d) 2 7 21. [Cacertain place shows stable population distribution. [1 means maximum number ofindividual will (@) Healthy (0) Youngest (©) Oldest (@) Reproducively more 22. Which of the following is responsible for ozone hole? @ C0, ) cH, (©) Chlorine (d) NO 23, At35°C ambien room temperature any liquid in two containers re allowod to coal from 100°C 10 72° and 80° to 50°C respectively. If we compare tie rate cooling we find that rate of cooling in later will be (a) Slow (b) Fast (©) Both at same rate (d) Depends on container size 24, Earth is active planct and have phenomenon like voleano, earthquake and continental dri. Phe energy forcontinental drift is (Moon's gravity (b) Earth's gravity (6). Radioactivity inthe core of earth (@) Energy from su 25, The mean salinity ofsea 35 g per liter. The main cause of this observed salinity is (@) Evaporation and rainfall (0) Photosynthesis (©) Crusterosion and surface run off @ Rivers drainage 26, Ifthe handle ofa door placed at hinges is displaced toward contre, more force is required to open it because (@)_ Less moment of force (©) More moment of force (©) Fotce will be zor0 (A) Contre of gravity is ze10 27, Ifa gasis released from pressurized bottle, then which statement will be true forthe released gas? @) twill gaitencrgy (©) lvl have same temperature asin bottle (©) Will gaintemperature (@)_ {till cool as compared to gas in container 28, Among the following which cell can divide by binary fission (a) Muscle ce (6) Nene cell (©) RBC (4) Bone matrow cell 29, Which statement is not correct for all manamals ? (@) Absence of scales () Absence of taying egg Absence of seginentation () Presence of asexual reproduction — = a _CaS POU 30, Smog is due ve (@) Air pollution derived from smoke and vehicles (0) More moisture in environment (©) Increasein CO, (@) Low temperature of earth surface 31. Call with large round size has more chance to survive as compared to thin cell under desiccation because of (2) Low surface to volume ratio (0) High surface to volume ratio (©) Thinmembrane (@) ‘Thick membrane 32. Which ofthe following is nota direct consequence of green house effect ? (@)_Inctease in sea evel () Raingall (©) Tsunami (@) Global warming 33, NaCI has ionic bond because @)_ Both Na and Cl have same mmber of valenoe electron. (&) Both Naand C1 belongs to same group (6) Na looses one electron and chlorine receives one electron (@) Durtodifference in their electronegativity 34, Brown ring tes is confirmotory test for which anionic species (@) Nitrate (0) Bromide (©) Chloride (@) Fluoride 35. The graph below shows frequency distribution of different sizes of cell during different stages of cell culture =0 t= frequency of cells small large small lange small large From this pattern of growth we can dravs conclusion that (@)_ Most ofthe cell divides at same time () Rate of cell division is constant (© Cell does not divide (d)_Allthe cell divides at same time 36, The computer codes for decimal numiber 99 will be (@ 1100011 @®) 11 (© 1000011 (@ 11000111 37. Parts perbillion can be represented as, (@ myKe () Hg! Kg © wil @ wie 38, Which ofthe following is not possible in biological systems? (@) DNA RNA ~> Protein (0) Protein > RNA > DNA (©) Glucose + amino acid — Protcin (@) RNA DNA ~* Protein 39, The liquid is Mowing in tube as shown in diagram.i The rate of low a position A.as compared to B will be (@) Fourtimes () Sixteen times (© Halt (@) One fourth 40, Ina given circuit voltage drop at diode is 0.9 V, iat 12g c > 202 nv Part B ‘Then which statement is correct (a) More current is owing through path AB (©) Morecurrentis flowing through path CD (©) Equal current is flowing from both routes, (@)_ Resistance isnot influencing flow of current 41, Abotile containing 2 ml of “C labeled phen! alanine shows radioactivity of ImCi, The spectic activiy of isotopeis 200 CiknMol. Then the concentration of phenyl alanine in bottle is (@) 200* 109M (@) 400% 10M © 100*10°M (@) 25% 109M 42, The general procedure for estimation of primary production isthe “light” and “dark” bottles method. In an experimen two bottles containing 200 mg/l ofO, have incubated in light and dark for seven days. The amount of O, estima aller incubation period was found to be 600 mg/l and 100 mg/l in fight and dark respectively: The net primary production during ineubation period is f@ 400mg (© 500mg (b) 100 min (@) 60mg 43. Which is nota structural alignment (oo!? (@) SSAP (0) TN-Align (© FCoffee (@) DALL 44. Which ofthe followings major radioactive indoor ai pollutant in home aie conditioner? f@) Cs o) U (© sr @ Rn ‘Variation in two characters in twwo or more species can be best represented by @) Histogram (b) Scattered diagram (©). Triangularbox (@ Linearcuve 46. Which of tie following statement correctly refer statistical parameter mode? (@). Most of insects mature on third day of development (©) Major par of population fils to advance their education above 10 + 2 (© Theavorage mumiber of sceds by plant is 3.5 (@ The eight of plant ranges from 5 to 10. 47, In slaistical error Types is represented by cr and Type I by 8. Then measure of power of error wii @ Le © a8 (b) I-f @ Bro 1948, Which ofthe following diagram correcly represents co-esistence of tw species even during niche overtapping ? Niche Niche, overlap | overlap 1 @ woe niche overlap 2 niche overlap 2 Niche Niche overlap | aa 1 © niche overlap 2 viehe overiag? 49, fall four gametes AB, aB, Aband ab reformed in equal probability, Then atrangernent of chromosomes at metaphase- 1 of meiosis will (a) ‘The distance between gene A and B is 10 cM. Ifa genotype : Ti self, the percentage of progeny with genotype abo will be @ 10% ) 25% (©) 025% @ 0.01% 51, Male parental care is expected to observed during (a) Polygynous species (6) Small population size (©) Life longbond pairing (4) Reverse sexual dimorphism Which ofthe following is the major enviromental cue Yor migration of birds during winter? @) Duration of day length (b) Instinct (©) Falling lemperature (@) Learning 53, Which cyclin is involved in the formation of pretransetintional enhancer bind (@) Cyclin D 0) Cyclin (© Cycling (@) Cyctin’y 54. Binding of erythropoietin to its EPO recephar leads vation of signaling pathway lenmed as (@)_ JAK-STAT pathway (0) NF-KB pathway Apusimad pathway (@) Tyrosine kinase patiovay58, 56, 38. cs a. 6. 64, 66, 67. Receptors for FSH is present on (@) Leydig cells ©) Sertolicets (© Peritubular cells (@ Spermatogonium germ cells During gametogenesis in male, cell during development ae termed as primary spermatocytes when they are (@) Before meiosis-1 (0) After meiosis-1 (© Afiermeiosis-IL (@ Maturesperms Which statement is true about progenitor cells? (@) They aresame as stem celis (&) They aretotipotent cells (©) They can divide but do not remain differentiated as stem cells (@) They cannot divide ‘Neuropeptides and neurotransmitter are molecules secreted by neuron. Which statement is correct statement about rncuropeptideas compared to neurotransmitter? (@) Less potent and short acting (0) More potent bt short acting (© Less potent but long acting (@ More potent and longer acting ‘There is small gap between two neurons at synapses, The purpose of the gap is (@) Unidirectional flow of information (0) Reabsorbtion of neurotransmitter (©) Coupling ofcharge over membrane (@_Slovr down speed of propagation Most abundant intracellular ion in plants is (@) Tron (0) Calcium (©). Potassium @ Zinc Na’ -K* pump operates under intracellular concentration of (@) ‘High Naand low K (©) High Naand High K (©) LowNaand fow K (@) Low Na and high K Precursor for amino acid proline 1s (Pyruvate (&) 3-Phosphogtycerate (©) Oxaloacatate () ce-ketoglutarate S-adenosy1 methionine isa precursor of which plant hormone? (@)_ Abscisic acid @) Auxin (© Eatylene @) Cytokinin Under certain conditions pyruvate can be allowed to decarboxylate into acetyl CoA and CO, For evolution of C labeled carbon in CO,, which carbon atom must be radiolabelled in glucose prior to glycolysis? (@ Chores ) Cor3 (9 Chart (@) CSorC2 ‘Which eycle has been used in hetero lactic fermentation ? (a) Enlner-DoudorofFpathway (b) Phosphaketolase Palway (©) Pentose Phosplate Pathway (@) Glycolate pathway The characteristic of mitochondrial genome is {@) Intron free DNA (b) Repative DNA (0) Polyistonic RNA (@) SateliteDNA In scannin Simple Sequence Repeats (SSR) primers are used against (a) Random sequence (0) Repattive sequence (©) Flanking region ofrepattive sequence (@) Conserved region of exon of gene69. 10. nl. n a mM 16. " m0 Integrity of introduced transgene in mouse can b @)_ Mate pronucet insertion (©) Fusion of enucleated egg with somatic cells (©) Transfer into competent embryogenic cell (@)_ Southern blot analysis Techniques used to assess HIVAI seroconversion are @ Immunoblot and ELISA () Smmuneprecipitation and PCR (©) PCR and Immunofluroscence (@ PCRand BLISA Which of the following cancerous transformation is dus to retez0 virus? (@) Hunan T-Cell leukemia ) BurkineLympliona (© Oral Epithelial Cancer (@ Coloncancer Among the following which is termed as proofreading activity of DNA palyterase? (@)_ 5'r3" polymerase activity () 315" polymerase activity (© 353 exonuclease activity (4) 3°55 exonuclease activity ‘The Carboxy-Terminal domain (CTD) of RNA polymerase Il consists of heptapeptide repeats (YSPTSPS), Other proteins often bind the C-terminal domain of RNA polymerase in order to activate polymerase activity. Which ofthe following is nota function associated with CTD of RNA polymerase ? (@) Promoter recognition (0) Promoter clearance (©) 5=Capping (@) Splicing Which of following is reactive centte for splicing of exons during processing of m-RNA? (@) Uland us (6) Branch point, U2 and US {Branch poim, U4 and U6 (@ U2amd Us Which of the following iste first step in translational proof reading ? {®)Amioacytation of -RNA by amino acyl CRNA synthetase (b) Peptide bond formation ©) Batey into A site (@)_ Formation of amino aeyl--RNA, 40 Sribosonte and m-RNA ternary compres Purornycin blocks anstation. Mage of action of drag puromtycin is, {@) Binds to A site and stop elongation (©) Stops peptidyl transferase activity (©) BindsEF-TU-GTP and prevent initiation ——_(@)_ do not allow termination of translation fetracyclines are a group of broad-spectrum antibiotics against bacterial resistance. Teiacycline antibiotics are protein synthesis inhibitors and exerts its effet by binding 10 (@) 30S subunit of ribosome ) 30'S subunit of ribosome (© Asite of ribosaine (@) Peptidyt transferase Ciprofloxacin is a synthetic chemotherapeutic antibiotic of the fluoroquinolone drug class. The target of antibiotic ciprofloxacin (a) Replication (©) Protein synthesis (©) Cell wall synthesis (@ Mombrovestmactite The one of the most widely used herbicides. methyl viologens interfere photosynthesis of higher plants. They are responsible for fa Evolution of more oxygen (©) Dissipation of proton gradient across tuykakoid membrane (©) Inhibition of Now of elecron from PS Ito PS I (@)_ Transfer oF electrons from PS 110 molecular oxygen Which would be tie result of mntation in genes responsible for radial patteraing in roots of higher plants? {@)Noapical roo! fromation {b) Root hair will fail develop\ TE Ne (©) Variation in number and position of cell in vascular system (@_ Roots will be positively geotrophic 80. In trabidopsis gene responsible for formation shoot meristem is (@)_Lealy (©) Agamous (©) Clavata @ Wes 81, Amongthe following which gene product migrates from leaves to shoot meristem during transition of shoot mi into floral meristem? item (2). Flowering locus T (©) Flowering locus D (©) Leafy (@ Apetalat 82. The postion of collagen tripfe helix in Ramachandran plotis at @ TopLeft (0) Topright (©) Bottom right (@ Bottom let 83. Oneof the most important gene, involved in dorsal-ventral axis determination in Drosophitais dorsal 1 codes Dorsal protein which (@) istaken up into the nuclei of cells and this sie will bocome the ventral side (©) remians inthe eytoptasm of cell and this side will become ventral side (©) is taken up into the nucle of cells and this side will oeome the dorse side (@) degraded in one side and that will become dorsal se 84, Which is true for amount of yolk and cfeavage in egg of amphibian? (@)_ Mesoleciut and holoblastic cleavage (©) Isolecithal and holoblastic cleavage © Mesolecital and meroblastic cleavage (@ Microlecithal and meroblastic cleavage 85, Among the following which enzyme uses NAD as cofactor? a) Histone acety! transferase: (b) Histone methyl transferase (©) Histone deacetylase (@ Histone demethylase dpinant DNA 86. Which of the following system can be utilized for glycosylation of peptides expressed using re techinolgy ? (a), Largebacterial fermenters (0) Small bacterial fermentors (©) Normal bacterial bioreactors (@) Mammalian cell line 87. Among the following which és uot responsible for producing near UV signal in circular dichroism for secondary structure determination of proteins? @) Tyrosine (©) Tryptophan (©) Disuiphide bond (@) Peptide bond 88, B—c.-P structure in protein structure are known for (@)_ Ligand binding (©). Stereologcal hindrance in binding ofigand (©) Catalytic centre (@) Transmembrane domain 89. Which ofthe following is most unstable condition in protein folding? (a) Nonp (0). Polar side chain present in core of protein ide chain exposed to outside (¢)_ Non potar side chains in cote of protein (@)_ Polar amino acids exposed to outside 90, Mosteflecive protein denaturant form of guanidiniunn when used in equimolar concentration is (@)_odide (0) Chloride (©). Bromide (@) Sulphate91, The melting temperature (Tin) isdefined asthe temperature at which half of the DNA strasts ain the double-helical state and half are in the random col state, Tm of DNA does not depends on (@ Length of DNA (b) %GC content (©) Presence of cations (@) Presenceof ations 92. Ina fheterozygous two recessive mutation at different sites will give mutantt phenotype when genes involved are @) Allelic and placed in cis (b) Allelicand placed in trans (©) Non-allelic and placed in cis 4@) Norwallelic and placed in trans 93. Allele frequency of a particular alele was found to be 0.6 it three different populations Ii probably due to (a) Neutralaltete (b) Stable polymorphism (©) Heterozygote advantage (a) Natural selection 94, Molecular evolution do not reflect (@). Species divergence (0) Convergent evolution (©) Natural selection (@) Neutral mutation 95, Somatic hypermutotion in immunoglobulin genesis responsible for (@)_ Classswitching () Affinity maturation (©) Clonal seletion (@ VDIRecombination 96. To assess the mulation in bacteria, bacteria Were inoculated in various aliquots an later on shifted on screening media forselection of mutants. The most important information for assessing mutation would be (9) Total aumber of mutants (©) Average number of mutants peraliquot (©) Petriptates with single mutant colony (2) Petiplates without any mutant colony 97. Inieraction of antibody with antigens like lock and key, The major force responsible for antigen antibody interaction is (@) Hydrogen bond (b) Van der waals interaction (©) Disulphide bond (@) Peptide bond 98, Whict is connmon cytokine soctcted by bothT,, andT,, cells @ 1s ) M4 (© INF-Y (@) IL 99, Major Histocompatibilty complex I (MHC Dis present at (@) All nucleated cells (©) Only on antigen presenting cells (© Only on B and Tlymmphocytes (@) Macrophages and Dendriticcells 100, Major reason for evolution for diversity in immune system is, (2) Natural selection (©) Neutral mutations (©). Directed evolution (@) Co-evolution 101, Atany place if more diversity and variation i observed in any species of domestic animal, hen it can be concluded aha @)_ Place is natural centre of origin of that species (b) Animal has been introduced once ands invasive {©} Anional has been introduced more thaw once (@)_ People take more care of animals 102, Among the following whichis ypical ree of Indian desert ocosystem? Prosopis cineraria (0) Avicenna (©) Mangifera indica {@) Acer neguido 103. Which of the following is not an invasive plant species in Incl ” (a) Partheniu hysterophorus (0) Salvinia motes (©) Loitana camares Wy Adrisvicasicat i CIENCES DEC-2010 104, The causal organist for bast of rice is @) Pyricularia grisea (0) Ustlago tritici (©) Brwinia chrysanthemt (@) Cercospora janseana 105, Which group of algae is believed to be most closely related fo higher plants ? (@ Charoptiyoeae (©) Chilorophyceae (©) Rhodophyceae (@) Pheophyceae 106, Followingcladogram represent changes in annelids during evolution. A B c [Oral sucker / Loose of setae Giitetlam Sete ‘Metamerism Seginentation / The group °C” in cladogram represents (@) Hirudinca (0) Fehiura (©) Polychaetes (@) Oligochaeta 107, Characteristic feature of Cnidaria is (2) No tissue or organ system (0) Diploblastic or bilayered (©) Triploblastic or three layered (@ Segementation 108, Nilgiri Tair is restricted only to upper heights (1,200 (0 2,600 metres) of western ghat. The major ease. (@) Habitat preferences () Habitat shrinkage (©) Uttanization nother parts of habitat (@) Pressure of tiger predation at lower height 109. Which ofthe following is nota ctaraceristic of climax community ? (a) Wideniche (0) Complex food web (©) Low resilience (@)Inter-botic nutrients dependence 110. Inan abandoned are first nitrogen fixing community arives and canry out nitrogen ixation, later on this co:nsany ‘is eplaced by non-nitrogen fixing species. In the mechanism of succession this isin general agreement accor (@)_ Facilitation () Tolerance (©) Inhibition (4) Adaptation 111. Under what thermodynamically condition reaction would be spontancous? (@) AN >and AS >0 (0) AH 0 ( AH TAS 112, Which is most favorable for inaximn sustainable harvesting of resources? (@)_ Major part of population is near or around the ca (0) Population is h (©) Population is one fourth below the carrying capacity (4) Population has stow doubling time ig capacity ‘of the carrying capacityeee) 13. 114, 15, 116. 17, nS, 19, ‘Which staterment is not corsect for blood? (@) Mature RBC is of larger size a8 compared 10 its precursor cells () Platelets play important role in blood clotting (©) Neutrophils are major phagocytotic cells (@_Basophils are present in least amount Mammalian jaw has evolved from (@)_ Pharyngeal arches () Temporal bone (©) Frontal bone (@)_ Dentary and sequamosal bones Which eukaryotic RNA polymerase transcribes -RNA genes? fa) RNA polymerase (b) RNA polymerase Il (© RNA polymerase fil (@) DNA polymerase} Aninsertion of single nucleotide in coding region of gene leads to frameshift mutation and result inthe formation of ‘on fmctional protein, Under certain condition second suppressor mutation in another gene may res ito formation f functional protein. Haw suppressor mutation can do this (@) There is insertional mutation in gene of -RNA anticodon such that it sable to inneract with fous aucleatide codon (©) Mutation in gone of ibasome leading to frameshift over transeript (©) Mutation in gene whose product buldge out extra nucleotide (4) Another mutation reverses the original insertion Which statement is correct regarding ABC teansparters? (2) Consist ofthe tansmembrane domain as well a the aucteotide-binding domain (©) Allare? glycoproteins (© Present in only eukaryotes (@ Makes menibrane porous ‘The organelle of C, plants, where glyoxglate is formed is @ Chioroptast (b) Peroxisome (© Mitochondria (@) Cytosol Jn prokaryotes during replication, th lagging strand is synthesized in a series of short fragments known as Okara fragients, consequently requiringnany primers, The RNA primers of Okazaki fagmentsare subsequently degraded by DNA Polymerase J and the gaps are filled. How DNA polynterase 1 fils the gap once the printer bave beet removed front lagging stand? (@)__DNA polymerase! hasits ovn primer () DNA polymerase does not require primer (©) DNA from leading stand serves as primer (@) Ends of existing Okazaki fragmentsot lagging stand serves as primer Which ofthe following small G-protein is involved in nuciear transport and targeting? (a) Ras 4) Ran © Rab (a) Rho Which of the following is not a characteristic feature of Apoptosis? (a) Swelhingatecll () Nuclear fragmentation (©) Change inca wall porosity (a) Permeability of minochondriat inner menbraue ‘Which statemem is correct in relation 0 activity of telomertse? (@) Increases with age (©) Observed ina canes (©) Respousible for apoptosis but not for ageing an sesponsible for intmtortaity (4) Re-syuthesize telomeres 26 =123, 14. 126. 127, 18, 130, 131 1. CSIR NET LIFE nan organism ithe muniber of linkage groupsis 12 then, numberof haploid set of chromosomes is Om 6 © @4 Chromophore associated with phytochrome of pants is (@) Phycobiltin (6) B-carotene © Peerin @) Flavinadenine dinucleotide During the carly origin of earth oxygen was absent in environment. Later on the oxygen increased and reached to present level, The main source of oxygen was (@) Photosynthesis (©) Release from CaCO, (©) Escape of CO, o environment (@) Escape of oxygen from internal sources Which ofthe following is produced in phenyl propanoid pathway’? @) Phenolics (©) Carotenes (©) Alkaloids (@) Terpenes ‘Which of the following helps in osmoprotection in plants? (@) Proline ©) Tryptophan (© Glycine (@) Levulinicacia Frog Alias length “I” and weight “w", Another frog “B” has double Yength and four times weight. It means (@) Frog Ais more cylindrical () Frog Bis more cylindrical (©) Frog Aus low surface to volume ratio (@) Frog Bis overweight Ina certain genetic cross, 1/16 proportion of progeny shiows mutant phenotype. It means (@)‘Twoindependent assorting genes are involved for trait (©). Two independently assorting duplicate genes are involved (© Two linked genes are involved for trait (@)_ Two independent segregating alleles are responsible for trait ‘Which statement is correct for membrane receptors for signal transduction? (@) Contain single or multiple membranes spanning domain (©) _Ainayscoupled with trimeric G protein © Always resultsin production of secondary messenger (@ Recognized non-polar signaling molecules Spontancity of motation means (@) Mutation in absence of exogenous mutagen () Mutation directly proportion to presence of mutagen (© Mutation inversely proportion to presence of mutagen (@_ Mutation atinappropriate time Plasmid copy number is achieved by plasmid-encoded contro elements that regutate the initiation of step, For example in stringent plasmid protein RepA dimerize and binds to origit of repkication anc replication more than once, What mutation may convert thisstriagent mode of replication in plasmid into relaxed @) Overexpression in repa protein () Mutation in repA gene in dimerization domain (©) Mutation in repa other than dimerization domain (@) Gain of function in regognization domain of rep. Antsand bees social structure include queen, sterile f (@) Eusociality (0) Sub-social (©) Group sel le workers and soldict dxoaes. This is beste ion (@) Aluuisin ‘Among the following whichis insulin dependent glucose transporter? @ GLUT &) GLUT2 (©) GLUTA (a) GLUTS138. 136, 137, 138, 139, 140. “What would be effect on secum concentration of TSH if a bolus of thyroxine is injected to a person? (@)_ Remainsunckanged (b) First increase and then come to normal (©) Initially decrease but after short ive will be normal (@) Remains high for prolonged period of time Substrate for DNA synthesis is (a) Nucloetide ti phosphate {b) Mucleaside tri phosphate (©. Nucleoside pyrophosphate (@) Ribonucleotide tri phosphate Optimum termpetature for growth ofextemo thermophiles is @ oc © 20°C (© 50°C (@ Overs0°C Treatment of acetosyringone is given during transfer of transgene using Agrobacterium as vector. The rationale behind this is that acetassringone (a) Helps in anchorage of bacteria to plant cell wall (b) Activates vir operon of bacteria (©) Helps in integration o ‘When a person enters a dark room from bright sunlight he cannot see anything fora few soconds because {@)_Rhodoposin pigment of rod cells is inactivated in bright light which takes time and is activated in dark and associate with opsin protein (6) Scotopsin proteins of rads are denatured {6} All Scotopsin are bound with retinal in rod cells (4) All Scotoposin becomes no-functional in bright light Langest reservoir of carbon is DNA inplant genome (q) Promotes bacterial growth by activating genes in plant (@) Atmosphere (0) Ocean sediments (©). Carbonate and Silicate Rocks (4) Inorganic carbonineanth mantle Answer Key 2) 3 @ 4@ > SO) 6% 10 10. @ 11. 0) 12. @) 13. (b) W.@ 15. @) 18. @) 19,@) 20. (a) u.6 2@ Ba -@) 1) 28) 2) «Ha H@ —-S@ 36. (@) 37. (a) 3.0) 8.0) 2 (3 BO 4M) 45. (@) 6. @ 41.0) 1 5. @ (a) . 5.@) 58.0) Bd) 9. EO) 6. @) 20 6.0 i (a) . 8.) 69. ) 1.) A) 74. ) 16. (a) 7.) BB.) 82. (6) . 84. 85. (©) 86.) 87. (a) 90. (0) . 2. @) 93. (a) 94. (0) ©) 98. (a) . 100.) 101 @—— HR G@)_— 103, (A 196. (a) a WE. (a) 99). 14. (@) 0 Ga) @) I) 9. @) 122.) , 124. (a) 125. (a) 16) TT) 130. @) 132.) 133.@) = LG) 138. @) 138. (b) 140. (b)CSIR NET LIFE SCIENCES (JUNE-2011) PART-A 1. Thecumlative profits ofa company since its inception are shown inthe diagram. Ifthe net worth of the compaay'at the end of At year is 99 crores, te pric it had started with was 10 g as 2 é a : Oop @ 90 Crore (0) 99 Crore (90 Cro¥e (@) 9.9Crore 2. Popular use of which ofthe following fertilizer incseass the acidity af soil? (@)- Potassium nitrate (©) Ammonium sulphate (©) Urea (4) Superphosphate of ime 3. Exposing an organism toa certain chemical can change miclotde bases ina gene, causing mutation. In one suck ‘mutated organism if protein had only 70% of the primary amino acid sequence, which of the following is likely? (2) Mutation broke the protein (©) The organism could wot make amino acids (©). Mutation created a terminator codon (d) The gene was not transeribed 4. Arcferenoe material i required to be prepared with 4 ppm requir to prepare 1000 g of such a reference material is ium. Theamount of CaCO, (nvoKecular weigh St) @ long ) Ang (Q dmg (@) Wmg Identify the figure which depicts a first order reaction. 2 2} 7 210 g 8 38 | Z 6 26 @ 84 34 82 22 ~o 46 56 T Tz) 6 Timen B = 10 E10 zp = 3) ~~ q z 0 46 6 O84 @ By 8 2 b> TTI TS 6 oT? 36 Time 6. Th spood of ca increases every nina as shown inthe following Table. The speed atthe er." + 7 inate would be Time (ninety Speed mies) T 13 2 a ae 3 45 360 @) 265 (&) 280 fe) 270 (@ 285 Ifthe atmospheric concentration of carbon dioxide is doubled and there are favourable conditions of water, nutrients, light and temperature, what would happen to water requirement of plants? (2) [tdecreases initial fr shart time and then returns t original value () Itincreases (6) Tt docreases (4) Winerease initially for short time and then returns te ariginal value FV, i8 applied (0 the circuit shown, the output would be 0)A physiological disorder X always Ieads to the disorder Y, However, disorder Y may occur by isu! A poy shows 4% incidence of disorder Y. Which ofthe following inference is valid? (@)_ 4%of the population suffers from both X & Y () Less than 4% of the population suffers from X (©) Atleast 4% of the population suffers from X (@ There: no incidence of X in the given population. Water is dripping out of a tiny hole atthe bottom of three flasks whose base diameter isthe same, and are intially filled to the same height, as shown. 10. B ic ‘Which isthe correct comparison of the rate of fall ofthe volume of water in the three flasks? (0) Biastest, A slowest (@) A fastest, B slowest (4) C fastest, B slowest (© Bfastest, C slowest 11, How many 6 bonds are present in the following molecule? HC = CCH=CHCH, @ 4 0) 10 © 6 @ 6 12, ‘Thegraph represents the depth profile of temperature inthe open ocean; in which region thisis ike tobe prevaleni? “Temperature (°C) “5 0 3 Surface Increasing eth () Equatorial region (@). Tropical region (4) Subtropical region (©) Polar regionUNE - 2011 1B, ‘Vapour Pressure Curve | aA 0 100 200 300 400-500 600 Temperature (K) ‘The normal boiling point ofa solvent (whose vapour pressure curves shown inthe figure) on a planet whose normal atmospheric pressure is3 bar, is about fa) 400K ) 275K (©) 100K (@) 500K 14, Diabetic patients are advised a low glycaemic index diet, The reason for this is VAPOUR PRESSURE OF SOLVENT (BAR) (2) They requite less carbohydrate than healthy individuals (b) ‘They cannotassimilate ordinary carbohydrates (©). They need to have slow, but sustained release of glucose in their blood steam (@)_ They can tolerate lower, it Nat higher than normal blood sugar levels, 15, Glucose molecules dtfuse across a cell of diameter in tine +. Ifthe cell diameter is tripled, the diffusion time world (a) increase t0 9 (b) dectease 10 4/3 (©) increase t03r (A) decrease 10 ¢/ 16. The reason for ihe hardness of diamond is (@)_ extended covalent bonding (8) layered structure (© formation of cage strucres (@) formation of tubular structures 17, Which of the folowing particles as the kargest range ina given medium itheir initial energies are the same? (alpha () gamma (©) positron (a) electron 18. A ball is dropped from a hicighth above the surface of the earth. Ignoring air drag, the curve that best represents its variation of acceleration fa) 3 w 3 q| “ & Distance Distance : — = — » =~ z=© @ Acceleration Distance Distance 19, Standing on polished stone floor one fets colder than on a rough floor ofthe same stone. Thisis because (@) Thermal conductivity ofthe stone depends on the surface smoothness (0) Specific heat of the stone changes by polishing it (©). The temperature ofthe polished floor is lower than that ofthe rough floor (a). Thereis greater heat loss from the soles ofthe feet when in contact with the polished floor than with the rough floor 20. The acidity of normal rain water is due to @ 80, ) CO, © No, @ NO PART-B 21, Recent studies on Archaea suggest tat life could have originated (@) extraterrestrially and seeded through meteorite impacts (®)_inshallow coastal areas. (©) in deep lydrothermal vents (© inhot, terrestrial habitats 22, Ifthe ratio ofthe number of nonsynonymous to snynonymous substitutions per site in protein coding gene s than one, it isan evidence of selection that is (a) positive () negative (©) neutral (@ random ‘The following isthe biochemical pathiva ‘os pomple pigment production in flowers of sweet pea! Colours Allele Coloaress _AllekeB. — Ss Puple Pigment Precursoa | Preoutson 2 Recessive mutation of either gene A or B leads to the formation of white flowers. A cross is made betwees iio parents with the genotype: AaBb x aabb. Considering dat the two genes are not linked, the phenotypes of the expected progenies are lw 9pumple: 7 white (b) Shite: 1 purple (©) 1 purple: 1 white (a 9 purple: 6 light purple: 1 white 24. The frequencies of alleles ‘A’ and ain population at Hardy- Weinlburg equilibrium are 0.7 and 0.3, respectively. In random sunple of 250 individuals taken from the population, how many are expected tobe heterozygous? @ 12 () 81 (©) 10s @ 145 The transition to lowering int plants requires (a) growth of plants under long-day conditions, (6) growth of plants under short-day conditions () reprogramming of the shoot apical meristem. (a) synthesisof the Nensering hormone MlrigenAMAL Ie 26. Inanaltruisticac,ifa donor sacrifices °C’ offspring which helps the recipient to gain ‘B' offspring and the donor is related tothe recipient bya coefficient 7 , under which condition would kn selection favour this altruistic trait? @ Bec. ) B>yC © B-c=0 ( B-C>0 27. Aneuploid females with only one X chromosome isa characteristic of individuals with 2) Cridu chat syndrome, (b) Klinefeter syndrome (©) Downsyndrome (@ Tumer syndrome 28. Which of the following food crops has recenily been genetically engineered to obtain edible vaccine to develop immunity against hepatiisB? (@) Banana (0) Maine (©) Potato (@) Tomato 29. The most commonty used methad of estimating primary productivity of 3 pond involves measurement of the antount (@) CO, utilized (b) autotroph biomass (©) oxygen released (2) organiccarbon 30. The area of allowed regions in the Ramachandran map will be least for @ Gly () L-Ala © LPol (@ methyl! L-Valine 31, Small RNAs with internally complementary sequences that form haitpin-like structure, synthesized as percursor RINAS and cleaved by endonucleases to form short duplexes are called (a) snRNA, (b) mRNA (©) (RNA (@) miRNA 32, A much greater proportion of energy fixed by autotrophs is transferred to the hebivore level in the open ocean ecosystem than in forest ecosystem because (@) aquaticauttrophsaresmll (b) aquatic herbivores are more efficient feeders (©) terrestrial autotrophs ae less efficent feeders (a) terrestrial autotrophs have mate indigestible tissues 33. Polar bears maintain their body temperature because they have more of (a) Transducin protein (©) Uncoupling protein (©) Myoglobin protein (@) FF ATPase 34. Transport of water across aquaporins is regulated by the presence of which of he following sequenice of three highly cortserved amino acids? @ Ala-Asn-Pro (b) Pro-Asr-Ala (© AsiPro-Ala (4) Pro-Ala-Asn 35. Which of the cyclins havea essential functions in S-phase of cel cycle? @ Actype (b) Baype © Daype (@) Both Band D-ypes 36. During generation ofan ation potential, cepolarization is duc to ia) K’ efx (0) Nar effus Na infty (@) K°inftox 37, Gprotetn-inked receptors are trans-menibrane proteins of (single-pass () three-pass (a) Sevearpass| CSIR NET LIFE SCIENCES JUNE-2011 38. Release of nutrients, oxidants ocelectron donors into the environment fo stimulate naturally occurring microorganisms todegrade a contaminant, is referred toas (@)_biostioutation ) phytoremediation (©) bioaugmentation, (@) bioremediation 38. A mechanism that car cause a gene to move from one linkage group to another is (@)_ crossing over (0) inversion (©) translocation (@ duplication 40, Th2 response is generated and maintained mainly by which ofthe following pair of ostokines? (@) W-4andiL-10 (0) TL-12andIFN-¥ (©) IFN-Y and TNF-o. (@ 1-2andL-12 41. Cytoplasmic determinants coding for anterior structure of Drosophila ennbry—o if injected elsewhere inthe recipient emtryo, would lead to (@) normal development () formation of additional ectopic head (© degeneration (@ aphenotype with io heads and two tails 42, The dwarf pea mutant 2) used by Mendel was defective in which of the following enzyme involved in gibberellin biosynthesis? (@)_ent-Kaurene symihise. (0) GA3 B-hydroxylase (©) GA20-0xidase (@) ent-Kaurenoicacid hydroxylase 43, ELISA assay uses @)_anenzyme which can react with secondary antibody. {®)_anenzyme which can react with theantigen (©) asubstrate which gets converted into coloured product (@) a radiotabelted secondary antibody 44, Which ofthe following motecutesis involved in Ca*— dependent cell-cell adhesion? (a) Calmodulin (b) Cadherin (© N-CAM (@) Calpain 45, The * Cap of RNA is required forthe {@)_ Stability of RNA only (b) Stability and transport of RNA (©) Transport of RNA only (@) Methylation of RNA. 46, Yeast antficial chromosome (YAC) vectors contain selectable markers. Loss of which marker a distinguishes the religated YACs from the original vector marker? @ TI () SUPS Ome ted during cleavage to give rise to primordial germ cells cloning site 17. Inan amphibian oooyte, the germplasm which ges (PGC's) is normally {@) distributed evenly throughout the oocyte (b)_ ‘localized at animal pote (©) localized at vegetal pote (@)_ aggregated in central part of oocyte 48. Which of efatlowing statcments with respect t alternate oxidase activity in cyanide resistanl respiration i pans, isnot correct? (@)_Allemate osidase accepts electrons directly rom oytochrome C (©) Some plants exhibi thermogenesis during inflorescence development (6) Transcription of alternate oxidase gene is offen induced by various abiotic stresses @) Whe electrons pass to allemate oxides, two sites of proton pumping are bypassed49, 92. 55 Inmature Arabidopsis embryo, root apical meristem consists of cells derived from (2) eanbryo and apical suspensor cells () embryo only (©) suspensor only (@)_hypophysis only Na—K° ATPaseisatetramer of 2q. and 2 subunits, On which ofthe following subunits ae the Na* and K" binding sites present? (2) bothon a () both on f (©) Na‘on o andK*on B (@ Nav on f and on ot A mother of blood group O has 2 child, The father could be of blood type a) KorBarO @) Aonly © AorB @ ABo Following figure shows McArthur and Wilson’ equilibrium model of biota ono single island. Rate c D No. of species preseat Inthis figure, terms A,B, Cand D inorder are (2) extinction inmigration, quilibrium number of species, sizeof species pool (b) immigration, extinction, equilibrium number of specics, size of species pool. (©) extinction. immigration, size of species pool, cquilibrinm number of species. (4) immigration, extinction, size of species pool, equilibrium numberof species. Routinely used glucose biosensor estimates blood alucose Level by sensing the concentration of @) glucose (b) oxygen (©) 8 -ghuconolactone @ HO, Name the ectothermic animal that can thermoregutate by behavioural means rather than by physiological means (2) Bomble bec in an orchard (b) Tuna fish in the ooean (©) Lizard ina desert (a) Flatworm in apond Which of the following methods of plant transformation can be used to introduce a gene into chloroplast (2) Agrobacteriun-mediated transformation (b) Patticte delivery system (6) Permeabitization (@)_ Electroporation The Hand c of wing length (a normally distributed parameter) in a population of fruit flies are 4 and 0.2 mum. respectively. In random sample of 400 frit fies, how many individuals ae expected to have wing lengths greater than 44 mm? (a) 20 () ot © Wo (a) 336 Which of the following isa characteristic ofan carly comunity? (@)_ Narrow sche specialization (b) High species diversity (©) Community production (@) Open mineral yang Acculture ofan Trost clhroinosat strain that is lysogenic for phage lambda is grown at 32°C. Induction of the prophage from the oe when the cults is exposed ta = — 3660. 61. a, 64, 68 MAD @ ae. (0) ultra violet radiation. (©) infra red radiation, (@) wild ype E.coli culture During urine formation the filtration of blood atthe glomerulus is (@)_ anactive process (©) anasmotic process (©). isapressure-dependent physical process (8) anon emergy-mediated transport process Ifthe core body temperature of a hnman rises above normal, which of the following processes would be initiated sequentially for thermoregulation? (a) Peripheral vasodilation, increased rate of respiration, tachycardia (b) Peripheral vasoconstriction, increased rte of respiration, bradycardia, (©). Peripheral vasoditation, decreased rte of respiration, tachycardia, (@_ Peripheral vasodilation, decreased rate of respiration, bradycardia With which protein of Yersinia would integrin proteins of maramalian cells interact for internalization? (@) Pilin () Fimbrin © tovasin (@) Adherin Grave's disease is associated with (@) insufficiency of thyroid hormone {b) excess of thytaid hormone (©) insufficiency of corticosteroids (excess of growth hormone ‘The fidelity of teplicative base selection cam be reduced by a factor of 10? when the repair of DNA (@ APendonuclease () ABC exinuclease (©) DNA photolyase (@) TLS DNA polymerase ‘What i the minimum qwuenber of NTPS required forthe formation of one peptide bond during protein synthe @) One 0) Two (©) Four @ Six ‘imperfect fang’ isa group repeesented by fungal species which have @)_ Simple mycelia (0) Noknown mechanisms of sexual reproduction (© Unkown phylogenstic celationship (4) Lost itssurvival mectanism against harsh environments ‘The photoreceptor commonly involved i light entrainment of the biological clock in flies, moulds and plants is (@)_ Phytochrome (0) Rhodopsin (©) Carotenoid (@) Cryptochrome ‘The free energy AG of a dissolved solute (2) Increases with solute coucentration (b) Decreases with solute concentration (©) Is independent of solute concentration (@)_ Depends only on temperaaure Which of the following is not a characteristic of phylum Chordata? (@) Pharyngeal slits ©) Amnioticegg (©) Postanal til (8) NotochordeI 69. In India, brow antered doer (Sangai) is found only in the floating andmasses of @) Walartake (©) Sasthamlotta lake (©) Dallake (@ Loktak lake 70, Both halophytes and glycophiytes compartmentalize cytotoxic ions into the intracellular compartment or actively ‘pump them out of the cell othe apoplasts With the help of membrane transport proteins, Among these, the Na -H° antiporter, NX, is ocalized in @) Theplasma membrane {©} Chloroplast (nner envelope) (©) Mitochondria (outer membrane) (@) Tonoplast PART-C You are studying the binding of proteins tothe cytoplasinic face of cultured liver cells and have founda method that gives good yield of inside-out vesicles from the plasma membrane. Unfortunatly, your preparations are contaminated ‘with variable amounts of tight-side-ont vesicles. Nothing you have tried, avoids this contamination. Somebody suggests that you pss the vesicles aver an affinity column made of lectin coupled te Sepharose beads. What i the rationale of this suggestion? (@) Right side-ou-vesicles will be lysed by lectin coupled to Sepharose beads (b)_ Right-side-out-vesicles will simply bind to the Tekin coupled Sepharose beads. (©). Lectin will bind to the carbohydrate residues present only on the inside out vesicles, (8) Lastin vill bindto only glycoproteins and glycolipids present on the inside-out vesicles. 72, Theoveralllengthofthe cell cycle can be measured fromthe doubling tim ofa population of exponentially proliferating cells, The doubling tie ofa population of mouse L cells was determined by counting the nunaber of cells in samples of culture at various times, What is the overall length of the cell eyele in mouse L cells? 10° Number of Cells 10" 0 20 40 60 80 100 “Fime (hows) (@ 30b ©) 2h © on @ 400 Using molecular clock, it was estimated that two species A and must have diverged from their common ancestor about 9 10*yearsago Irthe rate of divergence per base pair is estimated to be 0.0015 per million years, what isthe proportion of base pairs that differ between the two species now? @ 007 ) 0.0135 (©) 0.00017 (@) 0.0035 74, Aproteinin 100 mM KCI solution was heated and the observed, (tnidpoint of unfolding) was 60°C. When the same protein solution in 300 mM KCi was heated, the observed T, was 65°C. What isthe most probable reason for this increasein 7,” (@) Hydrophobic interaction is increased and electrostatic repulsion is decreas. (b) Hydrophobic interaction is decreased and electrostatic polsion is increased. (©) Hydrogen-bonding is increased (@)vandor Weals eraction is increased = —— 355 =Nw APRON 011 Daring receptor-mediated endocytosis, apolipoprotein B on the surface of a LDL particle binds tothe LDL-recepior present in coated pits containing clathrin, The receptor-LDL complex is internalized by endocytosis, trafficked to lysosomesand the LDL -teceptoris finally recycled. patient reports with familial hypercholesterolemia. Thiscould be due to SJ @_ mutation in the LDL molecule (0). defect in LDL-receptor recycling (©. mutation in the LDL-receptor (4) defect in cholesterol binding with its receptor 76, Budding yeast cells that are deficient for Mad2, a component of the spindle-attachment-check point, are killed by treatment with benomy/, which causes microtubles to depolymerse. Inthe absence of benomyl, hos, the celsar2 perfectly viable. Which explanation out ofthe following is able to justify this observation? @ Inthe absence of benomyl, the majority of spindles forms normally and the spinle-attachment checkpoint (Mad2) plays no role (©) Inthe presence of benomyl, the majority of spindles form normally and Mad? plays critical role in cell survival. (© Other than the rol in cell survival, microtuble depolymerization affects oxidative phosphorylation in the absence of Mad2, (@)_Benomy! also affects protein synthesis in the absence of Mad2, 71. Eukaryotic genomes are organized into chromosomes and can be visualized at mitosis by staining with specificdyes. eat denaturation followed by staining with Giemsa produced alternate dark and light bands. The dark bands obtained by this process are mainly (@) AT -rich and gene rich regions (0) AT -tich and gene desert regions (©) GC-rich and gene rich regions (@) GC-rich and gene desert regions 78. Anaminoacid contains no ionizable group in its side chain (R). Is titrated from pH 0 to 14. Which of the following ionizable state is not observed during the entire titration in the pH range 0 - 14? R R | | c (b) HN — C — COOH H a R R | | © HN— c —coo @ HN— ¢ —cooH | | H 79. Arescarchr has isolated a restriction endonuclease that cleaves at only one specific 10 basepair site ‘A. Would this enzyme be useful in protecting cells from vial infections, given that atypical viral genowe is 5 x 10" base pairs long? B, Restriction endonucleases are slow enzymes with turtiover number of | s, Suppose the isolated endonuclease was Faster with turnover numbers similar to those for carbonic aniydrase (10%s'), would ths increased ratcbe beneficial to host cells, assuming that the fast enzymes have similar levels of specificity? Tive correc combination of answer is {@) (A):No(B) Yes (b) (A) :No(B): No (9 (A): Yes 8) :No () (A) Yes (B) > Yes aa 3981 ressor inhibits expression of genes in Jac-operon whereas purine biosynthesis is repressed by the Pur repress ‘The two proteins have 31% identical sequences att have similar three-dimensional structures. The gene regulatory Properties ofthese proteins differ in relation to A. binding ofsmall molecules tothe repressor B. presence of recognition sites om the genome C. oligomeric nature of the repressor D._DNAbinding property The correct statements are (@ AandB () A,Bandc © Aandc @ B,CaniD ‘An ot -hekixina peptide or protein is chiaracterized by hydrogen bonds and characteristic dihedral anyics. Cioosciie right combination. (@) Hydrogen bonding between the amide CO of residue i and amide NH of residue i + 4. Dihedral angles in the region § =—50°, w =~ 60°. (6) Hydrogen bonding between the amide NH of residue i and amide CO of residue i+ 4, Dihedral angles in the region of @ =-50°, y =~ 60°, {© Hydrogen honding between the amide CO of residue i and amide NH of residue i +4. Dihedtral angles in the region of § =—50°, y = +60", (@ Hydrogen bonding between the amide CO of residue i and amide NH of residue I + 3. Dihedral angles in the region of g =- 50°, y =—60°, Mouse bone narrow cells were fractionated to derive stent cell antigen-I* (8 Xs, These cells were cultured \with interteakin3, or granulocyte-macrophage colony stimulating factor or macrophage-colony stimulating factor, ‘or granulocyte colony stimulating factor. Most numerous and varie colonies were obtained inthe culture stimulated with (a) loterleukin-3 (b) Granulocyte-macrophage colony stimulating factor (6) Macrophage-colony stimulating factor (@) Granulocyte-colony stimulating factor Precursors of the atoms in the purine skeleton are e 7 Cos ZENS UN wt Ne \ 1 I “cs cae) eS Zan rn 9 3 ()_ NI. Asp, C2and C8, formate, N3 and N9 guanidine C4, C5 and N7, Gly; 06, CO, (0) NI, Asp, C2and C8. citrate; N3 and N9. amide nitrogen of Gla, C4,.CS and N7; Gly; C6, CO, (©) NI.Asp, C2and C8, formate; N3 and NY amide nitsogen of Gla, C4, C5 and N7, Gly; C6, CO, (@) NI, Glu; C2 and C8, acetate: N3 and N9. amide nitrogen of Asn: C4, C5 and N7, Gly; C6, CO, Two £ col cultures Aand B are taken. Culture A was earlier grown in the presence of optimum concertration of srauitous inducer IPTG Boi the cotures are aw used to inoculate fesh medium containing sub-optimal concentration of gratuitous inducer. Ksvas observed that culture B was unable (9 ullize acose, whereas A did soeficiently ‘The reason behind thisis (a), pietmsavnent with IPTG hs resulted in a mutation as. result of which lac operon is constitutively expressed (0) TPT has made the cell membrane more porous to smal rlesules ano lactose is taken up miore efficiently by Aas compared to B85, 86 (© imculture A, Lactose permease was induced toa high level, during pretreatment with IPTG, which allowed the preferential uptake of lactose. (@_inculture A, IPTG activated a receptor which bound lactose more efficiently, thereby triggering a signal Cancer causing genes can be functionally classified into mainly threc types: (i) genes that induce cellular proliferation, Gi) tumor suppressor genes, (ii) genes that regulate apoptotic pathway. Epstein-Barr virus that causes cancer by ‘modulating apoptotic pathway, cnnainsa gene having sequence homology with which ofthe following genes? (@ bax (@) bel-2 © Ps (@ caspase3 Ihas been observed that in 5-10% ofthe eukaryotic RNAs with multiple AUG, the frst AUG is nek the initiation site, In such cases, the ribosome skips over one or more AUGs before encountering the favourable one a translation. This is postulated tobe due to the presence ofthe following consensus sequence (s) A. CCACCAUGG B. CCGCCAUGG c. ccgecauGe D, AACGGAUGA Which of the following sequence sets related to the above postulations is correct? (@ AandB (b) Aandc (© CandD (@ BandD Values ofT, (midpoint of denaturation), AH,, (enthalpy change at T,) and AC, (constant-pressure heal capacity change) ofa protein are measured ina differential scanning calorimeter, AG. (T), the Gibbs fee encray changeat any temperature T(K) can be estimated using the fllowing form of the Gibbs-Helmholtz equation withthe values ‘obtained from these measurements (T.-T) AG, (T)= AH, ~ AC, {T, -T+TIn (T/T) The stability curve forthe protein simulated using the observed thermody:iamic values is given below a oN g, \ TK (b) van der Waals and electrostatic interactions only ‘Toll-ike receptor 4 is associated with resposivencss fo LPS, an endotoxin thal causes fetal endtoxe shock. The mice deficient in Toll-like receptor 4 and BALBic mice were injected with Escherichia coli, Inaddition, some BALB/ rc alsoinjectod with he same bacteria alaneor with ani-interleukin-10 IL-0) antibody: The mice resistant chal effect of the bacteria were: tothe! (a) BALB/ imice receiving the bacteria (b) BALB/b mice receiving the bacteria and the anti-IL-10 antibody © @99, 90. 1 93 ee 42 a — Presence of circular mRNAs fora specific protein in an eukaryotic cell reflects a rapid rate of synthesis ofthat protein, Following mechanisms are suggested A. elF-4G and PABP promote this process through 5 interaction of mRNA. B. ribosomes are less active in recognizing circular mRNA. C. PABP and elF-4A promote this process . ribosomes can reinitiate translation without being disassembled. ‘Which ofthe following is correct? (@ AandD (b) Band D (©) AandC (@) Band siRNAs and miRNAs are used for achieving gene silencing, Although, major steps are siiiar there are dist. differences in the key players of the two processing pathways, Following statements relate to some chatacters features of gene silencing ‘A. Both siRNAs and miRNAs are processed by cytoplasmic endonuclease Dicer. B. ‘Drosha’ is needed for processing miRNAs and precursor siRNAs. C._ BolhsiRNtAsand miRNAs show association with Argonante protein D. Botte processing pathways involve RISe complex Which ofthe flloving combinations is NOT correct? @ Aad (©) Cand ( AsndB (@ Danda Glucose ismobilized in muscle when epinephrine activates G,, .Inan experiment in which muscle colls were stimulated \ith epinephrine, slucose mobilization was observed even after withdrawal ofepinephrine. This could be (a) due tothe presence of a cAMP phosphodiesterase inhibitor. (6) very low rates ofeyclic AMP formation (©) ductothe presence ofa cAMP phosphodiesterase activator, (@)_ duet the absence of protein kinase A In cukaryoti chromatin, 30 nin fiber (Solenoid) can open up to give rise to vo kinds of ciromati. In one type (A the promoter of gene within the apert chromatin is occupied by a nucleosome whereas i the other (B), the promoter is occupied by histone H1, The following possibilities are suggested. : ‘A. The gene in (A) is repressed B. The gene in (B) is repressed C. Thegenein(A) isactive D._ The genein (B)is active Which ofthe following ses is correct? (@) AandD (0) AandB fo) Band (@) Cand Intracellular pathogens like Aiscabacteria, Satmonelto, Leishmaniaand Listeria survive in macrophages by modulating, host cellular machinery. Inorder study the fate of tes intracellular palnogens in macrophages, cells were labelled with lysotracker Red arid infected with GFP-labelled organisms. Afier 2 hours at 37°C, cells were fixed, stained wit anii-trasferin reecpicr antibody and probed with secondary antibody conjugated-blue dyes. Cells were viewed under confocal microscope Observation: GEP-labelled \fycobacteria, Salmonella and Listeria were localized in the sane compartment fabelled with blue dyes; whereas GFP-Leishmaniay was localized with red labelled compartment. Which of the following agement is true based on these observations! (a) Myeob Salmonella ancl Listeria side inthe lysosonues. (0) Leisimonte reside in tysosome like compartmentom, 96. 98, (©) Leishmania reside in a compartment which bears characteristics of carly endocytic compartment. @ ycobacteria, Salmonelia and Listeria lyse the phagosomal membrane and reside in cytosol Macrophages were collected from BALB/c mice, CD40-deficient mice, CD86- deficient mice and ICAM--deticient mice. These macrophages were co-cultured with LCMV peptidespecific T cells in presence ofthe LCMV peptide for three days. The cells were recovered and co-cultured with BALBic-derived macrophages in presence of the peptide, During the last welve hours ofthe co-culture, 3H-thymidine was added to the cultures. The cells were harvested and SH- thymidize inconporation was assessed. The highest incorporation was observed in (@) BALB/c macsophage-T cell o-culture (©) CD40-deficient macrophage-T cell co-culture (©) CD8é6-deficient macrophage-T cell co-culture (@)_ ICAM-L-deficient macrophage-T cell co-culture Genetic studies demonstrated that TBP mutant cell extracts are deficient in transcription of genes from all three promoters viz. class I, II and Il, Following statements describe characteristic features of TBP A. TBP is considered as an universal basal transcription factor B, TBP not required for transcription of archaeal genes C. TBPis involved in recognizing TATA box 1D, TBPoperates at al promoters regardless oftheir TATA content ‘Which of te following combinations is NOT correct? fa) AandD (b) CandD © Bandd (@) AandC ‘cAMP signalling plays a very important role in the development and differentiation of Dictyostelium discoideum. ‘This morphogen is synthesized by different adenyl cyclases expressed at different stages ofits lifecycle, The following statements (AD) refer tothe effect of matatons in different adenyl cyclase genes ‘A. aca deficient cells can be allowed to aggregate by exposing themt to pulses of cAMP. B. ach deficient cells would form normal fruiting bodies and the spores can germinste when exposed to favourable conditions. C. cg deficien cells develop normally and the spores germinate in the sporehead itself D._ spores formed fron the ac delicient cells wll germinate irrespective ofthe osmotic conditions. ‘Which of the above statements are correct? (a) AandD (b) Aonly (c) AandB (d) CandD Fill n the blanks (,b, cand din the following statements with a proper combination of m,n, and p Wherein am represents longer snrepresents - shorter represents -prevents pp represents - induces Short day (SD) plants flowes when night lengths are__a_ than a critical dark period, Interruption ofthe dake period by a brie! light treatm flowering in SD plants. Long day (LD) plants ower when night Jength is____¢___ hana erica period Shortening ofthe night with brief ight treatment flowering in LD plans a boo é @m oo 1 p oan pom ° @n 0 mm p @m pon ° The total variance ina phenolypic character can be spit into two components - genetic (V,) and environmental (V,). The estbilty ofa phenotypic tat canbe expressed quantitatively as heritability coeicient he) which isealeulated asit= 4G ——NE - 2011 @ V-Ve ©) WV, © VIV+V, @ VV, ‘99, Mutations in CONSTANS (CO) of Arabidopsis thaliana results in late lowering phenotype, Transcript levels of CO ‘were defermined in long day and short day seedtings. Which of the following would likely represent the transcript profile of CO? Longeday Short-day soedlings seedlings @ o) — — © — —— @ 100, Following are some statements for synthesis of secondary metabolites in plants A. Tetpenes are synthesized by shikimic acid pathway and mevalonic acd pathway. B, Alkaloidsare nitrogen containing compounds and are synthesized by sikimic acid pathway: C._ Phenolic compounds are synthesized by shikimic acid pathway and mevalonic ac pathway. D. Both alkaloids and terpenes are synthesized by mevalonic acid pathway and MEP pathway. Which one ofthe following combinations of the above statement is tre? @ Add () Aandc (© Bande (@ Band WOH. During early cleavage of Caenorabditis elegans embryos, each asymmetrical division produces one founder cell Which produces differentiated descendants and one stem cell. The very fits cell division produces one anterior founder cell, namely AB and one posterior stem cell, namely’. Whe these blastomeres are experimentally separated ‘anid allowed fo proceed further with development, one could get the following possible outcomes: (@) Pl cell would develop autonomousty while the AB would show conditional development (6) Pl cells would show conditional development while AB would show autonomous development (©) Both woul show autonomous specification and result in mosaic development, (4) Both would show conditional specification and resi in egalaive development 02, Incase of sea vclin, which ofthe following isthe correct sequence of events taking place during the interaction af sperm andegg? (a) Chemosttraction of sperm to the egg by soluble molocules secreted by the egg —> exocytosis of the sperm acrosomal vesicle ro release its enzymes —> binding ofthe sperm tothe extracellular mattis ofthe egg —> passage of sperm through this extracellular matrix —> fusion egg and sperm cell membranes, (6) Chemesttsaction sperm tothe egg by soluble molecules sereted by the eng > binding of the sperm to the extracellular matrixof the egg —> exocytosis of he sperm acrosomal vesicle to release its enzymes —> passage of sperm through this extracellular matrix —» fusion of egg and sperm cel membranes (©) Chiemoatiraction of sperm the egg by Soluble molecules sereted bythe egg -> binding ofthe sperm tothe extracellular matsis of the 28g > passage of sperm through this exteacllular matrix —» exocytosis ofthe speninaerasomal vesicle to release its enzymes ~» fusion of egg and sperm cell membranes (@) Chemoattract this nof sperm to the egg by soluble matecules secreted by the egg —» passage of sperm through cellular matrix ~» binding of the sperin tothe extracellular matrix of the egg ~> eNocytosis ofthe sperm acrosomal vesice to Felease its enzymes ~> fusion of egg and sperm cell membranes 103. The time taken for atrial systole and diastole in a normal heart are 1, and, seconds, respectively. IT ventricular systole Lakes, soanaels, calculate the ventricular diastolic time (seconds) few h 0) WH, © y-Wek @ G+hyst,| ' | (SANA DONO UOTE 104. patient undergoes liver transplantation and during the course of post-operative treatment, becomes susceptible to infection, The patient cane treated in two different modes and can have alternative outcomes. Which of the following statements is correct? (a) Treatment with immunostimutatory drugs reducing the infection but ejecting the transplant (©) Treatment with immunostimulatory drugs reducing the infection and retaining the transplant (©). Treatment with antibiotics reducing the infection but retaining the transplant (@)_ Treatment with antibiotics reducing the infection but rejecting the transplant 105. Thedependenc ofthe rate of sucrose uptake with respect to sucrose concentration in plant cell was studied and data are shown in the folowing graph Sucrose uptake 10 20-30 Sucrose Concentration From the above data it can be inferred that (2). shesucrose uptake is energy independent and no special carrier is involved. (b) the sucrose uptake is energy dependent and a special carter is involved, (© at lower concentration of sucrose the uptake of sucrose is enesgy dependent and carrier mediated (@)_athigher concentrat-on of sucrose the uptake is energy dependent and cartier mediated 106. During episodes of anoxia in plants, pyruvate produced in glycolysis is initially ermented to lactate, During later stage there is an increase it the fermentation to ethanol and decrease in the fermentation (lactate, a phenomena ‘which helps plants survive anoxia. Which of the following slatementsis correct about this change of fermentation fx from lactate towardsethanol? (@ The cytosolic pH increases, thus activating both lactate dehydrogenase and pyruvate decarboxylase activity: (0) Theeytosolic pH increases, ths inhibiting lactate dehydrogenase acuvity and wctvating pyruvate decarboxylase activity (©). Thecytosolie pH decreases, thus activating both lactate dehydrogenase and pyruvate decarboxylase activity (@)_ Theeytosolic pH decreases thus inhibiting lactate dehydrogenase and activating pyruvate decarboxylase activity 107. Bacteria often acquire gonesby the process of ateral or horizontal transfer, Such ‘foreign’ genes, if acquired in recent past, may be identified by tei atypical GC content, as compared to native” genes, Suppose the genomic GC content of a bacterium is 40%. Gene A ofthis organism contains 1000 bases with 225 Gand 215 C, Another gene Bof len '300’bases contains 160 Gand 140 C. Which onc of the following would be the mos. accepale hypothesis (given that x= 3.841 al 0.05 significance level)? (a) Aznative, B: Foreign (®) A: Foreign, B: Native (©) A: Foreign. B: Foreign (d)_ A: Native, B: Native 08. Injection of noggin miRNA into a I-coll,UVeirradiated embryos of frog completely rescues dorsal development and allows the formation of a complete embryo. Sone af the following statements (A-D) could possibly explain this observation A. Noggin is a secreted protein which induces dorsal ectoderm to form aural issue and it darsalizes thes cells which would otherwise contribute o ventral mesoderm. nds direcily to BMP4 and BMP2 thus preventing complex formation with © Noggin along with ther molecules prevent BMP from binding (o and inducing ectodenn and mesoderm cells the organizer ei receptors.D, Noggin isa secreted protein which irtduces the dorsal ectoderm to form the epidermis and it ventraizes the mesoderm cells which would otherwise contribote to dorsal mesoderm, Which of the above statements are correct? @) ABandc (0) AandB @ Bani @ Aandd 109. Atmospheric CO, contains the naturally occurring sable carbon isotopes "Cand °C in the proportion of 98.9% and 1.1% respectively: Following are some ofthe statements regarding CO, assimilation: A. BothC, and C, plants assimilate ess "CO, than"CO, B. Both and C, plants assimilate less "CO, than CO, C. C plants assimilate lesser "CO, than "CO, as compared to C, plants D.C, plants assimilate lesser "CO, than "CO, as compared tC, plants Which one ofthe following combinations of above statements is true? (@) AandB (&) Aandc (©) CanaD (@ AandD 110. Spinal cord ofan animal was transected at C1/C2 level. The respiration ofthe animal stopped and st needed artificial respiration, However, the heart continued to beat although at a slower rate. Some of the explanations given were: A. respiration regulatory centre is located in the medulla B._espiration cegnatory centre is located above the CL/C2 cut C. heart regulatory centre is above the C1/C2 cut 1D. tvattias antoregulation Which one of te following is most appropriate? @) Acnly (0) Band C only (© 4,Band D only @ B,CandD only AL, Anorganis having heart for circulation, excrete through green glands thas several ganglia and tactile organs on its body and its larval form is very different than its adult font This organism is most likely to respite by: ‘A. exchanging oxygen and carbon dioxide through an extensive tracheal sytem. B, gaseous exchange over thinner areas of cuticle a by gills C._anefficion! tracheal system that delivers oxygen directly to the tissues D. adouble transport system, where the civeulating fluid contains a dissolved respiratory pigment, Choose the correct option @ Aandc () OnlyD © OnlyB (@ BandD 112, The MALDI spectcum ofa peptide stows a peak at nz corresponding r0 3600. When the ESI spec‘rum is recorded, peaks at nvz corresponding to 721,904 and 1801 were obtained. When the MALDI MS/MS spectrum was recorded, ‘ange muuber of peaks with m/z less than 3600 were observed. The spectral data indicate that the peptide (@)_ighhyimpure {6} pure with molecular mass of 3600 an partial sequence ofthe peptide can be determined. (©) highly uastableand degrades rapidly (a) degraded under condition employed for recording ES spectrum, 13, Ina stressful condition, ACTH secretion was increased and.as2 biood, One ofa combination ofthe followin: scsul glucocorticoid concent sation was elevated in anges nos likely (aking place in this condition A. Decreased circuta ig cosinaphis and basophils: B. Red C._ Potentiated inflammatory response to tissue injury creased mitotic activity of lymphocytes in lymph nodes,CSIR NET LIFE JUNE-2011 ‘The correct answer is, @ Bandc (b) AandB () BandD @) CandD 114, In one study, a group of 5 day rat pups were fed for 3 weeksa diet A and the pups gained weight by 300%, In aseooad study, when the same dict fed for 3 wocks to rats of 350 ams, they did not gain weight significantly. Ina third study, a diet B was fed to 250-350 ams rats and it was observed that they delivered normal pups aftr five weeks. Based on these observations which of the following statements is correct? (@ Diet A facilitates weight gain than diet, (0) Diet B facilitates pregnancy and child-bearing (©) More control experiments are to be conducted for definitive conclusion. (@ Diet Ais more energy containing that diet “B". Hence, its quantity should be reduced. 115. In Newrospora a cross between the genotypes ‘A’ and ‘a’ results in an ascus with asospores of genotypes as shown below: IODADOOCOOS Statements A to D are events that could have occurred during meiosis A. Crossing over between the centromere and the gene B. Segregation of alleles ‘A’ and ‘ain meiosis C. Segregation ofalleles “A’and ‘a’ in meiosis 1 D. Assortmen: of alleles‘A’and ‘a’ hic of the above events could correctly explain the observation shown in the figure? (@_ A followed by C () Catone (b) A followed by B (@) Dalone 116. Which of the following graph represents normal sexual cycle in @ normal human female? — estiogen on progesterone é 8 @ § © = & 5 ntration © @ Concentratio! ConSIR NET LIFESCIENCES JUNE - 2011 117. Based on he structural regions of s nuclear receptor shown inthe diagram, the following predictions were made AB c DE F NH} | | ll Bi | coo 'A. Region F is responsibie for binding to ligands and contains two zinc finger-like binding motifs B._ Receptors with A/B domains generally associate with chaperones and do not hind to DNA. C. Region E indicate that receptors associate with chaperones which protect the nuclear hormone receptors. D. Region C contains the P-box and the D-box required for dimerization of the receptor and creates contact with DNA phosphite backbone. ‘Which one of the following is true? (@ AandB @) Band () BandD (@) CandD 118. When FI female Drosophila of the genotype a'a b'b c'cis test crossed, the following progenies were obtained: Progeny classes* No. af progenies arbre 2 abc 28 abe’ 26 abe 4 a’be' 230 abe 220 ab'c’ 225 abc 225 Total 1000 *The progeny his been shown as classes derived from the female gamete Stafements 4 to Fas given below are couctusions derived from the above resull A. Genesa and bare linked in cis Genes a and bare linked in srans CC. Gonesa and bare linked in cis while band ae tn D. Thegenobype ofthe parents are a°a'b'b* and aabh E. The genotype ofthe parents are a°a'bb and aab" F. Genesaand b are 10eM apart Which ofthe above statements are correct? @) Catone (©) A.EandF (© BEandF (@) A,DandF ‘Monoclonal antibodies (nb) can be potentially used as therapeutic agents. The major advantage is that they can specifically target aberrant cells, Howeves, there is practical dificuly, Monoclonals are raised in mouse and therefore ili expected that an immune reaction will develop if Use are injected into humaas. It is therefore necessary (0 “Inuianze” monoclonal antibody by (@) expressing the gones for the mAb in cultured human cells and isolating the mab from these cells (b)_ replacing the Fy region of a mAb with one derived fom a human IgG (©) teplacing CL and CH regions of the Mab with that obtained from a human IgG (@_takinga human IgG and replacing the CDRs by those derived from the mouse mAb120, "The following is a hypothetical pathway forthe development of wild type (red) eye colour in an insect: w _Byme ™ (Cotoucess (range pigment) precursor) a Redeye colour (wild type) y —ErymeB (Colourtess (brown pigment) precursor) Enzymes A and B are encoded by the genes a' and b’, respectively. ‘The following statements are made regarding inheritance of the genes involved inthe development of eye colour: A. When two heterozygous individuals of the genotype a'ab'b are mated, progenies with red, orange, brown and ‘white eye colour will be observed irrespective of whether the gones are independently assorting or showing incomplete linkage. B. When two heterozygous individuals of the genotype a'ab'b are mated, progenies with re, orange, brown a White eye colour wil be observed ina ratio of 9:3:3: when the genes are independenily assorting, C When an leterozygous individual ofthe genotype a'b/a bis test crossed, progenies with red and white eye colour will be more in number, D. When an heterozygous individual ofthe genotype ab’ ab is test crossed, progenies wth orangeand brown eye coloar will be more in number, Which of the above statements is TRUE? (@ Aandc () Band © A,BandC (@ A,BandD 121. Mendel crossed tall pea plans with dwaf ones. The FI plants were all tall. When these F1 plants were selfed to produce F2 generation, he got 3; I alltodvwarfrati in the offsprings. What isthe probability that ou of three plans {9 F2 goneration} picked up at randomt two would be dwarf and one would be tall? @) 3M (b) 3/8 © 9164 @ 952 122, Two new plant species, A and B, were described in 1872, Subsequently it was found that the type for species A was never designated and fr species B there was one specimen designated as type bul missing, Asper Intemational Code of Botanical Nomenclature (ICBN), ification should be (@)_neotype for A only (b) neotype for A and lectotype for B (©) neotype for bot Aand B (@) Lectotype for both A and B 123. According to Macathurand Wilson’s equilibrium theory, which ofthe followings te? (a) Larger islands and islands closer to continent are expected to have more species than smaller and isolated islands, © ) Smaller istands and island far from the continent are expected to have more species than larger and isolated istands (c) Sina islands and istands closer to he continent are expected to have more species than far away smaller and isolated islands, (@ Moresp cies are expected on all iskands irrespective of their size and distanas from the continent 124. Proteins in cells can be visualized bythe following methods: press the gone (coding forthe said protein) as @ fusion with the green Auorescence protcin (GP) and directly viswalize under a fluorescence microscope Express the gene (coding for the said protein) a8 fusion with the f -galactosidase gene (lac Z) and directly visualize under a phase contrast bright field inieroscopeC._Afluorescence tagged antibody raised against the sid protein could be used fr visualization ina fluorescence nicroscope. D. Over express the protein and directly visualize it under scanning electron microscope. Which ofthe following methods you would choose to visualize protein in a living cell? (@) Aonly (b) AandConly (©) Asn Bonly @ Donly 125, Affected individuals from the pedigree given below are sufering from albinism, an autosomal recessive disease Identify the confirmed carier individuals inthis pedigree assuming thatthe members coming. fom outside the fami are homozygous for the dominant allele. I 1-0 I 3 rgd eo Oye mo Oo § era de ales! v ded bbba 123 456 (a) U2, 11,015, 111-6, Tl, 13 and 116 (b) 112, 11-3, 1-5, 111-6, U-2, Se-4, U5 and 1-2 () MI-2, 1-3, 1-5, 11-6, 11-2, U4 and IL-5 (@ (LL, U4, 1-7, 1-2, 1-4 and 1-5 126, Assume a new subspecies Ficus callosa subsp, microcarpa has been published by Jacobs. The newenclature ofthe resulting entities would be (a) Feallosa and F calfosa subsp. micracarpa Facobs to be nated subspecies off? callasa (©). F callosa subsp. calfosa Jacobs ana Feallosa subsp. nicrocarpa Jacobs. (&) F callosa subsp. microcarpa Jacobs and ol (@)_Fcallosa subsp, allosa and Fcatfosa subsp. microcarpa lacobs 127. Primary production in aquatic ecosystem is measured using Light and Dark-Bottle techutique. In this method, as an initect measure of photosynthetic production, dissolved oxygen concentration of the pond water enclaged in a BOD botleis measured intial (1) and aftr a fixed duration of incubation in a light bottle (L) and a dark bottle (D). Then ‘ne. grss and net primary productions are estimated is (2) (LD) and (L-), respectively (©) (Land (L-D), respectively (© Cand (-D), respectively (@ (Dyand (-D), respectively 128. Identify the most appropriate cladogram that can be constructed using the data matrix given below, assuring ‘O'sare pleisomorphicand‘I's are apomorpiic charactersAL ACBD ) @ @ 129. Gause’s ‘Competitive exclusion’ principle states that two species with identical niches cannot cocxist indefinitely Which of the followingstatementsis the most appropriate regarding the validity of the principle? (@)_Itdepends on how one defines niche (©) There are in nature many instances of continued coexistence of closely related species (©. Theprincipleis universally me (@_Itdoes not predict the outcome where, bot the species are equally strong competitors 130, Ina lake ecosystem, bottom-up effects (B) refers to cont of a lower trophic level onthe higher trophic levels and top down effects (T) refer to the opposite, In a lake with thres trophic levels - Phytoplankton (P), Zooplankton (Z) and Camivore (©), (a) Pand C are controlled by B, and Z is controlled by T (@) P.Zand C are all controlied by T (©) Pis controlled by B, Z is controlled by T and C is controlled by B (@)_Pis controlled by , Zis controlled by B and C is controlled by T 131. An organism has the following architectural pattern: (multicellular with germ layers (ii) a coclom derived from the mesoxterm (Gi) _ primary bilateral symmetry with secondary radial symmetry (iv) presence of endoskeletal plates Such an organism is most likely to A. have mesoby! as its connective tissue. 1B, undergo torsion, whereby the mouth and anus are properly oriented CC. _bedeveid of a brain but have calcareous spicules. ._ have comb plates ta help in locomotion. Which of the following is tre? (@) Aandc (b) Conly (© Donly (@ Bande 132, Idemtfy the apomogphic characters marked inthe dladogram b ho fammalia ay Testudines d —— Lepicosauria e —— Crocodilia L_ AvesTRAD S(@) a-amsioticegg; b-4-chambered heart; c-anapsidian skull; d-diapsiian skull; e-synapsid skull (©) &-amutiotic egg; b-synapsidan skull; 4 chambered hear; d.anapsidan skull ¢-diapsian skull (©) a-4-chambered heat; b-synapsid skull; e-annioticegg;d-diapsidan sku; e-anapsivan sku. (@_a-amniotic egg; b-synapsidan skull; c-anapsidan skull, d.diapsidan skull; e-4-chambered heart 133, The graph below shows the relationships of per capita population growth rate (6), fecundity (b) and age at first reproduction (c) in an animal species 2 4 6 8 10 12 14 16 o ‘What isthe most important conclusion to be drawn from the grapit? (@) Thelaterthe age of first reprod \n, the lower is the population growth rate achieved, (b) The population growl rate decreases as first reproduction és postponed to a later stage, regardless ofthe fecandity (6) Arany «se higher the fecundity, the higher is the population growth rate achieved (@)_ As te age at first reproduction is postponed further, the betefits of increasing fecundity on the poptation roth rate become progressively negligible 154, What willbe the approximate effective population size in panmictic population of 240 with 200 femal polygamous males? @ 160 ©) 133 © 6 @ 67 155, Ananimat-was fst stainta'ued in a constant environmental condition for several days until a consistent biological shythm (B) was established, The animal was then exposed toan experimental physica! thythnm (2) which modulates the phase and period of B. However, upon withdrawal of E, the B gradually regained its pattern of preexposure condition, From these observations whiclt one or more of the following shold be the most logical inference? A. Elisa Zeitgober B. Eisamaskingagent C. Ecauses utrainment of B and 40 D. Bisa conditioned 1 F The correct answer is (@ Aanac () BandD (©) Boul (®) Donly 136, Showin the graph below are the fitness costs and benefits of four alternatives behavioural phenorypes (2.QR,S) Given suficiem evolutionary time, which phenotype(s) slike to evolve as an adaptation?RENAL 139. 140. Benefits \ Costs / Benefits Low P Q R s Phenotypes (@) QandR (b) Qonly (©) P.QandR (@) Sonly ‘The following geological eras mark the advent of important events in the history ofearth- origin of tes origin of mammals and breakup of the land mass Pangaca: (@ Early Cambrian (©) Late Devonian (©) Late Cretaceous (@) Late Jurassic Identify the correct ma in ofthe events withthe geological era (@) Origin of terrestrial plants -(¢); Origin of mammals (d); Break-up of Pangaea -(a) (©) Origin ofterresal plants -(b) Origin of mammals (d); Break up of Pangaea ~c) (© Origin of terrestrial planis- (4); Origin of mammals (c); Break up of Pangaea -(b) (@)_ Origin of terrestrial plants -b), Origin of mammals (¢) Break up of Pangaea (4) Industral produts in which bacteria are employed for production are show i the following table: 1. List of products, HL. Microorganims A. 23-Butane diol i) Leuconostoc B, Dextran ii) Brevibacterium C. Glatamicacia iti) Bacillus pohmyxa D, Cobalamine iv) Propionibacterium The correct combinations are (@) Aili; Bi: C-ii, Div (0) A-i:B-iis Citi, D-iv (© A-iii: B-ié, C-iv,D-1 (@) A-ii;B-ii, C-iv,D-i Insertion lambda vectors are used (0 create ¢DNA libraries, In some insertion vectors, the site of insertion is within the l gene. The, recombinants which are cl can then be screened by plating on Ecol hf, The gene hil encodes a Protease that controls Iticlysogeny decision through which mechanisin? (a) HM protease degra () Hil protease degra 1, thereby promoting lytic pathway III and so clll cannot interact with Cll, lysogenic pathnay is thus preferred (©) Hf protease degrades cl, and therefore cl synthesis cannot be established, thus Iytic pathway is proferrad (@)_ Hil protease degrades INT, the protein involved in phage integeation and the Iytc pathway is initiate. A transposon carrying a promoterless galactosidase lac Z) was used (crate asertional mutation inthe region ed into the141 ‘A. The virulence ofthe bacteria was completely ost and the Jac Z was induced by acetosyringone. 'B, The virulence of the bacteria was reduoed andthe lac Z-was induced by acetosyringone. The virulence ofthe bacteria was completely last and Jac Z was not induced by aoetosyringone Which ofthe following assumptions are valid about these mutants? (a) Sn group A, the insertion could be in vir B, C. D or G; in group B the insertion could be in virC or E; and in group C the insertion could be in vira or G (©). Ingroup A, the insertion could bein viet, B, Cor D; in group B, the insertion cauld be in either virC or D; and in group C the insertion could bein vir (© In group A, the insestion could be in vied; in group B, the insertion could be in wir B; and in group C, the insertion could be in vir C. (@)_ In group A, the insertion could be in virG; in group B, the insertion could be in virB, Dandi; in grop C, ie insertion could be in vird. A.30-residue peptide was treated with uypsin and the tryptic peptides were separated by HPLC. Four peaks A, B, C ‘and D were obtained. Peptides corresponding to A, B, C and D were reduced and alkylated selectively at cysteine residues, The sequences obtained from A, B, Cand D after reduction and alkylation were: A, AEK; B, C{S-akyhJEPGYR and WC{Salky4) SPPK; C,C(Salkyl) EHFR and C{S-alky))GGK; D, C(Salkyl) EAFC(S-alkyDL. The sequence of the 230-tesidue peptide is AEKCEPGYRCEHFRWCSPPKCGGKCEAFCL @ t—_J U4 AEK CEPGY RCEHFRWCSPPKCGGKCEAFCL, O) Ele ee | AEKCEPGYRCEHFRWCSPPK sea © ABKCEPGYRCEHERWCSPPKCGGKCEAFCL @ i) aaa To dotcct mutation G AG—>G LG allele specific hybridization method is used. Four members of an affected family are investigated. DNA isolated from blood samples of parents and two offsprings are spotted on a mesbrane after appropriate processing and probed with eithet TGACTCCTGAGGAGAAGTC (first probe) or TGACTC (second probe) afte labelling. While probed with first oligonucleotide, signals are: obtained for the positions where DNA are spotted from parents and offspring I, When probed with second oligonucleotide, signals ase obtained at position where DNA from the parents and offspring I are spoted. Results are shown below ier | Mother | Offspring I | Offspring II - ee First probe : - 7 Second probe | + + - (On the basis ofthe result, which ofthe following statements is correct? (a) Parentsare affected () Ollspring is affected (©) OllSpring I is cartier (@) Ottspring Tis affected Molecular beacons (MIB) ane Taqanan (TQ) are used as probes in Real time PCR experiments. Both these probes are teased onthe principle of FRET and eimploy's Nuoropior (and a quencher (Q), However the mechanism’ by which they fanetion are different as illustrated below:a4 Target At what stage ofthe PCR we would be able to detect fluorescence? (@) Annealing step forboth (©) Extension step forboth (© Annealing for Aand Extension for B (@)_ Extension for Aand Annealing for B Anexperiment was designed to find out the relation between DNA uptake and transformation efficiency. *P labelled genomic DNA from Bacillus subtilis (A) and cold genomic DNA from Clostridium jejeuni (B) mixed in various proportions was usd to transform Bacilias subtilis, The results obtained are tabulated below: Iset. No] Concentration of DNA | Uptake of *P | Transforming used (ig/ml) labeled DNA | efficiency A B (6) (CFU) : 1 1 90 30 2 I 10 82 10 3 1 100 15 5 4 1 1000 5 1 ‘The following interpretations (A to D) could be made ‘A. The transformation is dependent on recombination between homologous sequences. B. Cells dic not distinguish between homologous or heterologous sequences for uptake of DNA, C._DNA uplake is basod on specific receptors D. DNA degradation dictates transformation efficiency Which of the following interpretations are correct? (@) AandB () Aandc © Cand (@) AandD When a wrist blastoma from a recently cut Axolot! foretimi is placed ona host hindlimb cut atthe mid thigh level, i will generate onlya wrist. The host (whose onn hind limib was temoved) will fill the gap and regenerate the limb upto he wrist, However i the donor blastema istreated with retinoic acid on grafting, the wrist blastema will regenerate a complete limi and wil not allow the host to fill the gap. This happens because retinoic acid tially aeross the blastema (@) helps in proximalization ofthe blastema and activates the Hox genes dif (0) helps inthe distalzation of theblastema and activates the Hox genes differentially across the blastema, (©) helps block the rooptors of GF essential for fimb development (a) helps vigorous proliferation ofthe cells atthe cut surface,LO 2.) 30 4@ 5.) 6@ 7.(b) 80) 2%) 1@ 11.) R© 1. @) 4@ Bb@ 6@ 1.0) 8 @) 19. @) 20.0) 2. ©) 2@ Bo wo 30 %@) 27. (@ BO vO 30. 31 @ 32. @) 33.0) 4.) 35. (a) 36. (©) 37. @) 3@ 9 Wa ALO) 2) 8.0 4.0) 45.) 6.0) 4. a) 49.@) 50. @) 51. @) 2.0) 53.) 4) 5.0) HO 57.) 38.) 39.0 0@ 6.0 20 68m 6o 0) 66.) 67. @) Bo 8. 0.) 7.0) 2.0) @) 7h @) 5. %@) 72.) 8) 79.0) 80.) 8L@ 82.0) 2. 8.@ 83.) %@ 81. @ OO 9. 9.) 91. @) 2.0) 93. @) 0) 95%) @ 8% @ 99.) 100.) TOL @ 102) 103. @)_— 1) © 6. 07.) 108.) 1. HK] = ML. 30 IG 15@ 6@ 1170 18@ Wd 20@ DL © 122) 12) — 2H) SLO 126@)-— 2.128.) DM) 10.) BL @ BA) — 33.) DS @) 136.) b7.0) Ba) 2% HO MLO WO MO M@ U5. @)CSIR NET LIFE SCIENCES (DEC-2011) PART-A 1. What is the angle @ in the quadrant ofa circle shown below? SN iy \ @ 138° ©) 90° © 6 (@) May have any value between 90° and 120° 2. In AABC, angle Ais larger than angle C and smaller than angle B by the same amount. [angle B is 67, angle Cis (@) 67 ) 33° {60° @ 57° 3. See the following mathematical manipulations. (@) Letr=5 i) Then x*-25=x-5 i) (OH =KS (iv) x+5=1 (Cancelling (x-5) from both sides) (¥) 101 [putting 5) Which of the above is wrong statement? @ Mow (©) Gi) to Gi © GidtoW) @ row 4, Inner planets ofthe solar system are rocky, where as outer planes are gaseous, One ofthe reason fox (@) Solar heat drove away the gases to the outer region ofthe solar system, (©) Gravitational pull ofthe sun pulled all rocky material to the inner salar system. (©) Outer planets are larger than the inner planets, (@) Comets delivered the gaseous materials to the outer planets 5. The number of craters abserved due to meteoritic impacts during the early stages of formation, is less on the Barth than that of Moon because, (@)_ Foration of craters on the Earth was difficult due to the presence of hard rocks (0) Impacting bodies onthe Earth were smaller in size (©. Craters on the Earth are now covered by acean water (@)_ Earlier craters were not preserved due to continuous modification of Earth's surface by geological processes. 6. During a total solar eclipse occurring at noon, it becomes dark enough for few ainates for slats to become visible. ‘The stars that are seen are those which will be seen from same location, (a) Onthe following night only (b)_ On dee night one month later (©) Onthe night three month later. (@ Onthe night six months later 7. The variation of solubilities of two compounds X and Y in water with temperature is depicted below: Which of the following statewentsis tre?10. Compound X Compound Y Solubility Jar units} Us © 10 2030 40 50 60 70 80 90 100 “Temperature [°C] (a) Solubility of ¥ is less than that of X (0) Solubility of X varies with temperature (©) Solubitities of X and Y are the same at 75°C, (@)_Solublities of X and Y are independent of temperature Living beings get energy from food through the process of aerobic respiration, One of the reactants is (@) Carbon dioxide (0) Water vapour (6) Oxygen (@ Phosphoris Restriction endonuclease cleaves DNA molecule at specific ‘recognition sites’. One such enzyme has four recognition sites ona circular DNA molecule. Aftes complete digestion, how many fragments would be produced upon reaction ‘with this enzyme @) 4 ms @3 @ 6 Which ofthe following statements about the concentration of CO, in the Earth's atmosphere is true? (@)_Yovas the highest in the very early atmosphere of the Earth has steadily decreased since the formation ofthe Earth's atunosphere (©) Ithas steadily increased since the formation of the Earth's atmosphere, (tslevel today is the highest inthe Barth’ history. ‘Magnesium powder, placed in an air-tight glass container 10 bar, is burnt by focusing sunlight. Par of the magnesium burns off, and some is left behind. The pressure oftheir in the container after it has returned to roam temperature is approximately. @ bar (0) 0.2bar (© 2bar (@) 08bar ‘When a magnet is made to fall free in air, it falls with an acceleration of 9.8 mis?, But whem it is made to fall through, along aluminium cylinder, its acceleration decreases, bose (@ Apart ofthe gravitational potential energy is losin heating the magnet. (©) Apart ofthe gravitational potential energy is ost in heating the cylinder. (0 Thesai northern hemisphere, (@)_ Theeylinder shields the gravitational force Asso cube of side £ floats on water 20% ofits volume under water. Cubes identical to its ae piled one-by-one on it Assume that cubes do not slip or topple andthe coutact between their surface is perfect. How many cubes are required to submerge one cube completely? @4 5 o 6 @) Infinite An overweight person runs 4 kn everyday as an exercise, Afler losing 20% of his body weight, ifhe has 10 sate distance in the same time, the energy expenditure would be (@) 20% more (©) The sameas earlier (@) 40% less periment was done in the magneCSIR NET LIFE 15, On exposureto desiccation, which of the following bacteria are least likely to experience rapid water loss? (@)_ Isolated rots (©) Rodsinchain (©. Cocci in chain (A) Covci in clusters 16. A.cupboard is filled witha large numbet of balls of 6 different colours. You already have one ball of cach colour, If you are blind-folded, how many balls do you need to draw to be sure of having 3 colour-matched pairs of balls? @ 3 wa © 5 @6 17. The conductance ofa potassium chloride solution is measured using the arrangement depicted below. The specific conductivity of thesakution in Sm’, whem there is no deflection inthe galvanometer, is Conductivity cell with cell constant 10 22 @ 10 ) 05 © 20 @ 13 18. What is the half-tite ofthe radio isotope whose activity profile is shown below? 100000 80000 0000 + & coo oe 123456789 00 Time (ays) @) I day (0) 3 days © 2 days (a) 4 days 49, Abell is rung before giv likely to happen? (@)_ ‘The dog learns to ignore the bel. (6) The dog salivates on heating the bell (©) The dog ignores food and runs towards the bell wg fod toa dog, After doing this continuously for 10 days, which ofthe following is most (© Thedog will not eat food without hearing the bell 20, For an elastic mera, strain is proportional to stress, A. constant stress is applied at tne, Which of the following plots characterizes the strain in “ir Lea 2, 24, ime Time —> PART-B (Onthe molar scale which ofthe following interaction in a nonpolar environment provides the highest contribution to thebio-molecule? (@)_ vander Waals interaction (b) Hydrogen bonding (© Satbridge (@ Hydrophobic interaction Michaelis and Menten derived their equation using which ofthe following assumption? (@)_ Rate limiting step in the reaction is the breakdown of ES complex to product and free enzyme. ()_ Rate limiting step inthe reaction isthe formation of ES complex. (©) Concentration ofthe substrate can be ignored (@)_ Non-enzymatic degradation ofthe substrate isthe major step, Invshich form of DNA, the numberof base pairs per helical turn is 10.5? @a oB @x @z Incontrast with plaat cells the most distinetive feature of cel division in animal cells is (8) Control of cell cycle transition by protein kinase (b) Enzyme responsible for DNA replication, (©). Ubiquitin-dependent pathway for protein degradation. (@ Pattern of chromosome movement Most common type of phospholipid in the cell membrane of nerve cells is (@)_ Plosphatidyichotine (0) Phosphatidylinositot (©). Phoshphatidylserine (@ Sphingomytein Reverse transcriptase has both ribonuclease and polymerase activites. Ribonuclease activity is required for (@) the synthesis of new RNA strand (©) the degradation RNA strand (©) thespnthesis of new DNA strand (@) the degradation of DNA strand The membrane lipid molecules assenible spontaneously into bilayers when placed in water and fonna closed spherical siructureknownas @) Tysosome () Peroxisome (©) Liposome (@) Endosome In gene regulation, Open Reading frame (ORF) implies (@)_Intervening nucleotide sequence in between two genes. (b) A series of triplet codons not interrupted by a stop codon. (©) Aseries of triplet codons that begins with a start codon and ends with a stop codon. (@)_ Theexonic sequence of a gene that corresponds to 5* UTR ofthe mRNA and thus does not code forthe protein, ‘Amino acid selenocysteine (Sec) is incorporated into polypeptide chain during translation by @) Charging of Ss (b) Charging of serine into RNA“ Tollowed by modification of serine into selenocysteine and then incorporation through serine codon, (©) Charging of Soc into (RNA and then incorporation through selenocysteine codon, into [RNA followed by incor ration through serine codon. (4) Charging of serine into 1RNA“* followed by modification of serine into selon through a specially placed stop codon ysteine an hen incorporation 6030. aL 32 ou 37 41 of -ananitin inbibits (@) Only RNA polymerase T (©) Only RNA polymerase II While replicating DNA, the rate of misincorporation by DNA polymerases | in 10*nucleotides. actual error rae in the replicated DN (b) Only RNA polymerase IT (@)_AILRNA polymerases However, the is 1 in 10° nucleotides incorporated, This is achieved mainly due to (@)_ Spontaneous excision of misinoorporated nucleotides. (b) 3/5" proof reading activity of DNA polymerase, (©) Termination of DNA polymerase at misincorporated sites. (@) 5°93" proofreading activi Toxic shock is caused by {@)_ Toxins produced by some bacteria (0) Excessive stimulation ofa large proportion of T cells by bacterial superantigen. (©) Abnormal cytokine production by B cells, (@)_ Excessive production of immunoglobulins. Bihylene binding toits receptor does NOT lead to (2) Dimerization of te receptor. (©) Activation of CTR Raf kinase Graft rejection does not involve @). Erythrocyte (©) Macrophages ‘The blastopore region of amphibian embryo that secretes BMP inhibitors and dorsalizes the surrounding ti known as (@) Brachet’scleft (©) Spemann’s organizer During developinent of embryos in plants, PIN prot (a) Establishment ofauxin gradients (©) Induction of programmed cell death (©) Phosphorylation af the receptor. (@) Endocytosis ftlylene-reeeptor complex. (©) Teel (@) Polymorphonuclearfeukoostes: ue is (0) Nieuwkoop center (@) Hensen’s node ¢ involved in (b)_ Regulation of gene expression (4) Induction of cel division Which ofthe following maternal effect gene products regulate production of anterior structures in Drosophila embryo? (a) Bicoid and Nanos (© Bicoid and Caudal (©) Bicoid and Hunchback (@ Nanosand Caudal Which ofthe floral whorls is affected in agamous (ag) mutants (@) Sepals and petals (@) Stamens and capels () Petalsand stamens (2) Sepals and carpets Which of the following sof cell organelles are involved in the biosynthesis ofjasmonic acid through octadecanoid signalling pattwcay? (2) Choroplastand peroxisomes (©) Mitochondria and peroxisomes (0) Chloroplast and mitochondria (€) Golgi bodies and itochowuria Which of the followingis NOT a prosthetic group of nitrate reductase. @ FAD (©) Mo CChioroptas! distbution ina photasynthesizing cell is governed by bluc ight sensing phototropin 2 (Pt (b) Heme @ Prerin thecells are irradiated wits high intensity blue light the chloroplasts (a) move to the side walls (©) _avesparsels distributed () aggregate in the middle of the cell @ aggregatein small clus 6 = _eA 42. Which of the follow cts as a branch point forthe bioosynthesis of sesquiterpene and triterpenes? (a) Famesyl pyropltosphate () Geranyl pyrophosphate (6) Isopentyl pyrophosphate (@ Hydroxymethylglularyl CoA 45, Which ofthe following waves is likely to be absent in a normal frog ECG? @ P 0) Q @T @R 44. The atmosphere ina sealed space craft contains (@) Pureosygen, (b) Amix of oxygen and nitrogen. (©) Mix of oxygen and carbon dioxide. (@_Pressurised atmospheric air available normally on ear, 45, Ina normal human eye, for sharp image formation onthe retina, maximum dioptric pawer is provided by the @) Retina (0) Cornea (6) Anterior surface ofthe fens (@) Posterior surface of the lens 46, In this low diagram namte the chemicals A, B, CandD in proper sequence, Decreased aneralp 4 (A) From kidney + @) Substate for t © Converting enzyme from hung P) NN ao ae Vasoconstietion salt and wate NT Inowased enteral prossore (@) Renin, Angiotensin II, Angiotensin I, Angiotensinogen. (b) Angiotensin 1, Angiotensinogen, Angiotensin I Renin, (©) Renin, Angiotensin I, Angictensin Il, Angiotensinogen. (@)_ Renin, Angiotensinogen, Angiotensin l, Angiotensin Sl 47. Aplantof te genotype AaBb is selfed, The two genes arc linked and are 50 map unis apart. What proportion ofthe progeny will have the genotype @) 12 ) W4 © i (@) V6 sininopucine pairs wi thynvine, and can occasionally pair with cytosine The 48 The base analog induced by 2-aminopurine is @) Transversion (©) Transition (© Deletion (@) Nonsense, 49. What kind of aneuploid gametes will be generated if meiotic non-disjunction occurs at first division? (1 represents the haploid number of chromasames), (@) Only n+ tandn ©) Onlyn-1andn (©) Bothn+ Landn~ 1 (4) Biter n+ Vor 1STATA ASO ON TD NOPIINN 50, _A single-strand nick in the parental DNA helix just ahead of a replication fork causes the replication fork to break. Recovery from thiscalamity requires, (@) DNAligase (0) DNA primase (© Site-speciticrecombination {@ Homologous recombination SI. Intransverse section ofa young stem, if vallecular canals and carinal cavals are present, then the plant belongs to @_Lycopodiales (0) Isoetales (©) Sclaginellales (@ Bquisctales 52, Horse shoe crab belong to the group (@)_ Onychophora (©) Chelicerata (©) Uniramia (@) Crustacea 53, Which ofthe following groups of species are typical of grassland habitats in India, (a) Black buck, wolf, great Indian bustard, lesser florican, (©) Spotted deer, dliole, peacock, finch lark (©) Sambar, tiger, paradise fl catcher (@)_ Otter, Cormorant, darter, pelican 54, Batrachochytrium dendrobatidis, a fungus, has been implicated in the decline of population of| (a) Fish (b) Frogs (©) Pelicans (@) Bas 55. ‘The Hutchinsonian concept of ecological niche is based on (a) Microhabitat ooxepiea. (©) Multidimensional hypervolume, (©) Role played in the ecosystem. (@)_ A combination of role played and microhabitat occupied 56. Aquatic primary production was measured using Light-and-Dark Bottle technique Ifthe initad axygen concentration was [and the final oxygen concentration in the light bottle i Zand that in the dark bottle D, the gross proclivity (in terms of oxygen released) is given as @ LD &) ED © - @ LD 57, Wellandsare conserved internationally through an effort called as (a) Basel Convention (b) Rio Convention (©) Moatreal Convention (@) Ramsar Convention 58. The first living beingson earth were antaerobic because (a) There was no oxygen in air (b) Oxygen damages proteins (©) Oxygen imerferes with the action of ribozymes (a) They evolved in deep sea 59. Which ofthe following processes interferes in sequence-based phylogeny”? (a) Horizontal gene transter (b) Adaptive mutations (©) DNA repaie (€)_ Reverse transcription 1¢ peacoch’s tail isan example of (a) Natural selection (b) Diversifi (©) Sexwal sclection (4). Group selection 1 selectin G1. A specialist species has (a) Wider niche and high: of niche wilization (b) Narrower niche and high effi62 6 a, 61 6. o (© Wider niche and low efficiency of niche utilization. (@_ Narrower niche and low efficiency of niche wilization, ‘Tokeep tem ina totipotent state, embryonic stem cells need to be maintained in a medium supplemented with (@)_ Growth hormone (b) Leukemia inhibiting factor © Nestin (@) Insulin Which ofthe following features is NOT shown by glyphosate, a broad spectrure herbicide? (Little residual soil activi (0) Ready translocation in phloem. (©) Inhibition ofa chloroplast enzyme catalyzing te synthesis of aromatic amino acids (@ Inhibition of early steps in the biosynthesis of branched chain antino acids. The rattans and canes that we use in furniture belong to (@)_Bamboos &) Palms (©) Arborescent lilies (@) Legumes ‘Which ofthe fotlowing is NOT a physiological characteristic of early successional plants? (@)_ High respiration rate. (6) Inhibition by far-red light (© High transpiration rate (@ Low photosynthetic rate The presence of Salmonelta in tap water is indicative of contamination with (@)_ Industral efMuents (©) Human excreta (© Agreutture waste (@) Kitchen waste Indirect imimunoffuorescence involves fluorescently labeled @) Imnmnogiobulin-specific antibodies (©) Antigen-specific antibodies (©) Hapten-specific antibodies (a) Carrier-specific antibodies A sample counted for one minute shorts acount rte of 752 cpm, For how many minutes should itbe courte have \ % probable error? OB 5 @2 @ 7 Measrement and napping with spatial resolution he membrane potential ofa cel, which is too smal formiroelctrode impalement, s done using (@) Radioisotope (b) Vollage-sensitive dye (© pH sensitive chemical @ Vial dyes One ofthe methods for finding comms regulatory motifs present ina set of co-regulated genesis (@) Prosite (b) MEME (©) Mat Inspector (@ PSSM PART-C Equilibrium constant (K} of non covalent interaction between two non-bonded atoms of two diflerent groups was measured at 27°C. Th vas observed ties K= 100 MF. The strength of this non covalent interaction in terms of Gibbs free energy change is: (a) 2746 kcal/mole (b) -2746 kcal/mole {c) 247 kcal/mole (d) -247 kealmok AB Ivan dr Waals nternetin is dseribed ty the following elation, AG, = 5“ + ue Where AG,,, isthe re energy ofthe van der Waals interaction, Aand Barc couslans, ris the distance between two nos bonded atoms and 2 and 9, and q,are partial charges onthe dipotes | and 2. In this relation, the parameter A deseribes @ BI ©}. Dipole-dipoteatraetion {@) Dipole-dipote repulsion on shel attraction (b) Electron shell repulsionB. "4 75, Rg ‘The pH of blood ofa healthy person is taintained at 7.40+ 0,05, Assuming that this pH is maintained entirely by the bicarbonate buffer (pKa, and pKa,of carbonic acid are 6.1 and 10,3, respectively), the molar ratio of [bicarbonate [carbonic aci] in the blood is (@) 0.05 (Om © 10 @ 2% ‘The hydrolysis of pyrophoshate to orthophosphate is important for several biosynthetic reactions. In B. coli, the molecutar mass of the enzyme pyrophosphatase is 120 KD and it consists of six identical subunits. The enzyme activity is defined as the amount of enzyme that hydrolyzes 1p mol of pyrophosphate in 15 minutes at 37°Cunder standard assay condition, The purified enzyme has a, of 2800 units per milligram of the enzyme. How ntany roles ofthe substrate are hydrolysed per second per milligram ofthe enayive wien the subs" such greater than , @ 005 junol ©) 62 pmol © 31 pol @ Lpmol ) Temperature °C Denaturation profiles of DNAare shown below. c % DNA Denatured ‘The differences inthe profiles arse because (@) The DNA issingle stranded but of different sizes, (b) A+ Teontent of A> B> C and the DNA are from complex genomes. (©) G+Coontent of C>B> A in DNA of comparable sizes isolated from simple genomes. (®) G+C conten is identical but A+ T content in A > B > C in DNA of comparable sizes isolated from simple genomes, Biosynthesis of tyrosine is detailed below Shikimic acid 5 shikimic acid phosphate 2, C —» corismic acid —> prephenic acid NAD: NADU Dy tyrosine. Identify A, B, Cand D. co, (a) ATP, phosphiocnolpyruvic acid, 3-enolpyruyl shikimic acid-5-phosphate, p-hydroxyp- henylpyruvic acid (©) GTP pyridoxal phosphate, 3-enolpyravylshikimic acié-Sphosphate, phenylpynuvic acid. (©) NADP. 3-phospliolydroxypyruvic acid, 3-enolpynivic shikimic acid-5-phasphate, p-phydroxy-phenylpyruvic acid. (4) ATP, 3-pliosphohydroxypyruvie acid, 3-enolpyruvyl shikinic acd-5-phosphat ytidexyp-hosphate A nerve impulse oraction potential is generated from transient changes in the permeability of the axon membrane to Na’ and K”iots. The depolarization of the membrane beyond the threshold level leads (o Na’ flowing into the cell and ‘change in menibrane potential os pasitive value. The K chancel then opens allowing Kt flow outwards ultimately ial the resting value. We Na’ and K’channels operate in opposite directions becau: restoring meubrane p (a) there isan clectrochemical gradient growth generated by proton transport, (b) there isa difference in Na" and K* concentrations on either side ofthe membrane. clare, wher (©) Navisavollage: is Kis ligand-gated. (@)_Natisdependent on ATP whereas K*is not.COSTE WADIA ONL OSE IL ORPIDEE 78. Theerythroeyte membrane cytoskeleton consists ofa meshwork of piotcins underlying the membrane. The principal component spectrin has o. , subunits which assemble to forms tetramers. The cytoskeleton is anchored to the membrane through linkages with the transmembrane proteins band 3 and glycophorin C, The cytosolic domain of band 3 also serves as the birding site of glycolytic enzymes such as glyceraldehyde 3-phosphate dehydrogenase, Analysis ofthe blood sample ofa patient with haemolytic anemia shows spherical red blood cells. The patient caries (2) A mutationin glycophorin C. (©) Amutant spectrin with increased tetramerization propensity. (©) Mutant B spectrin defective in cB. dimerization ability (@ Mutant glyceraldehyde 3-phosphate dehydrogenase. 79. In human, protein coding genes are mainly organized as “exons” and “introns”, There are ix’ >:onie regis it ‘ranscribe into various types of non-coding RNA (not translating into protein). Some introns anay harbor also ‘transcription units, which are (a) always other protein coding genes. (©) proteincoding gene and RNA coding genes (0) always RNA coding genes (@)_ pseudogenes 80, Maturation-promoting factor (MPF) controls th initiation of mitosis in eukaryotic cells, MPF kinase activity requires cyclin B, Cyclin Bis required for chromosome condensation and breakdown of the muctear envelope into vesicles. Cyclin B degradation is followed by chromosome decondensation, nuclear envelope reformation and ext from mitosis, This requires ubiquitination of a cyclin destruction box motif in cyclin B. RNase-treated Xenopus egg extracts and spermechromatin were, mixed, MPF activity increased withchromosome condensation and nuclear envelopebreakdown However, this was not followed by chromosome decondensation and muclear envelope reformation because (@) RNase contamination persisted in the system. (6) Cyclin B was missing from the system. (©) Ubiquitin liga (@) Cyclin B lacking the eyctin destruction bos had been over expressed. hhad been overexpressed. $51. Many cancers carry mutant p53 genes, while some cancers have normal p53 genes. p53 activates p21 (Wafl) which inhibits GVS-Caks, and phosphors tation of the retinoblastoma protein (Rb). Cancers with normal p53 genes could (a) Express non-phosphoryatable form of Rb (0) Express high levels of ps deubiquitinases, xk, (©) Express inactive forms of GUS (@ Express inactive forms of GUS cyclins 82, A fixed smear ofa bacteria culture is subjected to the following solutions in the order listed below and appeared red, (@) Carbolfuchsin (heated) (0) Acid-alcohol (©) Methylene blue Bacteria stained by this method can be identified as (@)_Nonaciel fast £° cot (0) Acid fast Mycobacterium sp. (©) Gram-positive £ coli (@) Gram-negative Adycobacterium sp. 83. In.an in vivo experiment using raio-Iabeled nucleotides, a researcher is trying to analyze the possible producis or DNA replication by resolving the products using urea-polyacrylamie gel electrophoresis. In one experimental se up RNase H was added (Set 1). while in another set no RNase H was added (Set 2), The possible observations of this esperiment could be A Theteis no ference in the mobility of labelled DNA fiagments between the Set | and Set 2 B__ Thereis distinct difference inthe mobility ofthe newly synthesized labeled DNA fragments between Set and Sei2 mobility ofthe new!y synth DNA fragments in case of Set 1 is faster as compared to the Set 2 D. The mobility oft is in case of Set 1 is sloweras compared tothe Set 284, 85 86, Which ofthe following combinations represent correct observations? (@) AandB (b) Bandc (© AmdD (@ BandD Synthesis of normal hemoglobin requires coordinated synthesis ofa a. globin and globin, Thalassemias are genetic defects perturbed in this coordinated synthesis. Patents suffering from deficiency of globin chains (P- thalassemia) could atsobe due to mutations affecting the biosynthesis of globin mRNA. ‘The following statements describe the genesis of non-functional f globin leading to -thalassemui. A. Motation in the promoter region of the Bb globin gene B. Motation in the spice junction ofthe globin gene, C. Mutation inthe inion 1 ofthe globin gene. D. Mutations towards the 3" end ofthe P.glabin gene that codes for polyadenylation site Which ofthe following combinations is correct? (@ A,BandD (©) ABandC © BCandD (@) C,Danda re-mRNAsare rapidly bond by snRNPs which carry out dual steps of splicing that removes the intron and joins the upstream and downstream exons. ‘The following statements describe some facts related vo this event ‘A. Alimos all ints begin with GU and end with AG sequences and hence all the G spliced out of RNA B, U2RNA recognizes important sequertces at the 3! acceptor end ofthe intron, or AG sequences are C_ The splicensome uses ATP to carry out accurate removal of introm, D. Anunusual linkage with 2 OH group of guanosine within intron form ‘Lariat’ structure Which ofthe following combinations is correct? @) AandB () Band (©) Cano (@ Danda For continuation of protein syathesisin bacteria, ribosomes need t be released from the rRNA as well as to dissociate into subunits. These processes do not occur spontaneously. They need the following possible conditions: A. RRF and EF-G aid in this process B._Anintrinsc activity of ribosomes and all uncharged tRNA are required ©, IF-1 promotes dissociation of ribosomes. D,_IF-3 and UF! promote dissociation of ribosome. Which ofthe following sets is correct?” (@) AandD (b) AandB © AandC (@) Bando Lusulin and oiler growth factors stimulate a pathway involving a protein kinase wTOR, which in its turn augments, protein synthesis. mTOR essentially modifies protein(s) which in their unmodified form act as inhibitors of protein synthesis, The following proteins are possible candidates A. BF] B. clF-4E-BPI ©. olFAE D. PHAS-I Which of the following setsis correct? (@) AandB (0) Band (© Aandc (@) Bandc88, 89, 90, 91 2 Bacteriophage 1. has two modes in its life cycle, lyticand lysogenic. In the lysogenic mode, the expression of all the phage genes are repressed while the expression of repressor gene switches between on and off-pesiton depending on the concentration of repressor. The following tatementsare made A. Repressor may act both as.a positive regulator and negative regulator B. Expression of repressor gene, cis independent of the expression of cll and cITl genes. C. Mutation ofcf gene will cause it to it to form clear plaques on both wild type E. coli and & coli (A) D, Mutation at operators, 0, and O, will allow the phage to aet.as virulent phage, ‘The correct statements are @ AandB @) Band @ CandD @ Danda Survival of intracellular pathogens depends on the levels of pro-inflammatory and antiinflammatory cytokines in macrophages. In an experimental condition, Mycobacteria infected macrophages were treated with IL-6 orIL-12 for 4 hours at 37° C. untreated cells were used as control, Cells were lysed and numberof bacteria in each experimental set as counted by measuring colony forming unit (CFU). Which ofthe following observations is tue? (@)TL-12 teated cells contain more intracellular bacteria than control (6) I-12 treated cells contain less intracellular bacteria than control (©) IL-6 treated cells contain more intracellular bacteria than control (@) TL-ireated cells contain les intracellular bacteria than contrat The bacterial Nagellar motor is 2 multiprotein complex. Rotation of the flagellum requires movemtent of protons across the membrane facilitated by a multi-protein complex. The flagellar motor proteins combine tocreatea proton channel that drives mechanical rotation. Ina screen for mutants, some non-motile ones were selected. These could have @) Mutations in tubulin and actin proteins (©) Mutations in kinesin proteins (© Mutated 1f-ATPase (4) Mutations in the charged residues lining the ridge ofthe F1iG subunit bacterial response regulator turns on gene Ain is phosphorylated form. The amount ofA” shows asharp and sleep rise at a threshold concentration ofthe signal sensed by the cognate sensor. This is mos likely due to (@)_ Increased phosphatase activity of the sensor the threshota concentration. (b) Decreased phosphorylation of the response regulator by the sensor, (©) Cooperatvity in binding of the response regulator tothe target gene. (8) A negative feedback in gene A expression. Intracellular transport and cytoskeletal organization ofa cell is regulated by nucleotide exchange of different stall molecular weight GTPases of Ras super family: Overexpression of which of the following GTPase modulates the actin-cytoskeleton of HeLa cells? (a) Ran in GDP bound form (B} RaninGTP bound fore ) Rho in GTP bound form (@ Rho in GDP bound form You ate given a gioup of four mize, Each mouse is immunized with keyhole limpet hemocyanin or azobenzene arsonale or lipopolysaccharide or dextran. Four weeks later, sera were collected from these mice and antigen-specific 5[ aud 1gG2a ELISA were performed, Only one ofthe mice showed positive response. Hh as (a) Keyhole limpet hemocyanin-primed mouse (b) Avobenvs soa primed mouse, (©) Lipopolysrectaride-primed mouse (@)Destran-primted mous ‘Tumor cells were isolated from & breast cancer patent, These cells were injected into nude mie and they were divided ito four groups: Group 1 received EGF secepiorconjugated with methotrexate; Group? received wansferring receptor-conjugined with methotrexate, Group 3 recxived santas receptar-conjtigated with methotrexate, Group 4 recoived same amount ofthe free drug. In which ofthe following cases tumorigenic index woul be minima? 6 == —— ————(@) Freedug (b) EGF receptorconjugated drug (©) Transferrin receptor conjugated drug (@ Mannose receptor-conjugated drug 93. When the prospective neurons from an early gastrula of a frog were transplanted into the prospective epidermis region, the donor cells differentiated into epidermis, However, when a sinilar experiment was done with the tae «gastrula of frog, the prospective neurons developed into ncurons only, Thes¢ observations Could possibly be explained | by the following phenomena, | A. Thecatly gastrula show conditional developrnent whereas the late gastula shows autonomous development. B. Theearly gastrula show autonomous developtent whereas the late gastrua shows conditional development, C._ The prospective neurons from the early gastrula are only specified whereas those from the late gastrula are determined D. Theprospostiveneurons from he cay gastrula are determined whereas those from the late gastrula ae specified, Which ofthe conclusions drawn above are correct? @ AaB @) AandC {© Aad (@ Banc 96, API (APETLA 1) sone ofthe floral meristem identifying genes. In wildtype Arabidopsis thaliana plants transformed with API:GUS, P glucuronidase (GUS) activity is seen in floral meristem, only after the commitmet to flowering jon of APL::GUS in the EMBRYONIC FLOWER (em) mutant background results in GUS activity that API is Ectopic expr {txoughout the shoots in four day old seedlings. These observations sug (@ not involved in flowering (b) involved in repression of lowering, (©) involved in promoting flowering, (@) stimulation of flowering inthe emfbackground. In case of morphallactic regeneration: (2) Theres repatteming ofthe existing tissues with litte new growth, (b)_ Theres repatteming of the existing tissues after the stern cell division has taken place. {c)Tharciscell division of the differentiated cells which maintain tei differentiated state to finally form a complete organism. (@) Theres dditferentiation ofthe cells at the cut surface which become undiffesentiated. These undifferentiated cells then divide to redifferentiate to form the complete structure. 98, The decision to become either a trophoblast or inner cell mass blastomere is one ofthe first decisions taken by any mammalian embryo, Below isa diagrammatic representation ofthe different cells formed during development from the morula with the help of different molecules, Identify the molecules 1-4, sequentially ‘®) morula Inner cell Epiblast | e Wass a embryonic A ‘stem cells. 9 0 | T 7 trophoblast Iypoblast, o—— | (a) ody 2, Oot 4, Nanog, Stat 3 (b) cx 2, Nanog, Stat 3, Oct i (©) ailx2, Nanog, Oot 4, Stat 3 (a) cd 2, Oct 4, Stat3, Nanog | 99. With respect to the exta embryonic structures forme in the mammal, te possible factual atsbates have been designated ' A. Allantoinstowsueinary wastes elps med end ofthe priaitive sireah gas exchange. Is derived fiom splanchnapleureat the caudal - —= 69