Sie sind auf Seite 1von 208

FOOTWEAR | HARDWARE Spring | Summer 2017 | Q1

NR. 251

MARKET CENTRAL ()

17Q1_FTW_EUR-CHF_001_U1.indd 1 08.06.2016 11:30:02


2 Segmentierung

adidas Logistik-Center Uffenheim adidas Logistik-Center Uffenheim


Retouren Retouren
Deutschland adidas Logistik-Center Austria adidas Logistik-Center
Abt.: Kunden Service Abt.: Kunden Service
Industriestrae 3 Industriestrae 3
adidas AG 97215 Uffenheim adidas Austria GmbH D-97215 Uffenheim
Adi-Dassler-Platz 1-2 Adi-Dassler-Gasse 6
91074 Herzogenaurach Retouren/Reklamationen: 9073 Klagenfurt-Viktring Retouren/Reklamationen:
Deutschland Bitte stimmen Sie Warenrcksendungen telefonisch Austria Bitte stimmen Sie Warenrcksendungen telefonisch
mit Ihrem Anprechpartner im Customer Service ab. mit Ihrem Anprechpartner im Customer Service ab.
Postanschrift: Er organisiert die Abholung. Customer Service Er organisiert die Abholung.
Postfach 1120 Telefon: 09842 93 91 88 Servicezeiten: Montag-Freitag 8:00-18:00 Uhr Telefon: 0463 28 48 254
91072 Herzogenaurach Fax: 09842 93 91 31
Deutschland Telefonsammelnummer: 0463 28 48 55 Click... Ihr Online-Business mit adidas
Click... Ihr Online-Business mit adidas Faxsammelnummer: 0463 28 48 315 https://b2bportal.adidas-group.com
Customer Service https://b2bportal.adidas-group.com E-Mail: Click-at@adidas.com
Servicezeiten: Montag-Freitag 0800-1800 Uhr E-Mail: Click-de@adidas.com E-Mail: Click-at@adidas.com
Click-Hotline: 0463 28 48 56
Click-Hotline: 09132 84 55 88
Telefonsammelnummer: 09132 84 90
Faxsammelnummer: 09132 84 21 77

E-Mail: Click-de@adidas.com

Allgemeine Informationen
Homepage: http://www.adidas.com
Alle Preisangaben in diesem Katalog sind unver-
Mindestauftragswert: bindliche Preisempfehlungen des Herstellers.
Bitte beachten Sie unsere Angaben
in der aktuellen Preisliste.
Magebend ist der bei Auftragserteilung fr den
Vorbestellungen fr Produktneuheiten unter besttigten Liefertermin gltige Listenpreis.
Einbeziehung von Produktbildern drfen ab dem Es gelten die aktuellen Verkaufs- und Liefer-
offiziellen PR-Launch entgegen genommen bedingungen fr adidas Group Erzeugnisse.
werden.
Magebend fr den Launch-Termin von Lizenz- nderungen und Irrtmer vorbehalten. Abbildungen
produkten (Matchwear) ist der Launchkalender knnen aufgrund von Produktnderungen abweichen.
der Vereine im Bereich Service auf unserer B2B-
Plattform Click.

Artikel mit diesem Logo haben Artikel mit diesem Logo haben Artikel mit diesem Logo haben
eine 12-monatige Laufzeit eine 18-monatige Laufzeit eine 24-monatige Laufzeit
(d.h. bis Ende Saison HW2017) (d.h. bis Ende Saison FS2018) (d.h. bis Ende Saison HW2018)

=
- fr Artikel mit diesem Symbol besteht die Mglichkeit zur Nachorder
- eine permanente Lieferfhigkeit bis zum Saisonende kann nicht gewhrleistet werden
=
- bei Artikeln mit diesem Symbol handelt es sich um Durchlufer aus einer Vorsaison
- sie sind zum frhesten Liefertermin der aktuellen Saison orderbar

17Q1_FTW_EUR_002_Kmaster_DE_AT_002_U2_ServiceInformationen_PERF.indd 2 08.06.2016 11:31:36


Segmentierung 3

Field of play SS17 Digitale Preislisten und Kataloge


Damit

adidas die Kollektion zielgruppengerechter entwickeln und positionieren kann, Auf unserer Online-Service-Plattform Click stehen Ihnen alle adidas
Sie als Fachhndler zielgruppengerechter einkaufen und prsentieren knnen, Kataloge und Preislisten in digitaler Form zur Verfgung.
der Abverkauf durch gezieltere Vorauswahl erhht wird,
Nutzen Sie den adidas Katalog als PDF auf Smartphone, Tablet
ist der Vertrieb der Kollektion nach Kundengruppen segmentiert. oder Computer oder in der animierten Flipping-Version nur fr den internen
Gebrauch. Bitte beachten Sie hierzu den Punkt 3.2 der E-Commerce-
Bedingungen.
Das Ziel:
Die adidas Produkte dort anzubieten, wo der Konsument sie erwartet.

Die Kataloge finden Sie auf Click im Service-Bereich:


Die neue Segmentierungssymbolik ab SS17
https://b2bportal.adidas-group.com
SPORT SPORT MULTI SPORT SPORT LIFESTYLE FASHION
SPECIALIST SPECIALIST GENERALIST DIRECTIONAL GENERALIST SPECIALIST
BRAND DRIVEN

Preislisten online

Auf Click knnen Sie die Preislisten zu den Katalogen als PDF-Version zum
Ausdrucken herunterladen. Auerdem stellen wir Ihnen die Preislisten
zustzlich als Excel-Dateien fr Ihr Shopsystem oder Ihre Warenwirtschaft
zur Verfgung.
COMMERCIAL

Die aktuellen Verkaufs- und Lieferbedingungen fr adidas Group Erzeugnisse


finden Sie ebenfalls auf Click.

SPORT MULTI SPORT SPORT LIFESTYLE


SPECIALIST GENERALIST DIRECTIONAL GENERALIST

Die im Produkt befindliche Segmentierung spiegelt den Stand Mitte Mai 2016.
Aus sortimentsstrategischen Grnden knnen sich im Laufe der Vororder noch
nderungen ergeben.
Bitte beachten Sie die aktuelle elektronische Variante als verbindlich.

An jedem Modell im Katalog sind die Kundengruppen gekennzeichnet, die darauf Zugriff
haben. Welcher Kundengruppe Sie als adidas-Fachhndler zugeordnet sind, erfahren
Sie bei Ihrem Kundenbetreuer.

17Q1_FTW_EUR-CHF_003_Kmaster_DACH_003_Segmentierung_PERF.indd 3 08.06.2016 11:31:52


4

FOOTWEAR

RUNNING TERREX INDOOR


Women 19 Men 48 TRAIL Women 82
Men 31 Women 61 Men 71 Men 83
Unisex 44 Kids 67 Women 77 Kids 85

BASKETBALL
TENNIS Icon 96 SLIDES
Women 88 Adult 96 Men 103 TRAINING
Men 90 Junior 99 Unisex 107 Men 115
Kids 93 Kids 99 Women 109 Women 118

KIDS
Running 127 Swim 143
Training 136 Terrex 145
Fuball 139 Disney 149
Tennis 142 Infants 150
HARDWARE

BAGS
Outdoor 156 Athletics 158
Running 156 Women 166
TERREX Basketball 157 Backpacks 171 HARDWARE
Backpacks 154 Swim 157 Kids 175 Running 177
Accessories 154 Training 157 Travel 175 Training 178

BALLS
Handball 180
Basketball 180

17Q1_FTW_EUR-CHF_004_TOC.indd 4 08.06.2016 11:32:13


5

RUNNING
FOOTWEAR TECHNOLOGIES SS 2017

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 5 08.06.2016 11:32:45


6

boost
Ultra responsive comfort and cushioning combined with unmatched longevity in
every climate. Stores and unleashes energy every time the foot hits the ground.

BOUNCE
Instant step-in comfort and responsive cushioning.

CLOUDFOAM
Super plush feel.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 6 08.06.2016 11:32:48


7

SPRINGBLADE
What it is: highly elastic blades.
How it works: springblade features forward-angled blades that flex and
recoil for explosive energy every time your foot hits the ground.

PRIMEKNIT
Superior seamfree fit through a precisely engineered, adaptive, lightweight
knitted textile created in one step.

ENGINEERED MESH
Supportive fit through a breathable, engineered lightweight textile.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 7 08.06.2016 11:32:51


8

TECHFIT
techfit teams a stretchy, foot-hugging fabric with elastic bands for a
sock-like snug fit with personalized support.
Personalized fit through a foot-hugging textile with zoned elastic support.

ADIPRENE
Highly absorbing foam for impact protection.

ENERGIZED STABILITY
Added stability through zoned boost densities to provide
personalized stability.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 8 08.06.2016 11:32:52


9

A high performance compound from a world leading tire supplier providing


industry leading grip in all weather and ground conditions.

Grippy lugs that ensure best traction when running on trails or in the
mountain region.

Individual moving lugs that adapt to any surface to ensure ultimate traction
when running on trails or in the mountain region.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 9 08.06.2016 11:32:54


10

Extended protection against wear and tear.

ATR OUTSOLE
All-terrain outsole design provides optimum grip control and support during
your run.

A system that moves with the foot for a smooth, supportive transition from
landing to push-off.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 10 08.06.2016 11:32:56


11

STRETCHWEB
Adapts to every runners foot strike by unleashing the full potential of boost
to provide a smoother and more flexible ride.

Cooler and dryer run through increased ventilation.

SPRINTWEB
Lightweight upper support for elite performance.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 11 08.06.2016 11:32:58


12

GORE-TEX
GORE-TEX extended comfort footwear: waterproof and breathable.
Ideal for higher activity levels.

climaproof offers 100% weather protection because of its bootie construction


with fully taped seams.

Endless energy in the mountains especially on a fast mountain run. boost


supports you with endless energy and high adaptability on rocky surfaces.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 12 08.06.2016 11:33:01


13

ADIPRENE is a highly shock absorbent ADIPRENE+ is a very elastic and durable foam
material that cushions and protects your that covers most of the forefoot area. Due to
heel at impact. its high elasticity, it uses the natural energy to
provide a responsive and dynamic toe-off.

Outdoor specific FORMOTION unit for enhanced motion control and downhill
comfort.

A lightweight TPU film which supports midsole stability and protects the EVA
sidewall from damage.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 13 08.06.2016 11:33:04


14

The uniqueness of Stealth Rubber is its high friction and shock absorption.
The difference between Stealth Rubber and other rubbers on the market is
obvious. Quite simply, Stealth Rubber provides unbeatable grip.

Continental rubber outsole for enhanced performance on any terrain. It has


outstanding grip on dry as well as wet ground and offers up to 30% more grip
compared to our main competitors.

Offers an optimal lug pattern design, in combination with different high-tech


adidas rubber compounds.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 14 08.06.2016 11:33:05


15

DUAL DENSITY VENTILATION / DRAINAGE MIDSOLE


DUAL DENSITY EVA injected midsole, with soft core for cushioning and harder
EVA outer rim for stability. Innovative ventilation/drainage system through
sidewall of the midsole with closed outsole for enhanced breathability and
comfort on wet trails and around water.

climacool tooling construction with ventilation and drainage holes for


enhanced breathability and comfort. Together with a breathable and fast
drying open mesh upper it provides a comfortable foot climate in and around
water. 360 degrees ventilation every day outdoors.

EXTERNAL HEELCAP
External heel cap for more stability when hiking on uneven grounds.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 15 08.06.2016 11:33:07


16

SPEED LACING
The speed lace ensures easy handling and is made out of an extremely
loadable material (heat cut with a non-braided core), which prevents abrasion
and provides durability.

TOGGLE AND LACE END


The speed lace toggle has an aluminum wheel, which enables visual
technology and offers maximum foothold. The Lace End Cover (LEC)
enables you to shorten the lace easily and change it quickly in case of
replacement.

RUN SMOOTH INSERTS


Run smooth inserts enable speed laces to run easily through the eye leds
when pulling and tying the laces. Laced all the way down with one pull assures
an optimal fit.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 16 08.06.2016 11:33:10


17

LACE BUNGEE is an elastic webbing on the forefoot that is easy to lift up and
put the lace under. It keeps the lace in one place.

ORTHOLITE SOCKLINER
An advanced foam insole to use in high impact sports applications, with high
resiliency for comfort and cushioning.

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 17 08.06.2016 11:33:11


18 RUNNING
*Artikel haben eine genderte Segmentierung und deshalb im Anhang des Katalogs zu finden (Stand zur Druckfreigabe Mitte Mai 2016)

RUNNING FTW SS17


RUNNING

SEGMENTATION

ULTRA FRANCHISE CLOUDFOAM


DRIVEN

DRIVEN
BRAND

BRAND
PUREBOOST X
COMMERCIAL

COMMERCIAL
ENERGY BOOST BOUNCE ENABLED
DRIVEN

DRIVEN
BRAND

BRAND
SUPERNOVA
COMMERCIAL

COMMERCIAL

ALPHA PUREBOOST
DRIVEN

DRIVEN
BRAND

BRAND
COMMERCIAL

COMMERCIAL

17Q1_FTW_EUR-CHF_005-018_Techpages.indd 18 08.06.2016 11:33:12


RUNNING
Women - Neutral 19

Women - Neutral
* UltraBOOST X UltraBOOST X

RUNNING
size 3.5-10.5 179,95 size 3.5-10.5 179,95
BA8278 core black/easy blue s17/glow orange BB1695 cleargreys12/midgreys14/dghsolid
s14 grey
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
DYNAMIC ADAPTIVE FIT optimal freedom of DYNAMIC ADAPTIVE FIT optimal freedom of
movement forendless comfort for a supportive movement forendless comfort for a supportive
fit fit
PRIMEKNITsuperiourseamfreefitthrough PRIMEKNITsuperiourseamfreefitthrough
apreciselyengineered,adaptive,lightweight apreciselyengineered,adaptive,lightweight
knitted textile created in one step. knitted textile created in one step.
BOOSTultraresponsivecomfortandcushining BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime climate.storesandunleashesenergyeverytime
thefoothitstheground thefoothitstheground
BA8278 deliv.02/17
STRETCHWEB adapts to every runner's foot BB1695 deliv.04/17
STRETCHWEB adapts to every runner's foot
strikebyunleashingthefullpotentialofBOOST strikebyunleashingthefullpotentialofBOOST
toprovideasmootherandmoreflexibleride. toprovideasmootherandmoreflexibleride.
[BA8278ZM]| [BB1695P&]|
UltraBOOST w
size 3.5-10.5 179,95
BA8927 mystery red s17/mystery red s17/
UltraBOOST w
tactile pink s17
size 3.5-10.5 179,95
BA8928 mystery blue s17/mystery blue s17/
vapour grey met.f16 S80682 core black/core black/dark grey
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
PRIMEKNITsuperiourseamfreefitthrough PRIMEKNITsuperiourseamfreefitthrough
apreciselyengineered,adaptive,lightweight apreciselyengineered,adaptive,lightweight
knitted textile created in one step. knitted textile created in one step.
FITCOUNTERsupportiveheelconstruction FITCOUNTERsupportiveheelconstruction
designedtoenablethefreemotionofthe designedtoenablethefreemotionofthe
achillestendon. achillestendon.
BOOSTultraresponsivecomfortandcushining BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime climate.storesandunleashesenergyeverytime
thefoothitstheground thefoothitstheground
BA8927 deliv.12/16 BA8928 deliv.12/16
STRETCHWEB adapts to every runner's foot S80682 deliv.12/16
STRETCHWEB adapts to every runner's foot
strikebyunleashingthefullpotentialofBOOST strikebyunleashingthefullpotentialofBOOST
toprovideasmootherandmoreflexibleride. toprovideasmootherandmoreflexibleride.
[BA8927^/]| [BA8928&&]| [S806829N]|
UltraBOOST w
size 3.5-10.5 179,95
S80685 tactile blue s17/tactile blue s17/core
black
S80686 still breeze f12/still breeze f12/core
black
TEXTILE/SYNTHETICS
PRIMEKNITsuperiourseamfreefitthrough
apreciselyengineered,adaptive,lightweight
knitted textile created in one step.
FITCOUNTERsupportiveheelconstruction
designedtoenablethefreemotionofthe
achillestendon.
BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
S80685 deliv.02/17 S80686 deliv.02/17
STRETCHWEB adapts to every runner's foot
strikebyunleashingthefullpotentialofBOOST
toprovideasmootherandmoreflexibleride.
[S80685CW]| [S80686DZ]|

17Q1_FTW_EUR-CHF_019_053.indd 19 08.06.2016 11:38:56


20 Women - Neutral
RUNNING

energy boost 3 w
size 3.5-10.5 159,95
BB5789 midnightgreyf15/midgreys14/still
breeze f12
BA7942 corepinks17/ftwrwhite/coreblack
BB5790 energy s17/easy green s17/easy orange
s17
TEXTILE/SYNTHETICS
Theshoesthatredefinedcushioningwhen
theylaunched.Thesewomen'srunningshoes
blendaflexible,adaptivetechfitupperwiththe
plush,energy-filledrideofboost.Theresult
isalightweight,neutralrunningshoethatwill
invigorate runners of every level, at any distance.
BB5789 deliv.01/17 BA7942 deliv.01/17 BB5790 deliv.01/17
TECHFITpersonalizedfitthroughafoot-hugging
textilewithzonedelasticsupport.
[BB5789&2]| [BA7942/T]| [BB5790$R]|

energy boost 3 w * *
size 3.5-10.5 159,95 supernova w
AQ1869 coreblack/darkgrey/dghsolidgrey size 3.5-10.5 139,95
AQ5964 ftwrwhite/chsolidgrey/crystalwhite BA9937 lghsolidgrey/ftwrwhite/mghsolid
s16 grey
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Withtheperfectblendofflexibleandseamless ENGINEEREDMESHsupportivefitthrougha
techfitupper,alightweight,adaptableoutsole breathable,engineeredlightweighttextile.
andenergy-returningboostmidsole,thisisa FITCOUNTERsupportiveheelconstruction
runningshoethatinvigorates.Featuringanewly designedtoenablethefreemotionofthe
engineeredFITFRAMEthatfitsnaturallytothe achillestendon.
heelandmidfoot. BOOSTultraresponsivecomfortandcushining
BOOSTultraresponsivecomfortandcushining combinedwithunmatchedlongevityinevery
combinedwithunmatchedlongevityinevery climate.storesandunleashesenergyeverytime
climate.storesandunleashesenergyeverytime thefoothitstheground
thefoothitstheground AQ1869 deliv.01/17 AQ5964 deliv.01/17
STRETCHWEB adapts to every runner's foot BA9937 deliv.12/16
TECHFITpersonalizedfitthroughafoot-hugging strikebyunleashingthefullpotentialofBOOST
textilewithzonedelasticsupport. toprovideasmootherandmoreflexibleride.
[AQ18694L]| [AQ5964I2]| [BA99374A]|
supernova w
size 3.5-10.5 139,95
*
BB6039 energys17/ftwrwhite/easyoranges17
BB3470 shockpinks16/ftwrwhite/coreblack
BB3469 core black/iron met./core pink s17
TEXTILE/SYNTHETICS
Thesewomen'srunningshoesmaximisethe
energy-returningbenefitsoftheirboostmidsole
withalightweight,elasticSTRETCHWEBoutsole.
Anengineeredmeshupperwithseamlesspanels
providessuperiorventilationandcomfort.The
heelhugsandguidesyourfoot,whiletheoutsole
grips wet and dry surfaces.
ENGINEEREDMESHsupportivefitthrougha
breathable,engineeredlightweighttextile.
FITCOUNTERsupportiveheelconstruction BB6039 deliv.12/16 BB3470 deliv.12/16 BB3469 deliv.12/16
designedtoenablethefreemotionofthe
achillestendon.
[BB6039JV]| [BB3470IP]| [BB3469P0]|

17Q1_FTW_EUR-CHF_019_053.indd 20 08.06.2016 11:39:28


Women - Neutral 21

PureBOOST X ATR
size 3.5-10 129,95

RUNNING
BB1727 mysteryreds17/nightred/techrust
met.s17
BB1728 mid grey s14/vista grey s15/silver met.
TEXTILE/SYNTHETICS
Preparedforalltypesofweather,these
lightweightwomen'sall-terrainrunningshoes
haveafull-lengthboostmidsoleforoptimal
energyreturn.Theirfullyreflective,sock-like
upperhugsyourfootforaprecisefitandfeatures
afree-floatingarchunderyourmidfoot.
DYNAMIC ADAPTIVE FIT optimal freedom of
movement forendless comfort for a supportive
fit
BOOSTultraresponsivecomfortandcushining
BB1727 deliv.12/16 BB1728 deliv.12/16
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
[BB1727GO]| [BB1728HR]|
PureBOOST Xpose
size 3.5-10 129,95
BB1731 energy s17/glow orange s14/maroon
BB1732 linen green s17/vapour steel f16/
crystalwhites16
BB1733 coreblack/ftwrwhite/darkgrey
BB1734 clear grey s12/silver met./mid grey s14
TEXTILE/SYNTHETICS
DYNAMIC ADAPTIVE FIT optimal freedom of
movement forendless comfort for a supportive
fit
BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
BB1731 deliv.02/17 BB1732 deliv.02/17 BB1733 deliv.02/17 BB1734 deliv.02/17
STRETCHWEB adapts to every runner's foot
strikebyunleashingthefullpotentialofBOOST
toprovideasmootherandmoreflexibleride.
[BB1731CB]| [BB1732DE]| [BB1733EH]| [BB1734FK]|

*
response + w
size 3.5-10.5 119,95
BB2988 easyoranges17/ftwrwhite/hazecoral
s17
BB2989 coreblack/ftwrwhite/utilityblackf16
BB2986 mid grey s14/silver met./still breeze
f12
TEXTILE/SYNTHETICS
Thesewomen'srunningshoesoptimisethe
energy-returningbenefitsoftheirboostmidsole
withalightweight,elasticSTRETCHWEBoutsole.
Anairmeshupperwithseamlesspanelsprovides
superior ventilation and comfort.
STRETCHAIRMESHhighly-breathablestretch
upperforadaptivefitandcooling.
BOOSTultraresponsivecomfortandcushining
BB2988 deliv.01/17 BB2989 deliv.01/17 BB2986 deliv.01/17
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
[BB2988$X]| [BB2989/-]| [BB2986.R]|

17Q1_FTW_EUR-CHF_019_053.indd 21 08.06.2016 11:39:52


22 Women - Neutral

questar w
size 3.5-10.5 99,95
RUNNING

S76940 energys17/ftwrwhite/easyoranges17
S76735 coreblack/corepinks17/ftwrwhite
S76939 midgreys14/lghsolidgrey/easy
orange s17
TEXTILE/SYNTHETICS
AIRMESHhighly-breathableupperforacooler
run.
FITCOUNTERsupportiveheelconstruction
designedtoenablethefreemotionofthe
achillestendon.
BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
TORSIONSYSTEMasystemthatmoveswiththe S76940 deliv.12/16 S76735 deliv.12/16 S76939 deliv.12/16
footforasmooth,supportivetransitionfrom
landingtopush-off.
[S76940RE]| [S76735OA]| [S76939Y-]|
Women - Stabilty
ultra boost st w *
size 3.5-10.5 179,95
BA7832 midnightgreyf15/stillbreezef12/
collegiate navy
BA7835 easyblues17/hazecorals17/dghsolid
grey
TEXTILE/SYNTHETICS
Foraluxuriousandsupportivefeel,these
women'sstabilityrunningshoesfeatureboostin
themidsole.AnadaptiveadidasPrimeknitupper
andergonomicheelgiveyoulightweightflexand
stabilityexactlywherethey'reneeded.
PRIMEKNITsuperiourseamfreefitthrough
apreciselyengineered,adaptive,lightweight
knitted textile created in one step.
FITCOUNTERsupportiveheelconstruction BA7832 deliv.12/16 BA7835 deliv.12/16
designedtoenablethefreemotionofthe
achillestendon.
[BA7832ZH]| [BA7835=Q]|

supernova sequence 9 w *
size 3.5-10.5 139,95
BB1617 super purple s16/silver met./mid grey
s14
BB1618 utilityblackf16/techrustmet.s17/easy
green s17
BB1619 corepinks17/ftwrwhite/clearonix
TEXTILE/SYNTHETICS
Theeverydaytrainingshoethatgetsyou
motivatedandkeepsyougoing.Thesewomen's
stabilityrunningshoesfeatureanenergy-
returningboostmidsoleandaContinental
RubberoutsolewithSTRETCHWEBtoadapttothe
groundandoptimisethepropertiesofboost.
ENGINEEREDMESHsupportivefitthrougha
breathable,engineeredlightweighttextile. BB1617 deliv.12/16 BB1618 deliv.12/16 BB1619 deliv.12/16
STABLEFRAMEguidesthefootandprovides
dynamic support.
[BB1617BC]| [BB1618CF]| [BB1619DI]|

17Q1_FTW_EUR-CHF_019_053.indd 22 08.06.2016 11:40:17


Women - Stabilty 23

*
supernova st w

RUNNING
size 3.5-10.5 139,95
BB1001 cleargreys12/silvermet./shockpink
s16
BB3104 tactile blue s17/silver met./energy
blue s17
BB3105 clearaqua/ftwrwhite/easyoranges17
TEXTILE/SYNTHETICS
There'snoexcusenottorunwiththesewomen's
shoes.ASTRETCHWEBoutsolemaximisesthe
energy-returningbenefitsoftheboostmidsole,
andanengineeredmeshupperwithseamless
panels provides superior ventilation and comfort.
Builtforstability,theheelhugsandguidesyour
foot,whiletheoutsolegripswetanddrysurfaces.
BB1001 deliv.04/17 BB3104 deliv.04/17 BB3105 deliv.04/17
ENGINEEREDMESHsupportivefitthrougha
breathable,engineeredlightweighttextile.
[BB1001W+]| [BB3104&S]| [BB31050V]|

*
vengeful w
size 3.5-10.5 119,95
BA7939 corepinks17/ftwrwhite/midgreys14
BB1637 collegiate navy/collegiate navy/still
breeze f12
BB1638 vista grey s15/silver met./easy green
s17
TEXTILE/SYNTHETICS
Settlethescoreinthesewomen'srunningshoes.
Contrastingdesignsonthemedialandlateral
sides give an intimidating look. Extra support on
themedialsideprovidesoptimaloverallstability,
whileboostgivesendlessenergy.
STRETCHAIRMESHhighly-breathablestretch
upperforadaptivefitandcooling.
BOOSTultraresponsivecomfortandcushining
BA7939 deliv.01/17 BB1637 deliv.01/17 BB1638 deliv.01/17
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
[BA7939^^]| [BB1637FM]| [BB1638GP]|
Women-Lightweight
adizero adios w adizero boston 6 w
size 3.5-10.5 149,95 size 3.5-10.5 139,95
BA7948 easyoranges17/ftwrwhite/energys17 BB1729 midgreys14/ftwrwhite/easyorange
TEXTILE/SYNTHETICS s17
BOOSTultraresponsivecomfortandcushining TEXTILE/SYNTHETICS
combinedwithunmatchedlongevityinevery Sleek and ready for racing and fast training,
climate.storesandunleashesenergyeverytime thesewomen'slightweightrunningshoesoffer
thefoothitstheground aboostenergy-returningmidsole.Theirtextile
MICROFITspecifictoalladizeromodels. andengineeredmeshupperhelpseliminate
designedforhighspeed,microfitlocksyourfoot chafing,reducesweightandprovidesaprecisefit.
downforadirectfitandfastrun MICROFITspecifictoalladizeromodels.
CONTINENTALahighperformancecompound designedforhighspeed,microfitlocksyourfoot
from a world leading tire supplier providing downforadirectfitandfastrun
industryleadinggripinall-weatherandground BOOSTultraresponsivecomfortandcushining
BA7948 deliv.01/17
conditions. BB1729 deliv.01/17
combinedwithunmatchedlongevityinevery
STRETCHWEB adapts to every runner's foot climate.storesandunleashesenergyeverytime
strikebyunleashingthefullpotentialofBOOST thefoothitstheground
[BA7948&0]| toprovideasmootherandmoreflexibleride. [BB1729IU]|

17Q1_FTW_EUR-CHF_019_053.indd 23 08.06.2016 11:40:55


24 Women-Lightweight

Women - Springblade
adizero tempo 8 ssf w
RUNNING

size 3.5-10.5 139,95


springblade nanaya
BA8096 mystery blue s17/still breeze f12/ size 3.5-10.5 179,95
nightnavy
TEXTILE/SYNTHETICS B49646 core black/granite/glow orange s14
Theseslim,sleekwomen'srunningshoesgive TEXTILE/SYNTHETICS
stabilityandalightweightfeelformidfootto Thesemodernrunningshoesforwomencombine
forefootrunners.Theirmeshupperhasstrategic aquiltedmeshupperwithwidelacesandaheel
overlaysforasnugfit,whilefull-lengthboost straptoadjustthefit.It'sallconnectedtoafull-
delivers maximum energy return. A durable lengthspringblademidsolewithindividually
rubber outsole offers secure grip. tuned Energy Blades.
MICROFITspecifictoalladizeromodels. STRETCHAIRMESHhighly-breathablestretch
designedforhighspeed,microfitlocksyourfoot upperforadaptivefitandcooling.
downforadirectfitandfastrun SPRINGBLADE individually tuned springs
BOOSTultraresponsivecomfortandcushining compressandreleaseenergywitheverystepto
combinedwithunmatchedlongevityinevery BA8096 deliv.01/17
helppropelforward. B49646 deliv.12/16
climate.storesandunleashesenergyeverytime ADIWEAR extended protection against wear
thefoothitstheground and tear.
[BA8096VC]| [B49646DJ]|
Women - Trail
response tr w
size 3.5-10.5 119,95 kanadia 8 tr w
size 3.5-10.5 89,95
BB1662 midgreys14/ftwrwhite/darkgrey
TEXTILE/SYNTHETICS
BB4418 linen s17/collegiate burgundy/glow
orange s14
Thesewomen'srunningshoesaredesignedfor
BB4420 core black/core pink s17/trace grey s17
a responsive feel and superior traction across
avarietyofterrain.Energy-returningboost SYNTHETICS/TEXTILE
andameshuppergiveyoualight,fastride Durability,tractionandstabilitycometogether
withsuperiorventilation.Adjustablelacingand inthesewomen'strailrunningshoesbuiltona
FITBANDSholdyourfootsecurewhileallowingit TRAXIONoutsoleandanextra-softcloudfoam
to move naturally. midsole.Theairmeshupperisreinforcedwith
ZONEDPROTECTIONspecifictoallextreme syntheticoverlaysforanidealfit.
models.protectiveoverlayscombinedwitha ZONEDPROTECTIONspecifictoallextreme
durablemeshofferssupportforoff-roadruns. models.protectiveoverlayscombinedwitha
BOOSTultraresponsivecomfortandcushining durablemeshofferssupportforoff-roadruns.
combinedwithunmatchedlongevityinevery BB1662 deliv.01/17
CLOUDFOAMsuperplushfeel. BB4418 deliv.12/16 BB4420 deliv.12/16
climate.storesandunleashesenergyeverytime TRAXIONgrippylugsthatensurebesttraction
thefoothitstheground whenrunningontrailsorinthemountain
[BB1662GM]| region. [BB4418IS]| [BB4420C9]|
Duramo 7 Trail W
size 3.5-10.5 64,95
Galaxy Trail W
BB4451 mid grey s14/collegiate burgundy/ size 3.5-10.5 59,95
dark grey
BB4452 utilityblackf16/chalkwhite/stillbreeze BB4464 linens17/chalkwhite/easyoranges17
f12 BB4466 core black/still breeze f12/core pink
TEXTILE/SYNTHETICS s17
Thesewomen'strailrunningshoescombine TEXTILE/SYNTHETICS
simpledesignwithexpertconstructionand Withmaximumtractionfortrailroutes,these
materialstodeliverhighperformance.A women'srunningshoesprovideultra-breathable
breathableairmeshupperkeepsyoucomfortable, comfortandplushcushioning.Asyntheticandair
whileasoftcloudfoammidsoleprovides meshupperislightweightandventilating,while
lightweightcushioning. themidsoleisresponsiveoveroff-roadobstacles.
ZONEDPROTECTIONspecifictoallextreme ZONEDPROTECTIONspecifictoallextreme
models.protectiveoverlayscombinedwitha models.protectiveoverlayscombinedwitha
durablemeshofferssupportforoff-roadruns. durablemeshofferssupportforoff-roadruns.
ADIWEAR extended protection against wear BB4451 deliv.01/17 BB4452 deliv.01/17
CLOUDFOAMsuperplushfeel. BB4464 deliv.12/16 BB4466 deliv.12/16
and tear. ADIWEAR extended protection against wear
CLOUDFOAMsuperplushfeel. and tear.
[BB4451JR]| [BB4452KU]| [BB4464O+]| [BB4466Q0]|

17Q1_FTW_EUR-CHF_019_053.indd 24 08.06.2016 11:41:27


Women - Bounce 25

Women - Bounce

RUNNING
edge lux w
size 3.5-10.5 99,95
BB8211 coreblack/ftwrwhite/silvermet.
BW0412linengreens17/ftwrwhite/mystery
green s17
TEXTILE
Thesewomen'srunningshoeshaveboldstyle
that'sreadyforafast5K.BOUNCEmidsole
technologyensuresenergy-filledcomfortallday,
andthesock-likeconstructionprovidesasleek,
snugfitthatletsyoumovenaturally.Alenticular
colour-shiftingmeshuppergivesthemamodern
look.
AIRMESHhighly-breathableupperforacooler
BB8211 deliv.01/17 BW0412 deliv.01/17
run.
BOUNCE instant step in-comfort and responsive
cushioning
[BB8211LT]| [BW04127H]|

edge lux w
size 3.5-10.5 99,95
BW0415coreblack/energys17/ftwrwhite
BW0416boldpink/hazecorals17/coreblack
BW0417collegiatenavy/framaslightblue/easy
blue s17
TEXTILE
AIRMESHhighly-breathableupperforacooler
run.
BOUNCE instant step in-comfort and responsive
BW0415 deliv.02/17 BW0416 deliv.02/17 BW0417 deliv.02/17
cushioning
ADIWEAR extended protection against wear
and tear.
[BW0415AQ]| [BW0416BT]| [BW0417CW]|

alphabounce lux w
size 3.5-10.5 89,95
B39265 core black/easy orange s17/utility
black f16
B39268 clearaqua/ftwrwhite/cleargreys12
B39271 cleargreys12/ftwrwhite/crystalwhite
s16
B39272 collegiate navy/clear aqua/clear onix
TEXTILE
ADIWEAR extended protection against wear
and tear.
BOUNCE instant step in-comfort and responsive
B39265 deliv.02/17 B39268 deliv.02/17 B39271 deliv.02/17 B39272 deliv.02/17
cushioning
FUSEDMESHadaptivefitwithfused,zoned
support.
[B39265&Y]| [B392682/]| [B39271#R]| [B39272^U]|

17Q1_FTW_EUR-CHF_019_053.indd 25 08.06.2016 11:41:49


26 Women - Bounce
RUNNING

mana bounce 2 w aramis


size 3.5-10.5 79,95
B39024 bold pink/silver met./glow orange s14
B39026 core black/silver met./onix
B39027 ftwrwhite/silvermet./coreblack
TEXTILE
AIRMESHhighly-breathableupperforacooler
run.
BOUNCE instant step in-comfort and responsive
cushioning B39024 deliv.01/17 B39026 deliv.01/17 B39027 deliv.01/17
ADIWEAR extended protection against wear
and tear.
[B39024V#]| [B39026X3]| [B39027Y6]|

element refine 3 w
size 3.5-10.5 69,95
BB4855 hazecorals17/chalkwhite/chalkwhite
BB4854 coreblack/coreblack/chalkwhite
TEXTILE
Acloudfoammidsolegivesthesewomen's
runningshoesacushionedresponsewithevery
stepdownandpushup.Featuringaminimalist
construction,theshoeisbuiltwithabreathable
recycledmeshuppertokeepyourfeetwell
ventilated.
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear. BB4855 deliv.02/17 BB4854 deliv.02/17
AIRMESHhighly-breathableupperforacooler
run.
[BB4855ZK]| [BB4854YH]|
Women - Cloadfoam

duramo 8 w
size 3.5-10.5 69,95
BB4666 utility black f16/core black/core black
BB4667 cleargreys12/ftwrwhite/corepinks17
BB4669 shockpinks16/ftwrwhite/boldpink
BB4671 mysteryblues17/ftwrwhite/easyblue
s17
BB4674 superpurples16/midnightgreyf15/
bold pink
TEXTILE/SYNTHETICS
WithacloudfoammidsoleandmidfootTPU
cage,thesewomen'srunningshoesdeliver
cushionedresponseandsupportwitheverystride.
Abreathablemeshupperkeepsyourfeetwell
ventilated, and a durable outsole provides long-
BB4666 deliv.12/16 BB4667 deliv.12/16 BB4669 deliv.12/16 BB4671 deliv.12/16 BB4674 deliv.12/16

lasting wear.
[BB4666WE]| [BB4667XH]| [BB4669ZN]| [BB4671T4]| [BB4674WD]|

17Q1_FTW_EUR-CHF_019_053.indd 26 08.06.2016 11:42:16


Women - Cloadfoam 27

RUNNING
durama w
size 3.5-10.5 64,95
BA7394 coreblack/ironmet./ftwrwhite
BA7395 ftwrwhite/mattesilver/crystalwhite
s16
TEXTILE/SYNTHETICS
Lowtothegroundwithahalf-sock,halflace-up
construction,thesewomen'srunningshoes
provideasuper-plushsock-likefeel.Designed
withawomen's-specificfit,thissupportiveshoe
gives endless comfort all run long.
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
BA7394 deliv.02/17 BA7395 deliv.02/17
and tear.
AIRMESHhighly-breathableupperforacooler
run.
[BA7394YI]| [BA7395ZL]|

energy cloud wtc w


size 3.5-10.5 64,95
BB3160 coreblack/ftwrwhite/stillbreezef12
BB3161 grey/core black/grey
BB3162 easymints17/ftwrwhite/coreblack
TEXTILE/SYNTHETICS
FITFRAMEsupportivecageintheshoe'smidfoot
provides midfoot lockdown and optimum
transitioninallphasesoftherunninggait
BB3160 deliv.12/16 BB3161 deliv.12/16 BB3162 deliv.12/16
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear.
[BB31607&]| [BB316182]| [BB316295]|

energy cloud wtc w


size 3.5-10.5 64,95
BB3165 easyblues17/silvermet./hazecoral
s17
BB3166 mysteryblues17/ftwrwhite/glow
orange s14
BB3167 core pink s17/still breeze f12/ftwr
white
BB3168 cleargreys12/ftwrwhite/easymints17
TEXTILE/SYNTHETICS
FITFRAMEsupportivecageintheshoe'smidfoot
provides midfoot lockdown and optimum
transitioninallphasesoftherunninggait
BB3165 deliv.12/16 BB3166 deliv.12/16 BB3167 deliv.12/16 BB3168 deliv.12/16
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear.
[BB3165CE]| [BB3166DH]| [BB3167EK]| [BB3168FN]|

17Q1_FTW_EUR-CHF_019_053.indd 27 08.06.2016 11:42:39


28 Women - Cloadfoam
RUNNING

element refresh w
size 3.5-10.5 59,95
BA7912 core pink s17/still breeze f12/ftwr
white
BA7913 coreblack/easymints17/ftwrwhite
TEXTILE/SYNTHETICS
Inspiredbythesimple,cleanandfunctional
designofPureboost,thisshoehelpsrunners
movenaturallywhilegivingthemendlesscomfort
throughtheSUPERCLOUDmidsoleandrubber
outsole.
AIRMESHhighly-breathableupperforacooler
run.
CLOUDFOAMsuperplushfeel. BA7912 deliv.02/17 BA7913 deliv.02/17
ADIWEAR extended protection against wear
and tear.
[BA7912YE]| [BA7913ZH]|

cosmic w
size 3.5-10.5 59,95
BB4349 grey/ftwrwhite/dghsolidgrey
BB4351 coreblack/ftwrwhite/utilityblackf16
BB4353 core pink s17/collegiate burgundy/still
breeze f12
BB4355 ftwrwhite/ftwrwhite/corepinks17
TEXTILE/SYNTHETICS
Thesehighlybreathablewomen'srunningshoes
delivermaximumcomfortwithanairmeshupper.
Theyfeatureextra-softcloudfoamforresponsive
cushioningandaplushfeel.
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear BB4349 deliv.01/17 BB4351 deliv.01/17 BB4353 deliv.01/17 BB4355 deliv.01/17
and tear.
AIRMESHhighly-breathableupperforacooler
run. [BB4349M$]| [BB4351GK]| [BB4353IQ]| [BB4355KW]|
galaxy 3 w
size 3.5-10.5 49,95
BB4365 coreblack/darkgrey/ftwrwhite
BB4366 clear grey s12/grey/still breeze f12
BB4369 core pink s17/core pink s17/still breeze
f12
BB4371 ftwrwhite/crystalwhites16/still
breeze f12
TEXTILE/SYNTHETICS
Withaclassiclookandaddedstability,these
women'srunningshoesdeliveranidealfit.A
breathableairmeshupperstretchesaroundthe
foot,whilecloudfoamgivesyouultracushioning.
AIRMESHhighly-breathableupperforacooler
run.
CLOUDFOAMsuperplushfeel. BB4365 deliv.12/16 BB4366 deliv.12/16 BB4369 deliv.12/16 BB4371 deliv.12/16
ADIWEAR extended protection against wear
and tear.
[BB4365M.]| [BB4366N/]| [BB4369Q2]| [BB4371KU]|

17Q1_FTW_EUR-CHF_019_053.indd 28 08.06.2016 11:43:17


Women - Cloadfoam 29

RUNNING
galaxy 3.1 w
galaxy 3.1 w size 3.5-10.5 49,95
size 3.5-10.5 49,95
BA7803 core black/core black/easy mint s17
BA7798 core black/core black/easy blue s17 BA7806 shockpinks16/shockpinks16/core
BA7800 clear grey s12/grey/easy pink s17 black
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
AIRMESHhighly-breathableupperforacooler AIRMESHhighly-breathableupperforacooler
run. run.
BA7798 deliv.01/17 BA7800 deliv.01/17
CLOUDFOAMsuperplushfeel. BA7803 deliv.01/17 BA7806 deliv.01/17
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear ADIWEAR extended protection against wear
and tear. and tear.
[BA77983B]| [BA7800R/]| [BA7803U5]| [BA7806XE]|

BB0884 deliv.12/16 BB0885 deliv.12/16 BB0886 deliv.12/16 BB0887 deliv.12/16 BB0888 deliv.12/16
duramo lite w
size 3.5-10.5 49,95
[BB0884O/]| [BB0885P&]| [BB0886Q2]| [BB0887R5]| [BB0888S8]| BB0884 coreblues17/ftwrwhite/collegiate
navy
BB0885 easymints17/clearaqua/ftwrwhite
BB0886 mid grey s14/silver met./clear grey s12
BB0887 corepinks17/ftwrwhite/collegiate
burgundy
BB0888 coreblack/nightmet.f13/ftwrwhite
BB0889 core black/vapour grey met.f16/utility
black f16
TEXTILE/SYNTHETICS
Women'srunningshoesdesignedforeveryday
training.Madewithalightweightmeshupperto
keepyourfeetventilated,theseshoesfeature
syntheticoverlaysforaddedsupport.Adurable
outsole provides long-lasting wear.
AIRMESHhighly-breathableupperforacooler
run.
CLOUDFOAMsuperplushfeel.
BB0889 deliv.12/16
ADIWEAR extended protection against wear
and tear.
[BB0889TB]|

17Q1_FTW_EUR-CHF_019_053.indd 29 08.06.2016 11:43:42


30 Women - Track&Field

Women - Track&Field
*
RUNNING

adizero ambition 4 w
size 3.5-10.5 99,95
BB5778 solarred/ftwrwhite/coreblack
TEXTILE/SYNTHETICS
Readytoflyassoonasthegungoesoff,these
women's middle-distance spikes get you across
thefinishlinewithspeed.Madewithanultra-
light,supportivetwo-meshupperandamoulded jumpstar w
outsolewithreplaceablespikesthatdiginand size 3.5-10.5 69,95
launchyouforward.
SPRINTWEBlightweightuppersupportforelite
BA7924 shockpinks16/gloworanges14/core
performance. black
MICROFITspecifictoalladizeromodels. TEXTILE/SYNTHETICS
designedforhighspeed,microfitlocksyourfoot SYNTHETICLEATHERlightweightsupport
downforadirectfitandfastrun BB5778 deliv.01/17
MESHbreathablemeshupper BA7924 deliv.01/17
PEBAXPLATElightweight SPIKE PINS ultimate grip
SPIKE PINS ultimate grip EVAPLATElightweight
[BB5778/=]| [BA7924=P]|

distancestar w
size 3.5-10.5 69,95
BB5757 gloworanges14/coreblack/shock
pink s16
TEXTILE/SYNTHETICS
Setthepacetofastinthesewomen'slightweight distancestar w
spikesbuiltforcompetition.Withameshupper size 3.5-10.5 69,95
tokeepyourfeetcool,thesetrackandfield
shoesarecomfortable,durableandprimedfor BB5758 clear aqua/core black/blue
maximum performance. TEXTILE/SYNTHETICS
SYNTHETICLEATHERlightweightsupport SYNTHETICLEATHERlightweightsupport
MESHbreathablemeshupper BB5757 deliv.01/17
MESHbreathablemeshupper BB5758 deliv.01/17
SPIKE PINS ultimate grip SPIKE PINS ultimate grip
EVAPLATElightweight EVAPLATElightweight
[BB5757=S]| [BB5758$V]|

sprintstar w
size 3.5-10.5 69,95
BB5751 ftwrwhite/coreblack/shockpinks16
SYNTHETICS
Eatupthetrackinthesesprintspikesbuiltfor
speed.Madeoflightweight,durablematerial,the
singulardesignsetsthesespikesapartfromthe
rest, and makes your style clear.
SYNTHETICLEATHERlightweightsupport sprintstar w
PEBAXPLATElightweight BB5751 deliv.01/17 size 3.5-10.5 69,95 BB5752 deliv.01/17
SPIKE PINS ultimate grip
TRAXION RUBBER ultimate grip BB5752 core black/glow orange s14/clear aqua
[BB5751WA]| SYNTHETICS [BB5752XD]|

17Q1_FTW_EUR-CHF_019_053.indd 30 08.06.2016 11:43:55


Women - Track&Field 31

Men - Neutral

RUNNING
UltraBOOST
size 3.5-12.5; 13.5; 14.5-15; 179,95
16-17
throwstar w
BA8842 core black/core black/dark grey
size 3.5-10.5 69,95
TEXTILE/SYNTHETICS
BB5767 ftwrwhite/coreblack/ftwrwhite
Withultra-cushionedboostunderfootand
SYNTHETICS/TEXTILE afoot-huggingupper,thesegame-changing
Thesecompetition-classwomen'strackandfield shoesformenarereadytotakeyouonthebest
shoesareprimedformaximumperformance. runyou'veeverhad.Eachfootstrikereleases
Theyfeatureasoftcollartoreducepressureon anenergisedpush-offforafast,lightridewith
theankleandAchillesduringthrowingevents. cushioningthatdoesn'tpackdownovertime.The
A rubber outsole offers maximum sticking adidasPrimeknitupperadaptstothechanging
performance. shapeofyourfootasyourun,andasupportive
SYNTHETICLEATHERlightweightsupport cagesecuresalockdownfit.
BB5767 deliv.01/17
MESHbreathablemeshupper BA8842 deliv.12/16
PRIMEKNITsuperiourseamfreefitthrough
TRAXION RUBBER ultimate grip apreciselyengineered,adaptive,lightweight
FITSTRAPsnugfit knitted textile created in one step.
[BB5767/X]| [BA8842+V]|

UltraBOOST
* UltraBOOST
size 3.5-12.5; 13.5; 14.5-15; 179,95
size 3.5-12.5; 13.5; 14.5-15; 179,95 16-17
16-17 S80635 energy s17/energy s17/core black
BA8844 core blue s17/mystery blue s17/core S80636 ftwrwhite/ftwrwhite/coreblack
black TEXTILE
TEXTILE PRIMEKNITsuperiourseamfreefitthrough
Withultra-cushionedboostunderfootand apreciselyengineered,adaptive,lightweight
afoot-huggingupper,thesegame-changing knitted textile created in one step.
shoesformenarereadytotakeyouonthebest FITCOUNTERsupportiveheelconstruction
runyou'veeverhad.Eachfootstrikereleases designedtoenablethefreemotionofthe
anenergisedpush-offforafast,lightridewith achillestendon.
cushioningthatdoesn'tpackdownovertime.The BOOSTultraresponsivecomfortandcushining
adidasPrimeknitupperadaptstothechanging combinedwithunmatchedlongevityinevery
shapeofyourfootasyourun,andasupportive climate.storesandunleashesenergyeverytime
cagesecuresalockdownfit. thefoothitstheground
BA8844 deliv.12/16
PRIMEKNITsuperiourseamfreefitthrough S80635 deliv.02/17 S80636 deliv.02/17
STRETCH WEB adapts to every runner's foot
apreciselyengineered,adaptive,lightweight strikebyunleashingthefullpotentialofBOOST
knitted textile created in one step. toprovideasmootherandmoreflexibleride.
[BA8844/Y]| [S8063527]| [S806363A]|
energy boost 3 m
size 6-12.5; 13.5; 14.5 159,95
BA7941 blue/ftwrwhite/coreblack
BB5786 nightnavy/midnightgreyf15/energy
orange s17
BB5787 blue/solar yellow/mystery blue s17
TEXTILE/SYNTHETICS
Theshoesthatredefinedcushioningwhenthey
launched.Thesemen'srunningshoesblend
aflexible,adaptivetechfitupperwiththe
plush,energy-filledrideofboost.Theresult
isalightweight,neutralrunningshoethatwill
invigorate runners of every level, at any distance.
TECHFITpersonalizedfitthroughafoot-hugging
textilewithzonedelasticsupport.
BOOSTultraresponsivecomfortandcushining
BA7941 deliv.01/17 BB5786 deliv.01/17 BB5787 deliv.01/17
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
[BA7941$Q]| [BB5786/.]| [BB5787#/]|

17Q1_FTW_EUR-CHF_019_053.indd 31 08.06.2016 11:44:20


32 Men - Neutral

energy boost 3 m *
supernova m
RUNNING

size 6-12.5; 13.5; 14.5 159,95


size 6-12.5; 13.5; 14.5 139,95
AQ1865 coreblack/darkgrey/dghsolidgrey
AQ5960 ftwrwhite/chsolidgrey/crystalwhite BB6035 core black/iron met./grey
s16 BB6037 blue/silver met./solar yellow
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Withtheperfectblendofflexibleandseamless Thesemen'srunningshoesmaximisetheenergy-
techfitupper,alightweight,adaptableoutsole returningbenefitsoftheirboostmidsolewith
andenergy-returningboostmidsole,thisisa alightweight,elasticSTRETCHWEBoutsole.An
runningshoethatinvigorates.Featuringanewly engineeredmeshupperwithseamlesspanels
engineeredFITFRAMEthatfitsnaturallytothe providessuperiorventilationandcomfort.The
heelandmidfoot. heelhugsandguidesyourfoot,whiletheoutsole
BOOSTultraresponsivecomfortandcushining gripsbothwetanddrysurfaces.
combinedwithunmatchedlongevityinevery ENGINEEREDMESHsupportivefitthrougha
climate.storesandunleashesenergyeverytime breathable,engineeredlightweighttextile.
thefoothitstheground AQ1865 deliv.01/17 AQ5960 deliv.01/17
FITCOUNTERsupportiveheelconstruction BB6035 deliv.12/16 BB6037 deliv.12/16
TECHFITpersonalizedfitthroughafoot-hugging designedtoenablethefreemotionofthe
textilewithzonedelasticsupport. achillestendon.
[AQ186509]| [AQ5960E.]| [BB6035FJ]| [BB6037HP]|

* PureBOOST
size 3.5-12.5; 13.5; 14.5 129,95 *
BA8895 collegiateburgundy/linens17/night
supernova m navy
size 6-12.5; 13.5; 14.5 139,95 BA8896 coreblues17/linens17/nightnavy
BA9933 vista grey s15/core black/unity blue f16 TEXTILE
TEXTILE/SYNTHETICS Builtforstreetrunningwithaminimalistsock-
ENGINEEREDMESHsupportivefitthrougha likeupper,thesemen'sshoesdeliverafast,
breathable,engineeredlightweighttextile. lightstride.Theboostmidsoleabsorbsthe
FITCOUNTERsupportiveheelconstruction energyfromeachimpactandreturnsitback
designedtoenablethefreemotionofthe foraresponsivefeel.Theknitupperadaptsto
achillestendon. theshapeofyourfootasitmoves,andaflexible
BOOSTultraresponsivecomfortandcushining STRETCHWEBoutsoleaddstotheenergy-fuelled
combinedwithunmatchedlongevityinevery ride.
climate.storesandunleashesenergyeverytime KNIT One piece knitted upper is engineered
thefoothitstheground fromAramisresearchforsuperiorcomfort
STRETCHWEB adapts to every runner's foot BA9933 deliv.12/16
andsupport.Wecanzonethedifferentstretch BA8895 deliv.02/17 BA8896 deliv.02/17
strikebyunleashingthefullpotentialofBOOST propertiesoftheknittocreateaunique,
toprovideasmootherandmoreflexibleride. adaptivefit.
[BA99330^]| [BA88957I]| [BA88968L]|

response + m
*
size 6-12.5; 13.5; 14.5 119,95
BB2983 vista grey s15/silver met./energy s17
BB2982 coreblack/ftwrwhite/utilityblackf16
BB1003 collegiateroyal/ftwrwhite/solaryellow
TEXTILE/SYNTHETICS
Thesemen'srunningshoesmaximisetheenergy-
returningbenefitsoftheirboostmidsolewith
alightweight,elasticSTRETCHWEBoutsole.An
airmeshupperwithseamlesspanelsprovides
superior ventilation and comfort.
STRETCHAIRMESHhighly-breathablestretch
upperforadaptivefitandcooling.
BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery BB2983 deliv.01/17 BB2982 deliv.01/17 BB1003 deliv.01/17
climate.storesandunleashesenergyeverytime
thefoothitstheground
[BB2983YI]| [BB2982XF]| [BB1003Y0]|

17Q1_FTW_EUR-CHF_019_053.indd 32 08.06.2016 11:44:44


Men - Neutral 33

questar m
size 6-12.5; 13.5; 14.5 99,95

RUNNING
S76936 mystery blue s17/silver met./blue
S76730 coreblack/ftwrwhite/granite
S76731 cleargreys12/ftwrwhite/mystery
blue s17
TEXTILE/SYNTHETICS
AIRMESHhighly-breathableupperforacooler
run.
FITCOUNTERsupportiveheelconstruction
designedtoenablethefreemotionofthe
achillestendon.
BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime
thefoothitstheground
S76936 deliv.12/16 S76730 deliv.12/16 S76731 deliv.12/16
TORSIONSYSTEMasystemthatmoveswiththe
footforasmooth,supportivetransitionfrom
landingtopush-off.
[S76936VR]| [S76730J%]| [S76731K^]|
Men - Stability
ultra boost st m
size 6-12.5; 13.5; 14.5 179,95
BA7837 blue/ftwrwhite/solaryellow
BA7838 coreblack/ironmet./dghsolidgrey
BA7839 grey/ftwrwhite/corereds17
TEXTILE/SYNTHETICS
Foraluxuriousandsupportivefeel,thesemen's
stabilityrunningshoesfeatureboostinthe
midsole. An adaptive adidas Primeknit upper
andergonomicheelgiveyoulightweightflexand
stabilityexactlywherethey'reneeded.
PRIMEKNITsuperiourseamfreefitthrough
apreciselyengineered,adaptive,lightweight
knitted textile created in one step.
BA7837 deliv.12/16 BA7838 deliv.12/16 BA7839 deliv.03/17
FITCOUNTERsupportiveheelconstruction
designedtoenablethefreemotionofthe
achillestendon.
[BA7837/W]| [BA7838+Z]| [BA7839%=]|

* supernova sequence 9 m
size 6-12.5; 13.5; 14.5 139,95
BB1612 lghsolidgrey/nightnavy/midnight
grey f15
BB1613 coreblack/ftwrwhite/scarlet
BB1614 blue/ftwrwhite/collegiatenavy
TEXTILE/SYNTHETICS
Theeverydaytrainingshoethatgetsyou
motivatedandkeepsyougoing.Thesemen's
stabilityrunningshoesfeatureanenergy-
returningboostmidsoleandaContinental
RubberoutsolewithSTRETCHWEBtoadapttothe
groundandoptimisethepropertiesofboost.
ENGINEEREDMESHsupportivefitthrougha
BB1612 deliv.12/16 BB1613 deliv.12/16 BB1614 deliv.12/16
breathable,engineeredlightweighttextile.
STABLEFRAMEguidesthefootandprovides
dynamic support.
[BB16126#]| [BB161370]| [BB161483]|

17Q1_FTW_EUR-CHF_019_053.indd 33 08.06.2016 11:45:14


34 Men - Stability

supernova st m
size 6-12.5; 13.5; 14.5 139,95
*
RUNNING

BB0992 mid grey s14/silver met./energy s17


BB3102 core blue s17/silver met./blue
BB3103 blue/silvermet./brightyellow
TEXTILE/SYNTHETICS
There'snoexcusenottorunwiththesemen's
shoes.ASTRETCHWEBoutsolemaximisesthe
energy-returningbenefitsoftheboostmidsole,
andanengineeredmeshupperwithseamless
panels provides superior ventilation and comfort.
Builtforstability,theheelhugsandguidesyour
foot,whiletheoutsolegripswetanddrysurfaces.
ENGINEEREDMESHsupportivefitthrougha
breathable,engineeredlightweighttextile.
FITCOUNTERsupportiveheelconstruction BB0992 deliv.04/17 BB3102 deliv.04/17 BB3103 deliv.04/17
designedtoenablethefreemotionofthe
achillestendon.
[BB0992R2]| [BB3102#M]| [BB3103^P]|

vengeful m
*
size 6-12.5; 13.5; 14.5 119,95
BA7938 blue/silver met./mystery blue s17
BB1630 brightorange/coreblack/ftwrwhite
BB1631 vista grey s15/vista grey s15/blue
TEXTILE/SYNTHETICS
Settlethescoreinthesemen'srunningshoes.
Contrastingdesignsonthemedialandlateral
sides give an intimidating look. Extra support on
themedialsideprovidesoptimaloverallstability,
whileboostgivesendlessenergy.
STRETCHAIRMESHhighly-breathablestretch
upperforadaptivefitandcooling.
BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery BA7938 deliv.01/17 BB1630 deliv.03/17 BB1631 deliv.01/17
climate.storesandunleashesenergyeverytime
thefoothitstheground
[BA7938#%]| [BB163081]| [BB163194]|
Men-Lightweight adizero boston 6 m
size 6-12.5 139,95 *
BA7933 mysteryblues17/nightnavy/blue
adizero adios m
size 6-12.5 149,95 TEXTILE/SYNTHETICS
Sleekandreadyforracingandfasttraining,these
BA7949 blue/ftwrwhite/easygreens17 men'slightweightrunningshoesofferaboost
TEXTILE/SYNTHETICS energy-returningmidsole.Theirtextileand
Wornbythetopmarathonfinishersintheworld, engineeredmeshupperhelpseliminatechafing,
thesemen'sfast,lightweightrunningshoesare reducesweightandprovidesaprecisefit.
craftedtofitthesizeofyourbiggestracegoals. MICROFITspecifictoalladizeromodels.
Theyfeatureboostenergyreturnandamodern designedforhighspeed,microfitlocksyourfoot
yet iconic design. downforadirectfitandfastrun
BOOSTultraresponsivecomfortandcushining BOOSTultraresponsivecomfortandcushining
combinedwithunmatchedlongevityinevery combinedwithunmatchedlongevityinevery
climate.storesandunleashesenergyeverytime climate.storesandunleashesenergyeverytime
thefoothitstheground thefoothitstheground
MICROFITspecifictoalladizeromodels. BA7949 deliv.01/17
STRETCHWEB adapts to every runner's foot BA7933 deliv.01/17
designedforhighspeed,microfitlocksyourfoot strikebyunleashingthefullpotentialofBOOST
downforadirectfitandfastrun toprovideasmootherandmoreflexibleride.
[BA794903]| [BA7933$R]|

17Q1_FTW_EUR-CHF_019_053.indd 34 08.06.2016 11:45:31


Men-Lightweight 35

adizero tempo m
Men - Springblade
size 6-12.5 139,95

RUNNING
springblade solyce m
BB4357 blue/nightnavy/easygreens17
size 6-12.5; 13.5; 14.5 179,95
TEXTILE/SYNTHETICS
Lightweightandreadyforspeed,thesemen's
B49640 core black/core black/core black
runningshoesofferstabilityformidfootto TEXTILE/SYNTHETICS
forefootrunners.Themeshupperhasstrategic Puttheacceleratortothefloorinthesemen's
overlaysforasnug,supportivefit,whilefull- runningshoes.Abreathablemeshupperrides
lengthboostdeliversmaximum energyreturn.A aboveafull-lengthspringbladeoutsolewith
durable rubber outsole offers secure grip. individually tuned energy blades to create an
BOOSTultraresponsivecomfortandcushining explosiveshoethat'sallgaspedal,nobrake.It
combinedwithunmatchedlongevityinevery featuresaneye-catchingpatternthataddstothe
climate.storesandunleashesenergyeverytime futuristic look.
thefoothitstheground AIRMESHhighly-breathableupperforacooler
ENGINEEREDMESHsupportivefitthrougha run.
breathable,engineeredlightweighttextile. SPRINGBLADE individually tuned springs
BB4357 deliv.01/17
MICROFITspecifictoalladizeromodels. B49640 deliv.12/16
compressandreleaseenergywitheverystepto
designedforhighspeed,microfitlocksyourfoot helppropelforward.
downforadirectfitandfastrun ADIWEAR extended protection against wear
[BB4357M=]| [B4964071]| and tear.
Men - Trail
*
adizero xt response tr m
size 6-12.5 149,95 size 6-12.5 119,95
AQ2369 core black/core blue s17/utility black BB1657 core blue s17/core black/energy
f16 orange s17
AQ2370 tactile orange s17/easy blue s17/clear BB1659 core black/utility black f16/core blue
brown s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Theselight,low-profilemen'srunningshoes Thesemen'srunningshoesaredesignedfor
are designed for moving fast over rugged trails. a responsive feel and superior traction across
boostcushioningprovidesanenergy-filledride, avarietyofterrain.Energy-returningboost
whileknitanklecuffshelpkeeppebblesandmud andameshuppergiveyoualight,fastride
out.Amountainbiketyre-inspiredTRAXION withsuperiorventilation.Adjustablelacingand
outsole provides secure grip. FITBANDSholdyourfootsecurewhileallowingit
BOOSTultraresponsivecomfortandcushining to move naturally.
AQ2369 deliv.01/17 AQ2370 deliv.01/17
combinedwithunmatchedlongevityinevery BB1657 deliv.01/17 BB1659 deliv.01/17
ZONEDPROTECTIONspecifictoallextreme
climate.storesandunleashesenergyeverytime models.protectiveoverlayscombinedwitha
thefoothitstheground durablemeshofferssupportforoff-roadruns.
[AQ2369/%]| [AQ2370XK]| [BB1657JW]| [BB1659L=]|
kanadia 8 tr m
size 6-12.5; 13.5; 14.5 89,95
BB4414 coreblues17/ftwrwhite/energys17
BB4415 tactileoranges17/chalkwhite/
collegiate burgundy
BB4416 core black/easy blue s17/trace grey s17
SYNTHETICS/TEXTILE
Durability,tractionandstabilitycometogether
inthesemen'strailrunningshoesbuiltona
TRAXIONoutsoleandanextra-softcloudfoam
midsole.Theairmeshupperisreinforcedwith
syntheticoverlaysforanidealfit.
ZONEDPROTECTIONspecifictoallextreme
models.protectiveoverlayscombinedwitha
durablemeshofferssupportforoff-roadruns.
CLOUDFOAMsuperplushfeel.
BB4414 deliv.12/16 BB4415 deliv.12/16 BB4416 deliv.12/16
TRAXIONgrippylugsthatensurebesttraction
whenrunningontrailsorinthemountain
region.
[BB4414EG]| [BB4415FJ]| [BB4416GM]|

17Q1_FTW_EUR-CHF_019_053.indd 35 08.06.2016 11:45:53


36 Men - Trail
RUNNING

duramo 7 trail m galaxy trail m


size 6-12.5; 13.5; 14.5 64,95 size 6-12.5; 13.5; 14.5 59,95
BB4428 coreblues17/ftwrwhite/energys17 BB4458 coreblues17/ftwrwhite/energyorange
BB4430 utility black f16/utility black f16/core s17
black BB4459 tactileoranges17/ftwrwhite/clay
TEXTILE/SYNTHETICS brown f15
Thesemen'strailrunningshoescombinesimple TEXTILE/SYNTHETICS
designwithexpertconstructionandmaterials Withmaximumtractionfortrailroutes,these
todeliverhighperformance.Abreathableair men'srunningshoesprovideultra-breathable
meshupperkeepsyourfeetcomfortable,while comfortandplushcushioning.Asyntheticandair
asoftcloudfoammidsoleprovideslightweight meshupperislightweightandventilating,while
cushioning. themidsoleisresponsiveoveroff-roadobstacles.
ZONEDPROTECTIONspecifictoallextreme ZONEDPROTECTIONspecifictoallextreme
models.protectiveoverlayscombinedwitha models.protectiveoverlayscombinedwitha
durablemeshofferssupportforoff-roadruns. BB4428 deliv.01/17 BB4430 deliv.01/17
durablemeshofferssupportforoff-roadruns. BB4458 deliv.12/16 BB4459 deliv.12/16
ADIWEAR extended protection against wear CLOUDFOAMsuperplushfeel.
and tear. ADIWEAR extended protection against wear
CLOUDFOAMsuperplushfeel. [BB4428KX]| [BB4430EE]| and tear. [BB4458Q1]| [BB4459R4]|
Men - Bounce
*

alphabounce 1 m
alphabounce hpc m size 6-12.5; 13.5; 14.5 99,95
size 6-12.5; 13.5; 14.5 109,95 BB9035 grey/clear onix/clear aqua
BB9048 coreblack/utilityblackf16/ftwrwhite BB9036 scarlet/blue/core black
TEXTILE TEXTILE
FUSEDMESHadaptivefitwithfused,zoned ADIWEAR extended protection against wear
support. and tear.
ADIWEAR extended protection against wear BOUNCE instant step in-comfort and responsive
and tear. BB9048 deliv.01/17
cushioning BB9035 deliv.12/16 BB9036 deliv.12/16
BOUNCE instant step in-comfort and responsive FUSEDMESHadaptivefitwithfused,zoned
cushioning support.
[BB9048WD]| [BB9035R&]| [BB9036S2]|

alphabounce rc m
size 6-12.5; 13.5; 14.5-15; 79,95
16-17
B42651 utility ivy f16/trace cargo s17/utility
grey f16
B42652 coreblack/ftwrwhite/utilityblackf16
B42857 cleargreys12/ftwrwhite/clearonix
TEXTILE
ADIWEAR extended protection against wear
and tear.
BOUNCE instant step in-comfort and responsive
cushioning B42651 deliv.12/16 B42652 deliv.01/17 B42857 deliv.01/17
FUSEDMESHadaptivefitwithfused,zoned
support.
[B42651T/]| [B42652U/]| [B42857+P]|

17Q1_FTW_EUR-CHF_019_053.indd 36 08.06.2016 11:46:14


Men - Bounce 37

* *

RUNNING
alphabounce rc m
size 6-12.5; 13.5; 14.5-15; 79,95
16-17
B42860 darkgreyheather/dghsolidgrey/
dark grey
TEXTILE
ADIWEAR extended protection against wear
and tear. alphabounce rc m
BOUNCE instant step in-comfort and responsive size 6-12.5; 13.5; 14.5-15; 79,95
cushioning 16-17
B42860 B42862
deliv.01/17
FUSEDMESHadaptivefitwithfused,zoned
deliv.01/17
B42862 chillmystred/mbdd/maroon/ftwr
support. white
[B42860-9]| [B42862=F]| TEXTILE

mana bounce 2 m aramis


size 6-12.5; 13.5; 14.5 79,95
B39021 core black/silver met./onix
B39022 brightyellow/coreblack/corereds17
BW0564ftwrwhite/silvermet./clearonix
TEXTILE
AIRMESHhighly-breathableupperforacooler
run.
BOUNCE instant step in-comfort and responsive
B39021 deliv.01/17 B39022 deliv.01/17 BW0564 deliv.01/17
cushioning
ADIWEAR extended protection against wear
and tear.
[B39021SZ]| [B39022T=]| [BW0564M8]|

17Q1_FTW_EUR-CHF_019_053.indd 37 08.06.2016 11:46:22


38 Men - Bounce

*
RUNNING

BB4653 deliv.12/16 BB4655 deliv.12/16 BB4656 deliv.12/16 BB4659 deliv.12/16 BB4661 deliv.12/16

duramo 8 m
size 6-12.5; 13.5; 14.5 69,95 [BB4653R0]| [BB4655T6]| [BB4656U9]| [BB4659XI]| [BB4661R&]|
BB4653 coreblack/ftwrwhite/coreblack
BB4655 coreblack/coreblack/ftwrwhite
BB4656 grey/ftwrwhite/onix
BB4659 mystery blue s17/collegiate navy/
collegiate navy
BB4661 brightyellow/darkgrey/darkgrey
BB4662 corereds17/ftwrwhite/coreblack
TEXTILE/SYNTHETICS
WithacloudfoammidsoleandmidfootTPUcage,
thesemen'srunningshoesdelivercushioned
responseandsupportwitheverystride.A
breathablemeshupperkeepsyourfeetwell
ventilated, and a durable outsole provides long-
lasting wear.
AIRMESHhighly-breathableupperforacooler
run.
CLOUDFOAMsuperplushfeel.
BB4662 deliv.12/16
ADIWEAR extended protection against wear
and tear.
[BB4662S2]|
Men - Cloadfoam

element refine 3 m
size 6-12.5; 13.5; 14.5 69,95
BB4849 onix/grey/chalkwhite
BB4846 core black/core black/core black
BB4847 mysteryblues17/nightnavy/chalk
white
TEXTILE
Acloudfoammidsolegivesthesemen'srunning
shoesacushionedresponsewitheverystepdown
andpushoff.Featuringaminimalistconstruction,
theshoeisbuiltwithabreathablerecycledmesh
upper to keep your feet well ventilated.
AIRMESHhighly-breathableupperforacooler
run. BB4849 deliv.02/17 BB4846 deliv.02/17 BB4847 deliv.02/17
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear. [BB4849.R]| [BB4846YI]| [BB4847ZL]|

17Q1_FTW_EUR-CHF_019_053.indd 38 08.06.2016 11:46:39


Men - Cloadfoam 39

RUNNING
energy cloud wtc m
size 6-12.5; 13.5; 14.5 64,95
BB3148 utility black f16/silver met./core black
BB3150 blue/collegiate navy/core black
BB3151 vistagreys15/ftwrwhite/brightyellow
TEXTILE/SYNTHETICS
FITFRAMEsupportivecageintheshoe'smidfoot
provides midfoot lockdown and optimum
transitioninallphasesoftherunninggait
BB3148 deliv.12/16 BB3150 deliv.12/16 BB3151 deliv.12/16
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear.
[BB3148BD]| [BB31505+]| [BB31516#]|

element refresh m
size 6-12.5 59,95
BA7908 blue/ftwrwhite/blue
energy cloud wtc m
BA7911 coreblack/ftwrwhite/coreblack
size 6-12.5; 13.5; 14.5 64,95 TEXTILE/SYNTHETICS
BB3157 grey/core black/blue Inspiredbythesimple,cleanandfunctional
designofPureboost,thisshoehelpsrunners
BB3158 energys17/ftwrwhite/coreblack movenaturallywhilegivingthemendlesscomfort
TEXTILE/SYNTHETICS throughtheSUPERCLOUDmidsoleandrubber
FITFRAMEsupportivecageintheshoe'smidfoot outsole.
provides midfoot lockdown and optimum AIRMESHhighly-breathableupperforacooler
transitioninallphasesoftherunninggait run.
BB3157 deliv.12/16 BB3158 deliv.12/16
CLOUDFOAMsuperplushfeel. BA7908 deliv.02/17 BA7911 deliv.02/17
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear ADIWEAR extended protection against wear
and tear. and tear.
[BB3157CF]| [BB3158DI]| [BA7908=R]| [BA7911XB]|

cosmic 1.1 m
size 6-12.5; 13.5; 14.5 59,95
BB3128 blue/ftwrwhite/collegiatenavy
BB3129 coreblack/corereds17/ftwrwhite
BB3130 grey/iron met./core black
TEXTILE/SYNTHETICS
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
BB3128 deliv.01/17 BB3129 deliv.01/17 BB3130 deliv.01/17
and tear.
AIRMESHhighly-breathableupperforacooler
run.
[BB312873]| [BB312986]| [BB31301V]|

17Q1_FTW_EUR-CHF_019_053.indd 39 08.06.2016 11:46:55


40 Men - Cloadfoam

*
RUNNING

cosmic m
size 6-12.5; 13.5; 14.5 59,95
BB4342 coreblues17/nightnavy/ftwrwhite
BB4344 core black/core black/utility black f16
BB4345 nightnavy/ftwrwhite/coreblues17
BB4347 grey/ftwrwhite/mysteryblues17
TEXTILE/SYNTHETICS
Thesehighlybreathablemen'srunningshoes
delivermaximumcomfortwithanairmeshupper.
Theyfeatureextra-softcloudfoamforresponsive
cushioningandaplushfeel.
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear. BB4342 deliv.01/17 BB4344 deliv.01/17 BB4345 deliv.01/17 BB4347 deliv.01/17
AIRMESHhighly-breathableupperforacooler
run.
[BB4342FI]| [BB4344HO]| [BB4345IR]| [BB4347KX]|

galaxy 3 m
size 6-12.5; 13.5; 14.5 49,95
BB4359 ftwrwhite/cleargreys12/cleargrey
s12
BB4360 collegiate navy/collegiate navy/blue
BB4361 collegiate royal/blue/blue
BB4363 core red s17/core red s17/scarlet
TEXTILE/SYNTHETICS
Withaclassiclookandaddedstability,these
men'srunningshoesdeliveranidealfit.A
breathableairmeshupperstretchesaroundthe
foot,whilecloudfoamgivesyouultracushioning.
AIRMESHhighly-breathableupperforacooler
run. BB4359 deliv.12/16 BB4360 deliv.12/16 BB4361 deliv.12/16 BB4363 deliv.12/16
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear. [BB4359O#]| [BB4360HM]| [BB4361IP]| [BB4363KV]|

galaxy 3.1 m
size 6-12.5; 13.5; 14.5 49,95
BA7794 core black/core black/utility black f16
BA7795 corereds17/coreblack/ftwrwhite
BA7796 grey/core black/blue
TEXTILE/SYNTHETICS
AIRMESHhighly-breathableupperforacooler
run.
CLOUDFOAMsuperplushfeel. BA7794 deliv.01/17 BA7795 deliv.01/17 BA7796 deliv.01/17
ADIWEAR extended protection against wear
and tear.
[BA7794&&]| [BA779502]| [BA779615]|

17Q1_FTW_EUR-CHF_019_053.indd 40 08.06.2016 11:47:11


Men - Cloadfoam 41

RUNNING
galaxy 3.1 m
size 6-12.5; 13.5; 14.5 49,95
BB3187 core black/core black/iron met.
TEXTILE/SYNTHETICS
AIRMESHhighly-breathableupperforacooler
run.
BB3187 deliv.01/17
CLOUDFOAMsuperplushfeel.
ADIWEAR extended protection against wear
and tear.
[BB3187IU]|

BB0805 deliv.12/16 BB0806 deliv.12/16 BB0807 deliv.12/16 BB0808 deliv.12/16 BB0809 deliv.12/16

[BB080596]| [BB0806A9]| [BB0807BC]| [BB0808CF]| [BB0809DI]|


duramo lite m
size 6-12.5; 13.5; 14.5 49,95
BB0805 mysteryblues17/silvermet./ftwrwhite
BB0806 coreblack/ironmet./ftwrwhite
BB0807 blue/collegiatenavy/ftwrwhite
BB0808 corereds17/ftwrwhite/scarlet
BB0809 darkgrey/nightmet.f13/coreblack
BB0810 clear grey s12/matte silver/grey
TEXTILE/SYNTHETICS
Men'srunningshoesdesignedforeveryday
training.Madewithalightweightmeshupperto
keepyourfeetventilated,theseshoesfeature
syntheticoverlaysforaddedsupport.Adurable
outsole provides long-lasting wear.
AIRMESHhighly-breathableupperforacooler
run.
CLOUDFOAMsuperplushfeel.
BB0810 deliv.12/16
ADIWEAR extended protection against wear
and tear.
[BB08106/]|

17Q1_FTW_EUR-CHF_019_053.indd 41 08.06.2016 11:47:26


42 Men - Track&Field

Men - Track&Field
RUNNING

adizero ambition 4
size 6-12.5 99,95
BB5774 solarred/ftwrwhite/coreblack
TEXTILE/SYNTHETICS distancestar
Readytoflyassoonasthegungoesoff,these size 6-12.5; 13.5; 14.5 69,95
men'smiddle-distancespikesgetyouacrossthe
finishlinewithspeed.Madewithanultra-light,
BB5753 ftwrwhite/solarred/solarred
supportivetwo-meshupperandamoulded TEXTILE/SYNTHETICS
outsolewithreplaceablespikesthatdiginand Setthepacetofastinthesemen'slightweight
launchyouforward. spikesbuiltforcompetition.Withameshupper
SPRINTWEBlightweightuppersupportforelite tokeepyourfeetcool,thesetrackandfield
performance. shoesarecomfortable,durableandprimedfor
MICROFITspecifictoalladizeromodels. maximum performance.
designedforhighspeed,microfitlocksyourfoot SYNTHETICLEATHERlightweightsupport
downforadirectfitandfastrun BB5774 deliv.01/17
MESHbreathablemeshupper BB5753 deliv.01/17
PEBAXPLATElightweight SPIKE PINS ultimate grip
SPIKE PINS ultimate grip EVAPLATElightweight
[BB5774$T]| [BB5753YG]|

jumpstar
size 6-12.5; 13.5 69,95
BB5759 ftwrwhite/solarred/ftwrwhite
TEXTILE/SYNTHETICS
Leapwithpowerinthesemen'sjumpingspikes
distancestar builttohelpathletestakeflight.Madewitha
size 6-12.5; 13.5; 14.5 69,95 syntheticandmeshupperforbreathabilityand
durability,theseshoesarelightweightandwell-
BB5755 blue/ftwrwhite/easygreens17 balanced.
TEXTILE/SYNTHETICS SYNTHETICLEATHERlightweightsupport
SYNTHETICLEATHERlightweightsupport MESHbreathablemeshupper
MESHbreathablemeshupper BB5755 deliv.01/17
SPIKE PINS ultimate grip BB5759 deliv.01/17
SPIKE PINS ultimate grip EVAPLATElightweight
EVAPLATElightweight TRAXION RUBBER ultimate grip
[BB5755-M]| [BB5759/Y]|

sprintstar
size 6-12.5; 13.5; 14.5 69,95
BB5746 solarred/ftwrwhite/solarred
SYNTHETICS sprintstar
Eatupthetrackinthesesprintspikesbuiltfor size 6-12.5; 13.5; 14.5 69,95
speed.Madeoflightweight,durablematerial,the
singulardesignsetsthesespikesapartfromthe BB5748 ftwrwhite/coreblack/gloworanges14
rest, and makes your style clear. SYNTHETICS
SYNTHETICLEATHERlightweightsupport SYNTHETICLEATHERlightweightsupport
PEBAXPLATElightweight BB5746 deliv.01/17
PEBAXPLATElightweight BB5748 deliv.01/17
SPIKE PINS ultimate grip SPIKE PINS ultimate grip
TRAXION RUBBER ultimate grip TRAXION RUBBER ultimate grip
[BB5746ZK]| [BB5748.Q]|

17Q1_FTW_EUR-CHF_019_053.indd 42 08.06.2016 11:47:35


Men - Track&Field 43

RUNNING
throwstar
size 6-12.5; 13.5; 14.5 69,95
BB5763 solarred/ftwrwhite/solarred
SYNTHETICS/TEXTILE
Harnesspowerwiththesemen'slightweight
trackandfieldshoes.Theyfeatureasupportive
syntheticupper,midfootstrapandsoftcollar
forcomfort.Designedforthrowingeventslike
hammer,shotputanddiscus.
SYNTHETICLEATHERlightweightsupport
BB5763 deliv.01/17
MESHbreathablemeshupper
FITSTRAPsnugfit
TRAXION RUBBER ultimate grip
[BB5763-L]|

17Q1_FTW_EUR-CHF_019_053.indd 43 08.06.2016 11:47:37


44 Unisex - adizero

Unisex - adizero
RUNNING

adizero md adizero HJ
size 4-12.5 129,95 size 4-14.5 129,95
BA9879 ftwrwhite/solarred/silvermet. BB4098 ftwrwhite/solarred/silvermet.
TEXTILE/SYNTHETICS SYNTHETICS/TEXTILE
Maintainyourspeedthroughoutyourcompetition Builtforspeedthroughtheverticaljump,these
withtheselightweightmiddle-distancetrackand trackandfieldshoessupportplantingand
fieldspikes.Theasymmetricaldesignprovides jumpingwithpower.Theyfeaturealightweight
addedstabilityforcurvesandstraightaways,while textile upper and a midfoot strap for a locked-
theboostmidsoleprovidesexceptionalenergy downfit.Ameshheelgivesbreathablecomfort.
return. SYNTHETICLEATHERlightweightsupport
SPRINTWEBlightweightuppersupportforelite ENGINEEREDMESHsupportivefitthrougha
performance. breathable,engineeredlightweighttextile.
MESHbreathablemeshupper BA9879 deliv.01/17
PEBAXPLATElightweight BB4098 deliv.01/17
PEBAXPLATElightweight SPIKE PINS ultimate grip
SPIKE PINS ultimate grip SHARKSKINlightweightgrip
[BA9879BT]| [BB4098M/]|

adizero lj
size 4-12.5; 13.5; 14.5 129,95
adizero javelin
BB4100 ftwrwhite/solarred/silvermet.
size 4-13.5; 14.5 129,95
TEXTILE/SYNTHETICS
BB4099 solarred/ftwrwhite/silvermet. Lowtothegroundandbuiltfortopspeedonthe
TEXTILE/SYNTHETICS runway,theselong-jumpspikesaredesigned
Lightweightyetpowerful,thesejavelinshoes forhighperformance.Madeoflightweight,
combinestyleandfunction.Theyfeatureamidfoot breathablematerials,withastableforefoot,the
straptokeepfeetsecure,asharkskin-textured design is simple and streamlined.
outsole and an abrasion-resistant toe cap made SYNTHETICLEATHERlightweightsupport
for dragging. ENGINEEREDMESHsupportivefitthrougha
SYNTHETICLEATHERlightweightsupport breathable,engineeredlightweighttextile.
MESHbreathablemeshupper MICROFIBRE STRIPES strong lockdown
PEBAXPLATElightweight BB4099 deliv.01/17
PEBAXPLATElightweight BB4100 deliv.01/17
SHARKSKINlightweightgrip SPIKE PINS ultimate grip
SPIKE PINS ultimate grip SHARKSKINlightweightgrip
[BB4099N/]| [BB4100&P]|
adizero avanti
size 3.5-12.5 129,95
BA9878 ftwrwhite/solarred/silvermet.
TEXTILE/SYNTHETICS adizero finesse
Theselightweightrunningspikesfeatureboost size 4-12.5 129,95
inthemidsoleforendlessenergyreturn.With
auniquefour-pinspikeplacementforalighter
BB4097 ftwrwhite/solarred/silvermet.
andsuperiortrackgrip,theseshoesaremeant SYNTHETICS/TEXTILE
for speed. Theseextremelylightweighttrackspikesare
MICROFITspecifictoalladizeromodels. madeforsprinterswhothriveonbeingfastout
designedforhighspeed,microfitlocksyourfoot oftheblock.Designedforspeedandfrequency,
downforadirectfitandfastrun asyntheticuppercombinedwithanengineered
ENGINEEREDMESHsupportivefitthrougha meshheellocksthefootinplaceformaximum
breathable,engineeredlightweighttextile. performance potential.
BOOSTultraresponsivecomfortandcushining MICROFITspecifictoalladizeromodels.
combinedwithunmatchedlongevityinevery designedforhighspeed,microfitlocksyourfoot
climate.storesandunleashesenergyeverytime BA9878 deliv.01/17
downforadirectfitandfastrun BB4097 deliv.01/17
thefoothitstheground PEBAXPLATElightweight
PEBAXPLATElightweight STICKY RUBBER ultimate grip
[BA9878AQ]| [BB4097L.]|

17Q1_FTW_EUR-CHF_019_053.indd 44 08.06.2016 11:47:52


Unisex - adizero 45

RUNNING
adizero prime sp adizero discus/hammer
size 5-12.5 199,95 size 5-15; 16 129,95
BB4117 ftwrwhite/solarred/silvermet. BB4955 red/ftwrwhite/solarred
SYNTHETICS TEXTILE/SYNTHETICS
Iflessismore,thentheselightweightsprint Builttowithstandthepowerandspeedthrowers
spikesarethepinnacleofmore:morespeed, need,thesediscusandhammerthrowshoesare
moreperformance,morepure.Theyfeaturea alightweightanchor.TheADIWEARoutsole
leather-likehigh-performancesyntheticupper. providesabruptstoppingability,andthewide
Theseamlessinternalsupportandspikeplate strapoverthemidfootensuresstability.
contributetothelightweight. MICROFITspecifictoalladizeromodels.
SYNTHETICLEATHERlightweightsupport designedforhighspeed,microfitlocksyourfoot
BB4117 deliv.01/17
MICROFIBRE STRIPES strong lockdown BB4955 deliv.01/17
downforadirectfitandfastrun
SPIKE PINS ultimate grip FITSTRAPsnugfit
NANOPLATElighweight STICKY RUBBER ultimate grip
[BB411784]| [BB4955=R]|

adizero accelerator
size 7-12.5; 13.5 129,95
adizero tj/pv
BB4954 ftwrwhite/solarred/silvermet.
size 4-14.5 129,95
SYNTHETICS/TEXTILE
BB4956 ftwrwhite/solarred/silvermet.
Theserace-readytrackspikesarebuilttocarry
powersprintersattopspeed.Themouldedsix- SYNTHETICS/TEXTILE
spike outsole provides maximum energy return. Thesetriplejumpandpolevaultingspikesare
Anultra-lightsyntheticupperwithsupportstrap lightweight,lowtothegroundandbuiltforspeed
locksdownthefit,andengineeredmeshinthe ontherunway.Featuringamidfootstrapfor
heeladdsbreathability. lockdownsupportwhenjumpingofftheground.
MICROFITspecifictoalladizeromodels. ENGINEEREDMESHsupportivefitthrougha
designedforhighspeed,microfitlocksyourfoot breathable,engineeredlightweighttextile.
BB4954 deliv.01/17
downforadirectfitandfastrun BB4956 deliv.01/17
FOREFOOT STRAP ultimate lockdown
PEBAXPLATElightweight SPIKE PINS ultimate grip
SPIKE PINS ultimate grip SHARKSKINlightweightgrip
[BB4954.O]| [BB4956$U]|

17Q1_FTW_EUR-CHF_019_053.indd 45 08.06.2016 11:48:01


adidas.com/adidasterrex

17Q1_FTW_EUR-CHF_019_053.indd 46 08.06.2016 11:48:29


TERREX 47

TERREX FTW SS17

TERREX
SEGMENTATION
DRIVEN
BRAND
COMMERCIAL
DRIVEN
BRAND
COMMERCIAL
DRIVEN
BRAND
COMMERCIAL

17Q1_FTW_EUR-CHF_019_053.indd 47 08.06.2016 11:48:34


48 TERREX
Men

Men selected accounts only

selected accounts only


TERREX

TERREX SCOPE HIGH GTX


size 5.5-12.5; 13.5; 14.5 199,95
TERREX SCOPE GTX
BB4587 core blue s17/core black/collegiate
size 5.5-12.5; 13.5; 14.5 159,95
navy
TEXTILE/SYNTHETICS BB0785 core blue s17/core black/collegiate
Lining:GORE-TEX Performance Comfort navy
membrane.Waterproofandbreathable. TEXTILE/SYNTHETICS
Collar Neoprene collar for comfort and Lining:GORE-TEX Performance Comfort
protection. membrane.Waterproofandbreathable.
Sockliner:MoldedOrtholite sockliner. Outsole:ApproachspecificOutsolefeaturing
Midsole:adiPRENE insert for comfort and STEALTH rubber for unbeatable grip.
shockabsorption. BB4587 deliv.01/17
Midsole:adiPRENE insert for comfort and BB0785 deliv.01/17
Outsole:ApproachspecificOutsolefeaturing shockabsorption.
STEALTH rubber for unbeatable grip. Sockliner:MoldedOrtholite sockliner.
[BB4587YK]| [BB0785M$]|
TERREX TRAIL CROSS SL
size 3.5-12.5; 13.5; 14.5 129,95
selected accounts only BB0714 umber f15/core black/energy s17 selected accounts only
BB0715 energyblues17/coreblack/bright
orange
TERREX TRAIL CROSS PROTECT TEXTILE/SYNTHETICS
size 5.5-12.5; 13.5; 14.5 149,95 Hikeandbiketechnicaltrailsinthesehybrid
outdoorshoesformen.TheStealth rubber
BB4772 coreblack/coreblack/ftwrwhite outsolecombinesoutstandinghikingtraction
TEXTILE/SYNTHETICS withoptimalpedallingpower.Thebreathable
Upper:Highabrasionmaterialfordurabilityand meshupperfeaturesweldingonthetoeforextra
protection. protection.AStealth rubber outsole gives you
Upper:Rubbertoecapforprotection. exceptionalgripforattackingtechnicaltrails.
Midsole:Pro-Moderatorforprotectionand Outsole:Stealthrubberforunbeatablegrip.
midfoot stability. Upper:Highabrasionmaterialfordurabilityand
Outsole:3zoneswithtailoredlugdesignsfor protection.
ascenting, descenting and pedaling. BB4772 deliv.01/17
Upper:Rubbertoecapforprotection. BB0714 deliv.12/16 BB0715 deliv.12/16
Upper:AnkleProtection Midsole:Pro-Moderatorforprotectionand
Outsole:Stealthrubberforunbeatablegrip. midfoot stability.
[BB4772XE]| [BB071471]| [BB071584]|
TERREX SOLO
size 5.5-12.5; 13.5; 14.5 129,95
BB5561 darkgrey/coreblack/chsolidgrey
BB5562 core blue s17/core black/collegiate
navy
BB5563 unity lime f16/core black/core blue s17
TEXTILE/SYNTHETICS
Light,fastandflexible,theselow-cutmen's
approachshoesarebuilttohandleboulder
hoppingandscramblingwithease.Thehybridof
afasthikerandanapproachshoe,itfeaturesa
climbingzonewithStealthrubberintheforefoot
andaTRAXIONoutsolethatenhancesground
contact and grip. A rubber toe cap is designed for
protection on rocks.
Upper:Openmeshupperforbreathabilityand
comfort. BB5561 deliv.01/17 BB5562 deliv.01/17 BB5563 deliv.01/17
Upper:Abrasionresistantweldingsfor
protection.
[BB5561S1]| [BB5562T4]| [BB5563U7]|

17Q1_FTW_EUR-CHF_019_053.indd 48 08.06.2016 11:48:56


Men 49

TERREX SWIFT SOLO

TERREX
size 5.5-12.5; 13.5; 14.5 99,95
TERREX FAST GTX-SURROUND
BB1992 vista grey s15/core black/energy s17 size 5.5-12.5; 13.5; 14.5 179,95
BB1993 coreblues17/chalkwhite/unitylime
f16
BB0948 core black/core black/vista grey s15
TEXTILE/SYNTHETICS BB0949 onix/onix/unity lime f16
Upper:Breathablesocklikeconstructionfora TEXTILE/SYNTHETICS
snugfitandcomfort. Upper:Speedlacingconstructionforfastand
Collar/Tongue:PerforatedEVAwithamesh snug lacing.
coverforbreathabilityandcomfort Sockliner:MoldedOrtholite sockliner.
Upper:Openmeshupperforbreathabilityand GTX-SurroundVentilationthroughmidsole
comfort. sidewallwithclosedoutsoleandGORE-TEX
Slip-on construction for easy and comfortable ExtendedComfortFootwearforenhanced
on and off. breathabilityand360degreeclimatecomfort
BB1992 deliv.01/17 BB1993 deliv.01/17
Outdole:Onepiecemoldedforefoot-toecapand BB0948 deliv.01/17 BB0949 deliv.01/17
withoutcompromisingonwaterproofprotection.
climbing zone- featuring STEALTH rubber for Outsole:ContinentalRubberforextraordinary
unbeatable grip. grip.
[BB1992VB]| [BB1993WE]| [BB0948N%]| [BB0949O^]|
TERREX FAST R MID GTX
size 5.5-12.5 179,95 TERREX FAST R GTX
S82179 core blue s17/core black/energy s17 size 5.5-12.5 159,95
BA8042 coreblack/coreblack/ftwrwhite S82178 core blue s17/core black/energy s17
TEXTILE/SYNTHETICS BA8048 coreblack/coreblack/ftwrwhite
Bequickandsure-footedonroughtrailsin TEXTILE/SYNTHETICS
thesefasthikingshoesformen.Thelightweight Bequickandsure-footedonthemountainin
mid-cut upper features protective overlays and a thesefasthikingshoesformen.Thelightweight
breathable,waterproofGORE-TEX membrane. upper features protective overlays and a
Asnug-fittingneopreneheelkeepsoutdirtand breathable,waterproofGORE-TEX membrane.
debris, and FORMOTIONgivesalower-to-the- FORMOTIONgivesalower-to-the-groundfeelfor
groundfeelforcontrolandcomfortondownhills. controlandcomfortondownhills.AContinental
PROMODERATORmedialandlateralsupport Rubber outsole gives you extraordinary grip on
providesadditionalstability,whileaContinental roughsurfaces.
Rubberoutsoleoffersextraordinarygriponrough Lining:GORE-TEX Extended Comfort Footwear.
surfaces. Collar Neoprene collar for comfort and
S82179 deliv.01/17 BA8042 deliv.01/17
Lining:GORE-TEX Extended Comfort Footwear. S82178 deliv.01/17 BA8048 deliv.01/17
protection.
Collar Neoprene collar for comfort and Midsole:OutdoorspecificFORMOTIONunitfor
protection. enhancedmotioncontrolanddownhillcomfort.
[S821797M]| [BA8042HM]| [S821786J]| [BA8048N/]|

FAST X HIGH GTX


size 5.5-12.5; 13.5; 14.5 169,95
AF5970 core black/dark grey/power red
TEXTILE/SYNTHETICS
Forversatilehikesovervariedterrain,thesehigh-
cutmen'soutdoorshoeskeepyoulightandstable
onfoot.Withawaterproof,breathableGORE-TEX
membraneandaContinentalRubberoutsolefor
extraordinary grip.
Lining:GORE-TEX Extended Comfort Footwear.
Midsole Full forefoot adiPRENE+ for forefoot
propulsion&efficiency.
Midsole:OutdoorspecificFORMOTIONunitfor
AF5970 deliv.12/16
enhancedmotioncontrolanddownhillcomfort.
Outsole:ContinentalRubberforextraordinary
grip.
[AF59708F]|

17Q1_FTW_EUR-CHF_019_053.indd 49 08.06.2016 11:49:16


50 Men
TERREX

TERREX SWIFT R MID GTX


size 5.5-12.5; 13.5; 14.5 149,95
BB4638 core black/core black/dark grey
BB4641 unitylimef16/coreblack/chalkwhite
BA9943 coreblues17/coreblack/chalkwhite
TEXTILE/SYNTHETICS
Lining:GORE-TEX Extended Comfort Footwear.
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:adiPRENE insert for comfort and
shockabsorption.
Midsole:LightweightEVAmidsoleforlongterm
cushioning. BB4638 deliv.01/17 BB4641 deliv.01/17 BA9943 deliv.01/17
Outsole:SuperHighTractionRubberfor
optimal grip in wet conditions.
[BB4638S5]| [BB4641N-]| [BA994323]|

TERREX SWIFT R MID


size 5.5-12.5; 13.5; 14.5 139,95
BB4590 granite/coreblack/chsolidgrey
TEXTILE/SYNTHETICS
Midsole:adiPRENE insert for comfort and
shockabsorption.
Midsole:LightweightEVAmidsoleforlongterm
cushioning.
Sockliner:Moldedsocklinertoenhancecomfort
andfit. BB4590 deliv.01/17
Outsole:SuperHighTractionRubberfor
optimal grip in wet conditions.
[BB4590T4]|

17Q1_FTW_EUR-CHF_019_053.indd 50 08.06.2016 11:49:22


Men 51

TERREX
BB4624 deliv.01/17 BB4628 deliv.01/17 BB4627 deliv.01/17 BB4626 deliv.01/17 TERREX SWIFT R GTX
size 5.5-12.5; 13.5; 14.5 129,95
[BB4624MZ]| [BB4628Q0]| [BB4627P#]| [BB4626O+]| BB4624 core black/core black/dark grey
BB4628 brown/core black/simple brown
BB4627 core black/core black/energy green s17
BB4626 core black/core black/energy s17
BB4631 energys17/coreblack/chalkwhite
BB4633 unitylimef16/coreblack/chalkwhite
BB4632 energygreens17/coreblack/bright
yellow
BB4630 mystery blue s17/core black/energy
green s17
BA8037 coreblues17/coreblack/chalkwhite
TEXTILE/SYNTHETICS
Lining:GORE-TEX Extended Comfort Footwear.
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:adiPRENE insert for comfort and
shockabsorption.
BB4631 deliv.01/17 BB4633 deliv.01/17 BB4632 deliv.01/17 BB4630 deliv.01/17 BA8037 deliv.01/17
Midsole:LightweightEVAmidsoleforlongterm
cushioning.
Outsole:SuperHighTractionRubberfor
[BB4631LV]| [BB4633N.]| [BB4632MY]| [BB4630KS]| [BA8037KW]| optimal grip in wet conditions.

TERREX SWIFT R
size 5.5-12.5; 13.5; 14.5 109,95
BB4594 core black/core black/energy green s17
BB4597 energygreens17/coreblack/chalk
white
BY2778 mysteryblues17/coreblack/chalk
white
BB4593 energys17/coreblack/chalkwhite
BA8039 core black/core black/dark grey
TEXTILE/SYNTHETICS
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:adiPRENE insert for comfort and
shockabsorption.
Midsole:LightweightEVAmidsoleforlongterm
BB4594 deliv.01/17 BB4597 deliv.01/17 BY2778 deliv.01/17 BB4593 deliv.01/17 BA8039 deliv.01/17
cushioning.
Outsole:SuperHighTractionRubberfor
optimal grip in wet conditions.
[BB4594XG]| [BB4597-P]| [BY27785W]| [BB4593WD]| [BA8039M=]|

17Q1_FTW_EUR-CHF_019_053.indd 51 08.06.2016 11:49:49


52 Men
TERREX

TERREX AX2R MID GTX


size 5.5-14.5 129,95
BB4602 core black/core black/vista grey s15
BB4604 core blue s17/core black/mystery
blue s17
TEXTILE/SYNTHETICS
Lining:GORE-TEX Extended Comfort Footwear.
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:LightweightEVAmidsoleforlongterm
cushioning.
Midsole:adiPRENE insert for comfort and
shockabsorption. BB4602 deliv.01/17 BB4604 deliv.01/17
Outsole:SuperHighTractionRubberfor
optimal grip in wet conditions.
[BB4602GJ]| [BB4604IP]|

TERREX AX2R GTX


size 5.5-12.5; 13.5; 14.5 119,95
BB1986 core blue s17/core black/mystery
blue s17
BB1987 nightbrown/coreblack/brown
BB1988 core black/core black/energy s17
BA8040 core black/core black/vista grey s15
TEXTILE/SYNTHETICS
Lining:GORE-TEX Extended Comfort Footwear.
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:LightweightEVAmidsoleforlongterm
cushioning.
Outsole:SuperHighTractionRubberfor BB1986 deliv.01/17 BB1987 deliv.01/17 BB1988 deliv.01/17 BA8040 deliv.01/17
optimal grip in wet conditions.
Midsole:adiPRENE insert for comfort and
shockabsorption. [BB1986XI]| [BB1987YL]| [BB1988ZO]| [BA8040FG]|

AX2 CP
size 5.5-12.5; 13.5; 14.5 99,95
BA9253 core black/granite/dark grey
TEXTILE/SYNTHETICS
Water-resistantCLIMAPROOFupperwithseam-
sealed membrane for water-resistance and
breathability
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:LightweightEVAmidsoleforlongterm
cushioning.
Midsole:adiPRENE insert for comfort and
shockabsorption. BA9253 deliv.12/16
Outsole:SuperHighTractionRubberfor
optimal grip in wet conditions.
[BA9253U6]|

17Q1_FTW_EUR-CHF_019_053.indd 52 08.06.2016 11:50:02


Men 53

TERREX
TERREX AX2R
size 5.5-12.5; 13.5; 14.5 89,95
BB1980 core blue s17/core black/mystery
blue s17
BB1982 energy s17/energy s17/core black
BB1981 brown/coreblack/nightbrown
BB1979 granite/coreblack/chsolidgrey
BA8041 core black/core black/vista grey s15
TEXTILE/SYNTHETICS
Sockliner:Moldedsocklinertoenhancecomfort
andfit.
Midsole:LightweightEVAmidsoleforlongterm
cushioning.
BB1980 deliv.01/17 BB1982 deliv.01/17 BB1981 deliv.01/17 BB1979 deliv.01/17 BA8041 deliv.01/17
Midsole:adiPRENE insert for comfort and
shockabsorption.
Outsole:SuperHighTractionRubberfor
[BB1980R0]| [BB1982T6]| [BB1981S3]| [BB1979YM]| [BA8041GJ]| optimal grip in wet conditions.

TERREX XKING
size 6-12 149,95
BB5443 coreblack/coreblack/chalkwhite
TEXTILE/SYNTHETICS TERREX SKYCHASER GTX
Amountainbiketyreforyourfeet.Thesemen's size 5.5-12.5; 13.5; 14.5 179,95
trailshoesarelightweightandprotectiveand BB0938 coreblack/coreblack/ftwrwhite
featureatyre-specificoutsoleconstruction
toreduceweightandstaylowtotheground. BB0939 vista grey s15/core black/energy s17
ContinentalRubbergivesyouextraordinarygrip TEXTILE/SYNTHETICS
on mountain runs. Upper:Speedlacingconstructionforfastand
Upper:Speedlacingconstructionforfastand snug lacing.
snug lacing. Lining:GORE-TEX Extended Comfort Footwear.
Midsole:UltralightweightinternalEVAmidsole Midsole:Boostoffersendlessenergyin
forlongtermcushioning. themountainsandhighadaptabilityonrocky
BB5443 deliv.01/17
MTBtiresforyourfeet:Directlymoldedto BB0938 deliv.01/17 BB0939 deliv.01/17
surfaces.
upper-fulllengthContinentalRubberfor Outsole:ContinentalRubberforextraordinary
extraordinary grip. grip.
[BB5443N.]| [BB0938L.]| [BB0939M/]|

TERREX SKYCHASER
size 5.5-12.5; 13.5; 14.5 159,95
BB0940 darkgrey/coreblack/ftwrwhite
BB0941 vista grey s15/core black/energy s17
BB0942 core blue s17/core black/unity lime f16
TEXTILE/SYNTHETICS
Upper:Speedlacingconstructionforfastand
snug lacing.
Midsole:Pro-Moderator-thinTPUfilmonthe
heelforextrastability.
Midsole:Boostoffersendlessenergyin
themountainsandhighadaptabilityonrocky
BB0940 deliv.01/17 BB0941 deliv.01/17 BB0942 deliv.01/17
surfaces.
Outsole:ContinentalRubberforextraordinary
grip.
[BB0940FI]| [BB0941GL]| [BB0942HO]|

17Q1_FTW_EUR-CHF_019_053.indd 53 08.06.2016 11:50:21


54 Men
TERREX

BB0953 deliv.01/17 BB0954 deliv.01/17 BB0955 deliv.01/17 BB0956 deliv.01/17 BB0958 deliv.01/17

[BB0953KW]| [BB0954LZ]| [BB0955M=]| [BB0956N+]| [BB0958P0]|


TERREX AGRAVIC GTX
size 5.5-12.5; 13.5; 14.5 149,95
BB0953 core black/core black/ftwr white
BB0954 dark grey/core black/bright yellow
BB0955 vista grey s15/core black/energy s17
BB0956 core blue s17/core black/unity lime f16
BB0958 energy s17/core black/core blue s17
BB0959 energy green s17/core black/bright
yellow
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces.
BB0959 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB0959Q3]|

17Q1_FTW_EUR-CHF_054_103.indd 54 08.06.2016 11:38:26


Men 55

TERREX
BB0962 deliv.01/17 BB0965 deliv.01/17 BB0966 deliv.01/17 BB0960 deliv.01/17 BB6001 deliv.01/17

[BB0962LY]| [BB0965O/]| [BB0966P&]| [BB0960JS]| [BB60015$]| TERREX AGRAVIC


size 5.5-12.5; 13.5; 14.5 129,95
BB0962 vista grey s15/core black/energy s17
BB0965 energy s17/core blue s17/core black
BB0966 energy green s17/bright yellow/core
black
BB0960 core black/core black/vista grey s15
BB6001 energy s17/core black/ftwr white
BB6002 core blue s17/core black/ftwr white
BB0961 dark grey/core black/bright yellow
BB0963 core blue s17/unity lime f16/tactile
green s17
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces.
BB6002 deliv.01/17 BB0961 deliv.01/17 BB0963 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB60026%]| [BB0961KV]| [BB0963M.]|

17Q1_FTW_EUR-CHF_054_103.indd 55 08.06.2016 11:38:46


56 Men
TERREX

BB1956 deliv.01/17 BB1958 deliv.01/17 BB1957 deliv.01/17 BB1955 deliv.01/17 BB6025 deliv.01/17
TERREX AGRAVIC SPEED
size 5.5-12.5; 13.5; 14.5 129,95
[BB1956R3]| [BB1958T9]| [BB1957S6]| [BB1955Q0]| [BB6025DE]|
BB1956 core black/core black/energy s17
BB1958 collegiate navy/core blue s17/core
blue s17
BB1957 vista grey s15/vista grey s15/core blue
s17
BB1955 core black/core black/ftwr white
BB6025 energy green s17/energy green s17/
collegiate green
BB3063 energy s17/energy s17/core black
TEXTILE/SYNTHETICS
Upper: Breathable sock like construction for a
snug fit and comfort.
Collar / Tongue: Perforated EVA with a mesh
cover for breathability and comfort
Upper: Abrasion resistant weldings for
protection.
Midsole: Lightweight EVA midsole for long term
cushioning and comfort.
BB3063 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB306371]|
TERREX TRAILMAKER GTX
size 5.5-12.5; 13.5; 14.5 129,95
BB0721 core black/vista grey s15/utility black
f16
BB0722 vista grey s15/core black/energy s17
BB0723 core blue s17/core black/unity lime f16
BB0724 energy s17/core black/ftwr white
TEXTILE/SYNTHETICS
Conquer technical trails with these speedy trail
running shoes for men. The lightweight upper
features highly abrasion-resistant welding for
extra protection in the toe area. A GORE-TEX
lining gives you a waterproof and breathable
barrier against the weather, while the outsole
provides Continental Rubber for extraordinary
grip over rugged terrain.
BB0721 deliv.01/17 BB0722 deliv.01/17 BB0723 deliv.01/17 BB0724 deliv.01/17
Upper: Speed lacing construction for fast and
snug lacing.
[BB07216#]| [BB072270]| [BB072383]| [BB072496]|

17Q1_FTW_EUR-CHF_054_103.indd 56 08.06.2016 11:39:07


Men 57

TERREX
TERREX TRAILMAKER
size 5.5-12.5; 13.5; 14.5 109,95
BB3355 core black/vista grey s15/utility black
f16
BB3357 core blue s17/core black/unity lime f16
BB3358 energy s17/core black/ftwr white
BB3359 core black/core blue s17/core black
TEXTILE/SYNTHETICS
Upper: Speed lacing construction for fast and
snug lacing.
Upper: Abrasion resistant weldings for
protection.
Midsole: Lightweight EVA midsole for long term
BB3355 deliv.01/17 BB3357 deliv.01/17 BB3358 deliv.01/17 BB3359 deliv.01/17
cushioning.
Outsole: Continental Rubber for extraordinary
grip.
[BB3355GN]| [BB3357IT]| [BB3358JW]| [BB3359KZ]|

KANADIA 7 TR GTX
size 5.5-12.5; 13.5; 14.5 99,95
S82877 dark grey/core black/chalk white
BB5428 core black/core black/energy s17
BB5429 mystery blue s17/core black/core
blue s17
BB5430 energy s17/core black/bright orange
BB5431 utility ivy f16/core black/unity lime f16
TEXTILE/SYNTHETICS
These rugged, lightweight outdoor shoes are
made for trail-running. The men's shoes keep
feet dry and protected with waterproof and
breathable GORE-TEX. A TRAXION outsole
grips unpredictable terrain.
S82877 deliv.12/16 BB5428 deliv.01/17 BB5429 deliv.01/17 BB5430 deliv.01/17 BB5431 deliv.01/17
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Lightweight EVA midsole for long term
cushioning.
[S82877QI]| [BB5428O%]| [BB5429P^]| [BB5430IN]| [BB5431JQ]|

TRACEROCKER
size 5.5-12.5; 13.5; 14.5 79,95
AF6148 core black/dark grey/core black
BB5436 core black/core black/energy s17
BB5437 mystery blue s17/core black/grey
BB5438 energy s17/core black/bright orange
TEXTILE/SYNTHETICS
These streamlined trail runners are the next best
thing to wings at your heels. The clean design of
these men's outdoor shoes features an abrasion-
resistant ripstop upper and a rugged TRAXION
outsole for grip.
Midsole: Lightweight EVA midsole for long term
AF6148 deliv.12/16 BB5436 deliv.01/17 BB5437 deliv.01/17 BB5438 deliv.01/17
cushioning.
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities.
[AF6148.O]| [BB5436O+]| [BB5437P#]| [BB5438Q0]|

17Q1_FTW_EUR-CHF_054_103.indd 57 08.06.2016 11:39:51


58 Men
TERREX

BB1890 deliv.03/17 BB1891 deliv.03/17 BB1892 deliv.03/17 BB1893 deliv.03/17 BB1894 deliv.03/17

[BB1890Q^]| [BB1891R1]| [BB1892S4]| [BB1893T7]| [BB1894UA]|


TERREX CC VOYAGER
size 5.5-12.5; 13.5; 14.5 89,95
BB1890 core black/core black/onix
BB1891 grey/core black/ftwr white
BB1892 collegiate navy/ftwr white/core blue
s17
BB1893 sub blue s13/core blue s17/energy s17
BB1894 clear onix/clear grey s12/energy green
s17
BB1895 scarlet/scarlet/energy s17
TEXTILE/SYNTHETICS
Upper: climacool open mesh for enhanced
breathability.
Midsole climacool ventilation/drainage through
midsole sidewall with closed outsole for
enhanced breathability and comfort.
BB1895 deliv.03/17
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities.
[BB1895VD]|

TERREX CC BOAT
size 3.5-14.5 79,95
BB1904 core black/chalk white/core black
BB1905 ftwr white/ftwr white/core black
BB1908 core blue s17/chalk white/bright yellow
BB1909 cargo brown f16/chalk white/umber f15
BB1910 collegiate navy/chalk white/core black
TEXTILE
Upper: climacool open mesh for enhanced
breathability.
EVA tongue Perforated EVA tongue for enhanced
comfort.
Midsole/ Outsole: climacool tooling
construction for enhanced breathability and BB1904 deliv.03/17 BB1905 deliv.03/17 BB1908 deliv.03/17 BB1909 deliv.03/17 BB1910 deliv.03/17
comfort.
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities. [BB1904FJ]| [BB1905GM]| [BB1908JV]| [BB1909KY]| [BB1910DC]|

17Q1_FTW_EUR-CHF_054_103.indd 58 08.06.2016 11:40:28


Men 59

Men - Water
selected accounts only

TERREX
climacool DAROGA PLUS
size 3.5-12.5; 13.5; 14.5 89,95
TERREX HYDRO_PRO
B40915 core black/chalk white/silver met. size 3.5; 4.5; 5.5; 6.5; 7.5; 169,95
TEXTILE/SYNTHETICS 8.5; 9.5; 10.5; 11.5; 12.5
Lightweight, packable with drainage for wet BA9184 energy s17/core black/ftwr white
conditions, this stretchy shoe with translucent SYNTHETICS/TEXTILE
3-stripes and protective toe handles trails and Upper: Neoprene inner bootie for optimal
travel. ADIPRENE heel cushion and grippy climate in wet and cold conditions.
TRAXION outsole. Upper: Streatchable lace cover for durability and
Upper: climacool upper for moisture transport keeps upper catch proof.
and enhanced ventilation Midsole: adiPRENE insert for comfort and
B40915 deliv.12/16
Sockliner: Molded sockliner to enhance comfort BA9184 deliv.01/17
shock absorption.
and fit. Outsole: Water specific Outsole featuring
Outsole High Traction Outsole for optimal grip STEALTH rubber for unbeatable grip.
[B40915QZ]| [BA9184YH]|

selected accounts only climacool JAWPAW SLIP ON


size 4-14; 35 59,95
TERREX HYDRO_LACE BB5444 core black/ftwr white/utility black f16
size 3.5; 4.5; 5.5; 6.5; 7.5; 149,95 TEXTILE/SYNTHETICS
8.5; 9.5; 10.5; 11.5; 12.5 These slip-on men's aquatic shoes are ideal for
BA9183 bright yellow/core black/ftwr white watersports. The ventilated climacool upper has
SYNTHETICS/TEXTILE easy pull-on tabs, a snug fit and an innovative
Upper: Neoprene inner bootie for optimal system for maximum water drainage. The
climate in wet and cold conditions. TRAXION outsole provides optimal grip.
Upper: Shoe size displayed on the rubber heel Upper: Open mesh nylon for best breathability
cap for easy reference. and quick drying.
Upper: Wide neoprene opening for an easy step Upper: Stretchable heel insert for optimal fit.
in and step out. Upper: Asymmetrical heel loop for easy
Midsole: adiPRENE insert for comfort and attachment to a Harness or Backpack.
BA9183 deliv.01/17
shock absorption. BB5444 deliv.01/17
Midsole: adidas Drainage System (a.D.S.) for
Outsole: Water specific Outsole featuring maximum water drainage.
STEALTH rubber for unbeatable grip. Outsole: Water specific Outsole featuring Super
[BA9183XE]| [BB5444O/]| High Traction rubber for optimal grip.

17Q1_FTW_EUR-CHF_054_103.indd 59 08.06.2016 11:40:51


adidas.com/adidasterrex

17Q1_FTW_EUR-CHF_054_103.indd 60 08.06.2016 11:41:12


Women 61

selected accounts only


Women
selected accounts only

TERREX
TERREX SCOPE HIGH GTX W
size 3.5-10.5 199,95
TERREX SCOPE GTX W
BB4588 trace grey s17/core black/vapour
size 3.5-10.5 159,95
steel f16
TEXTILE/SYNTHETICS BB5450 trace grey s17/core black/vapour
Lining: GORE-TEX Performance Comfort steel f16
membrane. Waterproof and breathable. TEXTILE/SYNTHETICS
Collar Neoprene collar for comfort and Lining: GORE-TEX Performance Comfort
protection. membrane. Waterproof and breathable.
Sockliner: Molded Ortholite sockliner. Midsole: adiPRENE insert for comfort and
Midsole: adiPRENE insert for comfort and shock absorption.
BB4588 deliv.01/17
shock absorption. BB5450 deliv.01/17
Sockliner: Molded Ortholite sockliner.
Outsole: Approach specific Outsole featuring Outsole: Approach specific Outsole featuring
STEALTH rubber for unbeatable grip. STEALTH rubber for unbeatable grip.
[BB4588ZN]| [BB5450MX]|

TERREX SOLO W TERREX SWIFT SOLO W


size 3.5-10.5 129,95 size 3.5-10.5 99,95
BB6022 vapour steel f16/core black/tactile BB4618 trace grey s17/chalk white/easy green
pink s17 s17
BB6023 easy orange s17/core black/tactile BB4619 tactile pink s17/core black/easy orange
pink s17 s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for Upper: Breathable sock like construction for a
protection. snug fit and comfort.
Upper: Open mesh upper for breathability and Collar / Tongue: Perforated EVA with a mesh
comfort. cover for breathability and comfort
Sockliner: Molded Ortholite sockliner. Upper: Open mesh upper for breathability and
Midsole: Full forefoot adiPRENE+ for forefoot comfort.
cushioning . Slip-on construction for easy and comfortable
BB6022 deliv.01/17 BB6023 deliv.01/17
Outdole: One piece molded forefoot -toe cap and BB4618 deliv.01/17 BB4619 deliv.01/17
on and off.
climbing zone- featuring STEALTH rubber for Outdole: One piece molded forefoot -toe cap and
unbeatable grip. climbing zone- featuring STEALTH rubber for
[BB6022A5]| [BB6023B8]| [BB4618O%]| [BB4619P^]| unbeatable grip.

TERREX FAST R MID GTX W


size 3.5-10.5 179,95
BA8045 tactile green s17/core black/vapour
steel f16
TERREX FAST GTX-SURROUND W
TEXTILE/SYNTHETICS
size 3.5-10.5 179,95
Be quick and sure-footed on rough trails in these
BB0952 vapour steel f16/vapour steel f16/ fast hiking shoes. The lightweight mid-cut upper
tactile pink s17 features protective overlays and a breathable,
TEXTILE/SYNTHETICS waterproof GORE-TEX membrane. A snug-
Upper: Speed lacing construction for fast and fitting neoprene heel keeps out dirt and debris,
snug lacing. and FORMOTION gives a lower-to-the-ground
Upper: Abrasion resistant weldings for feel for control and comfort on downhills. PRO
protection. MODERATOR medial and lateral support
Sockliner: Molded Ortholite sockliner. provides additional stability, while a Continental
GTX-Surround Ventilation through midsole Rubber outsole offers extraordinary grip on rough
sidewall with closed outsole and GORE-TEX surfaces. Features a women's-specific fit.
BB0952 deliv.01/17
Extended Comfort Footwear for enhanced BA8045 deliv.01/17
Lining: GORE-TEX Extended Comfort Footwear.
breathability and 360 degree climate comfort Collar Neoprene collar for comfort and
without compromising on waterproof protection. protection.
[BB0952JT]| [BA8045KV]|

17Q1_FTW_EUR-CHF_054_103.indd 61 08.06.2016 11:41:42


62 Women

TERREX FAST R GTX W


size 3.5-10.5 159,95 FAST X HIGH GTX W
TERREX

size 3.5-10.5 169,95


BA8049 tactile green s17/core black/vapour
steel f16 AF5972 dark grey/core black/vista grey s15
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Be quick and sure-footed on the mountain in For versatile hikes over varied terrain, these
these fast hiking shoes with a women's-specific high-cut women's outdoor shoes keep you light
fit. The lightweight upper features protective and stable on foot. With a women's-specific
overlays and a breathable, waterproof GORE-TEX fit, a waterproof and breathable GORE-TEX
membrane. FORMOTION gives a lower-to-the- membrane, and a Continental Rubber outsole
ground feel for control and comfort on downhills. for extraordinary grip.
A Continental Rubber outsole gives you Lining: GORE-TEX Extended Comfort Footwear.
extraordinary grip on rough surfaces. Midsole Full forefoot adiPRENE+ for forefoot
Lining: GORE-TEX Extended Comfort Footwear. propulsion & efficiency.
Collar Neoprene collar for comfort and Midsole: Outdoor specific FORMOTION unit for
protection. BA8049 deliv.01/17
enhanced motion control and downhill comfort. AF5972 deliv.12/16
Midsole: Outdoor specific FORMOTION unit for Outsole: Continental Rubber for extraordinary
enhanced motion control and downhill comfort. grip.
[BA8049O/]| [AF5972AL]|

TERREX SWIFT R MID GTX W


size 3.5-10.5 149,95
BB4644 easy orange s17/core black/mystery
blue s17
BB4642 core black/core black/granite
TEXTILE/SYNTHETICS
Lining: GORE-TEX Extended Comfort Footwear.
Sockliner: Molded sockliner to enhance comfort
and fit.
Midsole: adiPRENE insert for comfort and
shock absorption.
Midsole: Lightweight EVA midsole for long term
cushioning. BB4644 deliv.01/17 BB4642 deliv.01/17
Outsole: Super High Traction Rubber for
optimal grip in wet conditions.
[BB4644Q^]| [BB4642O$]|

TERREX SWIFT R GTX W


size 3.5-10.5 129,95
BB4635 core black/core black/tactile pink s17
BB4634 core black/core black/granite
BB4637 easy orange s17/core black/mystery
blue s17
BB4636 clear brown/core black/easy mint s17
TEXTILE/SYNTHETICS
Lining: GORE-TEX Extended Comfort Footwear.
Sockliner: Molded sockliner to enhance comfort
and fit.
Midsole: adiPRENE insert for comfort and
shock absorption.
Midsole: Lightweight EVA midsole for long term
cushioning. BB4635 deliv.01/17 BB4634 deliv.01/17 BB4637 deliv.01/17 BB4636 deliv.01/17
Outsole: Super High Traction Rubber for
optimal grip in wet conditions.
[BB4635P/]| [BB4634O/]| [BB4637R2]| [BB4636Q&]|

17Q1_FTW_EUR-CHF_054_103.indd 62 08.06.2016 11:42:06


Women 63

TERREX
TERREX AX2R GTX W
TERREX AX2R MID GTX W size 3.5-10.5 119,95
size 3.5-10.5 129,95
BB1990 core black/core black/tactile pink s17
BB4620 core black/core black/tactile pink s17 BB1991 mgh solid grey/ch solid grey/easy
BB4621 mgh solid grey/ch solid grey/core black mint s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Lining: GORE-TEX Extended Comfort Footwear. Lining: GORE-TEX Extended Comfort Footwear.
Sockliner: Molded sockliner to enhance comfort Sockliner: Molded sockliner to enhance comfort
and fit. and fit.
Midsole: Lightweight EVA midsole for long term Midsole: Lightweight EVA midsole for long term
cushioning. cushioning.
Midsole: adiPRENE insert for comfort and Midsole: adiPRENE insert for comfort and
BB4620 deliv.01/17 BB4621 deliv.01/17
shock absorption. BB1990 deliv.01/17 BB1991 deliv.01/17
shock absorption.
Outsole: Super High Traction Rubber for Outsole: Super High Traction Rubber for
optimal grip in wet conditions. optimal grip in wet conditions.
[BB4620IN]| [BB4621JQ]| [BB1990T5]| [BB1991U8]|

AX2 CP W
size 3.5-10.5 99,95
TERREX AX2R W
BA9655 core black/core black/easy mint s17 size 3.5-10.5 89,95
TEXTILE/SYNTHETICS
BB4623 mgh solid grey/core black/granite
Water-resistant CLIMAPROOF upper with seam-
BB4622 core black/core black/tactile pink s17
sealed membrane for water-resistance and
breathability TEXTILE/SYNTHETICS
Sockliner: Molded sockliner to enhance comfort Sockliner: Molded sockliner to enhance comfort
and fit. and fit.
Midsole: Lightweight EVA midsole for long term Midsole: Lightweight EVA midsole for long term
cushioning. cushioning.
Midsole: adiPRENE insert for comfort and Midsole: adiPRENE insert for comfort and
BA9655 deliv.01/17
shock absorption. BB4623 deliv.01/17 BB4622 deliv.01/17
shock absorption.
Outsole: Super High Traction Rubber for Outsole: Super High Traction Rubber for
optimal grip in wet conditions. optimal grip in wet conditions.
[BA9655#/]| [BB4623LW]| [BB4622KT]|

TERREX SKYCHASER W
size 3.5-10.5 159,95
TERREX SKYCHASER GTX W BB0945 dark grey/core black/ftwr white
size 3.5-10.5 179,95 BB0946 core green s17/core black/easy orange
BB0944 vapour steel f16/core black/tactile s17
green s17 TEXTILE/SYNTHETICS
TEXTILE/SYNTHETICS Upper: Speed lacing construction for fast and
Upper: Speed lacing construction for fast and snug lacing.
snug lacing. Midsole: Pro-Moderator - thin TPU film on the
Lining: GORE-TEX Extended Comfort Footwear. heel for extra stability.
Midsole: Boost offers endless energy in Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky the mountains and high adaptability on rocky
BB0944 deliv.01/17
surfaces. BB0945 deliv.01/17 BB0946 deliv.01/17
surfaces.
Outsole: Continental Rubber for extraordinary Outsole: Continental Rubber for extraordinary
grip. grip.
[BB0944JU]| [BB0945KX]| [BB0946L-]|

17Q1_FTW_EUR-CHF_054_103.indd 63 08.06.2016 11:42:29


64 Women
TERREX

TERREX AGRAVIC GTX W


size 3.5-10.5 149,95
BB0969 core black/core black/ftwr white
BB0970 tactile pink s17/haze coral s17/ftwr
white
BB0971 core green s17/easy green s17/ftwr
white
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces. BB0969 deliv.01/17 BB0970 deliv.01/17 BB0971 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB0969S8]| [BB0970LX]| [BB0971M-]|

TERREX AGRAVIC W
size 3.5-10.5 129,95
BB0973 tactile pink s17/tactile pink s17/easy
orange s17
BB0974 core green s17/core black/easy orange
s17
BB0972 utility black f16/core black/trace grey
s17
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces. BB0973 deliv.01/17 BB0974 deliv.01/17 BB0972 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB0973O%]| [BB0974P^]| [BB0972N$]|

TERREX AGRAVIC SPEED W


size 3.5-10.5 129,95
BB1960 core black/core black/ftwr white
BB1962 tactile pink s17/core black/easy orange
s17
BB3066 core green s17/core green s17/core
black
TEXTILE/SYNTHETICS
Upper: Breathable sock like construction for a
snug fit and comfort.
Collar / Tongue: Perforated EVA with a mesh
cover for breathability and comfort BB1960 deliv.01/17 BB1962 deliv.01/17 BB3066 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB1960N.]| [BB1962P/]| [BB3066AA]|

17Q1_FTW_EUR-CHF_054_103.indd 64 08.06.2016 11:42:53


Women 65

TERREX TRAILMAKER GTX W


size 3.5-10.5 129,95
BB0726 core black/vista grey s15/tactile pink

TERREX
s17
BB0727 tactile pink s17/core black/trace grey
s17
BB0728 core green s17/core black/easy green
s17
TEXTILE/SYNTHETICS
Conquer technical trails with these speedy trail
running shoes. The lightweight upper features
highly abrasion-resistant welding for extra
protection in the toe area. A GORE-TEX lining
gives you a waterproof and breathable barrier
against the weather, while the outsole provides
Continental Rubber for extraordinary grip over
rugged terrain.
BB0726 deliv.01/17 BB0727 deliv.01/17 BB0728 deliv.01/17
Upper: Speed lacing construction for fast and
snug lacing.
[BB0726BC]| [BB0727CF]| [BB0728DI]|

TERREX TRAILMAKER W
size 3.5-10.5 109,95
BB3360 vista grey s15/core black/tactile pink
s17
BB3361 easy orange s17/core black/tactile
pink s17
BB3362 core green s17/core black/easy green
s17
TEXTILE/SYNTHETICS
Upper: Speed lacing construction for fast and
snug lacing.
Upper: Abrasion resistant weldings for
protection.
Midsole: Lightweight EVA midsole for long term
BB3360 deliv.01/17 BB3361 deliv.01/17 BB3362 deliv.01/17
cushioning.
Outsole: Continental Rubber for extraordinary
grip.
[BB3360DD]| [BB3361EG]| [BB3362FJ]|

KANADIA 7 TR GTX W
size 3.5-10.5 99,95
S80302 vista grey s15/core black/super blush
s16
BB5434 easy orange s17/chalk white/ice purple
f16
BB5435 core green s17/chalk white/easy green
s17
TEXTILE/SYNTHETICS
These rugged, lightweight outdoor shoes are
made for trail-running. Designed for a women's-
specific fit, the outdoor shoes keep your feet dry
and protected with waterproof and breathable
GORE-TEX. A TRAXION outsole grips
unpredictable terrain.
S80302 deliv.12/16 BB5434 deliv.12/16 BB5435 deliv.12/16
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Lightweight EVA midsole for long term
cushioning.
[S80302V9]| [BB5434MZ]| [BB5435N=]|

17Q1_FTW_EUR-CHF_054_103.indd 65 08.06.2016 11:43:21


66 Women
TERREX

TRACEROCKER W
size 3.5-10.5 79,95
S80579 core black/vista grey s15/utility black
f16
BB5441 ice purple f16/ch solid grey/easy green
s17
TEXTILE/SYNTHETICS
These streamline trail runners are the next best
thing to wings at your heels. These outdoor shoes
feature a clean design, with an abrasion-resistant
ripstop upper, a women's-specific fit and a rugged
TRAXION outsole for grip.
Midsole: Lightweight EVA midsole for long term
cushioning. S80579 deliv.12/16 BB5441 deliv.01/17
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities.
[S80579BW]| [BB5441LV]|

TERREX CC VOYAGER SLEEK


size 3.5-10.5 89,95
BB1915 core black/core black/chalk white
BB1916 grey/core black/tactile pink s17
BB1917 core green s17/chalk white/easy green
s17
BB1918 blue/core black/tactile pink s17
TEXTILE/SYNTHETICS
Upper: Sleek silhouette for women's specific fit
and look.
Upper: climacool open mesh for enhanced
breathability.
Midsole climacool ventilation/drainage through
midsole sidewall with closed outsole for BB1915 deliv.03/17 BB1916 deliv.03/17 BB1917 deliv.03/17 BB1918 deliv.03/17
enhanced breathability and comfort.
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities. [BB1915IR]| [BB1916JU]| [BB1917KX]| [BB1918L-]|

TERREX CC BOAT SLEEK


size 3.5-10.5 79,95
BB1920 core black/chalk white/matte silver
BB1921 core green s17/chalk white/tactile
pink s17
BB1922 mid grey s14/chalk white/easy orange
s17
TEXTILE
Upper: climacool open mesh for enhanced
breathability.
Upper: Stretchable heel insert for optimal fit.
Midsole/ Outsole: climacool tooling BB1920 deliv.03/17 BB1921 deliv.03/17 BB1922 deliv.03/17
construction for enhanced breathability and
comfort.
[BB1920FH]| [BB1921GK]| [BB1922HN]|

17Q1_FTW_EUR-CHF_054_103.indd 66 08.06.2016 11:43:59


Kids 67

Kids

TERREX
TERREX MID GTX K
size 28-35; 3-6.5 99,95
BB1952 core black/core black/vista grey s15
BB1954 trace grey s17/core black/tactile pink
s17
BB1953 core blue s17/core black/energy green
s17
TEXTILE/SYNTHETICS
Upper: Reflective logo for enhanced visibility and
safety in the outdoors.
Upper: Speed lacing construction for fast and
snug lacing.
BB1952 deliv.01/17 BB1954 deliv.01/17 BB1953 deliv.01/17
Lining: GORE-TEX Extended Comfort Footwear.
Outsole: TRAXION outsole for maximum grip in
all directions.
[BB1952N=]| [BB1954P#]| [BB1953O+]|

TERREX GTX K
size 28-35; 3-6.5 89,95
BB1947 core black/core black/vista grey s15
BB1948 core blue s17/core black/energy green
s17
BB1949 trace grey s17/core black/tactile pink
s17
TEXTILE/SYNTHETICS
Upper: Reflective logo for enhanced visibility and
safety in the outdoors.
Upper: Speed lacing construction for fast and
snug lacing.
BB1947 deliv.01/17 BB1948 deliv.01/17 BB1949 deliv.01/17
Lining: GORE-TEX Extended Comfort Footwear.
Outsole: TRAXION outsole for maximum grip in
all directions.
[BB1947Q1]| [BB1948R4]| [BB1949S7]|

TERREX K TERREX AX2R MID CP K


size 28-35; 3-6.5 69,95 size 28-35; 3-6.5 79,95
BB1950 core blue s17/core black/chalk white BB1938 core blue s17/core black/unity lime f16
BB1951 tactile pink s17/core black/easy orange BB1939 tactile pink s17/core black/easy green
s17 s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Upper: Reflective logo for enhanced visibility and Upper: Reflective logo for enhanced visibility and
safety in the outdoors. safety in the outdoors.
Upper: Speed lacing construction for fast and Upper: CLIMAPROOF membrane for
snug lacing. waterproof protection in wet conditions.
Midsole: Lightweight EVA midsole for long term Midsole: Lightweight EVA midsole for long term
BB1950 deliv.01/17 BB1951 deliv.01/17
cushioning and comfort. BB1938 deliv.01/17 BB1939 deliv.01/17
cushioning and comfort.
Outsole: TRAXION outsole for maximum grip in Outsole: TRAXION outsole for maximum grip in
all directions. all directions.
[BB1950LW]| [BB1951MZ]| [BB1938P&]| [BB1939Q2]|

17Q1_FTW_EUR-CHF_054_103.indd 67 08.06.2016 11:44:32


68 Kids
TERREX

TERREX AX2R CP K
size 28-35; 3-6.5 69,95
BB1933 core blue s17/core black/unity lime f16
BB1934 tactile pink s17/core black/easy green
s17
TEXTILE/SYNTHETICS
Upper: CLIMAPROOF membrane for
waterproof protection in wet conditions.
Upper: Reflective logo for enhanced visibility and
safety in the outdoors.
Midsole: Lightweight EVA midsole for long term
cushioning and comfort. BB1933 deliv.01/17 BB1934 deliv.01/17
Outsole: TRAXION outsole for maximum grip in
all directions.
[BB1933KV]| [BB1934LY]|

TERREX AX2R CF K
size 28-35; 3-6.5 59,95
BB1930 core black/core black/onix
BB1931 core blue s17/core blue s17/energy
green s17
BB1932 tactile pink s17/tactile pink s17/easy
orange s17
TEXTILE/SYNTHETICS
Upper: Reflective logo for enhanced visibility and
safety in the outdoors.
Upper: Hook and loop closure system.
Midsole: Lightweight EVA midsole for long term
cushioning and comfort. BB1930 deliv.01/17 BB1931 deliv.01/17 BB1932 deliv.01/17
Outsole: TRAXION outsole for maximum grip in
all directions.
[BB1930HM]| [BB1931IP]| [BB1932JS]|

TERREX AX2R K
size 28-35; 3-6.5 49,95
BB1935 core black/core black/vista grey s15
BB1936 core blue s17/core black/unity lime f16
BB1937 easy green s17/core black/tactile pink
s17
TEXTILE/SYNTHETICS
Upper: Reflective logo for enhanced visibility and
safety in the outdoors.
Midsole: Lightweight EVA midsole for long term
cushioning and comfort. BB1935 deliv.01/17 BB1936 deliv.01/17 BB1937 deliv.01/17
Outsole: TRAXION outsole for maximum grip in
all directions.
[BB1935M.]| [BB1936N/]| [BB1937O/]|

17Q1_FTW_EUR-CHF_054_103.indd 68 08.06.2016 11:44:57


Kids 69

HYPERHIKER

TERREX
size 28-35; 3-6.5 59,95
BB5419 core blue s17/clear onix/mystery blue
TERREX CC Voyager K s17
size 28-35; 3-6.5 59,95 BB5420 tactile pink s17/ice purple f16/trace
BB1944 core blue s17/chalk white/unity lime grey s17
f16 TEXTILE/SYNTHETICS
BB1945 easy green s17/chalk white/tactile These kids' outdoor shoes are built for all-day
pink s17 hiking adventures on the trails. The mid-cut style
TEXTILE has a durable ripstop upper with a soft collar. A
Upper: climacool open mesh for enhanced TRAXION outsole grips in all directions.
breathability. Upper: Reflective logo for enhanced visibility and
Midsole climacool ventilation/drainage through safety in the outdoors.
midsole sidewall with closed outsole for Midsole: Lightweight EVA midsole for long term
BB1944 deliv.01/17 BB1945 deliv.01/17
enhanced breathability and comfort. BB5419 deliv.01/17 BB5420 deliv.01/17
cushioning and comfort.
Outsole: TRAXION - the perfect combination of Outsole: TRAXION outsole for maximum grip in
stability and grip for everyday outdoor activities. all directions.
[BB1944N$]| [BB1945O%]| [BB5419N/]| [BB5420GI]|

SANDPLAY OD K
size 4-6; 28-29; 31-35 49,95 KUROBE K
S82187 mystery blue s17/tactile green s17/ size 28-35; 3.5-6.5 29,95
core blue s17 BB5432 core blue s17/core blue s17/energy
S82188 easy blue s17/mid grey s14/tactile green s17
pink s17 BB5433 easy green s17/tactile pink s17/easy
TEXTILE/SYNTHETICS green s17
Everyday sandal to play. The updated kids' design TEXTILE/SYNTHETICS
is both flexible and lightweight with a soft footbed A simple water shoe that does it all. Easy slip-on
for more cushioning. Adjustable webbing provides design and a comfortable, sock-like fit. Made from
a natural, optimal fit and toe wrap protects. sandwich mesh with a rubber die-cut outsole.
Upper: All straps adjustable for optimal fit. Features an adidas sports logo.
S82187 deliv.01/17 S82188 deliv.01/17 BB5432 deliv.12/16 BB5433 deliv.12/16
Midsole: Soft EVA footbed for enhanced Upper: Open mesh nylon for best breathability
comfort. and quick drying.
[S821877L]| [S821888O]| [BB5432KT]| [BB5433LW]|
Kids - Infants
TERREX MID GTX I
size 18-27 59,95
S76931 core blue s17/chalk white/energy
green s17
S76932 trace grey s17/chalk white/tactile
pink s17
AX2 MID I
TEXTILE/SYNTHETICS size 17-27 39,95
For tiny hikers, this flexible shoe is serious about
ankle and midfoot support. A simplified upper
S76933 mystery blue s17/chalk white/core
with waterproof GORE-TEX rides on a lugged blue s17
TRAXION outsole made for rocky terrain. TEXTILE/SYNTHETICS
ADIFIT sizing. This mid-cut kid version of the adult hiking shoe
Upper: Reflective 3 stripes. offers little hikers flexible, stable support and a
Lining: GORE-TEX Extended Comfort Footwear. grippy outsole. With ADIFIT sizing.
S76931 deliv.12/16 S76932 deliv.12/16
Outsole: TRAXION outsole for maximum grip in S76933 deliv.12/16
adiFIT measuring tool for accurate fit.
all directions. Outsole: Mountain Grip - the perfect
adiFIT measuring tool for accurate fit. combination of stability and grip.
[S76931QC]| [S76932RF]| [S76933SI]|

17Q1_FTW_EUR-CHF_054_103.indd 69 08.06.2016 11:45:22


70 Kids - Infants
TERREX

Boat AC I
Daroga Plus AC I size 19-27 29,95
size 19-27 34,95 S76930 tactile pink s17/chalk white/easy green
S76935 utility ivy f16/chalk white/energy blue s17
s17 S76929 core blue s17/chalk white/energy s17
S76934 super purple s16/chalk white/still TEXTILE/SYNTHETICS
breeze f12 With stitched details that link to the grown-up
TEXTILE/SYNTHETICS version, this lightweight infants' shoe has a
Just like the grown-up version, this lightweight simple elastic gore that makes it easy to put on.
shoe has a full mesh upper and sporty outsole to A durable mesh upper sits on a slim one-piece
take on any terrain in stride. Easy elastic laces outsole.
with a single top strap closure. Upper: Open mesh nylon for best breathability
Mesh base with synthetic overlays and quick drying.
Elastic laces with top strap for easy on off and S76935 deliv.12/16 S76934 deliv.12/16
adiFIT measuring tool for accurate fit. S76930 deliv.12/16 S76929 deliv.12/16
adjustability. Sustainable content Environmentally developed
adiFIT measuring tool for accurate fit. pattern
[S76935UO]| [S76934TL]| [S76930P9]| [S76929WV]|

17Q1_FTW_EUR-CHF_054_103.indd 70 08.06.2016 11:45:37


TRAIL
Men 71

Men
TERREX XKING

TRAIL
size 6-12 149,95
BB5443 core black/core black/chalk white
TEXTILE/SYNTHETICS TERREX SKYCHASER GTX
A mountain bike tyre for your feet. These men's size 5.5-12.5; 13.5; 14.5 179,95
trail shoes are lightweight and protective and BB0938 core black/core black/ftwr white
feature a tyre-specific outsole construction
to reduce weight and stay low to the ground. BB0939 vista grey s15/core black/energy s17
Continental Rubber gives you extraordinary grip TEXTILE/SYNTHETICS
on mountain runs. Upper: Speed lacing construction for fast and
Upper: Speed lacing construction for fast and snug lacing.
snug lacing. Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Ultra lightweight internal EVA midsole Midsole: Boost offers endless energy in
for long term cushioning. the mountains and high adaptability on rocky
BB5443 deliv.01/17
MTB tires for your feet: Directly molded to BB0938 deliv.01/17 BB0939 deliv.01/17
surfaces.
upper - full length Continental Rubber for Outsole: Continental Rubber for extraordinary
extraordinary grip. grip.
[BB5443N.]| [BB0938L.]| [BB0939M/]|

TERREX SKYCHASER
size 5.5-12.5; 13.5; 14.5 159,95
BB0940 dark grey/core black/ftwr white
BB0941 vista grey s15/core black/energy s17
BB0942 core blue s17/core black/unity lime f16
TEXTILE/SYNTHETICS
Upper: Speed lacing construction for fast and
snug lacing.
Midsole: Pro-Moderator - thin TPU film on the
heel for extra stability.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
BB0940 deliv.01/17 BB0941 deliv.01/17 BB0942 deliv.01/17
surfaces.
Outsole: Continental Rubber for extraordinary
grip.
[BB0940FI]| [BB0941GL]| [BB0942HO]|

adizero xt
size 6-12.5 149,95
AQ2369 core black/core blue s17/utility black
f16
AQ2370 tactile orange s17/easy blue s17/clear
brown
TEXTILE/SYNTHETICS
These light, low-profile men's running shoes
are designed for moving fast over rugged trails.
boost cushioning provides an energy-filled ride,
while knit ankle cuffs help keep pebbles and mud
out. A mountain bike tyre-inspired TRAXION
outsole provides secure grip.
BOOST ultra responsive comfort and cushining
AQ2369 deliv.01/17 AQ2370 deliv.01/17
combined with unmatched longevity in every
climate. stores and unleashes energy every time
the foot hits the ground
[AQ2369/%]| [AQ2370XK]|

17Q1_FTW_EUR-CHF_054_103.indd 71 08.06.2016 11:46:00


72 Men
TRAIL

BB0953 deliv.01/17 BB0954 deliv.01/17 BB0955 deliv.01/17 BB0956 deliv.01/17 BB0958 deliv.01/17

[BB0953KW]| [BB0954LZ]| [BB0955M=]| [BB0956N+]| [BB0958P0]|


TERREX AGRAVIC GTX
size 5.5-12.5; 13.5; 14.5 149,95
BB0953 core black/core black/ftwr white
BB0954 dark grey/core black/bright yellow
BB0955 vista grey s15/core black/energy s17
BB0956 core blue s17/core black/unity lime f16
BB0958 energy s17/core black/core blue s17
BB0959 energy green s17/core black/bright
yellow
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces.
BB0959 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB0959Q3]|

17Q1_FTW_EUR-CHF_054_103.indd 72 08.06.2016 11:46:02


Men 73

TRAIL
BB0962 deliv.01/17 BB0965 deliv.01/17 BB0966 deliv.01/17 BB0960 deliv.01/17 BB6001 deliv.01/17

[BB0962LY]| [BB0965O/]| [BB0966P&]| [BB0960JS]| [BB60015$]| TERREX AGRAVIC


size 5.5-12.5; 13.5; 14.5 129,95
BB0962 vista grey s15/core black/energy s17
BB0965 energy s17/core blue s17/core black
BB0966 energy green s17/bright yellow/core
black
BB0960 core black/core black/vista grey s15
BB6001 energy s17/core black/ftwr white
BB6002 core blue s17/core black/ftwr white
BB0961 dark grey/core black/bright yellow
BB0963 core blue s17/unity lime f16/tactile
green s17
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces.
BB6002 deliv.01/17 BB0961 deliv.01/17 BB0963 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB60026%]| [BB0961KV]| [BB0963M.]|

17Q1_FTW_EUR-CHF_054_103.indd 73 08.06.2016 11:46:05


74 Men
TRAIL

BB1956 deliv.01/17 BB1958 deliv.01/17 BB1957 deliv.01/17 BB1955 deliv.01/17 BB6025 deliv.01/17
TERREX AGRAVIC SPEED
size 5.5-12.5; 13.5; 14.5 129,95
[BB1956R3]| [BB1958T9]| [BB1957S6]| [BB1955Q0]| [BB6025DE]|
BB1956 core black/core black/energy s17
BB1958 collegiate navy/core blue s17/core
blue s17
BB1957 vista grey s15/vista grey s15/core blue
s17
BB1955 core black/core black/ftwr white
BB6025 energy green s17/energy green s17/
collegiate green
BB3063 energy s17/energy s17/core black
TEXTILE/SYNTHETICS
Upper: Breathable sock like construction for a
snug fit and comfort.
Collar / Tongue: Perforated EVA with a mesh
cover for breathability and comfort
Upper: Abrasion resistant weldings for
protection.
Midsole: Lightweight EVA midsole for long term
cushioning and comfort.
BB3063 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB306371]|
TERREX TRAILMAKER GTX
size 5.5-12.5; 13.5; 14.5 129,95
BB0721 core black/vista grey s15/utility black
f16
BB0722 vista grey s15/core black/energy s17
BB0723 core blue s17/core black/unity lime f16
BB0724 energy s17/core black/ftwr white
TEXTILE/SYNTHETICS
Conquer technical trails with these speedy trail
running shoes for men. The lightweight upper
features highly abrasion-resistant welding for
extra protection in the toe area. A GORE-TEX
lining gives you a waterproof and breathable
barrier against the weather, while the outsole
provides Continental Rubber for extraordinary
grip over rugged terrain.
BB0721 deliv.01/17 BB0722 deliv.01/17 BB0723 deliv.01/17 BB0724 deliv.01/17
Upper: Speed lacing construction for fast and
snug lacing.
[BB07216#]| [BB072270]| [BB072383]| [BB072496]|

17Q1_FTW_EUR-CHF_054_103.indd 74 08.06.2016 11:53:05


Men 75

TERREX TRAILMAKER

TRAIL
size 5.5-12.5; 13.5; 14.5 109,95
BB3355 core black/vista grey s15/utility black
f16
BB3357 core blue s17/core black/unity lime f16
BB3358 energy s17/core black/ftwr white
BB3359 core black/core blue s17/core black
TEXTILE/SYNTHETICS
Upper: Speed lacing construction for fast and
snug lacing.
Upper: Abrasion resistant weldings for
protection.
Midsole: Lightweight EVA midsole for long term
BB3355 deliv.01/17 BB3357 deliv.01/17 BB3358 deliv.01/17 BB3359 deliv.01/17
cushioning.
Outsole: Continental Rubber for extraordinary
grip.
[BB3355GN]| [BB3357IT]| [BB3358JW]| [BB3359KZ]|

response tr m
size 6-12.5 119,95
BB1657 core blue s17/core black/energy
orange s17
BB1659 core black/utility black f16/core blue
s17
TEXTILE/SYNTHETICS
These men's running shoes are designed for
a responsive feel and superior traction across
a variety of terrain. Energy-returning boost
and a mesh upper give you a light, fast ride
with superior ventilation. Adjustable lacing and
FITBANDS hold your foot secure while allowing it
to move naturally.
BB1657 deliv.01/17 BB1659 deliv.01/17
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
[BB1657JW]| [BB1659L=]|

KANADIA 7 TR GTX
size 5.5-12.5; 13.5; 14.5 99,95
S82877 dark grey/core black/chalk white
BB5428 core black/core black/energy s17
BB5429 mystery blue s17/core black/core
blue s17
BB5430 energy s17/core black/bright orange
BB5431 utility ivy f16/core black/unity lime f16
TEXTILE/SYNTHETICS
These rugged, lightweight outdoor shoes are
made for trail-running. The men's shoes keep
feet dry and protected with waterproof and
breathable GORE-TEX. A TRAXION outsole
grips unpredictable terrain.
S82877 deliv.12/16 BB5428 deliv.01/17 BB5429 deliv.01/17 BB5430 deliv.01/17 BB5431 deliv.01/17
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Lightweight EVA midsole for long term
cushioning.
[S82877QI]| [BB5428O%]| [BB5429P^]| [BB5430IN]| [BB5431JQ]|

17Q1_FTW_EUR-CHF_054_103.indd 75 08.06.2016 11:53:34


76 Men

kanadia 8 tr m
size 6-12.5; 13.5; 14.5 89,95
BB4414 core blue s17/ftwr white/energy s17
TRAIL

BB4415 tactile orange s17/chalk white/


collegiate burgundy
BB4416 core black/easy blue s17/trace grey s17
SYNTHETICS/TEXTILE
Durability, traction and stability come together
in these men's trail running shoes built on a
TRAXION outsole and an extra-soft cloudfoam
midsole. The air mesh upper is reinforced with
synthetic overlays for an ideal fit.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
CLOUDFOAM super plush feel.
TRAXION grippy lugs that ensure best traction BB4414 deliv.12/16 BB4415 deliv.12/16 BB4416 deliv.12/16
when running on trails or in the mountain
region.
[BB4414EG]| [BB4415FJ]| [BB4416GM]|

TRACEROCKER
size 5.5-12.5; 13.5; 14.5 79,95
AF6148 core black/dark grey/core black
BB5436 core black/core black/energy s17
BB5437 mystery blue s17/core black/grey
BB5438 energy s17/core black/bright orange
TEXTILE/SYNTHETICS
These streamlined trail runners are the next best
thing to wings at your heels. The clean design of
these men's outdoor shoes features an abrasion-
resistant ripstop upper and a rugged TRAXION
outsole for grip.
Midsole: Lightweight EVA midsole for long term
cushioning. AF6148 deliv.12/16 BB5436 deliv.01/17 BB5437 deliv.01/17 BB5438 deliv.01/17
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities.
[AF6148.O]| [BB5436O+]| [BB5437P#]| [BB5438Q0]|

duramo 7 trail m
size 6-12.5; 13.5; 14.5 64,95
BB4428 core blue s17/ftwr white/energy s17
BB4430 utility black f16/utility black f16/core
black
TEXTILE/SYNTHETICS
These men's trail running shoes combine simple
design with expert construction and materials
to deliver high performance. A breathable air
mesh upper keeps your feet comfortable, while
a soft cloudfoam midsole provides lightweight
cushioning.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs. BB4428 deliv.01/17 BB4430 deliv.01/17
ADIWEAR extended protection against wear
and tear.
CLOUDFOAM super plush feel. [BB4428KX]| [BB4430EE]|

17Q1_FTW_EUR-CHF_054_103.indd 76 08.06.2016 11:53:51


Men 77

galaxy trail m
size 6-12.5; 13.5; 14.5 59,95

TRAIL
BB4458 core blue s17/ftwr white/energy orange
s17
BB4459 tactile orange s17/ftwr white/clay
brown f15
BB4460 core black/core blue s17/utility black
f16
TEXTILE/SYNTHETICS
With maximum traction for trail routes, these
men's running shoes provide ultra-breathable
comfort and plush cushioning. A synthetic and air
mesh upper is lightweight and ventilating, while
the midsole is responsive over off-road obstacles.
ZONED PROTECTION specific to all extreme
BB4458 deliv.12/16 BB4459 deliv.12/16 BB4460 deliv.12/16
models. protective overlays combined with a
durable mesh offers support for off-road runs.
CLOUDFOAM super plush feel.
[BB4458Q1]| [BB4459R4]| [BB4460KT]|
Women

TERREX SKYCHASER W
size 3.5-10.5 159,95
TERREX SKYCHASER GTX W BB0945 dark grey/core black/ftwr white
size 3.5-10.5 179,95 BB0946 core green s17/core black/easy orange
BB0944 vapour steel f16/core black/tactile s17
green s17 TEXTILE/SYNTHETICS
TEXTILE/SYNTHETICS Upper: Speed lacing construction for fast and
Upper: Speed lacing construction for fast and snug lacing.
snug lacing. Midsole: Pro-Moderator - thin TPU film on the
Lining: GORE-TEX Extended Comfort Footwear. heel for extra stability.
Midsole: Boost offers endless energy in Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky the mountains and high adaptability on rocky
BB0944 deliv.01/17
surfaces. BB0945 deliv.01/17 BB0946 deliv.01/17
surfaces.
Outsole: Continental Rubber for extraordinary Outsole: Continental Rubber for extraordinary
grip. grip.
[BB0944JU]| [BB0945KX]| [BB0946L-]|

TERREX AGRAVIC GTX W


size 3.5-10.5 149,95
BB0969 core black/core black/ftwr white
BB0970 tactile pink s17/haze coral s17/ftwr
white
BB0971 core green s17/easy green s17/ftwr
white
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
BB0969 deliv.01/17 BB0970 deliv.01/17 BB0971 deliv.01/17
surfaces.
Outsole: Continental Rubber for extraordinary
grip.
[BB0969S8]| [BB0970LX]| [BB0971M-]|

17Q1_FTW_EUR-CHF_054_103.indd 77 08.06.2016 11:54:04


78 Women
TRAIL

TERREX AGRAVIC W
size 3.5-10.5 129,95
BB0973 tactile pink s17/tactile pink s17/easy
orange s17
BB0974 core green s17/core black/easy orange
s17
BB0972 utility black f16/core black/trace grey
s17
TEXTILE/SYNTHETICS
Upper: Abrasion resistant weldings for
protection.
Midsole: Boost offers endless energy in
the mountains and high adaptability on rocky
surfaces. BB0973 deliv.01/17 BB0974 deliv.01/17 BB0972 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB0973O%]| [BB0974P^]| [BB0972N$]|
TERREX TRAILMAKER GTX W
size 3.5-10.5 129,95
BB0726 core black/vista grey s15/tactile pink
s17
BB0727 tactile pink s17/core black/trace grey
s17
BB0728 core green s17/core black/easy green
s17
TEXTILE/SYNTHETICS
Conquer technical trails with these speedy trail
running shoes. The lightweight upper features
highly abrasion-resistant welding for extra
protection in the toe area. A GORE-TEX lining
gives you a waterproof and breathable barrier
against the weather, while the outsole provides
Continental Rubber for extraordinary grip over
rugged terrain.
BB0726 deliv.01/17 BB0727 deliv.01/17 BB0728 deliv.01/17
Upper: Speed lacing construction for fast and
snug lacing.
[BB0726BC]| [BB0727CF]| [BB0728DI]|

TERREX TRAILMAKER W
size 3.5-10.5 109,95
BB3360 vista grey s15/core black/tactile pink
s17
BB3361 easy orange s17/core black/tactile
pink s17
BB3362 core green s17/core black/easy green
s17
TEXTILE/SYNTHETICS
Upper: Speed lacing construction for fast and
snug lacing.
Upper: Abrasion resistant weldings for
protection.
Midsole: Lightweight EVA midsole for long term
cushioning. BB3360 deliv.01/17 BB3361 deliv.01/17 BB3362 deliv.01/17
Outsole: Continental Rubber for extraordinary
grip.
[BB3360DD]| [BB3361EG]| [BB3362FJ]|

17Q1_FTW_EUR-CHF_054_103.indd 78 08.06.2016 11:54:23


Women 79

response tr w
size 3.5-10.5 119,95

TRAIL
BB1662 mid grey s14/ftwr white/dark grey
TEXTILE/SYNTHETICS
These women's running shoes are designed for
a responsive feel and superior traction across
a variety of terrain. Energy-returning boost
and a mesh upper give you a light, fast ride
with superior ventilation. Adjustable lacing and
FITBANDS hold your foot secure while allowing it
to move naturally.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
BOOST ultra responsive comfort and cushining
BB1662 deliv.01/17
combined with unmatched longevity in every
climate. stores and unleashes energy every time
the foot hits the ground
[BB1662GM]|

TERREX AGRAVIC SPEED W


size 3.5-10.5 129,95
BB1960 core black/core black/ftwr white
BB1962 tactile pink s17/core black/easy orange
s17
BB3066 core green s17/core green s17/core
black
TEXTILE/SYNTHETICS
Upper: Breathable sock like construction for a
snug fit and comfort.
Collar / Tongue: Perforated EVA with a mesh
BB1960 deliv.01/17 BB1962 deliv.01/17 BB3066 deliv.01/17
cover for breathability and comfort
Outsole: Continental Rubber for extraordinary
grip.
[BB1960N.]| [BB1962P/]| [BB3066AA]|

KANADIA 7 TR GTX W
size 3.5-10.5 99,95
S80302 vista grey s15/core black/super blush
s16
BB5434 easy orange s17/chalk white/ice purple
f16
BB5435 core green s17/chalk white/easy green
s17
TEXTILE/SYNTHETICS
These rugged, lightweight outdoor shoes are
made for trail-running. Designed for a women's-
specific fit, the outdoor shoes keep your feet dry
and protected with waterproof and breathable
GORE-TEX. A TRAXION outsole grips
unpredictable terrain.
S80302 deliv.12/16 BB5434 deliv.12/16 BB5435 deliv.12/16
Lining: GORE-TEX Extended Comfort Footwear.
Midsole: Lightweight EVA midsole for long term
cushioning.
[S80302V9]| [BB5434MZ]| [BB5435N=]|

17Q1_FTW_EUR-CHF_054_103.indd 79 08.06.2016 11:54:41


80 Women

kanadia 8 tr w
size 3.5-10.5 89,95
TRAIL

BB4418 linen s17/collegiate burgundy/glow


orange s14
BB4420 core black/core pink s17/trace grey s17
SYNTHETICS/TEXTILE
Durability, traction and stability come together
in these women's trail running shoes built on a
TRAXION outsole and an extra-soft cloudfoam
midsole. The air mesh upper is reinforced with
synthetic overlays for an ideal fit.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
CLOUDFOAM super plush feel. BB4418 deliv.12/16 BB4420 deliv.12/16
TRAXION grippy lugs that ensure best traction
when running on trails or in the mountain
region. [BB4418IS]| [BB4420C9]|

TRACEROCKER W
size 3.5-10.5 79,95
S80579 core black/vista grey s15/utility black
f16
BB5441 ice purple f16/ch solid grey/easy green
s17
TEXTILE/SYNTHETICS
These streamline trail runners are the next best
thing to wings at your heels. These outdoor shoes
feature a clean design, with an abrasion-resistant
ripstop upper, a women's-specific fit and a rugged
TRAXION outsole for grip.
Midsole: Lightweight EVA midsole for long term
cushioning. S80579 deliv.12/16 BB5441 deliv.01/17
Outsole: TRAXION - the perfect combination of
stability and grip for everyday outdoor activities.
[S80579BW]| [BB5441LV]|

17Q1_FTW_EUR-CHF_054_103.indd 80 08.06.2016 11:54:50


Women 81

Duramo 7 Trail W
size 3.5-10.5 64,95
BB4451 mid grey s14/collegiate burgundy/

TRAIL
dark grey
BB4452 utility black f16/chalk white/still breeze
f12
TEXTILE/SYNTHETICS
These women's trail running shoes combine
simple design with expert construction and
materials to deliver high performance. A
breathable air mesh upper keeps you comfortable,
while a soft cloudfoam midsole provides
lightweight cushioning.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
BB4451 deliv.01/17 BB4452 deliv.01/17
ADIWEAR extended protection against wear
and tear.
CLOUDFOAM super plush feel.
[BB4451JR]| [BB4452KU]|

Galaxy Trail W
size 3.5-10.5 59,95
BB4464 linen s17/chalk white/easy orange s17
BB4466 core black/still breeze f12/core pink
s17
TEXTILE/SYNTHETICS
With maximum traction for trail routes, these
women's running shoes provide ultra-breathable
comfort and plush cushioning. A synthetic and air
mesh upper is lightweight and ventilating, while
the midsole is responsive over off-road obstacles.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
BB4464 deliv.12/16 BB4466 deliv.12/16
CLOUDFOAM super plush feel.
ADIWEAR extended protection against wear
and tear.
[BB4464O+]| [BB4466Q0]|

17Q1_FTW_EUR-CHF_054_103.indd 81 08.06.2016 11:54:56


82 INDOOR
Women - Handball
*Artikel haben eine genderte Segmentierung und deshalb im Anhang des Katalogs zu finden (Stand zur Druckfreigabe Mitte Mai 2016)

Women - Handball
* *
Counterblast Falcon W
INDOOR

size 3.5-12.5 129,95


stabil boost 20Y W
BB1819 ftwr white/silver met./energy s17
size 3.5-12.5 139,95
TEXTILE/SYNTHETICS
BB1820 ftwr white/maroon/energy s17 These breathable women's handball shoes give
TEXTILE/RUBBER you plenty of cushioning and a low-to-the-ground
The game leaps forward. Made with boost and build for stability. They feature a lightweight
springblade technology for endless energy single-layer upper with strategic reinforcements.
straight into overtime, these women's handball SPRINT WEB: Supportive lightweight TPU base
shoes have a stable design with a flexible forefoot layer and abrasion resistant RPU top layer
and comfortable bootee construction. providing excellent stability and protection
Energy Boost: Full-length BOOST midsole ADIPRENE+ : Full forefoot ADIPRENE+ for ideal
offers explosive energy return plus exceptional cushioning during sport-specific movements.
comfort and the smoothest ride in Handball. ADIPRENE: Shock absorbing soft EVA providing
Endless energy means endless attacks, endless BB1820 deliv.01/17
excellent cushioning and helps reducing impacts BB1819 deliv.01/17
jumps, endless power! to ankle joints and knees
Stabilization band Maximal support and stability Torsion System: Provides best midfoot integrity
[BB1820CA]| and motion guidance [BB1819JW]|

* *
Court Stabil 13 W
size 3.5-12.5 99,95 Multido Essence W
BB1818 ftwr white/silver met./maroon size 3.5-12.5 59,95
TEXTILE/SYNTHETICS BB1821 ftwr white/energy s17/silver met.
A solid team player, these women's handball TEXTILE/SYNTHETICS
shoes keep you a step ahead of the competition These women's low-cut handball shoes are
with the ideal combination of strength and speed. versatile enough for all kinds of indoor training.
The low-cut, flexible upper gives natural freedom They have a lightweight open mesh upper and a
of movement. soft, flexible forefoot for ease of motion during
Torsion System: Provides best midfoot integrity your game.
and motion guidance ADIWEAR: High abrasion rubber compound
ADIPRENE+ : Highly responsive EVA maintaining on medial forefoot preventing the shoe from
forefoot propulsion to accelerate your game intense dragging abrasion.
ADIPRENE: Shock absorbing soft EVA providing Non-marking: Rubber compound providing ideal
excellent cushioning and helps reducing impacts BB1818 deliv.01/17
grip on all indoor surfacess BB1821 deliv.01/17
to ankle joints and knees AIR MESH highly-breathable upper for a cooler
EVA Sockliner: Providing comfort and support run.
[BB1818IT]| [BB1821DD]|
Women - Volleyball
* *

Volley Response 2 Boost W


Energy Volley Boost 2.0 W size 3.5-12.5 99,95
size 3.5-12.5 149,95 BA9675 mystery blue s17/glow orange s14/easy
BA9671 mystery blue s17/glow orange s14/easy coral s17
coral s17 TEXTILE/SYNTHETICS
SYNTHETICS/TEXTILE A volleyball shoe designed to help you make the
Jump higher and smash harder in these women's most of every dive and spike. The women's Volley
volleyball shoes designed to cushion and energise BA9671 deliv.12/16
Response 2.0 uses energy-returning boost for BA9675 deliv.12/16
each jump. Featuring an innovative boost foam a fast, light feel. A protective SPRINTSKIN upper
midsole that offers better cushion and energy makes it impact-resistant without sacrificing
return, and a gradient colour effect. [BA9671#=]| lightness. [BA967513]|

17Q1_FTW_EUR-CHF_054_103.indd 82 08.06.2016 11:55:18


Women - Volleyball 83

* *

INDOOR
Volley Response Boost 2 Mid W
size 3.5-12.5 129,95
BA9676 mystery blue s17/glow orange s14/easy
coral s17
TEXTILE/SYNTHETICS
Volley Team 4W
Float through footwork drills in the Boost Volley size 3.5-12.5 69,95
BA9676 Response Mid 2.0. These women's volleyball BA9678
deliv.12/16
shoes pair a mid-cut upper with the energy-
deliv.12/16
BA9678 easy coral s17/glow orange s14/ftwr
returning power of boost for supportive, fast white
[BA967626]| play. [BA96784C]| TEXTILE/SYNTHETICS
Men - Handball
* * stabil boost 20Y
size 4-15 139,95
BB1813 ftwr white/core black/solar yellow
TEXTILE/SYNTHETICS
The game leaps forward. Made with boost and
springblade technology for endless energy
straight into overtime. These men's handball
shoes have a layered 3D mesh upper for
breathable support, plus extra stability in the toe
Ligra 4 W and heel zones.
size 32-35; 3-12.5 49,95 Energy Boost: Full-length BOOST midsole
offers explosive energy return plus exceptional
BA9666 easy coral s17/ftwr white/glow orange comfort and the smoothest ride in Handball.
s14 Endless energy means endless attacks, endless
TEXTILE/SYNTHETICS jumps, endless power!
BA9666 deliv.12/16
A do-it all indoor shoe built for every court BB1813 deliv.01/17
SPRINTPLATE: Propulsion plate delivering
surface. With a breathable mesh and synthetic additional power for high jumps. Stabilizing and
upper, these women's shoes also feature a guiding the foot during jumping and landing.
[BA966601]| durable ADIWEAR outsole. [BB1813DE]|

* *
Counterblast Falcon
size 4.5-13 129,95
BB0872 granite/ftwr white/solar yellow
TEXTILE/SYNTHETICS
Low-cut,lightweighted and breathable shoe with
a comfortable fit and new silhouette. The material
and execution allows quick movement on court.
SPRINT WEB: Supportive lightweight TPU base
layer and abrasion resistant RPU top layer
providing excellent stability and protection
ADIPRENE+ : Full forefoot ADIPRENE+ for ideal
cushioning during sport-specific movements.
stabil boost 20Y ADIPRENE: Shock absorbing soft EVA providing
size 4-15 139,95 excellent cushioning and helps reducing impacts
BB1814 BB0872 to ankle joints and knees
deliv.01/17
BB1814 ftwr white/utility black f16/mystery deliv.01/17
Torsion System: Provides best midfoot integrity
blue s17 and motion guidance
[BB1814EH]| TEXTILE/SYNTHETICS [BB0872KW]|

17Q1_FTW_EUR-CHF_054_103.indd 83 08.06.2016 11:55:26


84 Men - Handball

Counterblast Falcon mid * Court Stabil 13


size 4-15 99,95
size 4.5-14 139,95 BB0866 solar yellow/core black/dark grey
INDOOR

AQ2336 utility black f16/solar yellow/ftwr white TEXTILE/SYNTHETICS


TEXTILE/SYNTHETICS Low-cut high-performance shoe with a flexible
These lightweight and extremely low-to-the- and soft forefoot that gives the foot liberty of
ground men's handball shoes help you move fast action and a TORSION bar for midfoot support
on the court. Their mid-top design was inspired by and stabilization, that kepps players more than a
basketball shoes for optimal ankle support. step ahead of the competition.
SPRINT WEB: Supportive lightweight TPU base Sprint Web: Supportive lightweight TPU top layer
layer and abrasion resistant RPU top layer providing excellent stability and protection
providing excellent stability and protection Torsion System: Provides best midfoot integrity
ADIPRENE+ : Full forefoot ADIPRENE+ for ideal and motion guidance
cushioning during sport-specific movements. Top-Grip rubber is a and NON-MARKING outsole
ADIPRENE: Shock absorbing soft EVA providing rubber compound providing excellent grip on all
excellent cushioning and helps reducing impacts indoor surfaces
to ankle joints and knees AQ2336 deliv.01/17
SPRINTWEB combines a mono mesh with BB0866 deliv.01/17
Torsion System: Provides best midfoot integrity welded foiles to provide lightweight support and
and motion guidance breathability
[AQ2336VI]| [BB0866M$]|

*
Multido Essence
size 4-15 59,95
BB0865 utility black f16/solar yellow/ftwr white
AQ6275 collegiate royal/silver met./shock
blue s16
AQ6276 solar red/night met. f13/ftwr white
AQ6277 ftwr white/night met. f13/collegiate
royal
TEXTILE/SYNTHETICS
Low-cut performance shoe with comfortable fit,
that has a flexible and soft forefoot and synthetic
on the upper with classic stripes.
ADIWEAR: High abrasion rubber compound
on medial forefoot preventing the shoe from
intense dragging abrasion.
Non-marking: Rubber compound providing ideal
grip on all indoor surfacess BB0865 deliv.01/17 AQ6275 deliv.12/16 AQ6276 deliv.12/16 AQ6277 deliv.12/16
AIR MESH highly-breathable upper for a cooler
run.
[BB0865L-]| [AQ62754H]| [AQ62765K]| [AQ62776N]|
Men - Volleyball
* *

Energy Volley Boost 2.0


size 6-15 149,95
BA9670 mystery blue s17/bright yellow/blue
SYNTHETICS/TEXTILE
Jump higher and smash harder in these men's Energy Volley Boost Mid
volleyball shoes designed to cushion and energise BA9670 deliv.12/16 size 3.5-15; 16 149,95 BA9672 deliv.12/16
each jump. Featuring an innovative boost foam
midsole that offers better cushion and energy BA9672 bright yellow/blue/mystery blue s17
return, and a gradient colour effect. [BA9670/W]| TEXTILE/SYNTHETICS [BA9672^+]|

17Q1_FTW_EUR-CHF_054_103.indd 84 08.06.2016 11:55:36


Men - Volleyball 85

INDOOR
Volley Response 2 Boost
size 6-15 99,95
BA9674 blue/mystery blue s17/bright yellow
TEXTILE/SYNTHETICS
A volleyball shoe designed to help you make the
most of every dive and spike. The men's Volley Volley Team 4
BA9674 deliv.12/16
Response 2.0 uses energy-returning boost for BA9677 deliv.12/16 size 6-15 69,95
a fast, light feel. A protective SPRINTSKIN upper
makes it impact-resistant without sacrificing BA9677 ftwr white/bright yellow/blue
[BA967400]| lightness. [BA967739]| TEXTILE/SYNTHETICS
Men - Spezial
* *

TEAM SPEZIAL
size 3.5-15; 16 99,95
G13058 core black/ftwr white/silver met.
TEXTILE/SYNTHETICS
Built for superior fit, grip and cushioning, these
Ligra 4 men's handball shoes have a classic look and
a triple TORSION SYSTEM for great midfoot
size 32-35; 3-14 49,95
support.
BA9667 mystery blue s17/mystery blue s17/ Upper ADITUFF for best abrasion resistance
bright yellow in the toe area.
TEXTILE/SYNTHETICS Midsole Moulded EVA midsole for fit and
BA9667 deliv.12/16
A do-it all indoor shoe built for every court G13058 deliv.12/16
comfort.
surface. With a breathable mesh and synthetic Inlay EVA insole for comfort
upper, these men's shoes also feature a durable NON-SLIP LINING for comfort and performance.
[BA966714]| ADIWEAR outsole. [G13058.D]|
Kids
* *
stabil J
HB SPEZIAL size 32-35; 3-6 69,95
size 3.5-15 79,95
BB0867 ftwr white/core black/solar yellow
M18444 royal/core white/ftwr white
TEXTILE/SYNTHETICS
M18209 core black/core white/core black
The game leaps forward. Made with springblade
LEATHER/SYNTHETICS technology for endless energy straight into
A classic handball shoe that has a long and overtime. These juniors' handball shoes have the
storied lineage. These men's shoes have a look of the adult's top Stabil with a layered 3D
suede upper with synthetic 3-Stripes and extra mesh upper for breathable support, plus extra
cushioning in the heel for comfort and support. stability in the toe and heel zones.
Upper: EVA tongue for additional comfort.Suede Stabilization band Maximal support and stability
leather with synthetic 3-Stripes. ADIPRENE+ : Full forefoot ADIPRENE+ for ideal
Inlay EVA insole for comfort cushioning during sport-specific movements.
Non-marking rubber outsole ADIPRENE: Shock absorbing soft EVA providing
M18444 deliv.12/16 M18209 deliv.12/16
Midsole: adiPRENE insert for comfort and BB0867 deliv.01/17
excellent cushioning and helps reducing impacts
shock absorption.adiPRENE+ insert for forefoot to ankle joints and knees
propulsion and efficiency. Non-marking: Rubber compound providing ideal
[M1844456]| [M18209/V]| [BB0867N%]| grip on all indoor surfacess

17Q1_FTW_EUR-CHF_054_103.indd 85 08.06.2016 11:55:44


86 Kids

* *
Counterblast Falcon J
INDOOR

size 32-35; 3-6 64,95


BB1809 core black/solar yellow/ftwr white
TEXTILE/SYNTHETICS
court stabil J For up and coming junior players seeking a
size 32-35; 3-6 54,95 lightweight and breathable shoe, the Counterblast
7 is an easy choice. These junior handball shoes
BB0874 solar yellow/core black/ftwr white have a stripped-down design for maximum speed,
TEXTILE/SYNTHETICS while cushioning in the forefoot and heel helps
A solid team player, these juniors' handball shoes absorb impact.
keep you a step ahead of the competition with Non-marking: Rubber compound providing ideal
the ideal combination of strength and speed. The grip on all indoor surfacess
low-cut, flexible upper gives natural freedom of ADITUFF: Sport specifically positioned high
movement. abrasion and tear resistant upper material
Mesh base with synthetic overlays BB0874 deliv.01/17
ADIPRENE: Shock absorbing soft EVA providing BB1809 deliv.01/17
Light EVA midsole with a rubber outsole for excellent cushioning and helps reducing impacts
more flexibility. to ankle joints and knees
[BB0874M=]| [BB1809HR]|

17Q1_FTW_EUR-CHF_054_103.indd 86 08.06.2016 11:55:48


TENNIS
*Artikel haben eine genderte Segmentierung und deshalb im Anhang des Katalogs zu finden (Stand zur Druckfreigabe Mitte Mai 2016)
87

TENNIS FTW SS17

TENNIS
SEGMENTATION

FOUNDATION RANGE BD / CD MIX RANGE

DRIVEN
DRIVEN

BRAND
BRAND

COMMERCIAL
COMMERCIAL

BRAND DRIVEN
DRIVEN
BRAND
COMMERCIAL

BD SPORT SPECIALIST
DRIVEN
BRAND
COMMERCIAL

17Q1_FTW_EUR-CHF_054_103.indd 87 08.06.2016 11:55:49


88 TENNIS
Women - aSMC Barricade

Women - aSMC Barricade aSMC Barricade 2017


size 3.5-10 129,95
BB4819 ftwr white/universe f10/solar red
TENNIS

aSMC Barricade Boost 2017


size 3.5-10 159,95 AQ6296 blaze orange s13/ftwr white/solar red
TEXTILE/SYNTHETICS
BB5050 solar yellow/ftwr white/solar yellow
ADIPRENE under the heel for superior
BB5049 ftwr white/universe f10/red
cushioning at impact.
TEXTILE/SYNTHETICS Full-length ADIPRENE+ for optimized
Boosts energy returning properties keep every cushioning and rebounding.
step charged with an endless supply of light, 3D TORSION provides adaptive midfoot
fast energy. support
ADIPRENE under the heel for superior 360TPU support upper for superior lateral
cushioning at impact. stability and durability in in key abrasion areas.
3D TORSION provides adaptive midfoot Seamless bootee construction for better fit and
support unmatched comfort.
360TPU support upper for superior lateral Adituff for better abrasion resistance in the toe
stability and durability in in key abrasion areas. BB5050 deliv.01/17 BB5049 deliv.03/17
area. BB4819 deliv.03/17 AQ6296 deliv.03/17
Seamless bootee construction for better fit and Adiwear 6 outsole offers the ultimate in high-
unmatched comfort. wear durability.
[BB5050A5]| [BB5049HR]| [BB4819VC]| [AQ62969U]|
Women - Barricade
Barricade 2017
size 4-15 139,95
AQ6295 samba blue s14/ftwr white/ftwr white
BA9072 ftwr white/dgh solid grey/ftwr white
BA9073 mystery blue s17/tactile blue s17/glow
orange s14
TEXTILE/SYNTHETICS
Full-length ADIPRENE+ for optimized
cushioning and rebounding.
GEOFIT construction for anatomical fit and
comfort.
Barricade 3D trianguar-chassis for adaptive
midfoot support and functional stability, and
extra freedom and flexibility in forefoot.
Knitted upper to naturally expand with your AQ6295 deliv.01/17 BA9072 deliv.01/17 BA9073 deliv.01/17
foot, help reduce irritation and give a mire
comfortable fit.
[AQ62958R]| [BA9072R&]| [BA9073S2]|

Barricade Classic Bounce W


size 3.5-10 99,95
BY2926 ftwr white/silver met./lgh solid grey
BY2926 BY2925
BY2925 ftwr white/mystery blue s17/easy deliv.01/17 deliv.01/17

green s17
SYNTHETICS/TEXTILE [BY2926&F]| [BY2925^C]|

17Q1_FTW_EUR-CHF_054_103.indd 88 08.06.2016 11:55:59


Women - Barricade 89

Barricade Club w
size 3.5-10 79,95
BB4825 mystery blue s17/core blue s17/clear

TENNIS
aqua
BB4826 haze coral s17/ftwr white/core pink s17
BB3378 ftwr white/silver met./core pink s17
TEXTILE/SYNTHETICS
Full-length ADIPRENE+ for optimized
cushioning and rebounding.
Adiwear 6 outsole offers the ultimate in high-
wear durability.
Adituff for better abrasion resistance in the toe
area.
3D TORSION provides adaptive midfoot
support
Lightweight engineered mesh in the upper for
BB4825 deliv.12/16 BB4826 deliv.12/16 BB3378 deliv.12/16
breathability and air flow.
Allcourt outsole.
Weight: 275 gram; 9.7 ounces
[BB4825T5]| [BB4826U8]| [BB3378N%]|

Barricade Court w
size 3.5-10 69,95
BB4829 energy s17/ftwr white/glow orange s14
BB4827 ftwr white/mystery blue s17/easy
green s17
BB4828 ftwr white/silver met./mgh solid grey
TEXTILE/SYNTHETICS
Cloudfoam midsole for step-in comfort and
superior cushioning.
ADIWEAR outsole offer the ultimate in high-
wear durability.
BB4829 deliv.12/16 BB4827 deliv.12/16 BB4828 deliv.12/16
Durable and abrasion resistant syntehtic upper.
Allcourt outsole.
Weight: 260 gram; 9.1 ounces
[BB4829XH]| [BB4827VB]| [BB4828WE]|
Women - adizero
*
Adizero Ubersonic 2 w Adizero Ubersonic 2 w clay
size 3.5-10 129,95 size 3.5-10 129,95
BB4811 ftwr white/silver met./glow orange s14 BB4812 core green s17/ftwr white/energy s17
BB4810 glow orange s14/silver met./samba TEXTILE/SYNTHETICS
blue s14 These women's tennis shoes are made for speed
TEXTILE/SYNTHETICS so you can keep up with the specific demands
These women's tennis shoes provide the of play on clay courts. A woven textile upper and
advantage of speed with an improved lightweight unitongue wrap construction provide lightweight
fit and better responsiveness. A woven textile fit and comfort while you chase down balls on the
upper and unitongue wrap construction provide red stuff. SPRINTFRAME construction offers
lightweight fit and comfort. SPRINTFRAME stability.
construction and midfoot webbing offer ADIPRENE under the heel for superior
lightweight stability. cushioning at impact.
ADIPRENE under the heel for superior Full-length ADIPRENE+ for optimized
BB4811 deliv.01/17 BB4810 deliv.01/17
cushioning at impact. BB4812 deliv.04/17
cushioning and rebounding.
Full-length ADIPRENE+ for optimized Adiwear 6 outsole offers the ultimate in high-
cushioning and rebounding. wear durability.
[BB4811NZ]| [BB4810MW]| [BB4812O=]|

17Q1_FTW_EUR-CHF_054_103.indd 89 08.06.2016 11:56:12


90 Women - adizero

Adizero Court W Adizero Attack w


size 3.5-10 69,95 size 3.5-10 49,95
TENNIS

BB4814 solar gold/silver met./ftwr white BB4817 easy green s17/ftwr white/glow orange
TEXTILE/SYNTHETICS s14
BB4818 ftwr white/silver met./mgh solid grey
These women's tennis shoes have a low to the
ground design to help you move with instinct, and SYNTHETICS
a lightweight feel for quick agility and control. Fast, light and full of attitude, these women's
Rear overlays and heel support give midfoot tennis shoes feature a synthetic upper with
stability for aggressive cuts, while a durable all- perforations for enhanced breathability. The
court outsole provides traction. durable ADIWEAR outsole stands up to abrasive
Full-length ADIPRENE+ for optimized courts and provides secure grip in all directions.
cushioning and rebounding. ADIWEAR outsole offer the ultimate in high-
Adituff for better abrasion resistance in the toe wear durability.
area. Perforations in forefoot and quarter for
ADIWEAR outsole offer the ultimate in high- enhanced breathability and air flow.
wear durability. BB4814 deliv.12/16
Durable and abrasion resistant syntehtic upper. BB4817 deliv.12/16 BB4818 deliv.12/16
3D TORSION provides adaptive midfoot Allcourt outsole.
support Weight: 260 gram; 9.1 ounces
[BB4814Q#]| [BB4817T6]| [BB4818U9]|
Men - Barricade
Barricade 2017 Boost
size 6-15 159,95
BA9103 core black/ftwr white/core green s17
BA9104 glow orange s14/ftwr white/solar gold
TEXTILE/SYNTHETICS
Boosts energy returning properties keep every
step charged with an endless supply of light,
fast energy.
GEOFIT construction for anatomical fit and
comfort.
Barricade 3D trianguar-chassis for adaptive
midfoot support and functional stability, and
extra freedom and flexibility in forefoot.
Knitted upper to naturally expand with your
foot, help reduce irritation and give a mire
comfortable fit. BA9103 deliv.04/17 BA9104 deliv.01/17
Adiwear 6 outsole offers the ultimate in high-
wear durability.
[BA9103HL]| [BA9104IO]|
Barricade 2017
size 4-15 139,95
AQ6295 samba blue s14/ftwr white/ftwr white
BA9072 ftwr white/dgh solid grey/ftwr white
BA9073 mystery blue s17/tactile blue s17/glow
orange s14
TEXTILE/SYNTHETICS
Full-length ADIPRENE+ for optimized
cushioning and rebounding.
GEOFIT construction for anatomical fit and
comfort.
Barricade 3D trianguar-chassis for adaptive
midfoot support and functional stability, and
extra freedom and flexibility in forefoot.
Knitted upper to naturally expand with your
foot, help reduce irritation and give a mire
comfortable fit. AQ6295 deliv.01/17 BA9072 deliv.01/17 BA9073 deliv.01/17
Adituff for better abrasion resistance in the toe
area.
[AQ62958R]| [BA9072R&]| [BA9073S2]|

17Q1_FTW_EUR-CHF_054_103.indd 90 08.06.2016 11:56:22


Men - Barricade 91

Novak Pro
Barricade 2017 clay size 6-14 139,95
size 6-15 139,95 BA8012 blue glow s16/ftwr white/high steel f09

TENNIS
BA9102 ftwr white/dgh solid grey/energy s17 BA8013 ftwr white/collegiate royal/scarlet
TEXTILE/SYNTHETICS SYNTHETICS
Full-length ADIPRENE+ for optimized ADIPRENE under the heel for superior
cushioning and rebounding. cushioning at impact.
GEOFIT construction for anatomical fit and Full-length ADIPRENE+ for optimized
comfort. cushioning and rebounding.
Barricade 3D trianguar-chassis for adaptive Adiwear 6 outsole offers the ultimate in high-
midfoot support and functional stability, and wear durability.
extra freedom and flexibility in forefoot. Full-length ADIPRENE+ for optimized
Knitted upper to naturally expand with your cushioning and rebounding.
foot, help reduce irritation and give a mire Adituff for better abrasion resistance in the toe
comfortable fit. area.
Adituff for better abrasion resistance in the toe 3D TORSION provides adaptive midfoot
BA9102 deliv.01/17
area. BA8012 deliv.12/16 BA8013 deliv.03/17
support
Adiwear 6 outsole offers the ultimate in high- Perforations in forefoot and quarter for
wear durability. enhanced breathability and air flow.
[BA9102GI]| [BA8012B7]| [BA8013CA]|

Barricade Classic Bounce


size 3-13.5 99,95
BY2919 deliv.01/17 BY2918 deliv.01/17 BY2919 ftwr white/core black/ftwr white
BY2918 mystery blue s17/silver met./ftwr white
[BY29190J]| [BY2918&G]| SYNTHETICS/TEXTILE

Barricade Club
size 4-14 79,95
BA9153 ftwr white/tech blue met.s17/mystery
blue s17
BA9154 ftwr white/solar gold/glow orange s14
BA9152 night met. f13/ftwr white/core black
TEXTILE/SYNTHETICS
Full-length ADIPRENE+ for optimized
cushioning and rebounding.
3D TORSION provides adaptive midfoot
support
360TPU support upper for superior lateral
stability and durability in in key abrasion areas.
Adituff for better abrasion resistance in the toe
BA9153 deliv.12/16 BA9154 deliv.12/16 BA9152 deliv.12/16
area.
Lightweight air mesh in the upper for
breathability and air flow.
[BA9153R&]| [BA9154S2]| [BA9152Q/]|

17Q1_FTW_EUR-CHF_054_103.indd 91 08.06.2016 11:56:39


92 Men - Barricade

Barricade Club clay


TENNIS

size 6-14 79,95


BA9155 silver met./night met. f13/core black
TEXTILE/SYNTHETICS
Full-length ADIPRENE+ for optimized
cushioning and rebounding.
3D TORSION provides adaptive midfoot
support
360TPU support upper for superior lateral
stability and durability in in key abrasion areas.
Adituff for better abrasion resistance in the toe
area.
Lightweight air mesh in the upper for
breathability and air flow.
ADIWEAR outsole offer the ultimate in high- BA9155 deliv.12/16
wear durability.
Clay outsole
Weight: 345 gram; 12.1 ounces [BA9155T5]|

Barricade Court
size 6-14 69,95
BB3325 ftwr white/clear onix/core black
BA9151 mystery blue s17/ftwr white/tech blue
met.s17
BA9150 ftwr white/glow orange s14/silver met.
TEXTILE/SYNTHETICS
Cloudfoam midsole for step-in comfort and
superior cushioning.
ADIWEAR outsole offer the ultimate in high-
wear durability.
Layered sandwich upper mesh for enhanced
comfort, breathability and air flow.
Adituff for better abrasion resistance in the toe
area. BB3325 deliv.12/16 BA9151 deliv.12/16 BA9150 deliv.12/16
TORSION SYSTEM for midfoot integrity.
Allcourt outsole.
Weight: 335 gram; 11.8 ounces [BB3325A8]| [BA9151P/]| [BA9150O.]|
Men - adizero
Adizero Ubersonic 2 oc
size 4-11.5 129,95
Adizero Ubersonic 2
BB3408 samba blue s14/bright yellow/ftwr
size 6-13.5 129,95
white
BA7825 glow orange s14/mystery blue s17/ TEXTILE/SYNTHETICS
ftwr white Knitted upper to naturally expand with your
TEXTILE/SYNTHETICS foot, help reduce irritation and give a mire
Knitted upper to naturally expand with your comfortable fit.
foot, help reduce irritation and give a mire 3D TORSION provides adaptive midfoot
comfortable fit. support
3D TORSION provides adaptive midfoot Sprintframe construction provides stability and
support speed through geometrical research to create a
Sprintframe construction provides stability and lightweight and supportive chassis.
speed through geometrical research to create a Adituff for better abrasion resistance in the toe
lightweight and supportive chassis. area.
Adituff for better abrasion resistance in the toe Adiwear 6 outsole offers the ultimate in high-
area. BA7825 deliv.01/17
wear durability. BB3408 deliv.12/16
Adiwear 6 outsole offers the ultimate in high- Seamless bootee construction for better fit and
wear durability. unmatched comfort.
[BA7825-L]| [BB3408CE]|

17Q1_FTW_EUR-CHF_054_103.indd 92 08.06.2016 11:56:54


Men - adizero 93

Adizero Ubersonic 2 clay Adizero Ubersonic 2 clay


size 6-13.5 129,95 size 6-13.5 129,95

TENNIS
BB3323 core green s17/ftwr white/green BB3322 core black/ftwr white/dgh solid grey
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Knitted upper to naturally expand with your Knitted upper to naturally expand with your
foot, help reduce irritation and give a mire foot, help reduce irritation and give a mire
comfortable fit. comfortable fit.
3D TORSION provides adaptive midfoot 3D TORSION provides adaptive midfoot
support support
Sprintframe construction provides stability and Sprintframe construction provides stability and
speed through geometrical research to create a speed through geometrical research to create a
lightweight and supportive chassis. lightweight and supportive chassis.
Adituff for better abrasion resistance in the toe Adituff for better abrasion resistance in the toe
area. area.
Adiwear 6 outsole offers the ultimate in high- Adiwear 6 outsole offers the ultimate in high-
BB3323 deliv.04/17
wear durability. BB3322 deliv.12/16
wear durability.
Seamless bootee construction for better fit and Seamless bootee construction for better fit and
unmatched comfort. unmatched comfort.
[BB332382]| [BB33227&]|

Adizero Court
size 4-13 69,95
BA9085 ftwr white/silver met./mystery blue s17 Adizero Court oc
size 4-13 69,95
TEXTILE/SYNTHETICS
These men's tennis shoes have a low to the BB3413 samba blue s14/mystery blue s17/
ground design to help you move with instinct, and ftwr white
a lightweight feel for quick agility and control. TEXTILE/SYNTHETICS
Rear overlays and heel support give midfoot ADIPRENE under the heel for superior
stability for aggressive cuts, while a durable all- cushioning at impact.
court outsole provides traction. ADIWEAR outsole offer the ultimate in high-
ADIPRENE under the heel for superior wear durability.
cushioning at impact. Adituff for better abrasion resistance in the toe
ADIWEAR outsole offer the ultimate in high- area.
wear durability. Monomesh upper for maximum cooling and air
Adituff for better abrasion resistance in the toe flow.
BA9085 deliv.12/16
area. BB3413 deliv.12/16
TORSION SYSTEM for midfoot integrity.
Monomesh upper for maximum cooling and air Omnicourt outsole
flow. Weight: 310 gram; 10.9 ounces
[BA9085WD]| [BB341394]|
Kids
Adizero Attack Barricade 2016 xJ
size 6-13.5 49,95 size 32-35; 3-6.5 69,95
BA9083 core black/silver met./ftwr white BA7812 ftwr white/dgh solid grey/grey
BA9084 ftwr white/core black/ftwr white TEXTILE/SYNTHETICS
SYNTHETICS These juniors' tennis shoes provide lightweight
Fast, light and full of attitude, these men's tennis stability for your game. They feature full-length
shoes feature a synthetic upper with perforations cushioning and a breathable upper. Designed with
for enhanced breathability. The durable an ADITUFF toe wrap and ADIWEAR outsole to
ADIWEAR outsole stands up to abrasive courts handle the rigours of aggressive tennis play.
and provides secure grip in all directions. adiPRENE+ midsole compound offers better
ADIWEAR outsole offer the ultimate in high- shock absorbing cushioning during match play
wear durability. and features our highest resilience for fast
Perforations in forefoot and quarter for responses
enhanced breathability and air flow. Adiwear 6 provides secure grip in all directions
BA9083 deliv.12/16 BA9084 deliv.12/16
Durable and abrasion resistant syntehtic upper. BA7812 deliv.12/16
due to an extremely durable outsole rubber
Allcourt outsole. A lightweight TPU skin is bonded to a ballistic
Weight: 260 gram; 9.1 ounces mesh, which provides optimal comfort.
[BA9083U7]| [BA9084VA]| [BA7812V7]|

17Q1_FTW_EUR-CHF_054_103.indd 93 08.06.2016 11:57:09


94 Kids
TENNIS

Sonic Attack K
size 28-35; 3-6.5 39,95
Barricade Club xJ AQ2817 ftwr white/tech steel f16/matte silver
size 32-35; 3-6.5 54,95 BB4123 ftwr white/tech steel f16/flash red s15
BA7706 ftwr white/silver met./samba blue s14 SYNTHETICS
BA7708 mystery blue s17/ftwr white/glow These kids' tennis shoes amplify young players'
orange s14 games with a fast look and an ultra-light moulded
SYNTHETICS/TEXTILE EVA midsole. Light enough to cover the court, with
Sporting the same winning look as the adult a durable build to stand up to match after match.
version, these juniors' tennis shoes rule the court. Light EVA midsole with a rubber outsole for
They're designed for maximum comfort, they have BA7706 deliv.12/16 BA7708 deliv.12/16
more flexibility. AQ2817 deliv.12/16 BB4123 deliv.12/16
a breathable air mesh upper and synthetic leather Upper: Synthetic leather upper for lightweight
overlays to get you through every set with stability and durability.
and support. [BA7706U7]| [BA7708WD]| [AQ2817//]| [BB41236#]|

17Q1_FTW_EUR-CHF_054_103.indd 94 08.06.2016 11:57:18


BASKETBALL 95

BASKETBALL
BASKETBALL FTW SS17
SEGMENTATION

FOUNDATION RANGE
OPEN FOR ALL ACCOUNTS EXCEPT
FASHION AND COMMERCIAL DRIVEN
LEISURE

BRAND DRIVEN / CD MIX

17Q1_FTW_EUR-CHF_054_103.indd 95 08.06.2016 11:57:18


96 BASKETBALL
Icon - D Rose

Icon - D Rose
BASKETBALL

D ROSE DOMINATE IV
D ROSE DOMINATE IV size 6-15 109,95
size 6-15 109,95
BB8181 mystery blue s17/scarlet/collegiate
BB8182 core black/utility black f16/ftwr white navy
SYNTHETICS/TEXTILE SYNTHETICS/TEXTILE
He may get knocked down, but D-Rose never He may get knocked down, but D-Rose never
stays down. Rise up with him in these basketball stays down. Rise up with him in these basketball
shoes featuring a patterned lightweight upper, the BB8182 deliv.12/16
shoes featuring a patterned lightweight upper, the BB8181 deliv.12/16
energised comfort of BOUNCE cushioning, an energised comfort of BOUNCE cushioning, an
updated TPU heel for added stability behind every updated TPU heel for added stability behind every
cut and a rising swirl graphic. [BB8182XD]| cut and a rising swirl graphic. [BB8181WA]|

D ROSE DOMINATE IV
size 6-15 109,95
BB8180 dgh solid grey/glow orange s14/ch
solid grey
BB8179 collegiate burgundy/scarlet/mgh solid
grey
SYNTHETICS/TEXTILE
He may get knocked down, but D-Rose never D ROSE MENACE 2
stays down. Rise up with him in these basketball size 6-15 79,95
shoes featuring a patterned lightweight upper, the BB8180 deliv.12/16 BB8179 deliv.12/16 BB8201 core black/scarlet/core black BB8201 deliv.12/16 B42634 deliv.12/16
energised comfort of BOUNCE cushioning, an
updated TPU heel for added stability behind every B42634 core black/ftwr white/core black
cut and a rising swirl graphic. [BB8180V7]| [BB8179=T]| SYNTHETICS [BB8201JO]| [B42634S$]|
Adult - Inline

Crazy Hustle
Crazy Hustle size 6-15; 16-19 99,95
size 6-15; 16-19 99,95 BW0559ftwr white/silver met./lgh solid grey
BB8257 scarlet/core black/collegiate burgundy BB8341 collegiate royal/silver met./blue
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Don't wait for the game to come to you. Push the Don't wait for the game to come to you. Push the
pace in this mid-cut basketball shoe. It features BB8257 deliv.01/17
pace in this mid-cut basketball shoe. It features BW0559 deliv.01/17 BB8341 deliv.01/17
a lightweight and durable upper, BOUNCE for a lightweight and durable upper, BOUNCE for
energised cushioning, and a TPU midfoot shank to energised cushioning, and a TPU midfoot shank to
support every slash down the lane. [BB8257ZK]| support every slash down the lane. [BW0559PI]| [BB8341U4]|

17Q1_FTW_EUR-CHF_054_103.indd 96 08.06.2016 11:57:34


Adult - Inline 97

BASKETBALL
Light Em Up 2017
size 6.5-15; 16-19 99,95
B49392 core black/energy s17/lgh solid grey
BB8348 mgh solid grey/ftwr white/dgh solid
grey
BB8349 ftwr white/reflective/scarlet
TEXTILE/SYNTHETICS
The basketball shoe designed to light up the
scoreboard. Go rim to rim with the energised
B49392 deliv.02/17 BB8348 deliv.02/17 BB8349 deliv.03/17
comfort of BOUNCE cushioning, the lockdown
fit of a wraparound tongue construction and
asymmetrical lacing, and the style of a dual-
[B49392AB]| [BB8348.P]| [BB8349=S]| colour upper.

Street Jam 3
Street Jam 3 size 6-15; 16-19 89,95
size 6-15; 16-19 89,95
BB7125 scarlet/pearl grey s14/collegiate
BB7127 core black/scarlet/core black burgundy
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
BB7127 deliv.01/17
Take over in crunch time in these basketball BB7125 deliv.01/17
Take over in crunch time in these basketball
shoes. They feature a breathable mesh upper, shoes. They feature a breathable mesh upper,
ADIPRENE+ cushioning and the all-weather grip ADIPRENE+ cushioning and the all-weather grip
[BB7127M-]| of an ADIWEAR outsole. [BB7125KU]| of an ADIWEAR outsole.

Street Jam 3
size 6-15; 16-19 89,95
BB7126 core black/ftwr white/collegiate royal
TEXTILE/SYNTHETICS Rise Up
BB7126 deliv.01/17
Take over in crunch time in these basketball BW0496 deliv.01/17 size 6-15 79,95
shoes. They feature a breathable mesh upper,
ADIPRENE+ cushioning and the all-weather grip BW0496clear brown/ftwr white/light brown
[BB7126LX]| of an ADIWEAR outsole. [BW0496RM]| TEXTILE/SYNTHETICS

17Q1_FTW_EUR-CHF_054_103.indd 97 08.06.2016 11:57:48


98 Adult - Inline
BASKETBALL

CRAZY TEAM 2017


size 6-15; 16-19 79,95
BB8256 ftwr white/mgh solid grey/mystery
blue s17
SYNTHETICS/TEXTILE
Rise Up Bring a little throwback style to the floor with
size 6-15 79,95 BB8246 deliv.01/17
these basketball shoes. They feature a breathable BB8256 deliv.01/17
mesh and synthetic upper with a padded collar,
BB8246 core black/utility black f16/ftwr white ADIPRENE+ cushioning, a wraparound enhanced
TEXTILE/SYNTHETICS [BB8246WC]| traction outsole and an exaggerated heel counter. [BB8256YH]|

CRAZY TEAM 2017


Nxt Lvl Spd V
size 6-15; 16-19 79,95
size 6-12.5; 13.5; 14.5-15; 69,95
B49400 scarlet/core black/ftwr white 16-19
BB8253 core black/blue/lgh solid grey B49391 core black/ftwr white/dgh solid grey
SYNTHETICS/TEXTILE SYNTHETICS/TEXTILE
Bring a little throwback style to the floor with Find a gear that defences don't have with these
these basketball shoes. They feature a breathable B49400 deliv.01/17 BB8253 deliv.01/17
basketball shoes. ADIPRENE+ cushioning and B49391 deliv.01/17
mesh and synthetic upper with a padded collar, the fit and comfort of GEOFIT construction help
ADIPRENE+ cushioning, a wraparound enhanced you get up and down the floor with speed and
traction outsole and an exaggerated heel counter. [B49400/E]| [BB8253V8]| efficiency. [B4939198]|

Nxt Lvl Spd V


size 6-15; 16-19 69,95 Nxt Lvl Spd V
BB8277 collegiate royal/ftwr white/collegiate size 6-12.5; 13.5; 14.5-15; 69,95
royal 16-19
BW0623scarlet/core black/ftwr white BW0624ftwr white/core black/clear grey s12
SYNTHETICS/TEXTILE SYNTHETICS/TEXTILE
Find a gear that defences don't have with these Find a gear that defences don't have with these
basketball shoes. ADIPRENE+ cushioning and BB8277 deliv.01/17 BW0623 deliv.01/17
basketball shoes. ADIPRENE+ cushioning and BW0624 deliv.01/17
the fit and comfort of GEOFIT construction help the fit and comfort of GEOFIT construction help
you get up and down the floor with speed and you get up and down the floor with speed and
efficiency. [BB8277$U]| [BW0623G$]| efficiency. [BW0624H%]|

17Q1_FTW_EUR-CHF_054_103.indd 98 08.06.2016 11:58:07


Junior - Inline 99

Junior - Inline

BASKETBALL
Light Em Up 2017 J
size 3-6.5 74,95 Light Em Up 2017 J
BW0524 BW0523 size 3-6.5 74,95
deliv.12/16
BW0524mgh solid grey/ftwr white/dgh solid deliv.12/16

grey BW0523ftwr white/core black/clear grey s12


[BW0524EZ]| TEXTILE/SYNTHETICS [BW0523DW]| TEXTILE/SYNTHETICS

Crazy Hustle J Crazy Hustle J


BW0510 deliv.01/17 size 3-6.5 64,95 BW0511 deliv.01/17 size 3-6.5 64,95
BW0510collegiate burgundy/core black/scarlet BW0511collegiate royal/silver met./blue
[BW05108I]| TEXTILE/SYNTHETICS [BW05119L]| TEXTILE/SYNTHETICS
Kids - Inline

Light Em Up 2017 C
Light Em Up 2017 C size 28-35 64,95
BW0527 size 28-35 64,95 BW0528
deliv.01/17 deliv.01/17
BW0528mgh solid grey/ftwr white/dgh solid
BW0527ftwr white/core black/scarlet grey
[BW0527H#]| TEXTILE/SYNTHETICS [BW0528I0]| TEXTILE/SYNTHETICS

17Q1_FTW_EUR-CHF_054_103.indd 99 08.06.2016 11:58:17


100 Kids - Inline
BASKETBALL

BB FUN 2 K BB FUN 2 K
size 28-35; 3-6.5 54,95 BB8307 deliv.01/17 size 28-35; 3-6.5 54,95 B49612 deliv.01/17

BB8307 energy blue s17/blue/ftwr white B49612 core black/ftwr white/energy s17
SYNTHETICS [BB8307S2]| SYNTHETICS [B496123$]|

Nxt Lvl Spd V NBA K


size 28-35; 3-6.5 54,95 B49616 deliv.01/17

B49616 core black/ftwr white/silver met.


SYNTHETICS/TEXTILE [B4961674]|

Nxt Lvl Spd V NBA K


size 28-35; 3-6.5 54,95 BW0501 deliv.01/17

BW0501blue/orange-sld/ftwr white
SYNTHETICS/TEXTILE [BW05017G]|

17Q1_FTW_EUR-CHF_054_103.indd 100 08.06.2016 11:58:23


Junior - Inline 101

BASKETBALL
Nxt Lvl Spd V K
size 28-35; 3-6.5 49,95
BB8284 deliv.01/17
BB8284 lgh solid grey/shock purple f16/mgh
solid grey
[BB8284=Q]| SYNTHETICS/TEXTILE

Nxt Lvl Spd V K


BW0499 deliv.01/17 size 28-35; 3-6.5 49,95
BW0499core black/ftwr white/dgh solid grey
[BW0499UV]| SYNTHETICS/TEXTILE

17Q1_FTW_EUR-CHF_054_103.indd 101 08.06.2016 11:58:26


102 Slides

CLOUDFOAM PLUS ZEN


SLIDES

Best for the athlete recovery starts when the game is over. With the
cloudfoam plus zen adidas provides the ultimate tool for post-sports
recovery and travel in order to enable athletes to get the most out of
their recovery window. The more efficient athletes recover today, the
better they perform at a high level tomorrow.
The cloudfoam plus zen allows for easy slip-on after sports and for
traveling, while its cloudfoam plus zen footbed guarantees incredible
comfort and a slight massage feeling. The breathable upper mesh
provides ventilation for a healthy foot climate.

ADILETTE CLOUDFOAM PLUS


The cloudfoam plus is our newest, extremely soft and smooth footbed
technology. By taking our famous cloudfoam to a whole new level of
softness, it provides an unmatched level of comfort with its cushioned,
contoured footbed. Made from the perfect material composition, the
feel of the cloudfoam plus offers a seamless relationship between foot
and slide, ideal for everyday use.

17Q1_FTW_EUR-CHF_054_103.indd 102 08.06.2016 11:58:30


SLIDES
Men - Pool 103

Men - Pool

SLIDES
adilette CF ultra ADJ
size 4-13 34,95
adilette CF ultra explorer
S80344 core black/iron met./ftwr white
size 4-13 34,95
BB4509 mystery blue s17/tech blue met.s17/
AQ2104 core black/core black/core black collegiate navy
AQ5050 collegiate navy/collegiate navy/ SYNTHETICS
collegiate navy These ahh-inspiring men's slides show off a
LEATHER 3-Stripes graphics on the adjustable upper. A
Be one with nature in this ahh-inspiring adilette cloudfoam ultra footbed gives them a plush,
slide. Rich materials and suede upper combine supremely comfortable feel.
with the plush feel of SUPERCLOUD PLUS Synthetic material mix for interesting looks of
footbed for a supremely comfortable experience. upper
Rich suede material for interesting looks Adjustable upper
AQ2104 deliv.12/16 AQ5050 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new S80344 deliv.12/16 BB4509 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new
level of softness with its cushiony footbed level of softness with its cushiony footbed
Injected EVA outsole for lightweight comfort Injected EVA outsole for lightweight comfort
[AQ2104HU]| [AQ5050WG]| [S80344+Z]| [BB4509KX]|

adilette SC+ C
size 4-18 29,95
AQ3113 collegiate royal/ftwr white/collegiate
royal
AQ3114 maroon/ftwr white/maroon
AQ3116 collegiate navy/ftwr white/collegiate
navy
S79352 core black/silver met./core black
SYNTHETICS
Tired feet deserve a little comfort. Featuring an
injected EVA outsole for maximum cushioning,
these men's lightweight slides bring relaxed style.
Designed with an extra-soft SUPERCLOUD
PLUS footbed for a ultra-comfortable fit.
AQ3113 deliv.12/16 AQ3114 deliv.12/16 AQ3116 deliv.12/16 S79352 deliv.12/16
Synthetic material mix for interesting looks of
upper
Padded bandage for extra comfort
[AQ3113M+]| [AQ3114N#]| [AQ3116P3]| [S79352PA]|

adilette CF ultra
size 4-13 29,95
AQ4935 core black/ftwr white/core black
AQ4936 eqt blue s16/ftwr white/eqt blue s16
TEXTILE/SYNTHETICS
Take a walk on the clouds in the latest
and greatest adilette slide. With a luxe adilette CF+ messi
SUPERCLOUD PLUS footbed, this slide is as size 4-13 29,95
comfortable as it is stylish.
BB4528 core black/granite/red
Synthetic material mix for interesting looks of
upper SYNTHETICS
AQ4935 deliv.12/16 AQ4936 deliv.12/16
Supercloud plus provides a whole new level of BB4528 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new
softness with its cushiony contoured footbed level of softness with its cushiony footbed
Injected EVA outsole for lightweight comfort Injected EVA outsole for lightweight comfort
[AQ49359S]| [AQ4936AV]| [BB4528N/]|

17Q1_FTW_EUR-CHF_054_103.indd 103 08.06.2016 11:58:48


104 Men - Pool
SLIDES

izamo CF adipure CF
size 6-13 34,95 size 5-13 29,95
S77988 eqt blue s16/ftwr white/core black AQ3936 core black/ftwr white/clear grey s12
S77989 core black/ftwr white/core black AQ3937 collegiate navy/vapour steel f16/clear
SYNTHETICS grey s12
These men's slides are designed for comfort with TEXTILE/SYNTHETICS
an extra soft cloudfoam footbed. The bandage These men's slides give you a barefoot-but-better
adjusts to fit the top of your feet and the EVA feel with an ultra-flexible outsole and a stretchy
outsole provides lightweight comfort. strap. With a cloudfoam footbed for a soft,
Synthetic material mix for interesting looks of cushioned feel.
upper Synthetic material mix for interesting looks of
Adjustable upper upper
n/a Soft CLOUDFOAM footbed for quick dry S77988 deliv.12/16 S77989 deliv.12/16
n/a Soft CLOUDFOAM footbed for quick dry AQ3936 deliv.12/16 AQ3937 deliv.12/16
comfort comfort
Injected EVA outsole for lightweight comfort Rubber outsole for durability and comfort
[S779880K]| [S779891N]| [AQ39366M]| [AQ39377P]|

adissage 2.0 logo adissage 2.0 stripes


size 5-18 29,95 size 5-18 29,95
S78504 core black/matte silver/core black S78505 core black/ftwr white/core black
SYNTHETICS SYNTHETICS
The next generation of adissage technology The next generation of adissage technology
designed to soothe and relax tired muscles. designed to soothe and relax tired muscles.
Massage nubs ergonomically placed on the Massage nubs ergonomically placed on the
footbed give an unmatched experience in these footbed give an unmatched experience in these
men's slides. Featuring a performance logo men's slides. Featuring a 3-Stripes bandage
bandage. upper.
Adjustable upper Non-absorbent quick-dry bandage
Quick drying bandage lining Adjustable upper
Injected EVA outsole for lightweight comfort S78504 deliv.12/16
Ergonomic placement of stimulating nubs for S78505 deliv.12/16
Ergonomic placement of stimulating nubs for the unmatched adissage 2.0 experience
the unmatched adissage 2.0 experience Injected EVA outsole for lightweight comfort
[S78504J/]| [S78505K&]|

adissage 2.0 stripes


size 5-18 29,95
BB4571 core black/core red s17/granite
SYNTHETICS
The next generation of adissage technology
designed to soothe and relax tired muscles.
Massage nubs ergonomically placed on the
footbed give an unmatched experience in these
men's slides. With a 3-Stripes bandage upper and
graphic footbed.
Non-absorbent quick-dry bandage
Adjustable upper
Ergonomic placement of stimulating nubs for BB4571 deliv.12/16
the unmatched adissage 2.0 experience
Injected EVA outsole for lightweight comfort
[BB4571Q#]|

17Q1_FTW_EUR-CHF_104_153.indd 104 08.06.2016 11:37:59


Men - Pool 105

SLIDES
voolossage
size 5-13 29,95
AQ2650 core black/ftwr white/core black
AQ2651 collegiate navy/ftwr white/collegiate
navy
BA8864 trace green s17/linen green s17/trace
green s17
SYNTHETICS
After playing hard, relax and recuperate in these
men's massage slides. With a one-piece stretch
upper for a snug, comfortable fit, a massaging
nub footbed and shower-proof EVA design.
Synthetic material mix for interesting looks of
AQ2650 deliv.12/16 AQ2651 deliv.12/16 BA8864 deliv.12/16
upper
TPR footbed with ever popular massage nubs
Injected EVA outsole for lightweight comfort
[AQ2650=V]| [AQ2651$Y]| [BA886400]|

kyaso ADJ
kyaso size 5-13 27,95
size 5-13 24,95
AQ5600 core black/ftwr white/core black
S78121 core black/matte silver/core black
AQ5601 shock blue s16/collegiate navy/
S78122 eqt blue s16/ftwr white/eqt blue s16 collegiate navy
SYNTHETICS SYNTHETICS
Hit the locker room in these men's shower slides. Hit the locker room in these men's shower slides.
They feature a contoured footbed with cutouts for They feature a contoured footbed with cutouts for
fast drainage and a flexible outsole so you can fast drainage and a flexible outsole so you can
rinse off without worries. They're finished with an rinse off without worries. Finished with embossed
adidas sports performance logo. 3-Stripes.
Molded EVA sole & upper unit for lightweight Molded EVA sole & upper unit for lightweight
comfort. comfort.
S78121 deliv.12/16 S78122 deliv.12/16
Synthetic Lining AQ5600 deliv.12/16 AQ5601 deliv.12/16
Adjustable upper
Engineered holes for maximum airflow and Engineered holes for maximum airflow and
water drainage water drainage
[S781218G]| [S781229J]| [AQ5600/X]| [AQ5601+-]|

caverock CF
size 5-13 29,95
S31679 core black/ftwr white/core black
SYNTHETICS
Lightweight and flexible, these men's thong voloomix GR
sandals have a classic design that's comfortable size 5-18 24,95
and versatile. They feature a performance logo on
the outer strap and a debossed triangle design on BA8856 core black/core black/core black
the cloudfoam footbed. SYNTHETICS
Thong construction for comfort and style Let your feet take a breather in these men's swim
S31679 deliv.12/16
Extra soft water-resistant SUPERCLOUD BA8856 deliv.12/16
slides featuring a foam-cushioned synthetic
EVA footbed for comfort. Engineered holes for leather upper in a graphic print. The contoured
maximum airflow and water drainage and textured footbed is easy on tired feet, while
[S31679//]| [BA885601]| the EVA outsole offers lightweight comfort.

17Q1_FTW_EUR-CHF_104_153.indd 105 08.06.2016 11:38:04


106 Men - Pool
SLIDES

Carozoon LG
size 4-13; 35 22,95
BA8779 mystery blue s17/ftwr white/mystery
blue s17
BA8781 trace green s17/ftwr white/trace green
voloomix GR s17
size 5-18 24,95 SYNTHETICS
BA8858 mystery blue s17/ftwr white/collegiate Lightweight and shower-friendly, these men's
navy swim slides are a post-training essential. They
SYNTHETICS have a contoured footbed and a non-absorbent,
Let your feet take a breather in these men's swim quick-drying bandage upper that features the
slides featuring a foam-cushioned synthetic adidas wordmark.
BA8858 deliv.12/16 BA8779 deliv.12/16 BA8781 deliv.12/16
leather upper in a graphic print. The contoured Non-absorbent quick-dry EVA bandage
and textured footbed is easy on tired feet, while Injected EVA outsole for lightweight comfort
the EVA outsole offers lightweight comfort. [BA885827]| [BA87794D]| [BA8781^+]|

FCB slide MUFC slide


size 4-13; 35 22,95 size 4-13; 35 22,95
AQ3793 fcb true red/ftwr white/fcb true red AQ3794 core black/ftwr white/core black
SYNTHETICS SYNTHETICS
After practising on the pitch, unlace your boots After practising on the pitch, unlace your boots
and slip on these men's slides. A signature FC and slip on these men's slides. A signature
Bayern design celebrates Die Roten with an all- Manchester United design celebrates the Red
red look and a Bayern crest on the upper. Devils with a Manchester crest on the upper.
Synthetic material mix for interesting looks of AQ3793 deliv.12/16
Synthetic material mix for interesting looks of AQ3794 deliv.12/16
upper upper
Injected EVA outsole for lightweight comfort Injected EVA outsole for lightweight comfort
[AQ37939T]| [AQ3794AW]|

voloomix
RM slide size 5-18 22,95
size 4-13; 35 22,95 AQ5897 core black/silver met./core black
AQ3795 collegiate royal/ftwr white/collegiate AQ5898 tech steel f16/ftwr white/tech steel f16
royal SYNTHETICS
SYNTHETICS Let your feet take a breather in these men's swim
After practising on the pitch, unlace your boots slides featuring a foam-cushioned synthetic
and slip on these men's slides. A signature Real leather upper. The contoured and textured footbed
Madrid design celebrates Los Vikingos with an all- is easy on tired feet, while the EVA outsole offers
blue look and a Madrid crest on the upper. lightweight comfort.
Synthetic material mix for interesting looks of AQ3795 deliv.12/16
Synthetic material mix for interesting looks of AQ5897 deliv.12/16 AQ5898 deliv.12/16
upper upper
Injected EVA outsole for lightweight comfort Injected EVA outsole for lightweight comfort
[AQ3795BZ]| [AQ5897OJ]| [AQ5898PM]|

17Q1_FTW_EUR-CHF_104_153.indd 106 08.06.2016 11:38:11


Men - Pool 107

SLIDES
ACE17 slide X17 slide
size 5-13 22,95 size 5-13 22,95
BB6041 core black/ftwr white/red BA8868 core black/ftwr white/red
SYNTHETICS SYNTHETICS
Designed for post-match comfort, these men's Designed for post-match comfort, these men's
BB6041 deliv.12/16
swim slides are lightweight and shower-friendly. BA8868 deliv.12/16
swim slides are lightweight and shower-friendly.
The easy-to-wear slides have a comfortable The easy-to-wear slides have a comfortable
contoured footbed and feature the Ace logo and contoured footbed and feature the X logo and
[BB6041DC]| graphics on the quick-drying bandage upper. [BA88684C]| graphics on the quick-drying bandage upper.
Unisex - Pool
aqualette CF
size 4-18 24,95
AQ2163 collegiate navy/ftwr white/collegiate
navy
AQ2165 energy blue s17/ftwr white/energy
blue s17
AQ2166 core black/ftwr white/core black
BA7863 trace green s17/ftwr white/trace green
s17
SYNTHETICS
Made for the shower, these swim slides have
a one-piece moulded EVA upper with a soft,
contoured cloudfoam footbed for extra comfort.
The quick-drying slides feature a lightweight
outsole.
AQ2163 deliv.12/16 AQ2165 deliv.12/16 AQ2166 deliv.12/16 BA7863 deliv.12/16
dual injected Dual injected and dual color upper
and sole unit
[AQ2163SA]| [AQ2165UG]| [AQ2166VJ]| [BA7863%Z]|

cloudfoam ultra zen


size 4-18 59,95
AQ5857 ftwr white/core black/scarlet
eezay CF
AQ5859 ftwr white/core black/clear onix
size 5-13 22,95
TEXTILE/SYNTHETICS
This sneaker is all about total recovery and
AQ6117 core black/ftwr white/core black
relaxation. A roomy fit allows your foot to spread RUBBER
and relax, and a soft cloudfoam ultra footbed Light, fast and fun, the Eezay thong sandals are
with massaging nubs gives you an outrageously equally at home on sand, land and around water. A
comfortable feel. classic style made for exceptional comfort, these
Injected EVA outsole for lightweight comfort men's sandals feature a soft cloudfoam footbed
Breathable mesh upper provides ventilation for and a firm outsole.
AQ5857 deliv.12/16 AQ5859 deliv.12/16
a healthy foot climate AQ6117 deliv.12/16
Molded soft EVA thong unit
CLOUDFOAM ultra footbed with soft massage Extra soft SUPERCLOUD EVA footbed for quick
nubs for recovery and comfort dry comfort
[AQ5857G&]| [AQ5859I5]| [AQ6117=X]|

17Q1_FTW_EUR-CHF_104_153.indd 107 08.06.2016 11:38:23


108 Unisex - Pool
SLIDES

Duramo Slide
size 4-18 19,95
BA8787 linen khaki s17/energy s17/trace cargo
s17
BA8788 mystery green s17/core black/linen
green s17
BA8789 mystery red s17/mystery red s17/
mystery red s17
BA8790 tactile orange s17/tactile orange s17/
tactile orange s17
SYNTHETICS
The classic slide, refined. Minimalism and iconic
details come together in this modern shower
slide. With a clean, quick drying one-piece design,
it offers comfort and simplicity.
BA8787 deliv.12/16 BA8788 deliv.12/16 BA8789 deliv.12/16 BA8790 deliv.12/16

Moulded soft EVA sole/upper unit


[BA87874C]| [BA87885F]| [BA87896I]| [BA8790&/]|

Duramo Slide
size 4-18 19,95
G14309 power blue/white/power blue
G15890 core black/white/core black
G15892 dark blue/white/dark blue
SYNTHETICS
The classic slide, refined. Minimalism and iconic
details come together in this modern shower
slide. With a clean, quick drying one-piece design,
it offers comfort and simplicity.
G14309 deliv.12/16 G15890 deliv.12/16 G15892 deliv.12/16
Moulded soft EVA sole/upper unit
Injected EVA outsole for lightweight comfort
[G14309+L]| [G15890M-]| [G15892O%]|
Unisex - Beach

eezay PARLEY
size 5-13 24,95
Duramo Slide
BA8825 non-dyed/lab green f12/chalk white
size 4-18 19,95
TEXTILE
U43664 white/power blue/red s09
Inspired by ocean conservation, these men's
SYNTHETICS thong sandals are designed with Parley yarn
The classic slide, refined. Minimalism and iconic made from recycled ocean waste. The beach-
details come together in these modern shower ready sandals feature an environmentally friendly
slides. With a clean, quick drying one-piece recycled EVA midsole and outsole and a classic
design, they offer comfort and simplicity. thong construction.
U43664 deliv.12/16 BA8825 deliv.12/16
Moulded soft EVA sole/upper unit cork footbed extra soft cork footbed for comfort
Injected EVA outsole for lightweight comfort and style
[U43664BS]| [BA8825/U]|

17Q1_FTW_EUR-CHF_104_153.indd 108 08.06.2016 11:38:37


Unisex - Beach 109

Women - Pool

SLIDES
eezay striped
size 5-13 19,95
adilette CF ultra stripes W
BA8808 core blue s17/mystery blue s17/tactile
size 4-10 29,95
green s17
BA8809 trace cargo s17/core blue s17/tactile S80420 core black/ftwr white/core black
green s17 TEXTILE/SYNTHETICS
SYNTHETICS Soft and easy to wear, these iconic men's slides
Primed for warm-weather fun in a classic have a cloudfoam ultra footbed that's incredibly
design, these beach-ready men's thong sandals comfortable. Features a single-strap upper with
are exceptionally comfortable and come with a standout contrast 3-Stripes.
brightly striped footbed. Synthetic material mix for interesting looks of
Textile thong construction for comfort and style upper
BA8808 deliv.02/17 BA8809 deliv.02/17
Soft EVA lining S80420 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new
Die-cut EVA footbed with graphic elements for level of softness with its cushiony footbed
lightweight comfort Injected EVA outsole for lightweight comfort
[BA8808$T]| [BA8809/W]| [S80420-K]|

adilette CF+ mono W


size 4-10 29,95
adilette CF+ salinas W
BB1095 core black/core black/core black
size 4-10 29,95
SYNTHETICS
BB3666 easy coral s17/ftwr white/ftwr white
3-stripes branded EVA upper for a fresh and
clean look SYNTHETICS
BB1095 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new BB3666 deliv.01/17
Injected EVA outsole for lightweight comfort
level of softness with its cushiony footbed Synthetic material mix for comfortable clog
Injected EVA outsole for lightweight comfort upper
[BB109574]| [BB3666S5]|

adilette CF+ armad W


size 4-10 29,95
BB3732 core black/tech rust met.s17/ftwr white
SYNTHETICS
These ahh-inspiring women's slides have a
colourful bandage with a gradient look upper.
adilette CF+ salinas W A cloudfoam ultra footbed gives them a plush,
size 4-10 29,95 supremely comfortable feel.
Synthetic-textile material mix for interesting
BB3667 maroon/ftwr white/ftwr white
looks of upper
SYNTHETICS n/a CLOUDFOAM ultra provides a whole new
BB3667 deliv.01/17 BB3732 deliv.12/16
Injected EVA outsole for lightweight comfort level of softness with its cushiony footbed
n/a Synthetic material mix for clog upper Injected EVA outsole for lightweight comfort
[BB3667T8]| [BB3732LW]|

17Q1_FTW_EUR-CHF_104_153.indd 109 08.06.2016 11:38:51


110 Women - Pool
SLIDES

voloossage W
size 4-10 29,95
adilette CF+ mono W AQ2652 core black/ftwr white/core black
size 4-10 29,95
SYNTHETICS
BB4541 scarlet/scarlet/scarlet Relax and recuperate in these soothing post-
BB4542 collegiate royal/collegiate royal/ game massage slides. The voolossage slide has
collegiate royal a comfort-focused design with a one-piece upper,
SYNTHETICS massaging nub footbed and shower-proof EVA
3-stripes branded EVA upper for a fresh and design.
clean look Synthetic material mix for interesting looks of
n/a CLOUDFOAM ultra provides a whole new BB4541 deliv.12/16 BB4542 deliv.12/16
upper AQ2652 deliv.12/16
level of softness with its cushiony footbed TPR footbed with ever popular massage nubs
Injected EVA outsole for lightweight comfort Injected EVA outsole for lightweight comfort
[BB4541KT]| [BB4542LW]| [AQ2652/.]|

adissage 2.0 stripes W


size 4-10 29,95 adipure CF W
size 4-10 29,95
S78515 core black/silver met./shock pink s16
SYNTHETICS
BB4558 core black/ftwr white/core black
The next generation of adissage technology
BB4559 haze coral s17/tech rust met.s17/
designed to soothe and relax tired muscles. linen s17
Massage nubs ergonomically placed on the SYNTHETICS
footbed give an unmatched experience in these These women's slides give you a barefoot-but-
women's slides. Featuring a 3-Stripes bandage better feel with an ultra-flexible outsole and a
upper. stretchy strap. With a cloudfoam footbed for a
Non-absorbent quick-dry EVA bandage soft, cushioned feel.
Adjustable upper Non-absorbent quick-dry EVA bandage
EVA footbed with ever popular massage nubs S78515 deliv.12/16
n/a Soft CLOUDFOAM footbed for quick dry BB4558 deliv.12/16 BB4559 deliv.12/16
Ergonomic placement of stimulating nubs for comfort
the unmatched adissage 2.0 experience Injected EVA outsole for lightweight comfort
[S78515M4]| [BB4558T8]| [BB4559UB]|

cloudfoam ultra Y W
size 4-10 27,95
B25342 core black/mid grey s14/silver met.
BA8827 easy coral s17/maroon/haze coral s17
SYNTHETICS
This thong has a feminine feel with delicate straps
on the upper. The super-flexible outsole is topped
with a layered SUPERCLOUD PLUS footbed for
incredibly soft cushioning that feels great on your
feet.
Thong construction for comfort and style
n/a CLOUDFOAM ultra provides a whole new B25342 deliv.12/16 BA8827 deliv.12/16
level of softness with its cushiony footbed
Injected EVA outsole for lightweight comfort
[B25342LM]| [BA8827%-]|

17Q1_FTW_EUR-CHF_104_153.indd 110 08.06.2016 11:39:11


Women - Pool 111

SLIDES
aqualette W
size 4-10 22,95
BA7866 tactile green s17/tactile green s17/
tactile green s17
BA7867 core pink s17/haze coral s17/core
pink s17
BA8762 core black/ftwr white/core black
SYNTHETICS
Made for the shower, these women's swim slides
feature a one-piece moulded EVA upper with a
contoured footbed for comfort. 3-Stripes on the
upper and a lightweight outsole complete the
BA7866 deliv.12/16 BA7867 deliv.12/16 BA8762 deliv.12/16
minimalist design.
Moulded soft EVA sole/upper unit
[BA7866^#]| [BA7867&0]| [BA8762%Y]|

eezay CF W
size 4-10 22,95
BA8794 haze coral s17/vapour grey f16/haze carodas W
coral s17 size 4-10 19,95
SYNTHETICS
AQ2149 core black/white/core black
Light, fast and fun, the Eezay is equally at home
on sand, land and around water. A classic sandal SYNTHETICS
made for exceptional comfort, these women's A locker room style that's basic, but never boring.
thong sandals feature a soft cloudfoam footbed These women's Carodas take a sleek shower slide
and a firm outsole. and add in a debossed footbed and bold adidas
Molded soft EVA thong unit branding across the upper.
BA8794 deliv.12/16 AQ2149 deliv.12/16
n/a Soft CLOUDFOAM footbed for quick dry Non-absorbent quick-dry EVA bandage
comfort Injected EVA outsole for lightweight comfort
[BA879438]| [AQ2149UI]|

eezay PARLEY W
size 4-10 24,95
BA8824 non-dyed/lab green f12/chalk white
TEXTILE
Inspired by ocean conservation, these women's
thong sandals are designed with Parley yarn
made from recycled ocean waste. The beach- adilette CF+ campus W
ready sandals feature an environmentally friendly size 4-10 29,95
recycled EVA midsole and outsole and a classic
thong construction. BB4517 trace grey s17/easy coral s17/ftwr
Thong construction for comfort and style white
Textile upper SYNTHETICS
cork footbed extra soft cork footbed for comfort EVA upper for a clean and fresh look
BA8824 deliv.12/16
and style BB4517 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new
Die-cut sole unit with textured outsole made level of softness with its cushiony footbed
from recycled EVA Injected EVA outsole for lightweight comfort
[BA8824$R]| [BB4517KW]|

17Q1_FTW_EUR-CHF_104_153.indd 111 08.06.2016 11:39:32


112 Women - Pool
SLIDES

adilette CF+ armad W


size 4-10 29,95 adilette CF+ fade W
S75824 maroon/ice purple f16/collegiate navy size 4-10 29,95
SYNTHETICS S82061 utility ivy f16/linen green s17/easy
These ahh-inspiring women's slides have a green s17
colourful bandage with a gradient look upper. S82063 easy coral s17/haze coral s17/easy
A cloudfoam ultra footbed gives them a plush, mint s17
supremely comfortable feel. SYNTHETICS
Synthetic-textile material mix for interesting 3-stripes branded EVA upper for a fresh and
looks of upper clean look
n/a CLOUDFOAM ultra provides a whole new S75824 deliv.12/16
n/a CLOUDFOAM ultra provides a whole new S82061 deliv.01/17 S82063 deliv.01/17
level of softness with its cushiony footbed level of softness with its cushiony footbed
Injected EVA outsole for lightweight comfort Injected EVA outsole for lightweight comfort
[S75824K0]| [S82061+X]| [S82063/-]|
Women - Beach

eezay ice cream W


size 4-10 19,95
BA8806 easy green s17/tech rust met.s17/
ftwr white
BA8807 easy yellow s17/vapour grey f16/ftwr
white
eezay dots W SYNTHETICS
size 4-10 19,95 Light, fast and fun, these women's thong sandals
are equally at home on sand, land and around
B23738 ftwr white/core black/core black water. With a sleek design, thin straps and a
SYNTHETICS graphic footbed for a fun look.
Thong construction for comfort and style B23738 deliv.02/17
Thong construction for comfort and style BA8806 deliv.03/17 BA8807 deliv.03/17
Soft EVA lining Soft EVA lining
Die-cut EVA sole unit with textured outsole Die-cut EVA sole unit with textured outsole
[B23738T^]| [BA8806.N]| [BA8807=Q]|

eezay glitter W
size 4-10 19,95 eezay dots W
BB1132 haze coral s17/silver met./ice purple size 4-10 19,95
f16 BY2452 ftwr white/haze coral s17/ice purple
SYNTHETICS f16
Summery and festive, these women's thong SYNTHETICS
sandals are made for the beach. They have a Light, fast and fun, the eezay is equally at home
classic thong construction with a glitter upper on sand and in water. Raised dots on the footbed
that sparkles in the sun. An EVA midsole offers adds a stylish look and a slight massaging texture.
lightweight cushioning. Thong construction for comfort and style
BB1132 deliv.02/17 BY2452 deliv.02/17
Thong construction for comfort and style Soft EVA lining
Die-cut EVA outsole for lightweight comfort Die-cut EVA sole unit with textured outsole
[BB1132%J]| [BY2452XU]|

17Q1_FTW_EUR-CHF_104_153.indd 112 08.06.2016 11:40:01


Women - Beach 113

SLIDES
eezay striped W
size 4-10 19,95
S80425 trace grey s17/haze coral s17/easy
coral s17
SYNTHETICS
Primed for warm-weather fun in a classic design,
these women's thong sandals are exceptionally
comfortable. They come with slim straps on the
upper and bold colour-contrast stripes on the
footbed.
S80425 deliv.02/17
Thong construction for comfort and style
Die-cut EVA outsole for lightweight comfort
[S80425+Z]|

17Q1_FTW_EUR-CHF_104_153.indd 113 08.06.2016 11:40:12


114 TRAINING

TRAINING FTW SS17


TRAINING

SEGMENTATION

MEN WOMEN
CRAZY POWER TR CRAZYTRAIN BOUNCE
DRIVEN

DRIVEN
BRAND

BRAND
CRAZY TRAIN BOUNCE ADIPURE
ZG BOUNCE GYMBREAKER BOUNCE
CRAZY TRAIN CF SECOND SKIN
CLOUDFOAM: DURAMO TRAINER, CRAZYTRAIN CF
COMMERCIAL

COMMERCIAL
GYM WARRIOR, ESSENTIAL STAR, ATHLETICS BOUNCE
GALAXY TRAINER COOL CLIMA BOUNCE
CLOUDFOAM: ESSENTIAL FUN,
ARIANNA, NIYA
CRAZY POWER TR

ATHLETICS BOUNCE

DRIVEN
BRAND
COOL CLIMA BOUNCE

COMMERCIAL
DRIVEN PUREBOOST X TR
BRAND
COMMERCIAL

17Q1_FTW_EUR-CHF_104_153.indd 114 08.06.2016 11:40:12


TRAINING
Men - Power 115

Men - Power

TRAINING
CrazyPower TR M
size 6-12.5; 13.5; 14.5 129,95
BA8929 core black/ftwr white/energy s17
BA8930 mystery blue s17/mystery blue s17/
blue
BA8931 core black/core black/dgh solid grey
BA8932 ftwr white/ftwr white/core black
TEXTILE/SYNTHETICS
Vary your tempo as you gain strength in these
men's training shoes. Built with a mixed-material
BA8929 deliv.01/17 BA8930 deliv.01/17 BA8931 deliv.01/17 BA8932 deliv.01/17
upper, they feature a supportive heel and a
protective RPU cage. These stable shoes include
a wide forefoot and an outsole designed for extra
[BA892902]| [BA8930/R]| [BA8931+U]| [BA8932%X]| traction.

CrazyTrain Bounce M
size 6-12.5; 13.5; 14.5 89,95
BA9004 utility ivy f16/core black/trace green
s17
TEXTILE/SYNTHETICS
Power through your speed drills in these training
BA9004 deliv.12/16
shoes for men. Built with BOUNCE energised
cushioning, they include a mixed-material upper
and forefoot inserts that add stability for multi-
[BA9004FH]| directional work.

CrazyTrain Bounce M
size 6-12.5; 13.5; 14.5 89,95
BY2871 core black/core black/solar gold
BY2872 scarlet/scarlet/collegiate burgundy
BY2871 BY2872 BY2873
deliv.12/16 deliv.12/16 deliv.12/16
BY2873 utility black f16/core black/collegiate
royal
[BY28711I]| [BY28722L]| [BY28733O]| SYNTHETICS/TEXTILE

17Q1_FTW_EUR-CHF_104_153.indd 115 08.06.2016 11:40:34


116 Men - Power
TRAINING

CrazyTrain Bounce TRF M


size 6-12.5; 13.5; 14.5 89,95
BA8128 vista grey s15/vista grey s15/solar gold
BA9801 core black/core black/utility ivy f16
TEXTILE/SYNTHETICS
Built with a textile upper, these men's training
shoes feature climachill ventilation and BA8128 deliv.12/16 BA9801 deliv.12/16
BOUNCE energised cushioning. The turf-
traction outsole includes a mudguard designed for
taking your workout to the trail. [BA8128M.]| [BA9801-H]|
Men - Mobility

ZG Bounce M
size 6-12.5; 13.5; 14.5 89,95
BA8141 utility grey f16/core black/scarlet
BA8142 trace green s17/utility ivy f16/ftwr
white
BA8938 core black/ftwr white/utility black f16
BA8939 core black/core black/ftwr white
BA8940 mystery blue s17/night navy/blue
TEXTILE/SYNTHETICS
Build strength and speed in comfort with these
training shoes for men. Designed with BOUNCE BA8141 deliv.01/17 BA8142 deliv.01/17 BA8938 deliv.01/17 BA8939 deliv.01/17 BA8940 deliv.01/17
energised cushioning, these shoes include a
seamless mesh upper for lightweight stability and
support. [BA8141JQ]| [BA8142KT]| [BA893814]| [BA893927]| [BA8940%W]|
Men - Multi Sport

Duramo 8 Trainer M
size 6-12.5; 13.5; 14.5 69,95
BB1745 core black/core black/ftwr white
BB1746 core black/ftwr white/scarlet
BB1748 collegiate navy/ftwr white/blue
BB1750 ftwr white/trace grey s17/core black
SYNTHETICS/TEXTILE
Quicken your feet in these training shoes for men.
Built with a durable textile upper, they feature BB1745 deliv.12/16 BB1746 deliv.12/16 BB1748 deliv.12/16 BB1750 deliv.12/16
the stable lateral support of a TPU cage. The
cloudfoam midsole provides cushioning while you
work on balance and strength. [BB1745IS]| [BB1746JV]| [BB1748L.]| [BB1750FI]|

17Q1_FTW_EUR-CHF_104_153.indd 116 08.06.2016 11:41:00


Men - Multi Sport 117

TRAINING
Gym Warrior 2 M
size 6-12.5; 13.5; 14.5 64,95
BA8959 ftwr white/core black/gum 3
BA8960 scarlet/scarlet/core black
BA8961 trace green s17/utility ivy f16/core
black
BA8962 collegiate royal/utility black f16/ftwr
white
TEXTILE/SYNTHETICS
Push yourself harder with every rep. These
training shoes for men include mesh quarter
BA8959 deliv.12/16 BA8960 deliv.12/16 BA8961 deliv.12/16 BA8962 deliv.12/16
panels and a durable RPU forefoot. Designed
with a supportive textile upper, they feature a
cloudfoam midsole for cushioning as you build
[BA89596H]| [BA8960&%]| [BA89610^]| [BA896211]| strength.

CrazyTrain CF M
size 6-12.5; 13.5; 14.5 59,95
BA8996 ftwr white/core black/trace grey s17
BA8997 utility blue f16/core black/mystery
blue s17
SYNTHETICS/TEXTILE
CrazyTrain CF M
Work on quickness and agility in these men's size 6-12.5; 13.5; 14.5 59,95
BA8996 BA8997 training shoes. Built with a textile upper, they BY2876
deliv.12/16 deliv.12/16
feature forefoot inserts for extra stability. The
deliv.12/16
BY2876 mystery blue s17/ftwr white/collegiate
cloudfoam midsole offers extra cushioning as you navy
[BA8996BS]| [BA8997CV]| increase power and speed. [BY28766X]| SYNTHETICS

CrazyTrain CF M
size 6-12.5; 13.5; 14.5 59,95
BY2877 core black/ftwr white/scarlet
BY2877 BY2878
deliv.12/16 deliv.12/16
BY2878 trace grey s17/core black/collegiate
royal
[BY28777-]| [BY28788$]| TEXTILE/SYNTHETICS

17Q1_FTW_EUR-CHF_104_153.indd 117 08.06.2016 11:41:25


118 Men - Multi Sport
TRAINING

Essential Star 3 M
size 6-12.5; 13.5; 14.5 54,95
BA8944 core black/energy s17/utility black f16
BA8945 utility ivy f16/sesame/trace green s17
BA8946 blue/silver met./mystery blue s17
BA8947 core black/silver met./utility black f16
TEXTILE/SYNTHETICS
Move past your plateau in these men's training
shoes. Built with a breathable multi-layer mesh BA8944 deliv.12/16 BA8945 deliv.12/16 BA8946 deliv.12/16 BA8947 deliv.12/16
upper, these shoes feature a stable forefoot
structure and include a cloudfoam midsole for
extra cushioning as you build strength. [BA8944&#]| [BA894500]| [BA894613]| [BA894726]|

Essential Star 3 M
size 6-13 54,95
BA8949 core black/utility black f16/ftwr white
BA8950 core black/utility black f16/ftwr white
BA8951 core black/silver met./collegiate royal
BA8952 dgh solid grey/ftwr white/solar gold
SYNTHETICS
Move past your plateau in these men's training
shoes. Built with a lightweight synthetic upper, BA8949 deliv.12/16 BA8950 deliv.12/16 BA8951 deliv.12/16 BA8952 deliv.12/16
these shoes feature a stable forefoot structure
and include a cloudfoam midsole for extra
cushioning as you build strength. [BA89494C]| [BA8950#.]| [BA8951^/]| [BA8952&/]|
Women - StellaSport

Aleki X
size 3.5-9 109,95
Midcut BB4765 radiant gold f10/medium grey heather/
size 3.5-9 109,95 BB0771 deliv.12/16 dawn blue BB4765 deliv.12/16 BB4763 deliv.12/16

BB0771 core black/radiant aqua f10/ftwr white BB4763 pop/midnight grey f15/radiant gold f10
TEXTILE/SYNTHETICS [BB0771GM]| TEXTILE/SYNTHETICS [BB4765YI]| [BB4763WC]|

17Q1_FTW_EUR-CHF_104_153.indd 118 08.06.2016 11:41:55


Women - StellaSport 119

TRAINING
Yvori Runner
size 3.5-9 99,95
Aleki X BB4961 urban sky f12/core black/blush yellow
size 3.5-9 109,95 s15-st
BB4766 BB4961 BB4962
deliv.12/16
BB4766 core black/bliss coral s13/intense deliv.12/16 deliv.12/16
BB4962 ftwr white/radiant aqua f10/dust purple
blue f11 s15-st
[BB4766ZL]| TEXTILE/SYNTHETICS [BB4961-K]| [BB4962.N]| TEXTILE/RUBBER

Yvori Runner
size 3.5-9 99,95
BB4959 deliv.12/16
BB4959 core black/core black/dust purple
s15-st
[BB4959%$]| TEXTILE/SYNTHETICS
Women - High Intensity

Pure Boost X TR 2
size 3.5-9 129,95
BA7956 collegiate navy/core black/easy green
s17
BA7957 trace green s17/core black/ftwr white
BA7958 lgh solid grey/core black/easy orange
s17
BB0699 core black/silver met./ftwr white
TEXTILE/SYNTHETICS
BA7956 deliv.12/16 BA7957 deliv.12/16 BA7958 deliv.12/16 BB0699 deliv.12/16
These women's training shoes feature an energy-
returning boost midsole and an arch designed
for women. They deliver a light, flexible feel that
[BA7956&&]| [BA795702]| [BA795815]| [BB0699P2]| supports the natural movement of your foot.

17Q1_FTW_EUR-CHF_104_153.indd 119 08.06.2016 11:42:24


120 Women - High Intensity
TRAINING

Pure Boost X TR Zip


size 3.5-9 129,95
BA8038 collegiate navy/core black/blue
BB1578 ftwr white/core black/dgh solid grey
BB1579 core black/ftwr white/core black
TEXTILE/SYNTHETICS
These women's training shoes feature an energy-
returning boost midsole and an arch designed BA8038 deliv.12/16 BB1578 deliv.12/16 BB1579 deliv.12/16
for a women's-specific frame. They deliver a light,
flexible feel that supports the natural movement
of your foot. [BA8038LZ]| [BB1578L=]| [BB1579M+]|

CrazyPower TR W
size 3.5-9.5 119,95
BA9870 utility black f16/vapour grey met.f16/
core black
BA9871 core black/vapour grey met.f16/ftwr
white
BB1556 onix/vapour grey met.f16/core pink s17
TEXTILE/SYNTHETICS
Designed to give you maximum support and
stability for high-intensity training, these women's
shoes are built with low-profile cushioning and a BA9870 deliv.12/16 BA9871 deliv.12/16 BB1556 deliv.12/16
slightly wider forefoot to allow your foot to expand
more naturally. A high-traction rubber outsole and
rubber cage provide support and durability. [BA987022]| [BA987135]| [BB1556FM]|

CrazyPower TR W
size 3.5-9.5 119,95
BB1557 ftwr white/vapour grey met.f16/clear
grey s12
TEXTILE/SYNTHETICS
Designed to give you maximum support and
stability for high-intensity training, these women's
shoes are built with low-profile cushioning and a BB1557 deliv.12/16
slightly wider forefoot to allow your foot to expand
more naturally. A high-traction rubber outsole and
rubber cage provide support and durability. [BB1557GP]|

17Q1_FTW_EUR-CHF_104_153.indd 120 08.06.2016 11:42:41


Women - High Intensity 121

TRAINING
ATHLETICS Bounce W
size 3.5-9 99,95
BA7952 utility black f16/vapour grey met.f16/
core black
BA7953 trace green s17/vapour grey met.f16/
utility ivy f16
BB1544 light grey heather/vapour grey met.f16/
ftwr white
BB1545 collegiate navy/vapour grey met.f16/
night navy
TEXTILE/SYNTHETICS
Designed with a BOUNCE midsole for energised
cushioning, these women's training shoes feature
BA7952 deliv.12/16 BA7953 deliv.12/16 BB1544 deliv.12/16 BB1545 deliv.12/16
a seamless, woven upper and built-in stability.
These trainers offer a comfortable, lightweight
feel that supports the natural movement of your
[BA7952%Y]| [BA7953/Y]| [BB1544BB]| [BB1545CE]| foot.

Gymbreaker bounce B
size 3.5-10.5 79,95
BB0978 haze coral s17/utility ivy f16/haze
coral s17
BB0979 collegiate navy/ftwr white/night navy
TEXTILE/SYNTHETICS
Gym workouts are no match for the Gymbreaker.
BB0978 deliv.12/16 BB0979 deliv.12/16
A BOUNCE midsole gives energised comfort
to these women's training shoes. Made for high-
intensity training with a breathable upper and a
[BB0978TA]| [BB0979UD]| pivot point outsole for easier rotational moves.

Gymbreaker bounce B
size 3.5-10.5 79,95
BB0981 core black/ftwr white/core black
BB0982 core black/energy blue s17/ftwr white
BB0983 ftwr white/easy orange s17/easy
orange s17
TEXTILE/SYNTHETICS
Gym workouts are no match for the Gymbreaker.
BB0981 deliv.12/16 BB0982 deliv.12/16 BB0983 deliv.12/16
A BOUNCE midsole gives energised comfort
to these women's training shoes. Made for high-
intensity training with a snug sock-like fit and a
[BB0981O+]| [BB0982P#]| [BB0983Q0]| pivot point outsole for easier rotational moves.

17Q1_FTW_EUR-CHF_104_153.indd 121 08.06.2016 11:43:04


122 Women - High Intensity
TRAINING

CrazyTrain Bounce W CrazyTrain Bounce W


size 3.5-9 89,95 size 3.5-9 89,95
BA9815 core black/night met. f13/onix BB1506 ftwr white/silver met./clear grey s12
BA9816 core red s17/night met. f13/energy s17 BB1507 core black/silver met./energy blue s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
These women's training shoes are primed for These women's training shoes are primed for
high-intensity training, both indoors and out. high-intensity training, both indoors and out.
A women's-specific design combines with BA9815 deliv.12/16 BA9816 deliv.12/16
A women's-specific design combines with BB1506 deliv.12/16 BB1507 deliv.12/16
BOUNCE energised cushioning to give you an energising BOUNCE midsole to give you
maximum performance for sports and interval maximum performance for sports and interval
training. [BA9815%Y]| [BA9816/Y]| training. [BB15065#]| [BB150760]|
Women - Neutral

CrazyTrain Bounce W
size 3.5-9 89,95
BB1512 easy blue s17/silver met./tech blue
met.s17
TEXTILE/SYNTHETICS
These women's training shoes are primed for
high-intensity training, both indoors and out.
A women's-specific design combines with BB1512 deliv.12/16
an energising BOUNCE midsole to give you
maximum performance for sports and interval
training. [BB15123.]|

Adipure 360.4 W
size 3.5-9 89,95
BA8725 mystery blue s17/core black/mystery
blue s17
BA8726 core pink s17/maroon/collegiate
burgundy
BA8727 haze coral s17/ftwr white/easy coral
s17
BA8728 energy blue s17/clear aqua/silver met.
TEXTILE/SYNTHETICS
"Better than barefoot" is what the adipure 360.4 BA8725 deliv.01/17 BA8726 deliv.01/17 BA8727 deliv.01/17 BA8728 deliv.01/17
is all about. These women's training shoes have a
comfortable feel, with flex grooves in the outsole
for easy, natural motion. [BA8725.N]| [BA8726=Q]| [BA8727$T]| [BA8728/W]|

17Q1_FTW_EUR-CHF_104_153.indd 122 08.06.2016 11:43:25


Women - Neutral 123

TRAINING
Adipure Amikomi
size 3.5-9 69,95
BB5912 haze coral s17/collegiate navy/chalk
white
BB5914 ftwr white/silver met./mgh solid grey
BB5916 core black/ftwr white/core black
TEXTILE
A perfect fit for natural training, these women's
BB5912 deliv.01/17 BB5914 deliv.01/17 BB5916 deliv.01/17
shoes can be worn in and out of the gym. They
combine an adipure outsole with a breathable
mesh upper. X-shaped TPU support bands over
[BB5912V7]| [BB5914XD]| [BB5916ZJ]| the forefoot give extra support.

CrazyTrain CF W
size 3.5-10 69,95
BA9958 collegiate navy/core blue s17/solar
gold
BB1514 dark grey/haze coral s17/energy blue
s17
BB1516 ftwr white/blue/clear aqua
TEXTILE/SYNTHETICS
These women's training shoes were designed with
BA9958 deliv.12/16 BB1514 deliv.12/16 BB1516 deliv.12/16
the female athlete in mind. A supportive mesh
upper combines with cloudfoam cushioning on
top of a grippy outsole that gives you plenty of
[BA99589N]| [BB15145/]| [BB151672]| traction.
Women - Multi Sport

Arianna Cloudfoam
size 3.5-9 64,95
AQ6390 ftwr white/silver met./dgh solid grey
TEXTILE/SYNTHETICS
A modern trainer that can do it all, these women's
CrazyTrain CF W training shoes cushion your workout with the
size 3.5-10 69,95 comfort of cloudfoam. A high-traction outsole
connects you firmly to the ground.
BB1518 core black/ftwr white/core black High Traction Outsole High Traction Outsole for
TEXTILE/SYNTHETICS optimal grip
These women's training shoes were designed with Additional Forefoot Support Medial & lateral
BB1518 deliv.12/16
the female athlete in mind. A supportive mesh AQ6390 deliv.12/16
forefoot support for safe sidewards movement
upper combines with cloudfoam cushioning on Cloudfoam Cloudfoam Midsole Technology for
top of a grippy outsole that gives you plenty of additional cushioning
[BB151898]| traction. [AQ63906J]|

17Q1_FTW_EUR-CHF_104_153.indd 123 08.06.2016 11:43:50


124 Women - Multi Sport
TRAINING

Arianna Cloudfoam
size 3.5-9 64,95
BA8741 collegiate navy/silver met./core pink
s17
BA8743 core black/night met. f13/haze coral
s17
BA8744 ftwr white/easy yellow s17/easy orange
s17
TEXTILE/SYNTHETICS
Modern trainers that can do it all, these women's BA8741 deliv.12/16 BA8743 deliv.12/16 BA8744 deliv.12/16
shoes cushion your workout with the comfort of
cloudfoam. A high-traction outsole connects you
firmly to the ground. [BA8741.L]| [BA8743$R]| [BA8744/U]|

CrazyMove Studio
Arianna Cloudfoam size 3.5-9 59,95
size 3.5-9 64,95 BB1589 utility blue f16/core black/ftwr white
BA8745 blue/tech blue met.s17/easy blue s17 BB1591 utility ivy f16/trace green s17/easy
BA8746 utility ivy f16/easy green s17/trace coral s17
green s17 TEXTILE
TEXTILE/SYNTHETICS These sleek, slip-on women's training shoes are
Modern trainers that can do it all, these women's BA8745 deliv.12/16 BA8746 deliv.12/16
designed for the studio. The stretch mesh upper BB1589 deliv.01/17 BB1591 deliv.01/17
shoes cushion your workout with the comfort of hugs your foot for a ventilated, second-skin feel
cloudfoam. A high-traction outsole connects you and the rubberised print on the outsole gives you
firmly to the ground. [BA8745+X]| [BA8746%-]| secure footing. [BB1589O&]| [BB1591IR]|

essential fun 2
size 3.5-9 49,95
AF5873 core black/ftwr white/shock pink s16
BB4023 ftwr white/silver met./mgh solid grey
TEXTILE/SYNTHETICS
Fresh 3-Stripes style for everyday activity. The
Essential Fun shows off bright colourblocking on
a breathable mesh upper, with cage lacing for
added midfoot support.
Fresh & Young Design New colorblocking with
various coloring options; design fits for multiple
occasions in life
Multipurpose Versatile allrounder for every day;
lightweight cushioned construction for all day
workouts AF5873 deliv.12/16 BB4023 deliv.12/16
Midfoot Support Strong midoot support for
movement in different directions
[AF58738H]| [BB40233.]|

17Q1_FTW_EUR-CHF_104_153.indd 124 08.06.2016 11:44:13


Women - Multi Sport 125

TRAINING
Essential Fun II W
size 3.5-9 49,95
BB1523 easy blue s17/ftwr white/core blue s17
BB1524 core black/core black/silver met.
BB1525 collegiate burgundy/core pink s17/haze
coral s17
BB1527 easy yellow s17/ftwr white/easy orange
s17
TEXTILE/SYNTHETICS
BB1523 deliv.12/16 BB1524 deliv.12/16 BB1525 deliv.12/16 BB1527 deliv.12/16
Fresh 3-Stripes style for everyday training.
These women's training shoes show off bright
colourblocking on a breathable mesh upper, with
[BB15236^]| [BB152471]| [BB152584]| [BB1527AA]| cage lacing for added midfoot support.

17Q1_FTW_EUR-CHF_104_153.indd 125 08.06.2016 11:44:23


126 KIDS
*Artikel haben eine genderte Segmentierung und deshalb im Anhang des Katalogs zu finden (Stand zur Druckfreigabe Mitte Mai 2016)

KIDS FTW SS17


KIDS

SEGMENTATION

RUNNING RUNNING RUNNING

DRIVEN
DRIVEN

BRAND
DRIVEN

BRAND
COMMERCIAL BRAND

ULTRABOOST ALPHABOUNCE MANABOUNCE


CLOUDFOAM

COMMERCIAL
COMMERCIAL
RUNNING RUNNING RUNNING

DRIVEN
BRAND
DRIVEN

DRIVEN
BRAND

BRAND
ATHLETICS ALLROUNDSTAR RAPIDARUN -
SWIM UNCAGED
SEASONAL FORTARUN BETTER

COMMERCIAL
COMMERCIAL
GRAPHICS
COMMERCIAL

DISNEY
FOOTBALL

RUNNING TENNIS OUTDOOR

DRIVEN
BRAND
DRIVEN

DRIVEN
BRAND

COMMERCIAL BRAND

RAPIDARUN BARRICADE 2016 TERREX


BARRICADE CLUB AX2
ATHLETICS
BOAT

COMMERCIAL
SONIC ATTACK
COMMERCIAL

RAPIDAFLEX
DAROGA

FOOTBALL
DRIVEN
COMMERCIAL BRAND

X/ACE-RAPIDATURF

17Q1_FTW_EUR-CHF_104_153.indd 126 08.06.2016 11:44:24


KIDS
Running - Take Down 127

Running - Take Down


* *

KIDS
UltraBOOST j
size 3.5-6.5 149,95 UltraBOOST Uncaged j
BB3045 core blue s17/mystery blue s17/core size 3.5-6.5 149,95
black BB3050 dgh solid grey/core black/utility black
TEXTILE/SYNTHETICS f16
These juniors' running shoes are designed to help TEXTILE/SYNTHETICS
you put more kilometres in your run. They feature High performance and high style combine in these
BB3045 deliv.12/16
a plush boost midsole that returns energy to BB3050 deliv.02/17
minimal yet supportive juniors' running shoes.
every step, combined with a sock-like adidas With a sock-like fit, full-length boost midsole
Primeknit upper that hugs your foot and provides and an adidas Primeknit upper, your feet are
[BB30455#]| an adaptive fit. [BB30502Y]| comfortable and ready for the run ahead.

* *

alphabounce j alphabounce j
size 3-6.5 79,95 size 3-6.5 79,95

BB7096 bold pink/easy pink s17/energy blue BB7092 scarlet/blue/core black


s17 BB7093 grey/clear onix/blue
TEXTILE TEXTILE
From the breathable mesh upper to the From their breathable mesh upper to their
BB7096 deliv.12/16
comfortable outsole, these versatile juniors' BB7092 deliv.12/16 BB7093 deliv.12/16
comfortable outsole, these juniors' running
running shoes are ideal for a variety of sports. The shoes are ideal for a variety of sports. The sleek
sleek and modern style keeps feet energised with and modern style keeps feet energised with a
[BB7096WE]| a BOUNCE midsole. [BB7092S2]| [BB7093T5]| BOUNCE midsole.

* *

alphabounce c alphabounce c
size 28-35 59,95 size 28-35 59,95

BB7091 bold pink/easy pink s17/energy blue BB7089 scarlet/blue/core black


s17 BB7090 grey/clear onix/blue
TEXTILE TEXTILE
From their breathable mesh upper to their From their breathable mesh upper to their
BB7091 deliv.12/16
comfortable outsole, these kids' running shoes go BB7089 deliv.12/16 BB7090 deliv.12/16
comfortable outsole, these kids' running shoes go
from practise to playground with ease. The sleek from practise to playground with ease. The sleek
and modern style keeps feet energised with a and modern style keeps feet energised with a
[BB7091R&]| BOUNCE midsole. [BB7089XI]| [BB7090Q/]| BOUNCE midsole.

17Q1_FTW_EUR-CHF_104_153.indd 127 08.06.2016 11:44:43


128 Running - Take Down

*
falcon elite 5 xj
size 32-35; 3-6.5 59,95
BB3012 easy green s17/shock purple f16/
energy blue s17
KIDS

BB3011
BB3010 collegiate navy/semi solar gold/energy
s17
TEXTILE/SYNTHETICS
Modern 3-Stripes heel branding gives these
juniors' running shoes a trendy look. Built with
cloudfoam cushioning, a breathable mesh upper
and a foot-hugging fit, these shoes deliver
lightweight comfort with high-flying style.
AIR MESH highly-breathable upper for a cooler
run.
FITFRAME supportive cage in the shoe's midfoot
provides midfoot lockdown and optimum BB3012 deliv.12/16 BB3011 deliv.12/16 BB3010 deliv.12/16
transition in all phases of the running gait
CLOUDFOAM super plush feel.
[BB3012/H]| [BB3011%H]| [BB3010+E]|

mana bounce 2 j
size 3-6.5 59,95
BB7104 mgh solid grey/ftwr white/still breeze
f12
BB7106 mystery blue s17/silver met./solar gold
TEXTILE
With a low-to-the-ground, energy-returning
midsole, these junior running shoes keep up with BB7104 deliv.12/16 BB7106 deliv.12/16
any sport. Flexible yet durable, they're designed
with a lightweight motion mesh upper and a
super-soft sockliner for active, all-day comfort. [BB7104FH]| [BB7106HN]|
kanadia 8 k
size 28-35; 3-7 59,95
*
BB3018 energy blue s17/ftwr white/easy pink
s17
BB3017 core blue s17/ftwr white/energy s17
BB3016 core black/blue/trace grey s17
SYNTHETICS/TEXTILE
Made to help them conquer the trails, these kids'
running shoes have a light but durable build and
a breathable mesh upper. The cloudfoam midsole
provides cushioning while a TRAXION outsole
gives them terrific grip in all directions.
ZONED PROTECTION specific to all extreme
models. protective overlays combined with a
durable mesh offers support for off-road runs.
TRAXION grippy lugs that ensure best traction BB3018 deliv.12/16 BB3017 deliv.12/16 BB3016 deliv.12/16
when running on trails or in the mountain
region.
[BB30182=]| [BB30171Z]| [BB30160W]|

17Q1_FTW_EUR-CHF_104_153.indd 128 08.06.2016 11:45:13


Running - Take Down 129

* durama 2 k
size 28-35; 3-6.5 49,95
BA7411 easy mint s17/ultra purple s12/linen

KIDS
green s17
BA7412 core pink s17/collegiate burgundy/still
breeze f12
BA7413 core black/energy blue s17/shock
pink s16
TEXTILE/SYNTHETICS
With relaxed, running-shoe style, these kids'
shoes hug little feet with a sock-like fit and super-
soft liner. Supportive panels on a breathable mesh
upper add to the comfortable feel.
CLOUDFOAM super plush feel.
SOCKFIT integrated tongue for reduced irritation
and increased comfort
BA7411 deliv.12/16 BA7412 deliv.12/16 BA7413 deliv.12/16
ADIWEAR ultimate durability
mesh mesh upper for lightweight and
breathability.
[BA7411IN]| [BA7412JQ]| [BA7413KT]|

*
duramo 8 k
size 28-35; 3-7 49,95
BB3023 grey/energy s17/onix
BB3022 core black/ftwr white/solar yellow
BB3024 core red s17/ftwr white/core black
TEXTILE/SYNTHETICS
Just like the adult version, these kids' running
shoes are made for a neutral stride. Breathable
mesh inside and out and a cloudfoam midsole add
to the comfort, while synthetic overlays deliver the
stability and support a young runner needs.
AIR MESH highly-breathable upper for a cooler
run.
BB3023 deliv.12/16 BB3022 deliv.12/16 BB3024 deliv.12/16
CLOUDFOAM super plush feel.
NON MARKING RUBBER OUTSOLE for durability
and comfort.
[BB3023&S]| [BB3022^P]| [BB30240V]|

*
energy cloud k
size 28-35; 3-6.5 44,95
S76738 easy blue s17/tactile blue s17/bold pink
S76739 onix/ftwr white/bright yellow
S76737 mystery blue s17/energy s17/ftwr white
TEXTILE/SYNTHETICS
Designed for up-and-coming athletes, these
kids' running shoes have a super-breathable
mesh upper and cloudfoam cushioning. With
eye-catching shiny 3-Stripes, the shoes have extra
support at the heel and midfoot.
FITFRAME supportive cage in the shoe's midfoot
provides midfoot lockdown and optimum
transition in all phases of the running gait
Laces
CLOUDFOAM super plush feel.
S76738 deliv.12/16 S76739 deliv.12/16 S76737 deliv.12/16
ADIWEAR ultimate durability
NON MARKING RUBBER OUTSOLE for durability
and comfort.
[S76738RJ]| [S76739SM]| [S76737QG]|

17Q1_FTW_EUR-CHF_104_153.indd 129 08.06.2016 11:45:50


130 Running - Take Down

Running - Standalone
* *
KIDS

mana bounce 2 c RapidaRun Uncaged K


size 28-35 39,95 size 28-35; 3-6.5 59,95
BB7102 mgh solid grey/ftwr white/still breeze BA9438 core black/silver met./easy pink s17
f12 TEXTILE/SYNTHETICS
BB7103 mystery blue s17/silver met./solar gold
Comfort and performance are unleashed in
TEXTILE these stylish kids' running shoes. The colourful
With an energy-returning midsole, these kids' BB7102 deliv.12/16 BB7103 deliv.12/16
printed upper is enhanced with extra support at BA9438 deliv.12/16
running shoes keep up with any sport or activity. the forefoot and heel. Finished with pillow-soft
Light yet durable, they feature a textile upper with cloudfoam cushioning and a running-specific
synthetic overlays for a bit of extra support. [BB7102DB]| [BB7103EE]| outsole. [BA9438.P]|

* *

RapidaRun Uncaged K RapidaRun K


size 28-35; 3-6.5 59,95 size 28-35; 3-6.5 54,95
BA9436 dgh solid grey/solar yellow/core black BA9430 core black/core black/energy s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Comfort and performance are unleashed in These kids' running shoes deliver performance
these stylish kids' running shoes. The colourful and comfort with every stride. A super-breathable
printed upper is enhanced with extra support at BA9436 deliv.12/16
mesh upper is enhanced with extra support at the BA9430 deliv.12/16
the forefoot and heel. Finished with pillow-soft forefoot, midfoot and heel. Finished with pillow-
cloudfoam cushioning and a running-specific soft cloudfoam cushioning and a running-specific
outsole. [BA9436ZJ]| outsole. [BA9430T1]|

* *

RapidaRun K RapidaRun K
size 28-35; 3-6.5 54,95 size 28-35; 3-6.5 54,95
BA9433 core blue s17/collegiate navy/ftwr BA7873 energy blue s17/shock pink s16/easy
white mint s17
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
These kids' running shoes deliver performance These kids' running shoes deliver performance
and comfort with every stride. The knit mesh and comfort with every stride. The colour-
upper is enhanced with extra support at the BA9433 deliv.12/16
changing layered mesh upper is enhanced with BA7873 deliv.12/16
forefoot, midfoot and heel. Finished with pillow- extra support at the forefoot, midfoot and heel.
soft cloudfoam cushioning and a running-specific Finished with pillow-soft cloudfoam cushioning
outsole. [BA9433WA]| and a running-specific outsole. [BA7873#/]|

17Q1_FTW_EUR-CHF_104_153.indd 130 08.06.2016 11:46:08


Running - Standalone 131

* *

KIDS
RapidaRun K
size 28-35; 3-6.5 54,95 FortaRun CF K
BA9435 ftwr white/easy orange s17/linen s17 size 28-35; 3-6.5 44,95
TEXTILE/SYNTHETICS BA7890 collegiate navy/core red s17/ftwr white
These kids' running shoes deliver performance TEXTILE/SYNTHETICS
and comfort with every stride. The knit-look Fast, fun and flexible. These kids' running shoes
BA9435 deliv.12/16
mesh upper is enhanced with extra support at BA7890 deliv.12/16
have a clean, fluid look with a comfortable
the forefoot, midfoot and heel. Finished with a seamless upper and unique 3-Stripes placement.
pillow-soft cloudfoam SURROUND footbed and a cloudfoam cushioning adds a great feel, and strap
[BA9435YG]| running-specific outsole. [BA7890^+]| closures make them easy to get on and off.

FortaRun K
FortaRun K size 28-35; 3-6.5 44,95
size 28-35; 3-6.5 44,95
BA9487 energy blue s17/easy coral s17/ftwr
BA9492 collegiate navy/core red s17/ftwr white white
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Fast, fun and flexible. These kids' running shoes Fast, fun and flexible. These kids' running shoes
BA9492 deliv.12/16
have a clean, fluid look with a comfortable BA9487 deliv.12/16
have a clean, fluid look with a comfortable
seamless upper and unique 3-Stripes placement. seamless upper and unique 3-Stripes placement.
cloudfoam cushioning adds a great feel, and cloudfoam cushioning adds a great feel, and
[BA9492/Y]| traditional laces give them a sporty look. [BA9487&0]| traditional laces give them a sporty look.

* *

FortaRun CF K FortaRun CF K
size 28-35; 3-6.5 39,95 size 28-35; 3-6.5 39,95
BA7889 solar yellow/ftwr white/core black BA7887 dark grey/easy blue s17/shock pink s16
BA9481 grey/ftwr white/dark grey BA9479 shock pink s16/ftwr white/bold pink
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Fast, fun and flexible. These kids' running shoes Fast, fun and flexible. These kids' running shoes
BA7889 deliv.12/16 BA9481 deliv.12/16
have a clean, fluid look with a comfortable BA7887 deliv.12/16 BA9479 deliv.12/16
have a clean, fluid look with a comfortable
seamless upper and unique 3-Stripes placement. seamless upper and unique 3-Stripes placement.
cloudfoam cushioning adds a great feel, and strap cloudfoam cushioning adds a great feel, and strap
[BA78895G]| [BA9481/T]| closures make them easy to get on and off. [BA78873A]| [BA9479&1]| closures make them easy to get on and off.

17Q1_FTW_EUR-CHF_104_153.indd 131 08.06.2016 11:46:23


132 Running - Standalone

* *
KIDS

FortaRun CF K
size 28-35; 3-6.5 39,95
BA7886 scarlet/energy orange s17/ftwr white FortaRun CF K
size 28-35; 3-6.5 39,95
BA7885 collegiate royal/ftwr white/collegiate
navy BA9483 core black/silver met./onix
TEXTILE/SYNTHETICS SYNTHETICS/TEXTILE
Fast, fun and flexible. These kids' running shoes Fast, fun and flexible. These kids' running shoes
have a clean, fluid look with a comfortable BA7886 deliv.12/16 BA7885 deliv.12/16
have a clean, fluid look with a comfortable BA9483 deliv.12/16
seamless upper and unique 3-Stripes placement. seamless upper and unique 3-Stripes placement.
cloudfoam cushioning adds a great feel, and strap cloudfoam cushioning adds a great feel, and strap
closures make them easy to get on and off. [BA788627]| [BA788514]| closures make them easy to get on and off. [BA9483%Z]|

* *

FortaRun EL K
FortaRun EL K size 28-35; 3-6.5 39,95
size 28-35; 3-6.5 39,95
BA7892 collegiate royal/ftwr white/collegiate
BA9496 bold pink/ftwr white/shock pink s16 navy
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Fast, fun and flexible. These kids' running shoes Fast, fun and flexible. These kids' running shoes
have a clean, fluid look with a comfortable BA9496 deliv.12/16
have a clean, fluid look with a comfortable BA7892 deliv.12/16
seamless upper and unique 3-Stripes placement. seamless upper and unique 3-Stripes placement.
cloudfoam cushioning adds a great feel, and cloudfoam cushioning adds a great feel, and
elastic laces with a top strap ensure a snug fit. [BA949602]| elastic laces with a top strap ensure a snug fit. [BA789200]|

* *

FortaRun K
FortaRun K size 28-35; 3-6.5 39,95
size 28-35; 3-6.5 39,95
BA7881 scarlet/energy orange s17/ftwr white
BA7880 bold pink/ftwr white/shock pink s16 BA9489 collegiate royal/ftwr white/collegiate
BA9490 dark grey/easy blue s17/shock pink s16 navy
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Fast, fun and flexible. These kids' running shoes Fast, fun and flexible. These kids' running shoes
have a clean, fluid look with a comfortable BA7880 deliv.12/16 BA9490 deliv.12/16
have a clean, fluid look with a comfortable BA7881 deliv.12/16 BA9489 deliv.12/16
seamless upper and unique 3-Stripes placement. seamless upper and unique 3-Stripes placement.
cloudfoam cushioning adds a great feel, and cloudfoam cushioning adds a great feel, and
traditional laces give them a sporty look. [BA7880/X]| [BA9490+V]| traditional laces give them a sporty look. [BA7881#$]| [BA948916]|

17Q1_FTW_EUR-CHF_104_153.indd 132 08.06.2016 11:46:43


Running - Standalone 133

* *

KIDS
FortaRun K
size 28-35; 3-6.5 39,95 FortaRun K
BA9491 solar yellow/ftwr white/core black size 28-35; 3-6.5 39,95
BA7884 grey/ftwr white/dark grey BA9494 core black/silver met./onix
TEXTILE/SYNTHETICS SYNTHETICS/TEXTILE
Fast, fun and flexible. These kids' running shoes Fast, fun and flexible. These kids' running shoes
BA9491 deliv.12/16 BA7884 deliv.12/16
have a clean, fluid look with a comfortable BA9494 deliv.12/16
have a clean, fluid look with a comfortable
seamless upper and unique 3-Stripes placement. seamless upper and unique 3-Stripes placement.
cloudfoam cushioning adds a great feel, and cloudfoam cushioning adds a great feel, and
[BA9491%Y]| [BA788401]| traditional laces give them a sporty look. [BA9494^/]| traditional laces give them a sporty look.

* *

AltaRun CF K
size 28-35; 3-6.5 34,95
AltaRun CF K
size 28-35; 3-6.5 34,95
BA9416 easy mint s17/easy coral s17/clear
aqua
BA7902 ftwr white/mid grey s14/ftwr white BA7917 mid grey s14/ftwr white/shock pink s16
BA9422 core black/core black/dgh solid grey TEXTILE/SYNTHETICS
SYNTHETICS Setting the pace for comfort, these kids' running
BA7902 deliv.12/16 BA9422 deliv.12/16
Setting the pace for comfort, these kids' running BA9416 deliv.12/16 BA7917 deliv.12/16
shoes are flexible and supportive. Featuring a
shoes are flexible and supportive. Featuring a breathable mesh upper, they're detailed with a
durable synthetic upper and kid-friendly strap sporty two-colour midsole and kid-friendly strap
[BA7902W9]| [BA9422T2]| closures. [BA9416V9]| [BA7917$T]| closures.

AltaRun CF K
size 28-35; 3-6.5 34,95
BA7426 energy s17/ftwr white/silver met.
BA7425 core blue s17/ftwr white/mystery blue
s17
BA7424 core black/silver met./core red s17
TEXTILE/SYNTHETICS
Setting the pace for comfort, these kids' running
BA7426 deliv.12/16 BA7425 deliv.12/16 BA7424 deliv.12/16
shoes are flexible and supportive. Featuring a
breathable mesh upper, they're detailed with a
sporty two-colour midsole and kid-friendly strap
[BA7426P/]| [BA7425O/]| [BA7424N.]| closures.

17Q1_FTW_EUR-CHF_104_153.indd 133 08.06.2016 11:47:15


134 Running - Standalone

* *
KIDS

AltaRun CF K AltaRun CF K
size 28-35; 3-6.5 34,95 size 28-35; 3-6.5 34,95
BA9417 ftwr white/blue/mid grey s14 BA7427 ftwr white/bold pink/mid grey s14
SYNTHETICS SYNTHETICS/TEXTILE
Lightweight and ready to move, these kids' Lightweight and ready to move, these kids'
running shoes are flexible and built to last. BA9417 deliv.12/16
running shoes are flexible and built to last. BA7427 deliv.12/16
Featuring a durable synthetic upper, they're Featuring a durable synthetic upper, they're
detailed with a sporty two-colour midsole and kid- detailed with a sporty two-colour midsole and kid-
friendly strap closures. [BA9417WC]| friendly strap closures. [BA7427Q&]|

* *

AltaRun CF K AltaRun CF K
size 28-35; 3-6.5 34,95 size 28-35; 3-6.5 34,95
BA9419 ftwr white/blue/mid grey s14 BA9420 ftwr white/bold pink/mid grey s14
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Setting the pace for comfort, these kids' running Setting the pace for comfort, these kids' running
shoes are flexible and built to last. Featuring a BA9419 deliv.12/16
shoes are flexible and supportive. Featuring a BA9420 deliv.12/16
breathable mesh upper, they're detailed with a breathable mesh upper, they're detailed with a
sporty two-colour midsole and kid-friendly strap sporty two-colour midsole and kid-friendly strap
closures. [BA9419YI]| closures. [BA9420R/]|

* *

AltaRun K
size 28-35; 3-6.5 34,95
AltaRun K
BA7419 easy mint s17/easy coral s17/clear size 28-35; 3-6.5 34,95
aqua
BA9424 mid grey s14/ftwr white/shock pink s16 BA9428 ftwr white/ftwr white/mid grey s14
TEXTILE/SYNTHETICS BA7897 core black/core black/dgh solid grey
Fresh style meets breathability in these kids' SYNTHETICS
BA7419 deliv.12/16 BA9424 deliv.12/16 BA9428 deliv.12/16 BA7897 deliv.12/16
running shoes. The comfortable mesh upper Lightweight and ready to move, these kids'
helps keeps active feet cooler. They're detailed running shoes are flexible and built to last.
with a sporty two-colour midsole. [BA7419Q0]| [BA9424V8]| Featuring a synthetic upper for durability. [BA9428ZK]| [BA78975F]|

17Q1_FTW_EUR-CHF_104_153.indd 134 08.06.2016 11:47:37


Running - Standalone 135

KIDS
AltaRun K
size 28-35; 3-6.5 34,95
BA7421 energy s17/ftwr white/silver met.
BA9423 core blue s17/ftwr white/mystery blue
s17
BA7422 core black/silver met./core red s17
TEXTILE/SYNTHETICS
BA7421 deliv.12/16 BA9423 deliv.12/16 BA7422 deliv.12/16
Fresh style meets breathability in these kids'
running shoes. The comfortable mesh upper
helps keeps active feet cooler. They're detailed
[BA7421KS]| [BA9423U5]| [BA7422LV]| with a sporty two-colour midsole.

* *

AltaRun K AltaRun K
size 28-35; 3-6.5 34,95 size 28-35; 3-6.5 34,95
BA9425 ftwr white/blue/mid grey s14 BA7423 ftwr white/bold pink/mid grey s14
SYNTHETICS SYNTHETICS/TEXTILE
BA9425 deliv.12/16
Lightweight and ready to move, these kids' BA7423 deliv.12/16
Lightweight and ready to move, these kids'
running shoes are flexible and built to last. running shoes are flexible and built to last.
Featuring a durable synthetic upper, they're Featuring a durable synthetic upper, they're
[BA9425WB]| detailed with a sporty two-colour midsole. [BA7423MY]| detailed with a sporty two-colour midsole.

* *

AltaRun K AltaRun K
size 28-35; 3-6.5 34,95 size 28-35; 3-6.5 34,95
BA9426 ftwr white/blue/mid grey s14 BA9427 ftwr white/bold pink/mid grey s14
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
BA9426 deliv.12/16
Fresh style meets breathability in these kids' BA9427 deliv.12/16
Fresh style meets breathability in these kids'
running shoes. The comfortable mesh upper running shoes. The comfortable mesh upper
helps keeps active feet cooler. They're detailed helps keeps active feet cooler. They're detailed
[BA9426XE]| with a sporty two-colour midsole. [BA9427YH]| with a sporty two-colour midsole.

17Q1_FTW_EUR-CHF_104_153.indd 135 08.06.2016 11:47:47


136 Training

Training
* *
RapidaFlex EL K
KIDS

size 28-35; 3-6.5 44,95 RapidaFlex EL K


size 29-35; 3-6.5 44,95
BA9442 collegiate royal/ftwr white/collegiate
navy BB1276 core black/bright yellow/bright yellow
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Light and fun to wear, these kids' training shoes Light and fun to wear, these kids' training shoes
have a super-flexible and colourful outsole. The have a super-flexible outsole. The breathable
breathable mesh upper has simple elastic laces mesh upper has simple elastic laces for active
for active kids on the go. Pillowy cloudfoam kids on the go. Pillowy cloudfoam cushioning adds
cushioning adds amazing comfort. amazing comfort.
Breathable mesh with thin no sew material on Breathable mesh with reflective no sew material
top for support and technical looks. on top for support and very technical looks.
Elastic laces with top strap for easy on off and Elastic laces with top strap for easy on off and
adjustability. BA9442 deliv.12/16
adjustability. BB1276 deliv.12/16
Lightweight and flexible combination of EVA and Lightweight and flexible combination of EVA and
non-marking rubber. non-marking rubber.
[BA9442XC]| [BB1276AB]|

* *
RapidaFlex EL K
size 28-35; 3-6.5 44,95 FortaGym CF K
size 28-35; 3-6.5 39,95
BA9447 ultra purple s12/easy pink s17/ftwr
white BA9335 ftwr white/core blue s17/core red s17
BA9448 collegiate navy/easy blue s17/still BA9336 core black/core black/onix
breeze f12 TEXTILE/SYNTHETICS
TEXTILE/SYNTHETICS Ready for everyday play, these kids' multipurpose
Light and fun to wear, these kids' training shoes shoes go from the playground to after-school
have a super-flexible outsole. The breathable sports with a non-marking sole and soft
mesh upper has simple elastic laces for active cloudfoam cushioning. The textile upper has
kids on the go. Pillowy cloudfoam cushioning adds overlays for support and kid-friendly strap
amazing comfort. closures.
Breathable mesh with thin no sew material on Textile base with synthetic overlays
top for support and technical looks. Fully adjustable upper straps for fit and
Elastic laces with top strap for easy on off and BA9447 deliv.12/16 BA9448 deliv.12/16
convenience. BA9335 deliv.12/16 BA9336 deliv.12/16
adjustability. Lightweight and flexible combination of EVA and
Lightweight and flexible combination of EVA and non-marking rubber.
non-marking rubber. [BA9447=R]| [BA9448$U]| [BA9335V9]| [BA9336WC]|

* *
FortaGym CF K
FortaGym CF K size 28-35; 3-6.5 39,95
size 28-35; 3-6.5 39,95 BA7921 ftwr white/ftwr white/clear grey s12
BA9342 bold pink/ftwr white/vista grey s15 BA7920 core black/core black/dgh solid grey
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Ready for everyday play, these kids' multipurpose Ready for everyday play, these kids' multipurpose
shoes go from the playground to after-school shoes go from the playground to after-school
sports with a non-marking sole and soft sports with a non-marking sole and soft
cloudfoam cushioning. The textile upper has cloudfoam cushioning. The textile upper has
overlays for support and kid-friendly strap overlays for support and kid-friendly strap
closures. closures.
Textile base with synthetic overlays Textile base with synthetic overlays
Fully adjustable upper straps for fit and Fully adjustable upper straps for fit and
convenience. BA9342 deliv.12/16
convenience. BA7921 deliv.12/16 BA7920 deliv.12/16
Lightweight and flexible combination of EVA and Lightweight and flexible combination of EVA and
non-marking rubber. non-marking rubber.
[BA9342U5]| [BA7921ZG]| [BA7920YD]|

17Q1_FTW_EUR-CHF_104_153.indd 136 08.06.2016 11:48:02


Training 137

* *

KIDS
FortaGym K FortaGym K
size 28-35; 3-6.5 39,95 size 28-35; 3-6.5 39,95
BA9360 core black/core black/onix BA9354 bold pink/ftwr white/vista grey s15
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Ready for everyday play, these kids' multipurpose Ready for everyday play, these kids' multipurpose
shoes go from the playground to after-school shoes go from the playground to after-school
sports with a non-marking sole and soft sports with a non-marking sole and soft
cloudfoam cushioning. The textile upper has cloudfoam cushioning. The textile upper has
overlays for support. overlays for support.
BA9360 deliv.12/16
Textile base with synthetic overlays BA9354 deliv.12/16
Textile base with synthetic overlays
Lightweight and flexible combination of EVA and Lightweight and flexible combination of EVA and
non-marking rubber. non-marking rubber.
[BA9360W9]| [BA9354YG]|

* *

FortaGym CF K FortaGym CF K
size 28-35; 3-6.5 34,95 size 28-35; 3-6.5 34,95
BA9337 blue/core green s17/gum 3 BA9340 core pink s17/easy orange s17/gum 3
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Ready for everyday play, these kids' multipurpose Ready for everyday play, these kids' multipurpose
shoes feature soft cloudfoam cushioning and a shoes feature soft cloudfoam cushioning and a
non-marking sole that makes them perfect for non-marking sole that makes them perfect for
school sports. The textile upper has overlays for school sports. The textile upper has overlays for
support and kid-friendly strap closures. support and kid-friendly strap closures.
Textile base with synthetic overlays Textile base with synthetic overlays
Fully adjustable upper straps for fit and Fully adjustable upper straps for fit and
BA9337 deliv.12/16
convenience. BA9340 deliv.12/16
convenience.
Lightweight and flexible combination of EVA and Lightweight and flexible combination of EVA and
non-marking rubber. non-marking rubber.
[BA9337XF]| [BA9340S&]|

* *

FortaGym K FortaGym K
size 28-35; 3-6.5 34,95 size 28-35; 3-6.5 34,95
BA9356 blue/core green s17/gum 3 BA9352 core pink s17/easy orange s17/gum 3
TEXTILE/SYNTHETICS TEXTILE/SYNTHETICS
Ready for everyday play, these kids' multipurpose Ready for everyday play, these kids' multipurpose
shoes feature soft cloudfoam cushioning and a shoes feature soft cloudfoam cushioning and a
non-marking sole that makes them perfect for non-marking sole that makes them perfect for
school sports. The textile upper has overlays for school sports. The textile upper has overlays for
support. support.
BA9356 deliv.12/16
Textile base with synthetic overlays BA9352 deliv.12/16
Textile base with synthetic overlays
Lightweight and flexible combination of EVA and Lightweight and flexible combination of EVA and
non-marking rubber. non-marking rubber.
[BA9356-M]| [BA9352WA]|

17Q1_FTW_EUR-CHF_104_153.indd 137 08.06.2016 11:48:10


138 Training

*
KIDS

AltaSport CF K BA9450 deliv.12/16 BA9525 deliv.12/16 BA7459 deliv.12/16 BA7460 deliv.12/16 BA7461 deliv.12/16
size 28-35; 3-6.5 29,95
BA9450 ftwr white/bold pink/ftwr white [BA9450XB]| [BA9525ZI]| [BA7459YK]| [BA7460R^]| [BA7461S1]|
BA9525 ftwr white/blue/ftwr white
BA7459 core black/ftwr white/core black
BA7460 bold pink/easy pink s17/ftwr white
BA7461 collegiate royal/easy blue s17/ftwr
white
BA7458 ftwr white/core black/ftwr white
BA9524 ftwr white/ftwr white/clear grey s12
BA9526 core black/core black/ftwr white
SYNTHETICS
Simple and sporty, these kids' training shoes are
made for school and play. The synthetic upper
is light but durable enough for active days, with
a grippy rubber cupsole. Simple strap closures
make them easy to get on and off.
Full synthetic upper for durability with nice
finish for style
Fully adjustable upper straps for fit and
BA7458 deliv.12/16 BA9524 deliv.12/16 BA9526 deliv.12/16
convenience.
Flexible rubber cupsole for grip and durability.
[BA7458XH]| [BA9524YF]| [BA9526-L]|

* *
AltaSport EL K
AltaSport CF K size 28-35; 3-6.5 29,95
size 28-35; 3-6.5 29,95 BA9452 tech green f16/linen green s17/cargo
BA9527 collegiate navy/ftwr white/blue brown f16
SYNTHETICS BA9538 onix/easy pink s17/chalk white
Simple and sporty, these kids' training shoes are TEXTILE/SYNTHETICS
made for school and play. The synthetic upper A casual, skater-inspired look for school or play.
is light but durable enough for active days, with These kids' training shoes have a breathable
a grippy rubber cupsole. Simple strap closures canvas upper with elastic laces and a top strap for
make them easy to get on and off. a snug fit. The non-marking outsole is suitable for
Full synthetic upper for durability with nice indoor gym wear.
finish for style Upper made of casual canvas
Fully adjustable upper straps for fit and BA9527 deliv.12/16
Fully adjustable upper straps for fit and BA9452 deliv.12/16 BA9538 deliv.12/16
convenience. convenience.
Flexible rubber cupsole for grip and durability. Flexible rubber cupsole for grip and durability.
[BA9527.O]| [BA9452ZH]| [BA9538/W]|

17Q1_FTW_EUR-CHF_104_153.indd 138 08.06.2016 11:48:24


Training 139

KIDS
BA9543 deliv.12/16 BA9544 deliv.12/16 BA9545 deliv.12/16 BA9542 deliv.12/16 BA9455 deliv.12/16

[BA9543.M]| [BA9544=P]| [BA9545$S]| [BA9542-J]| [BA9455=Q]|

AltaSport K
size 28-35; 3-6.5 29,95
BA9543 ftwr white/bold pink/ftwr white
BA9544 ftwr white/blue/ftwr white
BA9545 bold pink/easy pink s17/ftwr white
BA9542 collegiate royal/easy blue s17/ftwr
white
BA9455 ftwr white/ftwr white/clear grey s12
BA9541 core black/core black/ftwr white
SYNTHETICS
Simple and sporty, these kids' training shoes are
made for school and play. The synthetic upper is
light but durable enough for active days. The non-
marking outsole is suitable for indoor gym wear.
Full synthetic upper for durability with nice
BA9541 deliv.12/16
finish for style
Flexible rubber cupsole for grip and durability.
[BA9541ZG]|
Fuball
* *
RapidaTurf ACE K
size 29-35; 3-6.5 54,95
BA9693 core black/ftwr white/red
BA9694 core black/ftwr white/blue
SYNTHETICS
A kid-size take on a grown-up football style.
These kids' training shoes feature a fun print on
a synthetic upper, and a turf-inspired outsole.
Just like the adult ACE boot, they have classic
AltaSport K laces and a big performance logo on the synthetic
size 28-35; 3-6.5 29,95 suede heel.
ACE color concept
BA9547 mid grey s14/still breeze f12/grey
Football inspired silhouette
TEXTILE/SYNTHETICS Synthetic upper material mix for lightweight
BA9547 deliv.12/16 BA9693 deliv.12/16 BA9694 deliv.02/17
Mesh base with synthetic overlays durability and enhanced fit.
Flexible rubber cupsole for grip and durability. Lightweight EVA midsole and rubber turf outsole
[BA9547+Y]| [BA969337]| [BA96944A]|

17Q1_FTW_EUR-CHF_104_153.indd 139 08.06.2016 11:48:35


140 Fuball

* *
KIDS

RapidaTurf MUFC K
RapidaTurf FCB K size 29-35; 3-6.5 54,95
size 29-35; 3-6.5 54,95 BA9696 utility black f16/ftwr white/real red s10
BA9695 fcb true red/core black/ftwr white TEXTILE/SYNTHETICS
TEXTILE/SYNTHETICS With a turf-inspired outsole and Manchester
With a turf-inspired outsole and FC Bayern home United colours, these kids' training shoes have
colours, these kids' training shoes have legitimate legitimate football style. The breathable textile
football style. The breathable textile upper sports upper sports a red and black print and bold
a red print and bold 3-Stripes. Finished with the 3-Stripes. Finished with the official club crest on
official club crest on the heel and outsole. the heel and outsole.
FC Bayern Munich color story Manchester United color story
Football inspired silhouette Football inspired silhouette
Mesh base with transparent print and club logo BA9695 deliv.12/16
Mesh base with transparent print and club logo BA9696 deliv.12/16
on heel on heel
Lightweight EVA midsole and rubber turf outsole Lightweight EVA midsole and rubber turf outsole
[BA96955D]| [BA96966G]|

* *
RapidaTurf REAL K
size 29-35; 3-6.5 54,95
RapidaTurf Messi K
BA9699 ftwr white/ray purple f13/collegiate size 28-35; 3-6.5 54,95
navy
TEXTILE/SYNTHETICS BB0226 blue/ftwr white/solar orange
With a turf-inspired outsole and Real Madrid