Sie sind auf Seite 1von 30

UNTA ARAB

LOCUS AB753118 791 bp DNA linear MAM 17-APR-


2013
DEFINITION Camelus dromedarius mitochondrial CO1 gene for cytochrome c
oxidase
subunit 1, partial cds, haplotype: production-10.
ACCESSION AB753118
VERSION AB753118.1
KEYWORDS .
SOURCE mitochondrion Camelus dromedarius (Arabian camel)
ORGANISM Camelus dromedarius
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Tylopoda;
Camelidae; Camelus.
REFERENCE 1
AUTHORS Ahmed,M.M., Amer,S.A. and ElShazly,S.A.
TITLE Comparative molecular studies of energy related mitochondrial
genes
between the Arabian (single-hump) and Bactrian (double-hump)
camels
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 791)
AUTHORS Amer,S.A. and Ahmed,M.M.
TITLE Direct Submission
JOURNAL Submitted (03-OCT-2012) Contact:Sayed Amin Mohamed Amer Taif
University, Biology; Abo Bakre, Taif, Makkah 888, Saudi Arabia
FEATURES Location/Qualifiers
source 1..791
/organism="Camelus dromedarius"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/db_xref="taxon:9838"
/haplotype="production-10"
/country="Saudi Arabia"
gene <1..>791
/gene="CO1"
CDS <1..>791
/gene="CO1"
/codon_start=1
/transl_table=2
/product="cytochrome c oxidase subunit 1"
/protein_id="BAN15839.1"

/translation="LSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIG

GFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAG

NLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITA

VLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPG
FGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVG"
ORIGIN
1 ctaagcttat taattcgtgc tgaattgggg cagcctggga cattgcttgg agatgaccaa
61 atctataatg tagttgtaac ggctcatgct ttcgtcatga ttttctttat ggttatgcca
121 atcatgattg ggggcttcgg gaattgactg gtccccctaa taattggagc cccggacatg
181 gcgttccccc gcatgaataa tatgagcttc tggttgctac ctccctcatt cttgctactg
241 ctagcatcat ctatagttga agcaggagca ggcacaggct gaaccgttta ccctccccta
301 gccggaaacc tggctcatgc aggcgcttcc gtcgatttaa ctattttctc tctgcactta
361 gcaggagtgt cttcaattct aggggctatt aactttatca ccactattat taatataaaa
421 ccacctgcca tatctcaata ccagacccct ttatttgtat gatccgttct aatcaccgcc
481 gttctcttac tactctctct tccagtactg gctgccggaa ttacaatact actaacagac
541 cgtaacctaa atacaacttt ctttgatcct gcgggaggag gagatcccat cctttatcaa
601 cacctatttt gattcttcgg tcacccagaa gtttatatcc taatcctacc tggctttgga
661 ataatttccc acattgtcac ctactactct ggaaaaaaag aaccctttgg ctatatggga
721 atagtctgag ctataatgtc tatcggattc ctaggcttca ttgtatgagc ccaccatata
781 tttacagtag g
//
FASTA

>AB753118.1 Camelus dromedarius mitochondrial CO1 gene for cytochrome c


oxidase subunit 1, partial cds, haplotype: production-10
CTAAGCTTATTAATTCGTGCTGAATTGGGGCAGCCTGGGACATTGCTTGGAGATGACCAAATCTATAATG
TAGTTGTAACGGCTCATGCTTTCGTCATGATTTTCTTTATGGTTATGCCAATCATGATTGGGGGCTTCGG
GAATTGACTGGTCCCCCTAATAATTGGAGCCCCGGACATGGCGTTCCCCCGCATGAATAATATGAGCTTC
TGGTTGCTACCTCCCTCATTCTTGCTACTGCTAGCATCATCTATAGTTGAAGCAGGAGCAGGCACAGGCT
GAACCGTTTACCCTCCCCTAGCCGGAAACCTGGCTCATGCAGGCGCTTCCGTCGATTTAACTATTTTCTC
TCTGCACTTAGCAGGAGTGTCTTCAATTCTAGGGGCTATTAACTTTATCACCACTATTATTAATATAAAA
CCACCTGCCATATCTCAATACCAGACCCCTTTATTTGTATGATCCGTTCTAATCACCGCCGTTCTCTTAC
TACTCTCTCTTCCAGTACTGGCTGCCGGAATTACAATACTACTAACAGACCGTAACCTAAATACAACTTT
CTTTGATCCTGCGGGAGGAGGAGATCCCATCCTTTATCAACACCTATTTTGATTCTTCGGTCACCCAGAA
GTTTATATCCTAATCCTACCTGGCTTTGGAATAATTTCCCACATTGTCACCTACTACTCTGGAAAAAAAG
AACCCTTTGGCTATATGGGAATAGTCTGAGCTATAATGTCTATCGGATTCCTAGGCTTCATTGTATGAGC
CCACCATATATTTACAGTAGG

HIU MARTIL

LOCUS KU936198 638 bp DNA linear VRT 08-MAY-


2016
DEFINITION Sphyrna zygaena isolate DFD79 cytochrome c oxidase subunit 1
(CO1)
gene, partial cds; mitochondrial.
ACCESSION KU936198
VERSION KU936198.1
KEYWORDS .
SOURCE mitochondrion Sphyrna zygaena (smooth hammerhead)
ORGANISM Sphyrna zygaena
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Chondrichthyes;
Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;
Carcharhinidae; Sphyrna.
REFERENCE 1 (bases 1 to 638)
AUTHORS Zacharia,P.U., Ambily,M.N., Shiyas,C.A., Kishore,T.G.,
Ambily,L.,
Sobhana,K.S., Rekha Nair,J., Najmudeen,T.M., Shoba,J.K.,
Swatipriyanka,S.D., Sujitha,T., Purushottama,G.B., Ranjith,L.,
Muktha,M., Manoj Kumar,P.P., Saravanan,R., Akhilesh,K.V. and
Santhosh,B.
TITLE Direct Submission
JOURNAL Submitted (15-MAR-2016) Demersal Fisheries Division, Central
Marine
Fisheries Research Institute, P.B. No. 1603, Ernakulam North
P.O.,
Kochi, Kerala 682018, India
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..638
/organism="Sphyrna zygaena"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="DFD79"
/db_xref="taxon:195335"
gene <1..>638
/gene="CO1"
CDS <1..>638
/gene="CO1"
/codon_start=2
/transl_table=2
/product="cytochrome c oxidase subunit 1"
/protein_id="ANC28291.1"

/translation="VGTALSLLIRAELGQPGSLLGDDQIYNVIVTAHAFVMIFFMVMP

IMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASAGVEAGAGTGWTVYP

PLASNLAHAGPSVDLAIFSLHLAGVSSILASINFITTIINMKPPAISQYQTPLFVWSI
LVTTILLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH"
ORIGIN
1 agttgggaca gccctaagtc tcttaattcg agctgaactt gggcaaccag gatctcttct
61 aggagatgac cagatttata atgtaattgt aaccgcccac gctttcgtaa taatcttttt
121 tatagttatg ccaatcataa ttggtggctt cgggaattga ttagttcctt taataattgg
181 tgcaccagac atggccttcc cacgaataaa taacataagt ttctgacttc ttccaccatc
241 atttcttctc ctcctagctt ctgctggggt agaagctgga gcaggaactg gttgaacagt
301 ttatcctcca ttagctagca atttagccca tgctggacca tccgttgact tagctatttt
361 ttctcttcat ttagctggtg tatcatcaat cttagcctca atcaatttta ttacaactat
421 tatcaatata aaacccccag ccatctccca atatcaaaca ccactatttg tttgatctat
481 ccttgtaact actattttac ttctcctctc acttccagtt cttgcagcag ggattacaat
541 attacttaca gatcgtaacc ttaatactac attctttgat cccgcaggag gaggagatcc
601 aattctttat caacacttat tctgattctt tggccacc
FASTA

>KU936198.1 Sphyrna zygaena isolate DFD79 cytochrome c oxidase subunit 1


(CO1) gene, partial cds; mitochondrial
AGTTGGGACAGCCCTAAGTCTCTTAATTCGAGCTGAACTTGGGCAACCAGGATCTCTTCTAGGAGATGAC
CAGATTTATAATGTAATTGTAACCGCCCACGCTTTCGTAATAATCTTTTTTATAGTTATGCCAATCATAA
TTGGTGGCTTCGGGAATTGATTAGTTCCTTTAATAATTGGTGCACCAGACATGGCCTTCCCACGAATAAA
TAACATAAGTTTCTGACTTCTTCCACCATCATTTCTTCTCCTCCTAGCTTCTGCTGGGGTAGAAGCTGGA
GCAGGAACTGGTTGAACAGTTTATCCTCCATTAGCTAGCAATTTAGCCCATGCTGGACCATCCGTTGACT
TAGCTATTTTTTCTCTTCATTTAGCTGGTGTATCATCAATCTTAGCCTCAATCAATTTTATTACAACTAT
TATCAATATAAAACCCCCAGCCATCTCCCAATATCAAACACCACTATTTGTTTGATCTATCCTTGTAACT
ACTATTTTACTTCTCCTCTCACTTCCAGTTCTTGCAGCAGGGATTACAATATTACTTACAGATCGTAACC
TTAATACTACATTCTTTGATCCCGCAGGAGGAGGAGATCCAATTCTTTATCAACACTTATTCTGATTCTT
TGGCCAC
KATAK

LOCUS JF939104 558 bp DNA linear VRT 25-JUL-


2016
DEFINITION Rana longicrus voucher KIZYPX14268 cytochrome oxidase subunit I
(CO1) gene, partial cds; mitochondrial.
ACCESSION JF939104
VERSION JF939104.1
KEYWORDS .
SOURCE mitochondrion Rana longicrus
ORGANISM Rana longicrus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae;
Rana;
Rana.
REFERENCE 1 (bases 1 to 558)
AUTHORS Yan,F., Jiang,K., Chen,H.M., Fang,P., Jin,J.Q., Li,Y.,
Wang,S.N.,
Robert,W.M., Che,J. and Zhang,Y.P.
TITLE Matrilineal history of the Rana longicrus species group (Rana,
Ranidae, Anura) and the description of a new species from Hunan
province, southern China
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 558)
AUTHORS Yan,F., Jiang,K., Chen,H.M., Fang,P., Jin,J.Q., Li,Y.,
Wang,S.N.,
Robert,W.M., Che,J. and Zhang,Y.P.
TITLE Direct Submission
JOURNAL Submitted (12-MAY-2011) State Key Laboratory of Genetic
Resources
and Evolution, Kunming Institute of Zoology, Chinese Academy of
Sciences, No. 32 Jiaochang Donglu, Kunming, Yunnan 650223,
China
FEATURES Location/Qualifiers
source 1..558
/organism="Rana longicrus"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/specimen_voucher="KIZYPX14268"
/db_xref="taxon:133537"
gene <1..>558
/gene="CO1"
CDS <1..>558
/gene="CO1"
/codon_start=1
/transl_table=2
/product="cytochrome oxidase subunit I"
/protein_id="AEQ63777.1"

/translation="LSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPILIG

GFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSTVEAGAGTGWTVYPPLAG

NLAHAGPSVDLAIFSLHLAGVSSILGAINFITTIINMKPASTTQYQAPLFVWSVLITA
VLLLLSLPVLAAGITMLLTDRNLNTS"
ORIGIN
1 ttaagcctac tcatccgagc agaactgagt caacctggaa ctcttctggg agacgaccag
61 atctataacg ttattgtcac tgcccacgca ttcgtaatga ttttctttat agttatgcca
121 attctaatcg ggggtttcgg gaactgactg gtccccctga taatcggagc tccagatatg
181 gcctttccac gaatgaataa cataagcttc tgactgctcc ctccctcttt ttttcttctc
241 ctagcctcct ctacagttga agccggagcg ggtacgggct gaacagtcta ccccccatta
301 gcaggcaatc tcgcccacgc aggcccatca gtagacctgg ccatcttctc actgcatcta
361 gccggagtct catccatctt aggggccatc aactttatca caaccattat caatataaaa
421 cctgcatcta caacacaata ccaagcgcct ctctttgtct ggtcagtcct tatcaccgct
481 gtcctcctac tactatccct ccccgtcctg gccgccggga ttactatgct ccttacagac
541 cgaaatttaa atacctcc
//

FASTA

>JF939104.1 Rana longicrus voucher KIZYPX14268 cytochrome oxidase subunit I


(CO1) gene, partial cds; mitochondrial
TTAAGCCTACTCATCCGAGCAGAACTGAGTCAACCTGGAACTCTTCTGGGAGACGACCAGATCTATAACG
TTATTGTCACTGCCCACGCATTCGTAATGATTTTCTTTATAGTTATGCCAATTCTAATCGGGGGTTTCGG
GAACTGACTGGTCCCCCTGATAATCGGAGCTCCAGATATGGCCTTTCCACGAATGAATAACATAAGCTTC
TGACTGCTCCCTCCCTCTTTTTTTCTTCTCCTAGCCTCCTCTACAGTTGAAGCCGGAGCGGGTACGGGCT
GAACAGTCTACCCCCCATTAGCAGGCAATCTCGCCCACGCAGGCCCATCAGTAGACCTGGCCATCTTCTC
ACTGCATCTAGCCGGAGTCTCATCCATCTTAGGGGCCATCAACTTTATCACAACCATTATCAATATAAAA
CCTGCATCTACAACACAATACCAAGCGCCTCTCTTTGTCTGGTCAGTCCTTATCACCGCTGTCCTCCTAC
TACTATCCCTCCCCGTCCTGGCCGCCGGGATTACTATGCTCCTTACAGACCGAAATTTAAATACCTCC
MANUSIA

LOCUS GQ369957 16571 bp DNA circular PRI 24-JUL-


2016
DEFINITION Homo sapiens isolate MB3027 mitochondrion, complete genome.
ACCESSION GQ369957
VERSION GQ369957.1
KEYWORDS .
SOURCE mitochondrion Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 16571)
AUTHORS Zsurka,G., Hampel,K.G., Nelson,I., Jardel,C., Mirandola,S.R.,
Sassen,R., Kornblum,C., Marcorelles,P., Lavoue,S., Lombes,A.
and
Kunz,W.S.
TITLE Severe epilepsy as the major symptom of new mutations in the
mitochondrial tRNA(Phe) gene
JOURNAL Neurology 74 (6), 507-512 (2010)
PUBMED 20142618
REFERENCE 2 (bases 1 to 16571)
AUTHORS Zsurka,G., Hampel,K.G., Nelson,I., Jardel,C., Mirandola,S.,
Sassen,R., Kornblum,C., Marcorelles,P., Lavoue,S., Lombes,A.
and
Kunz,W.S.
TITLE Direct Submission
JOURNAL Submitted (09-JUL-2009) Department of Epileptology, University
of
Bonn, Sigmund-Freud-Str. 25, Bonn 53105, Germany
FEATURES Location/Qualifiers
source 1..16571
/organism="Homo sapiens"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="MB3027"
/isolation_source="patient with severe epilepsy"
/db_xref="taxon:9606"
/sex="female"
/tissue_type="skeletal muscle"
/country="Germany"
tRNA 580..650
/product="tRNA-Phe"
rRNA 651..1604
/product="12S ribosomal RNA"
tRNA 1605..1673
/product="tRNA-Val"
rRNA 1674..3231
/product="16S ribosomal RNA"
tRNA 3232..3306
/product="tRNA-Leu"
/note="codons recognized: UUR"
gene 3309..4264
/gene="ND1"
/note="MT-ND1"
CDS 3309..4264
/gene="ND1"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:4263..4264,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 1"
/protein_id="ACT53094.1"

/translation="MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYG

LLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGL

LFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSF

NLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAG

PFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTA
YPRFRYDQLMHLLWKNFLPLTLALLMWHVSMPITISSIPPQT"
tRNA 4265..4333
/product="tRNA-Ile"
tRNA complement(4331..4402)
/product="tRNA-Gln"
tRNA 4404..4471
/product="tRNA-Met"
gene 4472..5513
/gene="ND2"
/note="MT-ND2"
CDS 4472..5513
/gene="ND2"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:5513,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 2"
/protein_id="ACT53095.1"

/translation="MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVL

TKKMNPRSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAM

AMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSIL

SIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLL

LNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSL

IIPTIMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTT
LLLPISPFMLMIL"
tRNA 5514..5581
/product="tRNA-Trp"
tRNA complement(5589..5657)
/product="tRNA-Ala"
tRNA complement(5659..5731)
/product="tRNA-Asn"
tRNA complement(5763..5828)
/product="tRNA-Cys"
tRNA complement(5828..5893)
/product="tRNA-Tyr"
gene 5906..7447
/gene="CO1"
/note="MT-CO1"
CDS 5906..7447
/gene="CO1"
/codon_start=1
/transl_table=2
/product="cytochrome c oxidase subunit I"
/protein_id="ACT53096.1"

/translation="MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQP

GNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSF

WLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILG

AINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTT

FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWA

MMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKW

SAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGG

FIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTW

NILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEP
VYMKS"
tRNA complement(7448..7516)
/product="tRNA-Ser"
/note="codons recognized: UCN"
tRNA 7520..7587
/product="tRNA-Asp"
gene 7588..8271
/gene="CO2"
/note="MT-CO2"
CDS 7588..8271
/gene="CO2"
/codon_start=1
/transl_table=2
/product="cytochrome c oxidase subunit II"
/protein_id="ACT53097.1"

/translation="MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFL

TLTTKLTNTNISDAQEMETVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGH

QWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVL

HSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKI
FEMGPVFTL"
tRNA 8297..8366
/product="tRNA-Lys"
gene 8368..8574
/gene="ATP8"
/note="MT-ATP8"
CDS 8368..8574
/gene="ATP8"
/codon_start=1
/transl_table=2
/product="ATP synthase F0 subunit 8"
/protein_id="ACT53098.1"
/translation="MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKM
KNYNKPWEPKWTKICSLHSLPPQS"
gene 8529..9209
/gene="ATP6"
/note="MT-ATP6"
CDS 8529..9209
/gene="ATP6"
/codon_start=1
/transl_table=2
/product="ATP synthase F0 subunit 6"
/protein_id="ACT53099.1"

/translation="MNENLFASFIAPTILGLPAAVLIILFPPLLIPTSKYLINNRLIT

TQQWLIKLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNL

AMAIPLWAGAVIMGFRSKIKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRL

TANITAGHLLMHLIGSATLAMSTINLPSTLIIFTILILLTILEIAVALIQAYVFTLLV
SLYLHDNT"
gene 9209..9992
/gene="CO3"
/note="MT-CO3"
CDS 9209..9992
/gene="CO3"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:9992,aa:TERM)
/transl_table=2
/product="cytochrome c oxidase subunit III"
/protein_id="ACT53100.1"

/translation="MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLM

LGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFY

HSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMI

QALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTIC
FIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS"
tRNA 9993..10060
/product="tRNA-Gly"
gene 10061..10406
/gene="ND3"
/note="MT-ND3"
CDS 10061..10406
/gene="ND3"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:10406,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 3"
/protein_id="ACT53101.1"

/translation="MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPM
SPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSL
AYEWLQKGLDWTE"
tRNA 10407..10471
/product="tRNA-Arg"
gene 10472..10768
/gene="ND4L"
/note="MT-ND4L"
CDS 10472..10768
/gene="ND4L"
/codon_start=1
/transl_table=2
/product="NADH dehydrogenase subunit 4L"
/protein_id="ACT53102.1"

/translation="MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMA

TLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC"
gene 10762..12139
/gene="ND4"
/note="MT-ND4"
CDS 10762..12139
/gene="ND4"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:12139,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 4"
/protein_id="ACT53103.1"

/translation="MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQ

INNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISL

QISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPL

LIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPK

AHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSIC

LRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNY

ERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNIT

LLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLN
PDIITGFSS"
tRNA 12140..12208
/product="tRNA-His"
tRNA 12209..12267
/product="tRNA-Ser"
/note="codons recognized: AGY"
tRNA 12268..12338
/product="tRNA-Leu"
/note="codons recognized: CUN"
gene 12339..14150
/gene="ND5"
/note="MT-ND5"
CDS 12339..14150
/gene="ND5"
/codon_start=1
/transl_table=2
/product="NADH dehydrogenase subunit 5"
/protein_id="ACT53104.1"

/translation="MTMHTTMTTLTLTSLIPPILTTLVNPNKKNSYPHYVKSIVASTF

IISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIME

FSLWYMNSDPNINQFFKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYA

RADANTAAIQAILYNRIGDIGFILALAWFILHSNSWDPQQMALLNANPSLTPLLGLLL

AAAGKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTL

TLCLGAITTLFAAVCALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAF

FKAMLFMCSGSIIHNLNNEQDIRKMGGLLKTMPLTSTSLTIGSLALAGMPFLTGFYSK

DHIIETANMSYTNAWALSITLIATSLTSAYSTRMILLTLTGQPRFPTLTNINENNPTL

LNPIKRLAAGSLFAGFLITNNISPASPFQTTIPLYLKLTALAVTFLGLLTALDLNYLT

NKLKMKSPLCTFYFSNMLGFYPSITHRTIPYLGLLTSQNLPLLLLDLTWLEKLLPKTI
SQHQISTSIITSTQKGMIKLYFLSFFFPLILTLLLIT"
gene complement(14151..14675)
/gene="ND6"
/note="MT-ND6"
CDS complement(14151..14675)
/gene="ND6"
/codon_start=1
/transl_table=2
/product="NADH dehydrogenase subunit 6"
/protein_id="ACT53105.1"

/translation="MMYALFLLSVGLVMGFVGFSSKPSPIYGGLVLIVSGVVGCVIIL

NFGGGYMGLMVFLIYLGGMMVVFGYTTAMAIEEYPEAWGSGVEVLVSVLVGLAMEVGL

VLWVKEYDGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWTL
FVGVYIVIEIARGN"
tRNA complement(14676..14744)
/product="tRNA-Glu"
gene 14749..15889
/gene="CYTB"
/note="MT-CYB"
CDS 14749..15889
/gene="CYTB"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:15889,aa:TERM)
/transl_table=2
/product="cytochrome b"
/protein_id="ACT53106.1"

/translation="MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQ

ITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGL
YYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDL

VQWIWGGYSVDSPTLTRFFTFHFILPFIIAALAALHLLFLHETGSNNPLGITSHSDKI

TFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLF

AYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLI
LTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA"
tRNA 15890..15955
/product="tRNA-Thr"
tRNA complement(15957..16025)
/product="tRNA-Pro"
ORIGIN
1 gatcacaggt ctatcaccct attaaccact cacgggagct ctccatgcat ttggtatttt
61 cgtctggggg gtatgcacgc gatagcattg cgagacgctg gagccggagc accctatgtc
121 gcagtatctg tctttgattc ctgcctcatt ctattattta tcgcacctac gttcaatatt
181 acaggcgaac atacttacta aagtgtgtta attaattaat gcttgtagga cataataata
241 acaattgaat gtctgcacag ccgctttcca cacagacatc ataacaaaaa atttccacca
301 aacccccccc ctccccccgc ttctggccac agcacttaaa cacatctctg ccaaacccca
361 aaaacaaaga accctaacac cagcctaacc agatttcaaa ttttatcttt tggcggtatg
421 cacttttaac agtcaccccc caactaacac attattttcc cctcccactc ccatactact
481 aatctcatca atacaacccc cgcccatcct acccagcaca cacacaccgc tgctaacccc
541 ataccccgaa ccaaccaaac cccaaagaca ccccccacag tttatgtagc ttacctcctc
601 aaagcaatac actgaaaacg tttagacggg ctcacatcac cccataaaca aataggtttg
661 gtcctagcct ttctattagc tcttagtaag attacacatg caagcatccc cgttccagtg
721 agttcaccct ctaaatcacc acgatcaaaa gggacaagca tcaagcacgc agcaatgcag
781 ctcaaaacgc ttagcctagc cacaccccca cgggaaacag cagtgattaa cctttagcaa
841 taaacgaaag tttaactaag ctatactaac cccagggttg gtcaatttcg tgccagccac
901 cgcggtcaca cgattaaccc aagtcaatag aagccggcgt aaagagtgtt ttagatcacc
961 ccctccccaa taaagctaaa actcacctga gttgtaaaaa actccagttg acacaaaata
1021 gactacgaaa gtggctttaa catatctgaa cacacaatag ctaagaccca aactgggatt
1081 agatacccca ctatgcttag ccctaaacct caacagttaa atcaacaaaa ctgctcgcca
1141 gaacactacg agccacagct taaaactcaa aggacctggc ggtgcttcat atccctctag
1201 aggagcctgt tctgtaatcg ataaaccccg atcaacctca ccacctcttg ctcagcctat
1261 ataccgccat cttcagcaaa ccctgatgaa ggctacaaag taagcgcaag tacccacgta
1321 aagacgttag gtcaaggtgt agcccatgag gtggcaagaa atgggctaca ttttctaccc
1381 cagaaaacta cgatagccct tatgaaactt aagggtcgaa ggtggattta gcagtaaact
1441 gagagtagag tgcttagttg aacagggccc tgaagcgcgt acacaccgcc cgtcaccctc
1501 ctcaagtata cttcaaagga catttaacta aaacccctac gcatttatat agaggagaca
1561 agtcgtaaca tggtaagtgt actggaaagt gcacttggac gaaccagagt gtagcttaac
1621 acaaagcacc caacttacac ttaggagatt tcaacttaac ttgaccgctc tgagctaaac
1681 ctagccccaa acccactcca ccttactacc agacaacctt agccaaacca tttacccaaa
1741 taaagtatag gcgatagaaa ttgaaacctg gcgcaataga tatagtaccg caagggaaag
1801 atgaaaaatt ataaccaagc ataatatagc aaggactaac ccctatacct tctgcataat
1861 gaattaacta gaaataactt tgcaaggaga gccaaagcta agacccccga aaccagacga
1921 gctacctaag aacagctaaa agagcacacc cgtctatgta gcaaaatagt gggaagattt
1981 ataggtagag gcgacaaacc taccgagcct ggtgatagct ggttgtccaa gatagaatct
2041 tagttcaact ttaaatttgc ccacagaacc ctctaaatcc ccttgtaaat ttaactgtta
2101 gtccaaagag gaacagctct ttggacacta ggaaaaaacc ttgtagagag agtaaaaaat
2161 ttaacaccca tagtaggcct aaaagcagcc accaattaag aaagcgttca agctcaacac
2221 ccactaccta aaaaatccca aacatataac tgaactcctc acacccaatt ggaccaatct
2281 atcaccctat agaagaacta atgttagtat aagtaacatg aaaacattct cctccgcata
2341 agcctgcgtc agattaaaac actgaactga caattaacag cccaatatct acaatcaacc
2401 aacaagtcat tattaccctc actgtcaacc caacacaggc atgctcataa ggaaaggtta
2461 aaaaaagtaa aaggaactcg gcaaatctta ccccgcctgt ttaccaaaaa catcacctct
2521 agcatcacca gtattagagg caccgcctgc ccagtgacac atgtttaacg gccgcggtac
2581 cctaaccgtg caaaggtagc ataatcactt gttccttaaa tagggacctg tatgaatggc
2641 tccacgaggg ttcagctgtc tcttactttt aaccagtgaa attgacctgc ccgtgaagag
2701 gcgggcataa cacagcaaga cgagaagacc ctatggagct ttaatttatt aatgcaaaca
2761 gtacctaaca aacccacagg tcctaaacta ccaaacctgc attaaaaatt tcggttgggg
2821 cgacctcgga gcagaaccca acctccgagc agtacatgct aagacttcac cagtcaaagc
2881 gaactactat actcaattga tccaataact tgaccaacgg aacaagttac cctagggata
2941 acagcgcaat cctattctag agtccatatc aacaataggg tttacgacct cgatgttgga
3001 tcaggacatc ccgatggtgc agccgctatt aaaggttcgt ttgttcaacg attaaagtcc
3061 tacgtgatct gagttcagac cggagtaatc caggtcggtt tctatctact tcaaattcct
3121 ccctgtacga aaggacaaga gaaataaggc ctacttcaca aagcgccttc ccccgtaaat
3181 gatatcatct caacttagta ttatacccac acccacccaa gaacagggtt tgttaagatg
3241 gcagagcccg gtaatcgcat aaaacttaaa actttacagt cagaggttca actcctcttc
3301 ttaacaacat acccatggcc aacctcctac tcctcattgt acccattcta atcgcaatgg
3361 cattcctaat gcttaccgaa cgaaaaattc taggctatat acaactacgc aaaggcccca
3421 acgttgtagg cccctacggg ctactacaac ccttcgctga cgccataaaa ctcttcacca
3481 aagagcccct aaaacccgcc acatctacca tcaccctcta catcaccgcc ccgaccttag
3541 ctctcaccat cgctcttcta ctatgaaccc ccctccccat acccaacccc ctggtcaacc
3601 tcaacctagg cctcctattt attctagcca cctctagcct agccgtttac tcaatcctct
3661 gatcagggtg agcatcaaac tcaaactacg ccctgatcgg cgcactgcga gcagtagccc
3721 aaacaatctc atatgaagtc accctagcca tcattctact atcaacatta ctaataagtg
3781 gctcctttaa cctctccacc cttatcacaa cacaagaaca cctctgatta ctcctgccat
3841 catgaccctt ggccataata tgatttatct ccacactagc agagaccaac cgaaccccct
3901 tcgaccttgc cgaaggggag tccgaactag tctcaggctt caacatcgaa tacgccgcag
3961 gccccttcgc cctattcttc atagccgaat acacaaacat tattataata aacaccctca
4021 ccactacaat cttcctagga acaacatatg acgcactctc ccctgaactc tacacaacat
4081 attttgtcac caagacccta cttctaacct ccctgttctt atgaattcga acagcatacc
4141 cccgattccg ctacgaccaa ctcatacacc tcctatgaaa aaacttccta ccactcaccc
4201 tagcattact tatatgacat gtctccatac ccattacaat ctccagcatt ccccctcaaa
4261 cctaagaaat atgtctgata aaagagttac tttgatagag taaataatag gagcttaaac
4321 ccccttattt ctaggactat gagaatcgaa cccatccctg agaatccaaa attctccgtg
4381 ccacctatca caccccatcc taaagtaagg tcagctaaat aagctatcgg gcccataccc
4441 cgaaaatgtt ggttataccc ttcccgtact aattaatccc ctggcccaac ccgtcatcta
4501 ctctaccatc tttgcaggca cactcatcac agcgctaagc tcgcactgat tttttacctg
4561 agtaggccta gaaataaaca tgctagcttt tattccagtt ctaaccaaaa aaataaaccc
4621 tcgttccaca gaagctgcca tcaagtattt cctcacgcaa gcaaccgcat ccataatcct
4681 tctaatagct atcctcttca acaatatact ctccggacaa tgaaccataa ccaatactac
4741 caatcaatac tcatcattaa taatcataat ggctatagca ataaaactag gaatagcccc
4801 ctttcacttc tgagtcccag aggttaccca aggcacccct ctgacatccg gcctgcttct
4861 tctcacatga caaaaactag cccccatctc aatcatatac caaatctctc cctcactaaa
4921 cgtaagcctt ctcctcactc tctcaatctt atccatcata gcaggcagtt gaggtggatt
4981 aaaccaaacc cagctacgca aaatcttagc atactcctca attacccaca taggatgaat
5041 aatagcagtt ctaccgtaca accctaacat aaccattctt aatttaacta tttatattat
5101 cctaactact accgcattcc tactactcaa cttaaactcc agcaccacga ccctactact
5161 atctcgcacc tgaaacaagc taacatgact aacaccctta attccatcca ccctcctctc
5221 cctaggaggc ctgcccccgc taaccggctt tttgcccaaa tgggccatta tcgaagaatt
5281 cacaaaaaac aatagcctca tcatccccac catcatagcc accatcaccc tccttaacct
5341 ctacttctac ctacgcctaa tctactccac ctcaatcaca ctactcccca tatctaacaa
5401 cgtaaaaata aaatgacagt ttgaacatac aaaacccacc ccattcctcc ccacactcat
5461 cgcccttacc acgctactcc tacctatctc cccttttata ctaataatct tatagaaatt
5521 taggttaaat acagaccaag agccttcaaa gccctcagta agttgcaata cttaatttct
5581 gtaacaacta aggactgcaa aaccccactc tgcatcaact gaacgcaaat cagccacttt
5641 aattaagcta agcccttact agaccaatgg gacttaaacc cacaaacact tagttaacag
5701 ctaagcaccc taatcaactg gcttcaatct acttctcccg ccgccgggaa aaaaggcggg
5761 agaagccccg gcaggtttga agctgcttct tcgaatttgc aattcaatat gaaaatcacc
5821 tcggagctgg taaaaagagg cctaacccct gtctttagat ttacagtcca atgcttcact
5881 cagccatttt acctcacccc cactgatgtt cgccgaccgt tgactattct ctacaaacca
5941 caaagacatt ggaacactat acctattatt cggcgcatga gctggagtcc taggcacagc
6001 tctaagcctc cttattcgag ccgagctggg ccagccaggc aaccttctag gtaacgacca
6061 catctacaac gttatcgtca cagcccatgc atttgtaata atcttcttca tagtaatacc
6121 catcataatc ggaggctttg gcaactgact agttccccta ataatcggtg cccccgatat
6181 ggcgtttccc cgcataaaca acataagctt ctgactctta cctccctctc tcctactcct
6241 gctcgcatct gctatagtgg aggccggagc aggaacaggt tgaacagtct accctccctt
6301 agcagggaac tactcccacc ctggagcctc cgtagaccta accatcttct ccttacacct
6361 agcaggtgtc tcctctatct taggggccat caatttcatc acaacaatta tcaatataaa
6421 accccctgcc ataacccaat accaaacgcc cctcttcgtc tgatccgtcc taatcacagc
6481 agtcctactt ctcctatctc tcccagtcct agctgctggc atcactatac tactaacaga
6541 ccgcaacctc aacaccacct tcttcgaccc cgccggagga ggagacccca ttctatacca
6601 acacctattc tgatttttcg gtcaccctga agtttatatt cttatcctac caggcttcgg
6661 aataatctcc catattgtaa cttactactc cggaaaaaaa gaaccatttg gatacatagg
6721 tatggtctga gctatgatat caattggctt cctagggttt atcgtgtgag cacaccatat
6781 atttacagta ggaatagacg tagacacacg agcatatttc acctccgcta ccataatcat
6841 cgctatcccc accggcgtca aagtatttag ctgactcgcc acactccacg gaagcaatat
6901 gaaatgatct gctgcagtgc tctgagccct aggattcatc tttcttttca ccgtaggtgg
6961 cctgactggc attgtattag caaactcatc actagacatc gtactacacg acacgtacta
7021 cgttgtagcc cacttccact atgtcctatc aataggagct gtatttgcca tcataggagg
7081 cttcattcac tgatttcccc tattctcagg ctacacccta gaccaaacct acgccaaaat
7141 ccatttcact atcatattca tcggcgtaaa tctaactttc ttcccacaac actttctcgg
7201 cctatccgga atgccccgac gttactcgga ctaccccgat gcatacacca catgaaacat
7261 cctatcatct gtaggctcat tcatttctct aacagcagta atattaataa ttttcatgat
7321 ttgagaagcc ttcgcttcga agcgaaaagt cctaatagta gaagaaccct ccataaacct
7381 ggagtgacta tatggatgcc ccccacccta ccacacattc gaagaacccg tatacataaa
7441 atctagacaa aaaaggaagg aatcgaaccc cccaaagctg gtttcaagcc aaccccatgg
7501 cctccatgac tttttcaaaa aggtattaga aaaaccattt cataactttg tcaaagttaa
7561 attataggct aaatcctata tatcttaatg gcacatgcag cgcaagtagg tctacaagac
7621 gctacttccc ctatcataga agagcttatc acctttcatg atcacgccct cataatcatt
7681 ttccttatct gcttcctagt cctgtatgcc cttttcctaa cactcacaac aaaactaact
7741 aatactaaca tctcagacgc tcaggaaata gaaaccgtct gaactatcct gcccgccatc
7801 atcctagtcc tcatcgccct cccatcccta cgcatccttt acataacaga cgaggtcaac
7861 gatccctccc ttaccatcaa atcaattggc caccaatggt actgaaccta cgagtacacc
7921 gactacggcg gactaatctt caactcctac atacttcccc cattattcct agaaccaggc
7981 gacctgcgac tccttgacgt tgacaatcga gtagtactcc cgattgaagc ccccattcgt
8041 ataataatta catcacaaga cgtcttgcac tcatgagctg tccccacatt aggcttaaaa
8101 acagatgcaa ttcccggacg tctaaaccaa accactttca ccgctacacg accgggggta
8161 tactacggtc aatgctctga aatctgtgga gcaaaccaca gtttcatgcc catcgtccta
8221 gaattaattc ccctaaaaat ctttgaaata gggcccgtat ttaccctata gcaccccctc
8281 taccccctct agagcccact gtaaagctaa cttagcatta accttttaag ttaaagatta
8341 agagaaccaa cacctcttta cagtgaaatg ccccaactaa atactaccgt atggcccacc
8401 ataattaccc ccatactcct tacactattc ctcatcaccc aactaaaaat attaaacaca
8461 aactaccacc tacctccctc accaaagccc ataaaaataa aaaattataa caaaccctga
8521 gaaccaaaat gaacgaaaat ctgttcgctt cattcattgc ccccacaatc ctaggcctac
8581 ccgccgcagt actgatcatt ctatttcccc ctctattgat ccccacctcc aaatatctca
8641 tcaacaaccg actaatcacc acccaacaat gactaatcaa actaacctca aaacaaatga
8701 taaccataca caacactaaa ggacgaacct gatctcttat actagtatcc ttaatcattt
8761 ttattgccac aactaacctc ctcggactcc tgcctcactc atttacacca accacccaac
8821 tatctataaa cctagccatg gccatcccct tatgagcggg cgcagtgatt ataggctttc
8881 gctctaagat taaaaatgcc ctagcccact tcttaccaca aggcacacct acacccctta
8941 tccccatact agttattatc gaaaccatca gcctactcat tcaaccaata gccctggccg
9001 tacgcctaac cgctaacatt actgcaggcc acctactcat gcacctaatt ggaagcgcca
9061 ccctagcaat atcaaccatt aaccttccct ctacacttat catcttcaca attctaattc
9121 tactgactat cctagaaatc gctgtcgcct taatccaagc ctacgttttc acacttctag
9181 taagcctcta cctgcacgac aacacataat gacccaccaa tcacatgcct atcatatagt
9241 aaaacccagc ccatgacccc taacaggggc cctctcagcc ctcctaatga cctccggcct
9301 agccatgtga tttcacttcc actccataac gctcctcata ctaggcctac taaccaacac
9361 actaaccata taccaatgat ggcgcgatgt aacacgagaa agcacatacc aaggccacca
9421 cacaccacct gtccaaaaag gccttcgata cgggataatc ctatttatta cctcagaagt
9481 ttttttcttc gcaggatttt tctgagcctt ttaccactcc agcctagccc ctacccccca
9541 attaggaggg cactggcccc caacaggcat caccccgcta aatcccctag aagtcccact
9601 cctaaacaca tccgtattac tcgcatcagg agtatcaatc acctgagctc accatagtct
9661 aatagaaaac aaccgaaacc aaataattca agcactgctt attacaattt tactgggtct
9721 ctattttacc ctcctacaag cctcagagta cttcgagtct cccttcacca tttccgacgg
9781 catctacggc tcaacatttt ttgtagccac aggcttccac ggacttcacg tcattattgg
9841 ctcaactttc ctcactatct gcttcatccg ccaactaata tttcacttta catccaaaca
9901 tcactttggc ttcgaagccg ccgcctgata ctggcatttt gtagatgtgg tttgactatt
9961 tctgtatgtc tccatctatt gatgagggtc ttactctttt agtataaata gtaccgttaa
10021 cttccaatta actagttttg acaacattca aaaaagagta ataaacttcg ccttaatttt
10081 aataatcaac accctcctag ccttactact aataattatt acattttgac taccacaact
10141 caacggctac atagaaaaat ccacccctta cgagtgcggc ttcgacccta tatcccccgc
10201 ccgcgtccct ttctccataa aattcttctt agtagctatt accttcttat tatttgatct
10261 agaaattgcc ctccttttac ccctaccatg agccctacaa acaactaacc tgccactaat
10321 agttatgtca tccctcttat taatcatcat cctagcccta agtctggcct atgagtgact
10381 acaaaaagga ttagactgaa ccgaattggt atatagttta aacaaaacga atgatttcga
10441 ctcattaaat tatgataatc atatttacca aatgcccctc atttacataa atattatact
10501 agcatttacc atctcacttc taggaatact agtatatcgc tcacacctca tatcctccct
10561 actatgccta gaaggaataa tactatcgct gttcattata gctactctca taaccctcaa
10621 cacccactcc ctcttagcca atattgtgcc tattgccata ctagtctttg ccgcctgcga
10681 agcagcggtg ggcctagccc tactagtctc aatctccaac acatatggcc tagactacgt
10741 acataaccta aacctactcc aatgctaaaa ctaatcgtcc caacaattat attactacca
10801 ctgacatgac tttccaaaaa acacataatt tgaatcaaca caaccaccca cagcctaatt
10861 attagcatca tccctctact attttttaac caaatcaaca acaacctatt tagctgttcc
10921 ccaacctttt cctccgaccc cctaacaacc cccctcctaa tactaactac ctgactccta
10981 cccctcacaa tcatggcaag ccaacgccac ttatccagtg aaccactatc acgaaaaaaa
11041 ctctacctct ctatactaat ctccctacaa atctccttaa ttataacatt cacagccaca
11101 gaactaatca tattttatat cttcttcgaa accacactta tccccacctt ggctatcatc
11161 acccgatgag gcaaccagcc agaacgcctg aacgcaggca catacttcct attctacacc
11221 ctagtaggct cccttcccct actcatcgca ctaatttaca ctcacaacac cctaggctca
11281 ctaaacattc tactactcac tctcactgcc caagaactat caaactcctg agccaacaac
11341 ttaatatgac tagcttacac aatagctttt atagtaaaga tacctcttta cggactccac
11401 ttatgactcc ctaaagccca tgtcgaagcc cccatcgctg ggtcaatagt acttgccgca
11461 gtactcttaa aactaggcgg ctatggtata atacgcctca cactcattct caaccccctg
11521 acaaaacaca tagcctaccc cttccttgta ctatccctat gaggcataat tataacaagc
11581 tccatctgcc tacgacaaac agacctaaaa tcgctcattg catactcttc aatcagccac
11641 atagccctcg tagtaacagc cattctcatc caaaccccct gaagcttcac cggcgcagtc
11701 attctcataa tcgcccacgg gcttacatcc tcattactat tctgcctagc aaactcaaac
11761 tacgaacgca ctcacagtcg catcataatc ctctctcaag gacttcaaac tctactccca
11821 ctaatagctt tttgatgact tctagcaagc ctcgctaacc tcgccttacc ccccactatt
11881 aacctactgg gagaactctc tgtgctagta accacgttct cctgatcaaa tatcactctc
11941 ctacttacag gactcaacat actagtcaca gccctatact ccctctacat atttaccaca
12001 acacaatggg gctcactcac ccaccacatt aacaacataa aaccctcatt cacacgagaa
12061 aacaccctca tgttcataca cctatccccc attctcctcc tatccctcaa ccccgacatc
12121 attaccgggt tttcctcttg taaatatagt ttaaccaaaa catcagattg tgaatctgac
12181 aacagaggct tacgacccct tatttaccga gaaagctcac aagaactgct aactcatgcc
12241 cccatgtcta acaacatggc tttctcaact tttaaaggat aacagctatc cattggtctt
12301 aggccccaaa aattttggtg caactccaaa taaaagtaat aaccatgcac actactataa
12361 ccaccctaac cctgacttcc ctaattcccc ccatccttac caccctcgtt aaccctaaca
12421 aaaaaaactc atacccccat tatgtaaaat ccattgtcgc atccaccttt attatcagtc
12481 tcttccccac aacaatattc atgtgcctag accaagaagt tattatctcg aactgacact
12541 gagccacaac ccaaacaacc cagctctccc taagcttcaa actagactac ttctccataa
12601 tattcatccc tgtagcattg ttcgttacat ggtccatcat agaattctca ctgtgatata
12661 taaactcaga cccaaacatt aatcagttct tcaaatatct actcatcttc ctaattacca
12721 tactaatctt agttaccgct aacaacctat tccaactgtt catcggctga gagggcgtag
12781 gaattatatc cttcttgctc atcagttgat gatacgcccg agcagatgcc aacacagcag
12841 ccattcaagc aatcctatac aaccgtatcg gcgatatcgg tttcatcctc gccttagcat
12901 gatttatcct acactccaac tcatgagacc cacaacaaat agcccttcta aacgctaatc
12961 caagcctcac cccactacta ggcctcctcc tagcagcagc aggcaaatca gcccaattag
13021 gtctccaccc ctgactcccc tcagccatag aaggccccac cccagtctca gccctactcc
13081 actcaagcac tatagttgta gcaggaatct tcttactcat ccgcttccac cccctagcag
13141 aaaatagccc actaatccaa actctaacac tatgcttagg cgctatcacc actctgttcg
13201 cagcagtctg cgcccttaca caaaatgaca tcaaaaaaat cgtagccttc tccacttcaa
13261 gtcaactagg actcataata gttacaatcg gcatcaacca accacaccta gcattcctgc
13321 acatctgtac ccacgccttc ttcaaagcca tactatttat gtgctccggg tccatcatcc
13381 acaaccttaa caatgaacaa gatattcgaa aaataggagg actactcaaa accatacctc
13441 tcacttcaac ctccctcacc attggcagcc tagcattagc aggaatacct ttcctcacag
13501 gtttctactc caaagaccac atcatcgaaa ccgcaaacat atcatacaca aacgcctgag
13561 ccctatctat tactctcatc gctacctccc tgacaagcgc ctatagcact cgaataattc
13621 ttctcaccct aacaggtcaa cctcgcttcc ccacccttac taacattaac gaaaataacc
13681 ccaccctact aaaccccatt aaacgcctgg cagccggaag cctattcgca ggatttctca
13741 ttactaacaa catttccccc gcatccccct tccaaacaac aatccccctc tacctaaaac
13801 tcacagccct cgctgtcact ttcctaggac ttctaacagc cctagacctc aactacctaa
13861 ccaacaaact taaaataaaa tccccactat gcacatttta tttctccaac atactcggat
13921 tctaccctag catcacacac cgcacaatcc cctatctagg ccttcttacg agccaaaacc
13981 tgcccctact cctcctagac ctaacctgac tagaaaagct attacctaaa acaatttcac
14041 agcaccaaat ctccacctcc atcatcacct caacccaaaa aggcataatt aaactttact
14101 tcctctcttt cttcttccca ctcatcctaa ccctactcct aatcacataa cctattcccc
14161 cgagcaatct caattacaat atatacacca acaaacaatg ttcaaccagt aactactact
14221 aatcaacgcc cataatcata caaagccccc gcaccaatag gatcctcccg aatcaaccct
14281 gacccctctc cttcataaat tattcagctt cctacactat taaagtttac cacaaccacc
14341 accccatcat actctttcac ccacagcacc aatcctacct ccatcgctaa ccccactaaa
14401 acactcacca agacctcaac ccctgacccc catgcctcag gatactcctc aatagccatc
14461 gctgtagtat aaccaaagac aaccatcatt ccccctaaat aaattaaaaa aactattaaa
14521 cccatataac ctcccccaaa attcagaata ataacacacc cgaccacacc gctaacaatc
14581 aatactaaac ccccataaat aggagaaggc ttagaagaaa accccacaaa ccccattact
14641 aaacccacac tcaacagaaa caaagcatac atcattattc tcgcacggac tacaaccacg
14701 accaatgata tgaaaaacca tcgttgtatt tcaactacaa gaacaccaat gaccccaata
14761 cgcaaaacta accccctaat aaaattaatt aaccactcat tcatcgacct ccccacccca
14821 tccaacatct ccgcatgatg aaacttcggc tcactccttg gcgcctgcct gatcctccaa
14881 atcaccacag gactattcct agccatgcac tactcaccag acgcctcaac cgccttttca
14941 tcaatcgccc acatcactcg agacgtaaat tatggctgaa tcatccgcta ccttcacgcc
15001 aatggcgcct caatattctt tatctgcctc ttcctacaca tcgggcgagg cctatattac
15061 ggatcatttc tctactcaga aacctgaaac atcggcatta tcctcctgct tgcaactata
15121 gcaacagcct tcataggcta tgtcctcccg tgaggccaaa tatcattctg aggggccaca
15181 gtaattacaa acttactatc cgccatccca tacattggga cagacctagt tcaatgaatc
15241 tgaggaggct actcagtaga cagtcccacc ctcacacgat tctttacctt tcacttcatc
15301 ttgcccttca ttattgcagc cctagcagca ctccacctcc tattcttgca cgaaacggga
15361 tcaaacaacc ccctaggaat cacctcccat tccgataaaa tcaccttcca cccttactac
15421 acaatcaaag acgccctcgg cttacttctc ttccttctct ccttaatgac attaacacta
15481 ttctcaccag acctcctagg cgacccagac aattataccc tagccaaccc cttaaacacc
15541 cctccccaca tcaagcccga atgatatttc ctattcgcct acacaattct ccgatccgtc
15601 cctaacaaac taggaggcgt ccttgcccta ttactatcca tcctcatcct agcaataatc
15661 cccatcctcc atatatccaa acaacaaagc ataatatttc gcccactaag ccaatcactt
15721 tattgactcc tagccgcaga cctcctcatt ctaacctgaa tcggaggaca accagtaagc
15781 taccctttta ccatcattgg acaagtagca tccgtactat acttcacaac aatcctaatc
15841 ctaataccaa ctatctccct aattgaaaac aaaatactca aatgggcctg tccttgtagt
15901 ataaactaat acaccagtct tgtaaaccgg agatgaaaac ctttttccaa ggacaaatca
15961 gagaaaaagt ctttaactcc accattagca cccaaagcta agattctaat ttaaactatt
16021 ctctgttctt tcatggggaa gcagatttgg gtaccaccca agtattgact cacccatcaa
16081 caaccgctat gtatttcgta cattactgcc agccatcatg aatattgtac ggtaccataa
16141 atacttgacc acctgtagta cataaaaacc caatccacat caaaaccccc tccccatgct
16201 tacaagcaag tacagcaatc aaccctcaac tatcacacat caactgcaac tccaaagcca
16261 cccctcaccc actaggatac caacaaacct acccaccctt aacagtacat agtacataaa
16321 accatttacc gtacatagca cattacagtc aaatcccttc tcgtccccat ggatgacccc
16381 cctcagatag gggtcccttg accaccatcc tccgtgaaat caatatcccg cacaagagtg
16441 ctactctcct cgctccgggc ccataacact tgggggtagc taaagtgaac tgtatccgac
16501 atctggttcc tacttcaggg ccataaagcc taaatagccc acacgttccc cttaaataag
16561 acatcacgat g
//
TIKUS

LOCUS JX426131 587 bp DNA linear ROD 02-OCT-


2015
DEFINITION Rattus rattus isolate ECHI-M9 cytochrome c oxidase subunit 1
(CO1)
gene, partial cds; mitochondrial.
ACCESSION JX426131
VERSION JX426131.1
KEYWORDS .
SOURCE mitochondrion Rattus rattus (black rat)
ORGANISM Rattus rattus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;
Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 587)
AUTHORS Echi,P.C., Suresh,K.U., George,S., Ratheesh,R.V., Vinitha,M.R.,
Ejere,V.C., Iyaji,F.O. and Nnamonu,E.I.
TITLE Contribution towards the development of a DNA barcode reference
library for West African mammals
JOURNAL Afr. J. Biotechnol. 12 (48), 6704-6708 (2013)
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 587)
AUTHORS Echi,P.C., Suresh,K.U., George,S., Ratheesh,R.V., Vinitha,M.R.,
Ejere,V.C., Iyaji,F.O. and Nnamonu,E.I.
TITLE Direct Submission
JOURNAL Submitted (25-JUL-2012) Regional Facility for DNA
Fingerprinting
(RFDF), Rajiv Gandhi Centre for Biotechnology (RGCB), Thycaud
P.O.,
Poojappura, Thiruvananthapuram, Kerala 695 014, India
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..587
/organism="Rattus rattus"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="ECHI-M9"
/db_xref="taxon:10117"
gene <1..>587
/gene="CO1"
CDS <1..>587
/gene="CO1"
/codon_start=3
/transl_table=2
/product="cytochrome c oxidase subunit 1"
/protein_id="AFU82522.1"

/translation="VGTALSILIRAELGQPGALLGDDQIYNVIVTAHAFVMIFFMVMP

MMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYP

PLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSV
LITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPA"
ORIGIN
1 tagtagggac agctttaagt attctaattc gagctgaact aggacagcca ggcgcactcc
61 taggagatga ccaaatctat aatgtcatcg tcacagccca tgcattcgta ataattttct
121 ttatagtaat acctataata attggaggct tcgggaactg acttgtacca ctaataattg
181 gagcccctga tatagcattc ccacgaataa ataacataag cttttgactg cttcctccat
241 catttctact ccttttagca tcctccatag tagaagctgg agctggaaca ggatgaacag
301 tatacccccc cttagccgga aacctagccc atgctggagc atccgtagat ttaactattt
361 tttccctcca cctagccggg gtgtcttcta tcttaggagc tatcaacttt atcaccacta
421 tcattaatat aaaaccccct gctataaccc aatatcagac acctctcttt gtatgatccg
481 tactaattac agccgtccta ctacttctct cactgccagt attagcagca ggtatcacta
541 tactccttac agaccgaaat ctaaatacta ctttcttcga ccccgct
FASTA

>JX426131.1 Rattus rattus isolate ECHI-M9 cytochrome c oxidase subunit 1


(CO1) gene, partial cds; mitochondrial
TAGTAGGGACAGCTTTAAGTATTCTAATTCGAGCTGAACTAGGACAGCCAGGCGCACTCCTAGGAGATGA
CCAAATCTATAATGTCATCGTCACAGCCCATGCATTCGTAATAATTTTCTTTATAGTAATACCTATAATA
ATTGGAGGCTTCGGGAACTGACTTGTACCACTAATAATTGGAGCCCCTGATATAGCATTCCCACGAATAA
ATAACATAAGCTTTTGACTGCTTCCTCCATCATTTCTACTCCTTTTAGCATCCTCCATAGTAGAAGCTGG
AGCTGGAACAGGATGAACAGTATACCCCCCCTTAGCCGGAAACCTAGCCCATGCTGGAGCATCCGTAGAT
TTAACTATTTTTTCCCTCCACCTAGCCGGGGTGTCTTCTATCTTAGGAGCTATCAACTTTATCACCACTA
TCATTAATATAAAACCCCCTGCTATAACCCAATATCAGACACCTCTCTTTGTATGATCCGTACTAATTAC
AGCCGTCCTACTACTTCTCTCACTGCCAGTATTAGCAGCAGGTATCACTATACTCCTTACAGACCGAAAT
CTAAATACTACTTTCTTCGACCCCGCT
LUTUNG JAWA

LOCUS KY117596 16651 bp DNA linear PRI 30-AUG-


2017
DEFINITION Trachypithecus auratus mitochondrion, partial genome.
ACCESSION KY117596
VERSION KY117596.1
KEYWORDS .
SOURCE mitochondrion Trachypithecus auratus (Javan langur)
ORGANISM Trachypithecus auratus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;
Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Cercopithecidae; Colobinae; Trachypithecus.
REFERENCE 1 (bases 1 to 16651)
AUTHORS Mohd Salleh,F., Ramos-Madrigal,J., Penaloza,F., Liu,S.,
Mikkel-Holger,S.S., Riddhi,P.P., Martins,R., Lenz,D.,
Fickel,J.,
Roos,C., Shamsir,M.S., Azman,M.S., Burton,K.L., Stephen,J.R.,
Wilting,A. and Gilbert,M.T.P.
TITLE An expanded mammal mitogenome dataset from Southeast Asia
JOURNAL Gigascience 6 (8), 1-8 (2017)
PUBMED 28873965
REFERENCE 2 (bases 1 to 16651)
AUTHORS Mohd Salleh,F., Penaloza Figueroa,F., Ross,C., Martins,R.,
Patel,R., Gilbert,M.T.P. and Wilting,A.
TITLE Mitogenome Sequences for South-East-Asian Species
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 16651)
AUTHORS Mohd Salleh,F., Penaloza Figueroa,F., Ross,C., Martins,R.,
Patel,R., Gilbert,M.T.P. and Wilting,A.
TITLE Direct Submission
JOURNAL Submitted (07-NOV-2016) Junior Research Group: Biodiversity and
Biogeography of Southeast Asia, Leibniz Institute for Zoo and
Wildlife Research (IZW), Alfred Kowalke Strasse 17, Berlin
10315,
Germany
COMMENT ##Assembly-Data-START##
Assembly Method :: MITOmaker v. 1.14
Sequencing Technology :: Sanger dideoxy sequencing; Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..16651
/organism="Trachypithecus auratus"
/organelle="mitochondrion"
/mol_type="genomic DNA"
/isolate="A8A42277"
/db_xref="taxon:222416"
tRNA 1..72
/product="tRNA-Phe"
rRNA 73..1029
/product="12S ribosomal RNA"
tRNA 1030..1098
/product="tRNA-Val"
rRNA 1099..2678
/product="16S ribosomal RNA"
tRNA 2679..2753
/product="tRNA-Leu"
/note="codons recognized: UUR"
gene 2756..3710
/gene="ND1"
CDS 2756..3710
/gene="ND1"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:3710,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 1"
/protein_id="ARC95532.1"

/translation="MFTMNILLVTLPAIAAMAFLTLTERKLLGYMQLRKGPNIVGPYG

LLQPFADAVKLFTKEPLKPSTSTITLYVIAPALAFIIALLLWMPLPMPNPLINLNLGL

LFILATSSLAVHSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSILLMSGSF

NLHTLITTQEHLWLLLPSWPLAMMWFTSTLAETNRAPFDLTEGESELVSGFNTEYAAG

PFALFFMAEYMNIIMMNALTATIFLGTLYPIHSPELFTTCFITKTLLLTSLFLWIRAT
YPRFRYDQLMHLLWKNFLPLTLAFLMWYISIFIMTSGIPPQI"
tRNA 3711..3780
/product="tRNA-Ile"
tRNA complement(3778..3849)
/product="tRNA-Gln"
tRNA 3851..3919
/product="tRNA-Met"
gene 3920..4961
/gene="ND2"
CDS 3920..4961
/gene="ND2"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:4961,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 2"
/protein_id="ARC95533.1"

/translation="MNPLAQLIIYSTMFMGTIITLLSSHWFLAWAGLEMNMLAFTSIL

IKKTSSRSTEAATKYFLVQSTASMVLMMAIMYNNLFPEQWTMLNNINQLSSLAMTMAL

AMKLGMAPFHFWVPEVTQGTPLISGLLLLTWQKLAPISIMYQICSSVSTSMLLILSIL

SIMVGSWGGLNQTQLRKILAYSSITHMGWMMTTLTYNPNITIFYLLTYIILTTTAFLA

LNLNSNTTTLMLSHTWNKLTWLLPLMSSTLLSMGGLPPLTGFLPKWVTIQELTKNNNF

IMPTIMIIMTLLNLYFYLRLIYITSMTLLPASNNTKMKWQFENTKTTLLIPPLIILTT
FLLPVSPTILTIP"
tRNA 4962..5030
/product="tRNA-Trp"
tRNA complement(5039..5107)
/product="tRNA-Ala"
tRNA complement(5109..5181)
/product="tRNA-Asn"
rep_origin 5183..5215
tRNA complement(5214..5282)
/product="tRNA-Cys"
tRNA complement(5282..5348)
/product="tRNA-Tyr"
gene 5366..6910
/gene="COX1"
CDS 5366..6910
/gene="COX1"
/codon_start=1
/transl_table=2
/product="cytochrome c oxidase subunit I"
/protein_id="ARC95534.1"

/translation="MLINRWLFSTNHKDIGTLYLLFGAWAGTVGMAMSLLIRAELGQP

GNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRLNNMSF

WLLPPSFLLLLASAMVEAGAGTGWTVYPPLAGNLSHPGASVDLTIFSLHLAGISSILG

AINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTT

FFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWA

MVSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKW

SAAMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGG

FIHWFPLFSGYTLDQVCAKAHFTIMFVGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTW

NIVSSTGSFMSLVAMLLMIYMIWEAFASKRKVLSIEQPAYNLEWLHGSPPPYHTFDEP
TFIKVK"
tRNA complement(6908..6976)
/product="tRNA-Ser"
/note="codons recognized: UCN"
tRNA 6980..7047
/product="tRNA-Asp"
gene 7049..7732
/gene="COX2"
CDS 7049..7732
/gene="COX2"
/codon_start=1
/transl_table=2
/product="cytochrome c oxidase subunit II"
/protein_id="ARC95535.1"

/translation="MAHPVQLGLQDATSPIMEELIAFHDHAFMIVSLISFLVLYILLS

VLTTKLTSTNITDAQEMETIWTILPAIILVLIALPSLRILYLTDEINNPSFTIKSIGH

QWYWTYEYTDYGGLIFNSYMLPPLFLNPGDLRLLEVDNRVVLPIEAPVRMMITSQDVL

HSWTIPTLGLKTDAIPGRLNQTTFTAMRPGVYYGQCSEICGANHSFMPIVAELIPLKI
FEMGPVFTL"
tRNA 7798..7864
/product="tRNA-Lys"
gene 7866..8072
/gene="ATP8"
CDS 7866..8072
/gene="ATP8"
/codon_start=1
/transl_table=2
/product="ATP synthase F0 subunit 8"
/protein_id="ARC95536.1"
/translation="MPQLNTSTWLITIMTMLPALYLIMQLKLLNTNYYLPPSQKIPNT
QVFNNPWQLKWTKIYLPHLQPQHS"
gene 8027..8710
/gene="ATP6"
CDS 8027..8710
/gene="ATP6"
/codon_start=1
/transl_table=2
/product="ATP synthase F0 subunit 6"
/protein_id="ARC95537.1"

/translation="MNENLFTPFTTPTLLNLPAVVPIILFPALLFPTSKHLVNNRLIT

IQQSLTQLILKQMMMIHSTKGRTWSLMLMSLIIFIATTNLLGLLPYSFTPTAQLSMNL

AMAIPLWAGTVITGLRFKTKSSLAHFLPQGTPTLLIPMLVIIETISLLIQPVALAVRL

TANITAGHLLMHLIGSAVLALLTINFFATSLTFMLLLLXLTILEIAVALIQAYVFTLL
VSLYLHDNT"
gene 8710..9493
/gene="COX3"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
CDS 8710..9493
/gene="COX3"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:9493,aa:TERM)
/transl_table=2
/product="cytochrome c oxidase subunit III"
/protein_id="ARC95538.1"

/translation="MTHQTHPYHMVKPSPWPLTGAFSALLMTSGLIMWFHFYSMTLLM

LGLLTNMLTMYQWWRDIVRESTYQGHHTTPVQKGLRYGMVLFIISEVFFFAGFFWAFY

HSSLAPTPHLGGHWPPTGITPLNPLEVPLLNTSVLLASGVTITWAHHSLMENNRKQMI

QALLITILLGIYFTLLQVSEYYEAPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTVC
LIRQLLYHFTSKHHFGFEAAAWYWHFVDVVWLFLYISIYWWGS"
tRNA 9494..9561
/product="tRNA-Gly"
gene 9562..9907
/gene="ND3"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
CDS 9562..9907
/gene="ND3"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:9907,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 3"
/protein_id="ARC95539.1"
/translation="MNLMLALTINTFLTLLLMIIMFWLPLLNTYAEKADPYECGFDPL

NSARIPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPVMIKSSMMLIIILTLGL
AYEWTQKGLDWTE"
tRNA 9908..9972
/product="tRNA-Arg"
gene 9973..10269
/gene="ND4L"
CDS 9973..10269
/gene="ND4L"
/codon_start=1
/transl_table=2
/product="NADH dehydrogenase subunit 4L"
/protein_id="ARC95540.1"

/translation="MPVIYMNIMLAFLISLLGMLIYRSHLMSSLLCLEGMMLSLFIMS

TLMALNMHFPLANIVPIALLVFAACEAAVGLALLVSISNMYGLDYIHNLSLLQC"
gene 10263..11640
/gene="ND4"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
CDS 10263..11640
/gene="ND4"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:11640,aa:TERM)
/transl_table=2
/product="NADH dehydrogenase subunit 4"
/protein_id="ARC95541.1"

/translation="MLKMILPTIMLLPTTWFSKNSMLWINLTMHSLVISLIPLMFFNQ

ANNNLTSYSTYLSSDPLSTPLLTLTAWLLPLMIMASQYHLHNESPLWKKLYLSMMIFL

QISLIMTFMSTELILFYISFETTLVPTLIIITRWGNQAERLNASTYFLFYTLAGSLPL

LIMLVFMYNNTGSLNIVLLTLTAQELMSTWSHNLIWLACMMAFMVKMPLYGLHLWLPK

AHVEAPIAGSMVLAAVLLKLGGYGMMRLTSILNPLTEYMAYPFLMLSLWGMIMTSSIC

LRQTDLKSLIAYSSVSHMALVIMASLIQTPWSFTGAIILMIAHGLTSSMLFCLANSNY

ERTHSRIMLLSRGLQILLPLMAFWWFAANLTNLALPPTINLIGELLVVTTSFSWSHVT

IMLTGLNMLITALYSLHMFITTQRGVLTPHIMNMKPSFTRENMLMFMHISPIILLSLN
PNIIMGFTS"
tRNA 11641..11710
/product="tRNA-His"
tRNA 11711..11769
/product="tRNA-Ser"
/note="codons recognized: AGY"
tRNA 11770..11840
/product="tRNA-Leu"
/note="codons recognized: CUN"
gene 11847..13652
/gene="ND5"
CDS 11847..13652
/gene="ND5"
/codon_start=1
/transl_table=2
/product="NADH dehydrogenase subunit 5"
/protein_id="ARC95542.1"

/translation="MHASIIMLTLTYLMFPIITTLIKPSKNHLYPNYVKTTMMFAFIF

SLFPMTLYILLDQDMIISNWHWTTIQSLELTLSFKLDYFSMMFTPIALFITWCIMEFS

LWYMSSDPNINQFFKYLLIFLITMLILITANNLFQLFIGWEGVGIMSFLLIGWWHART

DANTAATQAILYNRVGDIGFILTMAWFLLHYNSWDLQQMFILDSNPNLLPLMGLLLAA

MGKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFHPLMENNMLIQSLTL

CLGAITTLFMAICALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFK

AMLFICSGSIIHNLNNEQDIRKMGGLFKMMPLTSTSLTIGNLALTGMPFLTGFYSKDL

IIETANTSYTNAWALSTTLIATSLTSAYSTRTIILALTGQPRFSTSVHINENNPALLN

PMKRLTLGSLLAGFLITNNIFPTTPPQLTMPYYLKLLALCVTILGFLMALDLTLMANN

LKMSTPSHMFKFSNMLGYFPITIHRMIPYQNLIMSQNLAFILLDSFWLEKLMPKTISH
VHTTTSITITTQKGMIKFYFLSFLIPLILVMLLTM"
gene complement(13653..14180)
/gene="ND6"
CDS complement(13653..14180)
/gene="ND6"
/codon_start=1
/transl_table=2
/product="NADH dehydrogenase subunit 6"
/protein_id="ARC95543.1"

/translation="MSYILFLLSVLLVMGFVGFSSKPSPIYGGLALIISGVVGCVIIL

NYGGTYMGLMMFLIYLGGMMVVFGYTTAMAIEEYPEAWVSGFEVLGSFLVGLAMEVGL

ILWVLDYGELVXXMVNLNNMGSWVVFEGEGSGLIREDSIGAGALYDYGRWLVVVAGWT
LFVGVYIVIEITRGN"
tRNA complement(14181..14250)
/product="tRNA-Glu"
gene 14255..15395
/gene="CYTB"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
CDS 14255..15395
/gene="CYTB"
/note="TAA stop codon is completed by the addition of
3' A
residues to the mRNA"
/codon_start=1
/transl_except=(pos:15395,aa:TERM)
/transl_table=2
/product="cytochrome b"
/protein_id="ARC95544.1"

/translation="MAPLRKSNPVMKMINHSLIDLPTPSNISTWWNFGSLLATCLTLQ
IITGLFLAMHYSPDTSSAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHVGRGL

YYGSFLLTETWNIGIALLLMIMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNL

VQWVWGGYSIDNPTLTRFFTLHFTLPFIIATLTALHLLFLHETGSNNPCGIPSNSDKI

PFHPYYTIKDILGLIFLLLILMTLVLFSPDLLSDPDNYTPANPLNTPPHIKPEWYFLF

AYAILRSVPNKLGGVLALLLSILILAIMPMLHKSKQQSMAFRPLSQLLLWLLITTLLT
LTWIGSQPVNQPFIMIGQVASMMYFATILILMPLASLIENNLLKWT"
tRNA 15396..15466
/product="tRNA-Thr"
tRNA complement(15469..15536)
/product="tRNA-Pro"
D-loop 15537..16651
ORIGIN
1 gtttatgtag cttanattta tccaaagcaa gacactgaaa atgtctagat ggacccacaa
61 atcccataaa caaataggtt tggtcccggc ctttctatta acttctagca agattacaca
121 tgcaagcatc cccgccccgg tgaagacacc ctacaaatca ctatgattaa aaggagtaag
181 tatcaagcac gcttaatgca gctcaagaca ctttgcttag ccacaccccc acgggaaaca
241 gcagtgacta atatttagct ataaacgaaa gtttaactaa gctatgctat ntatagggtt
301 ggtcaatttc gtgccagcca ccgcggccat acgattgacc cgagctaata gacctcggcg
361 taaagagtgt tttagataaa cccaactaaa taaagctaaa ctctttctaa actgtaaaac
421 cctagccaat gtaaaataaa ctacgaaagt ggctttnaaa atttctgaac acactatagc
481 taagattcaa actgggatta gagaccccac tatgcttagc cctaaacttc aatagttaaa
541 ataacaaaac tactcgccag aacactacaa gcaacagctt aaaaatcaaa ggacttggcg
601 gtgctccata nccccctaga ggagcctgtt ctataatcga taaaccccga tccaccctac
661 catctctcgc tcagcctata taccgccatc ttcagcaaac ctcaacaaga gatatgaagt
721 aagcacaaat gcccannnnn cgcaaaaacg ttaggtcaag gtgtagccta tgagctggga
781 aaaaatgggc tacattttct attacagaaa antctacgat aactcttatg aaacttaaga
841 gtccaaggag gatttagcag taaactaaga atagagtgct tagttgaact aggccatgaa
901 gcatgcacac accgcccgtc gctctcctca aatataatta agggttaact taactaaaca
961 ctcctatatt tatatagagg agataagtcg taacatggta agtgtactgg aaggtgcact
1021 tggataaatc aaggtatagc tcaatacaaa gcatcctgct tacacccgga agatatcaac
1081 attatttgat taccttgagc caacactagc ccaaaaannc ncaatcagta ctactaccaa
1141 ataaatatat aaatattaaa tcattcacaa atataaaagt ataggtgata gaaagtttac
1201 tctggcgcta tagacacagt accgcaaggg aaagatgaaa aaaaaaagac taagcacaaa
1261 atagcaagga cttaccccta taccttctgc ataatgagcc agctagagat tatttcgcaa
1321 agagaactan aagccaaaca ccccgaaacc agacgagcta cccaaaaaca gctaaaagag
1381 cacacccgtc tatgtggcaa aatagtggga agatttttga gtagaggcga tacacccacc
1441 gagcctggcg atagctggtt atccaagata gaatcttagt tcaaccttaa gcctacccgc
1501 agaaccancc aatccccctg taagcttaat tgttagtcta aagagggaca gctccttaga
1561 cactaggaaa aaaccttata tagagagtaa aannanttcc agcccccata gttggcctaa
1621 aagcagccat caattaagaa agcgttaaag ctcaacatta agcacccaaa gaaatttcaa
1681 acatttaact gaactcctaa catcacattg gattaatcta tcatattata gaagtaataa
1741 tgctagtatt agtaacatga ataaattctc ctacgcataa gcctaaatcg gaccgaaaac
1801 ctcaccgata tttaacagcc aaatactaat aatcataaac aagccagtat tactagtact
1861 gttaacccaa cacaggcatg ctatcaagga aaggttaaaa gaagtaaaag gaactcggca
1921 aantataacc ccgcctgttt accaaaaaca tcacctctag cattactagt attagaggca
1981 ctgcctgccc agtgacacat gtttaacggc cgcggtaccc tgaccgtgca aaggtagcat
2041 aatcacttgt tctttaaata gggacttgta tgaatggcaa cacgagggtt taactgtctc
2101 ttacttccaa ccagtgaaat tgacctgccc gtgaagaggc gggcataaaa caataagacg
2161 agaagaccct gcggagcttc aatttacnca atgcaatcat aatnaacata agcctatggg
2221 tttaacatan tcctgacact gcatttataa ttttggttgg ggtgacctcg gagcatagcc
2281 aaacctccga acagactatg ccaagactga acaagttaaa gcgaactaat acttacaatt
2341 gacccaataa tttgatcaac ggaataagtt accccaggga taacagcgca atcctattcc
2401 agagtccata tcgacaatag ggtttacgac ctcgatgttg gatcaggaca tcctaatggt
2461 gcagcagcta tcaagggttc gtttgttcaa cgattaaagt cctacgtgat ctgagttcag
2521 accggagtaa tccaggtcgg tttctatcta ttctacattt ctccctgtac gaaaggacaa
2581 gagaaataag gcctacttca tannaagtgc cttccttcca taaatgatct aatctcaatt
2641 taacaaaaaa ctacatatat aacccaagag cagggcttgt taagatggca gagcccggca
2701 attgcataaa acttaagact ttataatcag aggttcaact cctcttctta acaccatgtt
2761 cacaataaac attctacttg tcactttacc tgcgattgct gccatagcat ttcttacact
2821 taccgaacga aaactactag gctacataca attacgcaaa ggacccaaca ttgtaggacc
2881 ctatgggtta ctacaaccct ttgccgacgc agtaaaactc ttcaccaaag aaccgttaaa
2941 accttcaact tccactatta ctctttatgt tattgcacca gccttagcct ttatcattgc
3001 ccttctctta tgaatacctc tccctatgcc caatccccta attaatctca acctaggact
3061 tttatttatt ctagccacat ctagcctagc cgtccactct attttatgat caggatgagc
3121 atcaaactca aattatgcac taatcggagc actacgagca gtagcccaga caatttcata
3181 tgaagtaacc ctcgccatca ttttactgtc aattctacta ataagcggct catttaatct
3241 ccatacactc attacaacac aagaacacct ctgacttctc ttaccatcat gacctctagc
3301 cataatatga ttcacttcca cattagcaga gaccaaccga gcccctttcg acctaacaga
3361 aggggagtcc gaactagtct cagggtttaa cactgagtat gctgcaggcc cgtttgccct
3421 tttcttcata gctgaatata taaatatcat tataataaat gccctaacag ccacaatttt
3481 cctgggaaca ttatatccca ttcactcacc agaattgttc acaacatgct ttattactaa
3541 aacacttctc ttaacatccc tattcctatg aattcgagca acctaccctc gtttccgcta
3601 cgatcaactc atacatctcc tatgaaaaaa ttttcttccc cttacactag cattcctcat
3661 atgatatatc tcaattttca tcataacctc tggcatcccc cctcaaatct agaaatatgt
3721 ctgacaaaag agttactttg atggagtaaa taatagaggt acttaatcct cttatttcta
3781 gaattatagg catcgaacct actcctgaga attcaaattc ctccgtgcta cctaccacac
3841 ctcattctaa agtaaggtca gctnaaataa gctatcgggc ccataccccg aaaatgttgg
3901 ttatatcctt cccgtactaa ttaacccact agcccaactt attatttatt ctaccatatt
3961 tataggcact attattacat tattgagctc ccactgattt ctagcctgag cgggtctaga
4021 aataaatata ctagccttta cctctatctt aattaaaaaa acaagctctc gctccacaga
4081 agccgccact aaatatttcc ttgtacaatc tactgcatct atagtcctca taatagcaat
4141 tatatataac aacctgtttc ccgaacaatg aactatgtta aataatatta atcaactttc
4201 atctttagcc ataacaatgg ccctcgctat aaaattagga atagccccct ttcacttctg
4261 agtcccagaa gttacccaag gaacaccttt aatttctggt ctacttctcc tcacatgaca
4321 aaaactagcc cccatctcaa ttatgtacca aatttgctca tcagttagta caagtatact
4381 cctaattcta tccatcctat ccatcatagt aggtagctga ggaggtctta accaaacaca
4441 actacgtaaa attttagcat actcttcaat cacccatata ggctgaataa taacaacctt
4501 aacatacaat ccaaatatta caatttttta tctcctcaca tatattattt taacaaccac
4561 tgcatttcta gctctaaacc taaactcgaa caccacaacc ctaatattat cacacacctg
4621 aaataaactc acctgattat taccactaat atcatccacc ctcctatcta taggaggcct
4681 acccccacta accggctttc tacccaaatg agttactatc caagaactta caaaaaataa
4741 taacttcatt atacctacca ttataattat tataacccta ctaaacttat atttttattt
4801 acgcctaatt tatattacct ctataacact acttcctgca tccaataata caaaaataaa
4861 atgacaattc gaaaatacaa aaaccacact actcatcccc ccacttatta tccttactac
4921 cttcctatta cctgtatccc caacaatcct aaccatcccc tagaaattta ggttaaatan
4981 agaccgaaag ccttcaaagc tcttagtaag ttaagtatac ttaatttctg aaatatatta
5041 aggactacag aaccttattc cgcatcaact gaatgcaaat cagttacttt aattaagcta
5101 agcccttact agattaatgg gacttaaacc cacaaaaatt tagttaacag ctaaatgccc
5161 caatcaactg gctttaatct acttctcccg ccgcngggaa aaaaaggcgg gagaagcccc
5221 ggcagtaaac cnnntactgc tcctttgaat ttgcagttca acatgaaaat cacctcgggg
5281 ctggtaaaaa gagggcntaa acctctgtcc ttagatttac agcctaatgc ttactcagcc
5341 attttaccnn nnnnnttttt cacttatgct cattaaccgc tggctattct ctacaaatca
5401 taaagatatt ggaaccttat acttactatt tggcgcatga gctggaacag taggtatagc
5461 tataagcctt cttattcgag ccgagctggg tcaacctggt aacctgttag gcaatgatca
5521 tatctataat gttattgtta cagcccatgc atttgtcata attttcttta tggttatacc
5581 catcataatt ggaggttttg gaaactgact agtaccccta ataattggtg ctcctgacat
5641 agcatttccc cgcctaaata atataagctt ctgacttctt ccaccatcct tcctacttct
5701 tctcgcatca gccatagtag aagctggtgc tggaacaggt tgaacagtgt atccaccttt
5761 agcaggaaat ctctcccacc caggagcctc cgtagaccta actattttct cacttcatct
5821 agcaggtatt tcttctattc taggggctat taacttcatt acaactatca ttaatataaa
5881 accccctgca atatctcaat atcaaacccc tctatttgtt tgatcagtcc tgattacagc
5941 agtcctacta ctcctatctc tgcccgtact agccgctggt attacaatat tattaacaga
6001 ccgcaatctt aacaccactt tctttgaccc tgcaggaggg ggagacccta tcttatatca
6061 acacttattc tgattctttg ggcaccctga ggtctatatt cttattctac ctggcttcgg
6121 aataatttcc cacattgtaa catattattc tgggaaaaaa gagccgtttg ggtatatagg
6181 catagtctga gctatagtat caattgggtt cctaggcttt attgtatgag ctcaccatat
6241 atttacagtt ggaatagacg tagatacacg agcctatttt acctctgcca ctataattat
6301 tgcaatccca actggcgtta aagtctttag ctgacttgcc acgctacacg gaggaaatat
6361 taagtgatca gccgcaatac tctgagccct aggctttatt ttccttttta ccgtaggagg
6421 tctgaccggt attgtactag caaactcatc actagatatt gtattacacg acacatatta
6481 cgtcgtagcc catttccact atgtcttatc aataggggct gtctttgcta ttataggagg
6541 ctttattcac tgattccccc tattctcagg ttatacccta gatcaagtct gcgccaaagc
6601 ccactttact atcatatttg taggtgtaaa tttaaccttt ttcccacaac attttctggg
6661 cttatcaggg atgccccgac gctattctga ctatcccgat gcttatacca catgaaatat
6721 tgtatcatct acagggtcct ttatgtccct agtagcgata ttactaataa tttatataat
6781 ctgagaagct ttcgcttcaa aacgtaaagt actatcaatt gaacaacccg cctataatct
6841 agagtgacta catggctccc ctccacctta tcacacattt gatgaaccaa ccttcatcaa
6901 agttaaataa aaaaggaagg aatcgaacct cctgaaactg gtttcaagcc aatcctatag
6961 cctctataac tttttcaatg agatattaga aaaactattt catggctttg tcaaagctaa
7021 atcataggac atatcctata tatcttatat ggcccaccca gttcaactag gcctacaaga
7081 tgccacatcc cctatcatag aagaactaat tgcttttcac gaccacgcct tcataattgt
7141 atccctaatt agctttctcg ttctatatat tttactatca gtactaacaa caaaactaac
7201 tagcactaac attacagatg ctcaagaaat agaaactatc tgaactatcc tacccgcaat
7261 tatcctagtc ttaattgctc ttccatctct acgaattctc tacttaacag acgaaattaa
7321 taacccctca tttactatta aatcaattgg acatcaatga tactgaacct atgagtatac
7381 agattatgga ggtttaatct ttaattctta tatactcccc ccactatttt taaacccagg
7441 ggaccttcga cttctagaag ttgataaccg agtggtactt ccaattgaag cccctgtccg
7501 tataataatt acatctcaag acgttctaca ctcatgaacc atccctacac tcggtctaaa
7561 aacagatgca attccagggc gcttaaatca aactacattt actgccatac gaccaggtgt
7621 ctactacgga caatgttcag aaatctgcgg tgctaaccac agttttatgc caattgttgc
7681 agaattaatt ccactaaaaa ttttcgagat aggacccgta ttcaccttat aagtatacta
7741 annnnnnnat gcacttcacc tagcctactc ttaaaatatc aaggnnnnnn nnnnncccac
7801 tgtatagcta ctacagcatt aaccttttaa gttaaagatg agaaaacact tttctctgca
7861 gtgaaatgcc tcaactaaat acatctacat ggcttatcac cattataact atactacctg
7921 cactatacct tattatacaa ttaaaattac taaatacaaa ctactattta cccccatcac
7981 aaaaaattcc taatacgcag gtgtttaaca acccttggca actaaaatga acgaaaattt
8041 atttacccca tttacaaccc caacactcct aaatctaccc gctgtagttc ccattattct
8101 atttcccgca ctattattcc caacctccaa acaccttgtt aacaaccgac taattactat
8161 tcaacaaagt ctgactcaac ttatcctaaa gcaaataata ataattcata gtacaaaagg
8221 acgaacttga tccctaatac taatgtctct aatcattttt attgctacaa ccaacctcct
8281 cgggctatta ccttactcat ttacacctac cgcccaactg tctatgaatt tggcaatggc
8341 aatccctcta tgggctggta cagtaattac aggccttcgc ttcaaaacca aaagttccct
8401 agcccatttt ttaccacaag gcacacctac acttcttatc cccatgctag taattattga
8461 aactattagc ttattaattc aaccagtagc cctagctgta cgcctaaccg ctaatattac
8521 agcgggccat ctactcatgc atctaatcgg aagtgccgta ctagcgctat taaccattaa
8581 tttttttgca acttcactaa ccttcatact cctgttgcta nnnctaacaa ttctagaaat
8641 tgcggttgcc ctaattcaag cctatgtttt cacgctcctg gtcagccttt acttacatga
8701 taacacttaa tgacccacca aactcaccct tatcatatag tcaaacccag cccatgacca
8761 ctaacaggag ctttctcggc tctcctaata acatccggct taattatatg atttcacttt
8821 tattccataa ctctactaat attagggtta ctaaccaata tgttaacaat atatcaatgg
8881 tgacgtgaca ttgtacgaga aagcacttat caaggccacc atacaacacc agttcaaaaa
8941 ggcctccgtt acggaatagt attatttatt atctcagaag ttttcttctt tgcaggcttc
9001 ttctgagcat tttaccactc aagtcttgcc cctactccac atctaggagg gcactgacca
9061 ccaacaggca tcactcccct aaatcctcta gaagtacccc tcctaaatac ttctgtgcta
9121 cttgcatcag gggtcacaat cacttgagcc catcacagcc taatagaaaa taaccgaaaa
9181 caaataattc aagcccttct tatcacaatc ttattgggca tctacttcac cctcttgcaa
9241 gtgtctgagt attatgaagc acccttcact atttctgatg gcatttatgg ctcaacattt
9301 tttgttgcta ccggcttcca cggacttcac gttattattg gatctacatt ccttactgtc
9361 tgccttattc gccaactatt ataccacttt acatcaaagc atcattttgg ttttgaagca
9421 gctgcttgat actggcactt tgtagatgtc gtctgactct tcctttacat ctccatttac
9481 tgatgaggtt cctattcttt tagtataact agtacagctg acttccaatc agctagtttc
9541 gataacattc gaaaaagaat aataaaccta atacttgccc taacaattaa taccttccta
9601 accctgcttc taataattat tatattttga ttacccttac ttaataccta cgcagaaaag
9661 gctgaccctt acgaatgcgg gtttgaccca ctaaactccg ctcgcattcc tttttccata
9721 aaattttttc tagtcgctat tactttccta ctttttgatc tagaaattgc tctgctatta
9781 cccctaccat gggctctcca aacaacaaac ctccctgtaa taattaaatc atcaataata
9841 ttaatcatta ttttaaccct cggcttagca tacgagtgaa ctcaaaaagg actagactga
9901 accgaattgg caagtagttt aagtaaaata aatgatttcg actcattaga ttatgataat
9961 catactagcc aaatgcccgt tatttatata aatattatat tagcatttct tatctcactc
10021 ctaggcatat taatctatcg ttcacatcta atatcatctc tattatgcct agaaggaata
10081 atactctcac tatttattat aagcaccctc atagccttaa atatacattt tcccctagct
10141 aatattgtac ctattgctct gctagttttc gccgcttgcg aggcagcagt gggtcttgcc
10201 ctactagtct caatctcaaa tatatatggt ctagattata tccacaacct aagcttactc
10261 caatgctaaa aataattctt cccacaatca tgctactacc aacgacatga ttttccaaaa
10321 acagcatatt atggattaac ctaaccatac acagcttagt tattagtctt attcccctta
10381 tattttttaa tcaagctaat aataatctca ctagttactc gacttattta tcttctgacc
10441 cactatcaac acctcttcta acactaaccg cttgactctt acccctcatg attatagcaa
10501 gccagtacca tttacataat gaaagtcctt tatgaaaaaa actttatctc tccataataa
10561 tttttctaca aatctcccta attataacat ttatatccac agaactaatc ctgttctata
10621 tctcatttga aactactctt gtccccaccc taattattat tacccgatga ggcaatcaag
10681 cagaacgcct caacgcaagc acatatttcc tattctatac attagctggc tcccttccct
10741 tactaattat actagtattt atatataata acacaggttc attaaacatt gtattactaa
10801 cactcacagc ccaagaacta ataagcacct gatcccacaa tctaatttga ctggcatgca
10861 tgatagcctt catagtaaaa atacccctat atggtctaca cctatggctc cccaaagccc
10921 acgttgaagc tcccattgcc gggtcgatag ttcttgccgc agtactttta aaactaggtg
10981 gttatggtat aatgcgactt acctcaatcc ttaacccctt aacagaatat atagcctatc
11041 ccttcctcat gttatcccta tggggcataa ttataacaag ctcaatctgt ctccgacaaa
11101 cagatctaaa atcacttatt gcatactcct ccgtaagcca catagcccta gtaatcatag
11161 cctctctcat ccaaactcct tgaagcttta ctggcgctat tatccttata atcgcccatg
11221 gccttacctc atccatatta ttctgcctag caaattcaaa ctatgaacga acccacagtc
11281 gcattatatt actctctcga gggcttcaaa ttctacttcc actaatagcc ttctgatgat
11341 ttgcagcaaa cctcaccaat ctggccctac cccccaccat taatttaatt ggagaactac
11401 tagtagtaac aacctcattt tcttgatcac atgtcaccat tatactcaca ggactaaaca
11461 tactaattac tgccctctat tctcttcaca tattcattac aacacaacga ggggtactca
11521 ccccccacat tataaacata aaaccctcct tcacccgaga aaatatatta atatttatac
11581 acatctcccc catcatcctt ctatccctca accccaatat tattataggc ttcacctctt
11641 gtaaatataa tttaattnaa aatattagat tgtgaatcta aacatagaaa ctcacccctt
11701 cttatttacc gagaaagctt gcaaggactg ctaatccatg cctccgtact taacaaaacg
11761 gctatctcaa cttttaaagg ataacaggta tccattggtc ttaggaacca aaaatattgg
11821 tgcaactcca aataaaagta ataannatgc acgcctccat tattatacta acactaactt
11881 acttaatatt cccaattatt accactctca ttaagcccag caaaaatcac ctgtacccta
11941 attacgtaaa aacaactata atatttgcct ttatcttcag tctctttccc ataaccctat
12001 atattctatt agaccaagac ataattatct caaactgaca ttgaacaact attcagtccc
12061 tagaacttac actaagtttt aaactagact atttttccat aatattcacc ccaattgcac
12121 tatttatcac ctgatgtatt atagaattct cactatgata tataagctca gatccaaata
12181 ttaatcaatt ctttaagtat cttctcattt ttctcatcac catattaatt ctaattaccg
12241 ccaataacct cttccaactc tttattggat gagaaggtgt cggaattata tcctttctac
12301 taatcggctg atgacatgct cgaacagacg ccaacacagc agccacccaa gcaattctat
12361 ataaccgtgt tggtgatatc ggctttatcc taaccatagc atgatttctt ctccactata
12421 actcatgaga cctccagcaa atatttatcc tagactccaa cccaaatctt ttaccactaa
12481 taggacttct tctagcagca ataggaaaat cagcccaact tggtcttcac ccctgactcc
12541 cctccgccat agaaggccca accccagtct cagctttact ccattctagt actatagtag
12601 tagcaggagt atttttactt attcgctttc accccttgat agaaaataat atattaattc
12661 aaagtcttac attatgtcta ggagcaatta ccaccctatt tatagcaatc tgcgccctaa
12721 cacaaaatga catcaaaaaa attgtagcct tctctacctc aagtcaacta gggttaataa
12781 tagttaccat tggcattaat caaccacacc tagcattcct acatatctgc actcacgcct
12841 tcttcaaagc catactattc atttgctctg gctccattat ccacaattta aataacgaac
12901 aggatattcg aaaaatgggc ggattgttta aaataatgcc cctcacttca acttccctaa
12961 ccattggtaa cctagcactt acaggtatac ctttccttac aggtttctac tccaaagatc
13021 ttattatcga aaccgcaaac acgtcatata ctaatgcctg agccctatct actactctta
13081 tcgccacctc cctaacaagc gcctacagca ctcgaactat tattctagca ctaacaggac
13141 aaccccgctt ttcaacctca gttcacatca atgaaaataa tccagcttta ctaaacccaa
13201 taaaacgttt aacactaggc agcctactcg cgggattcct cattaccaat aatattttcc
13261 ccaccacacc accccaactg accataccct attacctaaa gctcctagct ctgtgtgtaa
13321 ctatcctagg ctttttaata gctctagact taacccttat agccaacaac ctcaaaataa
13381 gtaccccatc acatatattc aaattttcta acatattagg atattttccc attacaattc
13441 accgaataat tccctaccaa aacttaatta taagtcaaaa cctagccttc atcttattag
13501 actcattctg actagaaaaa ttaataccca aaacaatctc acatgtccat accactactt
13561 ctatcactat tactacccaa aaaggcatga tcaaatttta tttcctctcc ttccttattc
13621 cccttatcct ggttatacta ctaacaatat aatctattac ctcgagtaat ttcaataaca
13681 atataaacac caacaaataa cgttcaacca gcaaccacta ctaaccaacg accatagtca
13741 tacaatgcac ccgcaccaat agaatcttca cgaattaacc ctgacccctc tccttcaaaa
13801 actacccaac ttcctatatt atttaaatta accatcannn ctaccaactc accataatcc
13861 aaaactcata aaattaaccc cacctccatt gctaacccaa ctaaaaagct gcccaacacc
13921 tcaaaccctg aaacccatgc ctcaggatac tcctcaatag ccatcgcagt agtatagcca
13981 aaaacaacca ttataccccc caaatagatt aaaaatatta ttaaacccat gtaagtacct
14041 ccataattta aaataattac acaaccaact acaccactga taatcaatgc cagaccccca
14101 taaataggag aaggcttaga agaaaatccc acaaatccca taaccaataa cacacttaac
14161 aaaaataaaa tatatgacat cgttcttaca tggacttcaa ccatgactaa tgatatgaaa
14221 aatcatcgtt gtacttcaac tacaaaaanc accaatggcc cccctacgta aatccaatcc
14281 agtcataaaa ataattaacc actccctcat tgacttaccc accccatcaa acatttccac
14341 atgatgaaat tttggctctc tcctagcaac ttgcttaacg ctacagatca ttaccggtct
14401 attcctagca atacactatt caccagacac ttcctctgcc ttctcctcaa ttgcacatat
14461 tacccgagat gtaaattatg gctgaatcat ccgctatctc cacgccaatg gcgcctccat
14521 attctttatc tgcctatttc tacatgtagg ccgaggtcta tactacggct catttcttct
14581 caccgaaaca tgaaatattg gtattgcact cctacttata attatagcaa cagccttcat
14641 aggttacgta cttccatgag gacaaatatc attctgaggc gccacagtta tcacaaattt
14701 attatctgca attccataca ttggaacaaa cctcgtccaa tgagtctgag gtggctattc
14761 cattgataac ccaaccctca cacgattttt taccctccac tttaccctgc ccttcattat
14821 tgcaacccta acagcccttc atctactttt cctgcacgaa acaggatcaa acaacccctg
14881 cggaatcccc tccaactccg acaaaatccc cttccaccct tactatacga tcaaagatat
14941 tttaggccta atcttcctcc tccttatcct aataacccta gtattatttt cacctgacct
15001 tttaagtgac ccagacaact atactccagc taacccacta aacaccccac cacatattaa
15061 accagaatga tacttcctat ttgcatatgc aatcctacga tccgttccta ataaactagg
15121 aggtgtacta gccctccttc tatccattct tattttagca atcataccta tactccataa
15181 atctaaacaa caaagcatag cattccgccc actcagccaa ttactactat gactcctaat
15241 tacaactcta ttaaccctaa cctgaatcgg aagccaaccg gtaaatcagc ccttcattat
15301 aattggacaa gtagcatcca taatatattt tgctacaatt ttaatcctaa taccactagc
15361 ctccctaatc gaaaataacc tcctcaaatg aacctgcccc tgtagtataa acntaataca
15421 ccagtcttgt aaactgaaaa cggacannnn cntcttcccc ggggcaactc agaaagaaag
15481 tacttaactc caccaccaac acccaaagct ggcattctna tttaaactac tttctgcatt
15541 ctagggagta cagtccttaa aataacnnnn ttagcatagt tcaattttat gtacccntat
15601 gtaattcgtg cattactgct agtccacatg aatattatat agtactataa atgcttaacc
15661 gtccataaaa cataaattta catatttact aacnaatttt caccaacatg cttacaagca
15721 agaacatctt cctaaattcc atggctataa cacataaaat ccaaacctcc naaaacactg
15781 atcctaccca ttgaaatatc aaccaacacg acantttcat taccgcacat agntacatta
15841 tatcattgat cggacatagc acattacagc cgagcatacc caattcaact ctcgccaata
15901 cgaatattcc ccntcagtta ggtgtccctt gaccaccatc ctccgtgaaa tcaatatccc
15961 gcacaagagt gctactctcc tcgcaccggg cccataactc gtgggggtag ctataaatgn
16021 gcatctaagg gacatctggt tcttacctca gggccataac naccaagatc gcccacacgt
16081 tccccttaaa taagacatct cgatggatca cgggtctatc accctattaa ccagtcacgg
16141 gagctctcca tgcatttggt atcttttatc tctggtctgc acgcgacccc attgcagaat
16201 gctgngtctc gccacaatta gtcccgcang cgcctgtctt tgattcctag tccnatgcta
16261 ttattaatcg cacctacgtt caatattcta atcccgcatg aaccttnagc aaggtgttat
16321 ttaatccatg cttgtaagac atacaaataa ttaattacac atccatacca atccaaacta
16381 tatgttaact caagccacaa caaactatac acaaaccccc cctnccccca acttcgacca
16441 ctcccatata atttgccttt gccaaacccc aaaaacaaaa gcttnnngct gcctagccga
16501 agtctcactt tttatctttt aggtttacac acctaagnct accactttct caactaataa
16561 aaaattaatt cannnnttta ccanccccag ccatccaccc accctccttc ccacaacccc
16621 aaaagatagc gtccacaata tataataccc c
//