Sie sind auf Seite 1von 56

Mai 2002

ICS 13.040.40; 75.180 VDI-RICHTLINIEN May 2002

VEREIN
Emissionsminderung
DEUTSCHER VDI 3479
INGENIEURE Raffinerieferne Mineralltanklger
Former editions: 7/85; 3/01 draft, in German only

Emission control
Frhere Ausgaben: 7.85; 3.01 Entwurf, deutsch

Marketing installation tank farms Ausg. deutsch/englisch


Issue German/English

Vervielfltigung auch fr innerbetriebliche Zwecke nicht gestattet / Reproduction even for internal use not permitted
Zu beziehen durch / Available from Beuth Verlag GmbH, 10772 Berlin Alle Rechte vorbehalten / All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Die deutsche Version dieser Richtlinie ist verbindlich.


The German version of this guideline shall be taken as authorita-
tive. No guarantee can be given with respect to the English trans-
lation.

Inhalt 6HLWH Contents 3DJH

9RUEHPHUNXQJ   3UHOLPLQDU\QRWH 


*HOWXQJVEHUHLFK  6FRSH  
%HJULIIH   7HUPVDQGGHILQLWLRQV 
1 Technologie  1 Technology  
 $OOJHPHLQHV]X0LQHUDO|OWDQNOlJHUQXQG  *HQHUDOLQIRUPDWLRQRQPLQHUDORLOWDQN
LKUHQ(PLVVLRQVTXHOOHQ   IDUPVDQGWKHLUHPLVVLRQVRXUFHV  
 /DJHUXQJYRQ0LQHUDO|OHQ   6WRUDJHRIPLQHUDORLOV  
 )HVWGDFKWDQNV   )L[HGURRIWDQNV  
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

 6FKZLPPGDFKWDQNV   )ORDWLQJURRIWDQNV 


 =\OLQGULVFKH%HKlOWHU    &\OLQGULFDOYHVVHOV 
 8PVFKODJYRQ0LQHUDO|OHQ   /RDGLQJXQORDGLQJRIPLQHUDORLOV 
 (LQODJHUQ   3URGXFWVXSSO\ 
 $XVODJHUQ   3URGXFWZLWKGUDZDO 
 8PODJHUQXQG0LVFKHQ    ,QSODQWWUDQVIHUDQGEOHQGLQJ
 )|UGHUXQJLQ5RKUOHLWXQJHQ'LFKWV\VWHPH   7UDQVSRUWLQSLSLQJOLQHVVHDOLQJV\VWHPV 
 3XPSHQ    3XPSV
 $EVSHUUXQG5HJHORUJDQH   6KXWRIIDQGFRQWUROYDOYHV 
 )ODQVFKYHUELQGXQJHQ   )ODQJHGMRLQWV
 .DSSHQXQG%OLQGIODQVFKH    &DSVDQGEOLQGIODQJHV
 6RQVWLJH9RUJlQJH   2WKHURSHUDWLRQV 
 7DQNUHLQLJXQJ   7DQNFOHDQLQJ 
 3UREHQDKPH    6DPSOLQJ 
2 Emissionen und Mglichkeiten zu deren 2 Emissions and means of emission reduction  
Verminderung  
Lizenzierte Kopie von elektronischem Datentrger

 $OOJHPHLQHV   *HQHUDO


 /DJHUXQJYRQ0LQHUDO|OHQ   6WRUDJHRIPLQHUDORLOV 
 )HVWGDFKWDQNV   )L[HGURRIWDQNV 
 6FKZLPPGDFKWDQNV   )ORDWLQJURRIWDQNV
 =\OLQGULVFKH%HKlOWHU    &\OLQGULFDOYHVVHOV 
 8PVFKODJYRQ0LQHUDO|OHQ   /RDGLQJXQORDGLQJRIPLQHUDORLOV
 (LQODJHUQ   3URGXFWVXSSO\
 $XVODJHUQ   3URGXFWZLWKGUDZDO 
 8PODJHUQXQG0LVFKHQ    ,QSODQWWUDQVIHUDQGEOHQGLQJ

Kommission Reinhaltung der Luft im VDI und DIN Normenausschuss KRdL


Ausschuss Raffinerieferne Mineralltanklger

VDI/DIN-Handbuch Reinhaltung der Luft, Band 3


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

6HLWH 3DJH

 )|UGHUXQJLQ5RKUOHLWXQJHQ'LFKWV\VWHPH    7UDQVSRUWLQSLSLQJOLQHVVHDOLQJV\VWHPV 


 3XPSHQ   3XPSV  
 $EVSHUUXQG5HJHORUJDQH    6KXWRIIDQGFRQWUROYDOYHV 
 )ODQVFKYHUELQGXQJHQ    )ODQJHGMRLQWV  
 .DSSHQXQG%OLQGIODQVFKH   &DSVDQGEOLQGIODQJHV  
 6RQVWLJH9RUJlQJH    2WKHURSHUDWLRQV 
 7DQNUHLQLJXQJ    7DQNFOHDQLQJ 
 3UREHQDKPH   6DPSOLQJ 
3 Beschrnkung der Emissionen   3 Emission control 
 $OOJHPHLQHV    *HQHUDO  
 /DJHUXQJYRQ0LQHUDO|OHQ    6WRUDJHRIPLQHUDORLOV 
 8PVFKODJYRQ0LQHUDO|OHQ    /RDGLQJXQORDGLQJRIPLQHUDORLOV  
 )|UGHUXQJLQ5RKUOHLWXQJHQ'LFKWV\VWHPH    7UDQVSRUWLQSLSLQJV\VWHPV
VHDOLQJV\VWHPV 
 3XPSHQ   3XPSV  
 $EVSHUUXQG5HJHORUJDQH    6KXWRIIDQGFRQWUROYDOYHV 
 )ODQVFKYHUELQGXQJHQ    )ODQJHGMRLQWV  
 .DSSHQXQG%OLQGIODQVFKH   &DSVDQGEOLQGIODQJHV  
 6RQVWLJH9RUJlQJH    2WKHURSHUDWLRQV 
 7DQNUHLQLJXQJ   7DQNFOHDQLQJ 
 3UREHQDKPH   6DPSOLQJ 
4 Ermittlung der Emissionen   4 Determination of emissions 
 )HVWGDFKWDQNV   )L[HGURRIWDQNV  
 9HUOXVWHGXUFK$XVODJHUXQJXQG  :LWKGUDZDODQGEUHDWKLQJORVVHV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

$WPXQJHLQHVIUHLEHOIWHWHQ7DQNV  RIDIUHHO\YHQWHGIL[HGURRIWDQN 
 9HUOXVWHGXUFK$XVODJHUXQJXQG  :LWKGUDZDODQGEUHDWKLQJORVVHV
$WPXQJHLQHV)HVWGDFKWDQNVPLW RIDIUHHO\YHQWHGIL[HGURRIWDQN
9DNXXP'UXFN9HQWLOHQ   HTXLSSHGZLWKYDFXXPSUHVVXUH
UHOLHIYDOYHV 
 (LQIOXVVGHU)DUEJHEXQJDXIGLH  ,QIOXHQFHRIFRDWLQJFRORXU  
9HUOXVWH 
 %HIOOYHUOXVWHHLQHVIUHLEHOIWHWHQ  )LOOLQJORVVHVRIDIUHHO\YHQWHG
)HVWGDFKWDQNV   IL[HGURRIWDQN  
 'lPSIHUFNJHZLQQXQJVDQODJHQ  9DSRXUUHFRYHU\XQLWV 958V  
958  
 %HLVSLHOUHFKQXQJHQIU'LHVHONUDIW  ([DPSOHFDOFXODWLRQIRUGLHVHOIXHO
VWRIIWDQNV   VWRUDJHWDQN 
 6FKZLPPGDFKWDQNV   )ORDWLQJURRIWDQN  
 6WDQGYHUOXVW   6WDQGLQJVWRUDJHORVV  
 (QWQDKPHYHUOXVW/: $UEHLWVYHUOXVW    :LWKGUDZDOORVV ZRUNLQJORVV  
 %HLVSLHOUHFKQXQJHQ   ([DPSOHFDOFXODWLRQV 
5 Abflle, Abwsser, Abwrme   5 Waste, waste water, waste heat 
 $EIlOOH   :DVWH  
 $EZlVVHU   :DVWHZDWHU  
 $EZlUPH   :DVWHKHDW  
6FKULIWWXP  5HIHUHQFHV 
Anhang 3UIYHUIDKUHQ  Annex 7HVWPHWKRGV

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Vorbemerkung Preliminary note


In der Kommission Reinhaltung der Luft im VDI und In the Commission on Air Pollution Prevention of
DIN Normenausschuss KRdL erarbeiten Fach- VDI and DIN Standards Committee KRdL ex-
leute aus Wissenschaft, Industrie und Verwaltung in perts from science, industry and administration, act-
freiwilliger Selbstverantwortung VDI-Richtlinien ing on their own responsibility, establish VDI guide-
und DIN-Normen zum Umweltschutz. Diese be- lines and DIN standards in the field of environmental
schreiben den Stand der Technik bzw. den Stand der protection. These describe the state of the art in sci-
Wissenschaft in der Bundesrepublik Deutschland ence and technology in the Federal Republic of Ger-
und dienen als Entscheidungshilfen bei der Erarbei- many and serve as a decision-making aid in the pre-
tung und Anwendung von Rechts- und Verwaltungs- paratory stages of legislation and application of legal
vorschriften. Die Arbeitsergebnisse der KRdL flie- regulations and ordinances. KRdLs working results
en ferner als gemeinsamer deutscher Standpunkt in are also considered as the common German point of
die europische technische Regelsetzung bei CEN view in the establishment of technical rules on the
(Europisches Komitee fr Normung) und in die European level by CEN (European Committee for
internationale technische Regelsetzung bei ISO Standardization) and on the international level by
(Internationale Organisation fr Normung) sowie in ISO (International Organization for Standardization)
die Reference Documents on Best Available Techni- as well as in the Reference Documents on Best Avail-
ques (BREFs) fr verschiedene Branchen, wie die able Techniques (BREFs) issued for the various in-
BREFs Mineral Oil and Gas Refineries [1a] oder dustries such as the BREFS on Mineral Oil and Gas
auch Emissions from Storage [1b] ein. Refineries [1a] and Emissions from Storage [1b].
Folgende Themenschwerpunkte werden in vier Fach- The following topics are dealt with in four subdivi-
bereichen behandelt: sions:

Fachbereich I Subdivision I
Umweltschutztechnik Environmental Protection Techniques
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Produktionsintegrierter Umweltschutz; Verfahren Integrated pollution prevention and control for in-
und Einrichtungen zur Emissionsminderung; stallations; procedures and installations for emis-
ganzheitliche Betrachtung von Emissionsminde- sion control; overall consideration of measures for
rungsmanahmen unter Bercksichtigung von emission control with consideration given to the
Luft, Wasser und Boden; Emissionswerte fr air, water and soil; emission limits for dusts and
Stube und Gase; anlagenbezogene messtechni- gases; plant-related measurement instructions; en-
sche Anleitungen; Umweltschutzkostenrechnung vironmental industrial cost accounting

Fachbereich II Umweltmeteorologie Subdivision II Environmental Meteorology


Ausbreitung von Luftverunreinigungen in der Dispersion of pollutants in the atmosphere; emis-
Atmosphre; strfallbedingte Freisetzungen; sions from accidental releases; micro- and meso-
mikro- und mesoskalige Windfeldmodelle; Wech- scale wind field models; interaction between the
selwirkung zwischen Atmosphre und Oberfl- atmosphere and surfaces; meteorological measure-
chen; meteorologische Messungen; angewandte ments; applied climatology; air pollution maps;
Klimatologie; Lufthygienekarten; human-bio- human-biometeorological evaluation of climate
meteorologische Bewertung von Klima und Luft- and air hygiene; transfer of meteorological data
hygiene; bertragung meteorologischer Daten

Fachbereich III Umweltqualitt Subdivision III Environmental Quality


Wirkung von Luftverunreinigungen auf Mensch, Effects of air pollutants on man, farm animals, veg-
Tier, Pflanze, Boden, Werkstoffe und Atmosphre; etation, soil, materials, and the atmosphere; meth-
wirkungsbezogene Mess- und Erhebungsverfah- ods for the measurement and evaluation of effects;
ren; Erfassung und Wirkung mikrobieller Luftver- determination of microbial air pollutants and their
unreinigungen; Olfaktometrie; Umweltsimulation effects; olfactometry; environmental simulation

Fachbereich IV Subdivision IV
Umweltmesstechnik Environmental Measurement Techniques
Emissions- und Immissionsmesstechnik fr anor- Techniques for emission and ambient air measure-
ganische und organische Gase sowie fr Partikel; ments of inorganic and organic gases as well as
optische Fernmessverfahren; Messen von Innen- particulate matter; optical open-path measurement

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

raumluftverunreinigungen; Messen von Boden- methods; measurement of indoor air pollutants,


luftverunreinigungen; Verfahren zur Herstellung measurement of soil air pollutants; procedures for
von Referenzmaterialien; Prfplne fr Mess- establishing reference material; test procedures for
gerte; Validierungsverfahren; Messplanung; Aus- measurement devices; validation procedures;
werteverfahren; Qualittssicherung measurement planning; evaluation methods; qual-
ity assurance
Die Richtlinien und Normen werden zunchst als The guidelines and standards are first published as
Entwurf verffentlicht. Durch Ankndigung im Bun- drafts. These are announced in the Bundesanzeiger
desanzeiger und in der Fachpresse erhalten alle inte- (Federal Gazette) and in professional publications in
ressierten Kreise die Mglichkeit, sich an einem order to give all interested parties the opportunity to
ffentlichen Einspruchsverfahren zu beteiligen. participate in an official objection procedure. This
Durch dieses Verfahren wird sichergestellt, dass procedure ensures that differing opinions can be con-
unterschiedliche Meinungen vor Verffentlichung der sidered before the final version is published.
endgltigen Fassung bercksichtigt werden knnen.
Die Richtlinien und Normen sind in sechs Bnden The guidelines and standards are published in the six-
des VDI/DIN-Handbuches Reinhaltung der Luft zu- volume VDI/DIN Reinhaltung der Luft (Air Pollu-
sammengefasst. tion Prevention) manual.

Geltungsbereich Scope
'LHVH 5LFKWOLQLH JLOW IU QHXH UDIILQHULHIHUQH 7DQN 7KLVJXLGHOLQHLVDSSOLFDEOHWRQHZPDUNHWLQJLQVWDO
OlJHULQGHQHQIROJHQGH0LQHUDO|OHJHODJHUWXQGXP ODWLRQWDQNIDUPVIRUWKHVWRUDJHDQGORDGLQJXQORDG
JHVFKODJHQZHUGHQ LQJRIWKHIROORZLQJPLQHUDORLOW\SHV
5RK|OH FUXGHRLOV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

2WWRNUDIWVWRIIH PRWRUJDVROLQHV
'LHVHONUDIWVWRIIH GLHVHORLOV
+HL]|OH IXHORLOV
)OXJNUDIWVWRIIH MHWIXHOV
3HWUROHXP NHURVHQH
VSH]LHOOH7HVWEHQ]LQH VSHFLDOWHVWJDVROLQHV
$GGLWLYPLVFKXQJHQ DGGLWLYHPL[WXUHV
.UDIWVWRIINRPSRQHQWHQ PRWRUIXHOFRPSRQHQWV
:HQQ JHSUIW ZLUG RE GLH LQ GLHVHU 5LFKWOLQLH JH :KHQFRQWHPSODWLQJWKHDSSOLFDWLRQRIWKHHPLVVLRQ
QDQQWHQ 0LQGHUXQJVPDQDKPHQ RGHU (PLVVLRQV FRQWUROPHDVXUHVRUHPLVVLRQOHYHOVGHVFULEHGLQWKLV
ZHUWHDXFKDXI$OWDQODJHQDQJHZHQGHWZHUGHQN|Q JXLGHOLQH WR H[LVWLQJ IDFLOLWLHV WKH JLYHQ WHFKQLFDO
QHQPVVHQLQMHGHP)DOOGLHWHFKQLVFKHQXQGUlXP FRQGLWLRQVVSDFHFRQVWUDLQWVDQGWKHDSSURSULDWHQHVV
OLFKHQ *HJHEHQKHLWHQ XQG GLH 9HUKlOWQLVPlLJNHLW RIWKHPHDVXUHVPXVWEHWDNHQLQWRDFFRXQW
GHU0DQDKPHQEHUFNVLFKWLJWZHUGHQ
$XIGLHIUGHQ%DXXQG%HWULHEGHU$QODJHQJHOWHQ 5HIHUHQFHLVPDGHWRWKHDFWVRUGLQDQFHVDGPLQLV
GHQ*HVHW]H9HURUGQXQJHQ9HUZDOWXQJVXQGVRQV WUDWLYHUHJXODWLRQVDQGRWKHUUHJXODWLRQVDSSOLFDEOHWR
WLJH9RUVFKULIWHQ>ELV@ZLUGKLQJHZLHVHQ6LFKHU WKH FRQVWUXFWLRQ DQG RSHUDWLRQ RI WKH IDFLOLWLHV LQ
KHLWVWHFKQLVFKH9RUVFKULIWHQXQG5HJHOQEOHLEHQYRQ TXHVWLRQ>WR@7KHDSSOLFDEOHVDIHW\UHJXODWLRQV
GLHVHU5LFKWOLQLHXQEHUKUW)UVLFKHUKHLWVWHFKQLVFK DQG UXOHV UHPDLQ XQDIIHFWHG E\ WKLV JXLGHOLQH )RU
EHGHXWVDPH$QODJHQWHLOHLP6LQQHGHU6W|UIDOO9HU VDIHW\UHOHYDQW HTXLSPHQW LQ WHUPV RI WKH *HUPDQ
RUGQXQJ >@ N|QQHQ LP (LQ]HOIDOO ]XVlW]OLFKH 0D 8SVHW/RDG&DVH2UGHU>@DGGLWLRQDOPHDVXUHVEH
QDKPHQ GLH QLFKW LQ GLHVHU 5LFKWOLQLH EHVFKULHEHQ \RQGWKRVHGHVFULEHGLQWKLVJXLGHOLQHPD\EHQHFHV
VLQGHUIRUGHUOLFKVHLQ VDU\LQWKHLQGLYLGXDOFDVH
$OOH 9ROXPHQDQJDEHQ IU *DVH LQ GLHVHU 5LFKWOLQLH $OOJDVYROXPHVLQGLFDWHGLQWKLVJXLGHOLQHUHODWHWR
EH]LHKHQ VLFK DXI GHQ 1RUP]XVWDQG  . VWDQGDUGWHPSHUDWXUHDQGSUHVVXUHFRQGLWLRQV .
 K3D QDFK$E]XJGHV:DVVHUGDPSIDQWHLOV$XI K3D DIWHUGHGXFWLRQRIWKHZDWHUYDSRXUFRQ
$XVQDKPHQZLUGKLQJHZLHVHQ WHQW$Q\H[FHSWLRQVDUHH[SUHVVO\LQGLFDWHG

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

'LHVH5LFKWOLQLHJLOWQLFKWIU7DQNOlJHULQ5DIILQH 7KLVJXLGHOLQHGRHVQRWDSSO\WRUHILQHU\LQWHJUDWHG
ULHQ >@ XQG LQ SHWURFKHPLVFKHQ $QODJHQ VLH JLOW WDQNIDUPV>@DQGSHWURFKHPLFDOSODQWVQRUWRVHUY
HEHQIDOOVQLFKWIU7DQNVWHOOHQE]ZGLH9RUUDWVODJH LFH VWDWLRQV RU VWRUDJH WDQNV DW WKH HQG XVHUV ORFD
UXQJEHL(QGYHUEUDXFKHUQ6LHJLOWHEHQIDOOVQLFKWIU WLRQV 7KH VWRUDJH DQG ORDGLQJXQORDGLQJ RI OLTXLG
/DJHUXQJXQG8PVFKODJYRQ)OVVLJJDV SHWUROHXPJDV /3* DUHQRWWKHVXEMHFWRIWKLVJXLGH
OLQH

Begriffe Terms and definitions


'LH LQ GLHVHU 9',5LFKWOLQLH YHUZHQGHWHQ %HJULIIH 7KHWHUPVXVHGLQWKLV9',JXLGHOLQHVKDOOKDYHWKH
ZHUGHQZLHIROJWGHILQLHUW IROORZLQJPHDQLQJ

$XVODJHUQ 3URGXFWZLWKGUDZDO
$XVODJHUQLVWGDV(QWOHHUHQYRQ/DJHUWDQNVLQ7UDQV 3URGXFWZLWKGUDZDOGHVLJQDWHVWKHHPSW\LQJRIVWRU
SRUWPLWWHO DJHWDQNVLQWRPHDQVRIWUDQVSRUW

%HYRUUDWXQJVWDQN 6WRUDJHWDQN
%HYRUUDWXQJVWDQN LVW HLQ /DJHUWDQN GHU DXVVFKOLH $VWRUDJHWDQNLVDWDQNH[FOXVLYHO\GHVWLQHGIRUWKH
OLFK ]XU ODQJIULVWLJHQ $XIEHZDKUXQJ YRQ 0LQHUDO| ORQJWHUP VWRUDJH RI PLQHUDO RLOV WXUQRYHU IUH
OHQGLHQW 8PVFKODJVKlXILJNHLWFDHLQPDOSUR-DKU  TXHQF\ DSSUR[ RQFH SHU \HDU  DOO RWKHU WDQNV DUH
DOOHEULJHQ7DQNVVLQG8PVFKODJWDQNV WUDQVKLSPHQWYHVVHOV

(LQODJHUQ 3URGXFWVXSSO\
(LQODJHUQLVWGDV%HIOOHQYRQ/DJHUWDQNVDXV7UDQV 3URGXFWVXSSO\GHVLJQDWHVWKHILOOLQJRIVWRUDJHWDQNV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

SRUWPLWWHOQ IURPWKHPHDQVRIWUDQVSRUW

(UG|O 3HWUROHXP
(UG|O LVW HLQ QDWUOLFK YRUNRPPHQGHV *HPLVFK DXV 3HWUROHXPLVDQDWXUDOO\RFFXUULQJPL[WXUHRIDYDVW
.RKOHQZDVVHUVWRIIHQYHUVFKLHGHQVWHU=XVDPPHQVHW YDULHW\ RI FRPSOH[ K\GURFDUERQ FRPSRXQGV HVSH
]XQJ EHVRQGHUV 3DUDIILQH 1DSKWKHQH $URPDWHQ FLDOO\ SDUDIILQV QDSKWKHQHV DURPDWLFV  RI GLIIHUHQW
PLW XQWHUVFKLHGOLFKHQ 0ROHNOJU|HQ GDV XQWHU PROHFXODUVL]HZKLFKLV OLTXLGXQGHU WKHFRQGLWLRQV
/DJHUVWlWWHQEHGLQJXQJHQIOVVLJLVW(UG|OILQGHWVLFK SUHYDLOLQJDWWKHGHSRVLW3HWUROHXPLVSUHGRPLQDQWO\
KDXSWVlFKOLFKIHLQYHUWHLOWLQ6DQGVWHLQXQGNOIWLJHP IRXQGLQWKHSRUHVSDFHSUHVHQWLQVDQGVWRQHDQGILV
.DONVWHLQ GHU YRQ XQGXUFKOlVVLJHQ 6FKLFKWHQ EH VXUHG OLPHVWRQH HQFORVHG E\ LPSHUYLRXV URFN VWUDWD
GHFNW LVW LQ gOVFKLHIHUQ XQG LQ gOVDQGHQ $XHU DVZHOODVLQRLOVKDOHVDQGRLOVDQGV,QDGGLWLRQWR
.RKOHQVWRIIXQG:DVVHUVWRIINRPPHQLQZHVHQWOLFK FDUERQDQGK\GURJHQDVWKHPDLQFRPSRQHQWVRISH
JHULQJHUHU0HQJHXQGLQXQWHUVFKLHGOLFKHU.RQ]HQW WUROHXPVXOSKXUQLWURJHQDQGR[\JHQDUHJHQHUDOO\
UDWLRQ 6FKZHIHO 6WLFNVWRII XQG 6DXHUVWRII YRU ,Q SUHVHQWLQVPDOODQGYDU\LQJTXDQWLWLHV$PRQJWKH
FKHPLVFKHU %LQGXQJ VLQG DXHUGHP GLH 0HWDOOH PRVW FRPPRQ PHWDOOLF HOHPHQWV LQ SHWUROHXP DUH
9DQDGLXPXQG1LFNHOLQ6SXUHQHQWKDOWHQ WUDFHVRIYDQDGLXPDQGQLFNHOZKLFKRFFXULQRUJDQLF
FRPELQDWLRQV

*HIDKUHQNODVVHQ +D]DUGFODVVHV
*HIDKUHQNODVVHQQDFK9E)>@ +D]DUG FODVVHV WR 9E) 2UGLQDQFH RQ &RPEXVWLEOH
/LTXLGV >@
3URGXNWHGHU*HIDKUHQNODVVH$, +D]DUGFODVV$,SURGXFWV
)OVVLJNHLWHQPLWHLQHP)ODPPSXQNWXQWHU & /LTXLGVKDYLQJDIODVKSRLQWEHORZ &
3URGXNWHGHU*HIDKUHQNODVVH$,, +D]DUGFODVV$,,SURGXFWV
)OVVLJNHLWHQ PLW HLQHP )ODPPSXQNW YRQ  ELV /LTXLGVKDYLQJDIODVKSRLQWRIWR &
 &
3URGXNWHGHU*HIDKUHQNODVVH$,,, +D]DUGFODVV$,,,SURGXFWV
)OVVLJNHLWHQPLWHLQHP)ODPPSXQNWEHUELV /LTXLGVKDYLQJDIODVKSRLQWRIWR &
 &

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

3URGXNWHGHU*HIDKUHQNODVVH% +D]DUGFODVV%SURGXFWV
)OVVLJNHLWHQPLWHLQHP)ODPPSXQNWXQWHU & /LTXLGV KDYLQJ D IODVK SRLQW EHORZ  & ZKLFK
GLH VLFK EHL  & LQ :DVVHU O|VHQ RGHU GHUHQ DUHVROXEOHLQZDWHUDW &RUZKRVHFRPEXVWL
EUHQQEDUHIOVVLJH%HVWDQGWHLOHVLFKEHL &LQ EOH OLTXLG FRPSRQHQWV DUH VROXEOH LQ ZDWHU DW
:DVVHUO|VHQ'LHVH3URGXNWHWUHWHQLQUDIILQHULH  &,QPDUNHWLQJLQVWDOODWLRQWDQNIDUPVWKHVH
IHUQHQ 7DQNOlJHUQ QXU LQ XQWHUJHRUGQHWHU 0HQJH SURGXFWVRFFXURQO\LQQHJOLJLEOHTXDQWLWLHVLQWKH
DOV$GGLWLYHRGHUDOV.UDIWVWRIINRPSRQHQWHQDXI IRUPRIDGGLWLYHVRUPRWRUIXHOFRPSRQHQWV

/DJHUQ 6WRUDJH
/DJHUQ LVW GDV $XIEHZDKUHQ YRQ 0LQHUDO|OHQ ]XU 6WRUDJHGHVLJQDWHVWKHVWRFNLQJRIPLQHUDORLOVIRUIX
VSlWHUHQ9HUZHQGXQJ%HRGHU9HUDUEHLWXQJ WXUHXVHRUSURFHVVLQJ

0LQHUDO|O 0LQHUDORLO
$OV0LQHUDO|OZHUGHQ5RK|OXQGGDUDXVKHUJHVWHOOWH 0LQHUDORLOVWDQGVIRUFUXGHRLOVDQGWKHGHULYHGHQ
(QHUJLHWUlJHU .UDIWVWRIIH %UHQQVWRIIH  RGHU HUJ\VRXUFHV PRWRUIXHOVKHDWLQJIXHOV RUOXEULFDQWV
6FKPLHUVWRIIH gOH XQG )HWWH  EH]HLFKQHW 'LH %H RLOV DQG JUHDVHV  ,Q VWDQGDUG (QJOLVK XVDJH PLQ
]HLFKQXQJ0LQHUDORLOLQHQJOLVFKVSUDFKLJHQ7H[ HUDORLOUHIHUVWRDKLJKO\UHILQHGOXEULFDWLQJRLOIUDF
WHQ EH]HLFKQHW HLQH EHVRQGHUV VRUJIlOWLJ DXVUDIIL WLRQ ZKLWH RLO  7KH WHUP DV XVHG E\ WKH (XURSHDQ
QLHUWH 6FKPLHU|OIUDNWLRQ :HL|O  DOOHUGLQJV YHU &RPPLVVLRQFRQIRUPLQJWRWKHHTXLYDOHQWXVDJHLQ
ZHQGHW GDV hEHUVHW]XQJVEUR GHU (XURSlLVFKHQ RWKHU(XURSHDQODQJXDJHVUHIHUVWRIXHOVDQGOXEUL
.RPPLVVLRQ0LQHUDORLODXFKIU0LQHUDO|O FDQWVGHULYHGIURPSHWUROHXP SHWUROHXPSURGXFWVLQ
VWDQGDUG(QJOLVK 

0LVFKHQ %OHQGLQJ
0LVFKHQ %OHQGLQJ  LVW HLQ 6RQGHUIDOO GHV 8P %OHQGLQJUHSUHVHQWVDVSHFLDOFDVHRISURGXFWWUDQVIHU
ODJHUQV EHL GHP PHKUHUH /DJHUWDQNV E]Z DXFK LQZKLFKVHYHUDOVWRUDJHWDQNVRUPHDQVRIWUDQVSRUW
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

7UDQVSRUWPLWWHOEHWHLOLJWVLQG DUHLQYROYHG

5RK|O &UXGHRLO
$OV5RK|O &UXGHRLO ZLUGGDV(UG|OEH]HLFKQHWVR &UXGHRLOLVWKHWHUPDSSOLHGWRSHWUROHXPRQFHLWKDV
EDOGHVEHLGHU)|UGHUXQJDQGLH(UGREHUIOlFKHJH EHHQEURXJKWWRWKHHDUWKVVXUIDFH
ODQJW

7UDQVSRUWPLWWHO 0HDQVRIWUDQVSRUW
7UDQVSRUWPLWWHO VLQG 6WUDHQWDQNZDJHQ (LVHQEDKQ 0HDQVRIWUDQVSRUWLQFOXGHWDQNWUXFNVUDLOWDQNFDUV
NHVVHOZDJHQ 6FKLIIH &RQWDLQHU XQG )HUQOHLWXQJHQ WDQNHU VKLSV EDUJHV  FRQWDLQHUV DQG ORQJGLVWDQFH
3LSHOLQHV  SLSHOLQHV

8PIOOHQ 5HILOOLQJ
8PIOOHQHQWVSULFKWGHP8PVFKODJHQ 5HILOOLQJLVV\QRQ\PRXVZLWKORDGLQJXQORDGLQJ

8PODJHUQ ,QSODQWWUDQVIHU
8PODJHUQ LVW GDV 8PSXPSHQ YRQ 0LQHUDO|OHQ YRQ ,QSODQWWUDQVIHUGHVLJQDWHVWKHSXPSLQJRIPLQHUDO
HLQHP/DJHUWDQNLQHLQHQDQGHUHQ RLOVIURPRQHVWRUDJHWDQNWRDQRWKHU

8PVFKODJHQ /RDGLQJXQORDGLQJ
8PVFKODJHQLVWGLH)|UGHUXQJYRQ6WRIIHQDXV7UDQV /RDGLQJXQORDGLQJ VWDQGV IRU WKH WUDQVIHU RI VXE
SRUWPLWWHOQLQDQGHUH7UDQVSRUWPLWWHORGHULQ/DJHU VWDQFHVIURPRQHPHDQVRIWUDQVSRUWWRDQRWKHUPHDQV
WDQNV VRZLH DXV /DJHUWDQNV LQ DQGHUH /DJHUWDQNV RIWUDQVSRUWRUVWRUDJHWDQNVRUIURPRQHVWRUDJHWDQN
RGHULQ7UDQVSRUWPLWWHO WRDQRWKHUVWRUDJHWDQNRUPHDQVRIWUDQVSRUW

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

1 Technologie 1 Technology
1.1 Allgemeines zu Mineralltanklgern und ihren 1.1 General information on mineral oil tank farms
Emissionsquellen and their emission sources
0LW 0LQHUDO|OWDQNOlJHUQ ZHUGHQ GLH 5RK|OYHUVRU 7KHSXUSRVHRIPLQHUDORLOWDQNIDUPVLVWRHQVXUHUH
JXQJGHU5DIILQHULHQXQGGHU:HJGHU)HUWLJSURGXNWH OLDEOHHFRORJLFDOO\FRPSDWLEOHDQGHFRQRPLFDOFUXGH
YRQ GHQ 5DIILQHULHQ ]X GHQ (QGYHUWHLOHUQ XQG 9HU RLOVXSSO\WRWKHUHILQHULHVDQGGLVWULEXWLRQRIWKHILQ
EUDXFKHUQ VLFKHU |NRORJLVFK VLQQYROO XQG |NRQR LVKHGSURGXFWVIURPWKHUHILQHULHVWRWKHILQDOGLVWULE
PLVFKJHVWDOWHW9RQGHQ7DQNOlJHUQGHU.RSIVWDWLR XWRUVDQGFRQVXPHUV&UXGHRLODQGPLQHUDORLOSURG
QHQ GHU 0LQHUDO|OIHUQOHLWXQJHQ ZHUGHQ 5RK|O XQG XFWV DUH VXSSOLHG IURP WKH SLSHOLQH WHUPLQDO WDQN
DXFK0LQHUDO|OSURGXNWH]XGHQ5DIILQHULHQE]ZDQ IDUPV WR WKH RLO UHILQHULHV DQGRU RWKHU WDQN IDUPV
GHUHQ7DQNOlJHUQWUDQVSRUWLHUW9RQGHQ5DIILQHULHQ )URPWKHUHILQHULHVPLQHUDORLOSURGXFWVDUHVXSSOLHG
ZHUGHQ 0LQHUDO|OSURGXNWH ]X GHQ 0LQHUDO|OWDQN WRWKHPLQHUDORLOWDQNIDUPVE\UDLOWDQNFDUVWDQN
OlJHUQ GXUFK (LVHQEDKQNHVVHOZDJHQ 6WUDHQWDQN WUXFNV WDQNHU VKLSV RU SLSHOLQHV DQG IURP WKHUH
ZDJHQ7DQNVFKLIIHRGHU)HUQOHLWXQJHQWUDQVSRUWLHUW WUXFNHGWRWKHILQDOGLVWULEXWRURUFRQVXPHURUORDGHG
XQGYRQGRUWPLWWHOV6WUDHQWDQNZDJHQ]XP(QGYHU RQWDQNHUVKLSVRUUDLOWDQNFDUV
WHLOHU RGHU 9HUEUDXFKHU EHI|UGHUW RGHU DXI 7DQN
VFKLIIHE]Z(LVHQEDKQNHVVHOZDJHQYHUODGHQ
1HEHQGLHVHU9HUWHLOHUIXQNWLRQGLHQHQGLH0LQHUDO|O %HVLGHV WKHLU GLVWULEXWLRQ IXQFWLRQ PLQHUDO RLO WDQN
WDQNOlJHU DOV 3XIIHU IU GHQ PHQJHQPlLJHQ $XV IDUPVDOVRVHUYHDVWRFNSLOLQJIXQFWLRQDVZHOODVD
JOHLFK]ZLVFKHQNRQWLQXLHUOLFKHU3URGXNWLRQXQGGLV EXIIHU IXQFWLRQ WR FRPSHQVDWH IRU YROXPH IOXFWXD
NRQWLQXLHUOLFKHP%HGDUIVRZLH]XU9RUUDWVKDOWXQJ WLRQV UHVXOWLQJ IURP FRQWLQXRXV SURGXFWLRQ FRQGL
WLRQVDQGYDULDWLRQVLQGHPDQG
(LQ 7DQNODJHU EHVWHKW LQ GHU 5HJHO DXV 7DQNV YHU $WDQNIDUPXVXDOO\FRQVLVWVRIVWRUDJHWDQNVRIGLIIHU
VFKLHGHQHU *U|HQ %H XQG (QWODGHYRUULFKWXQJHQ HQW VL]H ORDGLQJ DQG XQORDGLQJ HTXLSPHQW SLSLQJ
5RKUOHLWXQJHQXQG3XPSVWDWLRQHQVRZLH6LFKHUKHLWV SXPSLQJVWDWLRQVDVZHOODVVDIHW\DQGSROOXWLRQFRQ
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

XQG8PZHOWVFKXW]HLQULFKWXQJHQ WUROHTXLSPHQW
'LH(PLVVLRQVTXHOOHQVLQG (PLVVLRQVRXUFHVLQFOXGH
GHILQLHUWH $XVOlVVH DXV /DJHUWDQNV XQG JHJHEH GHILQHGVRXUFHVDWVWRUDJHWDQNVDQGZKHUHDSSOL
QHQIDOOVDXV7UDQVSRUWPLWWHOQ FDEOHPHDQVRIWUDQVSRUW
GHILQLHUWH $XVOlVVH YRQ 'lPSIHUFNJHZLQQXQJV GHILQHG VRXUFHV DW YDSRXU UHFRYHU\ RU RIIJDV
RGHU$EJDVUHLQLJXQJVDQODJHQ FOHDQLQJXQLWV
VRJHQDQQWHGLIIXVH4XHOOHQGDVKHLW.RKOHQ VRFDOOHG IXJLWLYH VRXUFHV LH K\GURFDUERQ
ZDVVHUVWRII(PLVVLRQHQ DXV VWDWLVFKHQ XQG G\QD HPLVVLRQV IURP VWDWLF DQG G\QDPLF VHDOLQJ HOH
PLVFKHQ'LFKWHOHPHQWHQ PHQWV
VRQVWLJH 4XHOOHQ EHL 3UREHQDKPHQ XQG 5HLQL RWKHUVRXUFHVGXULQJVDPSOLQJDQGFOHDQLQJRSHU
JXQJVYRUJlQJHQ DWLRQV
%HL GLHVHQ (PLVVLRQHQ KDQGHOW HV VLFK LP :HVHQW (PLVVLRQVIURPWKHDERYHVRXUFHVDUHSUHGRPLQDQWO\
OLFKHQXP.RKOHQZDVVHUVWRIIH K\GURFDUERQHPLVVLRQV

1.2 Lagerung von Minerallen 1.2 Storage of mineral oils


'LH/DJHUXQJHUIROJWLQXQWHULUGLVFKHQRGHUREHULUGL 0LQHUDO RLOV DUH VWRUHG LQ XQGHUJURXQG RU DERYH
VFKHQ%HKlOWHUQ 7DQNV 2EHULUGLVFKH7DQNVVLQGLQ JURXQG YHVVHOV WDQNV  'HSHQGLQJ RQ WKH SURGXFW
$EKlQJLJNHLW YRP /DJHUJXW DOV )HVWGDFK RGHU VWRUHG DERYHJURXQG WDQNV DUH GHVLJQHG DV IL[HG
6FKZLPPGDFKWDQNVDXVJHIKUW URRIRUIORDWLQJURRIWDQNV
,Q7DEHOOHZLUGHLQhEHUEOLFNEHUGLHEHL0LQH 7DEOHSUHVHQWVDQRYHUYLHZRIWKHWDQNW\SHVFRP
UDO|OWDQNOlJHUQEOLFKHQ7DQNEDXDUWHQJHJHEHQ PRQO\HQFRXQWHUHGDWPLQHUDORLOWDQNIDUPV

1.2.1 Festdachtanks 1.2.1 Fixed-roof tanks


)HVWGDFKWDQNV VLQG VWHKHQGH ]\OLQGULVFKH %HKlOWHU )L[HGURRI WDQNV DUH YHUWLFDO F\OLQGULFDO YHVVHOV
PLW)ODFKERGHQDXV%DXVWDKOPLWNDORWWHQRGHUNH HTXLSSHG ZLWK D IODW WDQN ERWWRP IDEULFDWHG IURP
JHOI|UPLJHQ 'lFKHUQ VLHKH %LOG   'HU]HLW VLQG VWUXFWXUDOVWHHODQGGRPHGRUFRQLFDOURRIV VHH)LJ
*U|HQELV]X PEHNDQQW,KUH%HXQG(QW XUH 7DQNVWRUDJHFDSDFLWLHVRIXSWRPDUH

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Tabelle 1. Bauarten von Lagertanks und Behltern


Table 1. Storage tank types
Ausrstung entsprechend VbF [3]****)
Equipment as per VbF [3]****)
Tankbauart Tankgre Norm
Tank type Tank size V/D-Ventil Standard
Lftungshaube
Pressure/
Venting hood
vacuum relief valve
Festdachtank/Fixed-roof tank > 100 m3 A I *), A II, B A III
Festdachtank mit Schwimmdecke
> 500 m3 A I **), A II, B A III DIN EN 14 015-1 [16]
Fixed-roof tank with internal floating deck
Schwimmdachtank/Floating-roof tank > 1000 m3 A I, A II ***)
liegend, oberirdisch
A l, A II, B DIN EN 12 285 [17]
horizontal, above-ground
Zylindrische Behlter liegend, unterirdisch
100 m3 A I, A II, B A III DIN 6608 [18]
Cylindrical vessels horizontal, underground
stehend, oberirdisch
A I, A II, B DIN 6618 [19]
vertical, above-ground
*DVVDPPHOOHLWXQJYDSRXUFROOHFWLQJOLQH
$OWHUQDWLYDQVFKOXVVDQ*DVVDPPHOOHLWXQJDOWHUQDWLYHFRQQHFWLRQWRYDSRXUFROOHFWLQJOLQH
QXU%HXQG(QWOIWXQJVYHQWLOYHQWYDOYHRQO\
:HQQ7DQNVGLHIU$ ,$ ,,RGHU%)OVVLJNHLWHQYRUJHVHKHQVLQGgIIQXQJHQ]XU$WPRVSKlUHRGHUHLQ3HQGHOV\VWHPDXIZHLVHQVLQGGLHVH
PLWHLQHU)ODPPHQGXUFKVFKODJVLFKHUXQJ]XYHUVHKHQ
:KHUHWDQNVLQWHQGHGIRUWKHVWRUDJHRI&ODVV$ ,$ ,,RU%OLTXLGVYHQWWRDWPRVSKHUHRUDUHHTXLSSHGZLWKDYDSRXUEDODQFLQJV\VWHPIODPH
DUUHVWHUVPXVWEHSURYLGHG
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

zur Tankentwsserungs-
Anlage Gefllegradient < 1%
to tank drain plant

Bild 1. Beispiel fr einen Festdachtank ohne Schwimmdecke Fig. 1. Example of a fixed-roof tank without internal floating deck
Sicherheitstechnische Ausrstung nicht vollstndig dargestellt Safety equipment not completely shown
1 Peilstutzen 1 gauging connection
2 Dachmannloch 2 deck-mounted access hatch
3 Probeentnahmestutzen 3 sample port
4 Detonationssicherung mit Anschluss 4 detonation arrester with connection to vapour
Gaspendelsystem balancing system
5 Tanklftungsstutzen 5 tank vent
6 automatische Pegelmessung 6 automatic level measuring instrument
7 Grobinhaltsanzeige 7 coarse level indicator
8 Befllung und Entleerung mit Produkt 8 product filling and emptying nozzle
9 Beheizung 9 heating system
10 Tankdoppelboden 10 double tank bottom
11 Peiltisch 11 gauge float
12 Tiefpunktentleerung 12 low-point drain
13 Rhrwerk 13 mixer
14 Gaspendelsystem 14 vapour balancing system

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

OIWXQJVHLQULFKWXQJHQVLQGVRGLPHQVLRQLHUWGDVVGHU FXUUHQWO\ NQRZQ 7KHLU YHQWLQJ GHYLFHV DUH GLPHQ


]XOlVVLJH'UXFNEHUHLFKGHV7DQNVHLQJHKDOWHQZLUG VLRQHGLQVXFKDZD\WKDWWKHGHVLJQSUHVVXUHUDQJHRI
'LH 7DQNV N|QQHQ PLW +HL]XQJVHLQULFKWXQJHQ XQG WKHWDQNLVQRWH[FHHGHG7KHWDQNVPD\EHHTXLSSHG
PLW HLQHP RGHU PHKUHUHQ 5KUZHUNHQ DXVJHUVWHW ZLWKKHDWLQJV\VWHPVDQGRQHRUVHYHUDOPL[HUV7KH\
VHLQ 6LH VLQG PLW HQWVSUHFKHQGHQ 5RKUOHLWXQJV DUHSURYLGHGZLWKDSSURSULDWHSLSLQJFRQQHFWLRQVIRU
DQVFKOVVHQ]XU%HIOOXQJXQG(QWOHHUXQJYHUVHKHQ ILOOLQJDQGHPSW\LQJDQGKDYHWKHQHFHVVDU\LQVWUX
XQGEHVLW]HQHLQHIUGLHhEHUZDFKXQJGHV%HWULHEV PHQWDWLRQDQGVDPSOLQJV\VWHPVIRURSHUDWLRQPRQL
HUIRUGHUOLFKH,QVWUXPHQWLHUXQJXQG3UREHQDKPHHLQ WRULQJ
ULFKWXQJ
)HVWGDFKWDQNVIU3URGXNWHPLWKRKHP'DPSIGUXFN )L[HGURRIWDQNVIRUKLJKYDSRXUSUHVVXUHSURGXFWV
GLHVVLQGLP$OOJHPHLQHQ3URGXNWHGHU*HIDKUHQ WKHVH DUH XVXDOO\ &ODVV $ , DQG $ ,, SURGXFWV  DUH
NODVVH$ ,XQG$ ,,VLQGLQGHU5HJHOPLW9DNXXP JHQHUDOO\ HTXLSSHG ZLWK YDFXXPSUHVVXUH UHOLHI
'UXFNYHQWLOHQ 9'9HQWLOHQ  DXVJHVWDWWHW >@ YDOYHV 93YDOYHV >@ VHH6HFWLRQ )L[HG
VLHKH $EVFKQLWW   'LH )HVWGDFKWDQNV IU $ , URRIWDQNVIRU&ODVV$ ,SURGXFWVDUHQRUPDOO\FRQ
3URGXNWHVLQGLP$OOJHPHLQHQDQHLQH*DVVDPPHO QHFWHGWRDYDSRXUFROOHFWLQJOLQH7KHXVHRILQWHUQDO
OHLWXQJDQJHVFKORVVHQ'LH$XVUVWXQJPLWHLQHULQ IORDWLQJ GHFNV LV OLPLWHG WR H[FHSWLRQDO FDVHV HJ
QHQOLHJHQGHQ6FKZLPPGHFNHZLUGQXUQRFKLQ$XV ZKHQWKHWDQNLVFRQQHFWHGWRDQRLOSLSHOLQH ,QVSH
QDKPHIlOOHQ ]XP %HLVSLHO EHL $QELQGXQJ DQ HLQH FLDOFDVHVERWK93YDOYHVDQGLQWHUQDOIORDWLQJGHFNV
0LQHUDO|OIHUQOHLWXQJ  YRUJHIXQGHQ ,Q EHVRQGHUHQ DUHSURYLGHG
)lOOHQN|QQHQEHLGH(LQULFKWXQJHQYRUKDQGHQVHLQ
3URGXNWH PLW )ODPPSXQNW EHU  &  *HIDKUHQ %\ FRQWUDVW SURGXFWV ZLWK D IODVK SRLQW H[FHHGLQJ
NODVVH $ ,,,  ZHUGHQ GDJHJHQ LP $OOJHPHLQHQ LQ  &+D]DUG&ODVV$ ,,,DUHFRPPRQO\VWRUHGLQ
)HVWGDFKWDQNVPLWRIIHQHQ/IWXQJVKDXEHQJHODJHUW IL[HGURRIWDQNVZLWKRSHQYHQWKRRGV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

1.2.2 Schwimmdachtanks 1.2.2 Floating-roof tanks


6FKZLPPGDFKWDQNVVLQGQDFKREHQRIIHQHVWHKHQGH )ORDWLQJURRIWDQNVDUHYHUWLFDORSHQWRSF\OLQGULFDO
]\OLQGULVFKH %HKlOWHU GLH GXUFK HLQ 6FKZLPPGDFK YHVVHOVZKLFKDUHVHDOHGDJDLQVWWKHDWPRVSKHUHE\D
]XU$WPRVSKlUHDEJHGLFKWHWVLQG VLHKH%LOG  IORDWLQJURRI VHH)LJXUH 
6FKZLPPGlFKHU VLQG EHZHJOLFKH 6WDKONRQVWUXNWLR )ORDWLQJURRIVDUHPRYDEOHVWHHOVWUXFWXUHVGHVLJQHG
QHQ GLH DOV 5LQJSRQWRQGDFK PLW HLQIDFKHP 0LW HLWKHUDVULQJSRQWRRQURRIV ZLWKVLQJOHGHFNFHQWUDO
WHOWHLO RGHUDOV'RSSHOSRQWRQGDFK 'RSSHOGHFNEHU VHFWLRQ  RU DV GRXEOHGHFN SRQWRRQ URRIV GRXEOH
GLHJHVDPWH2EHUIOlFKH DXVJHIKUWZHUGHQ GHFNH[WHQGLQJRYHUWKHHQWLUHVXUIDFH 
'HU 5LQJVSDOW ]ZLVFKHQ :DQGXQJ XQG 6FKZLPP 7KHDQQXODUVSDFHEHWZHHQWKHWDQNZDOODQGIORDWLQJ
GDFK ZLUG DEJHGLFKWHW 'LH 6FKZLPPGlFKHU KDEHQ URRIHGJHLVFORVHGE\DULPVHDOLQJV\VWHP7KHIORDW
7DQNGDFKVWW]HQDXIGHQHQGDV7DQNGDFKEHLY|OOL LQJ URRIV DUH HTXLSSHG ZLWK OHJV RQ ZKLFK WKH URRI
JHU(QWOHHUXQJDXIGHP7DQNERGHQVWHKHQNDQQ%H GHFNVHWWOHVDWWKHWDQNERWWRPZKHQWKHWDQNLVFRP
XQG (QWOIWXQJVYHQWLOH VRUJHQ GDIU GDVV EHL 3UR SOHWHO\HPSWLHG9HQWYDOYHVHQVXUHWKDWDLUFDQHQWHU
GXNWPHQJHQYHUlQGHUXQJ LP DXIVWHKHQGHQ =XVWDQG RUHVFDSHIURPWKHVSDFHXQGHUQHDWKWKHIORDWLQJURRI
/XIWXQWHUGDV6FKZLPPGDFKJHODQJHQE]ZGDUXQWHU GXULQJ FKDQJHV LQ WKH SURGXFW OHYHO ZKLOH WKH URRI
HQWZHLFKHQ NDQQ )HUQHU VLQG 6FKZLPPGDFKWDQNV GHFN LV IORDWHG RII LWV OHJV 0RUHRYHU IORDWLQJURRI
PLW3HLOXQG)KUXQJVURKUHQDXVJHVWDWWHW WDQNVDUHHTXLSSHGZLWKJDXJLQJDQGJXLGHSROHV
'HU]HLWVLQG%DXJU|HQELV]X PEHNDQQW )ORDWLQJ URRI WDQNV ZLWK FDSDFLWLHV RI XS WR
 PDUHFXUUHQWO\NQRZQ
%HLGHU%HIOOXQJYRQ6FKZLPPGDFKWDQNVZLUGGDV $VWKHVWRUDJHWDQNLVEHLQJILOOHGWKHIORDWLQJURRILV
6FKZLPPGDFK PLW GHP )OVVLJNHLWVVSLHJHO DQJH OLIWHGE\WKHULVLQJOLTXLGOHYHO:KHQWKHWDQNLVEH
KREHQ %HL GHU (QWOHHUXQJ YRQ 6FKZLPPGDFKWDQNV LQJHPSWLHGWKHIORDWLQJURRIGHVFHQGV7KHHYDSRUD
VHQNW VLFK GDV 6FKZLPPGDFK DE 'DEHL YHUGXQVWHW WLRQORVVHVRFFXUULQJGXULQJSURGXFWZLWKGUDZDODUH
LP :HVHQWOLFKHQ GLH )OVVLJNHLWVPHQJH GLH EHLP ODUJHO\ OLPLWHG WR WKH OLTXLG YROXPH FOLQJLQJ WR WKH
$EVHQNHQGHV)OVVLJNHLWVVSLHJHOVDQGHQ7DQNZlQ WDQNZDOODVWKHOLTXLGOHYHOGURSV
GHQKDIWHQEOHLEW

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Bild 2. Beispiel fr einen Schwimmdachtank (Ringpontondach) Fig. 2. Example of a floating-roof tank (pontoon roof)
Sicherheitstechnische Ausrstung nicht vollstndig dargestellt Safety equipment not completely shown
1 Fllstandmessung 1 level measuring instrument
2 Handpeilung 2 manual gauging port
3 Temperaturmessung 3 temperature measuring instrument
4 Bhne 4 platform
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

5 Dachmannloch 5 deck-mounted access hatch


6 Pontonmannloch 6 pontoon access hatch
7 Randabdichtung (flexible) 7 flexible rim seal
8 Schwimmdachsttze 8 floating-roof leg
9 Be- und Entlftung (automatische) 9 vent valve (automatic)
10 Peilstutzen 10 gauging port
11 Randpeilstutzen 11 peripheral gauging connection
12 Schlauchumgang am Gelenk 12 hose guide system
13 Dachentwsserung 13 roof drain
14 Peiltisch 14 gauge float
15 Tankentwsserung 15 tank drain
16 Geflle 16 slope
17 Befllung und Entleerung fr Produkte 17 filling and emptying nozzle
18 Gelenkrohr (schwimmende Absaugung) 18 pivoted tube (floating vapour extraction system)
19 Bodenentleerung 19 bottom drain
20 Resteentleerung 20 residue drain
21 Fhrungsrohr 21 guide pole
22 Tankdoppelboden 22 double tank bottom

1.2.3 Zylindrische Behlter 1.2.3 Cylindrical vessels


6WHKHQGHXQGOLHJHQGH]\OLQGULVFKH%HKlOWHUVLQGLQ 9HUWLFDODQGKRUL]RQWDOF\OLQGULFDOVWRUDJHYHVVHOVDUH
$XVUVWXQJ XQG %HWULHEVZHLVH PLW )HVWGDFKWDQNV FRPSDUDEOH ZLWK IL[HGURRI WDQNV ZLWKRXW LQWHUQDO
RKQH6FKZLPPGHFNHYHUJOHLFKEDU$OVREHULUGLVFKH IORDWLQJ GHFN LQ ERWK WKHLU HTXLSPHQW DQG PRGH RI
VWHKHQGHRGHUOLHJHQGH%HKlOWHUOLHJHQVLHLQHLQHP RSHUDWLRQ$ERYHJURXQGYHUWLFDORUKRUL]RQWDOVWRU
$XIIDQJUDXPDXI6DWWHOIXQGDPHQWHQDXIRGHUZHUGHQ DJHYHVVHOVUHVWRQVDGGOHVXSSRUWVLQDWDQNEXQGRU
GRSSHOZDQGLJDXVJHIKUW$OVXQWHULUGLVFKHOLHJHQGH DUHRIWKHGRXEOHZDOOGHVLJQ8QGHUJURXQGKRUL]RQ
%HKlOWHU VLQG VLH GRSSHOZDQGLJ PLW /HFNEHU WDOVWRUDJHYHVVHOVDUHRIWKHGRXEOHZDOOGHVLJQDQG
ZDFKXQJDXVJHUVWHW HTXLSSHGZLWKOHDNDJHPRQLWRULQJV\VWHPV
(VVLQG%DXJU|HQELV]XPEHNDQQW 7DQNVL]HVXSWRPDUHFXUUHQWO\NQRZQ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

1.3 Umschlag von Minerallen 1.3 Loading/unloading of mineral oils


VLHKH%LOG VHH)LJXUH
1.3.1 Einlagern 1.3.1 Product supply
'LH (LQODJHUXQJ YRQ 0LQHUDO|OHQ HUIROJW EHUZLH 0LQHUDO RLOV DUH PDLQO\ GHOLYHUHG RQ UDLO WDQN FDUV
JHQGDXV(LVHQEDKQNHVVHOZDJHQ .:* 7DQNVFKLI WDQNHU VKLSV RU WDQN WUXFNV 7KH PLQHUDO RLOV DUH
IHQRGHU6WUDHQWDQNZDJHQ 7.: 'LH0LQHUDO|OH SXPSHGIURPWKHWUDQVSRUWLQJYHVVHOVWRWKHVWRUDJH
ZHUGHQEHUO|VEDUH5RKURGHU6FKODXFKYHUELQGXQ WDQNV YLD UHPRYDEOH FRQQHFWLQJ SLSHV RU KRVLQJ RU
JHQHYHQWXHOOPLW(QWODGHDUPHQDXVGHQ7UDQV XQORDGLQJDUPVDVWKHFDVHPD\EH7KHFRQQHFWLRQV
SRUWEHKlOWHUQLQGLH7DQNVHQWODGHQ'LH9HUELQGXQ DUHPDGHE\PHDQVRIFRXSOLQJV7UDQVIHUIURPWKH
JHQ ZHUGHQ PLW .XSSOXQJHQ KHUJHVWHOOW 'LH 0LQH WUDQVSRUWLQJ YHVVHOV WR WKH VWRUDJH WDQNV LV DFFRP
UDO|OHZHUGHQHQWZHGHUPLWVWDWLRQlUHQ3XPSHLQULFK SOLVKHG E\ VWDWLRQDU\ SXPSLQJ V\VWHPV UDLO WDQN
WXQJHQDXVGHQ7UDQVSRUWEHKlOWHUQ .:* RGHUPLW FDUV RUE\ERDUGPRXQWHGSXPSV WDQNWUXFNWDQNHU
IDKU]HXJHLJHQHQ3XPSHQ 7.:6FKLII LQGLH7DQNV VKLS 9ROXPHPHWHUVDQGVFDOHVDUHSURYLGHGWRGH
JHIOOW9ROXPHQPHVVXQGRGHU:lJHHLQULFKWXQJHQ WHUPLQH WKH H[DFW TXDQWLWLHV RI VXSSOLHG SURGXFW
GLHQHQ]XUJHQDXHQ(UIDVVXQJGHUHLQJHODJHUWHQ3UR 0LQHUDORLOSURGXFWVPD\DOVREHVXSSOLHGYLDSLSH
GXNWPHQJHQ'LH(LQODJHUXQJYRQ0LQHUDO|OHQNDQQ OLQHV$GGLWLYHVDQGDX[LOLDULHVDUHPDLQO\GHOLYHUHG
DXFKEHU0LQHUDO|OIHUQOHLWXQJHQHUIROJHQ$XV6WUD RQWDQNWUXFNVDQGLQFRQWDLQHUV
HQWDQNZDJHQXQG&RQWDLQHUQZHUGHQEHUZLHJHQG
$GGLWLYHRGHU+LOIVVWRIIHHLQJHODJHUW
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Bild 3. Arbeitsvorgnge in Tanklgern


bei Rohl und Minerallprodukten mit einem Dampfdruck von mehr als 13 mbar (13 hPa) bei einer Temperatur von 20 C

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

vapour
offgas
recovery unit

vapour buffer vessel

vapour balancing
system

means of transport floating-roof fixed-roof means of transport


(pipeline, road or rail (pipeline, road or rail
tanker, ship) tank tank tanker, ship)

in-plant transfer/blending

loading/refilling
product supply storage product withdrawal
(delivery) (loading)

product lines: vapour balancing lines:


Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

required

optional
Fig. 3. Operations in tank farms
for crude oil and mineral oil products having a vapour pressure greater than 13 mbar (13 hPa) at a temperature of 20 C

1.3.2 Auslagern 1.3.2 Product withdrawal


'LH$XVODJHUXQJYRQ0LQHUDO|OHQHUIROJWEHU)OO 0LQHUDO RLOV DUH ZLWKGUDZQ YLD ORDGLQJ VWDWLRQV
VWHOOHQ 'LHVH EHVWHKHQ DXV HLQHP 9HUODGHDUP GHU 7KHVHFRQVLVWRIDORDGLQJDUPZKLFKLVHLWKHULQWUR
HQWZHGHU EHL 2EHQEHIOOXQJ YRQ REHQ EHU HLQHQ GXFHGLQWRWKHWUDQVSRUWLQJYHVVHOIURPWKHWRSYLDD
'RPLQGHQ7UDQVSRUWEHKlOWHU 7.:XQG.:* HLQ GRPH WDQNWUXFNVDQGUDLOWDQNFDUV IRUVXEPHUJHG
JHIKUW 8QWHUVSLHJHOEHIOOXQJ RGHUEHL8QWHQEHIO WRS ORDGLQJ RU DWWDFKHG YLD D FRXSOLQJ IRU ERWWRP
OXQJPLWHLQHU.XSSOXQJDQJHVFKODJHQZLUG 7.:  ORDGLQJ WDQNWUXFNV ,QWKHFDVHRIVKLSVWKHORDGLQJ
%HL6FKLIIHQZLUGGHU9HUODGHDUPRGHU6FKODXFKDQ DUPRUKRVHLVILUPO\IODQJHGWRWKHGLVWULEXWLRQV\V
GDV 9HUWHLOHUV\VWHP IHVW DQJHIODQVFKW 6WDWLRQlUH WHP6WDWLRQDU\PHWHUVDQGVFDOHVUHFRUGWKHYROXPHV
=lKOHURGHU:DDJHQHUIDVVHQGLHDEJHJHEHQHQ0LQH ZLWKGUDZQZKLFKDUHORDGHGE\PHDQVRISXPSVSUR
UDO|OPHQJHQGLHPLWODJHUVHLWLJHQ3XPSHQYHUODGHQ YLGHGDWWKHWDQNIDUP
ZHUGHQ
'DV $XVODJHUQ YRQ 0LQHUDO|OHQ NDQQ DXFK EHU 0LQHUDO RLOV FDQ DOVR EH ZLWKGUDZQ YLD PLQHUDO RLO
0LQHUDO|OIHUQOHLWXQJHQHUIROJHQ SLSHOLQHV
,Q GHU 7DEHOOH  VLQG GLH MHZHLOLJHQ 8PVFKODJV /RDGLQJXQORDGLQJGDWDIRUWKHLQGLYLGXDOPHDQVRI
GDWHQDXIJHOLVWHW WUDQVSRUWDUHJLYHQLQ7DEOH

1.3.3 Umlagern und Mischen 1.3.3 In-plant transfer and blending


'DV 8PODJHUQ XQG 0LVFKHQ YRQ 0LQHUDO|OHQ E]Z ,QSODQW WUDQVIHU RI PLQHUDO RLOV DQGRU PLQHUDO RLO
0LQHUDO|ONRPSRQHQWHQLQQHUKDOEGHV7DQNODJHUVHU FRPSRQHQWVIRUEOHQGLQJZLWKLQWKHWDQNIDUPLVDF

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Tabelle 2. Umschlagsdaten
Transportmittel Pumprate Menge je Vorgang
m3/h m3

Einlagern Auslagern Einlagern Auslagern

Fernleitung bei Produkten: bei Produkten:


500 bis 3000 500 bis 2000 10 000 bis 100 000 10 000 bis 100 000
bei Rohlen: bei Rohlen:
1000 bis 5000 1000 bis 2500

Tankschiff bei Produkten: bei Produkten: abhngig von der Schiffsgre abhngig von der Schiffsgre
200 bis 1000 200 bis 400
bei Rohlen: bei Rohlen:
bis 12 000 bis 3000

Kesselwagen 250 bis 700 120 bis 700 Einzelkesselwagen: Einzelkesselwagen:


30 bis 90 30 bis 90
Ganzzug: 1750 Ganzzug: 1750

Straentankwagen 50 bis 75 120 bis 250 bis 40 bis 40

Container 50 bis 75 120 bis 250 25 25

Table 2. Loading/unloading data


Means of transport Pumping rate Volume per cycle
m3/h m3

Supply Withdrawal Supply Withdrawal

Pipeline Products: Products:


500 to 3,000 500 to 2,000 10,000 to 100,000 10,000 to 100,000
Crude oils: Crude oils:
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

1,000 to 5,000 1,000 to 2,500

Tanker ship Products: Products: depending on tanker capacity depending on tanker capacity
200 to 1,000 200 to 400
Crude oils: Crude oils:
up to 12,000 up to 3,000

Rail tank car 250 to 700 120 to 700 Single rail tank car: Single rail tank car:
30 to 90 30 to 90
Complete train: 1,750 Complete train: 1,750

Tank truck 50 to 75 120 to 250 up to 40 up to 40

Container 50 to 75 120 to 250 25 25

IROJW EHU IHVWLQVWDOOLHUWH 5RKUOHLWXQJHQ XQG 3XPS FRPSOLVKHGE\PHDQVRISHUPDQHQWO\LQVWDOOHGSLSLQJ


VWDWLRQHQ(QWVSUHFKHQGHVJLOWIUGDV8PODJHUQGDV V\VWHPVDQGSXPSVWDWLRQV7KHVDPHDSSOLHVWRSURG
QXULQ(LQ]HOIlOOHQHUIROJW XFWWUDQVIHUIURPRQHVWRUDJHWDQNWRDQRWKHUZKLFKLV
KRZHYHUOLPLWHGWRLQGLYLGXDOFDVHV
'LH =XJDEH YRQ $GGLWLYHQ HUIROJW LP $OOJHPHLQHQ $GGLWLYHV DUH QRUPDOO\ DGPL[HG LQ DQ HQGSRLQW
DOV(QGSXQNWGRVLHUXQJPLW3XPSUDWHQXQWHUPK SURFHVVDWSXPSLQJUDWHVVPDOOHUWKDQPK

1.4 Frderung in Rohrleitungen, Dichtsysteme 1.4 Transport in piping lines, sealing systems
'LH)|UGHUXQJGHU0LQHUDO|OHHUIROJWEHU5RKUOHL 0LQHUDORLOVDUHFRQYH\HGE\SXPSVYLDSLSLQJOLQHV
WXQJHQPLW3XPSHQ
$Q 5RKUOHLWXQJHQ 3XPSHQ VRZLH $EVSHUU XQG 3LSLQJOLQHVSXPSVDVZHOODVWKHVKXWRIIDQGFRQWURO
5HJHORUJDQHQZHUGHQ'LFKWV\VWHPHHLQJHVHW]W YDOYHVDUHSURYLGHGZLWKVHDOLQJV\VWHPV

1.4.1 Pumpen 1.4.1 Pumps


=XP7UDQVSRUWGHU0LQHUDO|OHZHUGHQEHUZLHJHQG 0LQHUDORLOVDUHSUHGRPLQDQWO\SXPSHGE\FHQWULIX
.UHLVHOSXPSHQ YHUZHQGHW )U VSH]LHOOH $QZHQ JDO SXPSV 5RWDU\ DQG RVFLOODWLQJ GLVSODFHPHQW

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

GXQJVIlOOH ZHUGHQ 9HUGUlQJHUSXPSHQ URWLHUHQGHU SXPSVVXFKDVJHDUSXPSVVFUHZSXPSVDQGURWDU\


XQGRV]LOOLHUHQGHU%DXDUWZLH=DKQUDG6FKUDXEHQ OREHSXPSVRUSLVWRQDQGGLDSKUDJPSXPSVDUHHP
VSLQGHOXQG.UHLVNROEHQSXPSHQRGHU.ROEHQXQG SOR\HGLQVSHFLDODSSOLFDWLRQV
0HPEUDQSXPSHQEHQXW]W
%HL.UHLVHOSXPSHQXQGURWLHUHQGHQ9HUGUlQJHUSXP &HQWULIXJDO SXPSV DQG URWDU\ GLVSODFHPHQW SXPSV
SHQZHUGHQLP$OOJHPHLQHQ*OHLWULQJGLFKWXQJHQLQ DUH JHQHUDOO\ HTXLSSHG ZLWK VLQJOH RU PXOWLSOH PH
(LQ]HO RGHU 0HKUIDFKDQRUGQXQJ HLQJHVHW]W 'XUFK FKDQLFDOVHDOV7KHXVHRIWZRPHFKDQLFDOVHDOVLQD
GLH 9HUZHQGXQJ YRQ ]ZHL *OHLWULQJGLFKWXQJHQ DOV PXOWLSOHPHFKDQLFDOVHDODUUDQJHPHQWDOORZVWKHLQ
0HKUIDFK*OHLWULQJGLFKWXQJ HU|IIQHW VLFK GLH 0|J FRUSRUDWLRQRIDSURWHFWLRQRUDODUPIXQFWLRQ0XOWL
OLFKNHLWHLQH6FKXW]RGHU6LJQDOIXQNWLRQHLQ]XULFK SOHPHFKDQLFDOVHDOVFDQEHRSHUDWHGZLWKDTXHQFK
WHQ %HL 0HKUIDFK*OHLWULQJGLFKWXQJHQ HUP|JOLFKW V\VWHP TXHQFKIOXLGSUHVVXUHPDLQWDLQHGEHORZWKH
GLH $QZHQGXQJ YRQ 9RUODJHPHGLHQ 9RUODJHPHGL SUHVVXUH XSVWUHDP RI WKH SURGXFWVLGH PHFKDQLFDO
XPVGUXFNNOHLQHUDOVGHU'UXFNYRUGHUSURGXNWVHLWL VHDO RUDEXIIHUV\VWHP EXIIHUIOXLGSUHVVXUHPDLQ
JHQ *OHLWULQJGLFKWXQJ  RGHU 6SHUUPHGLHQ 9RUODJH WDLQHG DERYH WKH SUHVVXUH XSVWUHDP RI WKH SURGXFW
PHGLXPVGUXFNJU|HUDOVGHU'UXFNYRUGHUSURGXNW VLGHPHFKDQLFDOVHDO WRSURYLGHDGGLWLRQDORSHUDWLQJ
VHLWLJHQ*OHLWULQJGLFKWXQJ KLHUEHLGLH.RQWUROOHGHU UHOLDELOLW\RIWKHVHDOLQJV\VWHP7KHTXHQFKV\VWHP
)XQNWLRQVIlKLJNHLW GHV 'LFKWV\VWHPV 'DV 9RUODJH FDQEHSURYLGHGZLWKDYHQWFRQQHFWLRQWRDQDSSUR
V\VWHPNDQQDQHLQJHHLJQHWHV*DVVDPPHOV\VWHPDQ SULDWHYDSRXUFROOHFWLRQV\VWHP
JHVFKORVVHQZHUGHQ
$OV .UHLVHOSXPSHQ XQG URWLHUHQGH 9HUGUlQJHUSXP &HQWULIXJDOSXPSVDQGURWDU\SRVLWLYHGLVSODFHPHQW
SHQNRPPHQDXFKZHOOHQGLFKWXQJVORVH3XPSHQZLH SXPSVPD\DOVREHRIWKHVHDOOHVVW\SHVXFKDVPDJ
0DJQHWNXSSOXQJVSXPSHQ XQG 6SDOWURKUPRWRUSXP QHWLFDOO\FRXSOHGSXPSVDQGFDQQHGPRWRUSXPSV
SHQ]XP(LQVDW]
,QEHJUQGHWHQ(LQ]HOIlOOHQN|QQHQIUKRFKYLVNRVH ,QMXVWLILHGLQGLYLGXDOFDVHVSDFNLQJJODQGVPD\EH
3URGXNWHZLHVFKZHUHV+HL]|OGLHQXULPEHKHL]WHQ XVHGDVDQDOWHUQDWLYHWRWKHDERYHVHDOLQJV\VWHPVIRU
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

=XVWDQG SXPSIlKLJ VLQG QHEHQ GHQ YRUJHQDQQWHQ KLJKYLVFRVLW\SURGXFWVVXFKDVKHDY\IXHORLOZKLFK


'LFKWV\VWHPHQ DXFK 6WRSIEXFKVHQ PLW 3DFNXQJHQ LVRQO\SXPSDEOHLQWKHKHDWHGFRQGLWLRQ
]XU$EGLFKWXQJYHUZHQGHWZHUGHQ

1.4.2 Absperr- und Regelorgane 1.4.2 Shutoff and control valves


'LH 6SLQGHO XQG :HOOHQGXUFKIKUXQJHQ YRQ $E 7KHVWHPDQGVKDIWEXVKLQJVRIWKHVKXWRIIDQGFRQ
VSHUUXQG5HJHORUJDQHQZHUGHQ]XP%HLVSLHOGXUFK WURO YDOYHV DUH VHDOHG E\ SDFNLQJ JODQGV EHOORZV
6WRSIEXFKVHQ )DOWHQElOJH  XQG  5XQGGLFKWULQJH VHDOVDQG2ULQJVHDOVIRULQVWDQFH
25LQJH DEJHGLFKWHW

1.4.3 Flanschverbindungen 1.4.3 Flanged joints


)ODQVFKYHUELQGXQJHQZHUGHQQXULQGHQ)lOOHQHLQ )ODQJHG MRLQWV DUH RQO\ XVHG ZKHUH DEVROXWHO\ UH
JHVHW]W LQ GHQHQ VLH DXV 9HUIDKUHQV 6LFKHUKHLWV TXLUHG IRU SURFHVV VDIHW\ RU PDLQWHQDQFH UHDVRQV
RGHU ,QVWDQGKDOWXQJVJUQGHQ QRWZHQGLJ VLQG 6LH )ODQJH IDFLQJV HPSOR\HG LQFOXGH SODLQ IDFLQJV
ZHUGHQ PLW JODWWHU 'LFKWOHLVWH 1XW XQG )HGHU RGHU WRQJXHDQGJURRYHRUPDOHDQGIHPDOHIDFLQJV7KH
9RUXQG5FNVSUXQJDXVJHIKUW,QVEHVRQGHUHZHU IROORZLQJIODQJHJDVNHWVDUHSUHIHUUHGVRIWHODVWRPHU
GHQEHYRU]XJWHLQJHVHW]W:HLFKVWRIIGLFKWXQJHQDXI JDVNHWVVRIWILEUHEDVHGJDVNHWVZLWKRUZLWKRXWLQ
(ODVWRPHUEDVLV:HLFKVWRIIGLFKWXQJHQDXI)DVHUEDVLV WHUQDOPHWDOUHLQIRUFHPHQWRUJUDSKLWHEDVHGJDVNHWV
PLWRGHURKQHLQQHUH0HWDOOYHUVWlUNXQJRGHUDXI*UD ZLWKRUZLWKRXWLQWHUQDOPHWDOUHLQIRUFHPHQW
ILWEDVLVPLWRGHURKQHLQQHUH0HWDOOYHUVWlUNXQJ

1.4.4 Kappen und Blindflansche 1.4.4 Caps and blind flanges


(QWOHHUXQJV XQG (QWOIWXQJVVWXW]HQ DQ 7LHI XQG 'UDLQDQGYHQWQR]]OHVDWSLSLQJV\VWHPORZDQGKLJK
+RFKSXQNWHQYRQ5RKUOHLWXQJVV\VWHPHQZHUGHQQXU SRLQWVDUHRQO\RFFDVLRQDOO\RSHUDWHG)RUUHDVRQVRI
JHOHJHQWOLFK EHQXW]W $XV *UQGHQ GHU $QODJHQ V\VWHPVDIHW\WKHVHQR]]OHVDUHVHDOHGE\PHDQVRI
VLFKHUKHLWZHUGHQVROFKH6WXW]HQPLW6FKUDXENDSSHQ VFUHZFDSVRUEOLQGIODQJHV
RGHU%OLQGIODQVFKHQGLFKWJHVHW]W

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

1.5 Sonstige Vorgnge 1.5 Other operations


1.5.1 Tankreinigung 1.5.1 Tank cleaning
)U GLH WXUQXVPlLJHQ LQQHUHQ 7DQNSUIXQJHQ XQG )RUURXWLQHLQWHUQDOWDQNLQVSHFWLRQVDQGUHSDLUSXU
]X5HSDUDWXU]ZHFNHQPVVHQGLH7DQNVJHOHHUWJH SRVHV WKH WDQNV PXVW EH HPSWLHG FOHDQHG DQG UHQ
UHLQLJWXQGJDVIUHLJHPDFKWZHUGHQ%HLGHU7DQNUHL GHUHGJDVIUHH5HJDUGLQJWDQNFOHDQLQJDGLVWLQFWLRQ
QLJXQJPXVVJUXQGVlW]OLFK]ZLVFKHQ5RK|OWDQNVXQG LVPDGHEHWZHHQFUXGHRLOWDQNVDQGSURGXFWWDQNV
3URGXNWHQWDQNV XQWHUVFKLHGHQ ZHUGHQ 5RK|OH HQW $SDUW IURP K\GURFDUERQV FUXGH RLOV DOVR FRQWDLQ
KDOWHQ QHEHQ .RKOHQZDVVHUVWRIIHQ DXFK 6HGLPHQWH VHGLPHQWV RULJLQDWLQJ IURP SHWUROHXP H[WUDFWLRQ
DXV GHU (UG|OI|UGHUXQJ 'LH 5RK|OWDQNV ZLUNHQ DOV 7KH FUXGH RLO WDQNV DFW DV VHWWOLQJ WDQNV LQ ZKLFK
$EVHW]EHKlOWHULQGHQHQVLFKQHEHQGLHVHQDQRUJDQL WKHVHLQRUJDQLFVHGLPHQWVVHWWOHWRJHWKHUZLWKKLJK
VFKHQ6HGLPHQWHQDXFKKRFKPROHNXODUH3DUDIILQHDOV PROHFXODUSDUDIILQVIRUPLQJVRFDOOHGVODFNZD[HV
VRJHQDQQWHU*DWVFKDEVHW]HQ,Q3URGXNWHQWDQNVEH 3URGXFW WDQNV RQ WKH RWKHU KDQG VWRUH GLVWLOODWHV
ILQGHQ VLFK 'HVWLOODWH GLH NHLQH VHGLPHQWLHUEDUHQ ZKLFK DUH IUHH IURP VHWWODEOH VROLGV $FFRUGLQJO\
6WRIIHHQWKDOWHQ(LQHDXIZlQGLJH7DQNUHLQLJXQJLVW RQO\FUXGHRLOWDQNVUHTXLUHH[WHQVLYHFOHDQLQJ
VRPLWQXUEHL5RK|OWDQNVQRWZHQGLJ
=XU5HLQLJXQJYRQ5RK|OWDQNVZXUGHQYHUVFKLHGHQH $YDULHW\RIFOHDQLQJPHWKRGVKDVEHHQGHYHORSHGIRU
5HLQLJXQJVYHUIDKUHQHQWZLFNHOW>@%HLDOOHQ9HU FUXGH RLO WDQNV >@ 7KH SULQFLSOH XQGHUO\LQJ DOO
IDKUHQZLUGGXUFKGDV(LQEULQJHQYRQ(QHUJLHLQGHQ WKHVHPHWKRGVLVWKHGLVVROXWLRQDQGZKLUOXSRIWKH
7DQN HLQ P|JOLFKVW KRKHU $QWHLO GHV *DWVFKHV EHL VODFNZD[HVE\LQWURGXFLQJHQHUJ\VRDVWREULQJDV
QRFKJHVFKORVVHQHP7DQNGXUFK$XIO|VHQXQG$XI KLJKDSURSRUWLRQRIWKHWDQNERWWRPVDVSRVVLEOHLQWR
ZLUEHOQ LQ GLH 6FKZHEHSKDVH JHEUDFKW XP LKQ ]X VXVSHQVLRQZKLOHWKHWDQNLVVWLOOFORVHGDQGSXPSLW
HLQHU VHSDUDWHQ %HKDQGOXQJ DESXPSHQ ]X N|QQHQ RIIIRUVHSDUDWHWUHDWPHQW)XUWKHUPRUHWKHORZERLO
)HUQHUVROOHQGLHLP*DWVFKHQWKDOWHQHQOHLFKWIOFKWL LQJ K\GURFDUERQV FRQWDLQHG LQ WKH VODFN ZD[HV
JHQ.RKOHQZDVVHUVWRIIHLQHLQHP6SOPHGLXPJHO|VW VKRXOGEHGLVVROYHGLQDIOXVKLQJPHGLXPDQGOLNH
XQGHEHQIDOOVDXVJHWUDJHQZHUGHQ ZLVHEHGLVFKDUJHG
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

)UGLHLQQHUH7DQNSUIXQJYRQ3URGXNWHQWDQNVXQG 3URGXFWWDQNVDUHFRPSOHWHO\HPSWLHGDQGUHQGHUHG
]X 5HSDUDWXU]ZHFNHQ ZHUGHQ GLHVH UHVWHQWOHHUW XQG JDVIUHHIRULQWHUQDOLQVSHFWLRQDQGUHSDLU
JDVIUHLJHPDFKW

1.5.2 Probenahme 1.5.2 Sampling


'LH(QWQDKPHYRQ3UREHQDXV7DQNVNDQQDQHLQHP 3URGXFWVDPSOLQJFDQEHFDUULHGRXWYLDWKHWDQNVDP
(QWQDKPHVWXW]HQYRUJHQRPPHQZHUGHQ%HLJURHQ SOLQJSRUW)RUODUJHWDQNYROXPHVWKHSXOOWKURXJK
7DQNYROXPLQD ZLUG GLH 'XUFK]XJVSUREH EHYRU]XJW VDPSOLQJPHWKRGLVSUHIHUUHGLHWKHVDPSOHLVH[
GLHYRP7DQNGDFKDXVEHUHLQHQ3UREHQDKPHVWXW]HQ WUDFWHGIURPWKHWDQNURRIYLDDVDPSOLQJSRUW:KHQ
HQWQRPPHQZLUG%HL$XVODJHUXQJE]Z$EJDEHJUR ZLWKGUDZLQJ RU GLVSHQVLQJ ODUJH SURGXFW YROXPHV
HU0HQJHQLVWDQVWHOOHHLQHV7DQNPXVWHUVHLQHPHQ UDWHSURSRUWLRQDOVDPSOHVFDQEHH[WUDFWHGIURPWKH
JHQSURSRUWLRQDOH 3UREH PLW HLQHP DXWRPDWLVFKHQ ORDGLQJOLQHE\DQDXWRPDWLFVDPSOHU
3UREHQHKPHUDXVGHU9HUODGHOHLWXQJP|JOLFK

2 Emissionen und Mglichkeiten zu deren 2 Emissions and emission control


Verminderung options
2.1 Allgemeines 2.1 General
9LHOH GHU 0LQHUDO|OH KDEHQ HLQHQ UHODWLY KRKHQ 0DQ\PLQHUDORLOVKDYHDUHODWLYHO\KLJKYDSRXUSUHV
'DPSIGUXFN VLHKH7DEHOOH  VXUH VHH7DEOH 
(QWVSUHFKHQG GHP 'DPSIGUXFN XQG GHU MHZHLOLJHQ 'HSHQGLQJRQWKHLUYDSRXUSUHVVXUHDQGWKHLUUHVSHF
.RQ]HQWUDWLRQLQGHU)OVVLJSKDVHN|QQHQ3URGXNW WLYH OLTXLG SKDVH FRQFHQWUDWLRQV SURGXFW IUDFWLRQV
DQWHLOH LQ GLH *DVSKDVH EHUWUHWHQ ZHQQ  ZLH EHL PD\YDSRUL]HDQGIRUPDJDVSKDVHLIWKHUHLVDIUHH
GHU/DJHUXQJRKQH6FKZLPPGHFNHHLQIUHLHU*DV YDSRXUVSDFHDERYHWKHOLTXLGVXUIDFHDVLVJHQHUDOO\
UDXPEHUGHU)OVVLJNHLWVREHUIOlFKHYRUKDQGHQLVW WKHFDVHLQVWRUDJHWDQNVZLWKRXWIORDWLQJGHFN+\
'DEHLN|QQHQVLFK.RKOHQZDVVHUVWRII/XIWJHPLVFKH GURFDUERQDLU PL[WXUHV XS WR WKH VDWXUDWLRQ FRQFHQ
ELV]XU6lWWLJXQJVNRQ]HQWUDWLRQHLQVWHOOHQ WUDWLRQPD\RFFXU

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Tabelle 3. Siedebereiche und Dampfdrcke von Minerallen [20]


Produkt Gefahren- Siedetemperaturen bzw. Dampfdruck
klasse Siedebereiche Richtwerte *) bei verschiedenen
bei 1013 mbar (1013 hPa) Temperaturen
bar (105 Pa)
C 20 C 37,8 C **) 50 C
Rohl AI 0,4 bis 0,56 0,45 bis 0,76
Propan 42 8,2 17,0
n-Butan 0,5 2,0 4,9
Ottokraftstoffe [22] AI etwa 30 bis 215
Sommerware 0,38 0,45 bis 0,60 ***) 0,8
Winterware 0,45 0,60 bis 0,90 1,2
Jahresmittelwert 0,40 1,0
Flugturbinen-Kraftstoff [28] A II etwa 165 bis 285 0,003 0,01
Dieselkraftstoff, Heizl EL [23; 24] A III etwa 180 bis 360 0,0005 0,002 0,004
Zum Vergleich:
Wasser B 100 0,02 0,12
Methanol 65 0,096 0,31 0,53

0LQHUDO|OHXQG0LQHUDO|OSURGXNWHKDEHQMHQDFK+HUNXQIWXQG9HUDUEHLWXQJHLQHXQWHUVFKLHGOLFKH=XVDPPHQVHW]XQJ'DKHUJLEWHV]XP%HL
VSLHOIUGHQ6LHGHEHUHLFKZLHDXFKIUGHQ'DPSIGUXFNNHLQHQHLQKHLWOLFKHQ:HUW6RIHUQNHLQHJHPHVVHQHQ:HUWHYRUOLHJHQN|QQHQGLHREHQ
JHQDQQWHQ5LFKWZHUWHEHL &DOV'XUFKVFKQLWWVZHUWHIUS7HLQJHVHW]WZHUGHQE]Z:HUWHDXV7DEHOOHQGHU$UEHLWVPDSSHIU0LQHUDO|OLQJH
QLHXUH>@HQWQRPPHQZHUGHQ
5HLG'DPSIGUXFNE]Z5HLG9DSRU3UHVVXUH 593 GDVKHLW'DPSIGUXFNEHL &>@
6SH]LILNDWLRQQDFK',1(1>@

Table 3. Boiling ranges and vapour pressures of mineral oils [20]


Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Product Hazard Boiling temperatures or boi- Vapour pressure


class ling ranges at 1013 mbar Guide values *) at different
(1013 hPa) temperatures
bar (105 Pa)
C 20 C 37.8 C **) 50 C
Crude oil AI - 0.4 to 0.56 0.45 to 0.76
Propane 42 8.2 17.0
n-butane 0.5 2.0 4.9
Motor gasolines [22] AI approx. 30 to 215
summer specification 0.38 0.45 to 0.60 ***) 0.8
winter specification 0.45 0.60 to 0.90 1.2
annual mean value 0.40 1.0
Jet fuel [28] A II approx. 165 to 285 0.003 0.01
Diesel fuel, EL-grade fuel oil A III approx. 180 to 360 0.0005 0.002 0.004
[23; 24]
For comparison:
Water B 100 0.02 0.12
Methanol 65 0.096 0.31 0.53

7KHFRPSRVLWLRQRIPLQHUDORLODQGPLQHUDORLOSURGXFWVYDULHVZLWKWKHLURULJLQDQGWKHXSVWUHDPSURFHVVLQJWKH\KDYHXQGHUJRQH$FFRUGLQJO\
LWLVQRWSRVVLEOHWRLQGLFDWHFRPPRQYDOXHVIRUWKHLUERLOLQJUDQJHVDQGYDSRXUSUHVVXUHV:KHUHQRPHDVXUHGGDWDDUHDYDLODEOHWKHDERYHJXLGH
YDOXHVDW &FDQEHXVHGDVDYHUDJHYDOXHVIRUS7RUWKHUHVSHFWLYHYDOXHVFDQEHREWDLQHGIURPWKHFKDUWVLQFOXGHGLQ$UEHLWVPDSSHIU0LQH
UDO|OLQJHQLHXUH>@
5HLG9DSRXU3UHVVXUH 593 LHYDSRXUSUHVVXUHDW &>@
6SHFLILFDWLRQWR',1(1>@

6RZRKOEHLGHUUXKHQGHQ/DJHUXQJLQIROJH'DPSI 5HOHDVHVRIWKLVYDSRXUSKDVHWRWKHRXWGRRUDWPRV
GUXFNDQVWLHJV]XP%HLVSLHOGXUFK7HPSHUDWXUHUK| SKHUHPD\RFFXUERWKGXULQJVWDWLFVWRUDJHDVDUHVXOW
KXQJ 7DQNDWPXQJ  DOV DXFK EHL (LQ $XV RGHU RIDQLQFUHDVHLQWKHYDSRXUSUHVVXUHFDXVHGE\DWHP
8PODJHUXQJHQLQIROJH9HUGUlQJXQJGXUFKQDFKVWU| SHUDWXUH ULVH WDQN EUHDWKLQJ  DQG GXULQJ ILOOLQJ
PHQGH )OVVLJNHLW NDQQ GLHVH *DVSKDVH LQ GLH $W HPSW\LQJDQGWUDQVIHUDFWLYLWLHVDVDUHVXOWRIYDSRXU
PRVSKlUHHQWZHLFKHQ GLVSODFHPHQWE\WKHLQFRPLQJOLTXLG

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

'DQHEHQ JLEW HV GLIIXVH (PLVVLRQHQ DXV 'LFKW ,Q DGGLWLRQ WKHUH DUH IXJLWLYH HPLVVLRQV IURP WKH
HOHPHQWHQ )ODQVFK XQG :HOOHQGLFKWXQJHQ VLHKH VHDOLQJHOHPHQWV IODQJHJDVNHWVDQGVKDIWVHDOVVHH
$EVFKQLWW XQG$UPDWXUHQ 6HFWLRQ YDOYHVDQGILWWLQJV
'LH =XVDPPHQVHW]XQJ GHU .UDIWVWRIIH VFKZDQNW LQ 7KHFRPSRVLWLRQRIPRWRUJDVROLQHVYDULHVZLWKERWK
$EKlQJLJNHLW YRQ GHQ YHUZHQGHWHQ 5RK|OHQ XQG WKHFUXGHRLOIHHGVWRFNDQGWKHUHILQHU\VWUXFWXUH,Q
DXFK GHU 5DIILQHULHVWUXNWXU =XVlW]OLFK N|QQHQ GLH DGGLWLRQPRWRUJDVROLQHVPD\FRQWDLQR[\JHQEHDU
.UDIWVWRIIHVDXHUVWRIIKDOWLJH9HUELQGXQJHQHQWKDOWHQ LQJFRPSRXQGV DOORZDEOHR[\JHQFRQWHQWRISURGXFW
JHPl',1(1>@ELV]X*HZ6DXHU JDVROLQHV DFFRUGLQJ WR ',1 (1  >@ XS WR
VWRII LP )HUWLJNUDIWVWRII  (LQH DNWXHOOH hEHUVLFKW  ZW $QXSGDWHGRYHUYLHZRIW\SLFDOFRPSRVL
EHU GLH W\SLVFKH =XVDPPHQVHW]XQJ YRQ 2WWRNUDIW WLRQV RI PRWRU JDVROLQHV IURP *HUPDQ UHILQHULHV LV
VWRIIHQDXVGHXWVFKHQ5DIILQHULHQLVWGHU]HLWLQ%HDU FXUUHQWO\LQSUHSDUDWLRQ>@
EHLWXQJ>@
'LH 'DPSISKDVH YRQ 2WWRNUDIWVWRIIHQ ZHLVW DQGHUH 7KHYDSRXUDQGOLTXLGSKDVHVRIPRWRUJDVROLQHVGLI
=XVDPPHQVHW]XQJHQ DXI DOV GLH )OVVLJSKDVH $OV IHU LQ WKHLU K\GURFDUERQ FRPSRVLWLRQV 7DEOH 
%HLVSLHOLVWLQ7DEHOOHGLH=XVDPPHQVHW]XQJGHV VKRZV WKH FRPSRVLWLRQ RI WKH K\GURFDUERQDLU PL[
.RKOHQZDVVHUVWRII/XIWJHPLVFKHV EHU HLQJHODJHU WXUHIRUPLQJDERYHVWRUHGSUHPLXPJUDGHJDVROLQHDV
WHP6XSHU2WWRNUDIWVWRIIDXIJHIKUW'LH.RQ]HQWUD DQH[DPSOH7KHUHVSHFWLYHFRQFHQWUDWLRQVRIWKHLQ
WLRQVYHUKlOWQLVVHKlQJHQYRQGHU9HUZHLO]HLWXQGGHU GLYLGXDO FRPSRQHQWV DUH D IXQFWLRQ RI WKH VWRUDJH
9HUGDPSIXQJVJHVFKZLQGLJNHLW DE 'LH MHZHLOLJH WLPHDQGWKHHYDSRUDWLRQUDWH7KHUHVSHFWLYHWHPSHU
WHPSHUDWXUDEKlQJLJH 6lWWLJXQJVNRQ]HQWUDWLRQ LP DWXUHGHSHQGHQWVDWXUDWLRQFRQFHQWUDWLRQVDWHTXLOLE
*OHLFKJHZLFKWV]XVWDQG ZLUG HUVW QDFK OlQJHUHU =HLW ULXP FRQGLWLRQV DUH RQO\ DWWDLQHG DIWHU D SURORQJHG
HUUHLFKW 'LHV KlQJW YRQ YHUVFKLHGHQHQ 3DUDPHWHUQ VWRUDJHWLPH7KLVLVGXHWRYDULRXVSDUDPHWHUV ILOO
DE %HIOOJUDG :LWWHUXQJVEHGLQJXQJHQ  8QWHUVX LQJOHYHOPHWHRURORJLFDOFRQGLWLRQV ,QYHVWLJDWLRQV
FKXQJHQHUIROJWHQLP'*0.3URMHNW>@ KDYH EHHQ FRQGXFWHG ZLWKLQ WKH VFRSH RI WKH
'*0. SURMHFW>@
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Tabelle 4. Zusammensetzung von Ottokraftstoffen in der Flssigphase und der sich daraus ergebenden Zusam-
mensetzung der Kohlenwasserstoffe im Kohlenwasserstoff-/Luftgemisch in einem Lagertank [21]
Komponenten Ottokraftstoff (Sommerqualitt/Super)

Mittelwerte Bereich

Kohlenwasserstoffverteilung Aliphaten
in der Gasphase *) < C4 <1 <1
in Gew.-% C4 21 10 bis 30
C5 50 44 bis 66
C6 20 10 bis 27
> C6 8 6 bis 9

Aromaten
Benzol <1 <1
Toluol 3 2 bis 3
MTBE 1 0 bis 3
> C7 1 1 bis 2

Flssigphase Aliphaten
in Gew.-% < C4 <1 <1
C4 2 1 bis 3
C5 17 14 bis 19
C6 18 17 bis 20
C7 21 17 bis 25
C8 22 21 bis 23
C9 11 10 bis 14
> C9 6 5 bis 8
Aromaten
Benzol <1 <1
Toluol 13 9 bis 15
MTBE 2 0 bis 4
> C7 24 19 bis 29

FD9RO.RKOHQZDVVHUVWRIIHEHL5DXPWHPHUSDWXULQGHU*DVSKDVH

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Table 4. Liquid-phase composition of motor gasolines and the resulting hydrocarbon composition of the hydrocar-
bon/air mixture in a storage tank [21]
Components Motor gasoline (summer specification/premium)
Average values Range

Vapour-phase hydrocarbon Aliphatics


composition*) in wt. % < C4 <1 <1
C4 21 10 to 30
C5 50 44 to 66
C6 20 10 to 27
> C6 8 6 to 9

Aromatics
Benzene <1 <1
Toluene 3 2 to 3
MTBE 1 0 to 3
> C7 1 1 to 2

Liquid-phase hydrocarbon Aliphatics


composition in wt. % < C4 <1 <1
C4 2 1 to 3
C5 17 14 to 19
C6 18 17 to 20
C7 21 17 to 25
C8 22 21 to 23
C9 11 10 to 14
> C9 6 5 to 8
Aromatics
Benzene <1 <1
Toluene 13 9 to 15
MTBE 2 0 to 4
> C7 24 19 to 29
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

YDSRXUSKDVHK\GURFDUERQFRQFHQWUDWLRQDWDPELHQWWHPSHUDWXUHDSSUR[YRO 

2.2 Lagerung von Minerallen 2.2 Storage of mineral oils


'LH(PLVVLRQHQDXV/DJHUWDQNVKlQJHQDEYRQ$UW (PLVVLRQV IURP VWRUDJH WDQNV GHSHQG RQ WKH W\SH
0HQJHXQG+lXILJNHLWGHV8PVFKODJVVRZLHGHU$UW QXPEHU DQG IUHTXHQF\ RI ORDGLQJXQORDGLQJ RSHUD
GHV /DJHUJXWHV GHQ 8PJHEXQJVEHGLQJXQJHQ GHU WLRQVWKHW\SHRISURGXFWVWRUHGWKHDPELHQWFRQGL
7DQNEDXDUW GHU %HWULHEVZHLVH GHU 7DQNV XQG GHQ WLRQVWKHWDQNGHVLJQWKHWDQNRSHUDWLQJFRQGLWLRQV
(PLVVLRQVPLQGHUXQJVPDQDKPHQ DQGWKHHPLVVLRQFRQWUROPHDVXUHVDSSOLHG
,Q 7DEHOOH  ZLUGHLQHhEHUVLFKWEHUGLH$XVUV 7DEOH  SUHVHQWV DQ RYHUYLHZ RI HPLVVLRQ FRQWURO
WXQJHQYRQ7DQNVLQ0LQHUDO|OWDQNOlJHUQ]XU0LQGH GHYLFHVIRUVWRUDJHWDQNVLQPLQHUDORLOWDQNIDUPV
UXQJGHU(PLVVLRQGDUJHVWHOOW

2.2.1 Festdachtanks 2.2.1 Fixed-roof tanks


%HL)HVWGDFKWDQNVNRPPWHVEHLVWDWLVFKHU/DJHUXQJ 8QGHU VWDWLF VWRUDJH FRQGLWLRQV HPLVVLRQV IURP
]X (PLVVLRQHQ GXUFK 7DQNDWPXQJ 8UVDFKH GHU IL[HGURRI WDQNV DULVH DV D UHVXOW RI WDQN EUHDWKLQJ
7DQNDWPXQJ LVW GLH bQGHUXQJ YRQ =XVWDQGVJU|HQ 7DQNEUHDWKLQJLVDWWULEXWDEOHWRFKDQJHVLQWKHVWDWH
'UXFN7HPSHUDWXU GHVLP7DQNHQWKDOWHQHQ.RK YDULDEOHV SUHVVXUHWHPSHUDWXUH RIWKHK\GURFDUERQ
OHQZDVVHUVWRII/XIWJHPLVFKHV ZHOFKH XQWHU DQGH DLU PL[WXUH SUHVHQW LQ WKH WDQN ZKLFK LQ WXUQ DUH
UHP GXUFK ZHFKVHOQGH PHWHRURORJLVFKH %HGLQJXQ FDXVHGE\YDULDWLRQVLQWKHPHWHRURORJLFDOFRQGLWLRQV
JHQ /XIWGUXFN 8PJHEXQJVWHPSHUDWXU 6RQQHQHLQ DPELHQWSUHVVXUHDPELHQWWHPSHUDWXUHVRODUUDGLD
VWUDKOXQJ1LHGHUVFKOlJH YHUXUVDFKWZLUG WLRQSUHFLSLWDWLRQ 
%HL GHU %HIOOXQJ YRQ )HVWGDFKWDQNV ZLUG GDV LP 'XULQJILOOLQJRIIL[HGURRIWDQNVWKHK\GURFDUERQ
7DQN EHILQGOLFKH .RKOHQZDVVHUVWRII/XIWJHPLVFK DLUPL[WXUHSUHVHQWLQWKHWDQNLVGLVSODFHGE\WKHLQ
GXUFK GLH ]XVWU|PHQGH )OVVLJNHLW YHUGUlQJW 'HU FRPLQJOLTXLG7KHH[KDXVWDLUIORZUDWHURXJKO\FRU
$EOXIWYROXPHQVWURPHQWVSULFKWLQHWZDGHP)|UGHU UHVSRQGVWRWKHIORZUDWHGHOLYHUHGE\WKHSXPS
VWURPGHU3XPSH

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Tabelle 5. bersicht ber die Ausrstungen von Tanks in Mineralltanklgern


Lagerkapazitt Umschlag Gefahren- Farb- Tankausfhrung Anforderungen an Festdachtanks
des Tanklagers klasse anstrich*)
nach VbF [3] Festdach- Schwimm- V/D- Gaspendelung Schwimm-
Tonnen 3
m /a tank dachtank Ventile **) und/oder decke
Abgasreinigung

1 2 3 4 5 6 7 8 9

< 5000 AI + + + + s)
A II + + + ***) s)
A III o +

5000 < 10000 AI/B + + o + + s)


10000 A I(Produkte) / B + + o + + s)
10000 A I(Rohl) + +
1000 A II + + + ***) s)
1000 A III o +
10000 < 10000 A II + + + ***) s)
10000 A III o +
1000 A II + + + ***) s)
1000 A III o +

5HIOHNWLRQGHU6WUDKOXQJVZlUPHPLQGHVWHQV 
%HWULHEVGUXFNPEDU K3D 9HQWLODQVSUHFKGUXFNPEDU K3D
*LOWQLFKWIU3URGXNWHPLWHLQHP'DPSIGUXFNYRQPHKUDOVPEDU K3D EHL &
s
'LH$XVUVWXQJPLWHLQHULQQHQOLHJHQGHQ6FKZLPPGHFNHZLUGQXUQRFKLQ$XVQDKPHIlOOHQ ]XP%HLVSLHOEHL$QELQGXQJDQHLQH0LQHUDO|OIHUQ
OHLWXQJ YRUJHIXQGHQ
 EOLFK o P|JOLFK  QLFKWEOLFK

Table 5. Overview of emission control devices for storage tanks in mineral oil tank farms
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Tank farm Turnover Hazard Paint Tank type Requirements for fixed-roof tanks
storage class coating*)
Fixed-roof Floating- V/P Vapour balanc- Floating
capacity to VbF [3]
metric tonnes m3/a tank roof tank valves **) ing and/or off- deck
gas cleaning

1 2 3 4 5 6 7 8 9

< 5000 AI + + + + s)
A II + + + ***) s)
A III o +

5000 < 10000 AI/B + + o + + s)


10000 A I(products) / B + + o + + s)
10000 A I(crude oil) + +
1000 A II + + + ***) s)
1000 A III o +

10000 < 10000 A II + + + ***) s)


10000 A III o +
1000 A II + + + ***) s)
1000 A III o +

0LQLPXPVRODUDEVRUSWDQFH 
2SHUDWLQJSUHVVXUHPEDU K3D YDOYHVHWSUHVVXUHPEDU K3D
1RWDSSOLFDEOHWRSURGXFWVKDYLQJDYDSRXUSUHVVXUHJUHDWHUWKDQPEDU K3D DW &
s
7KHXVHRILQWHUQDOIORDWLQJGHFNLVOLPLWHGWRVRPHH[FHSWLRQDOFDVHV HJWDQNVFRQQHFWHGWRDPLQHUDORLOSLSHOLQH 
 FRPPRQ o SRVVLEOH  QRWFRPPRQ

%HL GHU $XVODJHUXQJ DXV )HVWGDFKWDQNV PLW RGHU 'XULQJ SURGXFW ZLWKGUDZDO IURP IL[HGURRI WDQNV
RKQH6FKZLPPGHFNHZLUGEHLP$EVLQNHQGHV)OV ZLWKRUZLWKRXWLQWHUQDOIORDWLQJGHFNDLULVGUDZQLQ
VLJNHLWVVSLHJHOV/XIWGXUFKGLH9DNXXP'UXFNYHQ WKURXJKWKHYDFXXPSUHVVXUHUHOLHIYDOYHVRUWKHWDQN
WLOHRGHUGLH(QWOIWXQJHLQJHVDXJW'LHVH/XIWYHU YHQWDVWKHOLTXLGOHYHOGURSV7KLVDLUVWUHDPGLOXWHV
GQQW GDV .RKOHQZDVVHUVWRII/XIWJHPLVFK LP *DV WKH K\GURFDUERQDLU PL[WXUH LQ WKH YDSRXU VSDFH
UDXPEHUGHU)OVVLJNHLWE]Z6FKZLPPGHFNHZDV DERYHWKHOLTXLGVXUIDFHRUWKHIORDWLQJGHFNOHDGLQJ
]XHLQHUZHLWHUHQ9HUGXQVWXQJGHVDQGHU7DQNZDQG WRWKHHYDSRUDWLRQRIOLTXLGFOLQJLQJWRWKHWDQNZDOO

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

DQKDIWHQGHQ /DJHUJXWHV XQG DXV GHU )OVVLJNHLWV DQG HYDSRUDWLYH ORVVHV IURP WKH OLTXLG VXUIDFH %H
REHUIOlFKH IKUW 'XUFK GLH GDPLW YHUEXQGHQH $XI FDXVHRIWKHUHVXOWLQJVDWXUDWLRQSURFHVVWKHSUHVVXUH
VlWWLJXQJVWHLJWGHU'UXFNLP*DVUDXPXQGIKUW]XU LQWKHYDSRXUVSDFHLQFUHDVHVFDXVLQJHPLVVLRQVWR
(PLVVLRQ %HL 9DNXXP'UXFNYHQWLOHQ PXVV GD]X WKHDWPRVSKHUH,QWKHFDVHRIYDFXXPSUHVVXUHUHOLHI
GHU$QVSUHFKGUXFNEHUVFKULWWHQZHUGHQ YDOYHVWKHYDOYHVHWSUHVVXUHPXVWEHH[FHHGHGIRU
WKLVWRKDSSHQ
6RIHUQ GLH )OVVLJNHLWVREHUIOlFKH GXUFK HLQH ,IWKHOLTXLGVXUIDFHLVFRYHUHGE\DIORDWLQJGHFNK\
6FKZLPPGHFNHEHGHFNWLVWHUIROJWHLQ.RKOHQZDV GURFDUERQVFDQRQO\HYDSRUDWHLQWRWKHWDQNDWPRV
VHUVWRIIEHUJDQJ QXU QRFK EHU GHQ 5DQGVSDOW ]ZL SKHUHYLDWKHULPJDSEHWZHHQWKHIORDWLQJGHFNVHDO
VFKHQ 6FKZLPPGHFNHQGLFKWXQJ XQG 7DQNZDQG LQ DQGWKHWDQNZDOO
GLH7DQNDWPRVSKlUH
=XU9HUPLQGHUXQJGHU(PLVVLRQHQEHL)HVWGDFKWDQNV 7\SLFDOPHDVXUHVIRUUHGXFLQJHPLVVLRQVIURPIL[HG
N|QQHQ GHU 7DQNDQVWULFK XQG GHU (LQVDW] YRQ 9' URRIWDQNVDUHWKHVHOHFWLRQRIDVXLWDEOHWDQNFRDWLQJ
9HQWLOHQEHLWUDJHQ:HLWHUJHKHQGH0DQDKPHQVLQG FRORXU DQG WKH LQVWDOODWLRQ RI 93 YDOYHV 0RUH DG
GHU(LQEDXHLQHU6FKZLPPGHFNHRGHUGLH*DVSHQGH YDQFHGPHDVXUHVLQFOXGHWKHLQVWDOODWLRQRIDQLQWHU
OXQJ QDOIORDWLQJGHFNRUWKHXVHRIDYDSRXUEDODQFLQJV\V
WHP

D 7DQNDQVWULFK D 7DQNFRDWLQJ
=ZLVFKHQGHU2EHUIOlFKHQWHPSHUDWXUHLQHV+RKON|U 7KHUH LV D OLQHDU UHODWLRQVKLS EHWZHHQ WKH VXUIDFH
SHUVXQGGHP*HVDPWZlUPH5HPLVVLRQVJUDGVHLQHV WHPSHUDWXUHRIDKROORZERG\DQGWKHFRHIILFLHQWRI
)DUEDQVWULFKV EHVWHKW HLQ OLQHDUHU =XVDPPHQKDQJ WRWDOKHDWUHIOHFWDQFHIURPLWVSDLQWFRDWLQJ>@,Q
>@%HLVWDUNHU6RQQHQHLQVWUDKOXQJNDQQLQ0LWWHO &HQWUDO (XURSH WKH VXUIDFH WHPSHUDWXUH RI D EODFN
HXURSDGLH7HPSHUDWXUGHU2EHUIOlFKHHLQHVVFKZDU] ERG\ H[SRVHG WR LQWHQVLYH VRODU UDGLDWLRQ PD\ EH
ODFNLHUWHQ .|USHUV XP PHKU DOV  & K|KHU OLHJHQ PRUHWKDQ &KLJKHUWKDQWKDWRIDQLGHQWLFDOZKLWH
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

DOV GLH HLQHV JOHLFKDUWLJHQ ZHL ODFNLHUWHQ .|USHUV ERG\>@$VWKHWHPSHUDWXUHRIWKHRXWHUVNLQRID


>@ 'D VLFK GLH 7HPSHUDWXU GHU $XHQKDXW EHL PHWDOOLFKROORZERG\SURSDJDWHVUHODWLYHO\IDVWWRLWV
PHWDOOHQHQ+RKON|USHUQDXFKUHODWLYVFKQHOODXIGH LQWHULRUWKHFKRLFHRIWKHFRORXUIRUWKHWDQNFRDWLQJ
UHQ,QQHQUDXPEHUWUlJWKDWGLH:DKOGHV)DUEWRQV KDV D VLJQLILFDQW LQIOXHQFH RQ WKH GHJUHH RI WDQN
EHL 7DQNDQVWULFKHQ HLQHQ HUKHEOLFKHQ (LQIOXVV DXI EUHDWKLQJGXULQJWKHGD\QLJKWF\FOH
GDV $XVPD GHU 7DQNDWPXQJ LP 7DJ1DFKW5K\WK
PXV
(LQHQ hEHUEOLFN EHU GLH *HVDPWZlUPH5HPLV $QRYHUYLHZRIWKHFRHIILFLHQWVRIWRWDOKHDWUHIOHFW
VLRQVJUDGH :5  IU GHQ :HOOHQOlQJHQEHUHLFK GHV DQFH :5  IRU WKH ZDYH OHQJWK UDQJH RI QDWXUDO VXQ
QDWUOLFKHQ6RQQHQOLFKWHV ELVQP EHLYHU OLJKW WRQP LVJLYHQIRUYDULRXVFRORXUVRI
VFKLHGHQIDUELJHQ2EHUIOlFKHQDQVWULFKHQHQWKlOW 7D VXUIDFHFRDWLQJVLQ7DEOH>@
EHOOH>@
(LQKHOOHU7DQNDQVWULFKUHGX]LHUWGLH7DQNDWPXQJ $EULJKWWDQNFRDWLQJUHGXFHVWDQNEUHDWKLQJ
'LHEHLVSLHOKDIWDQJHJHEHQHQ*HVDPWZlUPH5HPLV 7KHFRHIILFLHQWVRIWRWDOKHDWUHIOHFWDQFHJLYHQDVH[
VLRQVJUDGH ZXUGHQ DQ IULVFK KHUJHVWHOOWHQ /DFN DPSOHV ZHUH GHWHUPLQHG RQ QHZO\ DSSOLHG SDLQW
VFKLFKWHQ HUPLWWHOW HQWVSUHFKHQG DOVR GHP JXWHQ ILOPVLHJRRGSDLQWFRQGLWLRQ>@
)DUE]XVWDQG>@
,QGHU/LWHUDWXUZHUGHQLQGLH)RUPHO]XU(UPLWWOXQJ 7KHOLWHUDWXUHLQWURGXFHVFRORXUVSHFLILFFRDWLQJIDF
GHU .RKOHQZDVVHUVWRII(PLVVLRQHQ GXUFK 7DQN WRUVZKLFKDUHWREHLQVHUWHGLQWKHHTXDWLRQIRUGHWHU
DWPXQJ $WPXQJVYHUOXVWH  $QVWULFKIDNWRUHQ HLQJH PLQLQJ K\GURFDUERQ HPLVVLRQV UHVXOWLQJ IURP WDQN
IKUWGLHMHZHLOVEHVWLPPWHQ)DUEW|QHQ]XJHRUGQHW EUHDWKLQJ EUHDWKLQJORVVHV >@
VLQG>@
'LH =XRUGQXQJ YRQ )DUEWRQ E]Z :lUPH5HPLVVL 7KHDOORFDWLRQRIFRDWLQJIDFWRUVWRSDLQWFRORXUVDQG
RQVJUDG]X$QVWULFKIDNWRUNDQQDXV%LOGHQWQRP RUFRHIILFLHQWVRIWRWDOKHDWUHIOHFWDQFHLVLOOXVWUDWHGLQ
PHQZHUGHQ>@ )LJXUH>@
$OV%HLVSLHOZHUGHQLQ 7DEHOOH  HLQLJH$QVWULFK &RDWLQJIDFWRUVGHWHUPLQHGRQWKHEDVLVRI)LJXUH
IDNWRUHQDQJHJHEHQGLHDXI*UXQGRELJHU%H]LHKXQJ DUH JLYHQ LQ 7DEOH  DV DQ H[DPSOH ,Q RSHUDWLQJ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Tabelle 6. Oberflchenanstriche Table 6. Surface coatings


Bezeichnung des Farbtons Gesamtwrme- RAL colours Coefficient of
Remissionsgrad W R total heat reflectance W R
(gerundet) (rounded)
% %

Schwarz RAL 9005 3 black RAL 9005 3


Maschinengrau RAL 7031 10 machine grey RAL 7031 10
Braun RAL 8011 12 brown RAL 8011 12
Mausgrau RAL 7005 13 mouse grey RAL 7005 13
Grn RAL 6010 14 green RAL 6010 14
Blau RAL 5010 19 blue RAL 5010 19
Silbergrau RAL 7001 27 silver grey RAL 7001 27
Kieselgrau RAL 7032 38 pebble grey RAL 7032 38
Rot RAL 3000 43 red RAL 3000 43
Lichtgrau RAL 7035 51 light grey RAL 7035 51
Elfenbein RAL 1014 57 ivory RAL 1014 57
Alu-Silber RAL 9006 72 aluminium silver RAL 9006 72
Cremewei RAL 9001 72 cream white RAL 9001 72
Wei RAL 9010 84 white RAL 9010 84
1
1
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Gesamtwrme-Remissionsgrad
R
R
Bild 4. Abhngigkeit des Anstrichfaktors vom Gesamtwrme- Fig. 4. Coating factor as a function of the total degree of heat
remissionsgrad reflectance

Tabelle 7. Anstrichfaktoren Table 7. Coating factors


Farbton Anstrichfaktor f Colour Coating factor f

Wei 1,0 white 1.0


Alu-Silber 1,1 aluminium silver 1.1
Lichtgrau 1,3 light grey 1.3
Kieselgrau 1,4 pebble grey 1.4
Mausgrau 1,6 mouse grey 1.6
Grn 1,6 green 1.6

HUPLWWHOWZRUGHQVLQG,QGHU3UD[LVNDQQGHU=XVWDQG SUDFWLFHWKHFRQGLWLRQRIWKHSDLQWFRDWLQJFDQEHGH
GHV)DUEDQVWULFKHVPLW+LOIHGHU)DUENDUWHQEHUSUIW WHUPLQHGZLWKWKHDLGRIFRORXUFKDUWV
ZHUGHQ

E 9DNXXP'UXFNYHQWLOH 9'9HQWLOH E 9DFXXPSUHVVXUHUHOLHIYDOYHV 93YDOYHV


'DV)XQNWLRQVSULQ]LSGHU9'9HQWLOHEHUXKWGDUDXI 7KHIXQFWLRQRI93YDOYHVLVWRPDLQWDLQWKHWDQNYD
GDVV GHU *DVUDXP GHV 7DQNV EHL /XIWGUXFNVFKZDQ SRXUVSDFHFORVHGGXULQJIOXFWXDWLRQVLQWKHDPELHQW
NXQJHQRGHUEHL$ENKOXQJ(UZlUPXQJWURW]GHUGD DLUSUHVVXUHRUWHPSHUDWXUHLQFUHDVHVGHFUHDVHVRIWKH

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

PLW YHUEXQGHQHQ bQGHUXQJ GHV 'DPSIGUXFNHV ELV WDQN FRQWHQWV UHJDUGOHVV RI WKH UHVXOWLQJ FKDQJH LQ
]XU (UUHLFKXQJ GHV WHFKQLVFK ]XOlVVLJHQ 8QWHU WKHYDSRXUSUHVVXUHXQWLOWKHDOORZDEOHRYHUSUHVVXUH
hEHUGUXFNVJHVFKORVVHQEOHLEW+LHUGXUFKZLUGLQEH QHJDWLYHSUHVVXUHLVDWWDLQHG,QWKLVZD\WKHGUDZLQJ
VWLPPWHQ*UHQ]HQGDV$QVDXJHQYRQ$XHQOXIWE]Z LQRIDPELHQWDLURUWKHGLVSODFHPHQWRIWKHK\GURFDU
HLQH 9HUGUlQJXQJ GHV .RKOHQZDVVHUVWRII/XIWJH ERQDLUPL[WXUHFDQEHDYRLGHGZLWKLQFHUWDLQOLPLWV
PLVFKHV YHUKLQGHUW 9'9HQWLOH EHHLQIOXVVHQ EHU 93 YDOYHV SUHGRPLQDQWO\ KHOS FRQWURO EUHDWKLQJ
ZLHJHQGGLH$WPXQJVYHUOXVWH ORVVHV
'LH (PLVVLRQVPLQGHUXQJ GHU .RKOHQZDVVHUVWRII 7KHDFKLHYDEOHUHGXFWLRQLQUHOHDVHVRIK\GURFDUERQ
/XIWJHPLVFKHKlQJWLP:HVHQWOLFKHQYRQIROJHQGHQ DLUPL[WXUHVLVPDLQO\JRYHUQHGE\WKHIROORZLQJIDF
)DNWRUHQDE WRUV
YRPXQWHUHQXQGREHUHQ9HQWLODQVSUHFKGUXFN WKHXSSHUDQGORZHUYDOYHVHWSUHVVXUH
YRQ GHU 7HPSHUDWXUGLIIHUHQ] LP *DVUDXP LQQHU WKHWHPSHUDWXUHJUDGLHQWEHWZHHQWKHWDQNYDSRXU
KDOEGHV7DQNVXQGGHU$XHQOXIW VSDFHDQGWKHDPELHQWDLU
YRQ GHU .RKOHQZDVVHUVWRII.RQ]HQWUDWLRQ GHV WKH K\GURFDUERQ FRQFHQWUDWLRQ RI WKH K\GURFDU
.RKOHQZDVVHUVWRII/XIWJHPLVFKHVLP*DVUDXP ERQDLUPL[WXUHLQWKHYDSRXUVSDFH
%HLP(LQODJHUQZLUGGHUDP9'9HQWLOHLQJHVWHOOWH 'XULQJWDQNILOOLQJWKHSUHVVXUHTXLFNO\ULVHVDERYH
REHUH $QVSUHFKGUXFN VFKRQ QDFK NXU]HU =HLW EHU WKHVHWSUHVVXUHRIWKH93YDOYH7KHYDOYHRSHQVDQG
VFKULWWHQ'DV9'9HQWLO|IIQHWXQGHQWOlVVWGDV.RK UHOHDVHV WKH K\GURFDUERQDLU PL[WXUH IURP WKH WDQN
OHQZDVVHUVWRII/XIWJHPLVFKDXVGHP7DQNLQV)UHLH LQWRWKHDWPRVSKHUH ILOOLQJORVVHV 'XULQJSURGXFW
%HIOOYHUOXVWH %HLGHU$XVODJHUXQJ|IIQHWEHLGHP ZLWKGUDZDOWKH93YDOYHRSHQVDVVRRQDVWKHSUHVHW
HLQJHVWHOOWHQXQWHUHQ$QVSUHFKGUXFNGDV9'9HQWLO ORZHUVHWSUHVVXUHLVDWWDLQHGVRWKDWDLUFDQIORZLQWR
VRGDVV/XIWLQGHQ7DQNKLQHLQVWU|PHQNDQQ+LHU WKHWDQN7KLVUHDFWLYDWHVWKHHYDSRUDWLRQRUFRQGHQV
GXUFK NRPPW GHU 9HUGDPSIXQJV RGHU .RQGHQVD LQJSURFHVVDQGPD\OHDGWRZLWKGUDZDOORVVHV:LWK
WLRQVSUR]HVVZLHGHULQ*DQJXQGIKUWJHJHEHQHQIDOOV GUDZDOORVVHVPD\RYHUODSZLWKEUHDWKLQJORVVHV>@
]X(QWQDKPHYHUOXVWHQ'LH(QWQDKPHYHUOXVWHN|QQHQ
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

VLFKPLWGHQ$WPXQJVYHUOXVWHQ>@EHUODJHUQ
9'9HQWLOH PVVHQ HQWVSUHFKHQG GHQ $XVOHJXQJV 7KHVHWWLQJVRIYDFXXPSUHVVXUHUHOLHIYDOYHVPXVWEH
EHGLQJXQJHQGHV7DQNVHLQJHVWHOOWZHUGHQ>@ VHOHFWHGWRVXLWWKHWDQNGHVLJQSDUDPHWHUV>@

F )HVWGDFKWDQNPLW6FKZLPPGHFNH F )L[HGURRIWDQNZLWKLQWHUQDOIORDWLQJGHFN
$XIJDEHGHU6FKZLPPGHFNHLVWHVGLHYRQGHU2EHU 7KHIXQFWLRQRIWKHLQWHUQDOIORDWLQJGHFNLVWRODUJHO\
IOlFKHGHV/DJHUJXWHVPLWKRKHP'DPSIGUXFNDXVJH SUHYHQWVXUIDFHHYDSRUDWLRQRIWKHKLJKYDSRXUSUHV
KHQGH9HUGXQVWXQJGXUFK$EGHFNXQJGHU2EHUIOlFKH VXUH OLTXLG EHLQJ VWRUHG E\ FRYHULQJ WKH OLTXLG VXU
ZHLWJHKHQG ]X YHUKLQGHUQ XQG GDGXUFK GLH %HIOO IDFHWKHUHE\VLJQLILFDQWO\UHGXFLQJILOOLQJEUHDWKLQJ
$WPXQJV XQG (QWQDKPHYHUOXVWH HUKHEOLFK ]X YHU DQGZLWKGUDZDOORVVHV,QWKHFDVHRISURORQJHGVWRU
PLQGHUQ%HLOlQJHUHQ6WDQG]HLWHQ PHKUDOVHLQ-DKU DJHSHULRGV RYHURQH\HDUHJVWRFNSLOLQJ VDWXUD
]XP%HLVSLHO%HYRUUDWXQJ ZLUGGLH$XIVlWWLJXQJGHV WLRQRIWKHYDSRXUVSDFHDERYHWKHIORDWLQJURRIFDQ
*DVUDXPHVEHUGHU6FKZLPPGHFNHDXI'DXHUQLFKW QRWEHSUHYHQWHGLQWKHORQJUXQ
YHUKLQGHUW
6FKZLPPGHFNHQJLEWHVLQGHQYHUVFKLHGHQVWHQ$XV ,QWHUQDOIORDWLQJGHFNVFRPHLQDEURDGYDULHW\RIGH
IKUXQJHQ %LVKHU KDEHQ VLFK VRZRKO LQ %H]XJ DXI VLJQV ,Q LQGXVWULDO SUDFWLFH RQO\ FHUWDLQ VKHHW DOX
GLH:LUNVDPNHLWDOVDXFKDXIGLH/HEHQVGDXHUQXUEH PLQLXPRUVKHHWVWHHOGHVLJQVKDYHSURYHQVXFFHVVIXO
VWLPPWH.RQVWUXNWLRQHQDXV$OXPLQLXPE]Z6WDKO VRIDULQWHUPVRIERWKHIIHFWLYHQHVVDQGVHUYLFHOLIH
EOHFKEHZlKUWGLHVHODVVHQVLFKZLHIROJWHLQWHLOHQ 7KHVHFDQEHFODVVLILHGDVIROORZV
6FKZLPPGHFNHQ GLH GLUHNW DXI GHU )OVVLJNHLWV &RQWDFWGHVLJQVZKLFKIORDWGLUHFWO\RQWKHOLTXLG
REHUIOlFKH VFKZLPPHQ VR GDVV NHLQ =ZLVFKHQ VXUIDFHVRWKDWWKHUHLVQRFOHDUDQFHEHWZHHQWKH
UDXP ]ZLVFKHQ GHP )OVVLJNHLWVVSLHJHO XQG GHU OLTXLGVXUIDFHDQGWKHIORDWLQJGHFN&RQWDFWW\SH
6FKZLPPGHFNH HQWVWHKW 6LH VLQG EHUZLHJHQG IORDWLQJGHFNVDUHSUHGRPLQDQWO\IDEULFDWHGIURP
DXV 6WDKOEOHFK 3IDQQHQIRUP RGHU 3RQWRQDXVIK VKHHWVWHHO SDQW\SHRUSRQWRRQW\SH 6WHHOIORDW
UXQJ KHUJHVWHOOW6FKZLPPGHFNHQDXV6WDKOVLQG LQJGHFNVDUHQRUPDOO\FRQWLQXRXVO\ZHOGHG
LQGHU5HJHOGXUFKJHKHQGJHVFKZHLW
6FKZLPPGHFNHQ GHUHQ JHVFKORVVHQH 2EHUIOlFKH 1RQFRQWDFW GHVLJQV ZKRVH FRQWLQXRXV GHFN LV
HLQLJH=HQWLPHWHUEHUGHU3URGXNWREHUIOlFKHYRQ VXSSRUWHG E\ IORDWV D IHZ FHQWLPHWUHV DERYH WKH

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

6FKZLPPHUQJHWUDJHQZLUG%HLGLHVHU.RQVWUXN SURGXFW VXUIDFH :LWK WKLV GHVLJQ WKHUH LV D YD


WLRQ LVW ]ZLVFKHQ GHU 3URGXNWREHUIOlFKH XQG GHU SRXU VSDFH EHWZHHQ WKH SURGXFW VXUIDFH DQG WKH
6FKZLPPGHFNH HLQ *DVUDXP YRUKDQGHQ 'LHVH IORDWLQJ GHFN 7KLV W\SH RI IORDWLQJ GHFN LV W\SL
'HFNHQ ZHUGHQ EHUZLHJHQG DXV $OXPLQLXP JH FDOO\FRQVWUXFWHGRIDOXPLQLXPDQGQRUPDOO\KDV
IHUWLJW6FKZLPPGHFNHQDXV$OXPLQLXPKDEHQLQ DFRQWLQXRXVVXUIDFHIRUPHGE\FODPSHGSODWHV
GHU 5HJHO HLQH JHVFKORVVHQH 2EHUIOlFKH DXV JH
NOHPPWHQ%OHFKHQ
%HL GHU 3ODQXQJ XQG GHP (LQEDX YRQ 6FKZLPP ,QGHVLJQLQJDQGLQVWDOOLQJLQWHUQDOIORDWLQJGHFNVIRU
GHFNHQLQREHULUGLVFKH7DQNVLVWEHVRQGHUVGDUDXI]X DERYHJURXQGWDQNVVSHFLDOFDUHLVUHTXLUHGWRHQVXUH
DFKWHQ GDVV GLH (LQEDXWROHUDQ]HQ  WDQN XQG WKDWWKHLQVWDOODWLRQWROHUDQFHVERWKRQWKHWDQNDQG
VFKZLPPGHFNHQVHLWLJHLQJHKDOWHQZHUGHQXQGGLH WKHIORDWLQJGHFNVLGHDUHDGKHUHGWRDQGWKDWWKH
5DQGDEGLFKWXQJHQ LQ GHU /DJH VLQG GLH 8QUHJHO ULPVHDOV DUH FDSDEOH RI DFFRPPRGDWLQJ VXUIDFH LU
PlLJNHLWHQ LQ GHU 7DQNZDQG DXV]XJOHLFKHQ VLHKH UHJXODULWLHVLQWKHWDQNZDOO VHH6HFWLRQ 
DXFK$EVFKQLWW 
%HL 6FKZLPPGHFNHQ N|QQHQ 6HNXQGlUGLFKWXQJHQ 6HFRQGDU\VHDOVFDQEHXVHGRQIORDWLQJGHFNVLIWKH
GRSSHOWH 5DQGDEGLFKWXQJHQ  DQJHZHQGHW ZHUGHQ IORDWLQJGHFNLVVXIILFLHQWO\VWLII
ZHQQHLQHDXVUHLFKHQGH6WHLILJNHLWGHU6FKZLPPGH
FNHJHJHEHQLVW

2.2.2 Schwimmdachtanks 2.2.2 Floating-roof tanks


%HL 6FKZLPPGDFKWDQNV ZHUGHQ GLH (PLVVLRQHQ +\GURFDUERQHPLVVLRQVIURPIORDWLQJURRIWDQNVRF
GXUFK GHQ 5LQJVSDOW VRZLH GXUFK GLH 'XUFKIKUXQ FXUWKURXJKWKHDQQXODUJDSDQGWKHGHFNRSHQLQJVIRU
JHQYRQ7DQNGDFKVWW]HQ3HLOXQG)KUXQJVURKUHQ WKHVXSSRUWOHJVJDXJLQJDQGJXLGHSROHVDVZHOODV
XQG GXUFK GLH 7DQNZDQGEHQHW]XQJ EHL GHU (QWOHH WKURXJK HYDSRUDWLRQ RI OLTXLG FOLQJLQJ WR WKH WDQN
UXQJ YHUXUVDFKW ,QVEHVRQGHUH WUDJHQ GLH 3HLO XQG ZDOO GXULQJ SURGXFW ZLWKGUDZDO 7KH JDXJLQJ DQG
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

)KUXQJVURKUHHUKHEOLFK]XGHQ(PLVVLRQHQEHL%HL JXLGH SROHV LQ SDUWLFXODU DUH PDMRU FRQWULEXWRUV WR


GHU/DJHUXQJYRQ5RK|OLVWGLH%LOGXQJYRQ3DUDIILQ HPLVVLRQV:KHQVWRULQJFUXGHRLOWKHIRUPDWLRQRI
VFKLFKWHQ DQ GHU 7DQNZDQG GXUFK GHQ (LQEDX YRQ SDUDIILQ OD\HUV RQ WKH WDQN ZDOO VKRXOG EH FRXQWHU
:DFKVNUDW]HUQ]XYHUPHLGHQ DFWHGE\LQVWDOOLQJZD[VFUDSHUV
8PEHLP%DXYRQ6FKZLPPGDFKWDQNVRSWLPDOH$E 7RHQVXUHHIIHFWLYHVHDOLQJWKHLQVWDOODWLRQWROHUDQFHV
GLFKWXQJ]XHUUHLFKHQVLQGGLH7ROHUDQ]HQLQHQJHQ RI IORDWLQJURRI WDQNV PXVW EH NHSW ZLWKLQ QDUURZ
*UHQ]HQ ]X KDOWHQ XQG GLH 5DQGDEGLFKWXQJHQ LQ OLPLWVDQGWKHULPVHDOVPDLQWDLQHGLQJRRGFRQGLWLRQ
JXWHP=XVWDQG]XHUKDOWHQ %LOG  )LJXUH 
7DQNVIU0LQHUDO|OHPLWKRKHP'DPSIGUXFN PHKU 7DQNVIRUKLJKYDSRXUSUHVVXUHPLQHUDORLOV JUHDWHU
DOVPEDUEHL & ZHUGHQPLW6HNXQGlUGLFKWXQ WKDQPEDUDW & DUHHTXLSSHGZLWKVHFRQGDU\
JHQ GRSSHOWH5DQGDEGLFKWXQJ DXVJHUVWHW VHDOV GRXEOHULPVHDO 
=XU9HUPLQGHUXQJGHU(PLVVLRQHQDXVGHQREHQJH (PLVVLRQVIURPWKHWDQNGHFNRSHQLQJVDUHUHGXFHG
QDQQWHQ'XUFKIKUXQJHQZHUGHQGLHVHDEJHGLFKWHW E\SURYLGLQJDSSURSULDWHVHDOLQJV\VWHPV

2.2.3 Zylindrische Behlter 2.2.3 Cylindrical vessels


+LQVLFKWOLFKGHU(PLVVLRQHQXQGLKUHU9HUPLQGHUXQJ ,QWHUPVRIHPLVVLRQVDQGHPLVVLRQUHGXFWLRQYHUWL
VLQGGLHVWHKHQGHQXQGOLHJHQGHQ]\OLQGULVFKHQ%H FDO DQG KRUL]RQWDO F\OLQGULFDO VWRUDJH YHVVHOV DUH
KlOWHU GHQ )HVWGDFKWDQNV RKQH 6FKZLPPGHFNH FRPSDUDEOH ZLWK IL[HGURRI WDQNV ZLWKRXW IORDWLQJ
JOHLFK]XVHW]HQ VLHKH$EVFKQLWW 8QWHULUGLVFKH GHFN VHH 6HFWLRQ   8QGHUJURXQG VWRUDJH YHV
7DQNVVLQGGHQZHWWHUEHGLQJWHQ7HPSHUDWXUVFKZDQ VHOVDUHRQO\H[SRVHGWRDPLQRUH[WHQWWRZHDWKHUUH
NXQJHQQXULQJHULQJHP0DHDXVJHVHW]W ODWHGWHPSHUDWXUHIOXFWXDWLRQV

2.3 Umschlag von Minerallen 2.3 Loading/unloading of mineral oils


'LH9HUPLQGHUXQJYRQ(PLVVLRQHQEHLP8PVFKODJ (PLVVLRQ FRQWURO PHDVXUHV DSSOLHG GXULQJ ORDGLQJ
YRQ 0LQHUDO|OHQ PLW HLQHP 'DPSIGUXFN YRQ PHKU XQORDGLQJ RI PLQHUDO RLOV KDYLQJ D YDSRXU SUHVVXUH
DOVPEDU K3D EHL &ZLUGGXUFK(UIDVVHQ JUHDWHUWKDQPEDU K3D DW &LQFOXGHFROOHF
GHV *DVJHPLVFKHV XQG 3HQGHOXQJ 5FNJHZLQQXQJ WLRQRIWKHGLVSODFHGYDSRXUVYDSRXUEDODQFLQJDQG
RGHU9HUEUHQQXQJGHUGDULQHQWKDOWHQHQ.RKOHQZDV UHFRYHU\ RU LQFLQHUDWLRQ RI WKH K\GURFDUERQV FRQ

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Bild 5. Schwimmdachdichtung Fig. 5. Floating roof seal


1 Tankwand 1 tank wall
2 Sekundrdichtung 2 secondary seal
3 Lsch-Schaum-Fangblech 3 fire-extinguishing foam deflector
4 Schwimmdach 4 floating roof
5 Aufhngeschere 5 suspension system
6 Andruckfeder 6 compression spring
7 Wachskratzer 7 wax scraper
8 Primrdichtung 8 primary seal
9 Gleitblech 9 flexible wiper plate

VHUVWRIIHHUUHLFKW'DEHLVLQG(LQULFKWXQJHQ6LFKHU WDLQHGLQWKHFROOHFWHGYDSRXUV)DFWRUVWREHFRQVLG
KHLWVULVLNHQXQG0LQLPLHUXQJGHV(QHUJLHDXIZDQGHV HUHG LQ WKLV FRQQHFWLRQ LQFOXGH HTXLSPHQW UHTXLUH
]XEHUFNVLFKWLJHQ PHQWVVDIHW\ULVNVDQGPLQLPL]DWLRQRIHQHUJ\FRQ
VXPSWLRQ
'LH (PLVVLRQHQ KlQJHQ EHLP 8PVFKODJ YRQ 0LQH (PLVVLRQV JHQHUDWHG GXULQJ PLQHUDO RLO ORDGLQJXQ
UDO|OHQYRQIROJHQGHQ3DUDPHWHUQDE ORDGLQJ RSHUDWLRQV DUH GHWHUPLQHG E\ WKH IROORZLQJ
IDFWRUV
'DPSIGUXFNGHVHLQJHIOOWHQ3URGXNWHV YDSRXU SUHVVXUH RI OLTXLG SURGXFW EHLQJ ORDGHG
XQORDGHG
$UWGHVYRUKHULJHQ7DQNLQKDOWVYRQGHUGLH.RQ NLQGRISULRUWDQNFRQWHQWVZKLFKDIIHFWVWKHFRQ
]HQWUDWLRQ GHV EHUHLWV LP 7DQN HQWKDOWHQHQ .RK FHQWUDWLRQRIWKHK\GURFDUERQDLUPL[WXUHDOUHDG\
OHQZDVVHUVWRII/XIWJHPLVFKHVEHHLQIOXVVWZLUG SUHVHQWLQWKHWDQN
=XU 9HUPLQGHUXQJ GHU (PLVVLRQHQ EHLP 8PVFKODJ 7KH IROORZLQJ PHDVXUHV DUH HPSOR\HG WR UHGXFH
YRQ0LQHUDO|OHQZHUGHQIROJHQGH0DQDKPHQDQJH HPLVVLRQVIURPPLQHUDORLOORDGLQJXQORDGLQJRSHUD
ZHQGHW WLRQV

Unterspiegelbefllung/Untenbefllung Top-submerged loading/bottom loading


'LH0LQHUDO|OHZHUGHQPLW)OODUPHQYHUODGHQGLH 0LQHUDORLOVDUHORDGHGZLWKWKHDLGRIORDGLQJDUPV
ELVDXIGHQ%RGHQGHV7DQNDEWHLOVGHU7UDQVSRUWEH H[WHQGLQJWRWKHERWWRPRIWKHWUDQVSRUWYHVVHOFRP

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

KlOWHUUHLFKHQEHL6FKLIIHQVLQGGLHVH5RKUHIHVWLQ SDUWPHQWV LQ WKH FDVH RI WDQNHU VKLSV WKH ORDGLQJ
VWDOOLHUW0LWGLHVHU7HFKQLNGHU8QWHUVSLHJHOEHIO DUPVDUHSHUPDQHQWO\LQVWDOOHG7KHVXEPHUJHGORDG
OXQJZLUGHLQ9HUVSUKHQYRQ3URGXNWHQYHUPLHGHQ LQJPHWKRGKHOSVSUHYHQWVSUD\LQJORVVHVVRWKDWWKH
GDGXUFKEOHLEWGHU.RKOHQZDVVHUVWRIIJHKDOWGHUYHU K\GURFDUERQ FRQFHQWUDWLRQ RI WKH GLVSODFHG DLU UH
GUlQJWHQ/XIWXQWHUKDOEGHU6lWWLJXQJVNRQ]HQWUDWLRQ PDLQVEHORZWKHVDWXUDWLRQFRQFHQWUDWLRQ
(LQHZHLWHUJHKHQGH(PLVVLRQVPLQGHUXQJZLUGGXUFK 0RUHHIILFLHQWHPLVVLRQFRQWUROLVDFKLHYHGZLWKWKH
8QWHQEHIOOXQJPLW7URFNHQNXSSOXQJHUUHLFKW'LHVH ERWWRP ORDGLQJ PHWKRG XVLQJ GULSWLJKW FRXSOLQJV
7HFKQLN LVW MHGRFK HUVW EHL GHU 7.:%HIOOXQJ DQ &XUUHQWO\WKLVORDGLQJPHWKRGLVRQO\DSSOLFDEOHWR
ZHQGEDUZHLOGLHHXURSDZHLW]XP(LQVDW]NRPPHQ WDQNWUXFNVVLQFHWKHUDLOWDQNFDUVHPSOR\HGWKURXJK
GHQ (LVHQEDKQ.HVVHOZDJHQ KLHUIU QRFK QLFKW JH RXW (XURSH DUH DV \HW QRW VWDQGDUGL]HG IRU WKLV
QRUPWVLQG PHWKRG

Gaspendelung Vapour balancing


=XU9HUPLQGHUXQJE]Z9HUPHLGXQJYRQ(PLVVLRQHQ 7RSUHYHQWRUUHGXFHHPLVVLRQVIL[HGURRIWDQNVDQG
N|QQHQ )HVWGDFKWDQNV XQG 8PVFKODJVHLQULFKWXQJHQ WKH ORDGLQJXQORDGLQJ HTXLSPHQW FDQ EH LQWHUFRQ
GXUFK *DVSHQGHOOHLWXQJHQ YHUEXQGHQ ZHUGHQ hEHU QHFWHGE\YDSRXUUHWXUQOLQHVDPHWKRGNQRZQDVYD
GLHVHILQGHWHLQ$XVWDXVFKGHUYHUGUlQJWHQ*DVYROX SRXUEDODQFLQJ
PLQDVWDWW
'LH YHUGUlQJWHQ *DV/XIWJHPLVFKH N|QQHQ EHU 9LDWKHYDSRXUUHWXUQOLQHWKHGLVSODFHGJDVDLUPL[
HLQH3HQGHOOHLWXQJ]ZLVFKHQ9HUODGHVWHOOHXQG$XV WXUHV FDQ EH UHWXUQHG IURP WKH ORDGLQJ SRLQW WR WKH
ODJHUXQJVWDQN JHSHQGHOW ZHUGHQ ZHQQ NHLQH WDQNEHLQJHPSWLHG7KLVPHWKRGLVRQO\DSSOLFDEOHWR
6FKZLPPGDFKWDQNVEHWURIIHQVLQG'HU(LQEDXYRQ IL[HGURRIWDQNV'HWRQDWLRQDQGIODPHDUUHVWHUVDUH
'HWRQDWLRQVXQG)ODPPHQGXUFKVFKODJVVLFKHUXQJHQ UHTXLUHGIRUVDIHW\UHDVRQV
LVWDXV*UQGHQGHU$QODJHQVLFKHUXQJQRWZHQGLJ
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Dmpfespeicherung Vapour buffering


=XU$XIQDKPHYRQNXU]IULVWLJDQIDOOHQGHQJU|HUHQ 7RSURYLGHIRUWHPSRUDU\VWRUDJHRIPDMRUDPRXQWV
0HQJHQ DQ YHUGUlQJWHQ .RKOHQZDVVHUVWRII*HPL RI H[SHOOHG K\GURFDUERQDLU PL[WXUHV DQG HQVXUH D
VFKHQVRZLH]XU9HUJOHLFKPlLJXQJGHU(LQVDW]PHQ XQLIRUPIHHGUDWHWRWKHGRZQVWUHDPYDSRXUUHFRYHU\
JHQ HLQHU QDFKJHVFKDOWHWHQ 5FNJHZLQQXQJVDQODJH V\VWHPEXIIHUYHVVHOVPD\EHLQWHJUDWHGLQWRWKHYD
N|QQHQ3XIIHUEHKlOWHULQGDV*DVSHQGHOV\VWHPLQWH SRXU EDODQFLQJ V\VWHP 7KHVH DUH QRUPDOO\ IL[HG
JULHUWZHUGHQ+LHUEHLKDQGHOWHVVLFKLP$OOJHPHL URRIWDQNVZKLFKKDYHEHHQUHWURILWWHGZLWKDQLQWHU
QHQ XP XPJHUVWHWH )HVWGDFKWDQNV GLH PLW +LOIH QDO HODVWRPHULF GLDSKUDJP GHFN WR SURYLGH IOH[LEOH
HLQHU(ODVWRPHUPHPEUDQ.RQVWUXNWLRQHLQYDULDEOHV DGMXVWPHQWRIWKHYHVVHOYROXPHWRYDULDWLRQVLQWKH
$XIQDKPHYHUP|JHQIU*DV/XIWJHPLVFKHDXIZHL YDSRXU IORZ 7KH UHTXLUHPHQWV IRU WKH FRQVWUXFWLRQ
VHQ'HU%DXXQGGLH$XVUVWXQJYRQ'lPSIHVSHL DQGHTXLSPHQWRIYDSRXUEXIIHUYHVVHOVDUHUHJXODWHG
FKHUQ LVW LQ GHP 9G7h90HUNEODWW 7DQNDQODJHQ LQ9G7h90HUNEODWW7DQNIDUPV>@
>@JHUHJHOW

Dmpferckgewinnung Vapour recovery


=LHOGHU'lPSIHUFNJHZLQQXQJLVWGLH9HUIOVVLJXQJ 7KHREMHFWLYHRIYDSRXUUHFRYHU\LVWKHUHFRQGHQVD
GHU.RKOHQZDVVHUVWRIIH WLRQRIWKHK\GURFDUERQYDSRXUV

D .RQGHQVDWLRQ D &RQGHQVDWLRQ
%HLGLHVHP9HUIDKUHQZLUGGDV.RKOHQZDVVHUVWRII ,Q WKH FRQGHQVDWLRQ SURFHVV WKH K\GURFDUERQDLU
/XIWJHPLVFKLQHLQHP:lUPHWDXVFKHUDEJHNKOWXQG PL[WXUHLVFRROHGLQDKHDWH[FKDQJHUZLWKSDUWRIWKH
GDEHL HLQ 7HLO GHU .RKOHQZDVVHUVWRIIH NRQGHQVLHUW K\GURFDUERQVEHLQJFRQGHQVHGLQWKHSURFHVV7KHDW
'LH .RQ]HQWUDWLRQ LQ GHU $EOXIW LVW DXVVFKOLHOLFK WDLQDEOH UHVLGXDO K\GURFDUERQ FRQFHQWUDWLRQ LQ WKH
YRQGHUHUUHLFKWHQ7HPSHUDWXUXQGQLFKWYRQGHU%H H[KDXVWDLULVH[FOXVLYHO\DIXQFWLRQRIWKHDSSOLHGUH
ODGXQJDEKlQJLJ IULJHUDWLRQWHPSHUDWXUHLQWKHFRQGHQVHUDQGLVLQGH
SHQGHQWRIWKHIHHGVWUHDPK\GURFDUERQORDG
'D GLH VWHWV YRUKDQGHQH /XIWIHXFKWLJNHLW ]XU 9HU $VWKHKXPLGLW\LQYDULDEO\SUHVHQWLQWKHDPELHQWDLU
HLVXQJGHV:lUPHWDXVFKHUVIKUWPXVVGLHVHU]ZHL OHDGV WR WKH LFLQJXS RI WKH KHDW H[FKDQJHU D WZR
VWXILJXQGRGHUIU:HFKVHOEHWULHEDXVJHOHJWZHUGHQ VWDJH FRQGHQVDWLRQ SURFHVV DQGRU D WZRVWDJH FRQ

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

3UREOHPDWLVFK LVW GDV $XIWUHWHQ YRQ .RKOHQZDVVHU GHQVLQJ V\VWHP SURYLGLQJ IRU DOWHUQDWH RSHUDWLRQ RI
VWRII:DVVHUPLVFKNULVWDOOHQ WKHKHDWH[FKDQJHUVLVUHTXLUHG2SHUDWLQJSUREOHPV
PD\EHHQFRXQWHUHGZLWKPL[HGK\GURFDUERQZDWHU
FU\VWDOV

E $EVRUSWLRQ E $EVRUSWLRQ
%HL GHU $EVRUSWLRQ ZLUG GDV .RKOHQZDVVHUVWRII ,QWKHDEVRUSWLRQSURFHVVWKHK\GURFDUERQDLUPL[
/XIWJHPLVFKLP*HJHQVWURPGXUFKHLQHEHL%HWULHEV WXUHLVSDVVHGWKURXJKDQDEVRUEHULQFRXQWHUFXUUHQW
WHPSHUDWXU IOVVLJH 0LVFKXQJ YRQ .RKOHQZDVVHU ZLWKDVFUXEELQJVROXWLRQFRQVLVWLQJRIDK\GURFDUERQ
VWRIIHQ ]XP%HLVSLHO3HWUROHXP DXVJHZDVFKHQ PL[WXUHZKLFKLVOLTXLGDWRSHUDWLQJWHPSHUDWXUH HJ
NHURVHQH ,QWKHSURFHVVWKHYDSRXUERUQHK\GURFDU
ERQVDUHDEVRUEHGLQWKHVFUXEELQJVROXWLRQ
'LHEHODGHQH:DVFKIOVVLJNHLWNDQQMHQDFKGHQ|UW 'HSHQGLQJRQWKHVLWHVSHFLILFFRQGLWLRQVWKHORDGHG
OLFKHQ 0|JOLFKNHLWHQ LQ HLQHP 3UR]HVV HLQJHVHW]W VFUXEELQJVROXWLRQFDQEHURXWHGWRIXUWKHUXVHLQDQ
RGHULQHLQHPZHLWHUHQ9HUIDKUHQVVFKULWWGXUFK$XI RWKHUSURFHVVRULWVK\GURFDUERQORDGFDQEHGHVRUEHG
KHL]HQ HQWJDVW ZHUGHQ 'LH KLHUEHL DXVJHWULHEHQHQ E\UHKHDWLQJLQDIXUWKHUSURFHVVVWHS7KHGHVRUEHG
*DVH PVVHQ HQWZHGHU NRQGHQVLHUW DXIJHDUEHLWHW JDVHVPXVWHLWKHUEHFRQGHQVHGIXUWKHUSURFHVVHGRU
RGHU YHUEUDQQW ZHUGHQ )U GLH .RQGHQVDWLRQ YRQ LQFLQHUDWHG 7KH FRQGHQVDWLRQ RI EXWDQHFRQWDLQLQJ
EXWDQKDOWLJHQ*HPLVFKHQPVVHQ.lOWHDQODJHQHLQ PL[WXUHVUHTXLUHVUHIULJHUDWLRQV\VWHPV
JHVHW]WZHUGHQ

F $GVRUSWLRQ F $GVRUSWLRQ
%HL GHU $GVRUSWLRQ ZLUG GDV .RKOHQZDVVHUVWRII ,QWKHDGVRUSWLRQSURFHVVWKHK\GURFDUERQDLUPL[
/XIWJHPLVFKGXUFKHLQ$GVRUEHQV]XP%HLVSLHO$N WXUH LV SDVVHG WKURXJK DQ DGVRUEHQW EHG HJ DFWL
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

WLYNRKOHJHOHLWHW'DEHLODJHUQVLFKGLH.RKOHQZDV YDWHGFDUERQZLWKWKHK\GURFDUERQVEHLQJUHWDLQHG
VHUVWRIIHDQGDV$GVRUEHQVDQ RQWKHVXUIDFHRIWKHDGVRUEHQW
1DFKHLQHUJHZLVVHQ%HODGH]HLWPXVVGDV$GVRUEHQV $IWHUDGHILQHGORDGLQJWLPHWKHDGVRUEHQWPXVWEH
UHJHQHULHUW ZHUGHQ 'DV 'HVRUEDW ZLUG LQ HLQHU UHJHQHUDWHG7KHUHVXOWLQJGHVRUEDWHLVDEVRUEHGLQD
:DVFKNRORQQH RGHU :DVFKVWXIH  YRQ HLQHP ]LUNX FLUFXODWLQJJDVROLQHRUJDVROLQHFRPSRQHQWVWUHDPLQ
OLHUHQGHQ %HQ]LQ RGHU %HQ]LQNRPSRQHQWHQVWURP DGRZQVWUHDPZDVKFROXPQ ZDVKVWDJH 7KHUHVLG
DXIJHQRPPHQ'DV5HVWJDVZLUGZHLWHUEHKDQGHOW XDOJDVLVVHQWWRIXUWKHUWUHDWPHQW
'XUFK (LQVDW] HLQHU VWDUNHQ 9DNXXPSXPSH 'UHK 7KHHPLVVLRQFRQWUROHIILFLHQF\RIWKLVSURFHVVFDQEH
NROEHQJHEOlVH EHVWHKWGLH0|JOLFKNHLWHLQHUZHLWH IXUWKHU LPSURYHG E\ WKH XVH RI D SRZHUIXO YDFXXP
UHQ/HLVWXQJVYHUEHVVHUXQJGLHVHV$QODJHQW\SV SXPS URWDU\OREHEORZHU 

G 0HPEUDQYHUIDKUHQ G 0HPEUDQHSURFHVV
6HOHNWLYH 0HPEUDQHQ WUHQQHQ GDV 'lPSIH/XIW 7KHPHPEUDQHSURFHVVXVHVVHOHFWLYHPHPEUDQHVWR
JHPLVFK LQ HLQH PLW .RKOHQZDVVHUVWRIIHQ DQJHUHL VHSDUDWHWKHYDSRXUDLUPL[WXUHLQWRDK\GURFDUERQ
FKHUWH 3KDVH 3HUPHDW  GLH GDQQ NRQGHQVLHUW RGHU HQULFKHG SKDVH SHUPHDWH  ZKLFK LV VXEVHTXHQWO\
DEVRUELHUWZLUGXQGHLQHDEJHUHLFKHUWH3KDVH 5HWHQ FRQGHQVHG RU DEVRUEHG DQG D K\GURFDUERQGHSOHWHG
WDW DXI SKDVH UHWHQWDWH 
=XUZHLWHUHQ)HLQUHLQLJXQJLVWGLH.RPELQDWLRQPLW )RU IXUWKHU SXULILFDWLRQ WKH PHPEUDQH SURFHVV FDQ
*DVPRWRUHQ RGHU 'UXFNZHFKVHODGVRUSWLRQVVWXIHQ EHFRPELQHGZLWKJDVHQJLQHVRUSUHVVXUHVZLQJDG
JHHLJQHW ]ZHLVWXILJH $QODJH  %HLP OHW]WHUHQ 9HU VRUSWLRQVWDJHV WZRVWDJHV\VWHP ,QWKHODWWHUSUR
IDKUHQZLUGGLH)HLQUHLQLJXQJGXUFK$GVRUSWLRQXQ FHVVIXUWKHUSXULILFDWLRQLVDFFRPSOLVKHGE\SUHVVX
WHU'UXFNDQ$NWLYNRKOHRGHUDQ0ROVLHEHQHUUHLFKW UL]HGDGVRUSWLRQRIWKHUHVLGXDOK\GURFDUERQVRQDF
'LH 5HJHQHUDWLRQ HUIROJW GXUFK (QWVSDQQHQ XQG WLYDWHG FDUERQ RU PROHFXODU VLHYHV 5HJHQHUDWLRQ LV
GXUFK 8QWHUGUXFN 'LH (LQJDQJVNRQ]HQWUDWLRQ GHU DFFRPSOLVKHG E\ GHSUHVVXUL]DWLRQ DQG YDFXXP GHV
'UXFNZHFKVHODGVRUSWLRQVVWXIHOLHJWLQGHU5HJHOXQ RUSWLRQ 7KH K\GURFDUERQ LQOHW FRQFHQWUDWLRQ DW WKH
WHUKDOE GHU XQWHUHQ ([SORVLRQVJUHQ]H XQG HV ZLUG SUHVVXUHVZLQJ DGVRUSWLRQ VWDJH LV QRUPDOO\ EHORZ
NHLQHQHQQHQVZHUWH:lUPHPHQJHIUHLJHVHW]W WKHORZHUH[SORVLRQOLPLW7KHDPRXQWRIKHDWOLEHU
DWHGLVQHJOLJLEOH

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Dmpfeverbrennung Vapour incineration


'LH .RKOHQZDVVHUVWRII/XIWJHPLVFKH DXV 9HUODGH +\GURFDUERQDLU PL[WXUHV UHOHDVHG GXULQJ ORDGLQJ
YRUJlQJHQN|QQHQXQWHU(LQKDOWXQJEHVWLPPWHU9HU XQORDGLQJ RSHUDWLRQV FDQ EH GHVWUR\HG E\ LQFLQHUD
IDKUHQVEHGLQJXQJHQ YHUEUDQQW ZHUGHQ 'lPSIHYHU WLRQSURYLGHGWKDWWKHSUHVFULEHGSURFHVVFRQGLWLRQV
EUHQQXQJVDQODJHQN|QQHQDXFKLQ.RPELQDWLRQPLW DUHREVHUYHG9DSRXULQFLQHUDWLRQV\VWHPVPD\DOVR
'lPSIHUFNJHZLQQXQJVDQODJHQEHWULHEHQZHUGHQ EH RSHUDWHG LQ FRPELQDWLRQ ZLWK YDSRXU UHFRYHU\
XQLWV
%HL PDJHUHQ .RKOHQZDVVHUVWRII/XIWJHPLVFKHQ LVW 7KHLQFLQHUDWLRQRIOHDQK\GURFDUERQDLUPL[WXUHVUH
HLQH$XIVlWWLJXQJRGHU6WW]IHXHUXQJHUIRUGHUOLFK TXLUHVSULRUFRQFHQWUDWLRQRIWKHIHHGVWUHDPRUVXS
SRUWILULQJ
%HL DOOHQ 'lPSIHYHUEUHQQXQJVDQODJHQ PXVV GLH 5HJDUGOHVVRIWKHW\SHRIYDSRXULQFLQHUDWLRQV\VWHP
6LFKHUKHLWVWHFKQLN EHVRQGHUV EHDFKWHW ZHUGHQ ([ VSHFLDODWWHQWLRQPXVWEHJLYHQWRVDIHW\UHTXLUHPHQWV
%HUHLFKH 'HWRQDWLRQV XQG )ODPPHQGXUFKVFKODJV H[SORVLRQKD]DUGDUHDVGHWRQDWLRQDQGIODPHDUUHVW
VLFKHUXQJHQ  HUV 

2.3.1 Einlagern 2.3.1 Product supply


%HLP (LQODJHUQ WUHWHQ (PLVVLRQHQ GXUFK 9HUGUlQ 'XULQJWDQNILOOLQJHPLVVLRQVRFFXUDVDUHVXOWRIWKH
JXQJ GHV HQWVSUHFKHQGHQ *DVYROXPHQV DXV GHP GLVSODFHPHQWRIWKHHTXLYDOHQWYDSRXUYROXPHIURP
7DQNDXI'LH(PLVVLRQKlQJWYRQGHU.RKOHQZDVVHU WKHWDQN7KHHPLVVLRQUDWHGHSHQGVRQWKHJDVSKDVH
VWRIINRQ]HQWUDWLRQ LQ GHU *DVSKDVH XQG GHU 0LQGH K\GURFDUERQFRQFHQWUDWLRQDQGWKHHPLVVLRQFRQWURO
UXQJVPDQDKPHDE VLHKH$EVFKQLWW %HLP(QW PHDVXUHDSSOLHG VHH6HFWLRQ 3URGXFWXQORDGLQJ
OHHUHQGHV7UDQVSRUWPLWWHOVWUHWHQNHLQH(PLVVLRQHQ IURPWKHWUDQVSRUWLQJYHVVHOGRHVQRWJHQHUDWHHPLV
DXI VLRQV

2.3.2 Auslagern 2.3.2 Product withdrawal


Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

'LH(PLVVLRQEHLGHU%HIOOXQJYRQ7UDQVSRUWPLWWHOQ (PLVVLRQVJHQHUDWHGGXULQJWKHORDGLQJRIWUDQVSRUW
VHW]WVLFK]XVDPPHQDXVGHQ9HUGUlQJXQJVYHUOXVWHQ LQJYHVVHOVDUHFRPSULVHGRIGLVSODFHGYDSRXUVRULJL
GHU'lPSIHGHVYRUKHULJHQ%HKlOWHULQKDOWVXQGGHQ QDWLQJIURPWKHSULRUWDQNFRQWHQWVDQGWKHHYDSRUD
9HUGXQVWXQJVYHUOXVWHQ ZlKUHQG GHU %HIOOXQJ 'LH WLRQORVVHVDULVLQJGXULQJWKHORDGLQJRSHUDWLRQ7KH
(PLVVLRQ KlQJW YRP *UDG GHU 9HUVSUKXQJ EHLP HPLVVLRQUDWHGHSHQGVRQWKHVSUD\LQJORVVHVRFFXU
(LQODXIGHUQHXHQ7DQNIOOXQJXQGGHU0LQGHUXQJV ULQJDVWKHOLTXLGSURGXFWLVEHLQJILOOHGLQWRWKHWUDQV
PDQDKPHDEGHUGLH*U|HGHV9HUGDPSIXQJVYHU SRUWYHVVHOZKLFKLQWXUQKDYHDQLQIOXHQFHRQWKH
OXVWHVEHHLQIOXVVW PDJQLWXGHRIHYDSRUDWLRQORVVHVDQGWKHHPLVVLRQ
FRQWUROPHDVXUHDSSOLHG

2.3.3 Umlagern und Mischen 2.3.3 In-plant transfer and blending


'LH(PLVVLRQHQKlQJHQEHLP8PODJHUQXQG0LVFKHQ 7KHHPLVVLRQVWREHH[SHFWHGGXULQJLQSODQWSURGXFW
YRQGHU.RKOHQZDVVHUVWRIINRQ]HQWUDWLRQLQGHU*DV WUDQVIHUDQGEOHQGLQJGHSHQGRQWKHJDVSKDVHK\GUR
SKDVHXQGGHU0LQGHUXQJVPDQDKPHDE VLHKH$E FDUERQFRQFHQWUDWLRQDQGWKHHPLVVLRQFRQWUROPHDV
VFKQLWW  XUHDSSOLHG VHH6HFWLRQ 

2.4 Frderung in Rohrleitungen, Dichtsysteme 2.4 Transport in piping lines, sealing systems
%HLGHU)|UGHUXQJYRQ0LQHUDO|OHQGXUFK5RKUOHLWXQ 7UDQVSRUWRIPLQHUDORLOVLQSLSLQJOLQHVFDXVHVHPLV
JHQ HQWVWHKHQ (PLVVLRQHQ DQ :HOOHQ .ROEHQVWDQ VLRQVDWWKHVKDIWSLVWRQDQGVWHPEXVKLQJVRISXPSV
JHQ XQG 6SLQGHOGXUFKIKUXQJHQ EHL 3XPSHQ XQG VKXWRIIDQGFRQWUROYDOYHVDVZHOODVDWWKHIODQJHG
$EVSHUUXQG5HJHORUJDQHQVRZLHDQ)ODQVFKYHUELQ MRLQWV2YHUWKH\HDUVGLIIHUHQWVHDOLQJV\VWHPVKDYH
GXQJHQ9HUVFKLHGHQH0|JOLFKNHLWHQGHU$EGLFKWXQ EHHQ GHYHORSHG 7KH PDJQLWXGH RI WKHVH HPLVVLRQV
JHQ VLQG LP /DXIH GHU =HLW HQWZLFNHOW ZRUGHQ 'LH FDQEHUHGXFHGE\DSSURSULDWHGHVLJQSURSHULQVWDO
*U|H GHU (PLVVLRQHQ DXV VROFKHQ $EGLFKWXQJHQ ODWLRQDQGJRRGPDLQWHQDQFHRIWKHVHDOLQJV\VWHPV
NDQQ GXUFK JHHLJQHWH .RQVWUXNWLRQ VDFKJHUHFKWH
0RQWDJHXQGVRUJIlOWLJH:DUWXQJYHUULQJHUWZHUGHQ
:lKUHQG GHV %HWULHEHV ZLUG GLH EHVWLPPXQJV 'XULQJ RSHUDWLRQ WKH VHDOV DQG JDVNHWV PXVW EH
JHPlH )XQNWLRQ GHU 'LFKWHOHPHQWH GXUFK ,QVSHN FKHFNHGIRUSURSHUIXQFWLRQWKHLQVSHFWLRQLQWHUYDOV

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

WLRQHQ EHUSUIW ZREHL VLFK GLH ,QVSHNWLRQVKlXILJ GHSHQGLQJRQWKHH[SHFWHGVHUYLFHOLIHDQGWKHKD]DUG


NHLWQDFKGHU]XHUZDUWHQGHQ6WDQG]HLWXQGGHP*H SRWHQWLDORIWKHIOXLGFRQYH\HG
IlKUGXQJVSRWHQ]LDOGHV)|UGHUJXWHVULFKWHW
=XVlW]OLFKNRPPHQMHQDFK+lXILJNHLWYRQ0lQJHOQ 'HSHQGLQJ RQ WKH IUHTXHQF\ RI VHDO IDLOXUHV DGGL
DOV JHHLJQHWH YRUEHXJHQGH 0DQDKPHQ 6FKDGHQV WLRQDOSUHYHQWLYHPHDVXUHVFDQLQFOXGHIDLOXUHDQDO\
DQDO\VH 6FKZDFKVWHOOHQIRUVFKXQJ VRZLH (UIDK VLVZHDNSRLQWDQDO\VLVDQGH[SHULHQFHH[FKDQJH
UXQJVDXVWDXVFKLQ)UDJH
=XU:DKOGHUWHFKQLVFKHQ/|VXQJN|QQHQGLHLQ$E )RUWKHVHOHFWLRQRIWKHRSWLPXPVHDOLQJVROXWLRQDY
VFKQLWWELV$EVFKQLWWDQJHJHEHQHQGXUFK HUDJH HPLVVLRQV IURP WKH IOXLG FRQYH\HG DUH WDEX
VFKQLWWOLFKHQ(PLVVLRQHQGHV)|UGHUJXWHVIUGLHYHU ODWHGLQ6HFWLRQWR6HFWLRQIRUWKHGLIIHUHQW
VFKLHGHQHQ 'LFKWV\VWHPH KHUDQJH]RJHQ ZHUGHQ (V W\SHVRIVHDOLQJV\VWHPV7KHVHDYHUDJHYDOXHVFDQEH
KDQGHOWVLFKKLHUEHLXP2ULHQWLHUXQJVZHUWH]XU$E XVHG DV DQ RULHQWDWLRQ IRU HPLVVLRQ HVWLPDWHV DQG D
VFKlW]XQJGHU(PLVVLRQHQXQGJUREHQ%HZHUWXQJGHU URXJKVHDOLQJV\VWHPHYDOXDWLRQ
'LFKWXQJVV\VWHPH
'LHVH:HUWHN|QQHQHEHQIDOOV]XU$EVFKlW]XQJYRQ 0RUHRYHUWKHVHYDOXHVFDQEHWDNHQDVDEDVLVIRUHV
JDVI|UPLJHQ(PLVVLRQHQEHLGHU3ODQXQJXQGDOV8Q WLPDWLQJJDVHRXVHPLVVLRQVLQWKHHQJLQHHULQJSKDVH
WHUVWW]XQJ EHL GHU (UVWHOOXQJ YRQ (PLVVLRQVHUNOl DQGDVDVRXUFHRIUHIHUHQFHIRUHPLVVLRQUHSRUWLQJWR
UXQJHQYHUZHQGHWZHUGHQ VXSHUYLVRU\DXWKRULWLHV

2.4.1 Pumpen 2.4.1 Pumps


%HL GHU )|UGHUXQJ YRQ 0LQHUDO|OHQ PLW 3XPSHQ 3XPSVIRUPLQHUDORLOVHUYLFHDUHQRUPDOO\HTXLSSHG
NRPPHQLP$OOJHPHLQHQGLHLQ 7DEHOOH  DXIJH ZLWKWKHVKDIWVHDOLQJV\VWHPVOLVWHGLQ 7DEOH  ,Q
IKUWHQ'LFKWV\VWHPH]XP(LQVDW]'DEHLLVWPLWGHQ QRUPDORSHUDWLRQWKHJLYHQDYHUDJHHPLVVLRQVDUHWR
DQJHJHEHQHQGXUFKVFKQLWWOLFKHQ(PLVVLRQHQLPODX EHH[SHFWHG
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

IHQGHQ%HWULHE]XUHFKQHQ

Tabelle 8. Durchschnittliche gasfrmige Emissionen des Frdergutes bei Pumpen


Nr. Dichtsystem mit nachfolgendem Dichtungstyp Durchschnittliche gasfrmige Emission Bemerkung
des Frdergutes im laufenden Betrieb *)
1 Einzel-Gleitringdichtung 1 g/(h Stck) DW **) = 50 mm
p = 10 bar (1 MPa)
n = 3000 min1
2 Mehrfach-Gleitringdichtung, mit Vorlagemedium annhernd Null
(bei geschlossener Leckageabfuhr)
3 Mehrfach-Gleitringdichtung, mit Sperrmedium keine Emission (technisch dicht)

4 wellendichtungslose Ausfhrung/Membranpumpe keine Emission (technisch dicht)

(VKDQGHOWVLFKKLHUEHLQLFKWXP*UHQ]ZHUWH VLHKHDXFK$EVFKQLWW 
:HOOHQGXUFKPHVVHU

Table 8. Average gaseous emissions from the fluid conveyed during pumping
No. Type of sealing system Average gaseous emissions from fluid Notes
pumped during normal operation *)
1 Single mechanical seal 1 g/(h unit) DS **) = 50 mm
p = 10 bar (1 MPa)
n = 3000 min1
2 Multiple mechanical seal with quench fluid approximately zero
(venting to a closed system)
3 Multiple mechanical seal with buffer fluid zero emission (technically tight)

4 Sealless pump design/diaphragm pump zero emission (technically tight)

3OHDVHQRWHWKDWWKHVHDUHQRWOLPLWYDOXHV VHHDOVR6HFWLRQ 
6KDIWGLDPHWHU

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Tabelle 9. Durchschnittliche gasfrmige Emissionen des Frdergutes an Durchfhrungen der Absperr- und Regelor-
gane
Nr. Dichtsystem mit nachfolgendem Dichtungstyp Durchschnittliche gasfrmige Emission des
Frdergutes im laufenden Betrieb, bezogen auf den
mittleren Dichtungsumfang*)
mg/(s m)

1 Stopfbuchse mit Packung 1,0

2 Stopfbuchse mit Manschette, O-Ring 0,1

3 Stopfbuchse mit Packung, Stopfbuchse mit Manschette, O-Ring 0,01

4 metallischer Faltenbalg, abgedichtet 0,01

5 metallischer Faltenbalg, abgedichtet


0,001
(mit Nachweis nach Abschnitt 3.4.2)

6 Stopfbuchse mit Packungen und Sperrmedium/Absaugung,


keine Emission (technisch dicht)
metallischer Faltenbalg, beidseitig verschweit

(VKDQGHOWVLFKKLHUEHLQLFKWXP*UHQ]ZHUWH VLHKHDXFK$EVFKQLWW 

Table 9. Average gaseous emissions from fluid conveyed at shutoff and control valve stem seals
No. Type of sealing system Average gaseous emissions from
fluid conveyed during normal operation related to the
mean seal perimeter *)
mg/(s m)

1 Packing gland 1.0

2 Gland with collar, O-ring 0.1


3 Packing gland, gland with collar, O-ring 0.1
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

4 Metal bellows, sealed 0.01

5 Metal bellows, sealed


0.001
(to be verified by calculation; see Section 3.4.2)

6 Packing gland and buffer medium/vent connection,


zero emissions (technically tight)
metal bellows seal-welded on either side

7KHVHDUHQRWOLPLWYDOXHV VHHDOVR6HFWLRQ 

2.4.2 Absperr- und Regelorgane 2.4.2 Shutoff and control valves


%HLGHU)|UGHUXQJYRQ0LQHUDO|OHQNRPPHQDQGHQ 6KXWRIIDQGFRQWUROYDOYHVIRUPLQHUDORLOVHUYLFHDUH
'XUFKIKUXQJHQ GHU $EVSHUU XQG 5HJHORUJDQH LP JHQHUDOO\ HTXLSSHG ZLWK WKH VWHP VHDOLQJ V\VWHPV
$OOJHPHLQHQGLHLQ 7DEHOOH  DXIJHIKUWHQ'LFKW OLVWHGLQ 7DEOH 8QGHUQRUPDOVHUYLFHFRQGLWLRQV
V\VWHPH]XP(LQVDW]'DEHLLVWPLWGHQDQJHJHEHQHQ WKH JLYHQ DYHUDJH HPLVVLRQV DUH WR EH H[SHFWHG
GXUFKVFKQLWWOLFKHQ(PLVVLRQHQLPODXIHQGHQ%HWULHE 7KHVHDUHJXLGHYDOXHVIRUHPLVVLRQHVWLPDWHVDQGD
]X UHFKQHQ (V KDQGHOW VLFK KLHUEHL XP 2ULHQWLH URXJKVHDOLQJV\VWHPHYDOXDWLRQ
UXQJVZHUWH ]XU $EVFKlW]XQJ GHU (PLVVLRQHQ XQG
JUREHQ%HZHUWXQJGHU'LFKWXQJVW\SHQ

2.4.3 Flanschverbindungen 2.4.3 Flanged joints


%HL GHU )|UGHUXQJ YRQ 0LQHUDO|OHQ NRPPHQ DQ )ODQJHG MRLQWV IRU PLQHUDO RLO VHUYLFH DUH JHQHUDOO\
)ODQVFKYHUELQGXQJHQ LP $OOJHPHLQHQ GLH LQ 7D HTXLSSHGZLWKWKHJDVNHWW\SHVOLVWHGLQ 7DEOH 
EHOOH  DXIJHIKUWHQ 'LFKWV\VWHPH ]XP (LQVDW] 8QGHUQRUPDOVHUYLFHFRQGLWLRQVWKHJLYHQDYHUDJH
'DEHL LVW PLW GHQ DQJHJHEHQHQ GXUFKVFKQLWWOLFKHQ HPLVVLRQVDUHWREHH[SHFWHG7KHVHDUHJXLGHYDOXHV
(PLVVLRQHQLPODXIHQGHQ%HWULHE]XUHFKQHQ(VKDQ IRUHPLVVLRQHVWLPDWHVDQGDURXJKJDVNHWYDOXDWLRQ
GHOWVLFKKLHUEHLXP2ULHQWLHUXQJVZHUWH]XU$EVFKlW
]XQJ GHU (PLVVLRQHQ XQG JUREHQ %HZHUWXQJ GHU
'LFKWXQJVW\SHQ

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Tabelle 10. Durchschnittliche gasfrmige Emissionen des Frdergutes bei Flanschabdichtungen


Nr. Dichtsystem mit Durchschnittliche gasfrmige Bemerkung
nachfolgendem Dichtungstyp Emission des Frdergutes im
laufenden Betrieb, bezogen auf
den mittleren Dichtungsumfang *)
mg/(s m)
1 Weichstoffdichtung; 0,01 zum Beispiel Faserplatte oder Platte aus expan-
Weichstoff-Metall-Dichtung; diertem Grafit oder PTFE-Platte; innen mit Metall
Metall-Weichstoff-Dichtung eingefasste Faserstoff- oder Grafitdichtung;
Spiraldichtung sowie Wellringdichtung oder
Kammprofildichtung mit Weichstoffauflage
2 Weichstoffdichtung; 0,001 zum Beispiel Elastomerdichtung; innen mit Metall
Weichstoff-Metall-Dichtung; eingefasste Spieblech- oder Klettblechdichtung;
Metall-Weichstoff-Dichtung Spiraldichtung sowie Wellringdichtung oder
(mit Nachweis nach Abschnitt 3.4.3) Kammprofildichtung mit Weichstoffauflage

(VKDQGHOWVLFKKLHUEHLQLFKWXP*UHQ]ZHUWH VLHKHDXFK$EVFKQLWW 

Table 10. Average gaseous emissions from fluid conveyed at flanged joints
No. Type of gasket Average gaseous emissions Notes
from fluid conveyed related to
mean gasket perimeter *)
mg/(s m)
1 Soft gasket; 0.01 e.g. compressed fibre or expanded graphite or
fabric-metal gasket, PTFE sheet, fibre or graphite gasket with internal
metal-fabric gasket wire reinforcement; spiral-wound metal gasket
with non-metallic filler as well as corrugated or
profile-serrated gaskets jacketed with non-
metallic filler.
2 Soft gasket; 0.001 e.g. elastomer gaskets, graphite sheet with
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

fabric-metal gasket; tangent reinforcement (Spieblech) or limpet


metal-fabric gasket reinforcement (Klettblech); spiral-wound metal
(to be verified by calculation; gasket with non-metallic filler as well as corru-
see Section 3.4.3) gated or profile-serrated gasket jacketed with
non-metallic filler.
7KHVHDUHQRWOLPLWYDOXHV VHHDOVR6HFWLRQ 

2.4.4 Kappen und Blindflansche 2.4.4 Caps and blind flanges


=XU9HUPHLGXQJYRQ(PLVVLRQHQZlKUHQGGHV$QOD 7RSUHYHQWHPLVVLRQVGXULQJSODQWRSHUDWLRQDQGHQ
JHQEHWULHEHV ZHUGHQ (QWOHHUXQJV XQG (QWOIWXQJV VXUHVDIHRSHUDWLQJFRQGLWLRQVGUDLQDQGYHQWQR]]OHV
VWXW]HQDQ7LHIXQG+RFKSXQNWHQYRQ5RKUOHLWXQJV SURYLGHGDWSLSLQJV\VWHPORZDQGKLJKSRLQWVPXVW
V\VWHPHQPLW6FKUDXENDSSHQXQG%OLQGIODQVFKHQDXV EHVHDOHGE\VFUHZFDSVDQGEOLQGIODQJHV
*UQGHQGHU$QODJHQVLFKHUKHLWGLFKWJHVHW]W

2.5 Sonstige Vorgnge 2.5 Other operations


2.5.1 Tankreinigung 2.5.1 Tank cleaning
'LH (QWVWHKXQJ YRQ (PLVVLRQHQ EHL GHU 5HLQLJXQJ (PLVVLRQV JHQHUDWHG GXULQJ FUXGH RLO WDQN FOHDQLQJ
YRQ 5RK|OWDQNV VRZLH GLH 0LQGHUXQJ GLHVHU (PLV RSHUDWLRQV DQG WKH UHVSHFWLYH FRQWURO PHDVXUHV DUH
VLRQHQ ZHUGHQ DXVIKUOLFK LP IRUW]XVFKUHLEHQGHQ FRYHUHGLQGHWDLOE\'*0.5HVHDUFK5HSRUW
'*0.)RUVFKXQJVEHULFKW>@GDUJHVWHOOW >@ZKLFKLVEHLQJUHJXODUO\XSGDWHG
%HL GHU 5HLQLJXQJ YRQ 3URGXNWHQWDQNV HQWVWHKHQ (PLVVLRQVDULVLQJGXULQJSURGXFWWDQNFOHDQLQJRSHU
(PLVVLRQHQGXUFKQDWUOLFKHXQGPHFKDQLVFKH%HOI DWLRQV DUH GXH WR QDWXUDO RU IRUFHG YHQWLQJ 2IIJDV
WXQJ 0|JOLFKNHLWHQ ]XU (PLVVLRQVPLQGHUXQJ IU FOHDQLQJRUYDSRXUUHFRYHU\RSWLRQVIRUWKHFRQWURORI
3URGXNWHGHU*HIDKUNODVVH$ ,GXUFK(LQVDW]YRQ$E HPLVVLRQVIURPWDQNVVWRULQJ&ODVV$ ,SURGXFWVDUH
JDVUHLQLJXQJV RGHU UFNJHZLQQXQJVDQODJHQ DEHU SUHVHQWHG LQ >D@ WRJHWKHU ZLWK WKH OLPLWDWLRQV RI
DXFKGLH*UHQ]HQGLHVHU9HUIDKUHQXQG]XEHDFKWHQGH WKHVHWHFKQRORJLHVDQGWKHFRQGLWLRQVWREHREVHUYHG
5DQGEHGLQJXQJHQ VLQG XQWHU DQGHUHP LQ >D@ EH
VFKULHEHQ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

2.5.2 Probenahme 2.5.2 Sampling


3UREHQZHUGHQLQGHU5HJHOOHGLJOLFK]X'RNXPHQWD 6DPSOLQJLVQRUPDOO\RQO\UHTXLUHGIRUGRFXPHQWLQJ
WLRQHQGHU3URGXNWTXDOLWlWGLUHNWDXVGHP7UDQVSRUW WKH SURGXFW TXDOLW\ 6DPSOHV DUH H[WUDFWHG GLUHFWO\
PLWWHORGHUGHP/DJHUWDQNHQWQRPPHQXQGQDFK$E IURPWKHWUDQVSRUWLQJYHVVHORUWKHVWRUDJHWDQNDQG
ODXIGHU$XIEHZDKUXQJVIULVWGHP6ORS]XJHIKUW URXWHG WR WKH VORS V\VWHP DIWHU H[SLU\ RI WKH SUH
VFULEHGUHWHQWLRQSHULRG

3 Beschrnkung der Emissionen 3 Emission control


3.1 Allgemeines 3.1 General
%HL$QZHQGXQJGHULQ$EVFKQLWWXQG$EVFKQLWW ,QIDFLOLWLHVDSSO\LQJWKHHPLVVLRQFRQWUROWHFKQROR
EHVFKULHEHQHQ9HUIDKUHQWHFKQLVFKHQ(LQULFKWXQJHQ JLHVHTXLSPHQWDQGPHWKRGVGHVFULEHGLQ6HFWLRQ
VRZLHGHUWHFKQLVFKHQ0|JOLFKNHLWHQ]XU9HUPLQGH DQG6HFWLRQRIWKLVJXLGHOLQHWKHIROORZLQJHPLV
UXQJ GHU (PLVVLRQHQ HQWVSUHFKHQ LP $OOJHPHLQHQ VLRQ OHYHOV DQG FRQWURO PHWKRGV QRUPDOO\ UHSUHVHQW
GLHIROJHQGHQ(PLVVLRQVZHUWHXQG0DQDKPHQGHP WKHVWDWHRIWKHDUW
6WDQGGHU7HFKQLN

3.2 Lagerung von Minerallen 3.2 Storage of mineral oils


)UGLH/DJHUXQJYRQ0LQHUDO|OHQLQREHULUGLVFKHQ $ERYHJURXQGVWRUDJHWDQNVIRUPLQHUDORLOVDUHQRU
/DJHUWDQNV ZHUGHQ GLHVH LQ GHU 5HJHO PLW )DUE PDOO\SURYLGHGZLWKDSDLQWFRDWLQJZKLFKUHIOHFWVDW
DQVWULFKHQ YHUVHKHQ GLH GLH 6WUDKOXQJVZlUPH *H OHDVW RIWKHUDGLDQWKHDW FRHIILFLHQWRIWRWDOKHDW
VDPWZlUPHUHPLVVLRQVJUDG ]XPLQGHVWHQV ]X UHIOHFWDQFH  )L[HGURRI WDQNV DFFRUGLQJ WR 7DEOH 
UFNZHUIHQ )HVWGDFKWDQNV QDFK 7DEHOOH  ZHUGHQ DUH HTXLSSHG ZLWK YDFXXPSUHVVXUH UHOLHI YDOYHV
PLW 9'9HQWLOHQ  %HWULHEVGUXFN   PEDU RSHUDWLQJ SUHVVXUH  PEDU  K3D 
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

 K3D  9HQWLODQVSUHFKGUXFN  PEDU YDOYHVHWSUHVVXUHPEDU K3D XQOHVV


K3D DXVJHUVWHWVRZHLWVLFKHUKHLWVWHFKQL RWKHUZLVHGLFWDWHGE\VDIHW\DVSHFWV
VFKH*UQGHGHPQLFKWHQWJHJHQVWHKHQ
)UGLH/DJHUXQJYRQ0LQHUDO|OHQPLWHLQHP'DPSI 0LQHUDO RLOV ZLWK D YDSRXU SUHVVXUH JUHDWHU WKDQ
GUXFNYRQPHKUDOVPEDU K3D EHLHLQHU7HP  PEDU K3D DWDWHPSHUDWXUHRI &DUHVWRUHG
SHUDWXUYRQ &ZHUGHQ LQ
6FKZLPPGDFKWDQNV IORDWLQJURRIWDQNV
)HVWGDFKWDQNVPLW6FKZLPPGHFNHRGHU IL[HGURRIWDQNVZLWKLQWHUQDOIORDWLQJGHFNRU
)HVWGDFKWDQNV PLW $QVFKOXVV DQ HLQ *DVVDPPHO IL[HGURRIWDQNVFRQQHFWHGWRDYDSRXUFROOHFWLRQ
OHLWXQJVV\VWHPRGHUJOHLFKZHUWLJH0DQDKPHQ OLQHRUHTXLYDOHQWPHDVXUHV
YRUJHVHKHQ'LHIOH[LEOHQ'LFKWXQJHQDQ6FKZLPP 7KH IOH[LEOH VHDOLQJ V\VWHPV RQ IORDWLQJURRI WDQNV
GDFKWDQNV XQG )HVWGDFKWDQNV PLW 6FKZLPPGHFNH DQG IL[HGURRIWDQNVZLWK LQWHUQDO IORDWLQJ GHFNDUH
ZHUGHQVRDXVJHIKUWGDVVGLH(PLVVLRQVUDWHLP9HU GHVLJQHGWRUHGXFHVWDQGLQJVWRUDJHORVVHVE\DPLQ
JOHLFK]XHLQHP)HVWGDFKWDQNRKQH6FKZLPPGHFNH LPXPRI FRPSDUHGWRDIL[HGURRIWDQNZLWKRXW
EHL UXKHQGHP 7DQN XP PLQGHVWHQV   JHVHQNW LQWHUQDOIORDWLQJGHFN
ZLUG
%HLGHU/DJHUXQJYRQ0LQHUDO|OHQGLHHLQHQ0DVVHQ 0LQHUDO RLOV ZKLFK FRQWDLQ PDVV FRQFHQWUDWLRQV
JHKDOWDQ6WRIIHQQDFK1U.ODVVH,GHU7$ /XIW JUHDWHUWKDQPJNJRIVXEVWDQFHVDVSHU1R
YRQ PHKUDOV PJNJ RGHUQDFK1U .ODVVH,, &ODVV,RI7$/XIW *HUPDQ&OHDQ$LU5HJXODWLRQV
XQG,,,RGHUQDFK1U.ODVVH,GHU7$/XIWYRQ RUPDVVFRQFHQWUDWLRQVJUHDWHUWKDQ RIVXEVWDQFHV
PHKUDOV DXIZHLVHQXQGGLHXQWHU/DJHUXQJVEH DVSHU1R&ODVVHV,,DQG,,,RUDVSHU1R
GLQJXQJHQ6WRIIHQDFK.ODVVH,RGHU &ODVV,RI7$/XIWDQGDUHFDSDEOHLQVWRUDJHRIHPLW
$EVDW]GHU7$/XIWHPLWWLHUHQN|QQHQZHUGHQ)HVW WLQJVXEVWDQFHVDVSHU&ODVV,RUSDUDRI
GDFKWDQNVPLW=ZDQJVEHDWPXQJYRUJHVHKHQGLHDQ 7$ /XIW DUH VWRUHG LQ IL[HGURRI WDQNV ZLWK IRUFHG
IDOOHQGHQ *DVH ZHUGHQ HLQHP *DVVDPPHOOHLWXQJV YHQWLODWLRQV\VWHP7KHYDSRXUVUHOHDVHGDUHURXWHG
V\VWHP RGHU HLQHU 1DFKYHUEUHQQXQJ ]XJHIKUW ,P WRDYDSRXUFROOHFWLRQV\VWHPRUDQLQFLQHUDWLRQXQLW
$EJDV HLQHU 1DFKYHUEUHQQXQJVDQODJH NDQQ HLQH 7KHH[KDXVWJDVRIWKHLQFLQHUDWLRQXQLWPHHWVWKHDS
0DVVHQNRQ]HQWUDWLRQ DQ RUJDQLVFKHQ 6WRIIHQ DQJH SOLFDEOHHPLVVLRQOLPLWVRIPJPIRURUJDQLFVH[

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

JHEHQDOV*HVDPW&YRQLQVJHVDPWPJPXQGDQ SUHVVHGDVWRWDOFDUERQDQGPJPIRUEHQ]HQH
%HQ]ROYRQPJPHLQJHKDOWHQZHUGHQ
,PhEULJHQZLUGDXI7DEHOOHYHUZLHVHQ )RUIXUWKHUGHWDLOVSOHDVHUHIHUWR7DEOH

3.3 Umschlag von Minerallen 3.3 Loading/unloading of mineral oils


'LH$QIRUGHUXQJHQ]XU%HVFKUlQNXQJGHU(PLVVLR 7KHHPLVVLRQFRQWUROPHDVXUHVWREHDSSOLHGGXULQJ
QHQ EHLP 8PVFKODJHQ YRQ 0LQHUDO|OHQ ZHUGHQ LQ PLQHUDORLOORDGLQJXQORDGLQJGHSHQGRQWKHVLWHVSH
$EKlQJLJNHLW YRQ GHQ MHZHLOLJHQ /DJHUNDSD]LWlWHQ FLILF VWRUDJH FDSDFLWLHV WKH QXPEHU RI WXUQRYHUV DV
8PVFKODJKlXILJNHLWHQ VRZLH GHU *HIDKUHQNODVVH ZHOODVWKHYDSRXUSUHVVXUHDQGKD]DUGFODVVWR9E)
QDFK9E)>@XQGGHV'DPSIGUXFNHVGHUJHODJHUWHQ >@RIWKHSURGXFWVVWRUHG7KHVSHFLDOHPLVVLRQFRQ
3URGXNWH JHWURIIHQ 'LH QDFKIROJHQG DXIJHIKUWHQ WUROPHDVXUHVGHVFULEHGEHORZDSSO\WR
EHVRQGHUHQ 0DQDKPHQ ]XU %HVFKUlQNXQJ GHU
(PLVVLRQHQZHUGHQJHWURIIHQLQ
QLFKW JHQHKPLJXQJVEHGUIWLJHQ 7DQNOlJHUQ DXV WDQN IDUPV QRW VXEMHFW WR DQ RSHUDWLQJ SHUPLW
VFKOLHOLFKQXUIU2WWRNUDIWVWRIIH VWRULQJH[FOXVLYHO\PRWRUJDVROLQHV
JHQHKPLJXQJVEHGUIWLJHQ 7DQNOlJHUQ IU 0LQH WDQN IDUPV VWRULQJ PLQHUDO RLO SURGXFWV DQG VXE
UDO|OSURGXNWHVRIHUQGLH%DJDWHOOVFKZHOOHQQDFK MHFWWRDQRSHUDWLQJSHUPLWLIWKHSHWW\WKUHVKROGV
XQGGHU7$/XIW>@EHUVFKULWWHQZHUGHQ DVSHUDQGRI7$/XIW>@DUHH[FHHGHG
EHLHLQHP8PVFKODJ! PD IURPDWXUQRYHURI!PD
$XI7DEHOOHZLUGKLQJHZLHVHQ 5HIHUHQFHLVPDGHWR7DEOH
%HLP 8PVFKODJ (LQ XQG $XVODJHUXQJ 8PODJHUQ )RU PLQHUDO RLO ORDGLQJXQORDGLQJ SURGXFW VXSSO\
XQG 0LVFKHQ  YRQ 0LQHUDO|OHQ ZLUG GLH 8QWHUVSLH DQGZLWKGUDZDOLQSODQWWUDQVIHUDQGEOHQGLQJ WKH
JHOEHIOOXQJDQJHZHQGHWGDUEHUKLQDXVZHUGHQEHL WRSVXEPHUJHG ILOOLQJ PHWKRG LV HPSOR\HG PRUHR
0LQHUDO|OHQ GLH HLQHQ 'DPSIGUXFN YRQ PHKU DOV YHUDSSURSULDWHFRQWUROPHDVXUHVIRURUJDQLFVHPLV
 PEDU  K3D  EHL HLQHU 7HPSHUDWXU YRQ  & VLRQVDUHSURYLGHGIRUPLQHUDORLOVKDYLQJDYDSRXU
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

KDEHQGLH(PLVVLRQHQDQRUJDQLVFKHQ6WRIIHQGXUFK SUHVVXUHJUHDWHUWKDQPEDU K3D DWDWHPSHUD


JHHLJQHWH0DQDKPHQYHUPLQGHUW WXUHRI &
*HHLJQHWH0DQDKPHQVLQG 6XLWDEOHFRQWUROPHDVXUHVLQFOXGH
(LQVDW]YRQ6FKZLPPGDFKWDQNV XVHRIIORDWLQJURRIWDQNV
*DVSHQGHOXQJ YDSRXUEDODQFLQJV\VWHP
*DVSHQGHOV\VWHPH HQWVSUHFKHQ GHP 6WDQG GHU 9DSRXU EDODQFLQJ V\VWHPV DUH GHHPHG WR UHIOHFW
7HFKQLNZHQQLQVEHVRQGHUHGHU)OVVLJNHLWVIOXVV WKHVWDWHRIWKHDUWLIWKHV\VWHPLVLQWHUORFNHGLQ
QXU EHL $QVFKOXVV GHV *DVSHQGHOV\VWHPV IUHLJH VXFKDZD\WKDWOLTXLGIORZLVRQO\UHOHDVHGDIWHU
JHEHQZLUGXQGGDV*DVSHQGHOV\VWHPXQGGLHDQ WKHLUFRQQHFWLRQDQGLIDSDUWIURPHPHUJHQF\UH
JHVFKORVVHQHQ (LQULFKWXQJHQ ZlKUHQG GHV *DV OHDVHV QHFHVVDU\ IRU VDIHW\ UHDVRQV WKH YDSRXU
SHQGHOQV EHWULHEVPlLJ DEJHVHKHQ YRQ VLFKHU EDODQFLQJV\VWHPDQGWKHFRQQHFWHGHTXLSPHQWGR
KHLWVWHFKQLVFK EHGLQJWHQ )UHLVHW]XQJHQ NHLQH QRW UHOHDVH DQ\ HPLVVLRQV WR DWPRVSKHUH GXULQJ
(PLVVLRQHQLQGLH$WPRVSKlUHDEJHEHQ QRUPDOYDSRXUEDODQFLQJRSHUDWLRQ
,PEHVWLPPXQJVJHPlHQ%HWULHELVWNHLQHJHVRQ 7KHGHILQLWLRQRIVSHFLILFHPLVVLRQOHYHOVIRUQRU
GHUWH )HVWOHJXQJ YRQ (PLVVLRQVZHUWHQ HUIRUGHU PDOVHUYLFHFRQGLWLRQVLVQRWUHTXLUHG
OLFK
'lPSIHVSHLFKHU YDSRXUEXIIHUYHVVHOV
'lPSIHVSHLFKHUVLQGPLW9'9HQWLOHQDXVJHUV 9DSRXUEXIIHUYHVVHOVDUHHTXLSSHGZLWKYDFXXP
WHW >@ HLQH ZHLWHUJHKHQGH %HVFKUlQNXQJ GHU SUHVVXUH UHOLHI YDOYHV >@ IXUWKHU HPLVVLRQ UH
(PLVVLRQHQLVWQLFKWHUIRUGHUOLFK GXFWLRQPHDVXUHVDUHQRWQHHGHG
'lPSIHUFNJHZLQQXQJVXQGYHUEUHQQXQJVDQOD YDSRXUUHFRYHU\DQGLQFLQHUDWLRQXQLWV
JHQ
,QGHUQDFKIROJHQGHQ 7DEHOOH  VLQGIUGLHLQ 7KHK\GURFDUERQDQGEHQ]HQHHPLVVLRQOHYHOVDW
$EVFKQLWW  DXIJHIKUWHQ 'lPSIHUFNJHZLQ WDLQDEOH GXULQJ FRQWLQXRXV RSHUDWLRQ RI WKH YD
QXQJVXQGYHUEUHQQXQJVDQODJHQE]Z$QODJHQ SRXU UHFRYHU\ DQG LQFLQHUDWLRQ XQLWV RU V\VWHP
NRPELQDWLRQHQ GLH LP 'DXHUEHWULHE HLQKDOWEDUHQ FRPELQDWLRQVGHVFULEHGXQGHU6HFWLRQDUHUHSUH
:HUWHIU.RKOHQZDVVHUVWRIIXQG%HQ]RONRQ]HQ VHQWHGLQ7DEOHEHORZ
WUDWLRQHQDQJHJHEHQ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

LQ EHJUQGHWHQ (LQ]HOIlOOHQ (LQVDW] YRQ )HVW XVHRIIL[HGURRIWDQNVZLWKLQWHUQDOIORDWLQJGHFN


GDFKWDQNVPLW6FKZLPPGHFNHQ LQMXVWLILHGLQGLYLGXDOFDVHV

3.4 Frderung in Rohrleitungen, Dichtsysteme 3.4 Transport in piping lines, sealing systems
%HL GHU )|UGHUXQJ YRQ 0LQHUDO|OHQ GLH PHKU DOV )RUSLSLQJOLQHVFDUU\LQJPLQHUDORLOVZLWKK\GURJHQ
 *HZ 6FKZHIHOZDVVHUVWRII RGHU PHKU DOV VXOSKLGHFRQFHQWUDWLRQVJUHDWHUWKDQZW RUPHU
 *HZ 0HUFDSWDQH HQWKDOWHQ RGHU GLH 6WRIIH FDSWDQFRQFHQWUDWLRQVJUHDWHUWKDQZW RUPLQ
QDFK HUDORLOVFRQWDLQLQJVXEVWDQFHVDVSHU

Tabelle 11. Emissionswerte fr Dmpferckgewinnungs- und -verbrennungsanlagen bei der Verladung von
Ottokraftstoffen *)
Anlagenart Wirkungsgrad Im Dauerbetrieb einhaltbare
Halbstundenmittelwerte

Kohlenwasserstoffe Benzol
ohne Methan +++)
% g/m3 mg/m3

Einstufige Kondensationsanlage 1

Einstufige Absorptions-, Adsorptions- und Membrantrennanlagen ca. 99,5 5 **) 1


+
Einstufige Adsorptionsanlagen mit zustzlichem Drehkolbengeblse ***) ca. 99,98 0,15 ) 1

Thermische Nachverbrennungsanlage ca. 99,98 0,05 **) <1


+ ++
Zweistufige Anlagen **) ca. 99,98 0,15 ) ) 1

'LH.RKOHQZDVVHUVWRIINRQ]HQWUDWLRQLPXQJHUHLQLJWHQ5RKJDVOLHJWEHLFDJP 
6RIHUQHLQVWXILJH$QODJHQDOV9RUVWXIHIU*DVPRWRUHQHLQJHVHW]WZHUGHQLVWHLQH.RQ]HQWUDWLRQYRQFDJPIUGHQ%HWULHEGHV*DVPRWRUV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

HUIRUGHUOLFK
'HU(QHUJLHYHUEUDXFKGLHVHU$QODJHQYHUGRSSHOWVLFKHWZDJHJHQEHUGHU$QODJHPLWHLQHU5HVWHPLVVLRQYRQJPZDVPLWK|KHUHQ&2
(PLVVLRQHQNRUUHOLHUW

%HLGHQKLHUUHOHYDQWHQ&&.RKOHQZDVVHUVWRIIHQHQWVSUHFKHQJPHLQHU*HVDPW&.RQ]HQWUDWLRQYRQHWZDJP

,P$EJDVYRQ9HUEUHQQXQJVDQODJHQWUHWHQZHLWHUH6FKDGVWRIIHDXI]XP%HLVSLHO6WLFNVWRIIR[LGH.RKOHQPRQR[LGXQG.RKOHQZDVVHUVWRIIHGHU
.ODVVHQ,XQG,,QDFK1UGHU7$/XIW>@%HLHLQHU*HVDPW&.RQ]HQWUDWLRQYRQZHQLJHUDOVPJPNDQQDXIGLHJHVRQGHUWH%HWUDFK
WXQJGHUJHQDQQWHQ(LQ]HONRKOHQZDVVHUVWRIIHYHU]LFKWHWZHUGHQ

'LH6XPPHYRQ.RKOHQZDVVHUVWRIIHQHLQVFKOLHOLFK0HWKDQOLHJWLP%HUHLFKYRQELVPJPRGHUK|KHU'LH0HWKDQ(PLVVLRQZLUG
GXUFKDEVRUSWLYHE]ZDGVRUSWLYH9HUIDKUHQQXUXQZHVHQWOLFKYHUPLQGHUWEHLWKHUPLVFKHQ9HUIDKUHQJLOWGLH)XQRWH 

Table 11. Emission levels for vapour recovery and incineration units during motor gasoline loading/unloading *)
Type of system Efficiency Half-hour mean values attainable
in continuous operation

Hydrocarbons Benzene
without methane +++)
% g/m3 mg/m3

Single-stage condensing system 1

Single-stage absorption, adsorption and membrane separation systems approx. 99.5 5 **) 1
+
Single-stage adsorption systems with additional Roots blower ***) approx. 99.98 0.15 ) 1

Incineration unit approx. 99.98 0.05 **) <1


+ ++
Two-stage systems **) approx. 99.98 0.15 ) ) 1

+\GURFDUERQFRQFHQWUDWLRQRIXQWUHDWHGUDZJDVDSSUR[JP
:KHUHVLQJOHVWDJHV\VWHPVDUHXVHGXSVWUHDPRIJDVHQJLQHVDK\GURFDUERQFRQFHQWUDWLRQRIDSSUR[JPLVUHTXLUHGWRPHHWJDVHQJLQHLQOHW
VSHFLILFDWLRQV
7KHHQHUJ\FRQVXPSWLRQRIWKHVHV\VWHPVLVDSSUR[LPDWHO\WZLFHWKDWRIDV\VWHPDFKLHYLQJDUHVLGXDOHPLVVLRQRIJPZKLFKFRUUHODWHVZLWK
KLJKHU&2HPLVVLRQV

:LWKWKH&&K\GURFDUERQVRIUHOHYDQFHKHUHJPFRUUHVSRQGWRDWRWDOFDUERQFRQFHQWUDWLRQRIDSSUR[JP

7KHH[KDXVWJDVRILQFLQHUDWLRQV\VWHPVFRQWDLQVIXUWKHUDLUSROOXWDQWVVXFKDVQLWURJHQR[LGHVFDUERQPRQR[LGHDQG&ODVV,DQG,,K\GURFDUERQV
DVSHU7$/XIW1R>@$WDWRWDOFDUERQFRQFHQWUDWLRQRIOHVVWKDQPJPDVHSDUDWHHYDOXDWLRQRIWKHLQGLYLGXDOK\GURFDUERQVFDQEH
GLVSHQVHGZLWK

7RWDO K\GURFDUERQ HPLVVLRQV LQFOXGLQJ PHWKDQH DUH RI WKH RUGHU RI  PJP WR  PJP RU KLJKHU 7KH HIIHFWLYHQHVV RI DEVRUSWLRQ RU
DGVRUSWLRQSURFHVVHVRQPHWKDQHHPLVVLRQVLVYHU\OLPLWHGIRUWKHWKHUPDOSURFHVVHVVHH)RRWQRWH 

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

D $EV7$/XIW>@RGHU D SDUDRI7$/XIW>@RU
E  .ODVVH , 7$ /XIW >@ PLW HLQHP *HKDOW YRQ E &ODVV,7$/XIW>@LQFRQFHQWUDWLRQVJUHDWHU
PHKUDOVPJNJRGHU WKDQPJNJRU
F .ODVVH,,XQG,,,RGHU.ODVVH,7$/XIW F &ODVVHV,,DQG,,,RU&ODVV,7$/XIW>@
>@PLWHLQHP*HKDOWYRQPHKUDOV*HZHQW LQFRQFHQWUDWLRQVJUHDWHUWKDQZWDQGKDYLQJ
KDOWHQXQGGHUHQ'DPSIGUXFNPHKUDOVPEDU D YDSRXU SUHVVXUH RI JUHDWHU WKDQ  PEDU 
K3D EHLHLQHU7HPSHUDWXUYRQ &EHWUlJW K3D DWDWHPSHUDWXUHRI &
ZHUGHQ DQ 3XPSHQ .RPSUHVVRUHQ $EVSHUU XQG WKHSXPSVVKXWRIIDQGFRQWUROYDOYHVDVZHOODVWKH
5HJHORUJDQHQ XQG )ODQVFKYHUELQGXQJHQ EHVRQGHUV IODQJHGMRLQWVDUHSURYLGHGZLWKDGYDQFHGHPLVVLRQ
ZLUNVDPH0DQDKPHQ]XU(PLVVLRQVPLQGHUXQJJH FRQWUROPHDVXUHV
WURIIHQ
'LHhEHUZDFKXQJYRQ'LFKWHOHPHQWHQZLUGLQ$E 'HSHQGLQJRQWKHKD]DUGFKDUDFWHULVWLFVRIWKHSURG
KlQJLJNHLW YRQ *HIlKUOLFKNHLWVPHUNPDOHQ GHU JH XFWVKDQGOHGWKHLUSK\VLFDOVWDWHSUHVVXUHDQGWHP
KDQGKDEWHQ 6WRIIH $JJUHJDW]XVWDQG 'UXFN XQG SHUDWXUH OHYHO WKH SURSHU IXQFWLRQ RI VHDOLQJ HOH
7HPSHUDWXUQLYHDX ]XP %HLVSLHO GXUFK HLQH E]Z PHQWVLVPRQLWRUHGE\WKHIROORZLQJPHDVXUHVZKLFK
GXUFK.RPELQDWLRQIROJHQGHU0DQDKPHQVLFKHUJH DUHSURYLGHGHLWKHULQGLYLGXDOO\RULQFRPELQDWLRQ
VWHOOW
%HJHKXQJ GHU %HUHLFKH PLW 'LFKWHOHPHQWHQ XQG YLVXDO LQVSHFWLRQ RI DUHDV ZLWK VHDOLQJ HOHPHQWV
.RQWUROOHDXI6FKOLHUHQ(LVELOGXQJ*HUXFKRGHU IRUYDSRXUVWUHDNVLFLQJXSRUOHDNLQGXFHGQRLVH
*HUlXVFKHLQIROJH8QGLFKWKHLWHQ JHQHUDWLRQ
%HJHKXQJ GHU %HUHLFKH PLW 'LFKWHOHPHQWHQ PLW LQVSHFWLRQRIDUHDVZLWKVHDOLQJHOHPHQWVZLWKWKH
PRELOHQ /HFNDQ]HLJH/HFNVXFKJHUlWHQ WUDJEDUH DLG RI PRELOH OHDN PRQLWRUVGHWHFWRUV SRUWDEOH
*DVZDUQHLQULFKWXQJHQ JDVGHWHFWRUV
NRQWLQXLHUOLFKH RGHU SHULRGLVFKH hEHUZDFKXQJ FRQWLQXRXVRUSHULRGLFPRQLWRULQJE\SHUPDQHQWO\
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

GHU$WPRVSKlUHGXUFKVHOEVWWlWLJDUEHLWHQGHIHVW LQVWDOOHGDXWRPDWHGGHWHFWRUVZLWKDODUPIXQFWLRQ
LQVWDOOLHUWH*HUlWHPLW:DUQIXQNWLRQ
$UWXQG8PIDQJGHU'LFKWKHLWVEHUZDFKXQJVLQGGD 7KHW\SHDQGVFRSHRIOHDNPRQLWRULQJYDU\ZLWKWKH
EHL DEKlQJLJ YRQ GHU NRQVWUXNWLYHQ *HVWDOWXQJ GHU GHVLJQDQGFRQVWUXFWLRQRIWKHVHDOLQJHOHPHQWV7KH
'LFKWHOHPHQWH+LHUDXVHUJHEHQVLFKTXDOLWDWLYH$Q ODWWHUDUHWKHEDVLVIRUWKHTXDOLWDWLYHPRQLWRULQJUH
IRUGHUXQJHQDQGLH'LFKWKHLWVEHUZDFKXQJ6RHUIRU TXLUHPHQWV7KXVDIODQJHZLWKSODLQIDFLQJIRULQ
GHUW]XP%HLVSLHOHLQ)ODQVFKPLWJODWWHU'LFKWOHLVWH VWDQFH UHTXLUHV PRUH LQWHQVLYH PRQLWRULQJ WKDQ D
HLQHQHQWVSUHFKHQGK|KHUHQhEHUZDFKXQJVDXIZDQG IODQJHZLWKVHDOZHOGHGOLSJDVNHW
DOVHLQ)ODQVFKPLW6FKZHLOLSSHQGLFKWXQJ
)U GLH HLQ]HOQHQ 'LFKWHOHPHQWH ZHUGHQ GDUEHU )XUWKHUPRUH PDLQWHQDQFH DQG UHSDLU PHDVXUHV DUH
KLQDXV0DQDKPHQGHU:DUWXQJXQG,QVWDQGVHW]XQJ GHILQHG DQG LPSOHPHQWHG IRU WKH LQGLYLGXDO VHDO
JHWURIIHQLQGHPGD]XHUIRUGHUOLFKHQ:DUWXQJVSODQ W\SHV 7KH PDLQWHQDQFH VFKHGXOH UHTXLUHG IRU WKLV
]XP%HLVSLHOQDFK',1 >@ VLQGGLHVSH]L SXUSRVH HJWR',1 >@ VKRXOGDGGUHVVWKH
HOOHQ %HODQJH LQVEHVRQGHUH ]X EHUFNVLFKWLJHQ KLQ IROORZLQJUHTXLUHPHQWVLQSDUWLFXODU
VLFKWOLFK
'LFKWKHLWVDQIRUGHUXQJHQ WLJKWQHVVUHTXLUHPHQWV
*HIlKUOLFKNHLWVPHUNPDOHQ KD]DUGFKDUDFWHULVWLFV
$JJUHJDW]XVWDQG SK\VLFDOVWDWH
'UXFNXQG7HPSHUDWXUQLYHDX SUHVVXUHDQGWHPSHUDWXUHOHYHO
'LH)ULVWHQIUGLH,QVWDQGKDOWXQJGHU'LFKWHOHPHQWH 7KH PDLQWHQDQFH LQWHUYDOV IRU WKH VHDOLQJ HOHPHQWV
ULFKWHQVLFKLP(LQ]HOQHQQDFKGHU$UWGHU.RQVWUXN GHSHQG RQ WKH VSHFLILF VHDO GHVLJQ DQG WKH VHUYLFH
WLRQXQG%HWULHEVZHLVHXQGJHZlKUOHLVWHQGLHWHFKQL FRQGLWLRQVDQGDUHVHOHFWHGVXFKDVWRHQVXUHWHFKQL
VFKH 'LFKWKHLW 'LHV HUIRUGHUW HQWVSUHFKHQGH .RQ FDO WLJKWQHVV 7KLV UHTXLUHV FRUUHVSRQGLQJ LQVSHF
WUROOHQ 'LH )ULVWHQ IU GLH .RQWUROOHQ XQG GLH ,Q WLRQV 7KH LQVSHFWLRQ DQG PDLQWHQDQFH LQWHUYDOV UH
VWDQGKDOWXQJVPDQDKPHQ]XU$XIUHFKWHUKDOWXQJGHU TXLUHGWRPDLQWDLQWHFKQLFDOWLJKWQHVVDUHGHILQHGLQ
WHFKQLVFKHQ 'LFKWKHLW ZHUGHQ LQ %HWULHEVDQZHLVXQ RSHUDWLQJLQVWUXFWLRQV
JHQIHVWJHOHJW

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

3.4.1 Pumpen 3.4.1 Pumps


%HVRQGHUVZLUNVDPH0DQDKPHQ]XU(PLVVLRQVPLQ $GYDQFHGPHDVXUHVIRUHPLVVLRQFRQWUROLQFOXGHWKH
GHUXQJVLQGGLH9HUZHQGXQJYRQ XVHRI
6SDOWURKUPRWRUSXPSHQ FDQQHGPRWRUSXPSV
3XPSHQPLW0DJQHWNXSSOXQJ PDJQHWLFDOO\FRXSOHGSXPSV
0HKUIDFK*OHLWULQJGLFKWXQJHQ PLW 9RUODJH RGHU PXOWLSOH PHFKDQLFDO VHDOV RSHUDWHG ZLWK TXHQFK
6SHUUPHGLHQ RUEXIIHUIOXLGV
0HKUIDFK*OHLWULQJGLFKWXQJHQ PLW DWPRVSKlUHQ PXOWLSOH PHFKDQLFDO VHDOV ZLWK DWPRVSKHUHVLGH
VHLWLJWURFNHQODXIHQGHU'LFKWXQJ GU\UXQQLQJPHFKDQLFDOVHDO
KHUPHWLVFKGLFKWHQ9HUGUlQJHUSXPSHQZLH0HP KHUPHWLFDOO\ VHDOHG SRVLWLYH GLVSODFHPHQW SXPSV
EUDQXQG)DOWHQEDOJSXPSHQ VXFKDVGLDSKUDJPDQGEHOORZVSXPSV
%HL3XPSHQPLW0HKUIDFK*OHLWULQJGLFKWXQJHQZLUG ,QSXPSVHTXLSSHGZLWKPXOWLSOHPHFKDQLFDOVHDOV
GLH 'LFKWKHLW GHV 6SHUUPHGLHQV\VWHPV GXUFK JHHLJ WKHWLJKWQHVVRIWKHEXIIHUIOXLGV\VWHPLVPRQLWRUHG
QHWH 0DQDKPHQ EHUZDFKW RGHU HV ZHUGHQ GLH E\VXLWDEOHPHDVXUHVRUWKHOHDNDJHORVVHVDUHGUDLQHG
/HFNYHUOXVWHJHVFKORVVHQDEJHOHLWHW YLDDFORVHGV\VWHP
6RZHLW 0LQHUDO|OH GHU *HIDKUHQNODVVH $ , 9E) >@ 3URYLGHGWKDW&ODVV$,PLQHUDORLOVDVSHU9E)>@
PLW HLQHP 6LHGHHQGH ELV  & QLFKW GLH LQ $E ZLWKDERLOLQJHQGSRLQWRIXSWR &GRQRWH[KLELW
VFKQLWWJHQDQQWHQ0HUNPDOHDXIZHLVHQN|QQHQ WKH FKDUDFWHULVWLFV VWDWHG XQGHU 6HFWLRQ  SXPSV
3XPSHQ PLW (LQ]HO*OHLWULQJGLFKWXQJHQ YHUZHQGHW ZLWKVLQJOHPHFKDQLFDOVHDOPD\EHHPSOR\HGDVORQJ
ZHUGHQVRIHUQQLFKWDXV*UQGHQGHU$QODJHQVLFKHU DVQRDGGLWLRQDOUHTXLUHPHQWVKDYHWREHREVHUYHGIRU
KHLW]XVlW]OLFKH$QIRUGHUXQJHQEHVWHKHQ UHDVRQVRIV\VWHPVDIHW\

3.4.2 Absperr- und Regelorgane 3.4.2 Shutoff and control valves


(LQHEHVRQGHUVZLUNVDPH0DQDKPH]XU(PLVVLRQV $QDGYDQFHGHPLVVLRQFRQWUROPHDVXUHLVWKHXVHRI
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

PLQGHUXQJLVWGHU(LQVDW]KRFKZHUWLJDEJHGLFKWHWHU SHUIHFWO\VHDOHGEHOORZVVHDOVZLWKGRZQVWUHDPVHF
PHWDOOLVFKHU )DOWHQElOJH PLW QDFKJHVFKDOWHWHU RQGDU\FRQWDLQPHQWSDFNLQJJODQGRUHTXLYDOHQWVHDO
6LFKHUKHLWVVWRSIEXFKVH RGHU JOHLFKZHUWLJHU 'LFKW LQJV\VWHPV7KHVHDORIWKHEHOORZVPXVWPHHWWKHUH
V\VWHPH 'LH $EGLFKWXQJ GLHVHU )DOWHQElOJH HQW TXLUHPHQWVVWDWHGXQGHU6HFWLRQDVDPLQLPXP
VSULFKW PLQGHVWHQV GHQ $QIRUGHUXQJHQ QDFK $E
VFKQLWW
'LFKWV\VWHPH N|QQHQ DOV JOHLFKZHUWLJ DQJHVHKHQ 6HDOLQJ V\VWHPV DUH FRQVLGHUHG WR EH HTXLYDOHQW LI
ZHUGHQZHQQVLHLP1DFKZHLVYHUIDKUHQGLHIROJHQ WKH\FDQEHGHPRQVWUDWHGWRPHHWWKHIROORZLQJUH
GHQ$QIRUGHUXQJHQHUIOOHQ TXLUHPHQWV
'LH NRQVWUXNWLYH $XVIKUXQJ GHV 'LFKWV\VWHPV %DVHG RQ WKH VHDOLQJ V\VWHP GHVLJQ SURSHU VHDO
OlVVW HLQH EHVWLPPXQJVJHPlH )XQNWLRQ XQWHU IXQFWLRQLVWREHH[SHFWHGRQDORQJWHUPEDVLVXQ
GHQ%HWULHEVEHGLQJXQJHQDXI'DXHUHUZDUWHQ GHUWKHJLYHQVHUYLFHFRQGLWLRQV
'LH (LQKDOWXQJ GHU VSH]LILVFKHQ /HFNDJHUDWH &RPSOLDQFH ZLWK WKH VSHFLILF OHDN UDWH  RI
YRQ   PEDU " V P   EHL 7HPSHUDWXUHQ   PEDU " V P   DW VHDOLQJ V\VWHP WHP
DP 'LFKWV\VWHP  NOHLQHU   &  E]Z YRQ SHUDWXUHVEHORZ &RU  PEDU " V P
  PEDU " V P  EHL 7HPSHUDWXUHQ DP DW VHDOLQJ V\VWHP WHPSHUDWXUHV IURP  & RU
'LFKWV\VWHPJU|HURGHUJOHLFK &ZLUGGXUFK PRUHLVGHPRQVWUDWHGE\DQLQLWLDODFFHSWDQFHWHVW
HUVWPDOLJH3UIXQJQDFKJHZLHVHQ SULRUWREHLQJSODFHGLQWRVHUYLFH
=XP 1DFKZHLV GHU VSH]LILVFKHQ /HFNDJHUDWH GHV 7KHVSHFLILFOHDNUDWHRIWKHVHDOLQJV\VWHPLVGHPRQ
'LFKWV\VWHPVZHUGHQ0HVVXQJHQXQWHU9HUZHQGXQJ VWUDWHG E\ WHVWV DIWHU VWHDG\VWDWH FRQGLWLRQV DUH DW
HLQHV LQHUWHQ 3UIJDVHV EHL 'UFNHQ 7HPSHUDWXUHQ WDLQHG7KHWHVWLVSHUIRUPHGZLWKWKHDLGRIDQLQHUW
XQG 6SLQGHO E]Z :HOOHQEHZHJXQJHQ GLH GLH %H WHVWJDVDWSUHVVXUHVWHPSHUDWXUHVDQGVWHPRUVKDIW
WULHEVEHGLQJXQJHQDEGHFNHQQDFK(UUHLFKHQGHVVWD PRYHPHQWV FRYHULQJ WKH FRPSOHWH UDQJH RI VHUYLFH
WLRQlUHQ =XVWDQGHV GXUFKJHIKUW *HHLJQHWH 0HVV FRQGLWLRQV 6XLWDEOH PHDVXUHPHQW PHWKRGV DUH IRU
YHUIDKUHQVLQG]XP%HLVSLHOGLH'UXFNDEIDOOPHWKRGH LQVWDQFHWKHSUHVVXUHGURSPHWKRGWR',1 

 
'LH/HFNDJHUDWHQZHUGHQLQPEDU"VJHPHVVHQXQGEHUGHQPLWW 7KHOHDNUDWHVDUHPHDVXUHGLQPEDU"VDQGGLYLGHGE\WKHPHDQ
OHUHQ'LFKWXQJVXPIDQJLQPEDU" VP XPJHUHFKQHW VHDOSHULPHWHUIRUFRQYHUVLRQWRPEDU" VP 

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

QDFK ',1   >@ GHU +HOLXP/HFNWHVW >@WKHKHOLXPOHDNWHVW ULQJJDSPHWKRGVHH$Q


5LQJVSDOWPHWKRGH VLHKH $QKDQJ LQ GLHVHU 5LFKW QH[WRWKLVJXLGHOLQH DQGWKHSXUJHJDVPHWKRG>@
OLQLH  XQG GLH 6SOJDVPHWKRGH >@ 'HU 1DFKZHLV 7KHWHVWLVSHUIRUPHGE\WKHPDQXIDFWXUHURQDWHVW
ZLUG DQ HLQHP IU GDV 'LFKWV\VWHP UHSUlVHQWDWLYHQ VSHFLPHQZKLFKLVUHSUHVHQWDWLYHRIWKHVHDOLQJV\V
3UIOLQJGXUFKGHQ+HUVWHOOHUHUEUDFKW'HU+HUVWHOOHU WHP7KHWHVWFRQGLWLRQVDQGUHVXOWVDUHGRFXPHQWHG
GRNXPHQWLHUW GLH 3UIEHGLQJXQJHQ XQG HUJHEQLVVH E\WKHPDQXIDFWXUHUDQGWKHUHSRUWVPDGHDYDLODEOH
XQGVWHOOWVLHDXI$QIRUGHUXQJ]XU9HUIJXQJ RQUHTXHVW

3.4.3 Flanschverbindungen 3.4.3 Flanged joints


(LQHEHVRQGHUVZLUNVDPH0DQDKPHLVWGLH9HUZHQ $QDGYDQFHGHPLVVLRQFRQWUROPHDVXUHLVWKHXVHRI
GXQJ YRQ )ODQVFKYHUELQGXQJHQ PLW KRFKZHUWLJHQ IODQJHG MRLQWV ZLWK KLJKTXDOLW\ JDVNHWV 7KH ODWWHU
'LFKWV\VWHPHQ+LHU]X]lKOHQ0HWDOOXQG6FKZHL LQFOXGHIXOOPHWDODQGVHDOZHOGHGJDVNHWVDVZHOODV
GLFKWXQJHQ VRZLH DOOH 'LFKWV\VWHPH GLH LQ HLQHP DOOJDVNHWV\VWHPVZKLFKFDQEHGHPRQVWUDWHGWRPHHW
1DFKZHLVYHUIDKUHQ GLH QDFKIROJHQG EHVFKULHEHQHQ WKHIROORZLQJUHTXLUHPHQWV
$QIRUGHUXQJHQHUIOOHQ
'LH NRQVWUXNWLYH $XVIKUXQJ GHV 'LFKWV\VWHPV %DVHGRQWKHJDVNHWV\VWHPGHVLJQSURSHUVHDOLQJ
OlVVW HLQH EHVWLPPXQJVJHPlH )XQNWLRQ XQWHU IXQFWLRQLVWREHH[SHFWHGRQDORQJWHUPEDVLVXQ
GHQ%HWULHEVEHGLQJXQJHQDXI'DXHUHUZDUWHQ GHUWKHJLYHQVHUYLFHFRQGLWLRQV
)U 'LFKWXQJVDXVZDKO XQG $XVOHJXQJ GHU 7KH JDVNHW VHOHFWLRQ DQG IODQJH MRLQW GHVLJQ DUH
)ODQVFKYHUELQGXQJHQ VLQG 'LFKWXQJVNHQQZHUWH EDVHG RQ VHDO FKDUDFWHULVWLFV WR ',1   RU
QDFK ',1   E]Z ',1  > @ ]X ',1>@
*UXQGH]XOHJHQ
'LH(LQKDOWXQJGHUVSH]LILVFKHQ/HFNDJHUDWHYRQ &RPSOLDQFH ZLWK WKH VSHFLILF OHDN UDWH  RI
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

 PEDU" VP ZLUGGXUFKHUVWPDOLJH3U  PEDU" VP LVGHPRQVWUDWHGE\DQLQL


IXQJ QDFKJHZLHVHQ +LHUEHL ZLUG HLQ 3UIYHUIDK WLDO DFFHSWDQFH WHVW 7KH WHVW PHWKRG HPSOR\HG
UHQ PLW +HOLXP0DVVHQVSHNWURPHWHU EHL HLQHP XVHVDKHOLXPPDVVVSHFWURPHWHUDWDWHVWGLIIHUHQ
3UI'LIIHUHQ]GUXFN YRQ  EDU   3D  XQG WLDOSUHVVXUHRIEDU  3D DQGDJDVNHWORDG
HLQHU)OlFKHQSUHVVXQJYRQEDU 03D DQ RIEDU 03D 3ULRUWRWKHOHDNWHVWHJDF
JHZDQGW9RUGHU/HFNDJHPHVVXQJ]XP%HLVSLHO FRUGLQJWR',1 >@WKHJDVNHWLVVWRUHG
QDFK ',1   >@ ZLUG GLH 'LFKWXQJ EHL LQ DLU LQ WKH PRXQWHG FRQGLWLRQ DW WKH PD[LPXP
PD[LPDOHU%HWULHEVWHPSHUDWXULPPRQWLHUWHQ=X VHUYLFHWHPSHUDWXUH VHHDOVR9',>@ 
VWDQGDQ/XIWJHODJHUW VLHKHGD]XDXFK9',
>@ 
$QGHUH YDOLGLHUWH 3UIYHUIDKUHQ ]XP %HLVSLHO 2WKHU YDOLGDWHG WHVW PHWKRGV HJ SUHVVXUH GURS
'UXFNDEIDOOPHWKRGHQDFK',1 >@RGHU PHWKRG WR ',1   >@ RU WKH SXUJH JDV
6SOJDVPHWKRGH >@ VLQG ]XOlVVLJ +LHUEHL LVW PHWKRG >@ DUH DOORZHG :KHQ XVLQJ WKHVH WHVW
DXIGLHREHQJHQDQQWH(LQKHLWIUGLH/HFNDJHUDWH PHWKRGV WKH OHDN UDWH GHWHUPLQHG PXVW EH FRQ
XP]XUHFKQHQ>@ YHUWHGWRWKHDERYHXQLW>@
'HU1DFKZHLVZLUGDQHLQHPIUGDV'LFKWV\VWHPUH 7KHWHVWLVWREHSHUIRUPHGE\WKHPDQXIDFWXUHURQD
SUlVHQWDWLYHQ3UIOLQJGXUFKGHQ+HUVWHOOHUHUEUDFKW WHVW VSHFLPHQ ZKLFK LV UHSUHVHQWDWLYH RI WKH JDVNHW
'HU +HUVWHOOHU GRNXPHQWLHUW GLH 3UIEHGLQJXQJHQ V\VWHP 7KH WHVW FRQGLWLRQV DQG UHVXOWV DUH GRFX
XQG HUJHEQLVVH XQG VWHOOW VLH DXI $QIRUGHUXQJ ]XU PHQWHG E\ WKH PDQXIDFWXUHU DQG WKH UHSRUWV PDGH
9HUIJXQJ DYDLODEOHRQUHTXHVW
6RZHLW 0LQHUDO|OH GHU *HIDKUHQNODVVH $ , 9E) >@ 3URYLGHGWKDW&ODVV$ ,PLQHUDORLOVWR9E)>@ZLWK
PLW HLQHP 6LHGHHQGH ELV  & QLFKW GLH LQ $E ERLOLQJ HQG SRLQWV XS WR  & GR QRW H[KLELW WKH
VFKQLWWJHQDQQWHQ0HUNPDOHDXIZHLVHQN|QQHQ FKDUDFWHULVWLFVVWDWHGXQGHU6HFWLRQVRIWJDVNHWV
EHL)ODQVFKHQPLW'LFKWOHLVWHQ:HLFKVWRIIGLFKWXQJHQ ZLWK LQWHUQDO ZLUH UHLQIRUFHPHQW PD\ EH XVHG IRU
PLW 0HWDOOYHUVWlUNXQJ YHUZHQGHW ZHUGHQ VRIHUQ IODQJHV ZLWK IDFLQJV 8QOHVV RWKHUZLVH GLFWDWHG E\
QLFKWVLFKHUKHLWVWHFKQLVFKH$VSHNWHGLHVHUIRUGHUOLFK VDIHW\DVSHFWVVRIWJDVNHWVPD\EHXVHGIRUIODQJHV
PDFKHQN|QQHQLP7DQNODJHUEHUHLFKEHL)ODQVFKHQ ZLWKIDFLQJVLQWKHWDQNIDUPDUHD
PLW 'LFKWOHLVWHQ DXFK :HLFKVWRIIGLFKWXQJHQ HLQJH
VHW]WZHUGHQ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

3.4.4 Kappen und Blindflansche 3.4.4 Caps and blind flanges


,P EHVWLPPXQJVJHPlHQ %HWULHE LVW NHLQH JHVRQ 7KHGHILQLWLRQRIVSHFLILFHPLVVLRQOHYHOVIRUQRUPDO
GHUWH)HVWOHJXQJYRQ(PLVVLRQVZHUWHQHUIRUGHUOLFK VHUYLFHFRQGLWLRQVLVQRWUHTXLUHG

3.5 Sonstige Vorgnge 3.5 Other operations


3.5.1 Tankreinigung 3.5.1 Tank cleaning
)U GLH (PLVVLRQHQ EHL GHU 5HLQLJXQJ YRQ 5RK|O 7RFRQWUROHPLVVLRQVIURPWDQNFOHDQLQJRSHUDWLRQV
WDQNV JHOWHQ GLH LQ HLQHP IRUW]XVFKUHLEHQGHQ WKH PHDVXUHV GHVFULEHG LQ WKH UHJXODUO\ XSGDWHG
'*0.%HULFKW  >@ GDUJHVWHOOWHQ (PLVVL '*0.5HVHDUFK5HSRUW>@DUHDSSOLHG
RQVPLQGHUXQJVPDQDKPHQ
=XU5HGX]LHUXQJGHUEHLGHU5HLQLJXQJYRQ7DQNVIU &RQWURORIHPLVVLRQVJHQHUDWHGGXULQJWKHFOHDQLQJRI
3URGXNWHGHU*HIDKUNODVVH$ ,HQWVWHKHQGHQ(PLVVL WDQNVVWRULQJ&ODVV$ ,SURGXFWVLVDFFRPSOLVKHGE\
RQHQ ZHUGHQ GLH $EJDVH HLQHU $EJDVUHLQLJXQJV URXWLQJWKHYDSRXUVWRDQRIIJDVFOHDQLQJRUYDSRXU
RGHU $EJDVUFNJHZLQQXQJVDQODJH ]XJHIKUW QDFK UHFRYHU\ XQLW DIWHU DOO UHPDLQGHUV RI OLTXLG SURGXFW
GHP]XYRUGHU7DQNYRQIOVVLJHQ3URGXNWUHVWHQHQW KDYHEHHQFRPSOHWHO\GUDLQHGIURPWKHWDQN
OHHUWZXUGH

3.5.2 Probenahme 3.5.2 Sampling


,P EHVWLPPXQJVPlLJHQ %HWULHE LVW NHLQH JHVRQ 7KHGHILQLWLRQRIVSHFLILFHPLVVLRQOHYHOVIRUQRUPDO
GHUWH)HVWOHJXQJYRQ(PLVVLRQVZHUWHQHUIRUGHUOLFK VHUYLFHFRQGLWLRQVLVQRWUHTXLUHG

4 Ermittlung der Emissionen 4 Determination of emissions


'LH0HVVXQJGHU(PLVVLRQHQLVWQXUPLWHUKHEOLFKHP $VWKHPHDVXUHPHQWRIK\GURFDUERQHPLVVLRQLVH[
PHVVWHFKQLVFKHQ$XIZDQGGXUFKIKUEDU1XULQ(LQ WUHPHO\FRPSOH[DQGWLPHFRQVXPLQJPHDVXUHPHQW
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

]HOIlOOHQ]XP%HLVSLHOEHL)RUVFKXQJVSURMHNWHQODV FRQFHSWV FDQ RQO\ EH LPSOHPHQWHG LQ LQGLYLGXDO


VHQ VLFK 0HVVNRQ]HSWH UHDOLVLHUHQ 'HUDUWLJH 0HV FDVHV HJ IRU UHVHDUFK SURMHFWV ([DPSOHV RI VXFK
VXQJHQ VLQG EHLVSLHOKDIW LQ '*0.)RUVFKXQJVEH PHDVXUHPHQWVDUHGHVFULEHGLQ'*0.5HVHDUFK5H
ULFKWHQXQG>@EHVFKULHEHQ6LHHUIRU SRUWVDQG>@7KH\UHTXLUHH[WHQVLYH
GHUWHQ HLQHQ KRKHQ $XIZDQG DQ 6LFKHUKHLWVWHFKQLN VDIHW\SURYLVLRQV VSHFLDOSHUPLW DQGFRPSUHKHQVLYH
6RQGHUJHQHKPLJXQJ  XQG DQ ]HLWOLFK OFNHQORVHU UHFRUGLQJWRHQVXUHFRQVLVWHQWFRYHUDJHRIWKHHPLV
5HJLVWULHUXQJ VLRQVRYHUWLPH
=XU (UPLWWOXQJ GHU *HVDPWHPLVVLRQHQ HLQHV 7DQN 7KHGHWHUPLQDWLRQRIWKHWRWDOHPLVVLRQVIURPDWDQN
ODJHUV LP EHVWLPPXQJVJHPlHQ %HWULHE JHK|UHQ IDUP GXULQJ QRUPDO VHUYLFH FRQGLWLRQV QRW RQO\ LQ
QHEHQGHQ(PLVVLRQHQDXV7DQNVVRZLHGHU'lPSIH YROYHVWKHHPLVVLRQVIURPWKHVWRUDJHWDQNVEXWDOVR
UFNJHZLQQXQJVDQODJH DXFK (PLVVLRQHQ DXV GLIIX HPLVVLRQVIURPWKHYDSRXUUHFRYHU\XQLWDQGIXJLWLYH
VHQ4XHOOHQ'LHVHZHUGHQEHUGLH$XIVXPPLHUXQJ HPLVVLRQVIURPGLYHUVHVRXUFHV7KHODWWHUDUHGHWHU
GHU3XPSHQ'LFKWHOHPHQWHHWFXQWHU%HUFNVLFKWL PLQHG E\ VXPPDWLQJ WKH HPLVVLRQV IURP SXPSV
JXQJGHUVSH]LILVFKHQ/HFNDJHHPLVVLRQHQ 7DEHOOHQ VHDOLQJ HOHPHQWV HWF WDNLQJ LQWR DFFRXQW WKH VSH
ELV7DEHOOH HUPLWWHOW FLILFOHDNHPLVVLRQV 7DEOHWR7DEOH 
'LHIROJHQGHQ%HUHFKQXQJHQN|QQHQ]XU(UPLWWOXQJ 7KH IROORZLQJ FDOFXODWLRQ PHWKRGV FDQ EH XVHG IRU
GHU(PLVVLRQHQKHUDQJH]RJHQZHUGHQ GHWHUPLQLQJWKHHPLVVLRQV

4.1 Festdachtanks 4.1 Fixed-roof tanks


=XU %HUHFKQXQJ GHU .RKOHQZDVVHUVWRIIHPLVVLRQHQ +\GURFDUERQ HPLVVLRQV IURP IL[HGURRI WDQNV DUH
DXV)HVWGDFKWDQNVZLUGHLQH5HFKHQPHWKRGHKHUDQ FDOFXODWHG E\ D PHWKRG GHYHORSHG RQ WKH EDVLV RI
JH]RJHQ GLH LQ $QOHKQXQJ DQ GHQ '*0.)RU '*0.5HVHDUFK5HSRUW>@RWKHUFDOFXODWLRQ
VFKXQJVEHULFKW>@HQWZLFNHOWZXUGHHVN|Q PHWKRGVVXFKDVWKHPHWKRGWR$3,>@PD\
QHQ DXFK DQGHUH 5HFKHQPHWKRGHQ ZLH QDFK DOVREHHPSOR\HG
$3, >@YHUZHQGHWZHUGHQ
'HU PLWWOHUH *HVDPWMDKUHVYHUOXVW /7DQN D LQ NJD 7KH PHDQ DQQXDO ORVV /7DQN D LQNJD  LVFDOFXODWHG
ZLUGXQWHU%HUFNVLFKWLJXQJHLQHUHYHQWXHOOYRUKDQ DFFRUGLQJWRWKHIROORZLQJHTXDWLRQWDNLQJLQWRDF
GHQHQ6FKZLPPGHFNHYRUKDQGHQHU9DNXXP'UXFN FRXQW HPLVVLRQ UHGXFWLRQV DFKLHYHG WKURXJK WKH LQ

Lizenzierte Kopie von elektronischem Datentrger


38 VDI 3479 All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Ventile und dem Farbanstrich berechnet auf das nal floating deck, if installed, the vacuum/pressure
Jahr bezogen zu: relief valves and the paint coating:
LTank, a = (1 hSD) [(1 hVD) f LA,a + LB,a] (1) LTank, a = (1 hSD) [(1 hVD) f LA,a + LB,a] (1)
Es bedeuten: where:
hSD Wirkungsgrad Schwimmdecke hSD efficiency of floating deck
(mindestens 0,95) (minimum 0.95)
hVD Wirkungsgrad Vakuum/Druckventil hVD efficiency of vacuum/pressure relief valve
f Anstrichfaktor (siehe Tabelle 7) f coating factor (see Table 7)
LA,a Verluste durch Auslagerung und Atmung; LA,a withdrawal and breathing losses
in kg/a (in kg/a)
LB,a Verluste durch Befllen (Einlagerung); LB,a filling losses (product supply)
in kg/a (in kg/a)

4.1.1 Verluste durch Auslagerung und Atmung 4.1.1 Withdrawal and breathing losses of a freely
eines freibelfteten Festdachtanks vented fixed-roof tank
Der mittlere Tages-Atmungsverlust LA,d (in kg/d) The mean daily breathing loss LA,d (in kg/d) is calcu-
wird nach folgender Gleichung berechnet: lated according to the following equation:

LA,d = fA cn Vn (2) LA,d = fA cn Vn (2)


Hinweis: Bei der Ermittlung des Jahres-Atmungsverlustes LA,a (in Note: In determining the annual breathing loss LA,a (in kg/a), the
kg/a) sind die Sommer- und Winterperioden zu bercksichtigen. summer and winter periods must be taken into account.

Entsprechend lautet der mittlere Jahres-Atmungsver- Accordingly, the equation for the mean annual
lust LA,a (in kg/a) breathing loss LA,a (in kg/a) can be rewritten as fol-
lows:
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

LA,a = LA,S ds + LA,W dW (3) LA,a = LA,S ds + LA,W dW (3)


oder or

LA,a = fA,S cn Vn,S ds + fA,W cn Vn,W dw (4) LA,a = fA,S cn Vn,S ds + fA,W cn Vn,W dw (4)
Es bedeuten: where:
LA,S mittlerer Tages-Atmungsverlust im Sommer; LA,S mean daily breathing loss in summer
in kg/d (in kg/d)
LA,W mittlerer Tages-Atmungsverlust im Winter; in LA,W mean daily breathing loss in winter
kg/d (in kg/d)
fA Sttigungsgrad (Sttigungsgrad ist das Ver- fA saturation level (the saturation level is the ratio
hltnis von erreichter Konzentration zur Stti- of the actual concentration to the saturation
gungskonzentration) concentration)
fA,S Sttigungsgrad im Sommer Werte sind aus saturation level in summer for values,
Tabelle 12 see Table 12

fA,W Sttigungsgrad im Winter zu entnehmen fA,W saturation level in winter
c Sttigungskonzentration (in kg/m3) der Koh- c saturation concentration (in kg/m3) of hydro-
lenwasserstoffe im Gasraum ber dem Fls- carbons in the vapour space above the liquid
sigkeitsspiegel, wird aus folgender Gleichung surface derived from the following Equation
errechnet [41] [41]
M Tn pT M Tn pT
c = ----------------------------
- (5) c = ----------------------------
- (5)
VM,n T pn VM,n T pn
Es bedeuten: where:
M mittlere molare Masse der Kohlenwasserstoffe M mean molar mass of hydrocarbons in vapour
im Gasraum ber dem Lagergut; in kg/kmol space above the stored product (in kg/kmol)
Tn Normtemperatur; in K (Tn = 273 K) Tn standard temperature (in K; Tn = 273 K)
pT Dampfdruck des Lagergutes bei Lagergut- pT vapour pressure of stored product (in hPa) at
temperatur; in hPa (T in K) stored product temperature (T in K)

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

90Q 0ROYROXPHQ LQ 1RUP]XVWDQG LQ PNPRO 90Q PRODUYROXPHDWVWDQGDUGFRQGLWLRQV


90Q PNPRO LQPNPRO90Q PNPRO
7 /DJHUJXWWHPSHUDWXULQ. 7 VWRUHGSURGXFWWHPSHUDWXUH LQ.
SQ 1RUPGUXFNLQK3D SQ K3D SQ VWDQGDUGSUHVVXUH LQK3DSQ K3D
Hinweis:%HL8PUHFKQXQJDXIGHQ1RUP]XVWDQGPLW7 7QHUJLEW Note:&RQYHUVLRQWRVWDQGDUGFRQGLWLRQVXVLQJ7 7QUHVXOWVLQWKH
VLFKGLH6lWWLJXQJVNRQ]HQWUDWLRQFQ LQNJP ZLHIROJW IROORZLQJVDWXUDWLRQFRQFHQWUDWLRQFQ LQNJP 

FQ $S7 0  FQ $S7 0 


7Q NPRO 7Q NPRO
-   -------------------
ZREHL $  ---------------------------- - -   -------------------
ZKHUH $  ---------------------------- -
9 0Q 7 S Q 
P K3D 9 0Q 7 S Q 
P K3D
9Q PLWWOHUHU7DJHVYROXPHQVWURPLQPG 9Q PHDQYROXPHWULFIORZUDWHSHUGD\ LQPG
9QD PLWWOHUHU-DKUHVYROXPHQVWURPLQPD 9QD PHDQYROXPHWULFIORZUDWHSHU\HDU LQPD

Tabelle 12. Daten fr Umschlagtanks und Bevorratungstanks


Mittlere Gasraumtemperatur Sttigungsgrade Gasraum-
Lagerguttemperatur fA volumen VG
K K m3
Sommer Winter Sommer Winter Sommer Winter
fA,S fA,W
Umschlagtanks 287 T1 = 286,5 278 0,63 0,57 0,5 V ***)
T2 = 303,5 *) 286
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Bevorratungstanks 291 280 **) **) 1 1 0,075 V ***)

'LHLP6RPPHUJHPHVVHQHPLWWOHUHPD[LPDOH*DVUDXPWHPSHUDWXUGUIWHDQGHUREHUHQ*UHQ]HGHUP|JOLFKHQ:HUWHOLHJHQZHQQPDQEHUFN
VLFKWLJWGDVVGLHVH7HPSHUDWXUFDPXQWHUGHU.XSSHOEHLHLQHU*DVUDXPK|KHYRQPJHPHVVHQZXUGH
)U%HYRUUDWXQJVWDQNVOLHJHQNHLQH0HVVZHUWHYRUGHVKDOEVLQGVLQQJHPlGLH:HUWHGHU*DVUDXPWHPSHUDWXUIU8PVFKODJWDQNVDQ]XZHQGHQ
7DQNYROXPHQLQP
Anmerkung zu Tabelle 12::HJHQGHVJURHQ0HVVDXIZDQGHV]XU(UPLWWOXQJGHU*DVUDXPWHPSHUDWXUHQ7XQG7GHUPLWWOHUHQ/DJHUJXW
WHPSHUDWXUHQ7XQGGHU6lWWLJXQJVJUDGHI$ZHUGHQIUhEHUVFKODJVUHFKQXQJHQLQ7DEHOOHDXI0HVVXQJHQEDVLHUHQGH0LWWHOZHUWH>@DQJH
JHEHQ(VLVWGDEHL]XEHDFKWHQGDVVGLHVH:HUWHDQHLQHP7DQNIUGLH/DJHUXQJYRQ2WWRNUDIWVWRIIJHPHVVHQZXUGHQIUGHQHLQ$QVWULFK
IDNWRUYRQ]X*UXQGHJHOHJWZXUGH%HL7DQNVPLWDEZHLFKHQGHP$QVWULFKIDNWRUPXVVGLHVHU YHUJOHLFKH$EVFKQLWWD LP9HUKlOWQLV
]XLQGLH*OHLFKXQJ]XU(UPLWWOXQJGHU(PLVVLRQHQ/$HLQJHVHW]WZHUGHQ

Table 12. Data for transhipment vessels and storage tanks


Mean temperature of Vapour space temperature Saturation levels Vapour space
stored product fA volume VG
K K m3
summer winter summer winter summer winter
fA,S fA,W
Transhipment vessel 287 T1 = 286.5 278 0.63 0.57 0.5 V ***)
T2 = 303.5 *) 286
Storage tanks 291 280 **) **) 1 1 0.075 V ***)

&RQVLGHULQJWKDWWKHPHDQPD[LPXPYDSRXUVSDFHWHPSHUDWXUHIRUWKHVXPPHUSHULRGZDVPHDVXUHGDSSUR[PEHORZWKHGRPHDWDYDSRXU
VSDFHKHLJKWRIPLWLVWREHDVVXPHGWKDWWKLVWHPSHUDWXUHLVDWWKHXSSHUOLPLWRIWKHSRVVLEOHWHPSHUDWXUHUDQJH
0HDVXUHGGDWDIRUVWRUDJHWDQNVDUHQRWDYDLODEOH7KHYDSRXUVSDFHWHPSHUDWXUHVJLYHQIRUWUDQVKLSPHQWYHVVHOVVKRXOGWKHUHIRUHEHDSSOLHGDQD
ORJRXVO\
WDQNYROXPHLQP
Note on Table 12:$VWKHPHDVXUHPHQWPHWKRGIRUGHWHUPLQLQJWKHYDSRXUVSDFHWHPSHUDWXUHV7DQG7WKHPHDQVWRUHGSURGXFWWHPSHUDWXUHV
7DQGVDWXUDWLRQOHYHOVI$LVYHU\HODERUDWHPHDQYDOXHVGHULYHGIURPPHDVXUHPHQWVDUHJLYHQLQ7DEOHIRUURXJKHVWLPDWHV>@,WVKRXOG
EHQRWHGWKDWWKHVHWHPSHUDWXUHVZHUHPHDVXUHGLQDPRWRUJDVROLQHVWRUDJHWDQNIRUZKLFKDFRDWLQJIDFWRURIZDVWDNHQDVDEDVLV)RUWDQNV
KDYLQJDQRWKHUFRDWLQJIDFWRUWKHUHVSHFWLYHFRDWLQJIDFWRU VHH6HFWLRQD PXVWEHVXEVWLWXWHGLQWKHHTXDWLRQIRUHPLVVLRQ/$XVLQJDUDWLR
RI

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

9QD 9Q6G69Q:G:  9QD 9Q6G69Q:G: 


(VEHGHXWHQ ZKHUH
9Q6 PLWWOHUHU9ROXPHQVWURPLP6RPPHULQPG 9Q6 PHDQYROXPHWULFIORZUDWHLQVXPPHU LQPG
9Q: PLWWOHUHU9ROXPHQVWURPLP:LQWHULQPG 9Q: PHDQYROXPHWULFIORZUDWHLQZLQWHU LQPG
G6 $Q]DKOGHU6RPPHUWDJHSUR-DKU G6 QXPEHURIVXPPHUGD\VSHU\HDU
G: $Q]DKOGHU:LQWHUWDJHSUR-DKU G: QXPEHURIZLQWHUGD\VSHU\HDU
 )UXQVHUH%UHLWHQ 0LWWHOHXURSD ZXUGHQGLH6RPPHUWDJH )RURXUODWLWXGHV &HQWUDO(XURSH WKHSHULRGIURP0D\WR6HS
YRQ 0DL ELV 6HSWHPEHU G6  D  XQG GLH :LQWHUWDJH YRQ WHPEHUKDVEHHQWDNHQDVDEDVLVIRUWKHVXPPHUGD\V G6 D
2NWREHUELV$SULO G: D EHUHFKQHW DQGWKHSHULRGRI2FWREHUWR$SULO G: D DVDEDVLVIRUWKH
ZLQWHUGD\V

'HU 9ROXPHQVWURP 9Q LQPG  ZLUG DXV IROJHQGHU 7KHYROXPHWULFIORZUDWH9Q LQPG LVGHULYHGIURP
*OHLFKXQJHUUHFKQHW WKHIROORZLQJHTXDWLRQ
7 S S  7 S S 
9Q  ----Q- ----- ----- 9 * ---  9Q  ----Q- ----- ----- 9 * --- 
SQ 7 7 W SQ 7 7 W
(VEHGHXWHQ ZKHUH
S 8PJHEXQJVGUXFNLQK3D S DPELHQWSUHVVXUH LQK3D
7 PLWWOHUH 0LQLPDOWHPSHUDWXU LP *DVUDXP LQ . 7 PHDQPLQLPXPWHPSHUDWXUHLQYDSRXUVSDFH LQ
0LWWHOXQJV]HLWELV8KU0LWWHOZHUWVLHKH .  DYHUDJLQJ SHULRG  DP WR  DP IRU
7DEHOOH PHDQYDOXHVHH7DEOH
7 PLWWOHUH 0D[LPDOWHPSHUDWXU LP *DVUDXP LQ . 7 PHDQ PD[LPXP WHPSHUDWXUH LQ YDSRXU VSDFH
0LWWHOXQJV]HLW  ELV  8KU 0LWWHOZHUWH LQ .  DYHUDJLQJSHULRGDPWRSPIRU
VLHKH7DEHOOH PHDQYDOXHVVHH7DEOH
9* *DVUDXPYROXPHQEHUGHP/DJHUJXWLQP 9* YROXPH RI YDSRXU VSDFH DERYH SURGXFW VWRUHG
LQP
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

W %H]XJV]HLW W G W UHIHUHQFHWLPH W G


'HUJHVDPWHPLWWOHUH-DKUHV$WPXQJVYHUOXVW/$D LQ 6XEVWLWXWLRQRIWKHDERYHH[SUHVVLRQLQ(TXDWLRQ 
NJD HUJLEWVLFKVRPLW]X VLHKH*OHLFKXQJ   \LHOGVWKHPHDQDQQXDOEUHDWKLQJORVV/$D LQNJD DV
IROORZV

7 S S 7 S S
/$D I$6S7 0 ----Q- --------- --------- 9*GVI$:S7 0 ----Q- ----------- ----------- 9*G:
S Q 7 6 7 6 S Q 7 : 7 :

(V EHGHXWHQ VLHKH DXFK %HGHXWXQJHQ XQWHU *OHL ZKHUH VHH DOVR GHQRWDWLRQ XQGHU (TXDWLRQ   WR
FKXQJ  ELV*OHLFKXQJ   (TXDWLRQ  
767: PLWWOHUH 0LQLPDOWHPSHUDWXUHQ LP *DV 767: PHDQ PLQLPXP WHPSHUDWXUHV LQ YDSRXU
UDXPLP6RPPHUE]Z:LQWHULQ. VSDFHLQVXPPHURUZLQWHU LQ.
767: PLWWOHUH 0D[LPDOWHPSHUDWXUHQ LP *DV 767: PHDQ PD[LPXP WHPSHUDWXUHV LQ YDSRXU
UDXPLP6RPPHUE]Z:LQWHULQ. VSDFHLQVXPPHURUZLQWHU LQ.

4.1.2 Verluste durch Auslagerung und Atmung 4.1.2 Withdrawal and breathing losses of a fixed-
eines Festdachtanks mit Vakuum/Druck- roof tank equipped withvacuum/pressure
Ventilen relief valves
=XU(UPLWWOXQJGHU(PLVVLRQHQHLQHV)HVWGDFKWDQNV 7R GHWHUPLQH WKH HPLVVLRQV IURP D IL[HGURRI WDQN
PLW9DNXXP'UXFN9HQWLOHQZLUGGHU9HUOXVWIUGLH HTXLSSHGZLWKYDFXXPSUHVVXUHUHOLHIYDOYHVWKHWR
*HVDPWDWPXQJ /$D HLQHV IUHLEHOIWHWHQ )HVW WDO EUHDWKLQJ ORVV /$D RI D IUHHO\ YHQWHG IL[HGURRI
GDFKWDQNVPLWHLQHP)DNWRUIU9DNXXP'UXFN9HQ WDQNLVPXOWLSOLHGE\DIDFWRUIRUWKHYDFXXPSUHVVXUH
WLOH h9' PXOWLSOL]LHUW VLHKH*OHLFKXQJ   UHOLHIYDOYH h9' VHH(TXDWLRQ  
5HFKQHULVFK OlVVW VLFK GHU :LUNXQJVJUDG h9' 7KH HIILFLHQF\ h9' GLPHQVLRQOHVV  RI D YDFXXP
GLPHQVLRQVORV  HLQHV 9DNXXP'UXFN9HQWLOV ZLH SUHVVXUHUHOLHIYDOYHFDQEHFDOFXODWHGDFFRUGLQJWR
IROJWEHVWLPPHQ WKHIROORZLQJHTXDWLRQ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 


I $6 F Q G 6 9 Q6 9' + I $: F Q G : 9 Q: 9'
h9'  -----------------------------------------------------------------------------------------------------------------
- 
I $6 F Q G 6 9 Q6 + I $: F Q G : 9 Q:

7 S S  7 S S 
9 Q6 9' = ----Q-  --------
- --------- 9 * ---  9 Q6 9' = ----Q-  --------
- --------- 9 * --- 
S Q 7 6 7 6 W S Q 7 6 7 6 W

7 S S  7 S S 
9 Q: 9' = ----Q-  ---------- - 9 * ---
- ----------  9 Q: 9' = ----Q-  ---------- - 9 * ---
- ---------- 
S Q 7 : 7 : W S Q 7 : 7 : W

(VEHGHXWHQ ZKHUH

9 Q6 9' PLWWOHUHU 9'9ROXPHQVWURP LP 6RP 9 Q6 9' PHDQ93HPLVVLRQIORZUDWHLQVXPPHU
PHULQPG LQPG

9 Q: 9' PLWWOHUHU 9'9ROXPHQVWURP LP :LQWHU 9 Q: 9' PHDQ 93 HPLVVLRQ IORZ UDWH LQ ZLQWHU
LQPG LQ PG
S XQWHUHU 9HQWLODQVSUHFKGUXFN LQ K3D S ORZHU YDOYH VHW SUHVVXUH LQ K3D   VHH
VLHKH)XQRWHGHU7DEHOOH )RRWQRWHRI7DEOH
%HWULHEVXQWHUGUXFN ZRUNLQJQHJDWLYHSUHVVXUH
S  = S + ---------------------------------------------- S  = S + ---------------------------------------------------------------
 
S REHUHU9HQWLODQVSUHFKGUXFNLQK3D S XSSHU YDOYH VHW SUHVVXUH LQ K3D   VHH
VLHKH)XQRWHGHU7DEHOOH )RRWQRWHRI7DEOH
%HWULHEVEHUGUXFN ZRUNLQJSRVLWLYHSUHVVXUH
S  = S + -------------------------------------------- S  = S + --------------------------------------------------------------
 
S 8PJHEXQJVGUXFNE]Z DEVROXWHU $WPR S DPELHQW SUHVVXUH RU DEVROXWH  DWPRV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

VSKlUHQGUXFNLQK3D SKHULFSUHVVXUH LQK3D


'HU*HVDPW-DKUHVZLUNXQJVJUDGh9'HLQHV9DNXXP 7KHWRWDODQQXDOHIILFLHQF\h9'RIDYDFXXPSUHVVXUH
'UXFN9HQWLOV GLPHQVLRQVORV  HUUHFKQHW VLFK ZLH UHOLHIYDOYH GLPHQVLRQOHVV LVFDOFXODWHGDVIROORZV
IROJW

S S S S
I $6 -------- - -------- - G V + I $: ---------- - ---------- - G Z
7 6 7 6 7 : 7 :
h9'  ------------------------------------------------------------------------------------------------------------------------- 
S S S S
I $6 --------- --------- G V + I $: ----------- ----------- G Z
7 6 7 6 7 : 7 :

4.1.3 Einfluss der Farbgebung auf die 4.1.3 Influence of coating colour on evaporative
Verluste losses
)U GLH (UPLWWOXQJ GHU (PLVVLRQHQ ZHUGHQ GLH HQW 7RGHWHUPLQHWKHHPLVVLRQVWKHEUHDWKLQJORVVHTXD
VSUHFKHQGHQ *OHLFKXQJHQ IU GLH $WPXQJVYHUOXVWH WLRQV DUH PXOWLSOLHG E\ WKH FRDWLQJ IDFWRU I 7KH
PLW GHP )DUEDQVWULFKIDNWRU I PXOWLSOL]LHUW 'HU IDFWRU IFDQEHREWDLQHGIURP7DEOH VHHDOVR1RWH
)DNWRU I LVW DXV GHU 7DEHOOH  ]X HQWQHKPHQ VLHKH RQ7DEOH 
DXFK$QPHUNXQJ]X7DEHOOH 

4.1.4 Befllverluste eines freibelfteten 4.1.4 Filling losses of a freely vented


Festdachtanks fixed-roof tank
'HU PLWWOHUH %HIOOYHUOXVW /%L LQ NJ)OOYRUJDQJ 7KH PHDQ ILOOLQJ ORVV /%L LQ NJILOOLQJ RSHUDWLRQ
EHL HLQHU %HIOOXQJ ZLUG QDFK IROJHQGHU *OHLFKXQJ GXULQJWDQNILOOLQJLVFDOFXODWHGDFFRUGLQJWRWKHIRO
EHUHFKQHW ORZLQJHTXDWLRQ
/%L I%FQTL  /%L I%FQTL 
(QWVSUHFKHQGODXWHWGHUPLWWOHUH-DKUHV%HIOOYHUOXVW +HQFHWKHPHDQDQQXDOILOOLQJORVV/%D LQNJD LV
/%DLQNJD

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

/%D I%FQ4  /%D I%FQ4 


(VEHGHXWHQ ZKHUH
I% 6lWWLJXQJVJUDG 6lWWLJXQJVJUDG LVW GDV 9HUKlOW I% VDWXUDWLRQOHYHO WKHVDWXUDWLRQOHYHOLVWKHUDWLR
QLVYRQHUUHLFKWHU.RQ]HQWUDWLRQ]XU6lWWLJXQJV RIWKHDFWXDOFRQFHQWUDWLRQWRWKHVDWXUDWLRQFRQ
NRQ]HQWUDWLRQ I% >@ FHQWUDWLRQ I% >@
'LH 6lWWLJXQJVNRQ]HQWUDWLRQ F LQ NJP  GHU .RK 7KH K\GURFDUERQ VDWXUDWLRQ FRQFHQWUDWLRQ F LQ NJ
OHQZDVVHUVWRIIHLP*DVUDXPEHUGHP)OVVLJNHLWV P  LQ WKH YDSRXU VSDFH DERYH WKH OLTXLG VXUIDFH LV
VSLHJHOZLUGPLW*OHLFKXQJ  EHUHFKQHW FDOFXODWHGZLWKWKHDLGRI(TXDWLRQ  
8PJHIRUPW HUJLEW VLFK GLH 6lWWLJXQJVNRQ]HQWUDWLRQ %\UHZULWLQJ(TXDWLRQWKHVDWXUDWLRQFRQFHQWUDWLRQ
FQ LQNJP FQ LQNJP LVREWDLQHGDVIROORZV
 
FQ % --- S 7 0  FQ % --- S 7 0 
7 7
ZREHL ZKHUH
7Q  . NPRO 7Q  . NPRO
- =    ---------------------
% = -------------------- - =    ---------------------
% = --------------------
9 0Q S Q 
P K3D 9 0Q S Q 
P K3D
TL HLQJHIOOWH )OVVLJNHLWVPHQJH EHLP (LQ]HOIOO TL ILOOHGLQOLTXLGYROXPHSHUILOOLQJRSHUDWLRQ
YRUJDQJLQP)OOYRUJDQJ LQPILOOLQJRSHUDWLRQ
4 HLQJHIOOWH )OVVLJNHLWVPHQJH LP -DKU PD 4 ILOOHGLQOLTXLGYROXPHSHU\HDU PD LH
GDV KHLW
Q Q
4 = TL  4 = TL 
L= L=
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Q $Q]DKOGHU)OOYRUJlQJHSUR-DKU Q QXPEHURIILOOLQJRSHUDWLRQVSHU\HDU
'HU JHVDPWH PLWWOHUH -DKUHV%HIOOYHUOXVW /%D LQ $FFRUGLQJO\ WKH WRWDO PHDQ DQQXDO ILOOLQJ ORVV /%D
NJD HUJLEWVLFKGDPLW]X LQNJD LV
 
/%D I% --- S 7 0 4  /%D I% --- S 7 0 4 
7 7

4.1.5 Dmpferckgewinnungsanlagen (VRU) 4.1.5 Vapour recovery units (VRUs)


'LH .RKOHQZDVVHUVWRII.RQ]HQWUDWLRQ F YRQ 'lPS 7KHFOHDQJDVK\GURFDUERQFRQFHQWUDWLRQFRIYDSRXU
IHUFNJHZLQQXQJVDQODJHQ LQPJP ZHUGHQGXUFK UHFRYHU\XQLWV LQPJP LVGHWHUPLQHGE\PHDVXUH
0HVVXQJHQ HUPLWWHOW 'HU (PLVVLRQVPDVVHQVWURP / PHQW7KHHPLVVLRQPDVVIORZ/ LQNJK LVFDOFX
LQNJK ZLUGZLHIROJWHUUHFKQHW ODWHGDVIROORZV
/ F4  / F4 
(VEHGHXWHQ ZKHUH
F .RKOHQZDVVHUVWRII.RQ]HQWUDWLRQLP5HLQJDVLQ F FOHDQJDVK\GURFDUERQFRQFHQWUDWLRQ LQPJP 
PJP HUPLWWHOWGXUFK0HVVXQJHQ GHWHUPLQHGE\PHDVXUHPHQWV
4 9HUGUlQJXQJVYROXPHQ]X958LQPK 4 YROXPHGLVSODFHGWR958 LQPK
%HL $XVIDOO GHU 958 VLQG HUJlQ]HQGH 5HFKQXQJHQ )RUWKHFDVHRI958IDLOXUHDGGLWLRQDOFDOFXODWLRQV
HUIRUGHUOLFK ZLOOEHUHTXLUHG

4.1.6 Beispielrechnungen fr 4.1.6 Example calculations for


Dieselkraftstofftanks diesel fuel tanks
Ausgangsdaten Calculation basis
7DQNSDUDPHWHU 7DQNSDUDPHWHUV
7DQNYROXPHQ 9  P 7DQNYROXPH 9 P
8PVFKODJSUR-DKU Q Q  7XUQRYHUVSHU\HDU Q Q 
-DKUHVGXUFKVDW] 4  P $QQXDOWKURXJKSXW 4 P

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

 
$QVWULFKIDNWRU $OX6LOEHU I = ------- =  &RDWLQJIDFWRU DOXPLQLXPVLOYHU I = ------- = 
 
VLHKH7DEHOOHQXQG VHH7DEOHVDQG
*DVUDXPYROXPHQEHUGHP 9ROXPHRIYDSRXUVSDFHDERYH
/DJHUJXW VLHKH7DEHOOH 9* P SURGXFWVWRUHG VHH7DEOH  9* P
8PJHEXQJVSDUDPHWHU $PELHQWSDUDPHWHUV
$Q]DKOGHU6RPPHUWDJSUR-DKU GD G6  1XPEHURIVXPPHUGD\VSHU\HDU GD G6 
$Q]DKOGHU:LQWHUWDJHSUR-DKU GD G:  1XPEHURIZLQWHUGD\VSHU\HDU GD G: 
8PJHEXQJVGUXFNE]Z DEVROXWHU $PELHQWSUHVVXUHRU DEVROXWH
$WPRVSKlUHQGUXFN S K3D DWPRVSKHULFSUHVVXUH S K3D
1RUPGUXFN $WPRVSKlUHQ 6WDQGDUGSUHVVXUH
GUXFN SQ K3D DWPRVSKHULFSUHVVXUH SQ K3D
1RUPWHPSHUDWXU 7Q . 6WDQGDUGWHPSHUDWXUH 7Q .
/DJHUWHPSHUDWXU 7 . 6WRUDJHWHPSHUDWXUH 7 .
0LWWOHUH0LQLPDOWHPSHUDWXU 0HDQPLQLPXPWHPSHUDWXUH
LP*DVUDXP VLHKH7DEHOOH LQYDSRXUVSDFH VHH7DEOH
LP6RPPHU 76 . LQVXPPHU 76 .
LP:LQWHU 7: . LQZLQWHU 7: .
0LWWOHUH0D[LPDOWHPSHUDWXULP 0HDQPD[LPXPWHPSHUDWXUHLQ
*DVUDXP VLHKH7DEHOOH YDSRXUVSDFH VHH7DEOH
LP6RPPHU 76 . LQVXPPHU 76 .
LP:LQWHU 7: . LQZLQWHU 7: .
3URGXNWSDUDPHWHU 3URGXFWSDUDPHWHUV
3URGXNW'LHVHONUDIWVWRII 3URGXFWGLHVHOIXHO
PLWWOHUHV0ROHNXODUJHZLFKWGHV3URGXNWHV 0HDQPROHFXODUZHLJKWRISURGXFWYDSRXU
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

NJ NJ
'DPSI 0 =  ------------ 'DPSI 0 =  ------------
NPRO NPRO
PLWWOHUHU'DPSIGUXFNEHL 0HDQYDSRXUSUHVVXUHDW
/DJHUWHPSHUDWXU S7 K3D VWRUDJHWHPSHUDWXUH S7 K3D
6lWWLJXQJVJUDGLP6RPPHU I$6  6DWXUDWLRQOHYHOLQVXPPHU I$6 
VLHKH7DEHOOH VHH7DEOH
6lWWLJXQJVJUDGLP:LQWHU I$:  6DWXUDWLRQOHYHOLQZLQWHU I$: 
VLHKH7DEHOOH VHH7DEOH
6lWWLJXQJVJUDG EHL%HUHFK I%  6DWXUDWLRQOHYHO I% 
QXQJGHU%HIOOYHUOXVWH IRUFDOFXODWLQJILOOLQJORVVHV

Berechnung der gesamten Jahres- Calculation of total annual breathing losses


Atmungsverluste nach Gleichung (9) as per Equation (9)

7 S S 7 S S
/$D I$6S7 0 ----Q-  --------- --------- 9*GVI$:S7 0 ----Q-  ----------- ----------- 9*GZ
S Q 7 6 7 6 S Q 7 : 7 :

  


/$D  ------------  ------------- ------------- 
  

  


 ------------  ------------ ------------ 
  
/$D  NJD

Berechnung der Befllverluste nach Calculation of filling losses as per


Gleichung (18) Equation (18):
 
/%D I% --- S 7 0 4 /%D I% --- S 7 0 4
7 7

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

 
/%D  ---------   /%D  --------- 
 
/%D NJD /%D NJD

Berechnung der Gesamtjahresverluste des Calculation of total annual losses of fixed-roof


Festdachtanks nach Gleichung (1) tank as per Equation (1):
/7DQND  h6' > h9' I/$D/%D@ /7DQND  h6' > h9' I/$D/%D@
/7DQND   >  @ /7DQND   >  @
/7DQND  NJD /7DQND  NJD

4.2 Schwimmdachtanks 4.2 Floating-roof tanks


=XU%HUHFKQXQJGHU.:(PLVVLRQHQDXV6FKZLPP +\GURFDUERQHPLVVLRQVIURPIORDWLQJURRIWDQNVDUH
GDFKWDQNVZLUGGLHLQWHUQDWLRQDODQHUNDQQWH5HFKHQ FDOFXODWHG DFFRUGLQJ WR WKH LQWHUQDWLRQDOO\ UHFRJ
PHWKRGHQDFK$3,>@KHUDQJH]RJHQ QL]HG$3,0HWKRG$3,>@
'DQDFK HUUHFKQHW VLFK GLH (PLVVLRQ LP )ROJHQGHQ $FFRUGLQJ WR WKLV PHWKRG WKH HPLVVLRQ LQ WKH IRO
DOV*HVDPWYHUOXVW/7 LQNJD EH]HLFKQHW]X ORZLQJUHIHUUHGWRDVWRWDOORVV/7 LQNJD LVGHWHU
PLQHG DV WKH VXP RI WKH VWRUDJH ORVV DQG WKH ZLWK
GUDZDOORVV
/7 /6/:  /7 /6/: 
(VEHGHXWHQ ZKHUH
/6 6WDQGYHUOXVWLQNJD /6 VWDQGLQJVWRUDJHORVV LQNJD
/: (QWQDKPHYHUOXVW $UEHLWVYHUOXVW LQNJD /: ZLWKGUDZDOORVV ZRUNLQJORVV  LQNJD
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

4.2.1 Standverlust 4.2.1 Standing storage loss


'HU6WDQGYHUOXVW/6 LQNJD ZLUGGXUFK(PLVVLRQHQ 7KH VWDQGLQJ VWRUDJH ORVV /6 LQ NJD  LV FDXVHG E\
DQGHU5DQGDEGLFKWXQJ/5DQGHQ7DQNGDFKDUPDWX HPLVVLRQVRFFXUULQJDWWKHULPVHDO/5DWWKHGHFNILW
UHQ/)XQGDP7DQNGDFK/3KHUYRUJHUXIHQ WLQJV/)DQGDWWKHWDQNGHFNVHDP/3
/6 /5/)/3  /6 /5/)/3 
/3LVWYRQGHU%DXDUWGHV6FKZLPPGDFKHVDEKlQJLJ /3GHSHQGVRQWKHW\SHRIIORDWLQJURRIFRQVWUXFWLRQ
]XP %HLVSLHO 3RQWRQ DXV $OXPLQLXP E]Z 6WDKO HJ DOXPLQLXP SRQWRRQ URRI RU VWHHO IORDWLQJ URRI
VFKZLPPGDFK %HL GHQ LQ 'HXWVFKODQG DXVVFKOLH )RU VWHHO IORDWLQJ URRIV DV H[FOXVLYHO\ XVHG LQ *HU
OLFKYHUZHQGHWHQ6WDKOVFKZLPPGlFKHUQLVW/3  PDQ\/3 
/ 6   ) 5 S 0 . &  ) ) S 0 . & / 6   ) 5 S 0 . &  ) ) S 0 . &
 






/5 /) /5 /)
/6  )5)) S 0.&  /6  )5)) S 0.& 
(VEHGHXWHQ ZKHUH
)5 5DQGDEGLFKWXQJVIDNWRULQNPRODYHUJOHLFKH )5 WRWDOULPVHDOORVVIDFWRU LQNPROD VHH(TXD
*OHLFKXQJ  WLRQ 
)) 6FKZLPPGDFKDXVUVWXQJVYHUOXVWIDNWRU $E )) WRWDOGHFNILWWLQJORVVIDFWRU VHDOLQJIDFWRU  LQ
GLFKWXQJVIDNWRU  LQ NPROD YHUJOHLFKH *OHL NPROD VHH(TXDWLRQ 
FKXQJ 
S 'DPSIGUXFNIXQNWLRQ GLPHQVLRQVORV  YHU S YDSRXUSUHVVXUHIXQFWLRQ GLPHQVLRQOHVV VHH
JOHLFKH*OHLFKXQJ  (TXDWLRQ 
0 0ROHNXODUJHZLFKW GHV 3URGXNWGDPSIHV LQ 0 PROHFXODU ZHLJKW RI SURGXFW YDSRXU LQ NJ
NJNPRO]XP%HLVSLHOIU5RK|OIU%HQ NPRO HJIRUFUXGHRLOIRUJDVROLQH
]LQH
.& 3URGXNWIDNWRU GLPHQVLRQVORV  ]XP %HLVSLHO .& SURGXFW IDFWRU GLPHQVLRQOHVV  HJ  IRU
IU5RK|O IU5DIILQDWHIU%HQ]LQ FUXGHRLOIRUUHILQHGSHWUROHXPVWRFNV
IRUJDVROLQH

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Tabelle 13. Dichtungsverlustfaktor KR in Abhngigkeit von der Windgeschwindigkeit fr geschweite Tanks


durchschnittlich gut sitzende Dichtungen sehr gut sitzende Dichtungen

Windgeschwindigkeit m/s 0 2,2 4,5 6,7 0 2,2 4,5 6,7

Tankkonstruktion und
Dichtungsverlustfaktor KR in kmol/(m a)
Randabdichtungssystem:

a) Mech. Gleitschuhdichtung
nur primr 8,6 22,3 65,5 139,9 2,2 14,9 49,1 104,2
gleitschuhmontierte Sekundr-
dichtungen 2,4 8,2 20,8 35,7 1,5 8,2 20,8 35,7
randmontierte
Sekundrdichtungen*) 0,9 3,9 6,8 9,8 0,6 3,6 6,5 9,5

b) Elastisch gefllte Dichtung


(flssigkeitsmontiert)
nur primr 2,4 7,4 16,4 28,3 1,5 3,6 8,9 16,4
Wetterschild 1,0 4,2 8,2 12,5 0,6 3,0 6,5 10,7
randmontierte Sekundrdichtung 0,4 1,9 2,2 2,5 0,3 1,5 1,8 2,1

ZLUGYRU]XJVZHLVHLQ'HXWVFKODQGYHUZHQGHW

Table 13. Rim seal loss factor KR at selected ambient wind speeds for welded tanks
Average-fitting seals Tight-fitting seals

Wind speed (in m/s) 0 2.2 4.5 6.7 0 2.2 4.5 6.7

Tank construction and


Rim seal loss factor KR (in kmol/(m a))
rim seal system:

a) Mechanical shoe seal


Primary only 8.6 22.3 65.5 139.9 2.2 14.9 49.1 104.2
shoe-mounted secondary seals 2.4 8.2 20.8 35.7 1.5 8.2 20.8 35.7
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

rim-mounted secondary seals*) 0.9 3.9 6.8 9.8 0.6 3.6 6.5 9.5

b) Resilient-filled seal
(liquid-mounted)
primary only 2.4 7.4 16.4 28.3 1.5 3.6 8.9 16.4
weather shield 1.0 4.2 8.2 12.5 0.6 3.0 6.5 10.7
rim-mounted secondary seal 0.4 1.9 2.2 2.5 0.3 1.5 1.8 2.1

SUHIHUDEO\XVHGLQ*HUPDQ\

'HU5DQGDEGLFKWXQJVIDNWRU)5 LQNPROD ZLUGZLH 7KHWRWDOULPVHDOORVVIDFWRU)5 LQNPROD LVGHWHU


IROJWHUPLWWHOW PLQHGDVIROORZV
)5 .5'  )5 .5' 
.5 'LFKWXQJVYHUOXVWIDNWRU LQ NPRO P D   VLHKH .5 ULPVHDOORVVIDFWRUIRUDSDUWLFXODUULPVHDOW\SH
7DEHOOH LQNPRO P D VHH7DEOH
' 7DQNGXUFKPHVVHULQP ' WDQNGLDPHWHU LQP
.5ZLUGLQ$EKlQJLJNHLWYRQGHU:LQGJHVFKZLQGLJ 7KHYDOXHIRU.5YDULHVZLWKWKHZLQGVSHHGDQGW\SH
NHLWXQGGHU'LFKWXQJVDUWDXV7DEHOOHEHVWLPPW RIULPVHDODQGFDQEHUHDGIURP7DEOH
'LH'DPSIGUXFNIXQNWLRQS  GLPHQVLRQVORV ODXWHW 7KH YDSRXU SUHVVXUH IXQFWLRQ S  GLPHQVLRQOHVV  LV
JLYHQE\
S S
------ ------
S$ S$
S = -------------------------------------
-

 S = -------------------------------------
-


S S
 +  ------  +  ------
S$ S$
S WDWVlFKOLFKHU'DPSIGUXFNLQ3D S DFWXDOYDSRXUSUHVVXUH LQ3D
NDQQ DXV 7DEHOOH  GLHVHU 5LFKWOLQLH HUPLWWHOW FDQEHUHDGIURP7DEOHLQWKLVJXLGHOLQH
ZHUGHQ
S$ DWPRVSKlULVFKHU/XIWGUXFN S$ K3D S$ DWPRVSKHULFSUHVVXUH S$ K3D

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

'HU 6FKZLPPGDFKDXVUVWXQJVYHUOXVWIDNWRU )) LQ 7KHWRWDOGHFNILWWLQJORVVIDFWRUIRUIORDWLQJURRIV))


NPROD ZLUGZLHIROJWEHUHFKQHW LQNPROD LVFDOFXODWHGDFFRUGLQJWRWKHIROORZLQJ
HTXDWLRQ

)) =
Q
1) .)
L L
 )) =
Q
1) .)
L L


1) $Q]DKOGHU$UPDWXUHQGHV7\SVL 1) QXPEHURIILWWLQJVRIW\SHL
. )L 'DFKDUPDWXUHQYHUOXVWIDNWRU IU $UPDWXUHQ . )L GHFNILWWLQJORVVIDFWRUIRUDSDUWLFXODUILWWLQJ
W\SLQNPROD W\SH LQNPROD
,P $OOJHPHLQHQ NDQQ IU HLQH JUREH $EVFKlW]XQJ )RUDURXJKHVWLPDWLRQRI))LWZLOOQRUPDOO\QRWEH
YRQ))DXIGLH(UPLWWOXQJGHU9HUOXVWHYRQQLFKWDE QHFHVVDU\WRGHWHUPLQHWKHORVVHVUHVXOWLQJIURPXQ
JHGLFKWHWHQ 7DQNGDFKVWW]HQ QLFKW DEJHGLFKWHWHQ VHDOHG URRI OHJV XQVHDOHG JDXJLQJ SROHV DQG XQ
3HLOURKUHQQLFKWDEJHGLFKWHWHQ%HXQG(QWOIWXQJV VHDOHGYHQWVDVWKHVHDUHVLJQLILFDQWO\ORZHUWKDQWKH
DUPDWXUHQYHU]LFKWHWZHUGHQGDGLHVHZHVHQWOLFKJH HPLVVLRQV RFFXUULQJ WKURXJK WKH VORWWHG JXLGH SROH
ULQJHUDOVGLH(PLVVLRQHQGXUFKGDVJHVFKOLW]WH)K 7KH ORVV IDFWRU IRU D SDUWLFXODU W\SH RI GHFN ILWWLQJ
UXQJVURKUVLQG'HU'DFKDUPDWXUHQYHUOXVWIDNWRU . )L . )L FDQEHGLUHFWO\UHDGIURP7DEOHIRUVHOHFWHG
LVWZLQGDEKlQJLJHUZLUGDXV7DEHOOHHUPLWWHOW DPELHQWZLQGVSHHGV

4.2.2 Entnahmeverlust LW (Arbeitsverlust) 4.2.2 Withdrawal loss LW (working loss)


'HU(QWQDKPHQYHUOXVW/: LQNJD HQWVWHKWGXUFKGLH 7KH ZLWKGUDZDO ORVV /: LQ NJD  UHVXOWV IURP WKH
9HUGXQVWXQJYRQ)OVVLJNHLWVUHVWHQGLHZlKUHQGGHU HYDSRUDWLRQRIUHPDLQLQJOLTXLGFOLQJLQJWRWKHWDQN
$EVHQNXQJGHV7DQNGDFKHVQDFKXQWHQDQGHU7DQN LQVLGHZDOODVWKHWDQNURRIGHVFHQGV
LQQHQZDQGKDIWHQEOHLEHQ
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Tabelle 14. Dacharmaturenverlustfaktor KF in Abhngigkeit von der Windgeschwindigkeit


0 2,2 4,5 6,7

Windgeschwindigkeit in m/s Dacharmaturenverlustfaktor KF in kmol/a


Geschlitztes Fhrungsrohr (ohne Abstreifer) 19,5 725,8 1905,1 3311,3

Geschlitztes Fhrungsrohr (mit Abstreifer) 18,6 145,2 349,3 589,7

Mannloch (abgedichtet) 0,7 0,7 0,7 0,7

Flssigkeitsstandanzeiger 6,4 15,9 27,2 39,0

Peil- und Probenahmerohr 1,0 1,0 1,0 1,0

Be- und Entlftungsarmatur 3,5 4,2 14,5 59,0


Tankdachsttzen
Membransttzen, nicht abgedichtet 0,4 0,7 0,7 0,7
Ringpontonsttzen, nicht abgedichtet 0,9 1,5 1,9 2,3

Table 14. Deck fitting loss factor KF at selected wind speeds


0 2.2 4.5 6.7

Wind speed in m/s Deck fitting loss factor KF (in kmol/a)


Slotted guide pole (without wiper) 19.5 725.8 1905.1 3311.3

Slotted guide pole (with wiper) 18.6 145.2 349.3 589.7

Access hatch (sealed) 0.7 0.7 0.7 0.7

Liquid level indicator 6.4 15.9 27.2 39.0

Gauging and sampling pole 1.0 1.0 1.0 1.0

Vent valve 3.5 4.2 14.5 59.0

Deck legs
Membrane legs, unsealed 0.4 0.7 0.7 0.7
Pontoon legs, unsealed 0.9 1.5 1.9 2.3

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

4 & :/ = 4 & :/ =
/ : = --------------------------------
-  / : = --------------------------------
- 
' '
(VEHGHXWHQ ZKHUH
4 -DKUHVGXUFKVDW]LQPD 4 DQQXDOWKURXJKSXW LQPD
& :DQGEHQHW]XQJVVFKLFKW   ]XP %HLVSLHO IU & ZDOO FOLQJDJH IDFWRU   HJ IRU VOLJKWO\ UXVWHG
OHLFKWDQJHURVWHWH7DQNZDQG WDQNZDOO
IU2WWRNUDIWVWRIIH P IRUPRWRUJDVROLQHV  LQP
IU5RK|O P IRUFUXGHRLOV  LQP
:/ )OVVLJNHLWVGLFKWHEHL &LQNJP :/ OLTXLGSURGXFWGHQVLW\DW & LQNJP
' 7DQNGXUFKPHVVHULQP ' WDQNGLDPHWHU LQP
= 8PUHFKQXQJVIDNWRU = FRQYHUVLRQIDFWRU
DPHULNDQLVFKH(LQKHLWLQ6,(LQKHLW=  IURP86WR6,XQLW= 

4.2.3 Beispielrechnungen 4.2.3 Example calculations


Ausgangsdaten Calculation basis
7DQNSDUDPHWHU 5RK|OWDQN 7DQNSDUDPHWHUV FUXGHRLOWDQN
'XUFKPHVVHU ' P 'LDPHWHU ' P
7DQNLQQHQZDQG]XVWDQG OHLFKWDQJHURVWHW 7DQNLQVLGHZDOO VOLJKWO\UXVWHG
:DQGEHQHW]XQJVVFKLFKW :DOOFOLQJDJHIDFWRU
IU5RK|O & P IRUFUXGHRLO & P
7DQNYROXPHQ $UEHLWV 7DQNYROXPH
YROXPHQ 9  P ZRUNLQJYROXPH 9 P
8PVFKODJSUR-DKU Q  7XUQRYHUVSHU\HDU Q 
-DKUHVGXUFKVDW] 4  PD $QQXDOWKURXJKSXW 4 PD
8PJHEXQJVSDUDPHWHU $PELHQWSDUDPHWHUV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

GXUFKVFKQLWWOLFKH:LQG 0HDQZLQGVSHHG Y PV


JHVFKZLQGLJNHLW Y PV
GXUFKVFKQLWWOLFKH/DJHU 0HDQSURGXFWVWRUDJH
WHPSHUDWXU 7  & WHPSHUDWXUH 7  &
/XIWGUXFN S$ K3D $WPRVSKHULFSUHVVXUHS$ S$ K3D
6FKZLPPGDFKGLFKWXQJ )ORDWLQJURRIULPVHDOV\VWHP
GRSSHOW ZLUNHQGH 5DQGDEGLFKWXQJ PLW HLQHU PH GRXEOHDFWLQJULPVHDOV\VWHPFRPSRVHGRIDPH
FKDQLVFKHQ *OHLWVFKXKGLFKWXQJ DOV 3ULPlUGLFK FKDQLFDO VKRHPRXQWHG SULPDU\ VHDO DQG D ULP
WXQJXQGPLWHLQHUUDQGPRQWLHUWHQ6HNXQGlUGLFK PRXQWHGVHFRQGDU\VHDO WLJKWILWWLQJVHDO
WXQJ VHKUJXWVLW]HQGH'LFKWXQJ
)U GHQ 'LFKWXQJVYHUOXVWIDNWRU .5 HUJLEW VLFK 7KHULPVHDOORVVIDFWRU.5GHULYHGIURP7DEOH
QDFK7DEHOOHOLQHDULQWHUSROLHUWHLQ:HUWYRQ E\OLQHDULQWHUSRODWLRQLV.5 NPRO PD 
.5 NPRO PD 
6FKZLPPGDFKDXVUVWXQJHQ )ORDWLQJURRIGHFNILWWLQJV
)U GLH MHZHLOLJHQ 'DFKDUPDWXUHQYHUOXVWIDNWRUHQ 7KH GHFN ILWWLQJ ORVV IDFWRUV IRU WKH SDUWLFXODU
HUJHEHQVLFKQDFK7DEHOOHOLQHDULQWHUSROLHUW W\SHV RI ILWWLQJ FDQ EH GHULYHG IURP 7DEOH  E\
IROJHQGH:HUWH OLQHDULQWHUSRODWLRQDVIROORZV
JHVFKOLW]WHV)KUXQJV VORWWHGJXLGHSROH
URKURKQH$EVWUHLIHU .) NPROD ZLWKRXWZLSHU .) NPROD
0DQQORFK .) NPROD DFFHVVKDWFK .) NPROD
)OVVLJNHLWVVWDQGDQ]HLJHU .) NPROD OLTXLGOHYHOLQGLFDWRU .) NPROD
3HLO3UREHQDKPHURKU .) NPROD JDXJLQJVDPSOLQJSROH .) NPROD
%HXQG(QWOIWXQJV YHQWVYDOYHV .) NPROD
DUPDWXUHQ .) NPROD
5LQJSRQWRQVWW]HQ .) NPROD SRQWRRQOHJV .) NPROD
0HPEUDQVWW]HQ .) NPROD PHPEUDQHOHJV .) NPROD

 
%HLVWDUNURVWLJHU7DQNZDQGLVWGLH:DQGEHQHW]XQJVVFKLFKWXPGHQ )RUVHYHUHO\UXVWHGWDQNZDOOVWKHZDOOFOLQJDJHIDFWRULQFUHDVHVE\
)DNWRUJU|HU DIDFWRURI

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

3URGXNWSDUDPHWHU 3URGXFWSDUDPHWHUV
5RK|O &UXGHRLO
'LFKWH :/ NJP 'HQVLW\ :/ NJP
0ROHNXODUJHZLFKW 0ROHFXODUZHLJKW
GHU3URGXNWGlPSIH 0 NJNPRO RISURGXFWYDSRXUV 0 NJNPRO
0LWWOHUHU'DPSIGUXFN 0HDQYDSRXUSUHVVXUH
EHL/DJHUWHPSHUDWXU S PEDU DWVWRUDJHWHPSHUDWXUH S PEDU
K3D K3D
3URGXNWIDNWRU .&  3URGXFWIDFWRU .& 
S S$ S S$
S = -------------------------------------------------------
- S = -------------------------------------------------------
-
   
{  + [  ( S S$ ) ] } {  + [  ( S S$ ) ] }
   
       
= ---------------------------------------------------------------------------------------------- = ----------------------------------------------------------------------------------------------
 
           
 +   + 


 
S  = ---------- =  S  = ---------- = 
 

Berechnung des Standverlustes (LS) Calculation of standing storage loss (LS)


nach Gleichung (22) as per Equation (22)
/6 )5S 0.&))S 0.& /6 )5S 0.&))S 0.&
/6 .5'S 0.& .).).) /6 .5'S 0.& .).).)
.).).).) S 0.& .).).).) S 0.&
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

/6   /6  


   
/6  NJD /6  NJD

Berechnung des Entnahmeverlustes (LW) Calculation of withdrawal loss (LW)


nach Gleichung (27) as per Equation (27)
4&: 4&:
/:  ------------------------/- /:  ------------------------/-
' '
 
          
/: = -------------------------------------------------------------------------  NJD /: = -------------------------------------------------------------------------  NJD
 

Berechnung des Gesamtverlustes (LT) Calculation of total loss (LT)


/7 /6/:  NJD /7 /6/:  NJD

5 Abflle, Abwsser, Abwrme 5 Waste, waste water, waste heat


5.1 Abflle 5.1 Waste
,Q UDIILQHULHIHUQHQ 7DQNODJHUQ IDOOHQ IHVWH IOVVLJH ,QPDUNHWLQJLQVWDOODWLRQWDQNIDUPVVROLGOLTXLGDQG
XQG VFKODPPI|UPLJH $EIlOOH DXV XQWHUVFKLHGOLFKHQ SDVW\ ZDVWH VWUHDPV DUH JHQHUDWHG E\ GLIIHUHQW
4XHOOHQDQ7\SLVFKH$EIlOOH>@PLWLKUHQ$EIDOO VRXUFHV7\SLFDOZDVWHVWUHDPVVXEMHFWWRVSHFLDOVXU
VFKOVVHOQXPPHUQ (:&&RGH GLHQDFKGHP(XUR YHLOODQFH >@ DUH OLVWHG EHORZ WRJHWKHU ZLWK WKHLU
SlLVFKHQ$EIDOOYHU]HLFKQLVDOVJHIlKUOLFKHLQJHVWXIW FRGHQXPEHUV (:&&RGH 
ZXUGHQVLQG
)HVWH$EIlOOHDXV6DQGIDQJDQODJHQXQGgO:DV VROLG ZDVWHV IURP RLOZDWHU VHSDUDWRUV (:&
VHUDEVFKHLGHUQ (:&&RGH &RGH

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

6FKOlPPHDXVgO:DVVHUDEVFKHLGHUQ (:&&RGH VOXUULHV IURP RLOZDWHU VHSDUDWRUV (:&


 &RGH
6FKOlPPH DXV (LQODXIVFKlFKWHQ (:&&RGH VOXUULHVIURPIORRUGUDLQV (:&&RGH

gOKDOWLJH$EIlOOH (:&&RGH ]XP%HL RLOODGHQZDVWHVWUHDPV (:&&RGH HJ
VSLHODXVGHU5HLQLJXQJYRQ/DJHUWDQNV IURPVWRUDJHWDQNFOHDQLQJRSHUDWLRQV
$EIlOOH GLH VRQVWLJH JHIlKUOLFKH 6WRIIH HQWKDOWHQ ZDVWHVWUHDPVFRQWDPLQDWHGZLWKRWKHUKD]DUGRXV
(:&&RGH VXEVWDQFHV (:&&RGH
'DUEHUKLQDXVIDOOHQ0HWDOOVFKURWWXQGYHUXQUHLQLJ %HVLGHV PHWDO VFUDS FRQWDPLQDWHG LQVXODQWV DQG
WHV ,VROLHUPDWHULDO VRZLH KDXVPOOlKQOLFKH $EIlOOH ZDVWHVLPLODUWRGRPHVWLFUHIXVHDUHREWDLQHG:DVWH
DQ$EIlOOHGLHQLFKWYHUPLHGHQRGHUYHUZHUWHWZHU VWUHDPVWKDWFDQQRWEHDYRLGHGRUURXWHGWRLQWHUQDORU
GHQN|QQHQZHUGHQQDFKGHQDEIDOOUHFKWOLFKHQ%H H[WHUQDOUHXVHPXVWEHGLVSRVHGRILQDFFRUGDQFHZLWK
VWLPPXQJHQEHVHLWLJW>@ WKHDSSOLFDEOHZDVWHPDQDJHPHQWUHJXODWLRQV>@

5.2 Abwsser 5.2 Waste water


,Q UDIILQHULHIHUQHQ 0LQHUDO|OWDQNOlJHUQ IDOOHQ $E 0DUNHWLQJ LQVWDOODWLRQ WDQN IDUPV JHQHUDWH GLYHUVH
ZlVVHUXQWHUVFKLHGOLFKHU$UWDQGLHLP:HVHQWOLFKHQ ZDVWHZDWHUVWUHDPVZKLFKDUHSUHGRPLQDQWO\FDXVHG
GXUFK1LHGHUVFKOlJHKHUYRUJHUXIHQZHUGHQ E\UDLQIDOO
1LHGHUVFKODJVZDVVHUYRQ9HUNHKUVXQG)UHLIOlFKHQ 6WRUPZDWHU IURP WUDIILF DQG RSHQ DUHDV DV ZHOO DV
VRZLH'DFKIOlFKHQGHV7DQNODJHUJHOlQGHV QLFKWEH IURPURRIDUHDVRQWKHWDQNIDUPSUHPLVHV VWRUPZD
KDQGOXQJVEHGUIWLJH$EZlVVHU ZLUGLQGHU5HJHOLQ WHUUHTXLULQJQRWUHDWPHQW LVQRUPDOO\FROOHFWHGLQD
HLQHP YRQ GHP EHKDQGOXQJVEHGUIWLJHQ $EZDVVHU VHSDUDWHV\VWHPLHVHSDUDWHO\IURPZDVWHZDWHUUH
JHVRQGHUWHQ6\VWHPJHVDPPHOW)UHLIOlFKHQVLQGLQV TXLULQJ WUHDWPHQW 2SHQ DUHDV LQFOXGH LQ SDUWLFXODU
EHVRQGHUHDXFK7DQNDXIIDQJUlXPHGLHEHU+RIHLQ WDQN EXQGV ZKLFK DUH GUDLQHG YLD IORRU GUDLQV DQG
OlXIH XQG XQWHULUGLVFKH /HLWXQJHQ HQWZlVVHUW ZHU EXULHG SLSLQJ OLQHV 7KH XQGHUJURXQG SLSHZRUN LV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

GHQ'LHVHXQWHULUGLVFKHQ/HLWXQJHQVLQGPLWHLQHP HTXLSSHGZLWKVKXWRIIVOLGHVZKLFKDUHDOZD\VFORVHG
$EVSHUUVFKLHEHU DXVJHUVWHW GHU JUXQGVlW]OLFK JH XQGHUQRUPDOVHUYLFHFRQGLWLRQV
VFKORVVHQLVW
gOKDOWLJHV$EZDVVHUIlOOWEHLGHU7DQNHQWZlVVHUXQJ 2LOODGHQZDVWHZDWHULVREWDLQHGGXULQJWDQNGUDLQ
VRZLH EHL GHU (QWZlVVHUXQJ YRQ )UHLIOlFKHQ ]XP DJHRSHUDWLRQVDVZHOODVIURPWKHGUDLQDJHRIRSHQ
%HLVSLHO 3XPSHQVWlQGHQ )OOSOlW]HQ  DQ EHKDQG DUHDV HJSXPSVWDWLRQVORDGLQJ\DUGV ZDVWHZD
OXQJVEHGUIWLJH$EZlVVHU  WHUWREHWUHDWHG
'LH5HLQLJXQJGLHVHV$EZDVVHUVZLUGGXUFKSK\VLND :DVWH ZDWHU WUHDWPHQW LV DFFRPSOLVKHG E\ SK\VLFDO
OLVFKH 3KDVHQWUHQQXQJ HUUHLFKW +LHUEHL NRPPHQ LQ SKDVH VHSDUDWLRQ (TXLSPHQW FRPPRQO\ HPSOR\HG
GHU5HJHO6FKZHUNUDIWDEVFKHLGHUPLW0HKUNDPPHU LQFOXGHVPXOWLFRPSDUWPHQWJUDYLW\VHSDUDWRUVRUFR
V\VWHPRGHU.RDOHV]HQ]DEVFKHLGHU]XU$QZHQGXQJ DOHVFHQFHVHSDUDWRUV7KHODWWHUDUHHTXLSSHGZLWKD
6LHDUEHLWHQPLWVHOEVWWlWLJHP9HUVFKOXVVGDVKHLW VHOIDFWLQJFRQWUROGHYLFHZKLFKFDXVHVWKHLURXWOHWWR
EHLhEHUVFKUHLWHQGHU.RKOHQZDVVHUVWRII$XIQDKPH EHVKXWRIIDVVRRQDVWKHK\GURFDUERQWDNHXSFDSDF
NDSD]LWlWVFKOLHWGHU$XVODXI'LH/HLVWXQJGHU$E LW\RIWKHV\VWHPLVH[FHHGHG7KHVHSDUDWRUV\VWHPV
VFKHLGHV\VWHPHOLHJW]ZLVFKHQXQG"VMHQDFK DUH GHVLJQHG WR KDQGOH FDSDFLWLHV RI EHWZHHQ  DQG
$QODJHQJU|HE]ZQDFKDQJHVFKORVVHQHUQLFKWEHU "VGHSHQGLQJRQWKHSODQWVL]HRUWKHFRQQHFWHG
GDFKWHU (QWZlVVHUXQJVIOlFKH GHU 8PVFKODJSOlW]H QRQURRIHGRYHU GUDLQDJH DUHDV RI WKH ORDGLQJXQ
XQG)OOK|IHIU6WUDHQWDQNZDJHQXQG(LVHQEDKQ ORDGLQJ VWDWLRQV DQG ORDGLQJ \DUGV IRU URDG WDQNHUV
NHVVHOZDJHQ DQGUDLOWDQNFDUV
'DV1LHGHUVFKODJVZDVVHUZLUGPHFKDQLVFKLQHLQHP 6WRUPZDWHU LV IUHHG IURP VXVSHQGHG VROLGV E\ PH
6DQGIDQJYRQPLWJHIKUWHQ6FKZHPPVWRIIHQJHUHL FKDQLFDOWUHDWPHQWLQDJULWFKDPEHUDQGGLVFKDUJHG
QLJW XQG LP hEULJHQ RKQH ZHLWHUH %HKDQGOXQJ ]X ZLWKRXWIXUWKHUWUHDWPHQWWRWKHUHFHLYLQJZDWHURUWKH
VDPPHQPLWGHPJHUHLQLJWHQ|OKDOWLJHQ$EZDVVHULQ SXEOLF VHZHU V\VWHP WRJHWKHU ZLWK WKH WUHDWHG RLO
GHQ 9RUIOXWHU RGHU GDV |IIHQWOLFKH $EZDVVHUV\VWHP ODGHQ ZDVWHZDWHU GLUHFWGLVFKDUJH RULQGLUHFWGLV
JHOHLWHW 'LUHNWHLQOHLWHU RGHU ,QGLUHNWHLQOHLWHU  'LH FKDUJH 7KHZDVWHZDWHUUDWHGHSHQGVRQWKHUDWHRI
$EZDVVHUPHQJHULFKWHWVLFKQDFKGHU1LHGHUVFKODJV SUHFLSLWDWLRQDQGWKHGUDLQDJHDUHDFRQQHFWHGWRWKH
PHQJHXQGGHUDQGDV6DPPHOV\VWHPDQJHVFKORVVH FROOHFWLRQV\VWHP
QHQ(QWZlVVHUXQJVIOlFKH

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

6DQLWlUDEZDVVHU ZLUG GLUHNW GHP |IIHQWOLFKHQ $E 6DQLWDU\ ZDVWH ZDWHU LV GLUHFWO\ GLVFKDUJHG WR WKH
ZDVVHUV\VWHP]XJHOHLWHW SXEOLFVHZHUV\VWHP

5.3 Abwrme 5.3 Waste heat


5HOHYDQWH$EZlUPHWULWWJHJHEHQHQIDOOVEHL(LQVDW] 5HOHYDQWDPRXQWVRIZDVWHKHDWDUHJHQHUDWHGZKHQ
YRQ*DVPRWRUHQDXIGLHMHGRFKDXI*UXQGGHVJHULQ XVLQJJDVHQJLQHV+RZHYHULQYLHZRIWKHPLQRUKHDW
JHQ:lUPHEHGDUIVLQUDIILQHULHIHUQHQ7DQNOlJHUQLQ UHTXLUHPHQWV RI PDUNHWLQJ LQVWDOODWLRQ WDQN IDUPV
GHU5HJHOQLFKWZLUWVFKDIWOLFKJHQXW]WZHUGHQNDQQ WKLVZDVWHKHDWFDQQRUPDOO\QRWEHSXWWRHFRQRPLF
XVH
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Schrifttum/Bibliography  %*%O , 6   ]XOHW]W JHlQGHUW DP


 %*%O1U6
>@ *HVHW] ]XP 6FKXW] YRU VFKlGOLFKHQ 8PZHOWHLQZLUNXQJHQ
GXUFK /XIWYHUXQUHLQLJXQJHQ *HUlXVFKH (UVFKWWHUXQJHQ >@ 9HURUGQXQJEHUJHIlKUOLFKH6WRIIH *HIDKUVWRII9HURUGQXQJ
XQG lKQOLFKH 9RUJlQJH %XQGHV,PPLVVLRQVVFKXW]JHVHW]  *HI6WRII9  LQ GHU )DVVXQJ YRP  %*%O ,
%,P6FK*  LQ GHU )DVVXQJ GHU %HNDQQWPDFKXQJ YRP 6  JHlQGHUWDP %*%O,6
 %*%O,6 ]XOHW]WJHlQGHUWDP >@ =ZHLWH DOOJHPHLQH 9HUZDOWXQJYRUVFKULIW ]XP $EIDOOJHVHW]
%*%O,6 7$$EIDOO YRP %0%O,6 PLW%HULFKWL
>D@ 5HIHUHQFH'RFXPHQWRQ%HVW$YDLODEOH7HFKQLTXHVIRU0LQH JXQJYRP %0%O,6
UDO 2LO DQG *DV 5HILQHULHV )LQDO 'UDIW RI 2FWREHU  >@ 8QIDOOYHUKWXQJVYRUVFKULIWHQ 899 
(,33&%6HYLOOD (LQH=XVDPPHQVWHOOXQJGHU8QIDOOYHUKWXQJVYRUVFKULIWHQLVW
>E@ 5HIHUHQFH'RFXPHQWRQ%HVW$YDLODEOH7HFKQLTXHVIRU(PLV EHLGHUMHZHLOLJHQ%HUXIVJHQRVVHQVFKDIW]XHUKDOWHQ
VLRQV IURP 6WRUDJH 6HFRQG 'UDIW RI 6HSWHPEHU  >@ 9',    (PLVVLRQVPLQGHUXQJ  0LQHUDO|OUDIIL
(,33&%6HYLOOD QHULHQ%HUOLQ%HXWK9HUODJ
>@ (UVWH$OOJHPHLQH9HUZDOWXQJVYRUVFKULIW]XP%XQGHV,PPLV >@ ',1 (1     $XVOHJXQJ XQG +HUVWHOOXQJ
VLRQVVFKXW]JHVHW] 7HFKQLVFKH$QOHLWXQJ]XU5HLQKDOWXQJGHU VWDQGRUWJHIHUWLJWHUREHULUGLVFKHUVWHKHQGHU]\OLQGULVFKHUJH
/XIW7$/XIW YRP *0%O6 VFKZHLWHU )ODFKERGHQ0HWDOOWDQNV IU GLH /DJHUXQJ YRQ
>D@ (UVWH $OOJHPHLQH 9HUZDOWXQJVYRUVVFKULIW ]XP %XQGHV,P )OVVLJNHLWHQEHL8PJHEXQJVWHPSHUDWXUXQGK|KHUHQ7HPSH
PLVVLRQVVFKXW]JHVHW] 7HFKQLVFKH$QOHLWXQJ]XU5HLQKDOWXQJ UDWXUHQ7HLO6WDKOWDQNV%HUOLQ%HXWK9HUODJ
GHU/XIW7$/XIW (QWZXUI6WDQG >@ ',1(1 :HUNVJHIHUWLJWH7DQNVDXVPHWDOOL
>E@ *HVHW] ]XU 8PVHW]XQJ GHU 893bQGHUXQJVULFKWOLQLH GHU VFKHQ:HUNVWRIIHQ/LHJHQGHHLQXQGGRSSHOZDQGLJH7DQNV
,985LFKWOLQLH XQG ZHLWHUHU (*5LFKWOLQLHQ ]XP 8PZHOW ]XUXQWHULUGLVFKHQ/DJHUXQJYRQEUHQQEDUHQXQGQLFKWEUHQQ
VFKXW] $UWLNHOJHVHW]  YRP  %*%O , 1U  6 EDUHQZDVVHUJHIlKUGHQGHQ)OVVLJNHLWHQ%HUOLQ%HXWK9HU
 ODJ
>@ 9HURUGQXQJEHU$QODJHQ]XU/DJHUXQJ$EIOOXQJXQG%H >@ ',1  /LHJHQGH%HKlOWHU 7DQNV DXV6WDKO
I|UGHUXQJ EUHQQEDUHU )OVVLJNHLWHQ ]X /DQGH 9HURUGQXQJ HLQZDQGLJIUGLHXQWHULUGLVFKH/DJHUXQJZDVVHUJHIlKUGHQ
EHU EUHQQEDUH )OVVLJNHLWHQ  9E)  LQ GHU )DVVXQJ YRP GHU EUHQQEDUHU XQG QLFKWEUHQQEDUHU )OVVLJNHLWHQ %HUOLQ
(%*%O,6EHU6 %HXWK9HUODJ
>@ (LQXQG]ZDQ]LJVWH 9HURUGQXQJ ]XU 'XUFKIKUXQJ GHV %XQ ',1  /LHJHQGH%HKlOWHU 7DQNV DXV6WDKO
GHV,PPLVVLRQVVFKXW]JHVHW]HV 9HURUGQXQJ ]XU %HJUHQ]XQJ GRSSHOZDQGLJIUGLHXQWHULUGLVFKH/DJHUXQJZDVVHUJHIlKU
GHU.RKOHQZDVVHUVWRIIHPLVVLRQEHLGHU%HWDQNXQJYRQ.UDIW GHQGHUEUHQQEDUHUXQGQLFKWEUHQQEDUHU)OVVLJNHLWHQ%HUOLQ
IDKU]HXJHQ%,P6FK9 YRP2NWREHU %*%O, %HXWK9HUODJ
6  >@ ',1  6WHKHQGH%HKlOWHU 7DQNV DXV6WDKO
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

>@ =Z|OIWH9HURUGQXQJ]XU'XUFKIKUXQJGHV%XQGHV,PPLVVL HLQZDQGLJ IU GLH REHULUGLVFKH /DJHUXQJ ZDVVHUJHIlKUGHQ


RQVVFKXW]JHVHW]HV 6W|UIDOO9HURUGQXQJ%,P6FK9 YRP GHU EUHQQEDUHU XQG QLFKWEUHQQEDUHU )OVVLJNHLWHQ %HUOLQ
 %*%O,6 JHlQGHUWDP %*%O %HXWK9HUODJ
,6 ',1  6WHKHQGH%HKlOWHU 7DQNV DXV6WDKO
>@ 6HFKVWH $OOJHPHLQH 9HUZDOWXQJVYRUVFKULIW ]XP %XQGHV,P GRSSHOZDQGLJRKQH/HFNDQ]HLJHIOVVLJNHLWIUGLHREHULUGL
PLVVLRQVFKXW]JHVHW] 7HFKQLVFKH $QOHLWXQJ ]XP 6FKXW] JH VFKH /DJHUXQJ ZDVVHUJHIlKUGHQGHU EUHQQEDUHU XQG QLFKW
JHQ/lUP7$/lUP YRP *0%O6 EUHQQEDUHU)OVVLJNHLWHQ%HUOLQ%HXWK9HUODJ
>@ 1HXQWH 9HURUGQXQJ ]XU 'XUFKIKUXQJ GHV %XQGHV,PPLV ',1  6WHKHQGH%HKlOWHU 7DQNV DXV6WDKO
VLRQVVFKXW]JHVHW]HV 9HURUGQXQJ EHU GDV *HQHKPLJXQJV GRSHOZDQGLJPLW/HFNDQ]HLJHIOVVLJNHLWIUGLHREHULUGLVFKH
YHUIDKUHQ   %,P6FK9  LQ GHU )DVVXQJ YRP  /DJHUXQJ ZDVVHUJHIlKUGHQGHU EUHQQEDUHU XQG QLFKWEUHQQ
%*%O ,6 ]XOHW]WJHlQGHUWDP %*%O, EDUHU)OVVLJNHLWHQ%HUOLQ%HXWK9HUODJ
6 >@ &KHPLVFK3K\VLNDOLVFKH 'DWHQ YRQ 2WWR XQG 'LHVHONUDIW
>@ =ZDQ]LJVWH 9HURUGQXQJ ]XU 'XUFKIKUXQJ GHV %XQGHV VWRIIHQ '*0.)RUVFKXQJVEHULFKW  +DPEXUJ 
,PPLVVLRQVVFKXW]JHVHW]HV 9HURUGQXQJ ]XU %HJUHQ]XQJ GHU ,6%1
(PLVVLRQHQ IOFKWLJHU RUJDQLVFKHU 9HUELQGXQJHQ EHLP 8P >@ 0LWWHLOXQJGHU'*0.
IOOHQXQG/DJHUQYRQ2WWRNUDIWVWRIIHQ%,P6FK9 YRP >@ ',1(1  .UDIWVWRIIHIU.UDIWIDKU]HXJH8Q
 %*%O,6 YHUEOHLWH2WWRNUDIWVWRIIH$QIRUGHUXQJHQXQG3UIYHUIDKUHQ
>@ 9LHUWH 9HURUGQXQJ ]XU 'XUFKIKUXQJ GHV %XQGHV,PPLV $XWRPRWLYH IXHOV  XQOHDGHGSHWURO  UHTXLUHPHQWV DQGWHVW
VLRQVVFKXW]JHVHW]HV 9HURUGQXQJEHUJHQHKPLJXQJVEHGUI PHWKRGV%HUOLQ%HXWK9HUODJ
WLJH $QODJHQ   %,P6FK9  YRP  %*%O , >@ ',1(1  .UDIWVWRIIHIU.UDIWIDKU]HXJH'LH
6  ]XOHW]WJHlQGHUWDP %*%O,6 VHONUDIWVWRII$QIRUGHUXQJHQXQG3UIYHUIDKUHQ
>@ *HVHW] ]XU 2UGQXQJ GHV :DVVHUKDXVKDOWV :DVVHUKDXVKDOWV $XWRPRWLYHIXHOVGLHVHOUHTXLUHPHQWVDQGWHVWPHWKRGV
JHVHW]  :+*  YRP  %*%O , 6   EHU %HUOLQ%HXWK9HUODJ
 %*%O , 6   ]XOHW]W JHlQGHUW DP
>@ ',1     )OVVLJH %UHQQVWRIIH  +HL]|OH
 %*%O,6
7HLO  +HL]|O (/  0LQGHVWDQIRUGHUXQJHQ %HUOLQ %HXWK
0LQGHVWDQIRUGHUXQJHQDQGDV(LQOHLWHQYRQ$EZDVVHULQ*H
9HUODJ
ZlVVHU D :DVVHUKDXVKDOWVJHVHW]  (UG|OYHUDUEHLWXQJ
+LQZHLVHXQG(UOlXWHUXQJHQ]X$QKDQJGHU5DKPHQ$E >@ *URH / $UEHLWVPDSSH IU 0LQHUDO|OLQJHQLHXUH 
ZDVVHU9Z9.|OQ%XQGHVDQ]HLJHU $UEHLWVEOlWWHU  L$ GHV $UEHLWVDXVVFKXVVHV 'HVWLOOLHU XQG
$QKDQJ(UG|OYHUDUEHLWXQJ HQWVSUHFKHQG GHU%HNDQQW 5HNWLIL]LHUWHFKQLNLP9',$XVVFKXVVIU9HUIDKUHQVWHFKQLN
PDFKXQJ GHU 1HXIDVVXQJ GHU $EZDVVHUYHURUGQXQJ YRP 'VVHOGRUI9',9HUODJ$XIODJH
%*%OYRP >@ ',1 (1    0LQHUDO|OHU]HXJQLVVH  %HVWLPPXQJ
$QKDQJ:DVVHUDXIEHUHLWXQJ.KOV\VWHPH'DPSIHU]HX GHV 5HLG'DPSIGUXFNHV  1DVVHV 9HUIDKUHQ %HUOLQ %HXWK
JXQJHQWVSUHFKHQGGHQ0LQGHVWDQIRUGHUXQJHQDQGDV(LQOHL 9HUODJ
WHQYRQ$EZDVVHULQ*HZlVVHUGHU5DKPHQDEZDVVHU9HUZDO >@ ',1     ,QVWDQGKDOWXQJ  %HJULIIH XQG 0D
WXQJVYRUVFKULIW%XQGHVDQ]HLJHUYRP6HLWH QDKPHQ
>@ *HVHW]]XP6FKXW]YRUJHIlKUOLFKHQ6WRIIHQ &KHPLNDOLHQJH 3K\VLFDODVVHWVPDLQWHQDQFHGHILQLWLRQVDQGDFWLRQV%HUOLQ
VHW]  &KHP*  LQ GHU )DVVXQJ GHU %HNDQQWPDFKXQJ YRP %HXWK9HUODJ

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

>@ $670' )OXJWXUELQHQNUDIWVWRIIH 6WDWLFJDVNHWVIRUIODQJHFRQQHFWLRQV3DUW*DVNHWVPDGH


$YLDWLRQ7XUELQH)XHOV IURP VKHHWV  FKHPLFDO UHVLVWDQFH WHVW SURFHGXUHV %HUOLQ
>@ %0,'*0. *HPHLQVFKDIWVSURMHNW  ELV  %HXWK9HUODJ
0HVVHQXQG(UPLWWOXQJYRQ.RKOHQZDVVHUVWRII(PLVVLRQHQ >@ .DQVFKLN.XQG6FKPLGW7UDXE+%HVWLPPXQJGHU(PLV
EHL/DJHUXQJ8PVFKODJXQG7UDQVSRUWYRQ2WWRNUDIWVWRIIHQ VLRQHQYRQ)ODQVFKYHUELQGXQJHQLQHLQHU&KHPLHDQODJH,Q
XQG3UIHQYRQ9HUIDKUHQ]XU%HKHUUVFKXQJGLHVHU(PLVVLR 9',%HULFKWH   (XURSlLVFKH .RQIHUHQ] ]X IOVVLJHQ
QHQ XQGJDVI|UPLJHQ(PLVVLRQHQ'VVHOGRUI9',9HUODJ
7HLO=XVDPPHQIDVVHQGHU%HULFKWGHV*HVDPWSURMHNWHV 6
7HLO%HULFKWH]XGHQ7HLOREMHNWHQ >@ %DWKHQ ' & +XPPHOW - 0HLVHO XQG + 6FKPLGW7UDXE
>@ %OHLEDXP,4XDQWLWDWLYH6WUDKOXQJVPHVVXQJDQNQVWOLFKHQ (PLVVLRQHQ DQ )ODQVFKYHUELQGXQJHQ (VVHQ 9XONDQ9HUODJ
XQGQDWUOLFKHQ6WUDKOXQJVTXHOOHQ-HQD)LVFKHU 
>@ *|ULQJ : % +DQWVFKNH 5 /HVVPHLVWHU XQG . =ZHUQH >@ %DWKHQ'-0HLVHOXQG+6FKPLGW7UDXE(UIDVVHQGLIIXVHU
PDQQ )$7,3(&  -DKUEXFK  6  :HLQKHLP (PLVVLRQHQ DQ 5RKUOHLWXQJVIODQVFKHQ ,Q : 7LHW]H +UVJ
9HUODJ&KHPLH 8QWHUVXFKXQJ XQG $QZHQGXQJ YRQ 'LFKWHOHPHQWHQ (V
>@ 0DQXDORI3HWUROHXP0HDVXUHPHQW6WDQGDUGV&KDSWHU VHQ9XONDQ9HUODJ6
(YDSRUDWLRQ /RVV 0HDVXUHPHQW 6HFWLRQ   (YDSRUDWLRQ >@ '*0.)RUVFKXQJVEHULFKW(UPLWWOXQJGHU.RKOHQZDV
/RVVIURP)L[HG5RRI7DQNV$3,3XEOLFDWLRQ$PHUL VHUVWRIIHPLVVLRQHQ DXV 6FKZLPPGDFKWDQNV +DPEXUJ
FDQ3HWUROHXP,QVWLWXWH6HFRQGHGLWLRQ2FWREHU '*0.-XOL
>D@0DQXDORI3HWUROHXP0HDVXUHPHQW6WDQGDUGV&KDSWHU >@ 0DQXDO RI 3HWUROHXP 0HDVXUHPHQW 6WDQGDUG &KDSWHU 
(YDSRUDWLYH/RVV0HDVXUHPHQW6HFWLRQ(YDSRUDWLYH/RVV (YDSRUDWLYH/RVV0HDVXUHPHQW$3,3XEOLFDWLRQVDQG
)URP )ORDWLQJ5RRI 7DQNV )LUVW (GLWLRQ $PHULFDQ 3HWUR $PHULFDQ3HWUROHXP,QVWLWXWH$SULO
OHXP,QVWLWXWH $3, $SULO >@ .KQ 5 . %LUHWW 0HUNEOlWWHU JHIlKUOLFKHU $UEHLWVVWRIIH
>@ 9G7h90HUNEODWW7DQNDQODJHQ%DQG5HJLVWHU' %G  .DS (UOlXWHUXQJHQ 0QFKHQ 9HUODJ PRGHUQH LQ
9G7h90EO )DVVXQJ9HUODJ7h95KHLQODQG GXVWULH6
.|OQ >@ ',1 (1    )ODQVFKH XQG LKUH 9HUELQGXQJHQ
>@ '*0.)RUVFKXQJVEHULFKW    ,PPLVVLRQVVFKXW] 5HJHOQIUGLH$XVOHJXQJYRQ)ODQVFKYHUELQGXQJHQPLWUXQ
XQG$UEHLWVVFKXW]EHLGHU5HLQLJXQJYRQ5RK|OWDQNV PLW%H GHQ)ODQVFKHQXQG'LFKWXQJHQ
UHFKQXQJVEHLVSLHOHQ +DPEXUJ 'HXWVFKH :LVVHQVFKDIWOLFKH )ODQJHVDQGWKHLUMRLQWV'HVLJQUXOHVIRUJDVNHWHGFLUFXODU
*HVHOOVFKDIWIU(UG|O(UGJDVXQG.RKOHH99HUWULHE+DP IODQJHFRQQHFWLRQV
EXUJ .DSVWDGWULQJ  VLHKH LP ,QWHUQHW XQWHU '*0.%H >@9','LFKWH)ODQVFKYHUELQGXQJHQ $UEHLWVWLWHOLQ9RUEH
ULFKWH UHLWXQJ
>D@ 92&(PLVVLRQVPLQGHUXQJ EHL 7DQNHQWJDVXQJHQ %8:$/ >@ 9HURUGQXQJ ]XU %HVWLPPXQJ YRQ EHVRQGHUV EHUZDFKXQJV
&$5%85$  &HUFO$LU %HDUEHLWHU :H\HU 9HUIDKUHQVWHFK EHGUIWLJHQ $EIlOOHQ %HVWLPPXQJVYHURUGQXQJ EHVRQGHUV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

QLN%DVHO%HULFKWVQU:% EHUZDFKXQJVEHGUIWLJH $EIlOOH  %HVWE$EI9  YRP


>@',1   6WDWLVFKH'LFKWXQJHQIU)ODQVFKYHU  %*%O, 6   ]XOHW]W JHlQGHUW GXUFK $UWL
ELQGXQJHQ7HLO'LFKWXQJVNHQQZHUWHXQG3UIYHUIDKUHQ NHO GHU9HURUGQXQJYRP%*%O,6
6WDWLFJDVNHWVIRUIODQJHFRQQHFWLRQV3DUW&KDUDFWHULVWLF >D@ $EIDOOYHU]HLFKQLV9HURUGQXQJ $99  YRP 
YDOXHVDQGWHVWSURFHGXUHV %*%O,1U6
',1   6WDWLVFKH'LFKWXQJHQIU)ODQVFKYHU >@ *HVHW]]XU)|UGHUXQJGHU.UHLVODXIZLUWVFKDIWXQG6LFKHUXQJ
ELQGXQJHQ7HLO'LFKWXQJHQDXV'LFKWXQJVSODWWHQ6SH GHU XPZHOWYHUWUlJOLFKHQ %HVHLWLJXQJ YRQ $EIlOOHQ .UHLV
]LHOOH3UIYHUIDKUHQ]XU4XDOLWlWVVLFKHUXQJ ODXIZLUWVFKDIWV XQG $EIDOOJHVHW]  .U:$EI*  YRP
6WDWLFJDVNHWV3DUW*DVNHWVPDGHIURPVKHHWVVSHFLDO  %*%O, 6   ]XOHW]W JHlQGHUW GXUFK $UWL
WHVWSURFHGXUHVIRUTXDOLW\DVVXUDQFH%HUOLQ%HXWK9HUODJ NHO GHV*HVHW]HVYRP%*%O,6
',1   6WDWLVFKH'LFKWXQJHQIU)ODQVFKYHU >@ '*0.)RUVFKXQJVEHULFKW  =XVDPPHQVHW]XQJ YRQ
ELQGXQJHQ7HLO'LFKWXQJHQDXV'LFKWXQJVSODWWHQ3UI 2WWRNUDIWVWRIIHQ DXV GHXWVFKHQ 5DIILQHULHQ )RUWVFKUHLEXQJ
YHUIDKUHQ]XU(UPLWWOXQJGHUFKHPLVFKHQ%HVWlQGLJNHLW IU$EVFKOXVV-DKUHVKlOIWH

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Anhang Prfverfahren Annex Test methods


3UIYHUIDKUHQ]XU%HVWLPPXQJYRQ/HFNDJHUDWHQEHL 7HVW PHWKRGV IRU GHWHUPLQLQJ WKH OHDN UDWH DW SUHV
'UFNHQ7HPSHUDWXUHQXQG6SLQGHOE]Z:HOOHQEH VXUHVWHPSHUDWXUHVDQGVWHPDQGRUVKDIWPRYHPHQWV
ZHJXQJHQ GLH GLH %HWULHEVEHGLQJXQJHQ YRQ $E FRYHULQJWKHVHUYLFHFRQGLWLRQVRIVKXWRIIDQGFRQWURO
VSHUUXQG5HJHORUJDQHQDEGHFNHQ YDOYHV

A1 Allgemeine Beschreibung des Prfverfahrens A1 General description of test method


'DV YHUZHQGHWH 3UIYHUIDKUHQ VWHOOW HLQH DXI GLH 7KHWHVWPHWKRGHPSOR\HGLQYROYHVDYDULDQWRIPDVV
3UIDXIJDEHDEJHVWLPPWH9DULDQWHGHU0DVVHQVSHNW VSHFWURPHWU\ZKLFKKDVEHHQDGDSWHGWRWKHWHVWRE
URPHWULHGDU$OV3UIJDVZLUG+HOLXPXQGDOV$QD MHFWLYH7KHPHWKRGXVHVKHOLXPDVWHVWJDVDQGDKH
O\VDWRUHLQ+HOLXP/HFNGHWHNWRUYHUZHQGHW'LH%H OLXPOHDNGHWHFWRUDVDQDO\]HU7KHOHDNDJHUDWHLVGH
VWLPPXQJ GHU /HFNDJHUDWH HUIROJW GXUFK 9HUJOHLFK WHUPLQHGE\FRPSDULVRQZLWKDKHOLXPWHVWOHDNFDOL
PLWHLQHPEHL5DXPWHPSHUDWXUNDOLEULHUWHQ+HOLXP EUDWHGDWURRPWHPSHUDWXUH VHH)LJXUH$ 
7HVWOHFN VLHKH%LOG$ 

A2 Anforderungen an den Prfling A2 Requirements for the test specimen


'HU3UIOLQJPXVVLP:HVHQWOLFKHQIROJHQGH9RUDXV 7KHWHVWVSHFLPHQPXVWPHHWWKHIROORZLQJPDLQUH
VHW]XQJHQHUIOOHQ TXLUHPHQWV
'HU ]X SUIHQGHQ 6SLQGHO:HOOHQDEGLFKWXQJ 7KHVWHPVKDIWVHDOWREHWHVWHGPXVWKDYHDVHF
PXVVHLQH]XVlW]OLFKH6SLQGHO:HOOHQDEGLFKWXQJ RQGDU\GRZQVWUHDPVWHPVKDIWVHDO
QDFKJHVFKDOWHWVHLQ
'HU 5DXP ]ZLVFKHQ GHU ]X SUIHQGHQ 6SLQGHO 7KHVSDFHEHWZHHQWKHVWHPVKDIWVHDOWREHWHVWHG
:HOOHQDEGLFKWXQJ XQG GHU =XVDW]DEGLFKWXQJ DQG WKH VHFRQGDU\ VHDO PXVW EH HTXLSSHG ZLWK D
PXVVEHUHLQHQ$QVFKOXVVIUGHQ+HOLXP/HFN FRQQHFWLRQIRUWKHKHOLXPOHDNGHWHFWRU
GHWHNWRUYHUIJHQ
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

)DOOVGLHVH9RUDXVVHW]XQJHQQLFKWVFKRQGXUFKGLH :KHUHWKHVHIHDWXUHVDUHQRWSURYLGHGIRUE\WKH
.RQ]HSWLRQGHV'LFKWV\VWHPVJHJHEHQVLQG VLHKH VHDOLQJ V\VWHP GHVLJQ VHH )LJXUH $  WKH\
%LOG$ PVVHQVLHGXUFK]XVlW]OLFKH(LQRGHU KDYHWREHHVWDEOLVKHGE\LQVWDOOLQJDGGLWLRQDOLQ
$QEDXWHQJHVFKDIIHQZHUGHQ]XP%HLVSLHO$XV WHUQDOV RU DWWDFKPHQWV HJ ILWWLQJ WKH SDFNLQJ
UVWXQJ GHU 6WRSIEXFKVEULOOH PLW =XVDW]DEGLFK JODQGZLWKVHFRQGDU\FRQWDLQPHQWVHDOVDQGDWHVW
WXQJHQXQG3UIDQVFKOXVV VLHKH%LOG$  FRQQHFWLRQ VHH)LJXUH$ 
'LH ]XVlW]OLFKHQ $EGLFKWXQJHQ GUIHQ ]X NHLQHQ 7KH VHFRQGDU\ VHDOV PXVW QRW ELDV WKH PHDVXUHG
0HVVZHUWYHUIlOVFKXQJHQIKUHQ GDWD
'HU 'UXFNUDXP GHV 3UIOLQJV PXVV PLW +HOLXP 7KH SUHVVXUH FKDPEHU RI WKH WHVW VSHFLPHQ PXVW
ELV ]XP ]XOlVVLJHQ %HWULHEVEHUGUXFN EHDXI DOORZ SUHVVXUL]DWLRQ WR WKH PD[LPXP DOORZDEOH
VFKODJWXQGELV]XU]XOlVVLJHQ%HWULHEVWHPSHUDWXU ZRUNLQJSUHVVXUHZLWKKHOLXPDQGKHDWLQJRUFRRO
DXIJHKHL]W RGHU JHNKOW ZHUGHQ N|QQHQ VLHKH LQJ WR WKH DOORZDEOH RSHUDWLQJ WHPSHUDWXUH VHH
]XP%HLVSLHO %LOG $ XQG %LOG $ RGHUGHU )LJXUH$DQG)LJXUH$IRUH[DPSOH RUWKH
3UIOLQJLVWLQHLQ.lOWHEDGHLQ]XWDXFKHQ WHVWVSHFLPHQPXVWEHLPPHUVHGLQDFROGEDWK

Bild A1. Prfaufbau Fig. A1. Test rig

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

Bild A2. Doppelabdichtung mit Prfanschluss im Gehuse Fig. A2. Test rig with double seal and test connection
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Bild A3. Einfachabdichtung mit Prfanschluss in der Stopfbuchs- Fig. A3. Test rig with single seal and test connection in the gland
brille

%HL GHQ MHZHLOLJHQ 3UIEHGLQJXQJHQ PVVHQ GLH 7KH WHVW FRQGLWLRQV PXVW EH VHOHFWHG VXFK DV WR
EHWULHEOLFKHQ 6SLQGHO E]Z :HOOHQEHZHJXQJHQ HQVXUHWKDWWKHRSHUDWLRQDOVWHPVKDIWPRYHPHQWV
GXUFKJHIKUWZHUGHQN|QQHQ FDQEHFDUULHGRXW
-H QDFK %HWULHEVEHGLQJXQJHQ 6FKDOWKlXILJNHLW 'HSHQGLQJRQWKHRSHUDWLQJFRQGLWLRQV VZLWFKLQJ
LVWYRU3UIEHJLQQHLQHUHSUlVHQWDWLYH$Q]DKOYRQ IUHTXHQF\ DUHSUHVHQWDWLYHQXPEHURIVZLWFKLQJ
6FKDOWVSLHOHQGXUFK]XIKUHQ F\FOHVLVWREHFDUULHGRXWSULRUWRWHVWLQJ

Lizenzierte Kopie von elektronischem Datentrger


Alle Rechte vorbehalten Verein Deutscher Ingenieure, Dsseldorf 2002 9', 

Bild A4. Prfling mit Blinddeckel zum Anschluss einer Heizplatte Fig. A4. Test specimen with blind for connection of a hot plate
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Bild A5. Prfling in Originalausfhrung mit Anschluss fr eine Fig. A5. Test specimen in its original design, test connection in
innenliegende Heizeinrichtung (als Beispiel ein Ventil) the blank flanges (seal as shown in Figures A2 and A3)

A3 Durchfhrung der Prfung A3 Test procedure


(VN|QQHQDOOHKDQGHOVEOLFKHQ+HOLXP/HFNGHWHN $OOFRPPHUFLDOO\DYDLODEOHOHDNGHWHFWRUVOHQGWKHP
WRUHQ YHUZHQGHW ZHUGHQ 'HU 3UIDEODXI VWHOOW VLFK VHOYHVWRWKHWHVW7KHWHVWSURFHGXUHLVDVIROORZV
ZLHIROJWGDU
-XVWLHUXQJ GHV +HOLXP/HFNGHWHNWRUV PLW HLQHP DGMXVWWKHKHOLXPOHDNGHWHFWRUXVLQJDFDOLEUDWHG
NDOLEULHUWHQ +HOLXP7HVWOHFN 'LIIXVLRQV7HVW KHOLXPWHVWOHDN GLIIXVLRQWHVWOHDN
OHFN
9HUELQGXQJ GHV +HOLXP/HFNGHWHNWRUV PLW GHP FRQQHFWWKHKHOLXPOHDNGHWHFWRUWRWKHWHVWVSHFL
3UIOLQJXQG$QOHJHQGHV3UIYDNXXPV PHQDQGDSSO\DWHVWYDFXXP
%HVSUKHQ GHV 3UIOLQJV PLW +HOLXP TXDOLWDWLYH VSUD\ WKH WHVW VSHFLPHQ ZLWK KHOLXP TXDOLWDWLYH
'LFKWKHLWVSUIXQJGHV9HUVXFKVDXIEDXV OHDNWHVWRIWHVWULJ
%HIOOHQGHV3UIOLQJVPLW+HOLXP YRUKHUHYDNX ILOO WKH WHVW VSHFLPHQ ZLWK KHOLXP HYDFXDWH EH
LHUHQRGHUPHKUPDOVPLW3UIJDVVSOHQ IRUHKDQGRUSXUJHVHYHUDOWLPHVZLWKWHVWJDV
%HVWLPPXQJ GHU /HFNDJHUDWH EHL DQQlKHUQGHP GHWHUPLQH WKH OHDN UDWH DW DSSUR[LPDWHO\ DWPR
$WPRVSKlUHQGUXFNXQG5DXPWHPSHUDWXULP3UI VSKHULF SUHVVXUH DQG URRP WHPSHUDWXUH LQ WKH
OLQJ VSHFLPHQ

Lizenzierte Kopie von elektronischem Datentrger


 9', All rights reserved Verein Deutscher Ingenieure, Dsseldorf 2002

%HVWLPPXQJ GHU /HFNDJHUDWH EHL K|KHUHQ 3UI GHWHUPLQHWKHOHDNUDWHDWKLJKHUWHVWSUHVVXUHVXS


GUFNHQELVKLQ]XU1HQQEHODVWXQJ WRWKHDOORZDEOHZRUNLQJSUHVVXUH
%HVWLPPXQJ GHU /HFNDJHUDWH EHL K|KHUHQ RGHU GHWHUPLQHWKHOHDNUDWHDWKLJKHURUORZHUWHPSHU
WLHIHUHQ 7HPSHUDWXUHQ ELV KLQ ]XU ]XOlVVLJHQ DWXUHVXSWRWKHDOORZDEOHRSHUDWLQJWHPSHUDWXUH
%HWULHEVWHPSHUDWXU
%HVWLPPXQJ GHU /HFNDJHUDWH XQWHU GHQ YRUJH GHWHUPLQHWKHOHDNUDWHXQGHUWKHDERYHFRQGLWLRQV
QDQQWHQ 9RUDXVVHW]XQJHQ EHL UXKHQGHU XQG EH IRUWKHVWDWLRQDU\DQGPRYLQJVWHPVKDIW
ZHJWHU6SLQGHO:HOOH
$OV/HFNDJHUDWHLVWGHU:HUWDQ]XVHKHQGHUVLFKQDFK 7KHOHDNUDWHLVWKHFRQVWDQWPHDVXUHGYDOXHRUFRQ
PLQGHVWHQVVWQGLJHU%HDXIVFKODJXQJGHV'LFKW VWDQW PHDQ YDOXH REWDLQHG XQGHU WKH UHVSHFWLYH WHVW
V\VWHPVPLW+HOLXPXQWHUGHQMHZHLOLJHQ3UIEHGLQ FRQGLWLRQVDIWHUDWOHDVWKRXUVDSSOLFDWLRQRIKH
JXQJHQDOVNRQVWDQWHU0HVVZHUWRGHUDOVNRQVWDQWHU OLXPDWDFRQVWDQWUDQJHRIYDULDWLRQ
0LWWHOZHUW EHL JOHLFKEOHLEHQGHU 6FKZDQNXQJVEUHLWH
HUJLEW

A4 Bewertung der Prfergebnisse A4 Evaluation of test results


'LH LP 9HUJOHLFK ]X HLQHP NDOLEULHUWHQ 'LIIXVLRQV 7KHOHDNUDWHVGHWHUPLQHGE\FRPSDULVRQZLWKDFDO
7HVWOHFN HUPLWWHOWHQ /HFNDJHUDWHQ VLQG XQDEKlQJLJ LEUDWHGGLIIXVLRQWHVWOHDNDUHLQGHSHQGHQWRIWKHSUHV
YRQGHQLP3UIOLQJYRUKDQGHQHQ'UXFNXQG7HP VXUHDQGWHPSHUDWXUHFRQGLWLRQVSUHYDLOLQJLQWKHWHVW
SHUDWXUYHUKlOWQLVVHQ VSHFLPHQV
Normen-Download-Beuth-Lief.-Nr.60026 Braunschweiger Flammenfilter GmbH-KdNr.381813-LfNr.2366437001-2004-04-19 10:31

Lizenzierte Kopie von elektronischem Datentrger