You are on page 1of 362

2 Table of Contents

$FLG5HÀX[*DVWURHVRSKDJHDO5HÀX['LVHDVH  4 Atherosclerosis 93
ADD / ADHD 7 Cardiomyopathy/Enlarged Heart 99
Alopecia / Hair Loss 13 Cardiac Arrhythmia 100
Alzheimer's Disease 15 Congestive Heart Failure 101
Ankylosis Spondylitis 22 Homocysteine (high) 103
Asthma 23 +\SHUWHQVLRQ +LJK%ORRG3UHVVXUH   5
Autoimmune Diseases 29 0LWUDO9DOYH3URODSVH  7
Blood Interpretation 40 Carpal Tunnel Syndrome 108
Cholesterol 40 &HUHEUDO3DOV\  9
HDL Cholesterol 41 Chronic Fatigue Syndrome 111
LDL Cholesterol 42 Common Cold 113
Lipoprotein a (Lp(a)) 42 Depression 115
$SROLSRSURWHLQ$O $SR$   2 Manic Depression / Bipolar Disorder 118
Apolipoprotein B (Apo B) 43 'HWR[L¿FDWLRQ  0
Triglycerides 43 'LHWDU\3URJUDPV 9
Fibrinogen: 44 $QWL,QÀDPPDWRU\'LHW  9
&5HDFWLYH3URWHLQ  5 &DQGLGD$OELFDQV'LHWDU\*XLGH  0
Homocysteine 45 FirstLine Therapy® Diet 131
)DVWLQJ*OXFRVH  6 0RGL¿HG(OLPLQDWLRQ'LHW  7
Fasting Serum Insulin 47 (DU'\VIXQFWLRQ  8
Sodium 48 (DU,QIHFWLRQ 2WLWLV0HGLD   8
3RWDVVLXP  9 Meniere's Syndrome / Tinnitus 140
Chloride 50 Enuresis (%HG:HWWLQJ   1
&DUERQ'LR[LGH &2   1 Eye Conditions 142
BUN (Blood Urea Nitrogen) 51 Cataracts 142
Creatinine 52 Conjunctivitis 144
BUN/Creatinine Ratio 52 *ODXFRPD  5
Uric Acid 53 Iritis / .HUDWLWLV  7
Calcium 54 Macular Degeneration 148
3KRVSKRUXV  5 Sty 149
$ONDOLQH3KRVSKDWDVH  6 Visual Disturbances 150
7RWDO3URWHLQ  7 Facet Syndrome 151
Albumin 58 Female Conditions 153
*OREXOLQ  9 Amenorrhea 153
$OEXPLQ*OREXOLQ5DWLR $*5DWLR   0 Cervical Dysplasia 154
Calcium/Albumin Ratio: (Ca/A ratio) 60 '\VPHQRUUKHD([FHVVLYH0HQVWUXDO&UDPSV  5
**7 *DPPDJOXWDP\OWUDQVIHUDVH   0 Endometriosis 156
6*27 DOVRNQRZQDV$67   1 Fibrocystic Breast Syndrome 158
6*37 DOVRNQRZQDV$/7   2 Menopause — Hormone Dysregulation 159
LDH 62 0HQRUUKDJLD([FHVVLYH0HQVWUXDO%ORRG)ORZ  3
Total Bilirubin 63 2YDULDQ&\VW  4
&3.  4 306 3UHPHQVWUXDO6\QGURPH   6
Serum Iron (Fe) 64 3RO\F\VWLF2YDULDQ6\QGURPH  7
7K\URLG3UR¿OH  5 3UHJQDQF\  9
7 WHWUDLRGRWK\URQLQH   5 Morning Sickness/Nausea 172
7 DOVRNQRZQDV)7,>IUHHWK\URLGLQGH[@   5 Uterine Fibroids 174
Blood Sugar Dysregulation / Metabolic Syndrome 67 Vaginitis / Leukorrhea 176
Body Composition 72 )HUWLOLW\6H[XDO'\VIXQFWLRQ0DOHDQG)HPDOH  8
Bursitis 74 Fibromyalgia 181
Cancer 75 Fingernails 185
Candida Albicans 83 Fracture 189
Cardiovascular Disease 88 Frozen Shoulder 191
$QJLQD3HFWRULV  2 *ORVVLWLVDQG7RQJXH5HODWHG&RQGLWLRQV  2
Table of Contents 3

*RXW  5 Sciatica 331


Headache 197 6LQXVLWLV+D\IHYHU$OOHUJLF5KLQLWLV  2
Headache: Nonvascular 197 Skin Conditions 334
Headache: Vascular / Migraine 198 Acne Vulgaris 334
Hepatitis 200 'LIIXVH'HSLJPHQWDWLRQ  6
Herpes 202 Dry, Scaling 336
+HUSHV6LPSOH[  2 Eczema 337
Herpes Zoster (Shingles) 203 Erythema 340
,QÀDPPDWRU\%RZHO'LVHDVH ,%'   4 )ODN\3DLQW'HUPDWRVLV  0
,QÀXHQ]D  7 Follicular Hyperkeratosis 341
Insomnia 210 Hyperpigmentation 341
Intervertebral Disc Disease 209 Impetigo 342
.LGQH\6WRQHV  2 3VRULDVLV  3
/LYHU*DOOEODGGHU  6 Scleroderma 345
/RZ%DFN3DLQ  9 6PDOO,QWHVWLQH3DQFUHDV  8
Lupus (Erythematosus) 221 Sprain/Strain 349
Mouth / Lip Conditions 213 Stress 350
Angular Stomatitis 213 Tendinitis 354
Canker Sores — Aphthous Stomatitis 214 Thyroid Conditions 355
Cheilosis 215 Hypothyroidism 355
Multiple Sclerosis 225 Hyperthyroidism 356
0\R¿EURVLWLV  9 Thyroiditis 357
Neurological Conditions 230 8OFHUV GXRGHQDODQGJDVWULF +3\ORUL 359
Foundation Neuroprotection 230 8ULQDU\7UDFW,QIHFWLRQ 87, %ODGGHU,QIHFWLRQ &\VWLWLV  360
)RUJHWIXOQHVV&RJQLWLYH)XQFWLRQ'HFOLQH 2
'LVWUDFWHG0LQG$WWHQWLRQ'H¿FLW%HKDYLRU 3
1HUYRXVQHVV$Q[LHW\  4
2FFDVLRQDO6OHHSOHVVQHVV6OHHS'LVRUGHUV  5
Negative Mood / Depression 236
Neurobehavioral Symptom Checklist 237
2VWHRDUWKULWLV  0
2VWHRSRURVLV  0
3DLQ,QÀDPPDWLRQ0DQDJHPHQW  2
3DUDWK\URLG&RQGLWLRQV 253
Hypoparathyroidism 253
Hyperparathyroidism 254
3DUNLQVRQ
V'LVHDVH  6
3HULRGRQWDO'LVHDVH  1
3RO\P\DOJLD5KHXPDWLFD  2
3URVWDWLWLV 3URVWDWLF+\SHUWURSK\%HQLJQ   4
Questionnaires / Assessment Tools 265
'HWR[L¿FDWLRQ4XHVWLRQQDLUH  6
)LUVW/LQH7KHUDS\Š+HDOWK3UR¿OH 8
Hypoglycemia Questionnaire 269
Insulin Resistance Questionnaire 270
Neurobehavioral Symptom Checklist 272
'$66'HSUHVVLRQ$Q[LHW\6WUHVV4XHVWLRQQDLUH  5
Health Appraisal Questionnaire 278
+HDOWK$SSUDLVDO4XHVWLRQQDLUH.H\  9
Yeast Questionnaire — Adult 318
Yeast Questionnaire — Children 319
Restless Legs Syndrome and Leg Cramps 320
Rheumatoid Arthritis 322
4 Acid Reflux - Gastroesophageal Reflux Disease

Acid Reflux - Gastroesophageal Reflux Disease


Also listed as: Heartburn, Reflux esophagitis, GERD
*DVWURHVRSKDJHDO UHÀX[ GLVHDVH *(5'  LV D GLVRUGHU LQ ZKLFK FRQWHQWV RI WKH VWRPDFK RU VPDOO LQWHVWLQH
repeatedly move back up into the esophagus (tube connecting the throat to the stomach). This regurgitating
DFWLRQLVFDOOHGUHÀX[5HÀX[FDXVHVKHDUWEXUQDQGDOWKRXJKPRVWSHRSOHKDYHDQDWWDFNRIKHDUWEXUQDWVRPH
SRLQWLQWKHLUOLYHVSHUVLVWHQWUHÀX[DQGVHYHUHKHDUWEXUQPD\LQGLFDWH*(5'
1RUPDOO\ZKHQDSHUVRQVZDOORZVWKHPXVFXODUZDOOVRIWKHHVRSKDJXVPRYHLQZDYHVWRSXVKWKHIRRGGRZQ
LQWRWKHVWRPDFK5LJKWDIWHUWKHIRRGHQWHUVWKHVWRPDFKDEDQGRIPXVFOH WKHORZHUHVRSKDJHDOVSKLQFWHU 
FORVHVRIIWKHHVRSKDJXV,IWKHPXVFOHIDLOVWRFORVHWLJKWO\HQRXJKWKHVWRPDFKFRQWHQWVFDQEDFNXSLQWRWKH
HVRSKDJXVFDXVLQJKHDUWEXUQDQGRWKHUV\PSWRPVRI*(5'
6XEVWDQFHVLQWKHGLJHVWLYHMXLFHVIURPWKHVWRPDFK QDPHO\DFLGSHSVLQDQGELOH FDQGDPDJHWKH
LQQHUOLQLQJRIWKHHVRSKDJXVFDXVLQJLQÀDPPDWLRQXOFHUV RSHQVRUHV DQGSRVVLEO\SUHFDQFHURXV
changes to cells (called Barrett’s esophagus).

Signs and Symptoms


+HDUWEXUQ±DEXUQLQJVHQVDWLRQXQGHUWKHVWHUQXPLQWKHFKHVWLVWKHSULPDU\V\PSWRPRI*(5'+HDUWEXUQ
RIWHQRFFXUVDIWHUDPHDODQGZRUVHQVDWQLJKWZKHQ\RXDUHO\LQJÀDW,WLVPRUHOLNHO\WRRFFXUIROORZLQJDKHDY\
PHDORULI\RXEHQGOLIWRUOLHGRZQMXVWDIWHUHDWLQJ

Other symptoms of GERD include:


• 5HJXUJLWDWLRQRIIRRG
• Belching
• Nausea and vomiting
• &KURQLFFRXJKZKHH]LQJ
• 6RUHWKURDWKRDUVHQHVVRUFKDQJHLQYRLFHGLI¿FXOW\VZDOORZLQJ
• Chest pain
*(5'LVFRPPRQLQLQIDQWVDQG\RXQJFKLOGUHQEXWLVJHQHUDOO\PLOG,IDQLQIDQWKDVWKHIROORZLQJV\PSWRPV
KRZHYHUFDOODSK\VLFLDQDVVRRQDVSRVVLEOH
• 2QJRLQJFRXJKLQJ
• :KHH]LQJJDVSLQJ
• Severe vomiting
• Frequent burping

Causes
*(5'FDQRIWHQEHWUDFHGWRWKHPDOIXQFWLRQLQJRIWKHORZHUHVRSKDJHDOVSKLQFWHU /(6 7KH/(6LVDPXVFOH
UHVSRQVLEOH IRU RSHQLQJ DQG FORVLQJ WKH ORZHU HQG RI WKH HVRSKDJXV ZKLFK LW DFFRPSOLVKHV E\ UHOD[LQJ DQG
FRQWUDFWLQJDWDSSURSULDWHWLPHV7KH/(6PD\ZHDNHQRUORVHWRQHDOORZLQJWKHFRQWHQWVRIWKHVWRPDFKWR
HVFDSHEDFNXSWKHHVRSKDJXV$Q\RIWKHIROORZLQJPD\FRPSURPLVHWKH/(6
• 3UHJQDQF\
• 2EHVLW\
• +LDWDOKHUQLD DFRQGLWLRQLQZKLFKDSRUWLRQRIWKHVWRPDFKSURWUXGHVWKURXJKDQRSHQLQJLQWKHGLDSKUDJP
ZKHUHWKHHVRSKDJXVQRUPDOO\¿WVVQXJJO\DQGSDVVHVLQWRWKHVWRPDFK 
• Recurrent or persistent vomiting
• 1DVRJDVWULF WXEHV WKHVH DUH LQVHUWHG WKURXJK WKH QRVH DQG LQWR WKH VWRPDFK IRU D YDULHW\ RI PHGLFDO
reasons)
• Smoking cigarettes
• 6RPHPHGLFDWLRQVLQFOXGLQJFDOFLXPFKDQQHOEORFNHUV DFODVVRIPHGVXVHGIRUKLJKEORRGSUHVVXUHVXFK
DVDPORGLSLQHGLOWLD]HPIHORGLSLQHQLIHGLSLQHQLVROGLSLQHDQGYHUDSDPLO DQWLFKROLQHUJLFGUXJV LQFOXGLQJ
EHQ]WURSLQHELSHULGHQGLF\FORPLQHK\RVF\DPLQHLVRSURSDPLGHDQGVFRSRODPLQH LURQSLOOVQRQVWHURLGDO
DQWLLQÀDPPDWRU\ GUXJV 16$,'V LQFOXGLQJ DVSLULQ DQG LEXSURIHQ  SRWDVVLXP GRSDPLQH IRU 3DUNLQVRQ
V
GLVHDVH  VHGDWLYHV ELVSKRVSKRQDWHV DOHQGURQDWH DQG ULVHGURQDWH IRU RVWHRSRURVLV  DQG EHWD EORFNHUV
VXFKDVDWHQROROODEHWDOROPHWRSUROROQDGROROSLQGRORODQGSURSUDQROROIRUKLJKEORRGSUHVVXUHRUKHDUW
disease.)
Acid Reflux - Gastroesophageal Reflux Disease 5

Risk Factors
• Heavy meals
• /\LQJGRZQRUEHQGLQJDIWHUDPHDO
• (DWLQJLPPHGLDWHO\SULRUWRH[HUFLVH
• 3ULRUHVRSKDJHDOVXUJHU\
• (VRSKDJHDOVWULFWXUH QDUURZLQJRIWKHHVRSKDJXV 
• Cigarette smoking
• Alcohol intake
• 3V\FKRORJLFDOVWUHVV

Children with the following conditions are at particular risk for GERD:
• Neurologic impairment
• Food allergies
• Scoliosis
• Frequent vomiting
• &\VWLF¿EURVLV
• Digestive disorders

Diagnosis
*(5'LVJHQHUDOO\QRWGLI¿FXOWWRGLDJQRVH<RXUV\PSWRPVZKDW\RXHDWDQGGULQNPHGLFDWLRQV\RXDUHWDNLQJ
DQG\RXUOLIHVW\OHDUHXVXDOO\HQRXJKWRPDNHDFOHDUGLDJQRVLV,IWKHGLDJQRVLVLVXQFOHDUWR\RXUGRFWRURQHRU
PRUHWHVWVPD\EHSHUIRUPHG
• 8SSHU HQGRVFRS\ FDOOHGHVRSKDJHDOJDVWURGXRGHQRVFRS\ (*'  ZKLFK LQYROYHV WKH LQVHUWLRQ RI D WXEH
GRZQ\RXUWKURDWLQWRWKHHVRSKDJXVWRORRNIRUVLJQVRIUHÀX[LQÀDPPDWLRQXOFHUVRURWKHUFKDQJHVLQWKH
esophagus.
• $ EDULXP VZDOORZ ZKLFK LQYROYHV YLVXDOL]DWLRQ RI WKH HVRSKDJXV WKURXJK D VHULHV RI [UD\V IROORZLQJ WKH
VZDOORZLQJRIDVXEVWDQFHFDOOHGEDULXP7KLVORRNVDWWKHPRYHPHQWRIWKHHVRSKDJXVDQGZKHWKHUDQ\
ÀXLGFRPHVEDFNIURPWKHVWRPDFKLQWRWKHHVRSKDJXV
• 0DQRPHWU\PHDVXUHVWKHSUHVVXUHRIWKHVSKLQFWHUPXVFOHLIORZWKLVLVFRQVLVWHQWZLWK*(5'

Lifestyle
0DNLQJFKDQJHVWRRUDYRLGLQJFHUWDLQKDELWVFDQJRDORQJZD\WRUHOLHYLQJRUSUHYHQWLQJ\RXUV\PSWRPVRI
*(5'
7KHIROORZLQJDUHW\SLFDOVXJJHVWLRQVIRUSHRSOHZLWK*(5'
• $YRLGEHKDYLRUWKDWGRHVQRWDOORZIRRGWRHDVLO\PRYHGRZQLQWRDQGWKURXJKWKHVWRPDFK7KLVLQFOXGHV
EHQGLQJO\LQJGRZQRUSDUWLFLSDWLQJLQMDUULQJH[HUFLVHVVRRQDIWHUDPHDO
• Don't eat heavy meals
• $YRLG DFLGLF IRRGV DQG GULQNV 7KHVH LQFOXGH FDIIHLQDWHG EHYHUDJHV GHFDIIHLQDWHG FRIIHH DQG RUDQJH
juice
• $YRLGDOFRKROFKRFRODWHVSHDUPLQWDQGSHSSHUPLQW7KHVHFDQUHOD[WKHORZHVRSKDJHDOVSKLQFWHU
• Avoid carbonated beverages
• $YRLGHDWLQJIDWW\IRRGVLQFOXGLQJIXOOIDWPLONZKLFKDOVRPD\UHOD[WKHORZHUHVRSKDJHDOVSKLQFWHUWRQH
• /RVHZHLJKWLI\RXDUHRYHUZHLJKW
• Quit smoking
• $YRLGPHGLFDWLRQVWKDWSURYRNHV\PSWRPV7KHVHLQFOXGHVPRRWKPXVFOHUHOD[DQWVVXFKDVFDOFLXPFKDQQHO
EORFNHUV LQFOXGLQJDPORGLSLQHGLOWLD]HPIHORGLSLQHQLIHGLSLQHQLVROGLSLQHDQGYHUDSDPLOZKLFKDUHXVHG
IRUKLJKEORRGSUHVVXUH DQWLFKROLQHUJLFGUXJV LQFOXGLQJEHQ]WURSLQHELSHULGHQGLF\FORPLQHK\RVF\DPLQH
LVRSURSDPLGHDQGVFRSRODPLQH LURQSLOOVQRQVWHURLGDODQWLLQÀDPPDWRU\GUXJV 16$,'VLQFOXGLQJDVSLULQ
DQGLEXSURIHQ SRWDVVLXPGRSDPLQH IRU3DUNLQVRQ
VGLVHDVH VHGDWLYHVELVSKRVSKRQDWHV DOHQGURQDWH
DQGULVHGURQDWHIRURVWHRSRURVLV DQGEHWDEORFNHUV VXFKDVDWHQROROODEHWDOROPHWRSUROROQDGROROSLQGRORO
DQGSURSUDQROROIRUKLJKEORRGSUHVVXUHRUKHDUWGLVHDVH 
,I\RXH[SHULHQFHPRUHIUHTXHQWV\PSWRPVDWQLJKW\RXPD\EHUHOLHYHGE\
• 5DLVLQJWKHKHDGRI\RXUEHGDERXWVL[LQFKHV
• Avoiding bedtime snacks
• 6WUHVV PD\ ZRUVHQ V\PSWRPV 7KHUHIRUH UHOD[DWLRQ VXFK DV \RJD WDL FKL DQG PHGLWDWLRQ DUH ZRUWK
FRQVLGHULQJDVSDUWRI\RXUZKROHFRPSUHKHQVLYHWUHDWPHQWSODQ
6 Acid Reflux - Gastroesophageal Reflux Disease

Medications
7KH PDLQ DLP RI GUXJ WUHDWPHQW LV WR FRQWURO WKH DFLGLW\ RI WKH VWRPDFK7KHUH DUH VHYHUDO GLIIHUHQW W\SHV RI
PHGLFDWLRQVXVHGIRU*(5'DQGHDFKZRUNVLQDGLIIHUHQWZD\2YHUWKHFRXQWHUDQWDFLGVQHXWUDOL]HWKHVWRPDFK
DFLGVKLVWDPLQH+EORFNHUVLQWHUIHUHZLWKWKHSURGXFWLRQRIDFLGDQGSURWRQSXPSLQKLELWRUVVXSSUHVVPROHFXOHV
LQWKHJODQGVUHVSRQVLEOHIRUWKHUHOHDVHRIDFLG

Drawbacks of drug therapy for GERD


$QWLUHÀX[GUXJVDUHOLNHDGRXEOHHGJHGVZRUG7KH\PD\EHYHU\HIIHFWLYHLQVXSSUHVVLQJJDVWULFDFLGVHFUHWLRQ
EXWVWURQJLQKLELWLRQRIJDVWULFDFLG +&, VHFUHWLRQFDQDWWKHVDPHWLPHFDXVHDQDUUD\RIGLJHVWLYHSUREOHPV
7KLV LV EHFDXVH SHRSOH ZKR DUH WDNLQJ WKHVH DJHQWV GR QRW VHFUHWH DGHTXDWH JDVWULF DFLG DQG HQ]\PHV IRU
GLJHVWLQJIRRGWKDWLVSUHVHQWLQWKHVWRPDFK7KLVLQWXUQFDXVHVLQGLJHVWLRQEORDWLQJÀDWXOHQFHFRQVWLSDWLRQ
HVRSKDJHDOFDQGLGLDVLVSOXVSRVVLEOHVLGHHIIHFWVDIIHFWLQJRWKHURUJDQV7KHVHVLGHHIIHFWVDUHPRUHVHYHUHZKHQ
DKLJKSURWHLQGLHW KLJKFRQWHQWRIPHDWFKHHVHGDLU\SURGXFWV EHDQV LVFRQVXPHGVLQFHSURWHLQGLJHVWLRQ
LVLQLWLDWHGLQWKHVWRPDFKDQGLVHVVHQWLDOO\WKHRQO\W\SHRIHQ]\PDWLFGLJHVWLRQWKDWRFFXUVWKHUH

Suggested Nutritional Supplementation


• Zinlori 75 ²WDEOHWVWZLFHGDLO\WKHQWDEOHWWZLFHGDLO\IRUPDLQWHQDQFH
=LQORULFRQWDLQVDKLJKSRWHQF\SDWHQWHG‚]LQFFDUQRVLQHFRPSOH[IRUPXODWHGWRSURYLGHUHOLHIRIJDVWULF
GLVFRPIRUWV=LQFFDUQRVLQHVXSSRUWVWKHKHDOWK\HFRORJ\QDWXUDOGHIHQVHVDQGLQWHJULW\RIWKHJDVWULF
mucosal lining.
• Ulcinex — WDEOHWVPLQEHIRUHPHDOV)RUIDVWUHOLHI²WDEOHWVDVQHHGHG
6WDQGDUGL]HGKHUEDOVXSSRUWIRUKHDOWK\VWRPDFKIXQFWLRQ
• Anti-Flux ²WDEOHWVDIWHUPHDOV(DFKWDEOHWVKRXOGEHFKHZHGEULHÀ\DQGVZDOORZHGZLWKDVLSRIZDWHU
$QLW)OX[XQOLNHGUXJVDFWVORFDOO\E\FRDWLQJWKHXSSHUJDVWULFDQGHVRSKDJHDOPXFRVDOVXUIDFH
%HFDXVHLWGRHVQRWQHXWUDOL]HJDVWULFDFLGDSSUHFLDEO\RUVXSSUHVVHVLWVSURGXFWLRQLWZLOOQRWLQWHUIHUH
ZLWKLPSRUWDQWGLJHVWLYHDQWLPLFURELDODQGPHWDEROLFIXQFWLRQVRIJDVWULFDFLG
• D-139 Gerd Ex ²GURSVXQGHUWKHWRQJXHWLPHVGDLO\,QFDVHVRIDFXWHV\PSWRPVDGPLQLVWHU
GURSVHYHU\PLQXWHVXQWLOV\PSWRPVVXEVLGHRUUHOLHILVDFKLHYHG'URSVVKRXOGEHKHOGXQGHUWRQJXH
IRUDSSUR[LPDWHO\VHFRQGVEHIRUHWKH\DUHVZDOORZHG7KLVZLOOHQVXUHVRPHVXEOLQJXDODEVRUSWLRQ
ZKLFKZLOOHQKDQFHWKHWKHUDSHXWLFDFWLYLW\RIWKHDFWLYHLQJUHGLHQWV

Dietary Suggestions
• FirstLine Therapy® Diet
ADD / ADHD 7

ADD / ADHD
Attention deficit/hyperactivity disorder
$WWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU $'+' LVWKHPRVWFRPPRQO\GLDJQRVHGEHKDYLRUDOGLVRUGHURIFKLOGKRRG
HVWLPDWHGWRDIIHFWEHWZHHQDQGRIVFKRRODJHGFKLOGUHQ7KHFRUHV\PSWRPVRI$'+'LQFOXGHLQDWWHQWLRQ
K\SHUDFWLYLW\DQGLPSXOVLYLW\$OWKRXJKPDQ\SHRSOHRFFDVLRQDOO\KDYHGLI¿FXOW\VLWWLQJVWLOOSD\LQJDWWHQWLRQRU
FRQWUROOLQJLPSXOVLYHEHKDYLRUWKHVHEHKDYLRUVDUHVRSHUVLVWHQWLQSHRSOHZLWK$'+'WKDWWKH\LQWHUIHUHZLWKGDLO\
OLIH*HQHUDOO\WKHVHV\PSWRPVDSSHDUEHIRUHWKHDJHRI\HDUVDQGFDXVHVLJQL¿FDQWIXQFWLRQDOSUREOHPVDW
KRPHLQVFKRRODQGLQYDULRXVVRFLDOVHWWLQJV2QHWRWZRWKLUGVRIDOOFKLOGUHQZLWK$'+' VRPHZKHUHEHWZHHQ
DQGRIWKHJHQHUDOSRSXODWLRQ FRQWLQXHWRH[KLELW$'+'V\PSWRPVLQWRDGXOWOLIH'LDJQRVLVLVGLI¿FXOW
XVXDOO\UHTXLULQJPRUHWKDQRQHYLVLW EXWHVVHQWLDODVHDUO\WUHDWPHQWFDQVXEVWDQWLDOO\DOWHUWKHFRXUVHRID
child’s educational and social development.

Signs and Symptoms


$ SHUVRQ LV FRQVLGHUHG WR KDYH$'+' LI KH RUVKHGHPRQVWUDWHV V\PSWRPVRILQDWWHQWLRQ K\SHUDFWLYLW\DQG
LPSXOVLYLW\IRUDWOHDVWPRQWKVLQDWOHDVWWZRVHWWLQJV VXFKDVDWKRPHDQGLQVFKRRO 7KHVLJQVDQGV\PSWRPV
OLVWHGEHORZDUHW\SLFDOO\VHHQLQFKLOGUHQZLWK$'+'DQGXVXDOO\DSSHDUEHIRUHDJHVHYHQ ,QRUGHUWRGLDJQRVH
$'+'LQDGXOWVSV\FKLDWULVWVPXVWGHWHUPLQHKRZWKHDGXOWSDWLHQWEHKDYHGDVDFKLOG

Symptoms of Inattention
• Fails to pay close attention to details or makes careless mistakes
• +DVGLI¿FXOW\VXVWDLQLQJDWWHQWLRQLQWDVNVRUSOD\DFWLYLWLHV
• 'RHVQRWVHHPWROLVWHQZKHQVSRNHQWRGLUHFWO\
• 'RHVQRWIROORZWKURXJKRQLQVWUXFWLRQVDQGIDLOVWR¿QLVKVFKRROZRUNFKRUHVRUGXWLHVLQWKHZRUNSODFH
• +DVGLI¿FXOW\RUJDQL]LQJWDVNVDQGDFWLYLWLHV
• $YRLGVGLVOLNHVRULVUHOXFWDQWWRHQJDJHLQWDVNVWKDWUHTXLUHVXVWDLQHGPHQWDOHIIRUW
• /RVHVWKLQJVQHFHVVDU\IRUWDVNVRUDFWLYLWLHV
• ,VHDVLO\GLVWUDFWHGE\H[WUDQHRXVVWLPXOL
• ,VIRUJHWIXOLQGDLO\DFWLYLWLHV

Symptoms of Hyperactivity and Impulsivity


• )LGJHWVZLWKKDQGVRUIHHWRUVTXLUPVLQVHDW
• /HDYHVVHDWLQVLWXDWLRQVZKHUHUHPDLQLQJVHDWHGLVH[SHFWHG
• 5XQVRUFOLPEVH[FHVVLYHO\LQLQDSSURSULDWHVLWXDWLRQV LQDGROHVFHQWVRUDGXOWVPD\EHOLPLWHGWRVXEMHFWLYH
IHHOLQJVRIUHVWOHVVQHVV 
• +DVGLI¿FXOW\SOD\LQJRUHQJDJLQJLQOHLVXUHDFWLYLWLHVTXLHWO\
• $FWVDVLIGULYHQE\DPRWRU
• 7DONVH[FHVVLYHO\
• %OXUWVRXWDQVZHUVEHIRUHTXHVWLRQVDUHFRPSOHWHG
• +DVGLI¿FXOW\DZDLWLQJWXUQ
• Interrupts or intrudes on others

Causes
/LNHPRVWFRPSOH[QHXUREHKDYLRUDOGLVRUGHUVWKHFDXVHRI$'+'LVXQNQRZQ*HQHWLFIDFWRUVDVZHOODVWKRVH
DIIHFWLQJEUDLQGHYHORSPHQWGXULQJSUHQDWDODQGSRVWQDWDOOLIHDUHOLNHO\LQYROYHG%UDLQVFDQVKDYHUHYHDOHGD
QXPEHURIGLIIHUHQFHVLQWKHEUDLQVRI$'+'FKLOGUHQFRPSDUHGWRWKRVHRIQRQ$'+'FKLOGUHQ)RUH[DPSOHPDQ\
FKLOGUHQZLWK$'+'WHQGWRKDYHDOWHUHGEUDLQDFWLYLW\LQWKHSUHIURQWDOFRUWH[DUHJLRQWKRXJKWWREHWKHEUDLQ¶V
command center. Irregularities in this area may impair an individual’s ability to control impulsive and hyperactive
EHKDYLRUV5HVHDUFKHUVDOVREHOLHYHWKDWK\SHUDFWLYHEHKDYLRULQFKLOGUHQUHVXOWVIURPH[FHVVLYHVORZZDYH RU
WKHWD DFWLYLW\LQFHUWDLQUHJLRQVRIWKHEUDLQ2WKHUVWXGLHVLQGLFDWHWKDW$'+'PD\EHFDXVHGE\DEQRUPDOO\ORZ
OHYHOVRIGRSDPLQHDQHXURWUDQVPLWWHULQYROYHGZLWKPHQWDODQGHPRWLRQDOIXQFWLRQLQJ
8 ADD / ADHD

Risk Factors
• +HUHGLW\FKLOGUHQZLWK$'+'XVXDOO\KDYHDWOHDVWRQH¿UVWGHJUHHUHODWLYHZKRDOVRKDV$'+'DQGRQHWKLUG
RIDOOIDWKHUVZKRKDG$'+'LQWKHLU\RXWKKDYHFKLOGUHQZLWK$'+'
• *HQGHU$'+'LVIRXUWRQLQHWLPHVPRUHFRPPRQLQER\VWKDQLQJLUOV VRPHH[SHUWVEHOLHYHWKDWWKHGLVRUGHU
LVXQGHUGLDJQRVHGLQJLUOVKRZHYHU 
• 3UHQDWDODQGHDUO\SRVWQDWDOKHDOWKPDWHUQDOGUXJDOFRKRODQGFLJDUHWWHXVHH[SRVXUHRIWKHIHWXVWRWR[LQV
LQFOXGLQJOHDGDQGSRO\FKORULQDWHGELSKHQ\OV 3&%V QXWULWLRQDOGH¿FLHQFLHVDQGLPEDODQFHV
• Learning disabilities, communication disorders, and tic disorders such as Tourette's syndrome
• 2WKHUEHKDYLRUDOGLVRUGHUVSDUWLFXODUO\WKRVHWKDWLQYROYHH[FHVVLYHDJJUHVVLRQ VXFKDVRSSRVLWLRQDOGH¿DQW
or conduct disorder)
• 1XWULWLRQDOIDFWRUVDOOHUJLHVRULQWROHUDQFHVWRIRRGIRRGFRORULQJRUDGGLWLYHV

Diagnosis
7KHQDPHVDQGV\PSWRPVIRU$'+'KDYHFKDQJHGIUHTXHQWO\VLQFHWKHWXUQRIWKHFHQWXU\:KDWLVQRZUHIHUUHG
WRDV$'+'KDVEHHQGHVFULEHGLQWKHSDVWDV0LQLPDO%UDLQ'\VIXQFWLRQ+\SHUNLQHWLF5HDFWLRQRI&KLOGKRRG
DQG$WWHQWLRQ'H¿FLW'LVRUGHU $'' :LWKRU:LWKRXW+\SHUDFWLYLW\7KHQDPH$'+'ZDVDGRSWHGLQE\WKH
WKLUGUHYLVLRQRIWKH'LDJQRVWLFDQG6WDWLVWLFDO0DQXDORI0HQWDO'LVRUGHUV '60,,,5 
'LDJQRVLVLVODUJHO\GHSHQGHQWRQVSHFL¿FREVHUYHGEHKDYLRUV7KH¿UVWVWHSLQHVWDEOLVKLQJWKHGLDJQRVLVRI
$'+'LVWRGHWHUPLQHZKHWKHUWKHLQGLYLGXDOPHHWVWKHGLDJQRVWLFFULWHULDDVGH¿QHGLQWKH'60,97KH'60
,9¶VV\PSWRPDWLFFULWHULDZHUHGHYHORSHGIRUFKLOGUHQWKHUHDUHQRVSHFL¿FFULWHULDIRU$'+'LQDGXOWV,QWKHVH
FDVHVSK\VLFLDQVZLOORIWHQGHWHUPLQHWKHSV\FKLDWULFVWDWXVRIWKHDGXOWSDWLHQWDVDFKLOGDQGPDNHDUHWURDFWLYH
GLDJQRVLVRIFKLOGKRRG$'+'6LQFHPRVWRIWKHFKDUDFWHULVWLFEHKDYLRUVRIFKLOGKRRG
$'+'RFFXUDWKRPHDQGLQWKHVFKRROVHWWLQJSDUHQWVDQGWHDFKHUVSOD\DQLPSRUWDQWUROHLQSURYLGLQJLQIRUPDWLRQ
to establish the diagnosis.

DSM-IV Diagnostic Criteria:


• Either (1) or (2)
1. 6L[ RU PRUH  V\PSWRPV RI LQDWWHQWLRQ WKDW SHUVLVW IRU DW OHDVW  PRQWKV WR D PDODGDSWLYH GHJUHH
LQFRQVLVWHQWZLWKWKHFKLOG
VGHYHORSPHQWDOOHYHO
2. 6L[ RUPRUH V\PSWRPVRIK\SHUDFWLYLW\LPSXOVLYLW\WKDWSHUVLVWIRUDWOHDVWPRQWKVWRDPDODGDSWLYH
GHJUHHLQFRQVLVWHQWZLWKWKHFKLOG
VGHYHORSPHQWDOOHYHO
• 6RPHLQDWWHQWLYHRUK\SHUDFWLYHLPSXOVLYHV\PSWRPVWKDWFDXVHGLPSDLUPHQWZHUHSUHVHQWEHIRUHWKHDJH
RI\HDUV
• 6RPHLPSDLUPHQWIURPV\PSWRPVSUHVHQWLQWZRRUPRUHVHWWLQJV VXFKDVDWVFKRROZRUNDQGKRPH 
• &OHDUHYLGHQFHRIVLJQL¿FDQWLPSDLUPHQWLQIXQFWLRQLQJ
• 6\PSWRPVQRWVHFRQGDU\WRDQRWKHUSV\FKRORJLFDOGLVRUGHU VXFKDVPRRGGLVRUGHUDQ[LHW\GLVRUGHU
$OWKRXJKPRVWFKLOGUHQZLWK$'+'KDYHV\PSWRPVRIERWKLQDWWHQWLRQDQGK\SHUDFWLYLW\LPSXOVLYLW\VRPHWHQG
WRGHPRQVWUDWHV\PSWRPVIURPRQHFOXVWHURUWKHRWKHU7KHVHVSHFL¿FVXEW\SHVRI$'+'DUHEDVHGRQWKH
SUHGRPLQDQWV\PSWRPSDWWHUQH[KLELWHGIRUWKHSDVWPRQWKV
• $'+'&RPELQHG7\SHLIERWK$DQG$FULWHULDDUHPHW
• $'+'3UHGRPLQDQWO\,QDWWHQWLYH7\SHLI$LVPHWEXW$LVQRW
• $'+'3UHGRPLQDQWO\+\SHUDFWLYH,PSXOVLYH7\SHLI$LVPHWEXW$LVQRW

Preventive Care
7KHUHDUHQRWDUJHWHGSUHYHQWLRQSURJUDPVIRU$'+'1HYHUWKHOHVVWKHIROORZLQJVWHSVPD\EHWDNHQWRKHOS
UHGXFHWKHULVNRIQHXUREHKDYLRUDOGLVRUGHUVLQFOXGLQJ$'+'
• 0LQLPL]LQJH[SRVXUHVWRSRWHQWLDOQHXURWR[LQV VXFKDVOHDGKHDY\PHWDOVSHVWLFLGHVKHUELFLGHV LQWKH
environment
• 6FUHHQLQJFKLOGUHQIRUKLJKOHYHOVRIOHDGLQWKHEORRGDQGWUHDWLQJWKLVLPPHGLDWHO\
• 2EWDLQLQJFRPSUHKHQVLYHKHDOWKFDUHEHIRUHGXULQJDQGLPPHGLDWHO\IROORZLQJSUHJQDQF\ RSWLPDOYLWDPLQ
PLQHUDODQGHVVHQWLDOIDWW\DFLGVWDWXV
• $GGUHVVLQJSV\FKRVRFLDOVWUHVVRUVLQWKHOLYHVRIDOOFKLOGUHQ

Nutrition and Dietary Supplements


According to a recent survey, nutritional therapies are the most commonly used alternative treatment among American
FKLOGUHQZLWK$'+''LHWDU\PDQDJHPHQWRI$'+'WDNHVWZREDVLFIRUPVUHVWULFWLRQDQGVXSSOHPHQWDWLRQ
ADD / ADHD 9

Dietary Restrictions
• Additives and allergies
,Q%HQMDPLQ)HLQJROGDSUDFWLFLQJDOOHUJLVWSURSRVHGWKDWDUWL¿FLDOFRORUVÀDYRUVDQGSUHVHUYDWLYHVDV
ZHOODVQDWXUDOO\RFFXUULQJVDOLF\ODWHV IRXQGLQPDQ\IUXLWVDQGYHJHWDEOHV ZHUHDPDMRUFDXVHRIK\SHUDFWLYH
EHKDYLRUDQGOHDUQLQJGLVDELOLWLHVLQFKLOGUHQ$FFRUGLQJWRKLVREVHUYDWLRQVHOLPLQDWLQJDOORIWKHVHVXEVWDQFHV
GUDPDWLFDOO\LPSURYHG$'+'V\PSWRPVLQRIFKLOGUHQDQGUHLQWURGXFLQJWKHPRQHDWDWLPHFDXVHGWKH
symptoms to recur.
$OWKRXJKWKHRULJLQDO)HLQJROGGLHWZDVEDVHGRQKLVFOLQLFDOH[SHULHQFHDQXPEHURIZHOOGHVLJQHGVWXGLHVKDYH
IRXQGDQDVVRFLDWLRQEHWZHHQFHUWDLQGLHWDU\FRQVWLWXHQWVDQGSRRUEHKDYLRULQFKLOGUHQ
2QHVXFKVWXG\DVVHVVHGWKHHIIHFWVRIIRRGFRORULQJRQEHKDYLRULQK\SHUDFWLYHFKLOGUHQDQGFKLOGUHQZLWK
QREHKDYLRUDOSUREOHPV$OOFKLOGUHQZHUHPDLQWDLQHGRQDFRORUIUHHGLHWDQGZHUHUDQGRPO\JLYHQRQHFRORUOHVV
FDSVXOHFRQWDLQLQJHLWKHUODFWRVH SODFHER RUWDUWUD]LQH \HOORZIRRGFRORULQJ DWYDU\LQJGRVHVHDFKPRUQLQJ
IRUGD\V7ZHQW\IRXURIWKHFKLOGUHQEHFDPHPRUHLUULWDEOHDQGUHVWOHVVDIWHUWDNLQJWDUWUD]LQHZKHUHDV
DOORIWKHFKLOGUHQEHKDYHGQRUPDOO\ZKHQJLYHQSODFHER,QDVLPLODUVWXG\RIFKLOGUHQZLWK$'+'EHKDYLRU
LPSURYHGRQGD\VZKHQFHUWDLQIRRGV FRUQZKHDWPLONVR\RUDQJHVDQGIRRGFRORULQJ ZHUHHOLPLQDWHGIURP
WKHGLHW%HKDYLRUZRUVHQHGRQGD\VZKHQWKHVHVDPHIRRGVZHUHUHLQWURGXFHGWRWKHGLHW1RWDEO\PRVWRIWKH
FKLOGUHQZKRGHPRQVWUDWHGDQLPSURYHPHQWLQEHKDYLRUZLWKWKHVHUHVWULFWLYHGLHWVLQERWKRIWKHVWXGLHVGHVFULEHG
DOVRKDGDKLVWRU\RIDOOHUJLHV VXFKDVDVWKPDDQGDOOHUJLFUKLQLWLV (JJVSHDQXWVDQG¿VKDUHIRRGVEHOLHYHG
WRFDUU\DKLJKULVNRIFDXVLQJDQDOOHUJLFUHDFWLRQ6RPHUHVHDUFKHUVVSHFXODWHWKDWHOLPLQDWLQJWKHVHIRRGVIURP
WKHGLHWPD\LPSURYHV\PSWRPVRI$'+'LQFHUWDLQFKLOGUHQ

Dietary supplements
$ZHOOEDODQFHGGLHWULFKLQPLFURQXWULHQWVLVHVVHQWLDOIRUQRUPDOEUDLQGHYHORSPHQWSDUWLFXODULQ\RXQJFKLOGUHQ
,QIDFWPDQ\FKLOGUHQZLWKQXWULHQWGH¿FLHQFLHVKDYHVLJQL¿FDQWFRJQLWLYHDQGEHKDYLRUDOSUREOHPV

Magnesium
6\PSWRPVRIPDJQHVLXPGH¿FLHQF\LQFOXGHLUULWDELOLW\GHFUHDVHGDWWHQWLRQVSDQDQGPHQWDOFRQIXVLRQ0LOG
PDJQHVLXPGH¿FLHQF\LVQRWXQFRPPRQLQQRUPDOO\QRXULVKHGFKLOGUHQDQGVRPHH[SHUWVEHOLHYHWKDWFKLOGUHQ
ZLWK$'+'PD\EHH[KLELWLQJWKHHIIHFWVRIPLOGPDJQHVLXPGH¿FLHQF\,QRQHVWXG\RIFKLOGUHQZLWK$'+'
ZHUHPDJQHVLXPGH¿FLHQW,QDVHSDUDWHVWXG\PDJQHVLXPGH¿FLHQWFKLOGUHQZLWK$'+'ZHUHUDQGRPO\
DVVLJQHGWRUHFHLYHPDJQHVLXPVXSSOHPHQWVLQDGGLWLRQWRVWDQGDUGWUHDWPHQWRUVWDQGDUGWUHDWPHQWDORQHIRU
PRQWKV7KRVHZKRUHFHLYHGPDJQHVLXPGHPRQVWUDWHGDVLJQL¿FDQWLPSURYHPHQWLQEHKDYLRUZKHUHDVWKH
FRQWUROJURXSH[KLELWHGZRUVHQLQJEHKDYLRU

Vitamin B6
$GHTXDWHOHYHOVRIYLWDPLQ% S\ULGR[LQH DUHUHTXLUHGIRUQRUPDOEUDLQGHYHORSPHQWDQGDUHHVVHQWLDOIRUWKH
V\QWKHVLVRIHVVHQWLDOEUDLQFKHPLFDOVLQFOXGLQJVHURWRQLQGRSDPLQHDQGQRUHSLQHSKULQH$SUHOLPLQDU\VWXG\
IRXQGWKDWS\ULGR[LQHZDVVOLJKWO\PRUHHIIHFWLYHWKDQPHWK\OSKHQLGDWH WKHPRVWFRPPRQO\XVHGVWLPXODQW LQ
improving behavior among hyperactive children.

Iron
,URQGH¿FLHQF\LVFRPPRQDPRQJFKLOGUHQDQGDGROHVFHQWVSDUWLFXODUO\LQORZHUVRFLRHFRQRPLFJURXSVZKHUHLW
DIIHFWVKDOIRIDOOLQIDQWV1RUPDOOHYHOVRILURQLQWKHEORRGDUHQHFHVVDU\IRURSWLPDOEUDLQIXQFWLRQ6\PSWRPV
RILURQGH¿FLHQF\LQFOXGHGHFUHDVHGDWWHQWLRQDURXVDODQGVRFLDOUHVSRQVLYHQHVV

Zinc
=LQFUHJXODWHVWKHDFWLYLW\RIQHXURWUDQVPLWWHUVIDWW\DFLGVDQGPHODWRQLQDOORIZKLFKDUHUHODWHGWRWKHELRORJ\
RIEHKDYLRU7ZRVHSDUDWHVWXGLHVIRXQGWKDWFKLOGUHQZLWK$'+'KDYHVLJQL¿FDQWO\ORZHUEORRG]LQFOHYHOVWKDQ
FKLOGUHQZLWKRXW$'+'$QRWKHUVWXG\LQGLFDWHGWKDW$'+'FKLOGUHQZLWKPLOG]LQFGH¿FLHQF\PD\EHOHVVOLNHO\
WRLPSURYHIURPDFRPPRQO\SUHVFULEHGVWLPXODQWWKDQFKLOGUHQZLWKDGHTXDWH]LQFOHYHOV

Melatonin
$OWKRXJKPHODWRQLQVXSSOHPHQWDWLRQSUREDEO\KDVQRGLUHFWHIIHFWRQWKHSULPDU\V\PSWRPVRI$'+'LWPD\EH
HIIHFWLYHLQPDQDJLQJVOHHSF\FOHGLVWXUEDQFHVLQFKLOGUHQZLWKDYDULHW\RIGHYHORSPHQWDOGLVRUGHUVLQFOXGLQJ
ADHD.
10 ADD / ADHD

Essential Fatty Acids


)DWW\DFLGVSOD\DNH\UROHLQQRUPDOEUDLQIXQFWLRQ6LQFHWKHERG\FDQQRWV\QWKHVL]HHVVHQWLDOIDWW\DFLGV ()$ 
WKH\PXVWEHSURYLGHGLQWKHGLHW7KHUHDUHWZRPDMRUW\SHVRI()$VRPHJDIDWW\DFLGV IRXQGLQFROGZDWHU
¿VKVXFKDVVDOPRQPDFNHUHOKDOLEXWDQGKHUULQJ DQGRPHJDIDWW\DFLGV IRXQGLQFRPPRQO\XVHGFRRNLQJ
RLOVVXFKDVVXQÀRZHURLOVDIÀRZHURLOFRUQRLODQGVR\EHDQRLO 2PHJDIDWW\DFLGVDUHKLJKO\FRQFHQWUDWHG
LQWKHEUDLQDQGDSSHDUWRSOD\DSDUWLFXODUO\LPSRUWDQWUROHLQFRJQLWLYHDQGEHKDYLRUDOIXQFWLRQ6SHFL¿FHQ]\PHV
FRQYHUW()$V VXFKDVDOSKDOLQROHQLFDFLG>$/$@ LQWRRWKHUVXEVWDQFHVNQRZQDVORQJFKDLQSRO\XQVDWXUDWHGIDWW\
DFLGV 38)$V 38)$VLQFOXGLQJHLFRVDSHQWDHQRLFDFLG (3$ DQGGRFRVDKH[DQRLF '+$ DUHDOVRHVVHQWLDOIRU
QRUPDOEUDLQIXQFWLRQ6RPHUHVHDUFKHUVEHOLHYHWKDWLQGLYLGXDOVZLWK$'+'PD\KDYHGLI¿FXOW\FRQYHUWLQJ()$V
WR38)$VDQGPD\EHGH¿FLHQWLQERWKRIWKHVHVXEVWDQFHV,QDUHFHQWVWXG\UHVHDUFKHUVUHSRUWHGWKHIROORZLQJ
¿QGLQJVLQK\SHUDFWLYHER\VFRPSDUHGWRER\VRIWKHVDPHDJHZKRZHUHQRWK\SHUDFWLYH
• /RZHUEORRGOHYHOVRI38)$VDQGRPHJDIDWW\DFLGV
• 0RUHDOOHUJLHVDQGRWKHUKHDOWKSUREOHPVDVVRFLDWHGZLWK()$GH¿FLHQFLHV
• /HVVOLNHOLKRRGRIKDYLQJEHHQEUHDVWIHG EUHDVWPLONFRQWDLQV38)$V
$QRWKHUVWXG\IRXQGWKDWER\VZLWKORZHUOHYHOVRIRPHJDIDWW\DFLGVKDGPRUHOHDUQLQJDQGEHKDYLRUDOSUREOHPV
VXFKDVWHPSHUWDQWUXPVDQGVOHHSGLVWXUEDQFHV WKDQER\VZLWKQRUPDORPHJDIDWW\DFLGOHYHOV

Suggested Nutritional Supplementation


• Lumina™VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQLVVXHVUHODWHGWRSURSHUIRFXV
DWWHQWLRQOHDUQLQJDQGPHPRU\WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDV
GRSDPLQHJDPPDDPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH
• Ceralin® ForteFDSVXOHVGDLO\
&HUDOLQ)RUWHLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJ
PXOWLSOHSDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK
• MindCare®²$GXOWVWDEOHWVWLPHVGDLO\&KLOGUHQWDEOHWVWLPHVGDLO\(VSHFLDOO\IRUDWWHQWLRQ
GH¿FLWDQGDJJUHVVLYHEHKDYLRU
0LQG&DUH 0HQWDW LVDSURSULHWDU\KHUEDOIRUPXODZKLFKLPSURYHVPHQWDOIXQFWLRQVE\DPRGXODWLRQRIWKH
FKROLQHUJLFDQG*$%$HUJLFQHXURWUDQVPLVVLRQ
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQSOXVDGYDQFHGGHWR[VXSSRUW

For Children Unable to Swallow Tablets/Capsules


• Ultracare for Kids® Medical Food²&KLOGUHQWDNHVHUYLQJVGDLO\
*RRGWDVWLQJEHYHUDJHVSHFL¿FDOO\GHVLJQHGDVQXWULWLRQDOVXSSRUWIRUFKLOGUHQZLWKIRRGDOOHUJ\UHODWHG
conditions and/or atopic disorders.
• Lumina™VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQLVVXHVUHODWHGWRSURSHUIRFXV
DWWHQWLRQOHDUQLQJDQGPHPRU\WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDV
GRSDPLQHJDPPDDPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH

Sleep Cycle Disturbance


• Benesom™²WDEOHWVRQHKRXUEHIRUHEHGWLPH
%HQHVRPLVIRUPXODWHGWRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVVE\
EHQH¿FLDOO\PRGXODWLQJWKHPHWDEROLVPRIPHODWRQLQDQG*$%$

Dietary Suggestion
• FirstLine Therapy® Diet

Massage and Physical Therapy


5HOD[DWLRQ DQG PDVVDJH WHFKQLTXHV KDYH EHHQ VKRZQ WR UHGXFH DQ[LHW\ DQG DFWLYLW\ OHYHOV LQ FKLOGUHQ DQG
DGROHVFHQWVZLWKDYDULHW\RISV\FKLDWULFLOOQHVVHV,QRQHVWXG\RIWHHQDJHER\VZLWK$'+'WKRVHZKRUHFHLYHG
PLQXWHVRIPDVVDJHIRUFRQVHFXWLYHVFKRROGD\VGHPRQVWUDWHGVLJQL¿FDQWLPSURYHPHQWLQPHDVXUHVRI
EHKDYLRUDQGFRQFHQWUDWLRQFRPSDUHGWRWKRVHZKRZHUHJXLGHGLQSURJUHVVLYHPXVFOHUHOD[DWLRQIRUWKHVDPH
GXUDWLRQRIWLPH
ADD / ADHD 11

Mind/Body Medicine
0LQGERG\ WHFKQLTXHV VXFK DV K\SQRWKHUDS\ SURJUHVVLYH UHOD[DWLRQ DQG ELRIHHGEDFN DUH SDUWLFXODUO\ ZHOO
VXLWHGWRFKLOGUHQDQGDGROHVFHQWV&KLOGUHQWHQGWRUHDGLO\DFFHSWK\SQRWLFVXJJHVWLRQDQGWKHYLVXDOSURFHVVRI
ELRIHHGEDFNZRUNVZHOOIRUFKLOGUHQRIWKLVJHQHUDWLRQEHFDXVHPDQ\DUHDFFXVWRPHGWRFRPSXWHUL]HGJUDSKLFV
7KURXJKWKHVHWHFKQLTXHVFKLOGUHQDUHRIWHQDEOHWROHDUQFRSLQJVNLOOVWKDWZLOOVWD\ZLWKWKHPIRUWKHUHVWRI
WKHLUOLYHV7KHVHWUHDWPHQWVDOORZFKLOGUHQWRJDLQDVHQVHRIFRQWURODQGPDVWHU\LQFUHDVHVHOIHVWHHPDQG
decrease stress.
0DQ\UHVHDUFKHUVEHOLHYHWKDWK\SHUDFWLYHEHKDYLRULQFKLOGUHQUHVXOWVIURPH[FHVVLYHVORZZDYH RUWKHWD DFWLYLW\
LQFHUWDLQUHJLRQVRIWKHEUDLQ,Q((*ELRIHHGEDFNRUQHXURIHHGEDFNDQLQGLYLGXDOLVSURYLGHGZLWKLQIRUPDWLRQ
UHJDUGLQJKLVRUKHUEUDLQDFWLYLW\7KHVXEMHFWLVWKHQWUDLQHGWRVXSSUHVVVORZZDYHDFWLYLWLHVZKLOHHQKDQFLQJ
IDVWHUEUDLQZDYHVRYHUDSHULRGRIXVXDOO\RUPRUHVHVVLRQV7KHEHOLHILVWKDWWKHVHFKLOGUHQFDQEHWUDLQHG
WRFRQVFLRXVO\PRGLI\DQGSHUPDQHQWO\FKDQJHWKLVXQGHUO\LQJDEQRUPDOHOHFWULFDOEUDLQDFWLYLW\DVVRFLDWHGZLWK
ADHD.
,QRQHVWXG\RIK\SHUDFWLYHFKLOGUHQDQGWHHQDJHUVWKRVHZKRVXFFHVVIXOO\GHFUHDVHGWKHLUWKHWDDFWLYLW\DIWHU
WRPRQWKVRILQWHQVLYHQHXURIHHGEDFNWUDLQLQJVKRZHGVLJQL¿FDQWLPSURYHPHQWVLQEHKDYLRUDQGDWWHQWLRQ,Q
DVLPLODUVWXG\RIFKLOGUHQDQGDGROHVFHQWVZLWK$'+'WKRVHZKRDWWHQGHGQHXURIHHGEDFNVHVVLRQVRYHU
DPRQWKSHULRGGHPRQVWUDWHGDVLJQL¿FDQWLPSURYHPHQWLQ,4VFRUHVDQGDVXEVWDQWLDOUHGXFWLRQLQLQDWWHQWLYH
EHKDYLRUFRPSDUHGWRWKRVHZKRGLGQRWDWWHQGWKHQHXURIHHGEDFNVHVVLRQV
$ODUJHUPRUHUHFHQWVWXG\IRXQGWKDWDFRPELQDWLRQRIEHKDYLRUDOWUHDWPHQWV QHXURIHHGEDFNDQGPHWDFRJQLWLYH
VWUDWHJLHVDWHFKQLTXHGHVLJQHGWRKHOSLQGLYLGXDOVFRQVFLRXVO\PRQLWRUKRZWKH\OHDUQDQGUHPHPEHUWKLQJV 
VLJQL¿FDQWO\LPSURYHG$'+'V\PSWRPVDFDGHPLFSHUIRUPDQFHDQG,4VFRUHVDPRQJFKLOGUHQDQGDGXOWVZLWK
$'+'7KHFRPELQHGWUHDWPHQWDOVRGUDPDWLFDOO\UHGXFHGWKHQHHGIRUPHGLFDWLRQVRIWKHSDUWLFLSDQWVZHUH
WDNLQJVWLPXODQWPHGLFDWLRQDWWKHEHJLQQLQJRIWKHVWXG\FRPSDUHGWRRQO\DWWKHHQGRIWKHVWXG\7REHPRVW
HIIHFWLYHIRU$'+'KRZHYHUWKHVHPLQGERG\WHFKQLTXHVVKRXOGEHLQFRUSRUDWHGLQWRDQRYHUDOOFRPSUHKHQVLYH
treatment plan that is tailored to the particular individual.

Traditional Chinese Medicine


Qi Gong
$OWKRXJK QR SXEOLVKHG VWXGLHV KDYH HYDOXDWHG TL JRQJ DV D WUHDWPHQW IRU$'+' SUHOLPLQDU\ HYLGHQFH IURP
XQSXEOLVKHG UHVHDUFK VXJJHVWV WKDW ZHHNO\ TL JRQJ EUHDWKLQJ WHFKQLTXHV PD\ LPSURYH DWWHQWLRQ DQG UHGXFH
GLVUXSWLYHEHKDYLRUVLQVFKRRODJHFKLOGUHQ

Supporting Research
1. $PHULFDQ$FDGHP\RI3HGLDWULFV&OLQLFDOSUDFWLFHJXLGHOLQHGLDJQRVLVDQGHYDOXDWLRQRIWKHFKLOGZLWKDWWHQWLRQGH¿FLWK\SHUDFWLYLW\
disorder. Pediatrics  
2. $PHULFDQ3V\FKLDWULF$VVRFLDWLRQ$WWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU,QDiagnostic and Statistical Manual of Mental Disorders. 4th
HG:DVKLQJWRQ'&$PHULFDQ3V\FKLDWULF$VVRFLDWLRQ
3. $UQROG/(3LQNKDP609RWRODWR1'RHV]LQFPRGHUDWHHVVHQWLDOIDWW\DFLGDQGDPSKHWDPLQHWUHDWPHQWRIDWWHQWLRQGH¿FLWK\SHUDFWLYLW\
disorder? J Child Adolesc Psychopharmacol
4. $UQROG /( .OH\NDPS ' 9RWRODWR 1 *LEVRQ 5$ +RUURFNV / 3RWHQWLDO OLQN EHWZHHQ GLHWDU\ LQWDNH RI IDWW\ DFLG DQG EHKDYLRU SLORW
H[SORUDWLRQRIVHUXPOLSLGVLQDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU. J Child Adolesc Psychopharmacol  
5. %DXPJDHUWHO $ $OWHUQDWLYH DQG FRQWURYHUVLDO WUHDWPHQWV IRU DWWHQWLRQGH¿FLWK\SHUDFWLYLW\ GLVRUGHU Pediatr Clin of North Am.
  
6. %HNDURJOX0$VODQ<*HGLN<5HODWLRQVKLSVEHWZHHQVHUXPIUHHIDWW\DFLGVDQG]LQFDQGDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUD
research note. J Child Psychol Psychiatry  
7. Blumenthal M, ed. The Complete German Commission E Monographs: Therapeutic Guide to Herbal Medicines. Boston, Mass:
,QWHJUDWLYH0HGLFLQH&RPPXQLFDWLRQV
8. %RULV 0 0DQGHO ) )RRGV DQG DGGLWLYHV DUH FRPPRQ FDXVHV RI WKH DWWHQWLRQ GH¿FLW K\SHUDFWLYH GLVRUGHU LQ FKLOGUHQ Ann Allergy.

9. %UHDNH\-7KHUROHRIGLHWDQGEHKDYLRXULQFKLOGKRRGJ Paediatr Child Health.
10. %XUJHVV-6WHYHQV/=KDQJ:3HFN//RQJFKDLQSRO\XQVDWXUDWHGIDWW\DFLGVLQFKLOGUHQZLWKDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU
Am J Clin Nutr.  VXSSO 66
11. &DUWHU&08UEDQRZLF]0+HPVOH\5HWDO(IIHFWVRIDIHZIRRGGLHWLQDWWHQWLRQGH¿FLWGLVRUGHUArch Dis Child
12. 'DUXQD-+'DOWRQ5)RUPDQ0$$WWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU,Q%HKUPDQ5(.OLHJPDQ50-HQVRQ+%HGVNelson
Textbook of Pediatrics. 16thHG3KLODGHOSKLD3D:%6DXQGHUV&RPSDQ\
13. 'DYLVV:%%HQWLYRJOLR35DFXVLQ5HWDO%XSURSLRQ
%XSURSLRQVXVWDLQHGUHOHDVHLQDGROHVFHQWVZLWKFRPRUELGDWWHQWLRQGH¿FLWK\SHUDFWLYLW\
VXVWDLQHG UHOHDVH LQ DGROHVFHQWV ZLWK FRPRUELG DWWHQWLRQGH¿FLWK\SHUDFWLYLW\
disorder and depression. J Am Acad Child Adolesc Psychiatry  
14. (VFKHU0'HVPHXOHV-*LDVWUD(0HQWKD*+HSDWLWLVDVVRFLDWHGZLWKNDYDDKHUEDOUHPHG\IRUDQ[LHW\BMJ
15. )LHOG74XLQWLQR2+HUQDQGH]5HLI0.RVORYVN\*$GROHVFHQWVZLWKDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUEHQH¿WIURPPDVVDJH
therapy. Adolescence  
16. )RRG DQG 'UXJ $GPLQLVWUDWLRQ 0HGZDWFK WKH )'$ VDIHW\ LQIRUPDWLRQ DQG DGYHUVH HYHQW UHSRUWLQJ SURJUDP &\OHUW SHPROLQH 
Accessed at KWWSZZZIGDJRYPHGZDWFKVDIHW\F\OHUWKWm on November 16, 2001.
17. *XWJHVHOO+$WNLQV'%DUVW5HWDO&DUGLRYDVFXODUPRQLWRULQJRIFKLOGUHQDQGDGROHVFHQWVUHFHLYLQJSV\FKRWURSLFGUXJVDVWDWHPHQW
IRU KHDOWKFDUH SURIHVVLRQDOV IURP WKH &RPPLWWHH RQ &RQJHQLWDO &DUGLDF 'HIHFWV &RXQFLO RQ &DUGLRYDVFXODU 'LVHDVH LQ WKH<RXQJ
American Heart Association. Circulation.   
12 ADD / ADHD

18. *UXHQZDOG-%UHQGOHU7-DHQLFNH&HWDOHGV PDR for Herbal Medicines.0RQWYDOH1-0HGLFDO(FRQRPLFV&R


Medicines.

19. -DQ-((VSH]HO+)UHHPDQ5')DVW'.0HODWRQLQWUHDWPHQWRIFKURQLFVOHHSGLVRUGHUV. J Child Neurol.  
20. .DQDUHN5'RHVVXFURVHRUDVSDUWDPHFDXVHK\SHUDFWLYLW\LQFKLOGUHQ"Nutr Rev.   
21. .LGG 3 $WWHQWLRQ GH¿FLW  K\SHUDFWLYLW\ GLVRUGHU $'+'  LQ FKLOGUHQ UDWLRQDOH IRU LWV LQWHJUDWLYH PDQDJHPHQW Altern Med Rev.
  
22. .QRFKHO-3'LVRUGHUVRIPDJQHVLXPPHWDEROLVP,Q ,Q)DXFL$6%UDXQZDOG(,VVHOEDFKHU.-HGVHarrison‘s
)DXFL $6 %UDXQZDOG ( ,VVHOEDFKHU .- HGV Principles of Internal
Medicine. WKHG1HZ<RUN1<0F*UDZ+LOO&RPSDQLHV,QF
23. .R]LHOHF76WDUREUDW+HUPHOLQ%$VVHVVPHQWRIPDJQHVLXPOHYHOVLQFKLOGUHQZLWKDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUMagnes Res.
  
24. .UXPPHO'6HOLJVRQ)+*XWKULH+$+\SHUDFWLYLW\LVFDQG\FDXVDO"Critical Reviews in Food Science and Nutrition DQG
 
25. /DPRQW-+RPRHRSDWKLFWUHDWPHQWRIDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUDFRQWUROOHGVWXG\Br Homoeopath J.
26. /HH6%LRIHHGEDFNDVDWUHDWPHQWIRUFKLOGKRRGK\SHUDFWLYLW\DFULWLFDOUHYLHZRIWKHOLWHUDWXUHPsychol Rep
27. /LQGHQ0+DELE75RGRMHYLF9$FRQWUROOHGVWXG\RIWKHHIIHFWVRI((*ELRIHHGEDFNRQFRJQLWLRQDQGEHKDYLRURIFKLOGUHQZLWKDWWHQWLRQ
GH¿FLWGLVRUGHUDQGOHDUQLQJGLVDELOLWLHVBiofeedback Self Regul  
28. /XEDU-6ZDUWZRRG026ZDUWZRRG-12¶'RQQHOO3+(YDOXDWLRQRIWKHHIIHFWLYHQHVVRI((*QHXURIHHGEDFNWUDLQLQJIRU$'+'LQ
D FOLQLFDO VHWWLQJ DV PHDVXUHG E\ FKDQJHV LQ 729$ VFRUHV EHKDYLRUDO UDWLQJV DQG :,6&5 SHUIRUPDQFH Biofeedback Self Regul.
  
29. /\RQ05&OLQH-&7RWRV\GH=HSHWQHN-HWDO(IIHFWRIWKHKHUEDOH[WUDFWFRPELQDWLRQPanax quinquefolium and Ginkgo biloba on
DWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUDSLORWVWXG\J Psychiatry Neurosci.  
30. 0LWFKHOO($$PDQ0*7XUERWW6+0DQNX0&OLQLFDOFKDUDFWHULVWLFVDQGVHUXPHVVHQWLDOIDWW\DFLGOHYHOVLQK\SHUDFWLYHFKLOGUHQClin
Pediatr (Phila).
31. Morrison R. 'HVNWRS*XLGHWR.H\QRWHVDQG&RQ¿UPDWRU\6\PSWRPV$OEDQ\&DOLI+DKQHPDQQ&OLQLF3XEOLVKLQJ

32. 07$&RRSHUDWLYH*URXS$PRQWKUDQGRPL]HGFOLQLFDOWULDORIWUHDWPHQWVWUDWHJLHVIRUDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUArch
Gen Psychiatry.
33. 1DWLRQDO,QVWLWXWHRI0HQWDO+HDOWK$WWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU$FFHVVHGDWKWWSZZZQLPKQLKJRYSXEOLFDWDGKGFIP on
November 9, 2001.
34. 1DWLRQDO,QVWLWXWHVRI+HDOWK'LDJQRVLVDQGWUHDWPHQWRIDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHU1DWLRQDO,QVWLWXWHVRI+HDOWK&RQVHQVXV
'HYHORSPHQW&RQIHUHQFH6WDWHPHQW1RYHPEHU$FFHVVHGDWhttp://odp.od.nih.gov/consensus/cons/110/110_statement.
htm on November 9, 2001.
35. 5LFKDUGVRQ$-3XUL%.7KHSRWHQWLDOUROHRIIDWW\DFLGVLQDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUProstaglandins Leukot Essent Fatty
Acids  
36. 5RZH .6 5RZH .- 6\QWKHWLF IRRG FRORULQJ DQG EHKDYLRU D GRVH UHVSRQVH HIIHFW LQ D GRXEOHEOLQG SODFHERFRQWUROOHG UHSHDWHG
measures study. J Pediatr
37. 6HYHU<$VKNHQD]L$7\DQR6:HL]PDQ$,URQ7UHDWPHQWLQFKLOGUHQZLWKDWWHQWLRQGH¿FLW+\SHUDFWLYLW\GLVRUGHUDSUHOLPLQDU\UHSRUW
Neuropsychobiology
38. 6WDUREUDW+HUPHOLQ%.R]LHOHF77KHHIIHFWVRIPDJQHVLXPSK\VLRORJLFDOVXSSOHPHQWDWLRQRQK\SHUDFWLYLW\LQFKLOGUHQZLWKDWWHQWLRQ
GH¿FLWK\SHUDFWLYHGLVRUGHU $'+' SRVLWLYHUHVSRQVHWRPDJQHVLXPRUDOORDGLQJWHVWMagnesium Research  
39. 6WHYHQV/-=HQWDOO66$EDWH0/.XF]HN7%XUJHVV-52PHJDIDWW\DFLGVLQER\VZLWKEHKDYLRUOHDUQLQJDQGKHDOWKSUREOHPV
Physiol Behav  
40. 6WHYHQV/-=HQWDOO66'HFN-/HWDO(VVHQWLDO
(VVHQWLDOIDWW\DFLGPHWDEROLVPLQER\VZLWKDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUAm
IDWW\ DFLG PHWDEROLVP LQ ER\V ZLWK DWWHQWLRQGH¿FLW K\SHUDFWLYLW\ GLVRUGHU J Clin
Nutr
41. 6WXEEHU¿HOG7*:UD\-$3DUU\768WLOL]DWLRQRIDOWHUQDWLYHWKHUDSLHVLQDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUJ Paediatr Child Health.

42. 7DQ*6FKQHLGHU6$WWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUSKDUPDFRWKHUDS\DQGEH\RQGPostgrad Med  
43. 7KRPSVRQ/7KRPSVRQ01HXURIHHGEDFNFRPELQHGZLWKWUDLQLQJLQPHWDFRJQLWLYHVWUDWHJLHVHIIHFWLYHQHVVLQVWXGHQWVZLWK$''
Appl Psychophysiol Biofeedback  
44. 7RUHQ3(OGDU66HOD%$HWDO=LQFGH¿FLHQF\LQDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUBiol Psychiatry
45. 9RONRZ1':DQJ*)RZOHU-6HWDO7KHUDSHXWLFGRVHVRIRUDOPHWK\OSKHQLGDWHVLJQL¿FDQWO\LQFUHDVHH[WUDFHOOXODUGRSDPLQHLQWKH
human brain. J Neurosci.  5&
46. :HQGHU(+7KHIRRGDGGLWLYHIUHHGLHWLQWKHWUHDWPHQWRIEHKDYLRUGLVRUGHUVDUHYLHZJ Dev Behav Pediatr.   
47. :HQGHU3+:ROI/(:DVVHUVWHLQ-$GXOWVZLWK$'+'$QRYHUYLHZAnn N Y Acad Sci
48. :HUEDFK01XWULWLRQDO,QÀXHQFHVRQ,OOQHVV1HZ&DQDDQ&RQQ.HDWV3XEOLVKLQJ
49. :ROUDLFK0/LQGJUHQ6'6WXPER3-HWDO(IIHFWVRIGLHWVLQVXFURVHRUDVSDUWDPHRQWKHEHKDYLRUDQGFRJQLWLYHSHUIRUPDQFHRI
children. N Engl J Med.
50. :ROUDLFK 0 $GGUHVVLQJ EHKDYLRU SUREOHPV DPRQJ VFKRRODJHG FKLOGUHQ WUDGLWLRQDO DQG FRQWURYHUVLDO DSSURDFKHV Pediatr Rev.
  
51. :ROUDLFK0%DXPJDHUWHO$7KHSUDFWLFDODVSHFWVRIGLDJQRVLQJDQGPDQDJLQJFKLOGUHQZLWKDWWHQWLRQGH¿FLWK\SHUDFWLYLW\GLVRUGHUClin
Pediatr (Phila)  
Alopecia / Hair Loss 13

Alopecia / Hair Loss


$ORSHFLDLVWKHDEVHQFHRUVORZLQJRIKDLUJURZWKLQDQDUHDRIWKHERG\ZKHUHKDLUIRUPHUO\JUHZ7KLVGLVRUGHU
KDVVHYHUDOFDXVHVLQFOXGLQJSK\VLFDOGDPDJHWRWKHKDLUVKDIWRUIROOLFOHVDQGIXQJDOLQIHFWLRQV7HORJHQHIÀXYLXP
ZKLFKLVZKHQWKHKDLU¶VJURZWKF\FOHLVGLVUXSWHGWHPSRUDULO\E\VXFKWHPSRUDU\SUREOHPVVXFKDVDFKHPLFDO
LPEDODQFHRUVWUHVVLVDQRWKHUFDXVH$ORSHFLDDUHDWDDQDXWRLPPXQHFRQGLWLRQWKDWFDXVHVSDWFK\DUHDVRI
KDLUORVVRQWKHVFDOSDQGVRPHWLPHVWKHERG\PD\DOVRFDXVHDORSHFLD7KHYDVWPDMRULW\RIFDVHVRIKDLUORVV
LQERWKPHQ PDOHSDWWHUQEDOGQHVV DQGZRPHQ IHPDOHGLIIXVHEDOGQHVV KRZHYHUDUHJHQHWLFLQRULJLQ7KLV
is called androgenetic alopecia.

Signs and Symptoms


• 0DOHSDWWHUQEDOGQHVV7KLQQLQJRUDEVHQFHRIKDLUDWWKHKDLUOLQHDQGWRSRIWKHKHDG
• )HPDOHGLIIXVHEDOGQHVV$JUDGXDOWKLQQLQJRIKDLUHVSHFLDOO\RQWKHWRSRIWKHKHDG7KHKDLUOLQHJHQHUDOO\
remains intact.
• Broken hairs, or hairs easily removed.
• 2QHRUPRUHURXQGRURYDOEDOGSDWFKHV

What Causes It?


,QDQGURJHQHWLFDORSHFLDVRPHKDLUIROOLFOHVJHQHWLFDOO\SURGXFHDVXEVWDQFHWKDWUHDFWVZLWKPDOHKRUPRQHV$V
\RXJHWROGHUWKLVUHDFWLRQHYHQWXDOO\FDXVHVWKHIROOLFOHWRVKXWGRZQ)HPDOHGLIIXVHEDOGQHVVKDSSHQVPRUH
VORZO\WKDQPDOHSDWWHUQEDOGQHVVEHFDXVHZRPHQKDYHDVPDOODPRXQWRIPDOHKRUPRQHVLQWKHLUERGLHV$
KRUPRQHLPEDODQFHPD\PDNHWKHSUREOHPZRUVH
7HPSRUDU\KDLUORVVPD\UHVXOWIURPDQ\VKRFNWRWKHERG\¶VV\VWHPV5HDVRQVLQFOXGHVWDUYDWLRQV\VWHPLF
LQIHFWLRQ FKLOGELUWK WK\URLG RU LPPXQRORJLF GLVRUGHUV GUXJV HVSHFLDOO\ FKHPRWKHUDS\ IRU FDQFHU  RU VWUHVV
+DLUIROOLFOHVFDQEHGHVWUR\HGSHUPDQHQWO\E\VFDUULQJIURPEXUQVVHYHUHVFDOSLQIHFWLRQV[UD\WKHUDS\RUVNLQ
GLVRUGHUV'DPDJHPD\DOVRUHVXOWIURPWLJKWKDLUVW\OHVRYHUDORQJSHULRGRIWLPHFKHPLFDOWUHDWPHQWVVXFKDV
KDLUFRORULQJRUSHUPDQHQWVRUKDELWXDOO\SXOOLQJRXWKDLU$IXQJDOFRQGLWLRQFDOOHGWLQHDFDSLWLV ³ULQJZRUPRI
WKHVFDOS´ DOVRFDXVHVKDLUORVV:LWKDORSHFLDDUHDWDRUSDWFK\KDLUORVVWKHERG\¶VLPPXQHV\VWHPDWWDFNV
WKHKDLUIROOLFOHVZKLFKJURZVPDOOHUDQGGRQ¶WSURGXFHDVPXFKKDLU7KHFRQGLWLRQPD\KDYHDJHQHWLFIDFWRU
DQGRIWHQWHQGVWRRFFXULQWLPHVRIVWUHVV

Treatment Options
7UHDWPHQWRSWLRQVGHSHQGRQWKHW\SHRIDORSHFLD\RXKDYH$JJUHVVLYHWUHDWPHQWGHSHQGVKRZ\RXIHHODERXW
\RXUKDLUORVVDQGPXVWEHZHLJKHGDJDLQVWSRWHQWLDOVLGHHIIHFWV,QPDQ\WHPSRUDU\IRUPVRIDORSHFLDWKH
FRQGLWLRQZLOOJRDZD\ZLWKRXWWUHDWPHQW6XUJHU\PD\EHXVHGWRWUHDWPHQZLWKPDOHSDWWHUQEDOGQHVVIRUZKRP
PHGLFDOWKHUDSLHVDUHLQHIIHFWLYHRUFDQQRWEHXVHG2SWLRQVLQFOXGHKDLUWUDQVSODQWVVFDOSUHGXFWLRQDQGVWULS
RUÀDSJUDIWV

Suggested Nutritional Supplementation


Basic Support
Men:
• Wellness Essentials™ for men ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUPDOHHQHUJ\DQGOLELGR
• Testralin — 3 tablets daily
7HVWUDOLQLVGHVLJQHGIRUPHQDJHGDQGEH\RQGWRVXSSRUWKHDOWK\WHVWRVWHURQHDQGHVWURJHQEDODQFH
and help maintain male reproductive health.
• Panto-3 ²WDEOHWVWLPHVGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUKHDOWK\KDLU
Women:
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
• Estro Factors — 3 tablets daily
(VWUR)DFWRUVSURPRWHVKHDOWK\KRUPRQHEDODQFHLQZRPHQRIDOODJHVE\IHDWXULQJWDUJHWHGQXWULHQWVWKDW
VXSSRUWKHDOWK\HVWURJHQPHWDEROLVPDQGGHWR[L¿FDWLRQ
14 Alopecia / Hair Loss

Protein Deficiency
• Ultimate Protein — VFRRSVPL[HGLQZDWHUWLPHVGDLO\
+LJK%LRORJLFDO9DOXH:KH\3URWHLQ

Stress*
• Serenagen (TCB 3) ²WDEOHWVWLPHVGDLO\ZLWKOXNHZDUPZDWHU
6HUHQDJHQ‚LVDFODVVLFFRPSUHKHQVLYHKHUEDOVWUHVVPDQDJHPHQWIRUPXODWDUJHWLQJLQGLYLGXDOVZKRDUH
³VWUHVVHGDQGZLUHG´
*Also see Stress Section

Dietary Considerations
• FirstLine Therapy® Diet
Alzheimer's Disease 15

Alzheimer's Disease
$GDSWHGIURPWKHERRN³%UDLQ5HFRYHU\FRP´E\'DYLG3HUOPXWWHU0'%RDUG&HUWL¿HG1HXURORJLVW
$W SUHVHQW DSSUR[LPDWHO\  PLOOLRQ $PHULFDQV KDYH $O]KHLPHU¶V GLVHDVH  %\ WKH \HDU  LW KDV EHHQ
HVWLPDWHGWKDWWKLVQXPEHUZLOODSSURDFKPLOOLRQ3UHYDOHQFHRI$O]KHLPHU¶VGLVHDVHKDVEHHQHVWLPDWHGWR
EHLQLQGLYLGXDOV\HDUVRUROGHU²WKHPRVWUDSLGO\JURZLQJVHJPHQWRIRXUSRSXODWLRQ&RVWVDVVRFLDWHG
ZLWKWUHDWPHQWDQGPDQDJHPHQWRI$O]KHLPHU¶VGLVHDVHDUHKLJKEXWWKHHPRWLRQDOFRVWVERUQHE\IDPLOLHVDQG
FDUHJLYHUVDUHLPPHDVXUDEOH,QDUHFHQWLVVXHRIArchives of Neurology -XQH WKHODFNRIXVHIXOQHVVRI
WKHGUXJVXVHGWRWUHDW$O]KHLPHU¶VZDVHORTXHQWO\GHVFULEHGLQDJXHVWHGLWRULDOE\'U:LOOLDP3U\VH3KLOOLSV
2XUVRFLHW\IRFXVHVRQWUHDWLQJPHGLFDOSUREOHPVZLWKSUHFLRXVOLWWOHDWWHQWLRQSDLGWRGLVHDVHSUHYHQWLRQ%XW
LW VHHPV DSSURSULDWH WR ¿UVW H[SORUH VRPH RI WKH HPHUJLQJ WKHRULHV VXUURXQGLQJ WKH FDXVHV RI $O]KHLPHU¶V
disease.

Electromagnetic Fields
,QWKHVHGD\VRIKDQGKHOGFHOOXODUSKRQHVSHUVRQDOFRPSXWHUVDQGDQDEXQGDQFHRIRWKHUHOHFWURQLFGHYLFHV
WKHJHQHUDOSXEOLFVHHPVWREHDWOHDVWPDUJLQDOO\FRQFHUQHGDERXWWKHSRVVLEOHKHDOWKULVNVRIHOHFWURPDJQHWLF
UDGLDWLRQH[SRVXUHDVHYLGHQFHGE\DUWLFOHVDSSHDULQJQRWRQO\LQDOWHUQDWLYHPHGLFDOSXEOLFDWLRQVEXWLQPDLQVWUHDP
MRXUQDOVDVZHOO
,QWKH$PHULFDQ-RXUQDORI(SLGHPLRORJ\UHVHDUFKHUVDWWKH8QLYHUVLW\RI6RXWKHUQ&DOLIRUQLD6FKRRORI
0HGLFLQHFRQ¿UPHGDGLUHFWUHODWLRQVKLSEHWZHHQRFFXSDWLRQVH[SRVLQJLQGLYLGXDOVWRKLJKHUOHYHOVRIHOHFWURPDJQHWLF
UDGLDWLRQDQGWKHULVNRIGHYHORSLQJ$O]KHLPHU¶VGLVHDVH7KH'HFHPEHULVVXHRI1HXURORJ\UHYHDOHGD
VXEVWDQWLDOLQFUHDVHGULVNRIGHYHORSLQJ$O]KHLPHU¶VGLVHDVHLQLQGLYLGXDOVZKRVHRFFXSDWLRQVH[SRVHGWKHPWR
KLJKHUWKDQDYHUDJHOHYHOVRIHOHFWURPDJQHWLFUDGLDWLRQ
+RZH[SRVXUHWRHOHFWURQLFGHYLFHVPD\OHDGWR$O]KHLPHU¶VGLVHDVHLVXQFOHDU6HYHUDODXWKRUVKDYHLQGLFDWHG
WKDWWKHHOHFWURPDJQHWLFUDGLDWLRQSURGXFHGE\HOHFWURQLFHTXLSPHQWHQKDQFHVWKHIRUPDWLRQRIEHWDDP\ORLGD
SURWHLQNQRZQWREHSUHYDOHQWLQWKHEUDLQVRI$O]KHLPHU¶VSDWLHQWV,WLVFOHDUWKDWWKLVSURWHLQHQKDQFHVEUDLQ
LQÀDPPDWLRQQRZNQRZQWREHWKHSULPDU\FDXVHRIEUDLQGHJHQHUDWLRQLQWKLVGLVHDVH
6RPHKRZLWVHHPVWKDWDUWLFOHVOLQNLQJHQYLURQPHQWDOIDFWRUVZLWKGLVHDVHPXFKOLNHUHVHDUFKGHDOLQJZLWKWKH
LPSDFWRIQXWULWLRQRQKHDOWKDUHJHQHUDOO\RYHUORRNHGLQIDYRURIFRQFHQWUDWLQJRQSKDUPDFHXWLFDODSSURDFKHV
to treating the illness they cause.

Aluminum
$QRWKHU JHQHUDOO\ XQQRWLFHG EXW FHUWDLQO\ LPSRUWDQW ULVN IDFWRU IRU WKH GHYHORSPHQW RI$O]KHLPHU¶V GLVHDVH LV
H[SRVXUHWRDOXPLQXP7KHVFLHQFHUHODWLQJWR$O]KHLPHU¶VDQGDOXPLQXPDSSHDUVLQRXUPRVWKLJKO\UHVSHFWHG
medical journals. Reporting in the journal NeurologyLQUHVHDUFKHUVIURPWKH8QLYHUVLW\RI7RURQWRIRXQGDQ
DVWRXQGLQJLQFUHDVHGULVNRI$O]KHLPHU¶VGLVHDVHLQLQGLYLGXDOVGULQNLQJPXQLFLSDOZDWHUKLJKLQDOXPLQXP
IRUDRUPRUH\HDUSHULRGRIWLPH³7KH¿QGLQJVIURPHSLGHPLRORJLFDOVWXGLHVFRXSOHGZLWKWKHODUJHERG\RI
H[SHULPHQWDOHYLGHQFHRIDOXPLQXPQHXURWR[LFLW\DQGHOHYDWHGFRQFHQWUDWLRQLQWKH$O]KHLPHU¶VGLVHDVHDIIHFWHG
EUDLQDUJXHWKDWSULRULW\VKRXOGEHJLYHQWRFRQVLGHUDWLRQRIORZHULQJDQGPDLQWDLQLQJDFFHSWDEOHOLPLWVRIUHVLGXDO
DOXPLQXP2QHFRXOGFHUWDLQO\DUJXHWKHUDWLRQDOHIRUUHGXFLQJDOXPLQXPH[SRVXUH³SDUWLFXODUO\IRUROGHUDJH
JURXSVDWULVNIRU$O]KHLPHU¶VGLVHDVH´VLQFHDOXPLQXPDFFXPXODWHVRYHUPDQ\\HDUVUHJDUGOHVVRIDJHDQGZH
ZLOODOOEHPHPEHUVRIWKH³ROGHUDJHJURXS´HYHQWXDOO\
7KHOLNHOLKRRGRI$O]KHLPHU¶VGLVHDVHEHLQJUHODWHGWRDOXPLQXPLVIXUWKHUVWUHQJWKHQHGE\DUHSRUWLQWKHMRXUQDOThe
LancetZKLFKGHVFULEHGDFWXDOVORZLQJRISURJUHVVLRQRIGHPHQWLDLQ$O]KHLPHU¶VGLVHDVHIROORZLQJDGPLQLVWUDWLRQ
RIdesferoximineDFKHPLFDONQRZQWRHQKDQFHDOXPLQXPH[FUHWLRQ
+RZDOXPLQXPLQFUHDVHV$O]KHLPHU¶VULVNLVQRZIDLUO\ZHOOXQGHUVWRRG/LNHRWKHUPHWDOVDOXPLQXPGLUHFWO\
HQKDQFHVWKHIRUPDWLRQRIGDQJHURXVIUHHUDGLFDOVOHDGLQJWRSURJUHVVLYHGDPDJHRIWKHGHOLFDWHFHOOPHPEUDQHV
VXUURXQGLQJQHXURQV(YHQWXDOO\WKLVFXPXODWLYHGDPDJHKDPSHUVQHXURQDOIXQFWLRQLQVXFKDUHDVDVPHPRU\
DQGUHDVRQLQJ²FKDUDFWHULVWLFVFRPPRQO\DVVRFLDWHGZLWK$O]KHLPHU¶VGLVHDVH
7KHGDPDJLQJHIIHFWRIIUHHUDGLFDOVSURGXFHGE\WKHSUHVHQFHRIDOXPLQXPFDQEHVLJQL¿FDQWO\UHGXFHGE\WKH
DGPLQLVWUDWLRQRImelatoninDSRZHUIXOEUDLQDQWLR[LGDQW0HODWRQLQLVSURGXFHGE\WKHSLQHDOJODQGDVPDOO
DOPRQGVKDSHGVWUXFWXUHVLWXDWHGLQWKHEDFNRIWKHEUDLQ7KHSURGXFWLRQRIWKLVLPSRUWDQWKRUPRQHUDSLGO\
GHFOLQHVZLWKDJH
,QDQLQWULJXLQJUHSRUWIURP6RXWK$IULFDUHVHDUFKHUVWULHGWRH[SODLQZK\$O]KHLPHU¶VGLVHDVHLVH[FHHGLQJO\UDUH
LQUXUDO$IULFDZKLOHSUHYDOHQWLQPRUHGHYHORSHGDUHDV7KH\UHDVRQHGWKDW³6LQFHPHODWRQLQLVSURGXFHGE\WKH
SLQHDOJODQGRQO\LQWKHGDUNWKHH[FHVVRIHOHFWULFOLJKWLQGHYHORSHGFRXQWULHVPD\KHOSH[SODLQZK\$O]KHLPHU¶V
GLVHDVHLVPRUHSUHYDOHQWLQWKHVHFRXQWULHVWKDQLQUXUDO$IULFD´
16 Alzheimer's Disease

In an article appearing in the Townsend Letter for DoctorsLQ'U0LFKDHO$:HLQHUH[HFXWLYHGLUHFWRURI


the Alzheimer’s Research Institute VXPPDUL]HGRXUSUHVHQWXQGHUVWDQGLQJRIWKHGDQJHUVRIDOXPLQXPH[SRVXUH
VWDWLQJ³$OXPLQXPKDVEHHQNQRZQWREHDQHXURWR[LFIRUQHDUO\DFHQWXU\7KHVFLHQWL¿FOLWHUDWXUHRQLWVWR[LF
HIIHFWVKDVQRZJURZQWRDFULWLFDOPDVV,WLVQRWQHFHVVDU\WRFRQFOXGHWKDWDOXPLQXPFDXVHV$O]KHLPHU¶VWR
recommend that it be reduced or eliminated as a potential risk. It is the only element noted to accumulate in the
WDQJOHEHDULQJQHXURQVFKDUDFWHULVWLFRIWKHGLVHDVHDQGLVDOVRIRXQGLQHOHYDWHGDPRXQWVLQIRXUUHJLRQVRIWKH
EUDLQRI$O]KHLPHU¶VSDWLHQWV´
$VLGHIURPPXQLFLSDOGULQNLQJZDWHURWKHUSRWHQWLDOVRXUFHVIRUDOXPLQXPH[SRVXUHDUHPDQ\DQGLQFOXGHQRQ
GDLU\ FUHDPHUV VHOIULVLQJ ÀRXUV FDNH PL[HV DQG YDULRXV SURFHVVHG IRRGV HVSHFLDOO\ LQGLYLGXDOO\ ZUDSSHG
FKHHVHVOLFHV:HDUHDEOHWRH[FUHWHDERXWPJRILQJHVWHGDOXPLQXPHDFKGD\EXWWKLVDPRXQWFDQEH
JUHDWO\H[FHHGHGE\HYHQDVLQJOHDQWDFLGWDEOHWZKLFKPD\SURYLGHDVPXFKDVPJRIDOXPLQXP2WKHU
PHGLFDWLRQVKLJKLQDOXPLQXPLQFOXGHPDQ\EXIIHUHGDQDOJHVLFSURGXFWV6HHWKHIROORZLQJOLVWIRUDGGLWLRQDO
aluminum containing medications.

Antiacids with Aluminum


 ‡$FLG; ‡0DDOR[3OXV([WUD6WUHQJWKWDEOHWV
 ‡$OHQLF$ONDWDEOHWV ‡0DDOR[3OXVWDEOHWV
 ‡$ONHWVWDEOHWV ‡0DDOR[WDEOHWV
• Almacore tablets • Marblen tablets
 ‡&DOJO\FLQH$QWDFLG ‡0HJDOR[WDEOHWV
 ‡'XUDFLG7DEOHWV ‡0L$FLGJHOFDSV
 ‡([WUD6WUHQJWK$OHQLF$ONDWDEOHWV ‡0LQWR[3OXVWDEOHWV
 ‡([WUD6WUHQJWK*HQDWRQWDEOHWV ‡0LQWR[WDEOHWV
 ‡([WUD6WUHQJWK0DDOR[WDEOHWV ‡0\DOJHQJHOFDSV
• Foamicon tablets • Mylanta Double Strength tablets
 ‡*DYLVFRQ([WUD6WUHQJWK5HOLHI)RUPXOD7DEOHWV ‡0\ODQWDJHOFDSV
 ‡0\ODQWD ‡*DYLVFRQWDEOHWV
 ‡5X/R[WDEOHWV ‡*DYLVFRQ'RXEOH6WUHQJWKWDEOHWV
 ‡5X/R[WDEOHWV ‡5X/R[3OXVWDEOHWV
 ‡*HOXVLOWDEOHWV ‡7HPSRWDEOHWV
 ‡*HQDWRQWDEOHWV ‡7LWUDODF([WUD6WUHQJWKWDEOHWV
• Titralac tablets

Analgesics with Aluminum


• %XIIHWV,,WDEOHWV
• Vanquish caplets
• Cope tablets

Analgesics without Aluminum


• %D\HU6HOHFW0D[LPXP6WUHQJWK+HDGDFKHFDSOHWV
• Anacin caplets and tablets
• $QDFLQ0D[LPXP6WUHQJWKWDEOHWV
From Drug Facts and Comparisons ©1999

Homocysteine
In The Lancet 0D\   IURP WKH 'HSDUWPHQW RI 1HXURORJ\ DQG &OLQLFDO &KHPLVWU\ DW WKH 8QLYHUVLW\ RI
+HLGHOEHUJ UHVHDUFKHUV UHYHDOHG WKDW WKH VHFRQG PRVW IUHTXHQW FDXVH RI GHPHQWLD LQ WKH HOGHUO\ SRSXODWLRQ
DIWHU$O]KHLPHU¶VGLVHDVHZDVVRFDOOHG³YDVFXODUGHPHQWLD´RUEUDLQG\VIXQFWLRQDVDFRQVHTXHQFHRIGLVHDVH
RIWKHVPDOOEORRGYHVVHOV:KDWZDVPRUHVWULNLQJZDVWKH¿QGLQJRIHOHYDWLRQRIDSDUWLFXODUFKHPLFDOLQWKH
EORRGRIWKHVHLQGLYLGXDOVFDOOHGhomocysteine7KHFRQFOXVLRQRIWKHUHSRUWSURYLGHGYHU\VWURQJVXSSRUWIRU
WKHHIIHFWLYHQHVVRIGLHWDU\VXSSOHPHQWDWLRQZLWKWKH%FRPSOH[JURXSRIYLWDPLQVLQWHUPVRIUHGXFLQJULVNRI
dementia.
%XWDSDUWIURPYDVFXODUGHPHQWLDHOHYDWLRQRIKRPRF\VWHLQHKDVHYHQPRUHLPSRUWDQWLPSOLFDWLRQV1HZUHVHDUFK
KDVIRXQGWKDWHOHYDWLRQRIWKLVEORRGFKHPLFDOLVGLUHFWO\UHODWHGWRWKHULVNRI$O]KHLPHU¶VGLVHDVH²WKHPRVW
common dementing illness. In a 1998 article published in the Archives of NeurologyUHVHDUFKHUVQRWHGD
LQFUHDVHG ULVN RI$O]KHLPHU¶V GLVHDVH LQ LQGLYLGXDOV ZLWK HOHYDWLRQ RI EORRG KRPRF\VWHLQH OHYHOV $QG DJDLQ
Alzheimer's Disease 17

HOHYDWHGKRPRF\VWHLQHFDQDOPRVWDOZD\VEHQRUPDOL]HGZLWKVLPSOHYLWDPLQWKHUDS\
0RUHGLVWUHVVLQJLVWKHIDFWWKDWOHYHOVRIEUDLQGDPDJLQJKRPRF\VWHLQHFDQEHLQFUHDVHGE\VRPHFRPPRQO\XVHG
PHGLFDWLRQVLQFOXGLQJ/GRSD 6LQHPHWŠWKHPDLQVWD\WUHDWPHQWIRU3DUNLQVRQ¶VGLVHDVH DVZHOODVDQWLELRWLFV
containing trimethoprim (Bactrim® and Septra®).
7KH FXUUHQW XQGHUVWDQGLQJ RI$O]KHLPHU¶V KROGV WKDW V\PSWRPV RI$O]KHLPHU¶V GLVHDVH UHVXOW IURP IDLOXUH RI
QHXURQVGDPDJHGRUGHVWUR\HGE\IUHHUDGLFDOVJHQHUDWHGE\LQÀDPPDWLRQ7KLVWKHVLVLVVXSSRUWHGE\PDQ\
VWXGLHVGHPRQVWUDWLQJKLJKHUOHYHOVRILQÀDPPDWLRQVSHFL¿FFKHPLFDOVNQRZQDVcytokinesLQEUDLQVRI$O]KHLPHU¶V
patients.
In a compelling 1998 report appearing in the journal Medical HypothesisHQWLWOHG³&RXOGGLHWEHXVHGWRUHGXFH
WKHULVNRI$O]KHLPHU¶VGLVHDVH"´'U3(1HZPDQGHVFULEHVKRZDVSHFL¿FEUHDNGRZQSURGXFWRIGLHWDU\IDW
arachidonic acidSURIRXQGO\HQKDQFHVLQÀDPPDWLRQ'U1HZPDQWKHQUHYHDOVKRZRWKHUGLHWDU\IDWVQDPHO\
WKHHVVHQWLDOIDWW\DFLGVIURPWKHRPHJDDQGRPHJDJURXSVKDYHMXVWWKHRSSRVLWHHIIHFW²WKH\DFWXDOO\
UHGXFHWKHLQÀDPPDWRU\SURFHVV
,QÀDPPDWLRQFDXVLQJDUDFKLGRQLFDFLGLVIRXQGLQDEXQGDQFHLQPHDWVPHDWSURGXFWVDQGHJJV,WLVHI¿FLHQWO\
DEVRUEHGIURPWKHJXWDQGLVLQFRUSRUDWHGLQWRWKHPHPEUDQHVRIWKHFHOOVPRUHUHDGLO\WKDQDQ\RWKHUIDWW\DFLG
$V'U1HZPDQVWDWHG³,WKDVEHHQHVWLPDWHGWKDWWKHSHUVRQVHDWLQJDW\SLFDO:HVWHUQGLHWWDNHLQEHWZHHQ
PJSHUGD\RIDUDFKLGRQLFDFLGLQWKHLUIRRG$VWKHQRUPDOUHTXLUHPHQWRIDUDFKLGRQLFDFLGLVRQO\PJSHU
GD\«LWLVHDV\WRXQGHUVWDQGZK\RYHUWKH\HDUVSHUVRQVLQWKHLQGXVWULDOL]HGFRXQWULHVEXLOGXSH[FHVVLYHSRROV
RIDUDFKLGRQLFDFLGDQGZK\ROGHUSHUVRQVLQVXFKVRFLHWLHVWHQGWRGHYHORS«UKHXPDWRLGDUWKULWLVDWKHURVFOHURVLV
FHUWDLQQHRSODVPV FDQFHUV SVRULDVLVDQGZK\QRW$O]KHLPHU¶VGLVHDVH´
7KLVRIIHUVDVWURQJDQGVRXQGDUJXPHQWIRUWKHXVHRIHVVHQWLDOIDWW\DFLGVXSSOHPHQWVFRPELQHGZLWKGLHWVULFK
LQ¿VKYHJHWDEOHVDQGJUDLQV²QDWXUDOVRXUFHVRIWKHLQÀDPPDWLRQUHGXFLQJRPHJDDQGRPHJDRLOV

Powerful Therapy
(IIHFWLYHWKHUDS\IRU$O]KHLPHU¶VGLVHDVHPXVWDFFRPSOLVKWKUHHWDVNV
1. 5HGXFH,QÀDPPDWLRQ
2. /LPLWWKH'DPDJLQJ(IIHFWVRI)UHH5DGLFDOV
3. Enhance Neuron Function.

1. Reducing Inflammation
Essential Fatty Acids
0DQLSXODWLRQRIGLHWDU\IDWVLVDSURYHQWKHUDS\WRUHGXFHLQÀDPPDWLRQ,QFUHDVLQJRPHJDOHYHOVKDYHEHHQ
GHPRQVWUDWHGWREHHIIHFWLYHLQDYDULHW\RILQÀDPPDWRU\FRQGLWLRQVLQFOXGLQJDUWKULWLVSVRULDVLVLQÀDPPDWRU\
ERZHOGLVHDVHVDQGPXOWLSOHVFOHURVLV7KLVLVZK\HVVHQWLDOIDWW\DFLGVXSSOHPHQWDWLRQLVDQLQWHJUDOSDUWRIDQ\
QXWULWLRQDOSURWRFROIRU$O]KHLPHU¶VGLVHDVH7KHEHVWVRXUFHIRURPHJDIDWVDUH¿VKRLOVWKHSRWHQF\RIZKLFK
is determined by its DHA content.
7KHEHVWVRXUFHVIRURPHJDRLOVDUHERUDJHVHHGRLODQGHYHQLQJSULPURVHRLO3RWHQF\RIWKHRPHJDJURXS
LVGHWHUPLQHGE\WKHFRQWHQWRI*/$

2. Limiting Free Radical Activity


Vitamin E
7KHXWLOL]DWLRQRIDQWLR[LGDQWVWROLPLWWKHDFWLYLW\RIIUHHUDGLFDOVDVWKHUDS\IRU$O]KHLPHU¶VGLVHDVHKDVEHHQ
H[WHQVLYHO\HYDOXDWHGRYHUWKHSDVWGHFDGH3HUKDSVWKHPRVWZLGHO\VWXGLHGLV9LWDPLQ(²DJRRGFDQGLGDWH
QRWRQO\EHFDXVHRILWVSRZHUIXODQWLR[LGDQWDFWLYLW\EXWDOVREHFDXVHRILWVKLJKIDWVROXELOLW\7KLVIHDWXUHLV
FUXFLDOVLQFHQRWRQO\LVWKHEUDLQPRUHWKDQIDWEXWLWLVWKHIDWFRPSRQHQWWKDWLVDWKLJKHVWULVNIRUIUHH
radical damage.
In a study published in the New England Journal of MedicineLQSDWLHQWVZHUHJLYHQYLWDPLQ(6HOHJLOLQH
DQRWKHUVRFDOOHG³$O]KHLPHU¶VGUXJ´ ERWKRUSODFHERIRUWZR\HDUV$WWKHHQGRIWKHVWXG\GDWDZHUHFRPSLOHG
DVVHVVLQJVXFKSDUDPHWHUVDVEHLQJLQVWLWXWLRQDOL]HGORVVRIDELOLW\WRSHUIRUPDFWLYLWLHVRIVHOIFDUH³VHYHUH
dementia” and death. The compelling results clearly demonstrated the group taking vitamin E did best in all areas
LQFOXGLQJORQJHYLW\DQGFRJQLWLYHIXQFWLRQ²better than the prescription medication.

Gingko Biloba
7KHWKHUDSHXWLFXVHRI*LQJNRELOREDJRHVEDFNFHQWXULHVDQGLWLVGHVFULEHGLQWUDGLWLRQDO&KLQHVHSKDUPDFRSRHLD
3HUKDSVWKHPRVWFRQYLQFLQJYDOLGDWLRQRIWKHHIIHFWLYHQHVVRI*LQJNRELOREDFRPHVIURPDSXEOLFDWLRQHQWLWOHG
18 Alzheimer's Disease

A Placebo-Controlled, Double-blind, Randomized Trial of an Extract of Gingko biloba for Dementia, published in
none other than the Journal of the American Medical Association7KHUHVXOWVZHUHGUDPDWLF$WWKHFRPSOHWLRQ
RIWKHVWXG\WKHSODFHERJURXSVKRZHGDSURJUHVVLYHGHFOLQHLQPHQWDOIXQFWLRQRQDVWDQGDUGL]HGSV\FKRORJLFDO
WHVWZKLOHWKHJURXSUHFHLYLQJ*LQJNRRQDYHUDJHDFWXDOO\improved7KHHIIHFWLYHQHVVRI*LQJNRELOREDPD\EH
H[SODLQHGE\VHYHUDOPHFKDQLVPVLQFOXGLQJLQFUHDVLQJEORRGÀRZLPSURYLQJFHUHEUDOPHWDEROLVPDQGSHUKDSV
PRVWLPSRUWDQWO\LWVDQWLR[LGDQWSRWHQWLDOUHGXFLQJWKHGDPDJLQJDFWLYLW\RIIUHHUDGLFDOV

Alpha Lipoic Acid


/LSRLFDFLGLVDSRZHUIXODQWLR[LGDQWWKDWLVUDSLGO\DEVRUEHGIURPWKHJXWDQGUHDGLO\HQWHUVWKHEUDLQWRSURWHFW
QHXURQVIURPIUHHUDGLFDOGDPDJH)XUWKHUDQWLR[LGDQWSURWHFWLRQLVGHULYHGIURPLWVDELOLW\WRUHF\FOHYLWDPLQV&
and E, and regenerate glutathioneRQHRIWKHEUDLQ¶VPRVWLPSRUWDQWDQWLR[LGDQWV
7KHEUDLQVRI$O]KHLPHU¶VSDWLHQWVKDYHEHHQVKRZQWRFRQWDLQVLJQL¿FDQWO\HOHYDWHGOHYHOVRILURQD³FDWDO\VW´
ZKLFKHQKDQFHVIUHHUDGLFDOSURGXFWLRQ/LSRLFDFLGDFWVDVDSRZHUIXOPHWDOFKHODWRU,WELQGVVHYHUDOSRWHQWLDOO\
WR[LFPHWDOVLQWKHERG\LQFOXGLQJFDGPLXPDQGIUHHLURQDQGIDFLOLWDWHVWKHLUH[FUHWLRQ7KLVLVDQRWKHULPSRUWDQW
UHDVRQZK\OLSRLFDFLGVKRXOGEHSDUWRIDQ\QXWULWLRQDOSURWRFROIRU$O]KHLPHU¶VGLVHDVH

N-Acetyl-Cysteine (NAC)
$VPHQWLRQHGDERYHJOXWDWKLRQHLVRQHRIWKHPRVWLPSRUWDQWEUDLQDQWLR[LGDQWV'H¿FLHQF\RIJOXWDWKLRQHDFWLYLW\
KDVEHHQGHVFULEHGLQYDULRXVQHXURGHJHQHUDWLYHFRQGLWLRQV7REHHIIHFWLYHJOXWDWKLRQHPXVWEHDGPLQLVWHUHG
LQWUDYHQRXVO\)RUWXQDWHO\JOXWDWKLRQHSURGXFWLRQFDQEHHQKDQFHGE\WKHRUDODGPLQLVWUDWLRQRI1$&
,QDGGLWLRQWRLQFUHDVLQJJOXWDWKLRQH1$&KDVDQLPSRUWDQWUROHLQDQGRILWVHOI2QHRIWKHPRVWQRWRULRXVIUHH
radicals implicated in Alzheimer’s disease is nitric oxide1$&KDVWKHXQLTXHDELOLW\WRUHGXFHWKHDFWLYLW\RIQLWULF
R[LGHV\QWKDVHDQGWKXVUHGXFHWKHJHQHUDWLRQRIQLWULFR[LGH

Vitamin D
9LWDPLQ'KDVUHFHQWO\EHHQGHPRQVWUDWHGWRKDYHSURIRXQGDQWLR[LGDQWDFWLYLW\,QD-DSDQHVHVWXG\SXEOLVKHG
LQLWZDVIRXQGWKDWPRGHUDWHWRVHYHUHGH¿FLHQFLHVRIYLWDPLQ'ZHUHIRXQGLQRI$O]KHLPHU¶VSDWLHQWV
studied.

3. Enhancing Neuronal Function


Coenzyme CoQ10 (CoQ10)
&RHQ]\PH4LVDFULWLFDOWUDQVSRUWHURIHOHFWURQVLQWKHSURFHVVRIHQHUJ\SURGXFWLRQLQHYHU\OLYLQJFHOO$VVXFK
GH¿FLHQFLHVRI&R4IXQFWLRQKDYHSURIRXQGHIIHFWVRQFHOOXODUDFWLYLW\DQGYLDELOLW\&R4VXSSOHPHQWDWLRQ
KDVEHHQGHPRQVWUDWHGWRHQKDQFHHQHUJ\SURGXFWLRQLQEUDLQQHXURQVDQGWKXVLPSURYHIXQFWLRQ,VQ¶WLWWKHQ
FULWLFDOO\LPSRUWDQWWRUHFRJQL]HWKDWWZRRIWKHPRVWZLGHO\SUHVFULEHGFKROHVWHUROORZHULQJGUXJVSUDYDVWDWLQ
3UDYDFKROŠ DQGORYDVWDWLQ 0HYDFRUŠ FDQVLJQL¿FDQWO\ORZHUVHUXPFRHQ]\PH4OHYHOV"

Nicotinamide Adenine Dinucleotide (NADH)


/LNH &R4 1$'+ LV ERWK DQ HVVHQWLDO LQJUHGLHQW IRU WKH FKHPLFDO UHDFWLRQV SRZHULQJ DOO OLYLQJ FHOOV DQG D
SRZHUIXODQWLR[LGDQW,QDDUWLFOHDSSHDULQJLQWKHAnnals of Clinical and Laboratory Science, Dr. Jörg
%LUNPD\HUUHSRUWHGDVLJQL¿FDQWLPSURYHPHQWLQFRJQLWLYHSHUIRUPDQFHDVPHDVXUHGRQDVWDQGDUGL]HGPHQWDO
SHUIRUPDQFHWHVWLQDJURXSRI$O]KHLPHU¶VSDWLHQWVJLYHQ1$'+³«WKH1$'+VHHPVWRDFWLQWZRZD\V2QH
LVWKHVWLPXODWLRQRIWKHHQGRJHQRXVELRV\QWKHVLVRIGRSDPLQHDQGQRUDGUHQDOLQH7KHRWKHULVDQLQFUHDVHLQ
HQHUJ\SURGXFWLRQRIFHOOVLQWKHEUDLQDQLQWKHSHULSKHU\´

Acetyl-L-carnitine
$FHW\O/FDUQLWLQH IXQFWLRQV SULPDULO\ DV D VKXWWOH WUDQVSRUWLQJ FULWLFDO IXHO VRXUFHV LQWR WKH mitochondria, the
HQHUJ\SURGXFLQJPDFKLQHU\RIWKHQHXURQ,WVVHFRQGWDVNLVWRIDFLOLWDWHWKHUHPRYDORIWKHWR[LFE\SURGXFWVRI
EUDLQPHWDEROLVP%HFDXVHRIWKHVHIXQFWLRQVDFHW\O/FDUQLWLQHKDVDSLYRWDOUROHLQIDFLOLWDWLQJWKHIXQGDPHQWDO
SURFHVVHVQHFHVVDU\IRUEUDLQVXUYLYDO
,QDGGLWLRQDFHW\O/FDUQLWLQHLVUHDGLO\FRQYHUWHGLQWRDQLPSRUWDQWneurotransmitter EUDLQFKHPLFDOPHVVHQJHU NQRZQ
as acetylcholineZKLFKLVNQRZQWREHSURIRXQGO\GH¿FLHQWLQWKHEUDLQVRI$O]KHLPHU¶VSDWLHQWV
In a report entitled A 1-year multicenter placebo-controlled study of acetyl-L-carnitine in patients with Alzheimer’s
diseaseZKLFKDSSHDUHGLQWKHMRXUQDONeurologyUHVHDUFKHUVDWWKH8QLYHUVLW\RI&DOLIRUQLD6DQ'LHJRIRXQGD
VWULNLQJUHGXFWLRQLQWKHUDWHRIPHQWDOGHFOLQHLQ\RXQJHU$O]KHLPHU¶VSDWLHQWVWDNLQJDFHW\O/FDUQLWLQHRYHUWKH
1 year evaluation.
Alzheimer's Disease 19

Phosphatidylserine
2YHUWKHSDVWGHFDGHVH[WHQVLYHPHGLFDOOLWHUDWXUHKDVDSSHDUHGGHVFULELQJWKHLPSRUWDQWUROHRIlecithin in
SUHVHUYLQJQRUPDOEUDLQIXQFWLRQ0RUHUHFHQWUHVHDUFKKDVUHYHDOHGWKDWWKHEHQH¿FLDODFWLRQRIOHFLWKLQLVIRU
WKHPRVWSDUWGXHWRRQHRILWVFRPSRQHQWVSKRVSKDWLG\OVHULQH3KRVSKDWLG\OVHULQHLVRQHRIWKHNH\FRQVWLWXHQWV
RIneuronal membranes²WKHVLWHZKHUHEUDLQFHOOVERWKUHFHLYHDQGWUDQVPLWFKHPLFDOPHVVDJHV$EQRUPDOLWLHV
RIWKHQHXURQDOPHPEUDQHKDYHEHHQOLQNHGWRDJHUHODWHGIXQFWLRQDOFKDQJHVLQEUDLQSHUIRUPDQFH$GHTXDWH
SKRVSKDWLG\OVHULQH LV D EDVLF UHTXLUHPHQW WR PDLQWDLQ YLWDO HQHUJ\ SURGXFWLRQ RI WKH PLWRFKRQGULD HQVXULQJ
RSWLPDOIXQFWLRQRIWKHEUDLQ,QDDUWLFOHHQWLWOHGEffects of phosphatidylserine in age-associated memory
impairment, appearing in the journal Neurology UHVHDUFKHUV IURP 6WDQIRUG 8QLYHUVLW\ VWDWHG WKDW WKH UHVXOWV
IURPWUHDWLQJPHPRU\LPSDLUHGSDWLHQWV³VXJJHVWWKDWWKHFRPSRXQGPD\EHDSURPLVLQJFDQGLGDWHIRUWUHDWLQJ
PHPRU\ORVVLQODWHUOLIH´

Vitamin B-12
6WDQGDUGPHGLFDOWH[WVKDYHORQJUHSRUWHGWKDWYLWDPLQ%LVDFULWLFDOIDFWRUIRUSUHVHUYDWLRQRIQRUPDOEUDLQIXQFWLRQ
,WVGH¿FLHQF\LVDVVRFLDWHGZLWKFRQIXVLRQGHSUHVVLRQPHQWDOVORZQHVVPHPRU\GLI¿FXOWLHVDQGDEQRUPDOLWLHV
RIQHUYHIXQFWLRQ1HZUHVHDUFKUHYHDOVWKDW%KHOSVSUHYHQWWKHDFFXPXODWLRQRIWKHEUDLQGDPDJLQJDPLQR
acid homocysteineZKLFKZKHQHOHYDWHGPDUNHGO\LQFUHDVHVWKHULVNIRU$O]KHLPHU¶VGLVHDVH

Folic Acid
)ROLFDFLGOHYHOVDUHRIWHQPDUNHGO\GHSUHVVHGLQSDWLHQWVVXIIHULQJIURPGHPHQWLDRUFRQIXVLRQDOVWDWHV'H¿FLHQF\
RIIROLFDFLGLVDVVRFLDWHGZLWKDSDWK\GLVRULHQWDWLRQPHPRU\GH¿FLWVDQGGLI¿FXOWLHVZLWKFRQFHQWUDWLRQ6HYHUDO
VWXGLHV KDYH FRUUHODWHG ORZ IROLF DFLG OHYHOV ZLWK GHPHQWLD $JDLQ WKH PHFKDQLVP PD\ LQYROYH HOHYDWLRQ RI
KRPRF\VWHLQHVLQFHOLNHYLWDPLQ%IROLFDFLGKHOSVORZHUWKLVEORRGYHVVHOGDPDJLQJDPLQRDFLG

DMAE
'0$(LVRQHRIWKHPRVWLPSRUWDQWQXWULHQWVIRUWKHEUDLQEHFDXVHLWFDQHQKDQFHSURGXFWLRQRIRQHRIWKHEUDLQ¶V
LPSRUWDQWQHXURWUDQVPLWWHUVDFHW\OFKROLQHZKLFKFRQWUROVPHPRU\KHDUWPXVFOHVOXQJVDQGGLJHVWLRQ
%HFDXVHDFHW\OFKROLQHLVXQDEOHWRFURVVWKHEORRGEUDLQEDUULHULWPXVWEHSURGXFHGZLWKLQWKHEUDLQIURPLWV
SUHFXUVRUFKROLQH+RZHYHUFKROLQHFDQQRWFURVVWKHEORRGEUDLQEDUULHUXQWLOLWKDVEHHQFRQYHUWHGE\WKHOLYHU
LQWRLWVOLSLGVROXEOHIRUP,IVXI¿FLHQWFKROLQHLVQRWDYDLODEOHRULIWKHERG\¶VDELOLW\WRSURGXFHWKLVIRUPRIFKROLQH
LVOHVVWKDQLGHDODFHW\OFKROLQHOHYHOVDUHOLNHO\WREHORZ'0$(ZKLFKLVEDVLFDOO\DFKROLQHPROHFXOHZLWKRQH
PHWK\OJURXSPLVVLQJIURPWKHQLWURJHQUHDGLO\FURVVHVWKHEORRGEUDLQEDUULHU2QFHLQVLGHWKHEUDLQLWLVHDVLO\
FRQYHUWHG¿UVWWRFKROLQHWKHQWRDFHW\OFKROLQH6WXGLHVLQGLFDWHWKDW'0$(FDQHOHYDWHPRRGDQGSURPRWHPRUH
UHVWIXOVOHHSDVZHOODVHQKDQFHPHPRU\PHQWDOIRFXVFODULW\RUWKRXJKWDQGPXVFOHWRQH

Huperzine (HupA)
7KH DONDORLG FRPSRXQG KXSHU]LQH$ +XS$  LV D WUDGLWLRQDO &KLQHVH KHUEDO UHPHG\ SUHSDUHG IURP WKH PRVV
Huperzia serrata7KHSXUL¿HGFRPSRXQGKDVEHHQXVHGLQ&KLQDIRUVHYHUDO\HDUVDVDSUHVFULSWLRQGUXJIRU
treating dementia.
+XS$DSSHDUVWREHDSRWHQWLQKLELWRURIDFHW\OFKROLQHVWHUDVH $&K( WKHHQ]\PHWKDWEUHDNVGRZQDFHW\OFKROLQH
%LRSV\DQGSRVWPRUWHPVWXGLHVVKRZVXEVWDQWLDOORVVRISUHV\QDSWLFFKROLQHUJLFQHXURQVLQEUDLQVRI$O]KHLPHU¶V
SDWLHQWVLQGLFDWLQJWKDWZKDWHYHUDFHW\OFKROLQHLVSURGXFHGLQWKHEUDLQVRIWKHVHSDWLHQWVLVTXLFNO\EURNHQGRZQ
E\$&K(7KLVDFHW\OFKROLQHVKRUWDJHPD\FRQWULEXWHWRPHPRU\ORVVDQGRWKHUFRJQLWLYHGHIHFWV
+XS$PD\DOVRSURWHFWQHXURQV,QVWXGLHVXVLQJFXOWXUHVRIFHOOVIURPWKHKLSSRFDPSXVDQGFHUHEHOOXPRIUDW
HPEU\RV+XS$GHFUHDVHGQHXURQDOFHOOGHDWKFDXVHGE\WR[LFOHYHOVRIJOXWDPDWH

Vinpocetine
9LQSRFHWLQH IURP 3HULZLQNOH IDFLOLWDWHV FHUHEUDOPHWDEROLVPE\LPSURYLQJ FHUHEUDOPLFURFLUFXODWLRQ VWHSSLQJ
XSEUDLQFHOO$73SURGXFWLRQDQGLQFUHDVLQJXWLOL]DWLRQRIJOXFRVHDQGR[\JHQ9LQSRFHWLQHLVDGHULYDWLYHRI
YLQFDPLQHZKLFKLVDQH[WUDFWRISHULZLQNOH$OWKRXJKWKHVHVXEVWDQFHVKDYHPDQ\VLPLODUHIIHFWV9LQSRFHWLQH
KDVPRUHEHQH¿WVDQGIHZHUDGYHUVHHIIHFWV
9LQSRFHWLQHLVRIWHQXVHGIRUWUHDWPHQWRIFHUHEUDOFLUFXODWRU\GLVRUGHUVVXFKDVPHPRU\SUREOHPVDFXWHVWURNH
DSKDVLD ORVVRIWKHSRZHURIH[SUHVVLRQ DSUD[LD LQDELOLW\WRFRRUGLQDWHPRYHPHQWV PRWRUGLVRUGHUVGL]]LQHVV
DQG KHDGDFKH  ,W LV DOVR XVHG WR WUHDW RSWKDOPRORJLFDO GLVHDVHV RI YDULRXV RULJLQ DQG VHQVRULQHXUDO KHDULQJ
impairment.
20 Alzheimer's Disease

Summary
7KH VFLHQFH UHODWLQJ HOHFWURPDJQHWLF UDGLDWLRQ H[SRVXUH WR$O]KHLPHU¶VGLVHDVH LVVRXQG5HGXFLQJ WKHULVN
RI$O]KHLPHU¶VGLVHDVHLQYROYHVDUHFRJQLWLRQRISRWHQWLDOVRXUFHVRIHOHFWURPDJQHWLFUDGLDWLRQOLNHKDQGKHOG
FHOOXODU SKRQHV HOHFWULF EODQNHWV KDQGKHOG KDLU GU\HUV FORFN UDGLRV RQ WKH QLJKW VWDQG QHDU WKH KHDG DQG
GHVNWRSFRPSXWHUVWRQDPHDIHZ
7KH UHODWLRQVKLS EHWZHHQ$O]KHLPHU¶V GLVHDVH DQG DOXPLQXP LV VXSSRUWHG E\ VHYHUDO REVHUYDWLRQV LQFOXGLQJ
ZRUOGZLGHHSLGHPLRORJLFDOUHSRUWVWKHSUHVHQFHRIH[WUHPHO\KLJKEUDLQDOXPLQXPOHYHOVLQ$O]KHLPHU¶VSDWLHQWV
DQGVWXGLHVUHYHDOLQJWKDWDOXPLQXPLQFUHDVHVGDPDJLQJIUHHUDGLFDOV0DQ\PXQLFLSDOZDWHUXWLOLWLHVDGGDOXPLQXP
VXOIDWHWRSXEOLFZDWHUVRXUFHVWRKHOSUHPRYH¿QHSDUWLFXODWHPDWWHU7KLVLVDVWURQJDUJXPHQWLQIDYRURIGULQNLQJ
ERWWOHGZDWHU$YRLGPHGLFDWLRQVFRQWDLQLQJDOXPLQXP5HDGLQJUHGLHQWODEHOVRIIRRGSURGXFWVWRKHOSDYRLG
DOXPLQXP FRQVXPSWLRQ  )RRG FRRNHG LQ DOXPLQXP FRRNZDUH FDQ DEVRUE VXEVWDQWLDO DPRXQWV RI DOXPLQXP 
FKRRVHJODVVRUVWDLQOHVVVWHHO$QGUHPHPEHUWKDWPHODWRQLQFDQOLPLWDOXPLQXP¶VGDPDJLQJHIIHFWV
$YRLG PHGLFDWLRQV FRQWDLQLQJ DFHWDPLQRSKHQ DV LW UHGXFHV WKH DYDLODELOLW\ RI WKH LPSRUWDQW DQWLR[LGDQW
glutathione.
0HDWDQGHJJVDUHULFKLQLQÀDPPDWLRQSURGXFLQJIDWW\DFLGV$QGLWLVWKLVLQÀDPPDWLRQWKDWOHDGVWRWKHHQKDQFHG
SURGXFWLRQRIEUDLQGDPDJLQJIUHHUDGLFDOV6XSSOHPHQWDWLRQZLWKRLOVULFKLQDSSURSULDWHHVVHQWLDOIDWW\DFLGV
FDQUHPDUNDEO\UHGXFHLQÀDPPDWLRQ²UHGXFLQJIUHHUDGLFDOSURGXFWLRQ
$SSURSULDWHDQWLR[LGDQWVDQGFHOOXODUHQHUJL]HUVVXEVWDQWLDWHGE\UHVHDUFKSXEOLVKHGLQWKHPRVWZHOOUHVSHFWHG
VFLHQWL¿FDQGPHGLFDOMRXUQDOVKDYHLPSRUWDQWUROHVLQDQ\WUHDWPHQWSODQIRUWKLVGLVHDVH
³*OXWHQVHQVLWLYLW\LVFRPPRQLQSDWLHQWVZLWKQHXURORJLFDOGLVHDVHRIXQNQRZQFDXVHDQGPD\KDYHDHWLRORJLFDO
VLJQL¿FDQFH´/DQFHW  

Suggested Nutritional Supplementation

Preventative Maintenance
• Ceralin Forte — 3 capsules daily
&HUDOLQ)RUWHLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJ
PXOWLSOHSDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQSOXVDGYDQFHGGHWR[VXSSRUW

Therapeutic Nutritional Support Protocol – Add to Above


• Ceriva ²VRIWJHOVGDLO\
&HULYDLVIRUPXODWHGWRVXSSRUWKHDOWK\FRJQLWLYHIXQFWLRQLQWKRVHFRQFHUQHGDERXWPDLQWDLQLQJWKHLU
PHPRU\E\EHQH¿FLDOO\PRGXODWLQJDFHW\OFKROLQH
• Memories — 7DEOHWV'DLO\
+HDOWK\EUDLQIXQFWLRQVXSSRUW
• CoQ10ST-100 ²FDSVXOHVGDLO\
6WDELOL]HG+LJKO\$EVRUEDEOH&RHQ]\PH4ZLWK1DWXUDO9LWDPLQ(
• Meta Lipoate 300 ²WDEOHWVGDLO\
3UHPLXPJUDGHSXULW\FRQWUROOHGDOSKDOLSRLFDFLG
• GLA Forte ²FDSVXOHVGDLO\
3RWHQWVRXUFHRIRPHJDIDWW\DFLGV
• Benesom™ — WRWDEOHWVRQHKRXUEHIRUHEHGWLPH
%HQHVRPLVIRUPXODWHGWRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVVE\
EHQH¿FLDOO\PRGXODWLQJWKHPHWDEROLVPRIPHODWRQLQDQG

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
Alzheimer's Disease 21

References
1. YDQ 5HQVEHUJ 6- 'DQLHOV :0 3RWRFQLN )& HW DO $ QHZ PRGHO IRU WKH SDWKRSK\VLRORJ\ RI$O]KHLPHU¶V GLVHDVH $OXPLQXP
WR[LFLW\XVH[DFHUEDWHGE\K\GURJHQSHUR[LGHDQGDWWHQXDWHGE\DQDP\ORLGSURWHLQIUDJPHQWDQGPHODWRQLQ6$IU-0HG  

2. :HLQHU0$(YLGHQFHSRLQWVWRDOXPLQXP¶VOLQNZLWK$O]KHLPHU¶VGLVHDVH7RZQVHQG/HWWHUIRU'RFWRUV
3. %LUFKHOO-'&KDSSHO-6$OXPLQXP&KHPLFDO3K\VLRORJ\DQG$O]KHLPHU¶V'LVHDVH/DQFHW  
4. )D‰HQGHU.0LHONH2%HUWVFK7HWDO+RPRF\VWHLQHLQFHUHEUDOPDFURDQJLRJUDSK\DQGPLFURDQJLRJUDSK\/DQFHW
1999.
5. &ODUNH56PLWK$'-REVW.$HWDO)RODWH9LWDPLQ%DQGVHUXPWRWDOKRPRF\VWHLQHOHYHOVLQFRQ¿UPHG$O]KHLPHU¶VGLVHDVH
$UFK1HXURO
6. 0OOHU7:HUQH%)RZOHU:HWDO1LJUDOHQGRWKHOLDOG\VIXQFWLRQDQG3DUNLQVRQ¶VGLVHDVH/DQFHW
7. 6PXOGHUV<0GH0DQ$0(6WHKRXZHU&'$7ULPHWKRSULPDQGIDVWLQJKRPRF\VWHLQH/DQFHW
8. )OR\G5$1HXURLQÀDPPDWRU\SURFHVVHVDUHLPSRUWDQWLQQHXURGHJHQHUDWLYHGLVHDVH$K\SRWKHVLVWRH[SODLQWKHLQFUHDVHGIRUPDWLRQ
RIUHDFWLYHR[\JHQDQGQLWURJHQVSHFLHVDVPDMRUIDFWRUVLQYROYHGLQQHXURGHJHQHUDWLYHGLVHDVHGHYHORSPHQW)UHH5DGLFDO%LRORJ\
DQG0HGLFLQH  
9. 1HZPDQ3(&RXOGGLHWEHXVHGWRUHGXFHWKHULVNRIGHYHORSLQJ$O]KHLPHU¶VGLVHDVH"0HG+\SRWKHVLV
10. 6DQR 0 (UQHVWR & 7KRPDV 5* HW DO$ FRQWUROOHG WULDO RI VHOHJHOLQH DOSKDWRFRSKHURO RU ERWK DV WUHDWPHQW IRU$O]KHLPHU¶V
GLVHDVH1HZ(QJO-0HG
11. -DQHWVN\%5HLFKPDQQ+<RXGLP0%+,URQDQG2[LGDWLYHGDPDJHLQQHXURGHJHQHUDWLYHGLVHDVHVLQ0LWRFKRQGULDDQG)UHH
5DGLFDOVLQ1HXURGHJHQHUDWLYH'LVHDVHV%HDO0) HG 1HZ<RUN:LOH\/LVV3XE
12. 3DKDQ-6KHLNK)*1DPERRGLUL$061DFHW\OF\VWHLQHLQKLELWVLQGXFWLRQRI12SURGXFWLRQE\HQGRWR[LQRUF\WRNLQHVWLPXODWHG
UDWSHULRQHOPDFURSKDJHV&JOLDOFHOOVDQGDVWURF\WHV)UHH5DGLFDO%LRORJ\DQG0HGLFLQH  
13. 6WDR<$VRK7 2L]XPL .  +LJK SUHYDOHQFH RI YLWDPLQ ' GH¿FLHQF\ DQG UHGXFHG ERQH PDVV LQ HOGHUO\ ZRPHQ ZLWK$O]KHLPHU¶V
GLVHDVH%RQH  
14. 6KXOWV &: %HDO 0) )RQWDLQH . HW DO $EVRUSWLRQ WROHUDELOLW\ DQG HIIHFWV RQ PLWRFKRQGULDO DFWLYLW\ RI RUDO FRHQ]\PH 4 LQ
3DUNLQVRQ¶VSDWLHQWV1HXURORJ\
15. %LUNPD\HU -*'  &RHQ]\PH 1LFRWLQDPLGH$GHQLQH 'LQXFOHRWLGH1HZ7KHUDSHXWLF$SSURDFK IRU ,PSURYLQJ 'HPHQWLD LQ$O]KHLPHU
7\SH$QQ&OLQDQG/DE6FLHQFH  
16. 7KDO/-&DUWD$&ODUNH:5HWDO$\HDUPXOWLFHQWHUSODFHERFRQWUROOHGVWXG\RIDFHW\O/FDUQLWLQHLQSDWLHQWVZLWK$O]KHLPHU¶V
GLVHDVH1HXURORJ\
17. &URRN7+7LQNOHQEHUJ-<HVDYDJH-(IIHFWVRISKRVSKDWLG\OVHULQHLQDJHDVVRFLDWHGPHPRU\LPSDLUPHQW1HXURORJ\
1996.
18. &ODUNH56PLWK$'-REVW.$HWDO)RODWHYLWDPLQ%DQGVHUXPWRWDOKRPRF\VWHLQHOHYHOVLQFRQ¿UPHG$O]KHLPHU¶VGLVHDVH
$UFK1HXURO
22 Ankylosis Spondylitis

Ankylosis Spondylitis
$FKURQLFDQGJHQHUDOO\SURJUHVVLYHLQÀDPPDWRU\DUWKULWLFGLVHDVHDIIHFWLQJWKHVSLQDOMRLQWVDQGDGMDFHQWFRQQHFWLYH
WLVVXHV$OVRFDOOHG³0DULH6WUXPSHOO'LVHDVH´7KLVDSSHDUVWREHDGLVHDVHPDLQO\RI\RXQJPHQDJHG
\HDUVROG,WVHHPVWRKDYHDJHQHWLFFRPSRQHQWDVLWLVVHHQLQPDOHUHODWLYHVDQGHVSHFLDOO\LQSDWLHQWVZLWK
KLVWRFRPSDWLELOLW\FRPSOH[+/$% ZKRKDYHDWLPHVJUHDWHUULVNRIGHYHORSLQJ$6SDUWLFXODUO\LQZKLWH
PHQ 7KHHWLRORJ\LVXQNQRZQ,WLVVHHQWKURXJKRXWWKHZRUOG
&RQYHQWLRQDOWUHDWPHQWGRHVQRWVWRSWKHSURJUHVVLRQRIWKHGLVHDVH6WUHWFKLQJH[HUFLVHVDQGFDUHIXODGKHUHQFH
WRFRUUHFWSRVWXULQJDUHDEVROXWHO\UHTXLUHGWRPDLQWDLQDVPXFKPRELOLW\DVSRVVLEOHRYHUWLPH2FFDVLRQDOO\
VXUJHU\LVXVHGWRUHSODFHDEDGO\DIIHFWHGMRLQWRUWRVWUDLJKWHQWKHVSLQH

Symptoms
• Initial Symptoms:/RZEDFNSDLQHVSHFLDOO\LQVDFURLOLDFDQGOXPEDUDUHDV PD\DSSHDUWREHVFLDWLFSDLQ 
VWLIIQHVVRQDZDNHQLQJQRFWXUQDOSDLQDQGVWLIIQHVVFDXVLQJLQVRPQLD
• Advanced Disease:3DLQVSUHDGVXSVSLQHRIWHQLQWRWKHPLGEDFNDQGQHFNKLSVDQGVKRXOGHUVPD\DOVREH
LQYROYHG RISDWLHQWV IDWLJXHZHLJKWORVVDQGDQRUH[LDVOLJKWDQHPLDPXVFOHVWLIIQHVVRUFUDPSLQJSDLQ
EUHDWKLQJRUGHFUHDVHGDELOLW\WRGUDZLQGHHSEUHDWKOLPLWHGPRELOLW\RIVSLQHEHQWRYHUVWDQFHLQFUHDVHG
GRUVDON\SKRVLVZDGGOLQJJDLWQRUPDOQHXURORJLFH[DPLQDWLRQFKURQLFLULWLV
• Joints Affected:6DFURLOLDF QHDUO\DOZD\V JHQHUDOVSLQDOIURPQHFNWROXPEDU DOZD\VHYHQWXDOO\ KLSV
RIWHQ VKRXOGHUV RIWHQ SHULSKHUDOMRLQWV UDUHO\ 

Suggested Nutritional Supplementation


• 8OWUD,QÀDP;® ²VFRRSVWZLFHGDLO\
0HGLFDOIRRGIRULQÀDPPDWLRQDQGELRWUDQVIRUPDWLRQ
• )ROORZHLWKHUWKH0RGL¿HG(OLPLQDWLRQ'LHWor the $QWL,QÀDPPDWRU\'LHW
• Kaprex® ²VRIWJHOWZLFHGDLO\
• 1RQUHVSRQGHUVE\GD\PRYHWRVRIWJHOVGDLO\
• 7LPHWREHQH¿W,PPHGLDWHWRGD\V
.DSUH[LVDFOLQLFDOO\WHVWHGKHUEDOGLHWDU\VXSSOHPHQWWKDWSURYLGHVQDWXUDOMRLQWUHOLHIWKDWLVHDV\RQWKH
JDVWURLQWHVWLQDO *, WUDFW,WZRUNVE\LQWHUIHULQJZLWKVLJQDOVLQWKHERG\WKDWLQLWLDWHWKHSURGXFWLRQRIGDPDJLQJ
compounds that cause minor pain and negatively impact cartilage and other joint tissues.
• EPA-DHA 6:1™ Enteric Coated ²VRIWJHOVWKUHHWLPHVGDLO\
(3$'+$(QWHULF&RDWHGRPHJDIDWW\DFLGVSURYLGLQJDUDWLRDSSURSULDWHIRUSDWLHQWVZLWKFKURQLF
LQÀDPPDWRU\FRQGLWLRQV
• Iso D3™ — 1 tablet three times daily.
,VR'GHOLYHUV,8RI9LWDPLQ'ZLWK,VRÀDYRQHVWKDWPD\KHOSIDFLOLWDWHWKHERG\
VXWLOL]DWLRQRI
YLWDPLQ'IRUHQKDQFHGKHDOWKEHQH¿WV
If there is a soy sensitivity use:
• D3 1000™ — 2 microtablets three times daily.
%LRDFWLYH9LWDPLQ'LQDPLFURWDEOHWGHOLYHU\IRUP

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW

Exercise Considerations
7KH REMHFW RI H[HUFLVH LV WR EXLOG XS PXVFOH JURXSV WKDW RSSRVH WKH GLUHFWLRQ RI SRWHQWLDO GHIRUPLWLHV LH WR
VWUHQJWKHQH[WHQVRUUDWKHUWKDQÀH[RUPXVFOHJURXSV 

Spondylitis Exercise
1. /LHRQEDFNZLWKKDQGVEHKLQGKHDGEHQGDWNQHHVDQGGUDZWKHPXSWRDEGRPHQWKHQUDLVHIHHW
ZLWKVRPHIRUFHUHOD[DQGORZHUWKHP
2. /\LQJRQEDFNVWUHWFKRXWZLWKDUPVRYHUKHDGXVHPRPHQWXPRIDUPVWRUDLVHWRDVLWWLQJSRVLWLRQ
3. /\LQJIDFHGRZQH[WHQGDUPVWRVLGHVWKHQOLIWWKHPRYHUEDFNDVWKRXJKÀ\LQJ
4. 6WDQGLQJGRQHFNUDQJHRIPRWLRQH[HUFLVHVVORZO\
5. 6WDQGLQJOHDQWRULJKWWKHQOHIWEHQGLQJVORZO\DWWUXQN
6. 5HSHDWHDFKRIWKHDERYHH[HUFLVHWLPHVRQFHRUWZLFHDGD\
Asthma 23

Asthma
$VWKPD LV D GLVHDVH LQ ZKLFK LQÀDPPDWLRQ RI WKH DLUZD\V UHVWULFWV DLUÀRZ LQ DQG RXW RI WKH OXQJV7KH ZRUG
DVWKPDFRPHVIURPWKH*UHHNZRUGIRU³SDQWLQJ´7KHSDQWLQJDQGZKHH]LQJVRXQGFKDUDFWHULVWLFRIDVWKPD
RFFXUEHFDXVHRIWKHUHVWULFWHGÀRZRIDLU
1RUPDOO\ZKHQ\RXEUHDWKHLQDQLUULWDQWRUDUHVXEMHFWHGWRDVWUHVVRUVXFKDVH[HUFLVH\RXUDLUZD\VUHOD[DQG
RSHQDOORZLQJWKHOXQJVWRJHWULGRILUULWDQWVRUWDNHLQPRUHDLU,QDSHUVRQZLWKDVWKPDPXVFOHVLQWKHDLUZD\V
WLJKWHQDQGWKHOLQLQJRIWKHDLUSDVVDJHVVZHOOV7KHLPPXQHV\VWHPJHWVLQYROYHGEXWLQVWHDGRIKHOSLQJLW
FDXVHVLQÀDPPDWLRQ
$VWKPDLVDGLVHDVHRIERWKDGXOWVDQGFKLOGUHQ,QIDFWDVWKPDLVWKHPRVWFRPPRQFKURQLFFKLOGKRRGLOOQHVV
$ERXWKDOIRIDOOFDVHVRIDVWKPDGHYHORSEHIRUHWKHDJHRI0DQ\FKLOGUHQZLWKDVWKPDDOVRKDYHDOOHUJLHV
:KLOHWKHUHLVQRFXUHIRUDVWKPDLWFDQEHFRQWUROOHG

Signs and Symptoms


0RVW SHRSOH ZLWK DVWKPD KDYH SHULRGLF DWWDFNV VHSDUDWHG E\ V\PSWRPIUHH SHULRGV 6RPH DVWKPDWLFV KDYH
FKURQLFVKRUWQHVVRIEUHDWKZLWKHSLVRGHVRILQFUHDVHGVKRUWQHVVRIEUHDWK$VWKPDDWWDFNVFDQODVWPLQXWHVWR
GD\VDQGFDQEHFRPHGDQJHURXVLIWKHDLUÀRZEHFRPHVVHYHUHO\UHVWULFWHG

The primary symptoms of asthma include:


• 6KRUWQHVVRIEUHDWK
• :KHH]LQJ±XVXDOO\EHJLQVVXGGHQO\PD\EHZRUVHDWQLJKWRUHDUO\LQWKHPRUQLQJDJJUDYDWHGE\H[SRVXUH
WRFROGDLUH[HUFLVHKHDUWEXUQDQGUHOLHYHGZLWKWKHXVHRIEURQFKRGLODWRUV GUXJVWKDWRSHQWKHDLUZD\V
see Medications)
• Chest tightness
• &RXJK GU\RUZLWKVSXWXP ±VRPHWLPHVWKLVLVWKHRQO\V\PSWRP

Call for emergency assistance if you have or are with someone having any of these serious symptoms:
• ([WUHPHGLI¿FXOW\EUHDWKLQJRUFHVVDWLRQRIEUHDWKLQJ
• %OXLVKFRORUWRWKHOLSVDQGIDFH FDOOHGF\DQRVLV 
• 6HYHUHDQ[LHW\
• Rapid pulse
• 3URIXVHVZHDWLQJ
• 'HFUHDVHGOHYHORIFRQVFLRXVQHVV VXFKDVGURZVLQHVVRUFRQIXVLRQ 

Additional symptoms that may be associated with an asthma attack include:


• Flared nostrils
• $EQRUPDOEUHDWKLQJSDWWHUQLQZKLFKH[KDODWLRQWDNHVPRUHWKDQWZLFHDVORQJDVLQKDODWLRQ
• 8VHRIWKHPXVFOHVEHWZHHQWKHULEV FDOOHGLQWHUFRVWDOV WRKHOSZLWKWKHLQFUHDVHGZRUNRIEUHDWKLQJ
• Coughing up blood (called hemoptysis)

Causes
$VWKPD LV PRVW OLNHO\ FDXVHG E\ D FRPELQDWLRQ RI VHYHUDO IDFWRUV ([SHUWV VXJJHVW WKDW LQ SHRSOH ZKR DUH
VXVFHSWLEOH JHQHWLFDOO\SUHGLVSRVHG IDFWRUVVXFKDVDOOHUJHQV VXEVWDQFHVWKDWFRPPRQO\LQGXFHDQDOOHUJLF
UHDFWLRQ LQIHFWLRQVGLHWDU\SDWWHUQVH[HUFLVHFLJDUHWWHVPRNHDQGVWUHVVFDQEULQJRQDQDVWKPDDWWDFN

Risk Factors
7KHIROORZLQJIDFWRUVPD\LQFUHDVHWKHULVNRIGHYHORSLQJDVWKPD
• $OOHUJLHV±FKLOGUHQZLWKDVWKPDRIWHQKDYHDOOHUJLHVDVZHOO
• )DPLO\KLVWRU\RIDVWKPDRUDOOHUJLHV
• &LJDUHWWHVPRNHLQFOXGLQJVHFRQGKDQGVPRNHIURPIRUH[DPSOHSDUHQWVRUDVSRXVH
• )RRGDOOHUJLHV±DWUXHIRRGDOOHUJ\SDUWLFXODUO\RQHWKDWLQGXFHVDVWKPDLVGLI¿FXOWWRLGHQWLI\DQGWKHUHIRUH
LWLVQRWFOHDUH[DFWO\KRZIUHTXHQWO\ RULQIUHTXHQWO\ WKLVFRQWULEXWHVWRDVWKPDLWVHHPVWREHPRUHFRPPRQ
LQFKLOGUHQWKDQLQDGXOWVDQGWKHUHVSRQVLEOHIRRGVLQFOXGHHJJVPLONZKHDWVR\SHDQXWV¿VKVKHOO¿VK
DQGVXO¿WHIRRGSHUVHUYDWLYHV
• /LYLQJLQD:HVWHUQRULQGXVWULDOL]HGFRXQWU\±VRPHH[SHUWVEHOLHYHWKDWGLHWDU\KDELWV PRUHSURFHVVHG
IRRGVOHVVIUXLWVDQGYHJHWDEOHV LQGRRUOLYLQJ UHVXOWLQJLQRYHUH[SRVXUHWRLQGRRUDOOHUJHQV HQHUJ\HI¿FLHQW
KRPHV WUDSSLQJDOOHUJHQLFGXVWPLWHVLQVLGH LPPXQL]DWLRQVDQGSRVVLEO\GHFOLQLQJUDWHVRIEUHDVWIHHGLQJ
FRQWULEXWHWRWKHULVLQJUDWHVRIDVWKPD
24 Asthma

• Urban living
• *HQGHU±DPRQJ\RXQJHUFKLOGUHQDVWKPDGHYHORSVWZLFHDVIUHTXHQWO\LQER\VDVLQJLUOVEXWDIWHUSXEHUW\
it may be more common in girls
• 2EHVLW\±FRQWURYHUVLDODUHFHQWVWXG\VXJJHVWVWKDWDVWKPDLVRYHUGLDJQRVHGDPRQJREHVHSHRSOH

Triggers
&KLOGKRRGDVWKPDLQSDUWLFXODUFDQEHWULJJHUHGE\DOPRVWDOORIWKHVDPHWKLQJVWKDWWULJJHUDOOHUJLHVVXFKDV
WKHIROORZLQJ
• 6HQVLWLYLW\WRDOOHUJHQVLQWKHDLUVXFKDVGXVWFRFNURDFKZDVWHDQLPDOGDQGHULQGRRUDQGRXWGRRUPROG
pollens
• 5HVSLUDWRU\LQIHFWLRQV
• $LUSROOXWDQWVVXFKDVVPRNHIURPWREDFFRRUD¿UHSODFHDHURVROVSHUIXPHVIUHVKQHZVSULQWGLHVHOSDUWLFOHV
VXOIXUGLR[LGHHOHYDWHGR]RQHOHYHOVDQGIXPHVIURPSDLQWFOHDQLQJSURGXFWVDQGJDVVWRYHV
• &KDQJHVLQWKHZHDWKHUHVSHFLDOO\LQWHPSHUDWXUH SDUWLFXODUO\FROG DQGKXPLGLW\

Other triggers include:


• %HKDYLRUVWKDWDIIHFWEUHDWKLQJ H[HUFLVLQJODXJKLQJFU\LQJ\HOOLQJ 
• Stress

Diagnosis
7KHV\PSWRPVRIDVWKPDFDQPLPLFVHYHUDORWKHUFRQGLWLRQVDQGDGRFWRUPXVWWDNHDWKRURXJKKLVWRU\WRUXOH
RXWRWKHUGLVHDVHV4XHVWLRQVZLOOOLNHO\EHDVNHGDERXWKRZDQGZKHQV\PSWRPVRFFXUDQGLIWKHUHLVDIDPLO\
KLVWRU\ RI DOOHUJLHV DQG DVWKPD RU RFFXSDWLRQDO H[SRVXUH WR FKHPLFDOV ,I DVWKPD LV VXVSHFWHG WHVWV FDOOHG
SXOPRQDU\IXQFWLRQWHVWV ZLOOSUREDEO\EHGRQHWRPHDVXUHDPRQJRWKHUWKLQJVWKHYROXPHRI\RXUOXQJVDQG
KRZPXFKDLU\RXH[KDOH2WKHUWHVWVPD\LQFOXGHFKHVWDQGVLQXV[UD\VEORRGWHVWVRUDOOHUJ\WHVWV

Preventive Care
$OWKRXJKWKHUHLVQRPHWKRGJXDUDQWHHGWRSUHYHQWDVWKPDWKHUHDUHDQXPEHURIPHDVXUHVSDUHQWVFDQWDNH
WRUHGXFHWKHLUFKLOG¶VULVNRIGHYHORSLQJDVWKPD7KHVHLQFOXGH
• ([FOXVLYHO\EUHDVWIHHGLQJIRUWKH¿UVWWRPRQWKVRIOLIHWKLVLVVXHLVFRQWURYHUVLDOKRZHYHUZLWKWKHPRVW
UHFHQW DQGODUJHVW VWXG\VXJJHVWLQJWKDWEUHDVWIHHGLQJIRUWKH¿UVWPRQWKVRIOLIHKHOSVWRSURWHFWWKH
child.
• 'HOD\LQJWKHLQWURGXFWLRQRIVROLGIRRGXQWLODJHPRQWKV
• 0DQLSXODWLQJWKHFKLOG
VHQYLURQPHQW QRWVPRNLQJGXULQJSUHJQDQF\RUDURXQGLQIDQWVHOLPLQDWLQJKRXVHKROG
DOOHUJHQVVXFKDVPLWHVDQGFRFNURDFKHV)RUH[DPSOHWRUHGXFHH[SRVXUHWRGXVWPLWHVHQFDVHPDWWUHVVHV
DQGSLOORZVLQVSHFLDOFRYHUVWKDWDUHLPSHUPHDEOHWRDOOHUJHQVDOVRUHPRYHFDUSHWVIURPEHGURRPV 
$FFRUGLQJWRFHUWDLQVWXGLHVRQDGXOWVDSSOHVDQGVHOHQLXPULFKIRRGLQWKHGLHWPD\SURWHFWDJDLQVWDVWKPDDQG
PRGHUDWHFRQVXPSWLRQRIUHGZLQHPD\EHDVVRFLDWHGZLWKOHVVVHYHUHDVWKPDDWWDFNV7KHVHIRRGVDUHKLJK
LQDQWLR[LGDQWV QDPHO\ÀDYRQRLGV ,WLVWRRHDUO\WRVD\GH¿QLWLYHO\WKDWWKHVHQXWULHQWVSURWHFWDJDLQVWDVWKPD
KRZHYHU3OXVLWLVLPSRUWDQWWRQRWHWKDWLQFHUWDLQLQGLYLGXDOVUHGZLQHPD\DFWXDOO\LQGXFHDVWKPDV\PSWRPVLI
\RXKDYHDQDOOHUJ\WRVXO¿WHVDIRRGDGGLWLYHRUDQ\RWKHUVXEVWDQFHIRXQGLQZLQH2IWHQZLQHODEHOVLQGLFDWH
LIVXO¿WHVDUHSUHVHQW
.H\VWHSVLQSUHYHQWLQJDVWKPDDWWDFNVLQFOXGHLGHQWLI\LQJWKHDOOHUJHQVDQGWKHWULJJHUVWKDWEULQJRQRUZRUVHQ
\RXUDVWKPDV\PSWRPVDQGWKHQZRUNLQJWRHOLPLQDWHRUDYRLGWKHP6RPHWLPHVLWWDNHVH[SRVXUHWRPRUHWKDQRQH
RIWKHVHIDFWRUVEHIRUHDQDVWKPDHSLVRGHLVWULJJHUHG.HHSLQJDGLDU\WRGHWHUPLQHWULJJHUVPD\EHKHOSIXO
7KHIROORZLQJFRQGLWLRQVDUHFRPPRQWULJJHUVIRUDVWKPD5HGXFH\RXUFKDQFHVRIH[SRVXUHWRWKHPE\WDNLQJ
VRPHFRPPRQVHQVHVWHSV
• 9LUDOLQIHFWLRQV FROGVÀXEURQFKLWLVSQHXPRQLD ±VWD\DZD\IURPSHRSOHZKR\RXNQRZDUHLOO
• 6LQXVLWLVDQGDOOHUJLFUKLQLWLV KD\IHYHURU\HDUURXQGDOOHUJLHV ±DYRLGVHDVRQDODOOHUJHQVE\VWD\LQJLQGRRUV
LQDLUFRQGLWLRQLQJDVPXFKDVSRVVLEOHDQGHOLPLQDWLQJLQGRRUDOOHUJHQVIHZHUDOOHUJ\DWWDFNVJHQHUDOO\PHDQV
IHZHUFDVHVRIVLQXVLWLVDQGDVWKPD
• *DVWURHVRSKDJHDOUHÀX[ KHDUWEXUQ ±DYRLGSURYRNLQJIRRGVPHGLFDWLRQDQGPHDOWLPHKDELWV

Avoid the following altogether:


• ,IVHQVLWLYHRUDOOHUJLFDVSLULQDQGQRQVWHURLGDODQWLLQÀDPPDWRU\GUXJV 16$,'V 
• %HWDEORFNHUV VXFKDVDFHEXWRORODWHQROROHVPROROODEHWDOROPHWRSUROROQDGROROSLQGROROSURSUDQRORO
and timolol) including those in eye medication
Asthma 25

• ,IVHQVLWLYHRUDOOHUJLFSURFHVVHGSRWDWRHVVKULPSGULHGIUXLWEHHUDQGZLQH±WKHVHRIWHQFRQWDLQVXO¿WH
IRRGSUHVHUYDWLYHV
$OOHUJ\GHVHQVLWL]DWLRQLI\RXKDYHDNQRZQDOOHUJ\PD\GHFUHDVHWKHQXPEHURIDVWKPDDWWDFNV\RXH[SHULHQFH
GLPLQLVKWKHLQWHQVLW\RIHDFKDWWDFNDQGORZHUWKHDPRXQWRIPHGLFDWLRQWKDW\RXQHHG

Treatment Approach
$YRLGLQJDVWKPDDWWDFNVUHGXFLQJLQÀDPPDWLRQDQGSUHYHQWLQJOXQJGDPDJHDUHWKHSULPDU\JRDOVRIWUHDWPHQW
7KLVUHTXLUHVHGXFDWLQJ\RXUVHOIDERXWDVWKPDZRUNLQJFORVHO\ZLWK\RXUGRFWRUWRGHWHUPLQHWKHVHYHULW\RI\RXU
DVWKPDDQGWRGH¿QHDWUHDWPHQWSODQDQGIROORZLQJUHFRPPHQGDWLRQV$GMXVWLQJ\RXUHQYLURQPHQWDVPXFKDV
SRVVLEOHWRSUHYHQWH[SRVXUHWRDOOHUJHQVRULUULWDQWVDUHLPSRUWDQWIRUWKHVXFFHVVIXOFRQWURORIDVWKPD&HUWDLQ
QXWULWLRQDOFKDQJHVSDUWLFXODUO\LQFUHDVLQJWKHDPRXQWRIRPHJDIDWW\DFLGVLQ\RXUGLHWDQGGHFUHDVLQJRPHJD
IDWW\DFLGVDQGDFXSXQFWXUHPD\EHXVHIXODGMXQFWV

Lifestyle
• Quit smoking
• /RVHZHLJKWLI\RXDUHRYHUZHLJKWDQGDOUHDG\KDYHDVWKPDDOWKRXJKWKHFRQQHFWLRQEHWZHHQREHVLW\DQG
DVWKPDLVQRWHQWLUHO\XQGHUVWRRGH[FHVVZHLJKWPD\SXWSUHVVXUHRQWKHOXQJVDQGWULJJHUDQLQÀDPPDWRU\
response.
• .HHSDGLDU\RIUHVSLUDWRU\FRPSODLQWV±WKLVPD\KHOSGHWHUPLQHWULJJHUV

Nutrition and Dietary Supplements


6WXGLHVLQGLFDWHWKDWSHRSOHZLWKDVWKPDWHQGWRKDYHORZOHYHOVRIFHUWDLQQXWULHQWV IRUH[DPSOHVHOHQLXPDQG
SRWDVVLXP DQGWKDWWKH:HVWHUQGLHW KLJKLQIDVWIRRGVDQGORZLQIUHVKIUXLWVDQGYHJHWDEOHV KDVEHHQDVVRFLDWHG
ZLWKKLJKHUUDWHVRIDVWKPD,QIDFWIULHGIRRGVDQGPDUJDULQHPD\EHSDUWLFXODUO\EDGHVSHFLDOO\LQFKLOGUHQ2Q
WKHRWKHUKDQGLWKDVEHHQVXJJHVWHGWKDWDGGLQJRQLRQJDUOLFSXQJHQWVSLFHVDQGDQWLR[LGDQWV VXFKDVIRRGV
ULFKLQYLWDPLQ&YLWDPLQ(ÀDYRQRLGVDQGEHWDFDURWHQH WRWKHGLHWPD\KHOSUHGXFHV\PSWRPV

Magnesium
7ZRODUJHVWXGLHVIRXQGWKDWORZGLHWDU\PDJQHVLXPLQWDNHPD\EHDVVRFLDWHGZLWKULVNRIGHYHORSLQJDVWKPDLQ
both children and adults.

N-acetylcysteine
$UHYLHZRIVFLHQWL¿FVWXGLHVVXJJHVWVWKDW1DFHW\OF\VWHLQHPD\KHOSGLVVROYHPXFXVDQGLPSURYHV\PSWRPV
DVVRFLDWHGZLWKDVWKPD

Omega-3 Fatty Acids


3UHOLPLQDU\ UHVHDUFK RQ DGXOWV ZLWK DVWKPD VXJJHVWV WKDW DQ RPHJD IDWW\ DFLG VXSSOHPHQW PD\ UHGXFH
LQÀDPPDWLRQDQGLPSURYHOXQJIXQFWLRQ
2QHWKLQJWKDWFDQEHVDLGDERXWRPHJDIDWW\DFLGVLVWKDWLI\RXHQULFK\RXUGLHWZLWKWKLVW\SHRIHVVHQWLDO
IDWW\DFLG IURPIRRGVVXFKDVFROGZDWHU¿VKÀD[VHHGVSXPSNLQVHHGVDQGZDOQXWV DQGUHGXFH\RXULQWDNH
RIRPHJDIDWW\DFLGV IURPIRRGVOLNHPHDWHJJ\RONVDQGFHUWDLQFRRNLQJRLOV WKLVLVOLNHO\WRKHOSLPSURYH
your symptoms.

Potassium
'DWDIURPVHYHUDOVWXGLHVVXJJHVWWKDWFRPSDUHGWRGLHWVZLWKQRUPDODPRXQWVRISRWDVVLXPGLHWVORZLQSRWDVVLXP
DUHDVVRFLDWHGZLWKSRRUOXQJIXQFWLRQDQGHYHQDVWKPDLQFKLOGUHQ,PSURYLQJGLHWDU\LQWDNHRISRWDVVLXPWKURXJK
IRRGVVXFKDV¿VKIUXLWVDQGYHJHWDEOHVPD\WKHUHIRUHEHYDOXDEOHIRUSUHYHQWLQJRUWUHDWLQJDVWKPD$GHTXDWH
DPRXQWVRIPDJQHVLXPDUHQHHGHGWRPDLQWDLQQRUPDOOHYHOVRISRWDVVLXP,QDGGLWLRQWKHGUXJWKHRSK\OOLQH
XVHGVRPHWLPHVIRUDVWKPD PD\GHSOHWHSRWDVVLXPDVFDQH[FHVVLYHLQWDNHRIVDOWRUFDIIHLQHLQWKHGLHW

Quercetin
4XHUFHWLQZKLFKLVDPHPEHURIDJURXSRIDQWLR[LGDQWVFDOOHGÀDYRQRLGVLQKLELWVWKHSURGXFWLRQDQGUHOHDVH
RIKLVWDPLQHDQGRWKHUDOOHUJLFLQÀDPPDWRU\VXEVWDQFHV+LVWDPLQHLVDVXEVWDQFHWKDWFRQWULEXWHVWRDOOHUJ\
V\PSWRPVVXFKDVDUXQQ\QRVHZDWHU\H\HVDQGKLYHV/LNHRWKHUÀDYRQRLGVTXHUFHWLQLVDSODQWSLJPHQW
UHVSRQVLEOHIRUFRORUVVHHQLQIUXLWVDQGYHJHWDEOHV
26 Asthma

Selenium
6WXGLHVVXJJHVWWKDWSHRSOHZLWKDVWKPDWHQGWRKDYHORZEORRGOHYHOVRIVHOHQLXP,QDGGLWLRQDSRSXODWLRQEDVHG
VWXG\ VWXGLHVWKDWHYDOXDWHJURXSVRISHRSOH VXJJHVWHGWKDWHDWLQJVHOHQLXPULFKIRRGVPD\KDYHDSURWHFWLYH
HIIHFWDJDLQVWDVWKPD3OXVWDNLQJVHOHQLXPVXSSOHPHQWVPD\SURYHWREHKHOSIXODVZHOO,QDVWXG\RISHRSOH
ZLWKDVWKPDIRUH[DPSOHWKRVHZKRUHFHLYHGVHOHQLXPVXSSOHPHQWVIRUZHHNVGHPRQVWUDWHGDVLJQL¿FDQW
LPSURYHPHQWLQV\PSWRPVFRPSDUHGWRWKRVHZKRUHFHLYHGSODFHER0RUHVWXGLHVZLWKODUJHUQXPEHUVRISHRSOH
DQGODVWLQJORQJHUWKDQZHHNVDUHQHHGHGWRGHWHUPLQHZKHWKHUVHOHQLXPVXSSOHPHQWDWLRQLVWUXO\VDIHDQG
HIIHFWLYHIRUSHRSOHZLWKDVWKPD

Vitamin C
$OWKRXJKUHVHDUFKLVOLPLWHGWKHUHLVVRPHLQGLFDWLRQWKDWYLWDPLQ&SDUWLFXODUO\IURPIUHVKIUXLWLQ\RXUGLHWPD\
EHXVHIXOIRUWUHDWLQJDOOHUJ\UHODWHGFRQGLWLRQVVXFKDVDVWKPD

Other
2WKHUVXSSOHPHQWVWKDWPD\KDYHEHQH¿WIRUDVWKPDLQFOXGH
• &RHQ]\PH4 &R4 ±LI\RXKDYHDVWKPD\RXPD\KDYHORZOHYHOVRIWKLVDQWLR[LGDQWLQ\RXUEORRG
,WLVQRWNQRZQDWWKLVWLPHKRZHYHUZKHWKHUWDNLQJ&R4VXSSOHPHQWVZLOOPDNHDQ\GLIIHUHQFHLQ\RXU
symptoms.
• /DFWREDFLOOXVDFLGRSKLOXV±WKHUHLVVRPHHYLGHQFHWKDWWKLVJRRGRUJDQLVP FDOOHGDSURELRWLF ZKLFKLV
IRXQGQDWXUDOO\LQWKHJXWPD\UHGXFHWKHULVNRIGHYHORSLQJDQDOOHUJLFUHDFWLRQLQFOXGLQJDVWKPD,QIDFW
VRPHHDUO\HYLGHQFHVXJJHVWVWKDWLIPRWKHUVZKRKDYHDWOHDVWRQHUHODWLYHZLWKDVWKPDRUVRPHRWKHU
DOOHUJ\UHODWHGLOOQHVVWDNHWKLVSURELRWLFZKLOHSUHJQDQWDQGEUHDVWIHHGLQJWKHLUEDELHVPD\EHOHVVOLNHO\
to develop asthma.
• /\FRSHQHDQGEHWDFDURWHQH±SUHOLPLQDU\GDWDVXJJHVWVWKDWHDFKRIWKHVHWZRDQWLR[LGDQWVPD\SURYH
XVHIXOIRUSUHYHQWLQJH[HUFLVHLQGXFHGDVWKPDV\PSWRPVZKHQWDNHQGDLO\
• 9LWDPLQ%±PD\EHQHHGHGLI\RXDUHWDNLQJWKHRSK\OOLQHEHFDXVHWKLVPHGLFDWLRQFDQORZHUEORRGOHYHOV
RIWKLVQXWULHQW

Suggested Nutritional Supplementation

Acute Management
• D-43 Bronchasthmol ²GURSVXQGHUWRQJXHWLPHVGDLO\$FXWHGURSVXQGHUWRQJXHHYHU\
PLQXWHV
• &0HWKR[\ÀDYRQH²WDEOHWVLQLWLDOO\WKHQWDEOHWHYHU\PLQXWHVXQWLOV\PSWRPVVXEVLGH
&0HWKR[\ÀDYRQHLVDV\QHUJLVWLFIRUPXODWKDWIHDWXUHVDVSHFLDOL]HGFRPSOH[RIELRÀDYRQRLGV
FRPELQHGZLWKYLWDPLQ&
9LWDPLQ&DQGWKHELRÀDYRQRLGVDUHNQRZQWREHKHOSIXOLQUHGXFLQJWKHHIIHFWVRIDOOHUJ\PHGLDWHGEURQFKLDO
DVWKPDVRPHWLPHVVWRSSLQJWKHDWWDFNLQDVOLWWOHDV¿YHPLQXWHV
• Nazanol ²WDEOHWVWLPHVGDLO\RQHPSW\VWRPDFK
1DWXUDOVWLPXODQWIUHHKHUEDOVXSSRUWIRUKHDOWK\VLQXVQDVDODQGOXQJIXQFWLRQ
• DMG Sublingual ²WDEOHWXQGHUWRQJXHHYHU\PLQXWHVXQWLOV\PSWRPVVXEVLGH
5HVHDUFKKDVVKRZQ'0*WREHDSK\VLRORJLFDOO\DFWLYHLQJUHGLHQWWKDW LVDQDQWLVWUHVVDJHQWWKDWFDQ
VLJQL¿FDQWO\LPSURYHSK\VLFDODQGPHQWDOSHUIRUPDQFH FDQLPSURYHDQGVWLPXODWHR[\JHQXWLOL]DWLRQDQG
WKHUHE\UHGXFHK\SR[LF ORZR[\JHQ VWDWHVLQWKHERG\DQG FDQLQFUHDVHUHVLVWDQFHWRGLVHDVHDQGLQIHFWLRQ
E\VWUHQJWKHQLQJERWKDUPVRIWKHLPPXQHUHVSRQVHV\VWHPLQFOXGLQJDQWLERG\DQGO\PSKRF\WHSURGXFWLRQ
• Mega B12 / Folic — 4 drops three times daily
+LJKO\FRQFHQWUDWHG%IROLFDFLGOLTXLG
• NOTE: &KLOGKRRGDVWKPDKDVEHHQVKRZQWRUHVSRQGUHPDUNDEO\ZHOOWR%WKHUDS\

Chronic Management
• VentiMax — $GXOWVFDSVXOHVWZLFHGDLO\ZLWKPHDOV&KLOGUHQRYHU\HDUVFDSVXOHWZLFHGDLO\ZLWK
PHDOV&KLOGUHQXQGHU\HDUV8VH9HQWL0D[3'
9HQWL0D[LVWKHRQO\VFLHQWL¿FDOO\GHVLJQHGQXWULWLRQDOVXSSOHPHQWIRUDVWKPDIUHHRIKLGGHQKHUEDOVWLPXODQWV
VXFKDVFDIIHLQHWKHRSK\OOLQHDQGHSKHGULQH
• VentiMax PD ²&KLOGUHQ\HDUVWHDVSRRQVWZLFHGDLO\PL[HGLQDSSOHRUSHDUMXLFH&KLOGUHQ
\HDUV7DEOHVSRRQWZLFHGDLO\PL[HGLQDSSOHRUSHDUMXLFH
• Perimine™ ²WDEOHWVWZLFHGDLO\ZLWKIRRG
3DWHQWHG)ODYRQRLG5LFK3HULOOD6HHG([WUDFW
Asthma 27

In severe chronic asthma, Dr. Jeffrey Bland recommends adding


• 8OWUD,QÀDP;3OXV²VFRRSVWZLFHGDLO\
0XOWLPHFKDQLVWLF VXSSRUW ZLWK NH\ QXWULHQWV SK\WRQXWULHQWV DQG VHOHFWLYH NLQDVH UHVSRQVH PRGXODWRUV
6.50V WRDGGUHVVXQGHUO\LQJLQÀDPPDWLRQ

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW

Supporting Research
• $OLJQH&$$XLQJHU3%\UG56:HLW]PDQ05LVNIDFWRUVIRUSHGLDWULFDVWKPD&RQWULEXWLRQVRISRYHUW\UDFHDQGXUEDQUHVLGHQFH$P-
5HVSLU&ULW&DUH0HG 3W 
• $PHULFDQ&ROOHJHRI$OOHUJ\$VWKPDDQG,PPXQRORJ\$FFHVVHGDWKWWSZZZDOOHUJ\PFJHGXSDWLHQWVFRQWUROKWPO on July 22, 2002.
• %DORQ-$NHU3'&URZWKHU(5HWDO$FRPSDULVRQRIDFWLYHDQGVLPXODWHGFKLURSUDFWLFPDQLSXODWLRQDVDGMXQFWLYHWUHDWPHQWIRUFKLOGKRRG
DVWKPD1(QJO-0HG
• %LUNHO'$(GJUHQ/+DWKD\RJDLPSURYHGYLWDOFDSDFLW\RIFROOHJHVWXGHQWV$OWHUQ7KHU+HDOWK0HG  
• %URQIRUW*(YDQV5/.XELF3)LONLQ3&KURQLFSHGLDWULFDVWKPDDQGFKLURSUDFWLFVSLQDOPDQLSXODWLRQDSURVSHFWLYHFOLQLFDOVHULHVDQG
UDQGRPL]HGFOLQLFDOSLORWVWXG\-0DQLSXODWLYH3K\VLRO7KHU  
• &DUU$&)UHL%7RZDUGDQHZUHFRPPHQGHGGLHWDU\DOORZDQFHIRUYLWDPLQ&EDVHGRQDQWLR[LGDQWDQGKHDOWKHIIHFWVLQKXPDQV$P-&OLQ
1XWU  
• &LDUDOOR/%URXVVHDX'5HLQHUW6+LJKHUGRVHLQWUDYHQRXVPDJQHVLXPWKHUDS\IRUFKLOGUHQZLWKPRGHUDWHWRVHYHUHDFXWHDVWKPD$UFK
3HG$GRO0HG  
• &LDUDOOR/6DXHU$+6KDQQRQ0:,QWUDYHQRXVPDJQHVLXPWKHUDS\IRUPRGHUDWHWRVHYHUHSHGLDWULFDVWKPDUHVXOWVRIDUDQGRPL]HG
SODFHERFRQWUROOHGWULDO
• -3HGLDWU  
• &XPPLQJV68OOPDQ'(YHU\ERG\¶V*XLGHWR+RPHRSDWKLF0HGLFLQHVUGHG1HZ<RUN1<3HQJXLQ3XWQDP
• (UQVW(%UHDWKLQJWHFKQLTXHV±DGMXQFWLYHWUHDWPHQWPRGDOLWLHVIRUDVWKPD"$V\VWHPDWLFUHYLHZ(XU5HVSLU-  
• )LHOG7+HQWHOHII7+HUQDQGH]5HLI0HWDO&KLOGUHQZLWKDVWKPDKDYHLPSURYHGSXOPRQDU\IXQFWLRQVDIWHUPDVVDJHWKHUDS\-3HGLDWU
 
• )XQJ.3&KRZ2.:6R6<$WWHQWXDWLRQRIH[HUFLVHLQGXFHGDVWKPDE\DFXSXQFWXUH/DQFHW  
• *D]GRO ) *YR]GMDNRYD $ 1DGYRUQLNRYD 5 HW DO 'HFUHDVHG OHYHOV RI FRHQ]\PH 4   LQ SDWLHQWV ZLWK EURQFKLDO DVWKPD $OOHUJ\
  
• *GDOHYLFK00LPRXQL'0LPRXQL0%UHDVWIHHGLQJDQGWKHULVNRIEURQFKLDODVWKPDLQFKLOGKRRGDV\VWHPDWLFUHYLHZZLWKPHWDDQDO\VLV
RISURVSHFWLYHVWXGLHV-3HGLDWU  
• *LOOLODQG)'%HUKDQH.7/L<).LP'+0DUJROLV+*'LHWDU\PDJQHVLXPSRWDVVLXPVRGLXPDQGFKLOGUHQ
VOXQJIXQWLRQ$P-(SLGHPLRO
  
• *UDKDP5,3LVWROHVH5$$QLPSDLUPHQWUDWLQJDQDO\VLVRIDVWKPDWLFFKLOGUHQXQGHUFKLURSUDFWLFFDUH-9HUWHEU6XEOX[5HV  
48.
• *XSWD,*XSWD93DULKDU$HWDO(IIHFWVRI%RVZHOOLDVHUUDWDJXPUHVLQLQSDWLHQWVZLWKEURQFKLDODVWKPDUHVXOWVRIDGRXEOHEOLQGSODFHER
FRQWUROOHGZHHNFOLQLFDOVWXG\(XU-0HGLFDO5HVHDUFK  
• +DE\003HDW-.0DUNV*%:RROFRFN$-/HHGHU65$VWKPDLQSUHVFKRROFKLOGUHQSUHYDOHQFHDQGULVNIDFWRUV7KRUD[  
595.
• +DFNPDQ506WHUQ-6*HUVKZLQ0(+\SQRVLVDQGDVWKPDDFULWLFDOUHYLHZ-$VWKPD  
• +DVVHOPDUN/0DOPJUHQ5=HWWHUVWURP22QJH*6HOHQLXPVXSSOHPHQWDWLRQLQLQWULQVLFDVWKPD$OOHUJ\
• +LMD]L 1$EDONKDLO % 6HDWRQ$ 'LHW DQG FKLOGKRRG DVWKPD LQ D VRFLHW\ LQ WUDQVLWLRQ D VWXG\ LQ XUEDQ DQG UXUDO 6DXGL$UDELD 7KRUD[

• +RQGUDV0$/LQGH.-RQHV$30DQXDOWKHUDS\IRUDVWKPD &RFKUDQH5HYLHZ &RFKUDQH'DWDEDVH6\VW5HY  &'
• +RSH%(0DVVH\'%)RXUQLHU0DVVH\*+DZDLLDQPDWHULDPHGLFDIRUDVWKPD+DZDLL0HG-
• +RZHV/*:KLFKGUXJVDIIHFWSRWDVVLXP"'UXJ6DI  
• +XQWOH\$:KLWH$5(UQVW(5HOD[DWLRQWKHUDSLHVIRUDVWKPDDV\VWHPDWLFUHYLHZ7KRUD[ 
• -DLQ 6& 5DL / 9DOHFKD$ -KD 8. %KDWQDJDU 62 5DP . (IIHFW RI \RJD WUDLQLQJ RQ H[HUFLVH WROHUDQFH LQ DGROHVFHQWV ZLWK FKLOGKRRG
DVWKPD-$VWKPD  
• -RRV66FKRWW&=RX+'DQLHO90DUWLQ(,PPXQRPRGXODWRU\HIIHFWVRIDFXSXQFWXUHLQWKHWUHDWPHQWRIDOOHUJLFDVWKPDDUDQGRPL]HG
FRQWUROOHGVWXG\-$OW&RPS0HG  
• .DGUDERYD-0DG
DULF$.RYDFLNRYD=3RGLYLQVN\)*LQWHU(*D]GLN)6HOHQLXPVWDWXVLVGHFUHDVHGLQSDWLHQWVZLWKLQWULQVLFDVWKPD
%LRO7UDFH(OHP5HV  
• .DOOLRPDNL06DOPLQHQ6$UYLORPPL+.HUR3.RVNLQHQ3,VRODXUL(3URELRWLFVLQSULPDU\SUHYHQWLRQRIDWRSLFGLVHDVHDUDQGRPL]HG
SODFHERFRQWUROOHGWULDO/DQFHW  
• .DXU%5RZH%+5DP)69LWDPLQ&VXSSOHPHQWDWLRQIRUDVWKPD &RFKUDQH5HYLHZ &RFKUDQH'DWDEVH6\VW5HY&'
• .OHLMQHQ-WHU5LHW*.QLSVFKLOG3$FXSXQFWXUHDQGDVWKPDDUHYLHZRIFRQWUROOHGWULDOV7KRUD[
• .RKHQ'3:\QQH($SSO\LQJK\SQRVLVLQDSUHVFKRROIDPLO\DVWKPDHGXFDWLRQSURJUDPXVHVRIVWRU\WHOOLQJLPDJHU\DQGUHOD[DWLRQ$P
-&OLQ+\SQRVLV  
• .UX]HO77KH+RPHRSDWKLF(PHUJHQF\*XLGH%HUNHOH\&DOLI1RUWK$WODQWLF%RRNV
• /HKUHU3(PRWLRQDOO\WULJJHUHGDVWKPDDUHYLHZRIUHVHDUFKOLWHUDWXUHDQGVRPHK\SRWKHVHVRIVHOIUHJXODWLRQWKHUDSLHV$SSO3V\FKRSK\VLRO
%LRIHHGEDFN  
• /HKUHU3)HOGPDQ-*LDUGLQR16RQJ+66FKPDOLQJ.3V\FKRORJLFDODVSHFWVRIDVWKPD-&RQVXOW&OLQ3V\FKRO  
• /HYLQH 0 5XPVH\ 6& 'DUXZDOD 5 3DUN -% :DQJ < &ULWHULD DQG UHFRPPHQGDWLRQV IRU YLWDPLQ & LQWDNH -$0$   
1453.
• /LQGH.-REVW.3DQWRQ-$FXSXQFWXUHIRUFKURQLFDVWKPD &RFKUDQH5HYLHZ ,Q7KH&RFKUDQH/LEUDU\,VVXH2[IRUG8SGDWH
6RIWZDUH
• 0D]XU /- 'H <EDUURQGR / 0LOOHU - &RODVXUGR * 8VH RI DOWHUQDWLYH DQG FRPSOHPHQWDU\ WKHUDSLHV IRU SHGLDWULF DVWKPD 7H[ 0HG
  
• 0H\GDQL61+D:.,PPXQRORJLFHIIHFWVRI\RJXUW$P-&OLQ1XWU  
• 0LGGOHWRQ(HG$OOHUJ\3ULQFLSOHVDQG3UDFWLFHWKHG6W/RXLV0R0RVE\<HDU%RRN,QF
• 0LOOHU$/7KHHWLRORJLHVSDWKRSK\VLRORJ\DQGDOWHUQDWLYHFRPSOHPHQWDU\WUHDWPHQWRIDVWKPD$OWHUQ0HG5HY  
28 Asthma

• 0RQWHOHRQH&$6KHUPDQ$51XWULWLRQDQGDVWKPD$UFK,QWHUQ0HG
• 1DJDNXUD70DWVXGD66KLFKLM\R.6XJLPRWR++DWD.'LHWDU\VXSSOHPHQWDWLRQZLWK¿VKRLOULFKLQRPHJDSRO\XQVDWXUDWHGIDWW\DFLGV
LQFKLOGUHQZLWKEURQFKLDODVWKPD(XU5HVS-  
• 1HXPDQ , 1DKXP + %HQ$PRW]$ 3UHYHQWLRQ RI H[HUFLVHLQGXFHG DVWKPD E\ D QDWXUDO LVRPHU PL[WXUH RI EHWDFDURWHQH$QQ$OOHUJ\
$VWKPD,PPXQRO  
• 1HXPDQ , 1DKXP + %HQ$PRW]$ 5HGXFWLRQ RI H[HUFLVHLQGXFHG DVWKPD R[LGDWLYH VWUHVV E\ O\FRSHQH D QDWXUDO DQWLR[LGDQW$OOHUJ\
  
• 1HZQKDP '0 $VWKPD PHGLFDWLRQV DQG WKHLU SRWHQWLDO DGYHUVH HIIHFWV LQ WKH HOGHUO\ UHFRPPHQGDWLRQV IRU SUHVFULELQJ 'UXJ 6DI
  
• 1,+&RQVHQVXV6WDWHPHQW$FXSXQFWXUH1DWLRQDO,QVWLWXWHVRI+HDOWK2I¿FHRIWKH'LUHFWRU  $FFHVVHGDWhttp://odp.od.nih.
gov/consensus/cons/107/107_statement.htm on September 24, 2001.
• 1LHOVHQ1+%URQIRUW*%HQGL[70DGVHQ):HHNH%&KURQLFDVWKPDDQGFKLURSUDFWLFVSLQDOPDQLSXODWLRQDUDQGRPL]HGFOLQLFDOWULDO&OLQ
([S$OOHUJ\
• 2NDPRWR00LVXQREX)$VKLGD.0LIXQH7+RVDNL<7VXJHQR+HWDO(IIHFWVRIGLHWDU\VXSSOHPHQWDWLRQZLWKQIDWW\DFLGVFRPSDUHG
ZLWKQIDWW\DFLGVRQEURQFKLDODVWKPD,QW0HG  
• 2NDPRWR00LVXQREX)$VKLGD.HWDO(IIHFWVRISHULOODVHHGRLOVXSSOHPHQWDWLRQRQOHXNRWULHQHJHQHUDWLRQE\OHXFRF\WHVLQSDWLHQWVZLWK
DVWKPDDVVRFLDWHGZLWKOLSRPHWDEROLVP,QW$UFK$OOHUJ\,PPXQRO  
• 5RKGHZDOG3$UHYLHZRIWKH)UHQFKPDULWLPHSLQHEDUNH[WUDFW 3\FQRJHQRO DKHUEDOPHGLFDWLRQZLWKDGLYHUVHFOLQLFDOSKDUPDFRORJ\,QW
-&OLQ3KDUPDFRO7KHU  
• 5RPLHX,7UHQJD&'LHWDQGREVWUXFWLYHOXQJGLVHDVHV(SLGHPLRO5HY  
• 5RZH%+(GPRQGV0/6SRRQHU&+&DPDUJR&$(YLGHQFHEDVHGWUHDWPHQWVIRUDFXWHDVWKPD>5HYLHZ@5HVSLU&DUH  
1390.
• 6DQFLHU.07KHUDSHXWLFEHQH¿WVRITLJRQJH[HUFLVHVLQFRPELQDWLRQZLWKGUXJV-$OWHUQ&RPSOHPHQW0HG  
• 6DQGHUV 5 3LQH EDUN H[WUDFW LV D SRWHQW DQWLR[LGDQW DQG PD\ KHOS ERRVW WKH HIIHFWV RI YLWDPLQ & DQG RWKHU DQWLR[LGDQWV 8& %HUNHOH\
VFLHQWLVWV UHSRUW >QHZV UHOHDVH@ )HEUXDU\  $FFHVVHG DW KWWSZZZEHUNHOH\HGXQHZVPHGLDUHOHDVHVOHJDF\BBDKWPO
on July 19, 2002.
• 6DWK\DSUDEKD710XUWK\+0XUWK\%7(I¿FDF\RIQDWXURSDWK\DQG\RJDLQEURQFKLDODVWKPD±DVHOIFRQWUROOHGPDWFKHGVFLHQWL¿FVWXG\
,QG-3K\VLRO3KDUPDFRO 
• 6KDKHHQ626WHUQH-$7KRPSVRQ5/6RQJKXUVW&(0DUJHWWV%0%XUQH\3*'LHWDU\DQWLR[LGDQWVDQGDVWKPDLQDGXOWVSRSXODWLRQ
EDVHGFDVHFRQWUROVWXG\$P-5HVSLU&ULW&DUH0HG 3W 
• 6KLPL]X70DHGD6$UDNDZD+HWDO5HODWLRQEHWZHHQWKHRSK\OOLQHDQGFLUFXODWLQJYLWDPLQOHYHOVLQFKLOGUHQZLWKDVWKPD3KDUPDFRO

• 6PLW+$*ULHYLQN/7DEDN&'LHWDU\LQÀXHQFHVRQFKURQLFREVWUXFWLYHOXQJGLVHDVHDQGDVWKPDDUHYLHZRIWKHHSLGHPLRORJLFDOHYLGHQFH
3URF1XWU6RF  
• 7DPDRNL-1DNDWD-.DZDWDQL.7DJD\D(1DJDL$*LQVHQRVLGHLQGXFHGUHOD[DWLRQRIKXPDQEURQFKLDOVPRRWKPXVFOHYLDUHOHDVHRIQLWULF
R[LGH%U-3KDUPDFRO  
• 8OOPDQ'+RPHRSDWKLF0HGLFLQHIRU&KLOGUHQDQG,QIDQWV1HZ<RUN1<3HQJXLQ3XWQDP
• 8OOPDQ'7KH&RQVXPHU¶V*XLGHWR+RPHRSDWK\1HZ<RUN1<3HQJXLQ3XWQDP
• 8UDWD<<RVKLGD6,ULH<HWDO7UHDWPHQWRIDVWKPDSDWLHQWVZLWKKHUEDOPHGLFLQH7-DUDQGRPL]HGFRQWUROOHGWULDO5HVSLU0HG
-XQ  
• 9DOO\+&DUU$(O6DOHK-7KRPSVRQ3:LQHLQGXFHGDVWKPDDSODFHERFRQWUROOHGDVVHVVPHQWRILWVSDWKRJHQHVLV-$OOHUJ\&OLQ,PPXQRO
 3W 
• 9HGDQWKDQ 3..HVDYDOX/10XUWK\.&HWDO&OLQLFDO VWXG\RI\RJDWHFKQLTXHV LQXQLYHUVLW\VWXGHQWVZLWKDVWKPDDFRQWUROOHG VWXG\
$OOHUJ\$VWKPD3URF  
• <RVKLGD6+HUEDOLVPIRUWKHWUHDWPHQWRIDVWKPD&KHVW  
• =LPHQW,7DVKNLQ'3$OWHUQDWLYHPHGLFLQHIRUDOOHUJ\DQGDVWKPD-$OOHUJ\&OLQ,PPXQRO  
Autoimmune Diseases 29

Autoimmune Diseases
Examples of autoimmune conditions include the following:
• Rheumatoid arthritis (RA) • /XSXV HJV\VWHPLFOXSXVHU\WKHPDWRVXV>6/(@
• Type 1 diabetes • ,QÀDPPDWRU\ERZHOGLVHDVH ,%' 
• Crohn’s Disease • Ulcerative Colitis
• Hashimoto’s thyroiditis • *UDYH¶VGLVHDVH
• Neurological diseases • 0\DVWKHQLD*UDYLV
• Multiple Sclerosis (MS) • Vitiligo
• *ORPHUXODQHSKULWLV ‡Sjogren's Syndrome
• 3HUQLFLRXV$QDHPLD ‡Addison’s Disease
• *RRGSDVWXUH¶VV\QGURPH ‡Autoimmune Haemolytic Anaemia
• Scleroderma • ,GLRSDWKLF7KURPERF\WRSHQLF3XUSXUD
• 5D\QDXG
V3KHQRPHQRQ
7KHWHUP$XWRLPPXQH'LVHDVHVUHIHUVWRDYDULHGJURXSRIPRUHWKDQGLVWLQFWFKURQLFLOOQHVVHVLQZKLFKWKH
XQGHUO\LQJ SUREOHP LV VLPLODU ² WKH ERG\¶V LPPXQH V\VWHP LV PLVGLUHFWHG DWWDFNLQJ WKH ERG\ WLVVXHV LW ZDV
GHVLJQHG WR SURWHFW$XWRLPPXQH GLVHDVH FDQ DIIHFW DQ\ V\VWHP RUJDQ RU WLVVXH LQ WKH ERG\ LQFOXGLQJ WKH
JDVWURLQWHVWLQDO *, QHUYRXVDQGHQGRFULQHV\VHPVDVZHOODVWKHH\HVEORRGEORRGYHVVHOVDQGVNLQDQG
other connective tissues.
7KHSXUSRVHRIWKLVJXLGHLVWRRIIHUDIXQFWLRQDOPHGLFLQHDSSURDFKWRDGGUHVVLQJWKHYDULRXVLVVXHVDVVRFLDWHG
ZLWKDXWRLPPXQHGLVHDVH7KHVWUDWHJLHVGLVFXVVHGLQWKLVJXLGHDUHQRWLQWHQGHGWRWUHDWGLVHDVHEXWWRLGHQWLI\
SRVVLEOHWULJJHUVDQGDGGUHVVXQGHUO\LQJDQGPHGLDWLQJIDFWRUVVXFKDV
 ‡6H[KRUPRQHV ‡'UXJV FKHPLFDOV
 ‡*,EDUULHUIXQFWLRQ PLFURÀRUDEDODQFH ‡7KHOSHU 7K GRPLQDQFH
 ‡,QÀDPPDWLRQ ‡,PSDLUHGELRWUDQVIRUPDWLRQ GHWR[L¿FDWLRQ
 ‡1XWULWLRQDOGH¿FLHQFLHV ‡2[LGDWLYHVWUHVV

Triggers — Minimize the impact of physiological and environmental triggers

Sex Hormones
7KHVH[KRUPRQHV²SDUWLFXODUO\HVWURJHQ²DSSHDUWRSOD\DUROHDVPHGLDWRUVDQGSHUSHWXDWRUVRILQÀDPPDWRU\
DQGDXWRLPPXQHGLVRUGHUV7KLVPD\H[SODLQWKHKLJKHULQFLGHQFHRIDXWRLPPXQHGLVHDVHVDPRQJZRPHQDQG
ÀXFWXDWLRQVRIGLVHDVHVHYHULW\REVHUYHGLQSUHJQDQWZRPHQ,QIDFWLW¶VEHHQVKRZQWKDWV\QRYLDOÀXLGOHYHOVRISUR
LQÀDPPDWRU\HVWURJHQVUHODWLYHWRDQGURJHQVDUHVLJQL¿FDQWO\HOHYDWHGLQERWKIHPDOHDQGPDOH5$SDWLHQWV

Sex Hormone Activity


5HVHDUFKVXJJHVWVWKDWVH[KRUPRQHVLQÀXHQFHWKHLPPXQHUHVSRQVHLQDQXPEHURIZD\V(VWURJHQDSSHDUV
WR HQKDQFH7K DFWLYLW\ ZKHUHDV DQGURJHQV DQG SURJHVWHURQH SRVVHVV LPPXQRVXSSUHVVLYH SURSHUWLHV7KH
ORFDO HIIHFWV RI VH[ KRUPRQHV DSSHDU WR FRQVLVW SULPDULO\ RI WKH PRGXODWLRQ RI FHOO SUROLIHUDWLRQ DQG F\WRNLQH
production.

Estrogen Metabolism
$QLQWHUHVWLQJDVSHFWRIWKHREVHUYDWLRQVFRQFHUQLQJHVWURJHQVDQGDXWRLPPXQLW\UHODWHVWRHVWURQHPHWDEROLVP
and to the 16ȽK\GUR[\ODWHG PHWDEROLWH²D PLWRJHQLF HVWURJHQ WKDW DSSHDUV WR LQFUHDVH HVWURJHQLQGXFHG
DXWRLPPXQLW\²LQUHODWLRQWROHYHOVRIWKHK\GUR[\ODWHGPHWDEROLWHZKLFKLVQRWPLWRJHQLFRULPPXQRJHQLF
$QXPEHURIVWXGLHVRQSDWLHQWVZLWK5$DQG6/(KDYHGHPRQVWUDWHGHOHYDWHGOHYHOVRIWKHPLWRJHQLFȽ
K\GUR[\HVWURQH Ƚ2+( OLNHO\FRQWULEXWLQJWRWKHFHOOXODUSUROLIHUDWLYHVWDWHREVHUYHGLQWKHVHDXWRLPPXQH
diseases.
30 Autoimmune Diseases

Considerations
• 3URPRWHHVWURJHQGHWR[L¿FDWLRQWRSUHYHQWHVWURJHQGRPLQDQFHLQUHODWLRQWRDQGURJHQDQGSURJHVWHURQH
• 6XSSRUWWKHK\GUR[\ODWLRQDQGPHWK\ODWLRQRIHVWURJHQVWRKHOSIDYRUWKHFRQYHUVLRQRI2+RYHUȽ2+
estrogens
• $VVHVVZLWKVHFWLRQ;,,RI+HDOWK$SSUDLVDO4XHVWLRQQDLUH +$4

Nutritional Support
• ,QGROHFDUELQRO ,& WRSURPRWH2+HVWURJHQFRQYHUVLRQ Meta I3C
• 1RQVR\LVRÀDYRQHVZLWKELRDFWLYHIRODWHIRUKHDOWK\HVWURJHQEDODQFHEstroFactors
• 0HGLFDOIRRGIRUKHDOWK\KRUPRQHEDODQFHEstrium
• 0HWDEROLFGHWR[L¿FDWLRQSURJUDP
• $QWLLQÀDPPDWRU\GLHWSURJUDP

Drugs & Chemicals


,WLVQRZDSSDUHQWWKDWDQXPEHURIGUXJVDQGHQYLURQPHQWDOSROOXWDQWVFDQLQGXFHLPPXQRWR[LFHIIHFWVUHVXOWLQJ
LQWKHDSSHDUDQFHRIDXWRDQWLERGLHVDQGLQVRPHLQVWDQFHVLQWKHDSSHDUDQFHRIDXWRLPPXQHFOLQLFDOV\QGURPHV
2QHRIWKHPRVWVWXGLHGGLVHDVHVLQUHODWLRQWRHQYLURQPHQWDOIDFWRUVLVOXSXVDOWKRXJKWKHUHLVLQFUHDVLQJUHVHDUFK
RQFRQGLWLRQVVXFKDVVFOHURGHUPD5$YDVFXOLWLVDVZHOODVPXVFOHEORRGDQGQHXURORJLFGLVRUGHUV

Drugs
2YHUGUXJVKDYHEHHQUHSRUWHGWREHUHODWHGWRDXWRLPPXQHFRQGLWLRQVDQGKDYHEHHQSDUWLFXODUO\LPSOLFDWHG
LQWKHGHYHORSPHQWRIGUXJUHODWHGOXSXV '5/ DFRQGLWLRQVRPHWLPHVDFFRPSDQLHGE\FHQWUDOQHUYRXVV\VWHP
DQG UHQDO LQYROYHPHQW 6SHFL¿F IDPLOLHV RI GUXJV WKDW KDYH EHHQ LGHQWL¿HG DV DXWRLPPXQHLQGXFLQJ DJHQWV
LQFOXGHDQWLFRQYXOVDQWVEHWDEORFNHUVDQGVXOIRQDPLGHV,QWHUHVWLQJO\FRPPRQGUXJVDVVRFLDWHGZLWK'5/DUH
HVWURJHQVJROGVDOWV DOVRXVHGWRWUHDW5$ SHQLFLOOLQDQGLQWHUIHURQ

Environmental Pollutants
0DQ\HQYLURQPHQWDOSROOXWDQWV²VXFKDV[HQRELRWLFVPHUFXU\FDGPLXPJROGRUJDQLFVROYHQWVYLQ\OFKORULGH
SULVWDQH DFRPSRXQGRIPLQHUDORLO DQGSHVWLFLGHV²PD\FDXVHDGYHUVHUHDFWLRQVLQVXVFHSWLEOHLQGLYLGXDOV
WKDW DUH FKDUDFWHULVWLF RI DXWRLPPXQH GLVHDVH$OWKRXJK WKH PHFKDQLVPV E\ ZKLFK HQYLURQPHQWDO SROOXWDQWV
contribute to autoimmune disorders are still under investigation, it is thought they may trigger macrophages and
RWKHULQÀDPPDWRU\FHOOVWRUHOHDVHSURLQÀDPPDWRU\SURGXFWV,QDGGLWLRQWKH\PD\VKLIWWKHEDODQFHEHWZHHQ
type 1 and type 2 immune responses.

Considerations
• ,GHQWLI\DQGDYRLGHQYLURQPHQWDOWULJJHUV
• $VVHVVGHWR[L¿FDWLRQFDSDFLW\
• Modulate Th1/Th2 balance
• $VVHVVZLWKVHFWLRQ,,RI+$4
• $VVHVVJHQHUDOSK\VLFDOV\PSWRPVZLWK0HGLFDO6\PSWRPV4XHVWLRQQDLUH 064
• (OLPLQDWLRQRUDQWLLQÀDPPDWRU\GLHWSURJUDP

Nutritional Support
• 0HGLFDOIRRGIRUPHWDEROLFGHWR[L¿FDWLRQUltraClear PLUS
• (OLPLQDWLRQRUDQWLLQÀDPPDWRU\GLHWSURJUDP
• %LRDFWLYHIRODWHVIRUGHWR[L¿FDWLRQActiFolate
• &RPSUHKHQVLYHDQWLR[LGDQWVXSSRUWOxygenics
• 5HGXFHGLVRDOSKDDFLGV 5,$$ DQGYLWDPLQ'QXWUDFHXWLFDOKaprex AI

Mediators — Address the underlying physiological and dietary contributors

Gi Barrier Function & Microflora Balance


5HVHDUFKVXJJHVWVWKHUHLVDFRUUHODWLRQEHWZHHQPXFRVDOEDUULHUIXQFWLRQDQGDXWRLPPXQHGLVHDVH7KH*,
WUDFWLVUHVSRQVLEOHIRUUHJXODWLQJWKHWUDI¿FRIPROHFXOHVEHWZHHQWKHHQYLURQPHQWDQGWKHERG\WKURXJKDEDUULHU
PHFKDQLVP7RJHWKHUWKH*,EDUULHUZLWKLWVVHOHFWLYHO\SHUPHDEOHLQWUDFHOOXODUWLJKWMXQFWLRQVO\PSKRLGWLVVXH
Autoimmune Diseases 31

DQGQHXURHQGRFULQHQHWZRUNFRQWUROWKHEDODQFHEHWZHHQWROHUDQFHDQGLPPXQLW\WRSRWHQWLDODQWLJHQV:KHQ
WKHSUHFLVHWUDI¿FNLQJRIPROHFXOHVEHFRPHVG\VUHJXODWHGDXWRLPPXQHGLVHDVHFDQRFFXU

Intestinal Permeability
7KH SHUPHDELOLW\ RI WKH LQWHVWLQDO EDUULHU GHSHQGV RQ WKH UHJXODWLRQ RI LQWHUFHOOXODU WLJKW MXQFWLRQV ZKLFK DUH
UHVSRQVLEOHIRUVHOHFWLYHO\WUDI¿FNLQJEHQH¿FLDODQGSRWHQWLDOO\KDUPIXOPROHFXOHV²VXFKDVQXWULHQWVDQGDQWLJHQV
UHVSHFWLYHO\ ² EHWZHHQ WKH HQYLURQPHQW DQG KRVW ,W LV QRZ ZLGHO\ DFFHSWHG WKDW WLJKW MXQFWLRQ G\VIXQFWLRQ
FRPPRQO\UHIHUUHGWRDV³OHDN\JXW´SOD\VDUROHLQWKHSDWKRJHQHVLVRIVHYHUDOGLVHDVHVSDUWLFXODUO\DXWRLPPXQH
diseases.
(PHUJLQJVFLHQWL¿F¿QGLQJVIURPPXFRVDOELRSVLHVRI,%'SDWLHQWVKDYHVKRZQDOWHUHGH[SUHVVLRQRIFULWLFDOWLJKW
MXQFWLRQSURWHLQVSRVVLEO\GXHWRWKHHIIHFWVRISURLQÀDPPDWRU\F\WRNLQHVRQEDUULHULQWHJULW\7KLVVXJJHVWVDYLFLRXV
F\FOHLVFUHDWHGLQZKLFKLQFUHDVHGLQWHVWLQDOSHUPHDELOLW\DOORZVIXUWKHUOHDNDJHRILQWHVWLQDOFRQWHQWVFRQWULEXWLQJ
WRDSURLQÀDPPDWRU\LPPXQHUHVSRQVHRQLQWHVWLQDOWLVVXHWKDWLQWXUQSURPRWHVIXUWKHUJXWOHDNLQHVV

Microflora Balance
$KHDOWK\LQWHVWLQDOWUDFWKDUERUVDODUJHYDULHW\RIEHQH¿FLDOPLFURÀRUDRU³IULHQGO\´EDFWHULDUHVLGLQJLQFORVH
SUR[LPLW\WRUDSLGO\UHQHZLQJLQWHVWLQDOHSLWKHWKLDOFHOOVDQGRWKHUFRPSRQHQWVRIWKHPXFRVDOLPPXQHV\VWHP
&RPSRQHQWVRIEHQH¿FLDOPLFURÀRUDDUHHVVHQWLDOWRPDLQWDLQDEDODQFHGLPPXQHDQGLQÀDPPDWRU\UHVSRQVH
ZKHQWKLVEDODQFHLVGLVUXSWHGH[FHVVLYHLPPXQHDFWLYDWLRQFRXOGSRVHDULVNWRWKHGHYHORSPHQWRILQWHVWLQDO
RUV\VWHPLFLQÀDPPDWLRQ

Considerations
• 0DQDJH*,IXQFWLRQWKURXJK*,5HVWRUDWLRQ3URJUDP VHH53URJUDP
• 5HGXFHLQÀDPPDWRU\UHVSRQVH
• $VVHVVZLWKVHFWLRQRI+$4

Nutritional Support
• 0HGLFDOIRRGIRULQÀDPPDWLRQ²8OWUD,QÀDP;
• (OLPLQDWLRQRUDQWLLQÀDPPDWRU\GLHWSURJUDP
• Lactobacillus acidophilus NCFM and %L¿GREDFWHULXP supplement — Ultra Flora I.B.
• +HUEDODQLPLFURELDOZLWKEHUEHULQHDQGRUHJDQR²Candibactin BR and Candibactin AR
• 2PHJD KLJK(3$ VXSSOHPHQW² EPA-DHA 6:1

TH1 Dominanace
Emerging data suggests the same immune mechanisms that protect against invasive microorganisms are
LQYROYHGLQWKHJHQHUDWLRQRIRUJDQVSHFL¿FDXWRLPPXQHGLVHDVHDVZHOODVUHVXOWLQWKHGHVWUXFWLRQRIWLVVXH
DQGORVVRIRUJDQIXQFWLRQGXULQJWKHFRXUVHRIDXWRLPPXQHGLVHDVH7KLVLPPXQHUHVSRQVHNQRZQDVFHOOXODU
LPPXQLW\LVFRQWUROOHGE\7KFHOOVZKLFKGHYHORSSUHIHUHQWLDOO\RYHU7KFHOOVGXULQJLQIHFWLRQVZLWKLQWUDFHOOXODU
pathogens.

Cellular Immunity Action


8SRQDFWLYDWLRQ7KFHOOVFRQWUROWKHW\SHRILPPXQHUHVSRQVHE\VHFUHWLQJSURLQÀDPPDWRU\F\WRNLQHVDFWLYDWLQJ
PDFURSKDJHVWRSURGXFHUHDFWLYHR[\JHQLQWHUPHGLDWHVDQGQLWULFR[LGHDQGVWLPXODWLQJWKHLUSKDJRF\WLFIXQFWLRQV
:KHQWKH7KSDWKZD\LVRYHUVWLPXODWHGWKH7KGULYHQLPPXQHUHVSRQVHFDQEHEHFRPHDJJUHVVLYHDQG
DXWRUHDFWLYHLQVXVFHSWLEOHLQGLYLGXDOVDVKDVEHHQVHHQLQRUJDQVSHFL¿FDXWRLPPXQHGLVHDVHVVXFKDV5$
and type 1 diabetes.

Role in Autoimmune Inflammation


$QXPEHURIVFLHQWL¿FREVHUYDWLRQVVXJJHVWWKDW7KGULYHQLPPXQLW\SOD\VDGRPLQDQWUROHLQWKHSDWKRJHQHVLV
RI DXWRLPPXQH LQÀDPPDWLRQ (PHUJLQJ UHVHDUFK LQGLFDWHV WKDW7K FHOOV DUH VWLPXODWHG E\ SURLQÀDPPDWRU\
F\WRNLQHVZKHUHDV7KFHOOVDUHVWLPXODWHGE\DQWLLQÀDPPDWRU\F\WRNLQHVVXJJHVWLQJDVWURQJDVVRFLDWLRQRI
7KGRPLQDQFHLQDXWRLPPXQHLQÀDPPDWLRQ,QWHUHVWLQJO\DFWLYDWHG7KFHOOVKDYHEHHQIRXQGLQWKHLQÀDPHG
V\QRYLXPRI5$SDWLHQWV

Considerations
• Reduce Th1 dominance and balance overall immune activity
• $VVHVVZLWKVHFWLRQ9,,RI+$4
32 Autoimmune Diseases

• $QWLLQÀDPPDWRU\GLHWSURJUDP

Nutritional Support
• 0HGLFDOIRRGIRULQÀDPPDWLRQDQGELRWUDQVIRUPDWLRQ²8OWUD,QÀDP;
• (OLPLQDWLRQRUDQWLLQÀDPPDWRU\GLHWSURJUDP
• 2PHJD KLJK(3$ VXSSOHPHQW² EPA-DHA 6:1
• RIAA and Vitamin D nutraceutical — Kaprex AI
• Lactobacillus acidophilus NCFM and %L¿GREDFWHULXP supplement — Ultra Flora I.B.
• 1RQVR\LVRÀDYRQHVZLWKELRDFWLYHIRODWHIRUKHDOWK\HVWURJHQEDODQFH²EstroFactors

Inflammation
5HVHDUFKLQGLFDWHVWKDWLQÀDPPDWLRQLVLQWULQVLFWRDXWRLPPXQHGLVHDVHV'XULQJLQÀDPPDWLRQWKHLQÀDPPDWRU\
FDVFDGHVUHOHDVHDZLGHDUUD\RIF\WRNLQHVHLFRVDQRLGVUHDFWLYHR[\JHQVSHFLHV 526 DQGRWKHUPHGLDWRUV
WKDWFDQRYHUZKHOPDQGRIIVHW7K7KEDODQFHDQGSRWHQWLDOO\GDPDJHERG\WLVVXHV

Cytokine Dysregulation
5HFHQW HYLGHQFH LQGLFDWHV WKH LQYROYHPHQW RI F\WRNLQHV ² PHGLDWRUV WKDW FRQWURO LPPXQH DQG LQÀDPPDWRU\
UHVSRQVHV²LQWKHSDWKRJHQHVLVRIDXWRLPPXQHGLVHDVH6SHFL¿FDOO\F\WRNLQHVDVVRFLDWHGZLWKWKH7KLPPXQH
UHVSRQVH²VXFKDV,/71) DQG,)1 ²VWLPXODWHRWKHULQÀDPPDWRU\UHVSRQVHVLQGLFDWLQJWKH\SOD\D
V\QHUJLVWLFUROHWRGULYHFKURQLFLQÀDPPDWRU\UHVSRQVHVLQDXWRLPPXQHGLVHDVH

Eicosanoid Pathways
0DMRUPHGLDWRUVRIFROODWHUDOGDPDJHLQDXWRLPPXQLW\DUHHLFRVDQRLGV²OLSLGPHGLDWRUVWKDWDUHFHQWUDOWRWKH
LQÀDPPDWRU\SDWKZD\DQGWKHUHJXODWLRQRIQXPHURXVSK\VLRORJLFDOSURFHVVHV,QKLELWLRQRIWKHF\FORR[\JHQDVH
GHSHQGHQGHLFRVDQRLGSURGXFWVLVNQRZQWRLPSURYHWKHTXDOLW\DQGSURORQJWKHOLIHRISDWLHQWVZLWKDXWRLPPXQH
disease, such as lupus and autoimmune arthritis.

C-Reactive Protein
+LJKVHQVLWLYLW\&UHDFWLYHSURWHLQ KV&53 LVDQRQVSHFL¿FPDUNHURILQÀDPPDWLRQWKDWPD\EHPDUNHGO\HOHYDWHG
LQFKURQLFLQÀDPPDWRU\FRQGLWLRQVDQGKDVEHHQUHSRUWHGWREHSUHGLFWLYHRIIXWXUHFRURQDU\KHDUWGLVHDVH &+' 
events in several studies.
%HFDXVHWKHLQÀDPPDWLRQLQDXWRLPPXQHGLVHDVHVKDVEHHQIRXQGWRUHVXOWIURPWKHXQGHUO\LQJLVVXHRILPPXQH
DFWLYDWLRQ³GLVHDVHPRGLI\LQJDQWLDUWKULWLFGUXJV´ '0$5'V KDYHEHHQXVHGWRVXSSUHVVWKHLPPXQHV\VWHP
WKHUHE\HYHQWXDOO\OHDGLQJWRDGHFUHDVHLQLQÀDPPDWLRQ$QXPEHURIQDWXUDOLQJUHGLHQWVPD\SURYLGHVLPLODU
LPPXQHEDODQFLQJDQGDQWLLQÀDPPDWRU\HIIHFWV

Considerations
• &DOPV\VWHPLFLQÀDPPDWRU\VWDWXV
• 6XSSRUWDQWLR[LGDQWSDWKZD\V
• $GGUHVVIDWW\DFLGSUR¿OH
• $VVHVVVWDWXVRIKV&53DQGRWKHULQÀDPPDWRU\PDUNHUV
• $VVHVVJHQHUDOSK\VLFDOV\PSWRPVZLWK064

Nutritional Support
• 0HGLFDOIRRGIRULQÀDPPDWLRQ —8OWUD,QÀDP;
• $QWLLQÀDPPDWRU\GLHWSURJUDP
• RIAA and Vitamin D nutraceutical — Kaprex AI
• 2PHJD KLJK(3$ VXSSOHPHQW² EPA-DHA 6:1

Impaired Biotransformation
7KHGHSOHWLRQRULQVXI¿FLHQF\RIDQ\FRIDFWRULQYROYHGLQELRWUDQVIRUPDWLRQFDQVLJQL¿FDQWO\LPSDLURYHUDOOKHDOWK
DQGZHOOEHLQJ%LRWUDQVIRUPDWLRQGHVFULEHVWKHVHULHVRIFKHPLFDODOWHUDWLRQVWKDWDFRPSRXQGXQGHUJRHVLQRUGHU
IRUWKHERG\WRDGHTXDWHO\H[FUHWHWKHFRPSRXQG7KHVHFKHPLFDODOWHUDWLRQVPRVWRIWHQLQYROYHWKHF\WRFKURPH
3IDPLO\RIHQ]\PHVZKLFKLQFOXGHVWKHGHWR[L¿FDWLRQHQ]\PHVWKDWDFWWRPHWDEROL]HGUXJVDQGIRUHLJQ
FKHPLFDOV&\WRFKURPH3FRQWDLQLQJHQ]\PHVDUHDOVRLQYROYHGLQWKHGHWR[L¿FDWLRQRIHVWURJHQPHWDEROLVP
RIDUDFKLGRQLFDFLGDQGHLFRVDQRLGVDQGFRQYHUVLRQRIYLWDPLQ'LQWRLWVDFWLYHPHWDEROLWH
Autoimmune Diseases 33

Vitamin D Metabolism
2QHRIWKHLPSRUWDQWUROHVRIWKH&<3IDPLO\UHODWHGWRLPPXQHIXQFWLRQUHJXODWLRQLVWKHPHWDEROLVPRI
YLWDPLQ'9LWDPLQ'LV¿UVWK\GUR[\ODWHGLQDUDWHOLPLWLQJVWHSWRK\GUR[\YLWDPLQ'LQWKHOLYHUE\&<3
K\GUR[\ODVH DQGWKHQIXUWKHUK\GUR[\ODWHGLQWKHNLGQH\WRGLK\GUR[\YLWDPLQ'ZKLFKLVWKHDFWLYH
KRUPRQDOIRUPRIWKHYLWDPLQ([SUHVVLRQRIWKHYLWDPLQ'K\GUR[\ODWLQJHQ]\PHVLQWKHOLYHUDQGNLGQH\GHWHUPLQH
LQSDUWWKHUROHWKDWWKHKRUPRQDOIRUPRIYLWDPLQ'KDVLQPRGXODWLQJLPPXQHIXQFWLRQ

B Vitamins and Estrogen Detoxification


%YLWDPLQV²VXFKDVIRODWH%DQG%²IXQFWLRQDVLPSRUWDQWFRIDFWRUVIRUHQ]\PHVLQYROYHGLQHVWURJHQ
GHWR[L¿FDWLRQ7KHUHIRUHGHFUHDVHGOHYHOVRI%YLWDPLQVFDQGLVUXSWHVWURJHQGHWR[L¿FDWLRQOHDGLQJWRLQFUHDVHG
OHYHOVRIFLUFXODWLQJHVWURJHQDQGDQXQKHDOWK\EDODQFHRIHVWURJHQPHWDEROLWHVVXFKDV2+(DQG 2+(
%HFDXVHXSWRRIWKH86SRSXODWLRQKDVDJHQHWLFYDULDWLRQWKDWLPSDLUVWKHDELOLW\WRPHWDEROL]HIROLFDFLG
VXSSOHPHQWDWLRQZLWKWKHDFWLYHPHWDEROLWHRIIRODWH/PHWK\OWHWUDK\GURIRODWH /07+) FDQEHHVSHFLDOO\
EHQH¿FLDO

Considerations
• ,QLWLDWHSDWLHQWVSHFL¿FPHWDEROLFGHWR[L¿FDWLRQSURJUDP
• 6XSSRUWDQWLR[LGDQWSDWKZD\V
• Assess vitamin D status
• $VVHVVZLWKVHFWLRQ,,RI+$4
• $VVHVVJHQHUDOSK\VLFDOV\PSWRPVZLWK064

Nutritional Support
• (OLPLQDWLRQRUDQWLLQÀDPPDWRU\GLHWSURJUDP
• 0HGLFDOIRRGIRUPHWDEROLFGHWR[L¿FDWLRQ²UltraClear PLUS
• 0LONWKLVWOHH[WUDFW²Silymarin 80
• %LIXQFWLRQDOGHWR[L¿FDWLRQVXSSRUWIRUPXOD²AdvaClear
• Vitamin D3VXSSOHPHQWZLWKVR\LVRÀDYRQHV²Iso D3

Nutritional Deficiencies
$YDULHW\RIFRPPRQQXWULWLRQDOGH¿FLHQFLHVFDQH[DFHUEDWHWKHDXWRLPPXQHUHVSRQVHVXFKDVWKHIROORZLQJ

Vitamin D
0RXQWLQJVFLHQWL¿FGDWDLQGLFDWHVYLWDPLQ'GH¿FLHQF\LQFUHDVHVWKHULVNRIDXWRLPPXQHGLVHDVHVVXFKDVW\SH
GLDEHWHV06DQG5$7KHPHWDEROL]HGKRUPRQDOIRUPRIYLWDPLQ' >2+@' DFWVDVDQLPSRUWDQWLPPXQH
PRGXODWRUWKURXJKLWVLQWHUDFWLRQVZLWKLPPXQHFHOOVDQGLQYROYHPHQWLQUHJXODWLQJO\PSKRF\WHIXQFWLRQF\WRNLQH
production, and macrophage activity.
8QIRUWXQDWHO\YLWDPLQ'GH¿FLHQF\KDVUHDFKHGHSLGHPLFSURSRUWLRQVLQWKH8QLWHG6WDWHV:LWKWKLVQHZHPSKDVLV
RQWKHLPSRUWDQFHRIYLWDPLQ'PDQ\UHVHDUFKHUVDUHQRZUHFRPPHQGLQJOHYHOVRILQWDNHPXFKKLJKHUWKDQ
,8SHUGD\ZKLFKLVWKHUHFRPPHQGHGDPRXQW

Folate
0RGHUDWH K\SHUKRPRF\VWHLQHPLD UHODWHG WR ORZ IRODWH OHYHOV KDV EHHQ UHSRUWHG LQ SDWLHQWV ZLWK DXWRLPPXQH
GLVHDVHV,QWHUHVWLQJO\DUHFHQWVWXG\RISDWLHQWVZLWK5$VKRZHGDFRUUHODWLRQEHWZHHQKLJKKRPRF\VWHLQHOHYHOV
ORZIRODWHVWDWXVDQGLQFUHDVHGFRQFHQWUDWLRQVRILPPXQHDFWLYDWLRQPDUNHUV²VXJJHVWLQJWKDWERWKIRODWHVWDWXV
DQGLPPXQHDFWLYDWLRQFRXOGEHLQYROYHGLQWKHGHYHORSPHQWRIK\SHUKRPRF\VWHLQHPLD

Omega-3 Fatty Acids


2PHJDIDWW\DFLGVSDUWLFXODUO\(3$SRVVHVVSRWHQWDQWLLQÀDPPDWRU\DQGLPPXQRPRGXODWRU\HIIHFWV7KH
SURSHUWLHVRIRPHJDVLQFOXGHUHJXODWLRQRIWKHDPRXQWDQGW\SHVRIHLFRVDQRLGVSURGXFHGDVZHOODVDFWLRQV
RQWUDQVFULSWLRQIDFWRUDFWLYLW\DQGJHQHH[SUHVVLRQ$QXPEHURIFOLQLFDOWULDOVLQLQÀDPPDWRU\DQGDXWRLPPXQH
GLVHDVHV²LQFOXGLQJ5$&URKQ¶VGLVHDVHXOFHUDWLYHFROLWLVSVRULDVLV6/(DQG06²KDYHUHYHDOHGVLJQL¿FDQW
EHQH¿WVRIRPHJDVXSSOHPHQWDWLRQ

Selenium and Zinc


7KHUROHRIWKHVHPLQHUDOVLQFKURQLFLQÀDPPDWRU\FRQGLWLRQVLVRIJUHDWVFLHQWL¿FLQWHUHVWEHFDXVHWKH\DUHFR
IDFWRUVLQPHWDEROLFSURFHVVHVLQYROYLQJMRLQWWLVVXHVDQGLPPXQHV\VWHPIXQFWLRQ6HOHQLXPDQG]LQFGH¿FLHQFLHV
KDYHEHHQOLQNHGWRDQH[DFHUEDWLRQRILQÀDPPDWLRQLQDFWLYH5$DQGVXSSOHPHQWDWLRQKDVEHHQUHSRUWHGWR
UHGXFHMRLQWWHQGHUQHVVDQGVWLIIQHVV
34 Autoimmune Diseases

Considerations
$VVHVVGLHWDQGVXSSOHPHQWUHJLPHQZLWKGLHWGLDU\ IRXQGLQWKHFirstLine Therapy® book)

Oxidative Stress
(PHUJLQJUHVHDUFKVXJJHVWVWKDWFKURQLFR[LGDWLYHVWUHVVPD\SOD\DVXEVWDQWLDOUROHLQWKHSDWKRJHQHVLVRI
DXWRLPPXQHGLVHDVHDQGUHODWHGFRPSOLFDWLRQV2[LGDWLYHVWUHVVIDYRUVDVHTXHQFHRILPPXQHV\VWHPDFWLYLWLHV
VXFKDVSURGXFWLRQRISURLQÀDPPDWRU\F\WRNLQHVPDFURSKDJHDFWLYDWLRQFHOOXODUSUROLIHUDWLRQDQGHQGRWKHOLDO
DFWLYDWLRQ²WKHVDPHHYHQWVIRXQGLQDXWRLPPXQHGLVHDVHVSDUWLFXODUO\6/(7KLVKDVOHGVRPHUHVHDUFKHUV
WRK\SRWKHVL]HWKDWR[LGDWLYHVWUHVVPD\WULJJHULQÀDPPDWRU\DFWLYLW\LQGXFLQJDÀDUHRIDXWRLPPXQHGLVHDVHLQ
susceptible individuals.

Considerations
• 5HGXFHR[LGDWLYHVWUHVVDQGLQÀDPPDWLRQ
• $VVHVVDQWLR[LGDQWQXWULHQWLQWDNH

Nutritional Support
• &RPSUHKHQVLYHDQWLR[LGDQWEOHQGRIYLWDPLQV$&(ZLWKVHOHQLXPDQG]LQF²Oxygenics
• *UHHQWHD'OLPRQHQHDQGWXPHULFIRUPXOD²Celapro
• 0HGLFDOIRRGIRULQÀDPPDWLRQDQGELRWUDQVIRUPDWLRQ²8OWUD,QÀDP;
• $QWLLQÀDPPDWRU\GLHWSURJUDP

Suggested Nutritional Supplementation

Core Nutritional Support Protocol


• 8OWUD,QÀDP;® Plus 360 — VFRRSVWZLFHGDLO\
0XOWLPHFKDQLVWLFVXSSRUWZLWKNH\QXWULHQWVSK\WRQXWULHQWVDQGVHOHFWLYHNLQDVHUHVSRQVHPRGXODWRUV
6.50V WRDGGUHVVXQGHUO\LQJLQÀDPPDWLRQ
• )ROORZHLWKHUWKH0RGL¿HG(OLPLQDWLRQ'LHW or the $QWL,QÀDPPDWRU\'LHW
• /DFWR)ODP;Œ— 1 capsule daily
/DFWR)ODP;IHDWXUHVL. plantarum 299V²DVWUDLQLGHQWL¿HGSURELRWLFWKDWKDVEHHQVSHFL¿FDOO\VKRZQ
WRVXSSRUWWKHLQWHJULW\DQGKHDOWK\IXQFWLRQRIWKHPXVFRVDOOLQLQJ
• EPA-DHA 6:1™ Enteric Coated ²VRIWJHOVWKUHHWLPHVGDLO\
(3$'+$(QWHULF&RDWHGRPHJDIDWW\DFLGVSURYLGLQJDUDWLRDSSURSULDWHIRUSDWLHQWVZLWKFKURQLF
LQÀDPPDWRU\FRQGLWLRQV
• Iso D3™ — 1 tablet three times daily.
9LWDPLQ'ZLWK,VRÀDYRQHV,VR'LVGHVLJQHGWRVXSSRUWRSWLPDOPHWDEROLVPRIYLWDPLQ'WRLWVDFWLYH
IRUP
If there is a soy sensitivity use:
• D3 1000™ — 2 microtablets three times daily.
+LJKSRWHQF\YLWDPLQ'²WKHPRVWELRDFWLYHIRUPRIVXSSOHPHQWDOYLWDPLQ'

Additional Nutritional Support Considerations


Body composition management
• High BMI ²,QWURGXFHORZHUFDORULH0RGL¿HG(OLPLQDWLRQRU$QWLLQÀDPPDWRU\'LHW
• Low BMI²,QWURGXFHKLJKHUFDORULH0RGL¿HG(OLPLQDWLRQRU$QWLLQÀDPPDWRU\'LHWDQGPHDVXUHKV&53
• ,IKV&53LVJUHDWHUWKDQPJOWKHQLQFUHDVHKaprex® AI to 2 tablets, three times daily

Insulin resistance and dysglycemia


• 0HWD*O\FHP;Œ— 2 tablets three times daily
Autoimmune Diseases 35

Sex hormone dysregulation


• EstroFactors® — 3 tablets daily.
• Meta I3C® — 2 capsules daily.
• ActiFolate® — 1 tablet, three times daily.

Hepatic detoxification imbalances/Drug or Chemical toxicity


• AdvaClear® — FDSVXOHVWZLFHGDLO\

Gastrointestinal Restoration (4R Program)


• Endefen™ — 1 tsp, three times daily.
• UltraFlora I.B.™ ²FDSVXOHVGDLO\
• Glutagenics® — 2 tsp, three times daily.

TH1 dominance or chronic allergy


• EstroFactors® or Testralin® — 3 tablets daily.

Impaired biotransformation or hepatic detoxification imbalances


• AdvaClear® —FDSVXOHVWZLFHGDLO\
• Silymarin 80 — 3 tablets daily.

Oxidative stress
• Oxygenics® — WDEOHWVGDLO\
• Celapro® ²VRIWJHOVGDLO\
• MetaLipoate® 300 ²WDEOHWWZLFHGDLO\

Vitamin A insufficiency
• Ultra Pure Cod Liver Oil™ — 1 tsp, three times daily

Thyroid Support
• Thyrosol® ²WDEOHWVWZLFHGDLO\
36 Autoimmune Diseases

Modified Elimination Diet


Foods to Include Foods to Avoid
8QVZHHWHQHGIUHVKIUR]HQZDWHU
Fruits SDFNHGRUFDQQHGXQVZHHWHQHGIUXLW
MXLFHVH[FHSWRUDQJH
2UDQJHV

$OOIUHVKUDZVWHDPHGVDXWpHG
Vegetables juiced, or roasted vegetables
&RUQFUHDPHGYHJHWDEOHV

Rice, oats, millet, quinoa, amaranth, :KHDWFRUQEDUOH\VSHOWNDPXWU\H


Starch WHIIWDSLRFDEXFNZKHDW DOOJOXWHQFRQWDLQLQJSURGXFWV

3URGXFWVPDGHIURPULFHRDW 3URGXFWVPDGHIURPZKHDWVSHOW
Bread/Cereal EXFNZKHDWPLOOHWSRWDWRÀRXUWDSLRFD
DUURZURRWDPDUDQWKTXLQRD
NDPXWU\HEDUOH\DOOJOXWHQ
containing products

All beans, peas, and lentils unless Soybeans†WRIXWHPSHKVR\EHDQV


Legumes RWKHUZLVHLQGLFDWHG soy milk, other soy products

$OPRQGVFDVKHZVZDOQXWVVHVDPH
WDKLQL VXQÀRZHUDQGSXPSNLQ
Nuts and Seeds VHHGVEXWWHUVPDGHIURPWKHVHQXWV
3HDQXWVSHDQXWEXWWHU
and seeds

$OOFDQQHG ZDWHUSDFNHG IUR]HQRU %HHISRUNFROGFXWVIUDQNIXUWHUV


Meat and Fish IUHVK¿VKFKLFNHQWXUNH\ZLOGJDPH
lamb
sausage, canned meats, eggs,
VKHOO¿VK

Dairy Products & Milk Milk substitutes such as rice milk,


almond milk, oat milk, coconut milk,
Milk, cheese, cottage cheese, cream,
\RJXUWEXWWHULFHFUHDPIUR]HQ
Substitutes other nut milks \RJXUW³QRQGDLU\´FUHDPHUV

&ROGH[SHOOHUSUHVVHGROLYHÀD[ Margarine, butter, shortening,


Fats FDQRODVDIÀRZHUVXQÀRZHUVHVDPH
ZDOQXWSXPSNLQRUDOPRQGRLOV
processed (hydrogenated) oils,
mayonnaise, spreads

6RGDSRSRUVRIWGULQNVDOFRKROLF
)LOWHUHGRUGLVWLOOHGZDWHUKHUEDOWHD
Beverages VHOW]HURUPLQHUDOZDWHU
EHYHUDJHVFRIIHHWHDRWKHU
FDIIHLQDWHGEHYHUDJHV

$OOVSLFHVXQOHVVRWKHUZLVHLQGLFDWHG
)RUH[DPSOHXVHFLQQDPRQFXPLQ Chocolate††, ketchup, mustard, relish,
Spices & Condiments dill, garlic, ginger, carob, oregano,
parsley, rosemary, tarragon, thyme,
chutney, soy sauce, barbeque sauce,
other condiments
turmeric, vinegar

:KLWHRUEURZQUH¿QHGVXJDUKRQH\
%URZQULFHV\UXSIUXLWVZHHWHQHU PDSOHV\UXSFRUQV\UXSKLJKIUXFWRVH
Sweeteners blackstrap molasses, stevia FRUQV\UXSFDQG\GHVVHUWVPDGHZLWK
WKHVHVZHHWHQHUV

1RWHWKDWVR\LVDQLQJUHGLHQWLQVRPHRIWKHUHFRPPHQGHGPHGLFDOIRRGVDQGVXSSOHPHQWIRUPXODV7KHUHIRUHWKRVH
SURGXFWVDUHRQO\UHFRPPHQGHGLI\RXUKHDOWKFDUHSUDFWLWLRQHUKDVGHWHUPLQHG\RXKDYHQRLQWROHUDQFHWRVR\
††
1RWHWKDWFKRFRODWHLVDQLQJUHGLHQWLQVRPHRIWKHUHFRPPHQGHGPHGLFDOIRRGV7KHUHIRUHWKRVHSURGXFWVDUHRQO\
UHFRPPHQGHGLI\RXUKHDOWKFDUHSUDFWLWLRQHUKDVGHWHUPLQHG\RXKDYHQRLQWROHUDQFHWRFKRFRODWH
Autoimmune Diseases 37
38 Autoimmune Diseases


   

        

 
 
      
          
 
     

           
         


    

            !  .       !
 "   #!  %
  
&!
 -
   #!
  /   #!
 $
 
      0  1  
   
 
  !#! &!
 %   &!  0     
 


  #!

  2


 
 *  #!

 '         !


 (     
#! 


 $  #!  3           

   !&!
 (     &!
 (

 #!
 (   )!
 ( 
   *  )!
!"
  

 #!
 
 .
 
4

 
#!
 +  )!
 2  #!
 ,   #!




   

 5 
      #!
 + #!
 6078  
      
 #!
 '     

 #!
 + 


#!
 # 

 -   #!   
 +99 #!


  :    !)!
 %   #!  %
 &!
 ,  
      #!


#
 ; 
  
   


! !
 ' 
 


#!

 
 

-,#)<==*>=
Autoimmune Diseases 39

Adjunctive Nutritional Support For Autoimmune Diseases

Patient Name

ID Number Date

Assessment Profile Vitamin D status


• Dietary Evaluation 6HUXPK\GUR[\YLWDPLQ'JUHDWHUWKDQ
• *OXWHQVHQVLWLYLW\ ZKHDW 30ng/liter
• Casein sensitivity (dairy)
• $GHTXDF\RIYHJHWDEOHSURWHLQ Antinuclear antibody Analysis
• $GHTXDF\RIPLQLPDOO\SURFHVVHGYHJHWDEOHV Elevated ANA titre
LQFOXGLQJFUXFLIHUV
• $GHTXDF\RIRPHJDIDWW\DFLGLQWDNH Oxidant stress status
• $PRXQWRIUH¿QHGVXJDUVÀRXUDQGIDWV (OHYDWHGXULQDU\OLSLGSHUR[LGHV
(OHYDWHGSODVPD+G*OHYHOV
Body Composition Analysis
/RZIDVWLQJVHUXPWULJO\FHULGHV
High BMI (greater than 27)
/RZ UHG FHOO JOXWDWKLRQH WR JOXWDWKLRQH
/RZ%0, OHVVWKDQ GLVXO¿GHUDWLR

GI functional analysis Insulin and Glycemic status


,UULWDEOHERZHOV\PSWRPV (OHYDWHGKU33JOXFRVHRULQVXOLQ
&ROLWLVRULQÀDPPDWRU\ERZHO 6HUXP7*+'/UDWLRJUHDWHUWKDQ
Mucosal permeability test (Lactulose/ *O\FRKHPRJORELQJUHDWHUWKDQ
mannitol)
7UDQVLWWLPH KRXUV Fatty acid status
Fecal calprotectin test (less than 60) 5HG FHOO DUDFKLGRQLF DFLG WR (3$ UDWLR
greater than 70.
Hepatic Detoxification Function Additional nutritional status evaluation
Alcohol and/or drug intolerance $QHPLDIRULURQDQGFRSSHU
Environmental chemical sensitivity Zinc tolerance test
Mercury sensitivity Sugar craving (Chromium)
$FHWDPLQRSKHQ FKDOOHQJH WHVW IRU &RJQLWLYHG\VIXQFWLRQ %YLWDPLQV
GHWR[L¿FDWLRQVXI¿FLHQF\
Skin problems and night blindness (vitamin
A and zinc)
Estrogen metabolism problems
Muscle cramping (magnesium) and
)ODUHVZLWKPHQVWUXDOSHULRG
premature ventricular contractions
,QFUHDVLQJSUREOHPVZLWKPHQRSDXVH
$OWHUDWLRQ RI V\PSWRPV ZLWK HVWURJHQ
containing drugs
40 Blood Interpretation

Blood Interpretation
)URP/DE,QWHUSUHWDWLRQ 1XWULWLRQDO7KHUDS\:RUNVKRSE\0LFKDHO7D\ORU'&

Cholesterol
&KROHVWHUROYDOXHVVKRXOGRQO\EHDQDO\]HGDIWHUDKRXUIDVW)XUWKHUWKHSK\VLFLDQPXVWEHDZDUHWKDWWKH
SDWLHQW¶VSRVWXUHSULRUWRWKHEORRGGUDZLVVLJQL¿FDQW,IWKHSDWLHQWKDVEHHQLQDUHFXPEHQWSRVWXUHIRUPRUH
WKDQPLQXWHVFKROHVWHUROYDOXHVPD\EHXSWRORZHUWKDQQRUPDO
&KROHVWHUROLVDEORRGIDWZKLFKLVWKHSULPHEXLOGLQJEORFNFRPSRQHQWWRPDNHKRUPRQHVHQ]\PHVDQGDQWLERGLHV
DORQJZLWKLRGLQHDQGSURWHLQ
$OVRPRVWRIWKHLQIRUPDWLRQUHODWLYHWRLQFUHDVHGRUGHFUHDVHGFKROHVWHUROFDQEHH[WUDSRODWHGWRWULJO\FHULGHV
+RZHYHULQJHQHUDOFKROHVWHUROLVLQFUHDVHGLQPRVWHQGRFULQHRURUJDQK\SRIXQFWLRQDQGGHFUHDVHGLQPRVW
HQGRFULQHRURUJDQK\SHUIXQFWLRQ
7KHRSWLPXPFKROHVWHUROYDOXHLVPJG/

If cholesterol is low: VRPHRIWKHVLFNHVWRISDWLHQWVKDYHORZFKROHVWHUROYDOXHV


• ,IORZFKROHVWHUROLVSUHVHQWUXOHRXWK\SHUWK\URLGLVP
• 5XOHRXWK\SRPHWDEROLFIDWW\OLYHU ORZ6*37 
• 6XVSHFWDXWRLPPXQHGLVHDVHFRQVLGHU$1$6('UDWH&UHDFWLYHSURWHLQDQGUKHXPDWRLGIDFWRUWHVWV
• )UHHUDGLFDOSDWKRORJ\ SRVVLEOHFDQFHURURWKHUFKURQLFGHJHQHUDWLYHGLVHDVHV ,IFKROHVWHUROLVORZZLWK
DQRUPDORUORZWRWDO:%&ORZDOEXPLQKLJKJOREXOLQKLJKIHUULWLQKLJKSODWHOHWVDQGKLJK/'+RU6*37
ZKLFKPD\QRWEHHOHYDWHGHDUO\RQ DQGRFFDVLRQDOO\WKHO\PSKRF\WHFRXQWLVORZ
• 8UHPLD SDWLHQWLVVZROOHQDQG%81LVHOHYDWHG
• Hemolytic jaundice (total bilirubin is elevated)
• $FXWHLQIHFWLRQV EXUQVXSFKROHVWHURODQGWKHSDWLHQWKDVHOHYDWHG:%&¶V
• Vegetarian diets
• 7KH¿UVWRPLQRXVVLJQLVDFKROHVWHUROOHVVWKDQ
• 2WKHU3URWHLQPDOQXWULWLRQDQHPLDVDQRUH[LDLQWHVWLQDOREVWUXFWLRQHSLOHSV\
• 'UXJVWKDWFDQFDXVHDORZFKROHVWHUROWK\UR[LQHDQGKHSDULQ

The following nutritional agents may be considered for those with low cholesterol values:
• ,IIDWW\OLYHULVVXVSHFWHG
Choline, Inositol, methionine
Lipogen²WDEOHWVWKUHHWLPHVGDLO\
&RPSUHKHQVLYHOLSRWURSKLFIRUPXOD
• ,RGLQHLIK\SHUWK\URLGLVPLVVXVSHFW
Iodex²GURSVWLPHVGDLO\
Liquid organic iodine
• Lithium
Lithinase²WDEOHWVWLPHVGDLO\
Naturally chelated lithium
• ,IGXHWRRWKHUGLVHDVHVWDWH FDQFHURUDGYDQFHGGHJHQHUDWLYHGLVHDVHVWDWHV WUHDWDFFRUGLQJO\

If cholesterol is elevated: 1RWHRIDOOFLUFXODWLQJFKROHVWHUROLVPDQXIDFWXUHGE\WKHOLYHU


• 6XVSHFWK\SRWK\URLGLVP ORZWK\URLGIXQFWLRQORZ77DQGRU7RU76+JUHDWHUWKDQDQGRUORZ
EDVDOWHPSHUDWXUHEHORZ)
• ,ILQFUHDVHGZLWKD76+EHORZDQG7DQG7LVORZVXVSHFWDQWHULRUSLWXLWDU\K\SRIXQFWLRQ
• ,ILQFUHDVHGZLWKDQRUPDO76+VXVSHFWDGLHWKLJKLQFDUEVDQGVDWXUDWHGIDW,IJOXFRVHLVDOVRHOHYDWHG
hyperinsulinemia is possible
• ([FHVVGLHWDU\SURWHLQLIHOHYDWHGFKROHVWHUROLQFUHDVHG%81FUHDWLQLQHUDWLRZLWKQRUPDOWULJO\FHULGHV
• /LYHUELOLDU\K\SHUIXQFWLRQHVSHFLDOO\LI**76*37RU6*27LVJUHDWHUWKDQ
• Diabetes, nephrosis, atherosclerosis, multiple sclerosis, leukemia, eclampsia, and pregnancy, and immune
G\VIXQFWLRQDOOPD\LQFUHDVHFKROHVWHUROYDOXHV
Blood Interpretation 41

The following nutritional agents may be considered for those with elevated serum cholesterol
values:
Cardioauxin ²WDEOHWVWZLFHGDLO\
&DUGLRYDVFXODUULVNUHGXFWLRQIRUPXOD
• 2PHJD2LO JDPPDOLQROHLFDFLG
GLA Forte ²FDSVXOHVGDLO\
2PHJD2LOV (3$DQG'+$
Red Yeast Extract Extra Strength — 1 capsule three times daily
&RQFHQWUDWHGEORRGOLSLGORZHULQJIRUPXOD
1RWH/RZHULQJGLHWDU\FKROHVWHUROPD\KDYHVRPHHIIHFWRQWKHRYHUDOOORZHULQJRIVHUXPFKROHVWHUROVXFKDV
IRXQGLQWKH3ULWLNLQ'LHW ORZIDWORZSURWHLQDQGKLJKFRPSOH[FDUERK\GUDWHV 5H¿QHGFDUEVVKRXOGEHOLPLWHG
WRJUDPVSHUGD\DQGIUHVKUDZIRRGVVKRXOGFRPSRVHWKHPDMRULW\RIWKHGLHW/LPLWWKHDPRXQWRIOHDQ
PHDWWRRXQFHVSHUGD\HVSHFLDOO\LIGLJHVWLYHSUREOHPVDUHSUHVHQW:LWKWKDWVWDWHGDGGUHVVLQJRWKHUIDFWRUV
VXFKDVH[HUFLVHUHGXFLQJFRIIHHFRQVXPSWLRQVPRNLQJDQGREHVLW\DUHRIXWPRVWLPSRUWDQFH

If fatty liver is suspected


• Choline, Inositol, methionine
Lipogen²WDEOHWVWKUHHWLPHVGDLO\
&RPSUHKHQVLYHOLSRWURSKLFIRUPXOD

Iodine if hyperthyroidism is suspect


Iodex²GURSVWLPHVGDLO\
Liquid organic iodine
• Lithium
Lithinase²WDEOHWVWLPHVGDLO\
Naturally chelated lithium
• ,IGXHWRRWKHUGLVHDVHVWDWH FDQFHURUDGYDQFHGGHJHQHUDWLYHGLVHDVHVWDWHV WUHDWDFFRUGLQJO\

HDL Cholesterol
(range should be 55 – 120 ideal range is 37 – 70)
+'/FKROHVWHUROLVFRPSULVHGPRVWO\RISURWHLQDQGSKRVSKROLSLG+'/DORQJZLWK$32(ZLOOUHGLVWULEXWHFKROHVWHURO
WRRXUFHOOVIRUJURZWKDQGVWHURLGV\QWKHVLVDQGZLOOUHWXUQFKROHVWHUROWRWKHKHSDWRF\WHV1RUPDOUDQJHIRU
+'/LVWRDQGJUHDWHU,I+'/LVWRRHOHYDWHGRQHZLOOVXVSHFWWKHSRVVLELOLW\RIDXWRLPPXQHGLVHDVH,I
LWLVWRRORZ OHVVWKDQ FDUGLRYDVFXODUULVNFOLPEVUDSLGO\,WLVIRXQGWREHGHFUHDVHGLQHVVHQWLDOIDWW\DFLG
GH¿FLWDQGOLYHUG\VIXQFWLRQ

The following nutritional agents may be considered for those with low HDL cholesterol values:
• Niacin Sustained Release²WDEOHWVWLPHVGDLO\
• Vitamin E
E-Complex 1:1²FDSVXOHVGDLO\
• (3$'+$
EPA-DHA Extra Strength²VRIWJHOWLPHVGDLO\
• /&DUQLWLQHZLWK&KURPLXP SLFROLQDWHRUJOXFRVHWROHUDQFHIDFWRU 1RWHFKURPLXPWUDYHOVRQWUDQVIHUULQDV
GRHVLURQ%HIRUHDUELWUDULO\JLYLQJODUJHGRVHVRIFKURPLXPPDNHVXUHWKDWWKHUHLVDGHTXDWHWUDQVIHUULQ
levels.
L-Carnitine 500²WDEOHWVGDLO\LQEHWZHHQPHDOV
• ([HUFLVH
• 5HVWULFWLQWDNHRIK\GURJHQDWHGRLOV
&KROHVWHURO+'/FKROHVWHUROUDWLRLVDQLPSRUWDQWLQGLFDWRURI&9'ULVN$UDWLROHVVWKDQLVFRQVLGHUHGLGHDO
5DWLRVRIGRZQWRDUHFRQVLGHUHGDGHTXDWH5DWLRVKLJKHUWKDQFUHDWHDQHQYLURQPHQWIRULQFUHDVLQJ
ULVNRI&9'
42 Blood Interpretation

LDL Cholesterol
(range should be 50 – 110)
7\SLFDOO\DV/'/LQFUHDVHV+'/ZLOOGHFUHDVH/'/LVPRVWO\FKROHVWHURO,WLVXVXDOO\HVWLPDWHGE\XWLOL]LQJWKH
IROORZLQJIRUPXODFKROHVWHURO± +'/WULJO\FHULGHV +RZHYHULIWKHWULJO\FHULGHVDUHJUHDWHUWKDQWKH
IRUPXODFDQQRWEHXWLOL]HGDQGWKH/'/ZLOOEHXQGHWHUPLQHG(OHYDWHGOHYHOVRI/'/FRUUHODWHVZHOOWRLQFUHDVHG
ULVNRIDWKHURVFOHURVLVDQGWKHSDWLHQWLVOLNHO\WRDOVREHGLDEHWHV
Elevated LDL is treated utilizing the same treatment agents recommended in treating elevated total serum
cholesterol and low HDL levels.
+'//'/FKROHVWHUROUDWLRLVDOVRDQLPSRUWDQWLQGLFDWRURI&9'ULVN$Q/'/+'/UDWLROHVVWKDQLVFRQVLGHUHG
LGHDO$Q/'/+'/UDWLREHWZHHQDQGLVFRQVLGHUHGDGHTXDWH

Lipoprotein a (Lp(a))
/LSRSURWHLQVDUHKLJKPROHFXODUZHLJKWSDUWLFOHVWKDWWUDQVSRUWZDWHULQVROXEOHOLSLGV SULPDULO\WULJO\FHULGHVDQG
FKROHVWHUROHVWHUV WKURXJKWKHEORRGSODVPD/S D FRQVLVWVRIDQ/'/PROHFXOHWKDWLVFRYDOHQWO\ERXQGWRWKH
protein component apolipoprotein(a). Research over the last 20 years has underscored the critical relationship
EHWZHHQ/S D DQG&$'GHOLQHDWLQJLWVFDXVDWLYHUROHLQDWKHURWKURPERJHQHVLVDQGLWVVWURQJDVVRFLDWLRQZLWK
both coronary and peripheral cardiac events.
/S D LVODUJHO\DQLQKHULWHGWUDLW/S D KDVEHHQFLWHGDVDEHWWHUSUHGLFWRURIFRURQDU\GLVHDVHVHYHULW\WKDQPRVW
RWKHUOLSLGSDUDPHWHUV'RHWFK5RKHLPDQG7KRPSVRQUHIHUUHGWR/S D DVWKHPRVWLPSRUWDQWJHQHWLFIDFWRU
DVVRFLDWHGZLWKHDUO\DWKHURVFOHURVLVDQG&$'/S D ELQGVWRHQGRWKHOLDODQGPDFURSKDJHFHOOV¿EULQRJHQDQG
¿EULQSURPRWLQJWKHGHSRVLWRIFKROHVWHURODQGRWKHUIDWW\ZDVWHLQWKHYDVFXODUHQGRWKHOLXP/S D DOVRSUHYHQWV
FORWO\VLV GLVVROXWLRQ DGGLQJ¿EULQDQGRWKHUGHEULVWRDWKHURVFOHURWLFSODTXH
/S D LVDOVRDQDFFXUDWHLQGLFDWRUIRUDVVHVVLQJWKHH[WHQWRIFDURWLGDWKHURVFOHURVLVDQGDQHOHYDWHGVHUXPOHYHO
FDQVHUYHDVWKHPRVWVLJQL¿FDQWLQGLFDWRURISDWLHQWVLQZKLFKFHUHEUDOLQIDUFWLRQLVDFRQFHUQ)XUWKHUHOHYDWHG
Lp(a) may impair normal vasodilation mechanisms

The following nutritional agents may be considered for those who have elevated Lp(a) values:
• Cardioauxin²WDEOHWVWZLFHGDLO\
&DUGLRYDVFXODUULVNUHGXFWLRQIRUPXOD
• Cardiogenics Intensive Care ²WDEOHWVGDLO\LQEHWZHHQPHDOV
• 9LWDPLQ&/O\VLQH/SUROLQHUHGXFWLRQ
Collagenics²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• 5HGXFHFRQVXPSWLRQRISDUWLDOO\K\GURJHQDWHGRLOV

Apolipoprotein A-l (Apo A-1)


$SR$LVWKHSULPDU\SURWHLQPDWUL[IRU+'/DQGKLJKHUOHYHOVRIWKLVSURWHLQDUHSUHGLFWLYHRIDGHFUHDVHG
LQFLGHQFHRI&9')UHQFKUHVHDUFKHUVIRXQGWKDWLQ\RXQJPHQ$SR$LVWKHDQDO\WHPRVWKLJKO\FRUUHODWHG
ZLWKHDUO\0,+RZHYHULQ\RXQJZRPHQLWUHPDLQV+'/,QD0D\R&OLQLFVWXG\FDUGLRYDVFXODUVSHFLDOLVWV
DUJXHGWKDWSODVPDDSROLSURSURWLHQOHYHOV±SDUWLFXODUO\$DQG$±PD\EHFRQVLGHUDEO\EHWWHUPDUNHUVWKDQ
traditional lipid determinants.

The following nutritional agents may be considered for those who have lowered levels of Apo-
A1:
1. Stress reduction
2. ([HUFLVH
3. 'LHWDU\PRGL¿FDWLRQ
4. 5HGXFHFRQVXPSWLRQRISDUWLDOO\K\GURJHQDWHGRLOV
5. (3$'+$
EPA-DHA Extra Strength ²VRIWJHOWLPHVGDLO\
6. *DUOLF
Super Garlic 6000²WDEOHWVGDLO\
Blood Interpretation 43

Apolipoprotein B (Apo B)
$SR%LVWKHSULPDU\VXEVWDQFHLQ/'/DQGLVWKXVDVVRFLDWHGZLWKDQLQFUHDVHGLQFLGHQFHRI&$'5HLQKDUWDQG
RWKHUVFRQFOXGHGWKDWERWK$SR$DQG%SURYLGHLPSRUWDQWLQIRUPDWLRQDERXWWKHSUHVHQFHRI&$',WLVDOVR
DVVRFLDWHGZLWKDQLQFUHDVHGULVNRIDUWHULDOVWHQRVLVRIWKHFDURWLGV

The following nutritional agents may be considered for those who have elevated levels of
Apo B:
• ,QFUHDVHVROXEOH¿EHU
Herbulk²VFRRSVWLPHVGDLO\
• /LPLWIDWVWRRIFDORULHVZLWKHPSKDVLVRQPRQRXQVDWXUDWHVDQG(3$'+$
• Limit simple carbohydrates
Super Garlic 6000 ²WDEOHWVGDLO\

Apo B/Apo A-1 Ratio:


$SR%$SR$5DWLRLVKLJKO\SUHGLFWLYHZLWKIXWXUH&$'LQFKLOGUHQDQGDGXOWV

Triglycerides
(Normal range is 80 – 115)
7ULJO\FHULGHVDUHHVWHUL¿HGIDWW\RLOVWKDWSUHGRPLQDWHLQWKHFRUHRIFK\ORPLFURQVDQG9'/,WLVHVVHQWLDOO\
IDWDQGVXJDU7ULJO\FHULGHVDUHPHWDEROL]HGE\WKH&16DQGDUHHVVHQWLDOO\WKHIXHOWKDWUXQVWKHQHUYRXV
V\VWHP7KH\KDYHEHHQDVVRFLDWHGZLWKDQLPSDLUHG¿EULQRO\WLFV\VWHPDQGDUHLPSOLFDWHGLQWKHSURJUHVVLRQ
RIERWKFRURQDU\DQGSHULSKHUDODWKHURVFOHURVLVLQGHSHQGHQWRI/'/)XUWKHUHOHYDWHGVHUXPWULJ\FHULGHVKDYH
EHHQVSHFL¿FDOO\WLHGWRWKHRFFXUUHQFHRIDWKHURWKURPERWLFVWURNHDQG7,$¶V$GLHWKLJKLQVDWXUDWHGIDWVFDQ
raise serum triglycerides as can a diet high in carbohydrates.
&HUWDLQO\ORZWK\URLGIXQFWLRQFDQFRQWULEXWHWRHOHYDWHGWULJO\FHULGHYDOXHV
$SHUVRQZKRLVFRUUHFWO\PHWDEROL]LQJWKHLUIDWVSURWHLQVDQGFDUEVZLOOJHQHUDOO\KDYHDERXWKDOIDVPXFK
triglycerides as cholesterol.

If triglycerides are elevated:


• $VZHOODV/'+DQGJOXFRVHVXVSHFWDWHQGHQF\WRZDUGVGLDEHWHV
• :LWKDQLQFUHDVHG76+JUHDWHUWKDQVXVSHFWK\SRWK\URLGLVP
• ,ILQFUHDVHGZLWKD76+EHORZVXVSHFWK\SRIXQFWLRQRIWKHDQWHULRUSLWXLWDU\
• 6RPHRWKHUFRQGLWLRQVPD\LQFUHDVHWKHWULJO\FHULGHVLQFOXGLQJPRVWHQGRFULQHK\SRIXQFWLRQLQJJODQGVOLYHU
ELOLDU\G\VIXQFWLRQLPPXQHG\VIXQFWLRQVHYHUHIUHHUDGLFDOSDWKRORJ\SUHJQDQF\DQGSDQFUHDWLWLV
• ,IHOHYDWHGDERYHFRQVLGHUSDQFUHDWLWLVDQGRUDQDOFRKROLF
• Triglyceride/HDL ratio is >5, suspect insulin resistance
• *HQHWLFDOO\HOHYDWHGDVIRXQGLQ'\V%OLSRSURWHLQHPLDOLSRSURWHLQOLSDVHGH¿FLHQF\DQGOLSRSURWHLQOLSDVH
FRIDFWRU $SR&,, GH¿FLHQF\
• 'UXJVWKDWFDQFDXVHDQHOHYDWHGWULJO\FHULGHYDOXHLQFOXGHFDIIHLQHFRUWLFRVWHURLGVGLXUHWLFVRUDOFRQWUDFHSWLYHV
dopamine, epinephrine

The following nutritional agents may be considered for those with elevated triglyceride values:
• Cardioauxin²WDEOHWVWZLFHGDLO\
&DUGLRYDVFXODUULVNUHGXFWLRQIRUPXOD
• 0HWDJO\FHP; — 1 tablet three times daily
$GYDQFHGQXWULWLRQDOVXSSRUWIRUKHDOWK\LQVXOLQDFWLYLW\ JOXFRVHOHYHOV
• L-Carnitine 500²WDEOHWVGDLO\LQEHWZHHQPHDOV
• ,QFUHDVHVROXEOH¿EHU
Herbulk²VFRRSVWLPHVGDLO\
• /LPLWIDWVWR±RIFDORULHVZLWKHPSKDVLVRQ(3$'+$DQGPRQRXQVDWXUDWHV
• /LPLWFDUERK\GUDWHV VLPSOH LQFOXGLQJIUXLWVDQGIUXLWMXLFHV
• 7UHDWORZWK\URLGLIIRXQGDFFRUGLQJO\ UXOHRXWKDORJHQVHQVLWLYLWLHV
• 7UHDWORZDQWHULRUSLWXLWDU\LIIRXQGDFFRUGLQJO\
44 Blood Interpretation

Prolan-H ²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• ([HUFLVH

If triglycerides are found to be low, consider:


• +\SHUWK\URLGLVPHVSHFLDOO\LVWKH76+LVIRXQGWREHEHORZDQGLI7DQG7DUHHOHYDWHG
• $XWRLPPXQHGLVHDVHLIIRXQGZLWKDORZRUQRUPDOFKROHVWHURO0D\QHHGWRRUGHU(65$1$&UHDFWLYH
SURWHLQDQG5)IDFWRUWRUXOHRXW$OVRFKHFNKDLUIRUKHDY\PHWDOV
• Vegetarians
• /LSDVHGH¿FLHQF\LIIRXQGZLWKDQHOHYDWHG/'+DQGGHSUHVVHGFDOFLXP

The following nutritional agents may be considered for those with low triglycerides:
• Iodine (kelp) and lithium
Iodex²GURSVWLPHVGDLO\
Lithinase²WDEOHWVGDLO\ZLWKIRRG
• Lipase
Azeo-Pangen ²WDEOHWVZLWKHDFKPHDO
• Dietary change
• Treat the autoimmune disease accordingly

Fibrinogen:
)LEULQRJHQLVDJOREXOLQV\QWKHVL]HGLQWKHOLYHU,WVWURQJO\HIIHFWVEORRGFRDJXODWLRQYLVFRVLW\EORRGUKHRORJ\DQG
SODWHOHWDJJUHJDWLRQ,WKDVDGLUHFWHIIHFWRQWKHYDVFXODUZDOODQGLVDSURPLQHQWDFXWHSKVHUHDFWDQW)LEULQRJHQ
SOD\VDNH\UROHLQDUWHULDORFFOXVLRQE\SURPRWLQJDWKHURVFOHURWLFSODTXHWKURPEXVIRUPDWLRQHQGRWKHOLDOLQMXU\DQG
K\SHUYLVFRVLW\$SRVLWLYHFRUUHODWLRQH[LVWVEHWZHHQ¿EULQRJHQOHYHOVDQGPRUWDOLW\IURPEUDLQLQIDUFWLRQ7KRVH
ZLWKDKLJKHUULVNRIYDVFXODUUHODWHGHYHQWVDUHWKRVHZLWKHOHYDWHG¿EULQRJHQZLWKKLJKWRWDOFKROHVWHURO+'/
UDWLRRUHOHYDWHGWULJO\FHULGHV)LEULQRJHQZLOOLQFUHDVHZLWKVPRNLQJRUDOFRQWUDFHSWLYHXVHREHVLW\VWUHVVDQG
DJLQJ)LEULQRJHQPD\EHHOHYDWHGLQQHSKURVLVFDUFLQRPDSQHXPRQLDDFXWHLQIHFWLRQDQGSUHJQDQF\

The following nutritional agents may be considered for those with elevated fibrinogen:
• *DUOLFJLQNJR(3$*/$QDWWRNLQDVH
Nattokinase — 2 capsules daily
Super Garlic 6000²WDEOHWVGDLO\
Ginkgo RoseOx — 2 tablets daily
EPA-DHA Extra Strength — 1 capsules 3 times daily
GLA Forte²FDSVXOHVGDLO\
• Turmeric, proteolytic enzymes, ginger
,QÀDYRQRLG
Protrypsin
• Vitamins E and C
E-Complex-1:1 ²FDSVXOHVGDLO\
Ultra Potent-C 1000 ²WDEOHWVWLPHVGDLO\
• *O\F\UUKL]LQ
Licorice Plus — 2 tablets daily
• &RXPDULQFRQWDLQLQJERWDQLFDOV EXSOHXUXPNKHOODUHGFORYHU\HOORZFORYHU
Liv. 52 ²WDEOHWVGDLO\
• Dietary pectin
Nutri-Chelate²WDEOHWVWLPHVGDLO\LQEHWZHHQPHDOV
• 5HGXFHZHLJKWWRLGHDOZHLJKW
• Stop smoking
• Consider stopping oral contraceptives
Blood Interpretation 45

C-Reactive Protein
&5HDFWLYH3URWHLQLVDYHU\VHQVLWLYHPDUNHUIRULQÀDPPDWLRQLQFOXGLQJWKHLQÀDPPDWLRQIURPWKHLPPXQRORJLF
GLVHDVHVLQIHFWLRQRUFHOOLQMXU\,WKDVEHHQGHWHUPLQHGWKDWLQÀDPPDWLRQLVDFUXFLDOIDFWRULQWKHSDWKRJHQHVLV
RIDWKHURWKURPERVLV,WLVDPDUNHUDVVRFLDWHGZLWKSURGXFWLRQRILQÀDPPDWRU\F\WRNLQHV7KHVHF\WRNLQHVDSSHDU
to encourage coagulation and damage to the vascular endothelium.
$UHFHQWVWXG\SXEOLVKHGLQWKH1HZ(QJODQG-RXUQDORI0HGLFLQHIRXQGWKDWSODVPD&UHDFWLYHSURWHLQ &53 LV
DVWURQJSUHGLFWRURIP\RFDUGLDOLQIDUFWLRQDQGVWURNH0HQZLWK&53YDOXHVLQWKHKLJKHVWTXDUWLOHKDGWKUHH  
WLPHVWKHLQFLGHQFHRIP\RFDUGLDOLQIDUFWLRQDQGWZR  WLPHVWKHLQFLGHQFHRILVFKHPLFVWURNH7KHVHUHODWLRQVKLSV
UHPDLQHGVWHDG\RYHUORQJSHULRGVDQGZHUHLQGHSHQGHQWRIRWKHUOLSLGDQGQRQOLSLGIDFWRUVLQFOXGLQJVPRNLQJ
&OHDUO\&53LVDVWURQJSUHGLFWRURIWKHULVNRIIXWXUH0,
6HSDUDWH IURP WKH FDUGLRYDVFXODU DQG SHULSKHUDO YDVFXODU LVVXHV HOHYDWHG &53 LV DOPRVW DOZD\V SUHVHQW LQ
UKHXPDWLFIHYHUUKHXPDWRLGDUWKULWLVDFXWHEDFWHULDOLQIHFWLRQVDQGYLUDOKHSDWLWLV,WLVIUHTXHQWO\VHHQLQJRXW
DGYDQFHGPDOLJQDQWWXPRUVDFWLYHFLUUKRVLVSHULWRQLWLVDQGEXUQVDQGFDURWHQRLGGH¿FLHQF\,WLVVRPHWLPHV
VHHQWREHHOHYDWHGLQ06JXLOODLQEDUUHV\QGURPH,8'VFKLFNHQSR[DQGVFDUOHWIHYHU

The following nutritional agents may be considered for those with elevated CRP levels:
• $GGUHVVFDXVHVRIDFXWHSKDVHUHVSRQVH LH,QIHFWLRQVLQÀDPPDWLRQVPRNLQJ
• 7HVWIRUDQWLERGLHVWRLQIHFWLRXVDJHQWVVXFKDV&SQHXPRQLDHRU+S\ORUL
• 0DQDJHDFXWHV\VWHPLFLQÀDPPDWLRQ
Kaprex ²VRIWJHOVGDLO\
• Large dose ascorbate therapy
Ultra Potent-C Powder ²WVSWLPHVGDLO\
• 3URWHRO\WLFHQ]\PHV
Protrypsin²WDEOHWVGDLO\LQEHWZHHQPHDOV
• &OLQLFDOO\DGGUHVVWKHVXVSHFWHGFRQGLWLRQFRQWULEXWLQJWRWKHHOHYDWHG&53

Homocysteine
(normal range is <7.2)
+RPRF\VWHLQHLVDQLQWHUPHGLDWHDPLQRDFLGPHWDEROLWHZKLFKLVDWWKHFURVVURDGVRIWZRFULWLFDOSDWKZD\VLQ
WKH ERG\ LQFOXGLQJ PHWK\ODWLRQ UHDFWLRQV DQG WUDQVVXOIXUDWLRQ UHDFWLRQV  ,QGHHG LW LV DQ LQWHUPHGLDWH LQ WKH
ELRV\QWKHVLVRIF\VWHLQHIURPPHWKLRQLQHYLDF\VWDWKLRQLQH'H¿FLHQF\RIYLWDPLQ%IROLFDFLGDQGRU%FDQ
DIIHFWWKHHQ]\PHSDWKZD\VLQYROYHGLQF\VWHLQHIRUPDWLRQUHVXOWLQJLQLQFUHDVHGFLUFXODWLQJKRPRF\VWHLQHOHYHOV
LQWKHEORRG,WLVDQDPLQRDFLGWKDWDFWVDVDPROHFXODUDEUDVLYHRUFRFNOHEXUDVLWÀRDWVGRZQWKHYHVVHOUDNLQJ
WKHHQGRWKHOLXP7KLVPD\EHWKHHYHQWWKDWEHJLQVWKHLQLWLDOVWDJHRIDWKURJHQHVLV
,W LV HVWLPDWHG WKDW WKH 8QLWHG 6WDWHV ORVHV  SHU \HDU GXH WR KHDUW DWWDFN DQG VWURNH IURP HOHYDWHG
KRPRF\VWHLQH YDOXHV  :H KDYH NQRZQ DERXW WKLV FULWLFDO SOD\HU LQ FDUGLRYDVFXODU KHDOWK VLQFH WKH ¶V 
+RPRF\VWHLQHLVDQLQGHSHQGHQWULVNIDFWRUIRUFDUGLRYDVFXODUGLVHDVHVHSDUDWHIURPWKHRWKHUFOLQLFDOHQWLWLHV
OLVWHGDERYH,QIDFWIRUHDFKLQFUHPHQWDERYHRQH¶VULVNIRUKHDUWDWWDFNLQFUHDVHVE\2QHVWXG\
IRXQGWKDW\HDUVSRVW0,RISDWLHQWVZLWKKRPRF\VWHLQHOHYHOVEHORZKDGGLHGZKLOHRIWKRVHZLWK
OHYHOVRIRUKLJKHUKDGGLHG
+RPRF\VWHLQHPD\EHHOHYDWHGLQRWKHUFRQGLWLRQV6RPHRIWKHVHFOLQLFDOFRQGLWLRQVLQFOXGHGHHSYHLQWKURPERVLV
GLDEHWHV5$RVWHRSRURVLVELUWKGHIHFWVNLGQH\GLDO\VLVSDWLHQWVGHSUHVVLRQ06$O]KHLPHU¶VGLVHDVHHWF

The following nutritional agents may be considered for those with elevated homocysteine
levels:
• %IROLFDFLG% WULPHWK\OJO\FLQH
Vessel Care ²WDEOHWVGDLO\
• 1DFHW\OF\VWHLQH
NAC-600 — 2 capsules daily
• (3$'+$
EPA-DHA Extra Strength — 1 capsule 3 times daily
• $GGUHVVKHSDWLFWR[LFLW\LQWHUIHULQJZLWKPHWK\ODWLRQSDWKZD\
46 Blood Interpretation

Fasting Glucose
(normal range is 80 – 100; ideal range is 65-85)
*OXFRVHLVYHU\DFLGLF7KLVLVZK\GLDEHWLFVKDYHDWHQGHQF\WRZDUGVDFLGRVLV7KHZKROHV\VWHPVXUURXQGLQJ
KRZRXUERGLHVXWLOL]HJOXFRVHDVZHOODVWKHRUJDQVWKDWSDUWLFLSDWHLQWKDWXWLOL]DWLRQLVTXLWHLQYROYHG

If glucose is elevated, consider the following:


• 'LDEHWHV%HVXUHWRUXQDIDVWLQJVHUXPJOXFRVHDQGD+HPRJORELQ$& SURWHLQERXQGJOXFRVH DQGD
simple urinalysis (glucosuria usually does not occur until plasma value reaches 180)
• $ORQJZLWKHOHYDWHGFKROHVWHURO ! DQGWULJO\FHULGHV  VXVSHFWK\SHULQVXOLQHPLD V\QGURPH;
• $ORQJZLWKGHFUHDVHG&2  DQGDQLQFUHDVHGDQLRQJDS ! VXVSHFWWKLDPLQH % GH¿FLHQF\
2WKHUGLVHDVHSURFHVVHVFRQGLWLRQVWKDWPD\HOHYDWHJOXFRVHLQFOXGHLQIHFWLRQV LI:%&FRXQWLV! 
FKURQLFUHQDOGLVHDVHK\SHUWK\URLGK\SHUIXQFWLRQRIWKHDGUHQDOV &XVKLQJ¶VGLVHDVH 0,RFFDVLRQDOO\SUHJQDQF\
LQÀDPPDWRU\ERZHOFRQGLWLRQVDVWKPDSDQFUHDWLWLVEUDLQWUDXPDVHYHUHWUDXPDRIDQ\VRUWFRQYXOVLRQVVHYHUH
OLYHUGLVHDVHDQGWKH¿UVWKRXUVDIWHUDVHYHUHEXUQ
Drugs that may also cause one’s serum glucose levels to elevate include: ACTH, corticosteroids, epinephrine,
IXURVDPLGHWKLD]LGHVSKHQ\WRLQ

The following nutritional agents may be considered for those with an elevated serum
glucose:
• 0RGLI\WKHGLHW'LHWVORZLQFDORULHVKLJKLQ¿EHUEXWORZLQVLPSOHFDUERK\GUDWHVDQGVDWXUDWHGRUWUDQVIDWW\
acids may help. (FirstLine® Therapy Diet)
• ([HUFLVH7KHXSWDNHRIJOXFRVHLQWRPXVFOHLVDVLJQL¿FDQWPHDQVRIJOXFRVHGLVSRVDODQGWDNHVSODFH
LQGHSHQGHQWO\IURPWKHDFWLRQRILQVXOLQ
• %FRPSOH[LQFOXGLQJ%WRFRQYHUWWU\SWRSKDQWRQLDFLQDQGIRUJOXFRQHRJHQHVLV % IRUFRQYHUVLRQRI
S\UXYLF DFLG WR DFHW\O &R$  % IRU PHWK\OPDORQDWH FRQYHUVLRQ WR VXFFLQDWH IRU FDUERK\GUDWH DQG IDW
PHWDEROLVP 1LDFLQ %WRPDNH*7)DQG1$' PDJQHVLXP]LQF IRULQVXOLQV\QWKHVLVE\SDQFUHDWLF%
FHOOVDQGWRDGGUHVVWKHSRVWUHFHSWRUGHIHFW FKURPLXP WRPDNHJOXFRVHWROHUDQFHIDFWRUDQGDGGUHVVWKH
SUHUHFHSWRUGHIHFW FRSSHU IRULQVXOLQELQGLQJ ELRWLQ QHHGHGIRUJOXFRVHXWLOL]DWLRQLQWKHFHOOV YDQDGLXP
KDVSRVVLEOHLQVXOLQWURSLFHIIHFWV
8OWUD*O\FHP;²IROORZPRGL¿HGVWHSSURJUDPLQ%ORRG6XJDU6HFWLRQ
0HWD*O\FHP;²WDEOHWVWZLFHGDLO\
• %RWDQLFDOVLQFOXGLQJJ\PQHPDWULJRQHOOD IHQXJUHHNVHHGV PRPRUGLFD ELWWHUPHORQ ¿FXV ¿JOHDI
Fenugreek Plus ²WDEOHWVGDLO\LQEHWZHHQPHDOV

If glucose is low, consider the following:


• +\SRJO\FHPLD UHDFWLYH RIWKHSRSXODWLRQLVK\SRJO\FHPLFDQGWKHPDMRULW\RIWKRVHLQGLYLGXDOVZLOO
SRVVHVVIRRGDOOHUJLHVSDUWLFXODUO\WRWKHJUDLQV1RWXQFRPPRQO\WKH/'+ZLOOEHGHFUHDVHG EHORZ 
/'+ DFWLYLW\ UHSUHVHQWV WKH DFWLYH H[FKDQJH RI FKORULGH ZLWK JOXFRVH DQG JOXFRVH ZLWK ]LQF DQG VRGLXP
JO\FRO\VLV WKHUHIRUH/'+DFWLYLW\LVDVVRFLDWHGZLWKSDQFUHDWLFIXQFWLRQDQGJOXFRVHPHWDEROLVP
• 0DQ\QXWULWLRQDOPHGLFLQH,9LQIXVLRQVFDQFDXVHDUHDFWLYHK\SRJO\FHPLFHYHQW)ROORZSURWRFRO
• ,QVXOLQRPD7XPRUVVKRXOGEHUXOHGRXWZLWKXQH[SODLQHGGHFUHDVHGIDVWLQJJOXFRVH$QLQVXOLQJOXFRVH
UDWLRRIJUHDWHUWKDQLVSUHVXPSWLYHRILQVXOLQRPD
• 3RVVLEOHVSUXHRUFHOLDFGLVHDVHHVSHFLDOO\ZLWKDÀDWFXUYHRQ*77 PJPO DOWKRXJKDÀDWFXUYHRQD
*77KDVDOVREHHQVHHQZLWKK\SRWK\URLGLVPDQGSLWXLWDU\LQVXI¿FLHQF\DGGLVRQ¶VGLVHDVH ZLWKDFRQFXUUHQW
decreased sodium and increased potassium)
2WKHU FRQGLWLRQV PD\ FDXVH D ORZ IDVWLQJ JOXFRVH LQFOXGLQJ  3URWHLQ PDOQXWULWLRQ RFFDVLRQDOO\ SUHJQDQF\
K\SRDGUHQLD K\SRFKORUK\GULD DQG OLYHU GLVHDVH GHVWUXFWLRQ RU LQVXI¿FLHQF\  FHUWDLQ W\SHV RI KHDY\ PHWDO
burdens.
6HYHUDOPHGLFDWLRQVPD\DOVRFDXVHORZEORRGJOXFRVHOHYHOVLQFOXGLQJ$FHWRKH[DPLQHDOORSXULQRODPLQRVDOLF\OLF
acid, amodiaquine amphotericin B, steroids, androgens, choorpropamide, cyclophosphamide, desipramine,
erythroycin, glycopyrrolate, haloperidol, halothane, hydrazine, imipramine, indomethacin, isoniazid, lincomycin,
0$2LQKLELWRUVPHUFDSWRSXULQHPHWD[DORQHPHWKR[VDOHQPHWKR[\ÀXUDQHPHWK\OGRSDPHWKO\WKLRXUDFLOQLFRWLQLF
DFLG QLWURIXUDQWRLQ QRYRELRFLQ ROHDQGRP\FLQ R[D]HSDP R[\SKHQEXWD]RQH SDUDOGHK\GH SDUDPHWKDGLRQH
phenacemide, phenacetin, phenothiazines, phenybutazone, progestins and estrogens, propranolol, propylthiouracil,
TXLQDFULQHVXOIRQDPLGHVWHWUDF\FOLQHVWKLRVHPLFDUED]RQHVWKLRWKL[HQHWROD]DPLGHWULPHWKDGLRQHXUDFLO
Blood Interpretation 47

The following nutritional agents may be considered for those who exhibit low serum
glucose levels:
• 'LHW  (DW QXPHURXV VPDOO PHDOV WKURXJKRXW WKH GD\  %H DZDUH WKDW K\SRFKORUK\GULD ELOLDU\ VWDVLV DQG
KHSDWLFLQVXI¿FLHQF\DUHFRPPRQZLWKJO\FHPLFSUREOHPV ERWKKLJKDQGORZ $GLHWKLJKLQSURWHLQPD\
EHFRQWUDLQGLFDWHG5H¿QHGFDUEVVKRXOGEHVWRSSHGDQGIUHVKUDZIUXLWVVXFKDVEHUULHVDQGOHDI\JUHHQ
YHJHWDEOHVVKRXOGEHDVWDSOH,IGLJHVWLYHSUREOHPVDUHSUHVHQWOLPLWOHDQPHDWWRWRRXQFHVSHUGD\
• 7KHVDPHYLWDPLQVDQGPLQHUDOVDQGKHUEDOVDVOLVWHGDERYHZLWKHOHYDWHGJOXFRVHYDOXHV
• Address the underlying clinical condition that may be contributing
• $GGUHVVWKHXQGHUO\LQJGUXJWKHUDS\WKDWPD\EHLQÀXHQFLQJWKHORZEORRGVXJDUVWDWXV

Clinical observations:
2QHPD\QHHGWRUXQD5HLQFKWHVW KDLUPLQHUDODQDO\VLVIRUWR[LFKHDY\PHWDOV 6RPHVWXGLHVLPSOLFDWHKHDY\
PHWDOVKDVDFRQWULEXWLQJIDFWRULQG\VJO\FHPLFFRQGLWLRQV
)DVWLQJEORRGJOXFRVHLVJHQHUDOO\DEOHWRLGHQWLI\ LQLWLDO K\SHUJO\FHPLFFRQGLWLRQVDOWKRXJKLQK\SRJO\FHPLD
WKHEORRGJOXFRVHLVRIWHQQRWEHORZKRPHRVWDWLFUDQJHV$WRKRXUJOXFRVHWROHUDQFHWHVW *77 FDQEH
SHUIRUPHGWRLGHQWLI\UHDFWLYHK\SRJO\FHPLD2QHPXVWQRWHWKDWZLWKLQWKDWWHVWWKDWFDQEHTXLWHV\PSWRPDWLF
IRUWKHSDWLHQWEHLQJWHVWHGWKDWD*77YDOXHRISRLQWVRUPRUHEHORZWKHIDVWLQJOHYHOLVLQGLFDWLYHRIUHDFWLYH
hypoglycemia.
7KRVHGLDEHWLFSDWLHQWV 7\SH,±LQVXOLQGHSHQGDQWRU7\SH,, QHHGWREHPRQLWRUHGZLWKDWHVWFDOOHGJO\FRKHPRJORELQ
$&7KLVWHVWZLOOWHOOXVZKDWWKHSDWLHQW¶VEORRGVXJDUOHYHOVDUHDYHUDJLQJRYHUDSHULRGRIWRZHHNV

Fasting Serum Insulin


(ideal range is 0-15 mcIU/ml)
,QVXOLQOHYHOVVKRXOGEHWDNHQIROORZLQJDKRXUIDVWDQGDOVRKRXUVSRVWSUDQGLDO IROORZLQJDPHDO 7KH
LQWDNHRIH[FHVVFDORULHVDQGUH¿QHGFDUERK\GUDWHVRYHUDSHULRGRIWLPHZLOOUHSHDWHGO\VWLPXODWHLQVXOLQUHOHDVH
DQG OHDGV WR G\VLQVXOLQHPLD  3URORQJHG G\VLQVXOLQHPLD WKHQ OHDGV HYHQWXDOO\ WR LQVXOLQ UHVLVWDQFH  ,QVXOLQ
UHVLVWDQFHLVJHQHUDOO\DVVRFLDWHGZLWKDUHODWLYHJOXFRVHLQWROHUDQFHHOHYDWHGWULJO\FHULGHOHYHOVFHQWUDOREHVLW\
K\SHUWHQVLRQORZOHYHOVRI+'/DQGHOHYDWHGXULFDFLG
7KHSKHQRPHQRQRILQVXOLQUHVLVWDQFH 0HWDEROLFV\QGURPH WKHQLQFUHDVHVWKHULVNRIGHYHORSLQJGLDEHWHV7\SH
,,REHVLW\FDUGLRYDVFXODUGLVHDVHK\SHUWHQVLRQPDOLJQDQFLHVFKURQLFLQÀDPPDWRU\VWDWHV

If the patient exhibits an elevated fasting serum insuin level:


:HPD\VXVSHFWWKHFOLQLFDOFRQGLWLRQFDOOHG0HWDEROLFV\QGURPH7KHUHLVFHUWDLQO\DKLJKHULQVXOLQRXWSXWWKDW
PD\OHDGWR7\SH,,GLDEHWHVPHOOLWXV7KLVZLOOOLNHZLVHLQFUHDVHFDUGLRYDVFXODUULVN

The following nutritional agents may be considered for those patients exhibiting elevated,
fasting insulin levels:
• ,QFUHDVHH[HUFLVH(YHQPRGHUDWHH[HUFLVHZLOOLPSURYHRQH¶VLQVXOLQVHQVLWLYLW\
• ,QFUHDVHPLQHUDOLQWDNHRIFKURPLXPPDJQHVLXPYDQDGLXPDQG]LQFWKDWDUHDOOLPSRUWDQWIRUWKHHI¿FLHQW
PDQXIDFWXUHDQGXVHRILQVXOLQ VHHGHWDLOVGLVFXVVHGDERYHLQWKHJOXFRVHVHFWLRQ
0HWD*O\FHP;²WDEOHWVWZLFHGDLO\
8OWUD*O\FHP;²)ROORZPRGL¿HGVWHSSURJUDPLQ%ORRG6XJDU6HFWLRQ
Gluco-Control — 1 tablet 3 times daily
• ,QFUHDVH%FRPSOH[ELRWLQDQGLQRVLWROIRULPSURYHGLQVXOLQUHVSRQVH DJDLQVHHDERYH
Glycogenics — 1 tablet 3 times daily

If the patient exhibits a low fasting serum insulin level:


:HPD\VXVSHFWWKHFOLQLFDOFRQGLWLRQRI7\SH,GLDEHWHVPHOOLWXVZLWKDQDVVRFLDWHGHOHYDWLRQLQIDVWLQJJOXFRVH
RUWKHSKHQRPHQRQPD\LQIDFWEHDEHQLJQLQGLYLGXDOSDWWHUQ

The following nutritional agents may be considered for those patients exhibiting a low,
fasting insulin level:
• Increase the same minerals listed above
48 Blood Interpretation

• /DUJLQLQH
Arginine Plus²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• %RWDQLFDOV*\PQHPD67ULJRQHOODI IHQXJUHHNVHHGV DQGLQVXOLQPLPHWLFVVXFKDV0RPRUGLFDF ELWWHU
melon)
Fenugreek Plus ²WDEOHWVGDLO\LQEHWZHHQPHDOV

If the patient exhibits an elevated 2 hour post-prandial serum insulin:


7KHSDWLHQWPD\KDYH0HWDEROLFV\QGURPH,QVXOLQUHVLVWDQFHRUSRVVLEO\LIDOUHDG\FOLQLFDOO\D7\SH,GLDEHWLF
WKH\PD\UHTXLUHDQDGMXVWPHQWRIWKHLULQVXOLQGRVLQJ

The following nutritional agents may be considered for those patients exhibiting an elevated
2 hour post-prandial serum insulin:
• Again, increase those minerals and vitamins listed above
• 1DFHW\OF\VWHLQH
NAC-600 ²FDSVXOHVWZLFHGDLO\LQEHWZHHQPHDOV
• 'LHWDU\ORZHUWKHFDORULFLQWDNHLQFUHDVH¿EHUDQGFRQVXPHIHZHUFRQFHQWUDWHGFDUEV
• ([HUFLVH

If the patient exhibits a decreased 2 hour post-prandial serum insulin:


The patient may either be a Type I diabetes mellitus individual or simply possesses a benign idiopathic decreased
insulin event.

The following nutritional agents may be considered for those patients exhibiting a
decreased 2 hour, post-prandial serum insulin:
• $QWLR[LGDQWVXSSRUWIRUWKHSDQFUHDWLFLVOHWFHOOV HVSHFLDOO\LIUHFHQWRQVHW LQFOXGLQJYLWDPLQ(&FDURWHQRLGV
selenium, and taurine.
Oxygenics²WDEOHWVGDLO\
• %RWDQLFDOVELWWHUPHORQVIHQXJUHHNVHHGVJUHHQWHDDOOPD\LPSURYHLQVXOLQRXWSXW
Fenugreek Plus²WDEOHWVGDLO\LQEHWZHHQPHDOV
Celapro²VRIWJHOVGDLO\
• ,QFUHDVHH[HUFLVH

Sodium
(normal range is 140 – 144)
6RGLXP LV WKH SULPDU\ DFLGLI\LQJ PLQHUDO RI WKH ERG\ DQG LV DQWDJRQLVWLF WR SRWDVVLXP  ,W LV HVVHQWLDO WR WKH
DFLGEDVH S+ EDODQFHDQGLQWUDFHOOXODUÀXLGH[FKDQJHIRUERG\ZDWHUGLVWULEXWLRQDIIHFWLQJWKHKHDUWNLGQH\
DQGDGUHQDOFRUWH[6RGLXPSXPSVZDWHUDQGQXWULHQWVLQWRWKHFHOOZDOODQGLVSULPDULO\XQGHUWKHFRQWURORIWKH
DGUHQDOFRUWH[&KORULGHSXPSVZDWHUDQGQXWULHQWVWKURXJKWKHFHOOZDOODQGWKHSRWDVVLXPHVVHQWLDOO\PRYHV
WKHPDERXWLQVLGHRIWKHFHOO
6RGLXPZRUNVLQDYHU\QDUURZUDQJHDQGLVH[FUHWHGUHDGLO\E\WKHNLGQH\V6LFNNLGQH\VZLOOOHWWRRPXFKSDVV
WKURXJKRUQRWHQRXJK6RGLXPLVWKHPRVWDEXQGDQWFDWLRQLQWKHH[WUDFHOOXODUÀXLG,WLVWKHPRVWLPSRUWDQW
RVPRWLFUHJXODWRURIWKHH[WUDFHOOXODUÀXLGEDODQFH

If the patient exhibits an elevated serum sodium level, consider:


• 'HK\GUDWLRQ SDWLHQWGLGQRWGULQNHQRXJKZDWHUGXULQJWKHLUKRXUIDVWSULRUWREORRGGUDZ 
• 1HSKULWLVORRNIRUHOHYDWHG%81DQGRUFUHDWLQLQH
• ,IHOHYDWHGZLWKDORZSRWDVVLXPFRQVLGHUDGUHQDOK\SHUIXQFWLRQ$GUHQDODGHQRPD"
• ,IHOHYDWHGZLWKHOHYDWHGFKORULGHSRVVLEOHRYHUXVHRIDVSLULQRUVRIWHQHGGULQNLQJZDWHU
• 2WKHUIDFWRUVWKDWPD\HOHYDWHVRGLXPLQFOXGHGLDEHWHVS\RULFREVWUXFWLRQ&+)

The following drugs may elevate sodium levels:


• estrogen corticosteroids
• contraceptives.
Blood Interpretation 49

The following nutritional agents may be considered for those with an elevated serum
sodium level:
• Restrict sodium intake
• 5DZJODQGXODUNLGQH\DQG/DUJLQLQH
5HQDJHQ'7;²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
Arginine Plus²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• ,IGUXJUHODWHGFRQVLGHUUHPRYDO

If the patient exhibits a low serum sodium level, consider:


• +\SRDGUHQLD HVSHFLDOO\ LI FRQFXUUHQW LQFUHDVHG SRWDVVLXP EXW QRW WRWDOO\ QHFHVVDU\  3HUIRUP SRVWXUDO
ragland’s blood pressure or pupillary ragland’s test.
• 3RVVLEO\IXOOEORZQ$GGLVRQ¶VGLVHDVH
• 0\[HGHPD K\SRWK\URLG
• $FXWHLQIHFWLRQV
• ,IORZZLWKORZFKORULGHDQGHOHYDWHGSRWDVVLXPFRQVLGHUK\SRFKORUK\GULD
• ,IORZZLWKORZRUKLJKFKORULGHDQGHOHYDWHGSRWDVVLXPFRQVLGHUERZHOG\VIXQFWLRQ
• 2WKHUIDFWRUVWKDWPD\FDXVHDORZHUHGVRGLXPOHYHOLQFOXGHS\ORULFVSDVPGLDEHWHVGLDUUKHDDQGPD\
be observed as secondary to cirrhosis, CHF and nephrosis.

The following drug category may cause low serum sodium levels:
• the diuretics

The following nutritional agents may be considered for those patients exhibiting a low
serum sodium value:
• Adrenal glandular
Adrenogen²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• Celery and/or celery juice
• 5HGXFWLRQRUHOLPLQDWLRQRIGLXUHWLFVZKHUHDSSURSULDWH
• 7UHDWPHQWRIWKHXQGHUO\LQJFRQWULEXWLQJGLVHDVHSURFHVV

Potassium
(range should be 4.0 – 4.6)
3RWDVVLXPLVWKHFKLHILRQIRXQGLQWKHLQWUDFHOOXODUFRPSDUWPHQW2QO\DVPDOOSDUWRIWKHWRWDOERG\SRWDVVLXP
stores are contained in the serum. The concentration inside the RBC is at least 15 to 20 times greater than that
IRXQGLQWKHVHUXPSODVPD7KHUHIRUHVLJQL¿FDQWO\ORZHUHGVHUXPYDOXHVFDQEHFRQVLGHUHGYHU\VHULRXV)XUWKHU
LWVHUYHVDVWKHSULPDU\R[LGL]LQJPLQHUDORIWKHERG\,WDWWUDFWVZDWHUDQGQXWULHQWVLQWRWKHFHOOV3RWDVVLXP
LVDOVRHVVHQWLDOWRPDLQWHQDQFHRIS+ EORRGDQGXULQH DQGPDLQWHQDQFHRIRVPRWLFSUHVVXUH$QGSRWDVVLXP
VKRXOGDOZD\VEHYLHZHGLQUHODWLRQWRWKHRWKHUHOHFWURO\WHV

If the patient exhibits a low serum potassium level, consider the following:
• ,IORZZLWKORZ%81VXVSHFWDGLHWWKDWLVKLJKLQUH¿QHGFDUERK\GUDWHV
• ,IORZZLWKDQLQFUHDVHGVRGLXPDQGRUFKORULGHVXVSHFWDGUHQDOK\SHUIXQFWLRQ$GUHQDODGHQRPD"
• 2WKHUIDFWRUVWKDWPD\FRQWULEXWHWRDORZSRWDVVLXPVHUXPOHYHOLQFOXGHGLDUUKHDDQGRUYRPLWLQJIDWLJXH
FKURQLFIDWLJXHEHQLJQHVVHQWLDOK\SHUWHQVLRQPHWDEROLFDONDORVLVVHYHUDOW\SHVRIDQHPLDIDPLOLDOSHULRGLF
SDUDO\VLVPDOLJQDQWJURZWKVFKURQLFQHSKULWLVZHDNP\RFDUGLXPGU\PRXWK

The following drugs may cause a low serum potassium level:


• diuretics
• GHVR[\FRUWLFRVWHURQH
• testosterone

The following nutritional agents may be considered for those patients exhibiting a low
serum potassium level:
• 3RWDVVLXP
MG/K Aspartate²WDEOHWVGDLO\
50 Blood Interpretation

• 5HGXFHUH¿QHGFDUERK\GUDWHFRQVXPSWLRQ
• 5HGXFWLRQRUHOLPLQDWLRQRIGLXUHWLFVZKHUHSRVVLEOH
• Treat the underlying contributing clinical condition/disease

If a patient exhibits an elevated serum potassium value, consider the following:


• $GUHQDOFRUWLFDOK\SRIXQFWLRQDOGRVWHURQHZLOOEHGHFUHDVHGVRGLXPDQGFKORULGHQRUPDOWRGHFUHDVHG
plasma and salivary cortisol decreased plasma renin increased, and urinary 17 ketosteroids decreased.
• 5HQDOG\VIXQFWLRQLIHOHYDWHG%81DQGFUHDWLQLQHDQGRWKHUHOHFWURO\WHVDUHRXWRIUDQJH
• ,IKLJKZLWKLQFUHDVHG$OSKDDQGJOREXOLQWLVVXHGHVWUXFWLRQ FDQFHU" LVSRVVLEOH/RRNIXUWKHUWRVHHLI
WKHUHLVDORZDOEXPLQHOHYDWHGJOREXOLQHOHYDWHGIHUULWLQSODWHOHWVDQG/'+RU6*37
• %UDG\FDUGLDDQGRUFRQJHVWLYHKHDUWFHOOVZKLFKPD\PDQLIHVWDVDQDEQRUPDO7ZDYHRQ(.*
• 2WKHUFRQGLWLRQVWKDWPD\FRQWULEXWHWRDQHOHYDWHGSRWDVVLXPLQFOXGHPHWDEROLFDFLGRVLVDFXWHEURQFKLDO
DVWKPDGLDEHWHVDFXWHLQIHFWLRQVDQGDFFLGHQWDOKHPRO\VLVGXULQJYHQLSXQFWXUHPD\LQFUHDVHSRWDVVLXP
OHYHOVDVPXFKDV±

The following nutritional agents may be considered for those patients exhibiting an elevated
serum potassium value:
• Adrenal glandular
Adrenogen ²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• 5DZNLGQH\JODQGXODUDQG/DUJLQLQH
5HQDJHQ'7;²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
Arginine Plus²FDSVXOHVWZLFHGDLO\LQEHWZHHQPHDOV
• Treat the underlying contributing clinical condition/disease

Chloride
(normal range is 100 – 106)
,IWKHSDWLHQWH[KLELWVDGLVWXUEHGFKORULGHYDOXHWKLVLQGLFDWHVDQLPEDODQFHRIWKHZDWHUVKLIWLQJPHFKDQLVP
(OHYDWHGFKORULGHVZRXOGPHDQWKDWWRRPXFKZDWHULVFURVVLQJWKHPHPEUDQH'HFUHDVHGFKORULGHYDOXHDORQJ
ZLWKGHFUHDVHGDOEXPLQ PDUNHGHGHPDLIDOEXPLQLVEHORZ PHDQVWKDWWKHUHLVGH¿FLHQWZDWHUFUHRVVLQJ
WKHPHPEUDQHVDQGZLOO\HLOGDSLWWLQJHGHPD

If the patient exhibits a low value for chloride, you may want to consider the following:
• ,IORZZLWK&2LQFUHDVHGWKHQPHWDEROLFDONDORVLVLVSUREDEOH
• ,IORZZLWK%81RUFUHDWLQLQHLQFUHDVHGDQGRWKHUHOHFWURO\WHVLPEDODQFHGUHQDOG\VIXQFWLRQLVSUREDEOH
• ,IORZZLWKORZVRGLXPWKHQDGUHQDOK\SRIXQFWLRQLVSRVVLEOH
• ,IORZZLWKVRZVRGLXPDQGKLJKSRWDVVLXPERZHOG\VIXQFWLRQFRQVWLSDWLRQLVSRVVLEOH
• ,IORZZLWKORZFKORULGHDQGKLJKSRWDVVLXPWKHQK\SRFKORUK\GULDLVSRVVLEOH
• 2WKHUFRQGLWLRQVWKDWPD\H[KLELWDGHFUHDVHGFKORULGHLQFOXGHS\ORULFVSDVPGLDEHWHVUHVSLUDWRU\GLVWUHVV
$OVRH[FHVVLYHYRPLWLQJDFXWHDQGFKURQLFIHYHUVH[FHVVLYHSHUVSLUDWLRQHPSK\VHPDGLDEHWLFDFLGRVLV
KHDWFUDPSVGLDUUKHDSQHXPRQLDLQIHFWLRQ

The following nutritional agents may be considered for those patients exhibiting a
decreased chloride value:
• Adrenal glandular
Adrenogen²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• Digestive enzymes and butyrate
Spectrazyme²WDEOHWVZLWKHDFKPHDO
Butyrate Plus²FDSVXOHVWZLFHGDLO\
• .LGQH\JODQGXODUDORQJZLWKODUJLQLQH
5HQDJHQ'7;²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
Arginine Plus²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• %HWDLQH+&/ UHPHPEHUFKORULGHDVVLVWVLQWKHSURGXFWLRQRI+&/E\WKHFKLHIFHOOVRIWKHVWRPDFK
Metagest²WDEOHWVDWHQGRIHDFKPHDO
Blood Interpretation 51

• Table salt
• Treat the underlying condition

If the patient exhibits an elevated chloride value, you may want to consider the following:
• ,I KLJK ZLWK ORZ &2 WKHQ PHWDEROLF DFLGRVLV LV SUREDEOH DORQJ ZLWK DQ HOHYDWHG DQLRQ JDS VRXUFH RI
DFLGRVLVLVIURPUHQDOG\VIXQFWLRQGLDEHWLFNHWRDFLGRVLVODFWLFDFLGRVLVRUH[RJHQRXVSRLVRQVHWK\OHQHJO\FRO
VDOLF\ODWHVPHWKDQROSDUDOGHK\GHO RU ZLWKDQRUPDODQLRQJDSWKHFDXVHLV*,DONDOLORVVGXHWRGLDUUKHD
LOHRVWRP\RUFRORVWRP\UHQDOWXEXODUDFLGRVLVVHOHFWLYHK\SRDOGRVWHURQLVPLQJHVWLRQRIDFHWD]RODPLGHRU
ammonium chloride)
• ,IKLJKZLWKLQFUHDVHG%81DQGFUHDWLQLQHDQGRWKHUHOHFWURO\WHVLPEDODQFHGUHQDOG\VIXQFWLRQ QHSKULWLV 
is probable.
• 5XOHRXWH[FHVVXVHRIVDOLF\DWHVRUWDEOHVDOW
• 2WKHU FRQGLWLRQV WKDW PD\ H[KLELW DQ LQFUHDVHG FKORULGH YDOXH LQFOXGH  DGUHQDO FRUWLFDO K\SHUIXQFWLRQ
GHK\GUDWLRQ K\SHUSDUDWK\URLGLVP FDUGLDF GHFRPSHQVDWLRQ DQHPLD SURVWDWLF DQG RWKHU W\SHV RI XULQDU\
obstruction.

Carbon Dioxide (CO2)


(normal range is 26 – 28)
*HQHUDOO\VSHDNLQJLIWKHSDWLHQWH[KLELWVDQHOHYDWHG&2WKHSDWLHQWLVFRQVLGHUHGWREHLQDVWDWHRIDONDORVLV
DQ\WKLQJDERYHP(T/IXUWKHUDOZD\VRUGHUDSXOPRQDU\IXQFWLRQWHVWLIHOHYDWHGDERYH 2IWHQLQFDVHV
RIPHWDEROLFDONDORVLVWKHUHLVQHHGIRU+&/DQGDVVRFLDWHGIDFWRUVLQFOXGLQJ]LQFWKLDPLQHDQGSRWDVVLXP,I
&2LVKLJKZLWKORZFKORULGHWKHQPHWDEROLFDONDORVLVLVSUREDEOH+RZHYHULI&2LVHOHYDWHGDORQJZLWKKLJK
/'+DQGEDVRSKLOVWKHQDVWKPDRUVRPHRWKHUREVWUXFWLYHOXQJFRQGLWLRQPD\EHSRVVLEOH2WKHUIDFWRUVPD\
FDXVHDQLQFUHDVHG&2YDOXHLQFOXGLQJIHYHUKRWEDWKVORVVRI+&/WKURXJKYRPLWLQJUHVSLUDWRU\GLVWUHVV
DGUHQDOFRUWLFDOK\SHUIXQFWLRQ5HPHPEHUDONDORVLVLVDFRPPRQ¿QGLQJLQSDWLHQWVZLWKIRRGDQGHQYLURQPHQWDO
sensitivities.
,IWKHSDWLHQWH[KLELWVDlow CO2 valueWKHSDWLHQWLVFRQVLGHUHGWREHLQDVWDWHRIDFLGRVLV0LOGDFLGRVLVLV
FRQVLGHUHGWRUXQEHWZHHQ±0RGHUDWHDFLGRVLVLVFRQVLGHUHGWRUXQEHWZHHQ±6HYHUHDFLGRVLV
LVOHVVWKDQ7KHSDWLHQWPD\EHLQDVWDWHRIPHWDEROLFDFLGRVLVGXHWRODFWLFDFLGRUS\UXYLFDFLGRUGXHWR
WR[LQV2WKHUIDFWRUVWKDWPD\GHFUHDVH&2LQFOXGHUHQDOG\VIXQFWLRQGHK\GUDWLRQGLDEHWHV UHPHPEHUVXJDU
is very acidic), or respiratory alkalosis.

BUN (Blood Urea Nitrogen)


(normal range is 13 – 18)
1LWURJHQ 1 LVVSOLWRIIRISURWHLQLQWKHOLYHUWKHUHVXOWLVXUHDQLWURJHQ%81LVDE\SURGXFWRISURWHLQPHWDEROLVP
%81DOVRDVVHVVHVUHQDOFKDQJHVPXFKIDVWHULQWKHOHVVVHULRXVFDVHVWKDQFUHDWLQLQH%81LVDQH[FHOOHQW
WRROIRUGHWHUPLQLQJUHQDOG\VIXQFWLRQLQWKHHDUO\VWDJHV,WZLOODOVRDVVHVVDPLQRDFLGDQGSURWHLQQHHGGXULQJ
SUHJQDQF\,WLVLPSRUWDQWWKDW%81EHGHWHUPLQHGRQO\RQDKRXUIDVWVLQFHWKHUHLVDQLQFUHDVHLQEORRG
YDOXHVDIWHULQJHVWLRQRISURWHLQ
7KHFOLQLFLDQPXVWDOVREHDZDUHRIWKHVLJQRI7KLVLVZKHUHWKH%81YDOXHIDOOVWRDQGWKHVHUXPSURWHLQ
YDOXHFOLPEVWRWKXVPDNLQJWKHVLJQRI7KLVFLUFXPVWDQFHFUHDWHVDIDYRUDEOHHQYLURQPHQWIRUWKHIXWXUH
GHYHORSPHQWRIFDQFHULQWKHSDWLHQW

If the patient exhibits an increased (because the body is either splitting off too much N2, or
the body is not excreting it like it should) BUN value, consider the following:
• 5HQDOLPSDLUPHQWGXHWRXUHPLDUHQDOGHVWUXFWLRQQHSKULWLV DFXWHRUFKURQLF PHWDOOLFSRLVRQLQJRIWKHNLGQH\V
DVIRXQGLQSDWLHQWVUHFHLYLQJLPSURSHUO\VXSHUYLVHGFKHODWLRQWKHUDS\SDWLHQWV RUSRO\F\VWLFNLGQH\
• ,QFDVHVRIDXJPHQWHGQLWURJHQFDWDEROLVP WKHERG\LVEUHDNLQJGRZQSURWHLQ DVLQLQWHVWLQDOREVWUXFWLRQ
GHK\GUDWLRQSQHXPRQLDSHULWRQLWLVEOHHGLQJIURPDQ\RFFXOWVRXUFH
• 2WKHU FDXVHV LQFOXGLQJ DGGLVRQ¶V GLVHDVH XQFRQWUROOHG GLDEHWHV JRXW UKHXPDWRLG DUWKULWLV &+)
pregnancy.
• Certain drugs may increase BUN including: alkaline antacids, antimony salts, arsenicals, cephaloridine,
IXURVHPLGHJHQWDPLFLQNDQDP\FLQPHWK\OGRSDQHRP\FLQ
52 Blood Interpretation

If the patient exhibits a decreased BUN value (not splitting off enough N2), consider the
following:
• Acute liver destruction
• $FXWHKHSDWLFLQVXI¿FLHQF\
• Nephrosis (the patient is losing everything through the kidney)
• &KURQLFZDVWLQJGLVHDVH
• Amylosidosis
• 3UHJQDQF\
In both cases (elevated values or decreased values, the clinician must determine the underlying cause and
clinically address it.

Creatinine
(normal range is .6 – 1.0)
&UHDWLQLQHLVDOVRDE\SURGXFWRISURWHLQPHWDEROLVP,WVHUYHVZHOODVDJORPHUXODU¿OWUDWLRQDVVHVVPHQWWHVW
&UHDWLQLQHLVIRXQGLQVNHOHWDOPXVFOHDQGKHDUWPXVFOH&UHDWLQLQHPD\EHVOLJKWO\ORZHULQFKLOGUHQDQGGXULQJ
SUHJQDQF\&UHDWLQLQHKDVDGLXUQDOYDULDWLRQZLWKWKHORZHVWYDOXHVDWDERXW$0DQGWKHSHDNYDOXHVDURXQG
30

If the patient exhibits an elevated serum creatinine value, consider the following:
• ,IKLJKDORQJZLWK%81DQGWKHSDWLHQW¶VHOHFWURO\WHVDUHRXWRIUDQJHWKHQSRRUNLGQH\IXQFWLRQLVSRVVLEOH
• ,IKLJKZLWKLQFUHDVHGPRQRF\WHVQRUPDO%81DQGHOHFWUR\WHVWKHQSURVWDWLFK\SHUWURSK\LVSRVVLEOH$
FUHDWLQLQH DW  RU KLJKHU LQ PHQ DQG VXEMHFWLYH V\PSWRPV XULQDU\ LQIUHTXHQF\ XUJHQF\ QRFWXULD GXH
WRLQFRPSOHWHHPSW\LQJKHVLWDQF\DQGLQWHUPLWWHQFHZLWKGHFUHDVHGVL]HDQGIRUFHRIWKHXULQDU\VWUHDP
LQFRQWLQHQFHWHUPLQDOGULEEOLQJVHQVDWLRQRILQFRPSOHWHHPSW\LQJRUFRPSOHWHXULQDU\UHWHQWLRQPD\HQVXH 
PD\LQGLFDWH%3+HVSHFLDOO\LQPDOHVRYHU\HDUVRIDJH)XUWKHULQFDVHVRI%3+DOZD\VUXOHRXWIRRG
allergies.
• (OHYDWHGOHYHOVZLOORFFXUZKLOHWKHERG\LVFOHDULQJKHDY\PHWDOVLISXVKHGWRRIDVW '2127&+(/$7(
IF CREATININE IS > 1.1)
• 2WKHUFOLQLFDOIDFWRUVWKDWPD\HOHYDWH%81LQFOXGH&+)VWDUYDWLRQGHK\GUDWLRQXQFRQWUROOHGGLDEHWHV
&UHDWLQLQHPD\EHORZLQWKHSDWLHQWZLWKDP\RWRQLDFRQJHQLWD XVXDOO\DFKLOG
$JDLQWKHFOLQLFLDQPXVWHVWDEOLVKWKHUHDVRQ V IRUWKHHOHYDWHGFUHDWLQLQHDQGWUHDWDFFRUGLQJO\

BUN/Creatinine Ratio
(normal range is 13 – 17)
If the patient exhibits an elevated BUN/Creatinine ratio, consider the following:
• &DWDEROLFVWDWHVLQFOXGLQJIHYHUWLVVXHWUDXPDEXUQVLQWHUQDOEOHHGLQJFLUFXODWRU\IDLOXUHOHDGLQJWRIDOOLQ
UHQDOEORRGÀRZDQGWKHQWRVKRFNDQGDFXWH&+)
• $FXWHDQGFKURQLFUHQDOIDLOXUH
• 8ULQDU\WUDFWREVWUXFWLRQ %3+
• High protein diet.
• Diabetes insipidus
• :KHQHYHU DQWLGLXUHWLF KRUPRQH YDVRSUHVVLQ  SURGXFHG LQ WKH K\SRWKDODPXV LV GH¿FLHQW LW FDXVHV WKH
NLGQH\VWRGHFUHDVHWKHUHDEVRUSWLRQRIZDWHUWKXVGHFUHDVLQJWKHÀXLGFRQWHQWRIWKHERG\LQFUHDVLQJWKH
BUN/Creatinine ratio.

If the patient exhibits a decreased BUN/creatinine value, consider the following:


• ,IORZVXVSHFWHGHPDGXHWRSRVWHULRUSLWXLWDU\G\VIXQFWLRQ FKHFNIRUORZVRGLXPDQGFKORULGH 7KHUHZLOO
EHDQLQDSSURSULDWHVHFUHWLRQRIDQWLGLXUHWLFKRUPRQH $'+ 5HPHPEHU$'+ YDVRSUHVVLQ LVSURGXFHG
LQWKHK\SRWKDODPXVDQGVWRUHGLQWKHSRVWHULRUSLWXLWDU\:KHQUHOHDVHGLWLQFUHDVHVZDWHUUHDEVRUSWLRQE\
WHNLGQH\VWKXVLQFUHDVLQJWKHÀXLGFRQWHQWRIWKHERG\DQGGHFUHDVLQJ%81FUHDWLQLQHUDWLR
• 2WKHUIDFWRUVWKDWPD\GHFUHDVH%81FUHDWLQLQHUDWLRLQFOXGHSUHJQDQF\ORZSURWHLQ±KLJKFDUERK\GUDWH
diets, hypochorhydria.
Blood Interpretation 53

Remember, normal concentrations of BUN and creatinine are: 10x BUN; .1x creatinine
,I%81DQGFUHDWLQLQHUDLVHWRJHWKHUDGKHULQJWRWKHDERYHUDWLRLQWKHSUHVHQFHRIDQHOHYDWHGXULFDFLGWKH
SDWLHQWLVH[SHULHQFLQJUHQDOIDLOXUH,IKRZHYHUWKH%81LVULVLQJH[SRQHQWLDOO\DQGWKHFUHDWLQLQHLVUHPDLQLQJ
VWDWLRQDU\WKHSDWLHQWPD\KDYHKDUGHQLQJRIWKHDUWHULHVSHULUHQDOD]RWHPLD QRFDOFLXPFRXOGNLOOWKHSDWLHQW 
or internal bleeding.

Uric Acid
(normal range is 4 – 6)
8ULFDFLGLVWKHDVKRISURWHLQGLJHVWLRQ OLYHUGHDPLQL]DWLRQ )XUWKHUXULFDFLGLVVWRUHGLQWKHNLGQH\VKHQFH
WKHUHLVDQLQFUHDVHDORQJZLWK%81LQUHQDOG\VIXQFWLRQDQGVRPHWLPHVLQOLYHUG\IXQFWLRQ

If the patient exhibits an elevated uric acid value, consider the following:
LQGLFDWHVLQFUHDVHGSXULQHFDWDERLVPDQGPHWDERLFEORFNEHIRUHQLWURJHQRXVZDVWHFDQEHH[FUHWHGDVXUHD 
• *RXW UXOHRXWK\SRFKORUK\GULDLQJRXW 
• ,IKLJKZLWKKLJK(65DQGEDVRSKLOVDWKHURVFOHURVLVLVSRVVLEOH
• 3RVVLEOHKHDY\PHWDOEXUGHQ UXQKDLUDQDO\VLV
• 2WKHUFRQGLWLRQVWKDWPD\HOHYDWHXULFDFLGLQFOXGH5$OLYHUG\VIXQFWLRQUHQDOG\VIXQFWLRQ VXFKDVDFXWH
RUFKURQLFQHSKULWLVXULQDU\REVWUXFWLRQPHWDOOLFSRLVRQLQJRIWKHNLGQH\ FDQFHU FRQGLWLRQVDFFRPSDQLHG
E\PDVVLYHDQGUDSLGGHVWUXFWLRQRIFHOOQXFOHLDVZKHQWKHERG\LVIHHGLQJRQLWVHOI SHUQLFLRXVDQHPLD
hyperparathyroidism, polycythemia, diabetes, CHF, hypertension
• 3RVVLEOHXVHRISUHVFULSWLRQRUUHFUHDWLRQDOGUXJVLQFOXGLQJDGUHQRFRUWLFDOVWHURLGVEXVXOIDQQLWURJHQPXVWDUG
SXULQHDQDORJXHDQWLPHWDERLOLWHVS\KUD]LQDPLGHTXLQHWKD]RQHWKLD]LGHVYHQFULVWLQHVXIDWH

The following nutritional agents may be considered for those patients exhibiting an
elevated uric acid value:
• )RUJRXWEODFNFKHUULHV'$OVRFRQVLGHU+&/LIK\SRFKORUK\GULF
Metagest²WDEOHWVDWHQGRIHDFKPHDO
• 3DQFUHDWLFHQ]\PHV
Azeo-Pangen²WDEOHWVPLGPHDO>HDFKPHDO@
• Folic acid
Intrinsi B-12 /Folate²WDEOHWVWLPHVGDLO\

If the patient exhibits a decreased uric acid value, consider the following:
• ,IORZVXVSHFWSRRUHQ]\PDWLRQ
• $OVR LI ORZ VXVSHFW 0RO\EGHQXP GH¿FLHQF\ OHDGLQJ WR D VXOIXU GHWR[ SDWKZD\ LPSDLUPHQW PD\ KDYH D
KLVWRU\RIDOOHUJLFUHDFWLRQWRWKHVXOIXUEDVHGDQWLELRWLFV 6HSWUDRU%DFWULP RUZLQHGXHWRWKHXULQDU\VXO¿WHV
&DQEHUHDGLO\FKHFNHGZLWKDXULQDU\VXO¿WHGLSVWLFN7KHUHVKRXOGEHQRXULQDU\VXO¿WHVVKRZLQJXSDQ
D8$6XO¿WHVLQWKHSUHVHQFHRIDQRUPDOIXQFWLRQLQJSDWKZD\ZRXOGEHR[LGL]HGDOOWKHZD\WRVXOIDWHV
)XUWKHULVXULFDFLGLVORZDORQJZLWKDORZ0&9 OHVVWKDQ DQG0&+WKHQPRO\EGHQXPQHHGLVHYHQ
more probable.
• ,IORZDORQJZLWKHOHYDWHG0&90&+0&&+&DQG5':VXVSHFW%DQGRUIRODWHGH¿FLHQF\

The following nutritional agents may be considered for those patients exhibiting a
decreased uric acid value:
• Molybdenum
Advaclear²WDEOHWVWLPHVGDLO\
• Broad spectrum, plant based digestive enzymes
Spectrazyme²WDEOHWVZHDFKPHDO>PLGPHDO@
• %FRPSOH[
Glycogenics — 1 tablet 3 times daily
54 Blood Interpretation

Calcium
(normal range is 9.7 – 10.1)
RIRXUERG\¶VFDOFLXPLVVWRUHGLQRXUERQHV,WLVWKHPRVWDEXQGDQWPDFURPLQHUDOLQWKHERG\&DOFLXPLV
DEVRUEHGIURPWKHXSSHUVPDOOLQWHVWLQHVDQGWKHDPRXQWRIDEVRUSWLRQGHSHQGVXSRQWKHDFLGLW\LQWKDWUHJLRQ
DVZHOODVWKHDPRXQWRISKRVSKDWHSUHVHQW
6HUXPSURWHLQVLQÀXHQFHWKHFDOFLXPOHYHO*HQHUDOO\FDOFLXPLVLQFUHDVHGLQK\SHUSURWHLQHPLDDQGGHFUHDVHG
LQK\SRSURWHLQHPLD
&DOFLXPLVXVHGUDSLGO\IRUWLVVXHUHSDLUGXHWRWUDXPDDQGLQIHFWLRQV,WLVXVHGLQFRQMXQFWLRQZLWKYLWDPLQ$&
PDJQHVLXPSKRVSKRUXVLRGLQHDQGXQVDWXUDWHGIDWW\DFLGV
$ERXWRIVHUXPFDOFLXPLVLQWKHLRQL]HGIRUPDQGLVWKHQRQGLIIXVLEOHIRUPZKLFKLVERXQGWRSURWHLQ
(mostly albumin).
$SK\VLFLDQPXVWPDNHVXUHWKDWDSDWLHQW¶VFDOFLXPOHYHOQHYHUJRHVDERYH LQGLFDWLQJDQH[WUHPHO\PRUELG
clinical condition).
/DFWRVHDQGYLWDPLQ'ZLOOHQKDQFHFDOFLXPDEVRUSWLRQ+LJK¿EHUSK\WDWHVFHOOXORVHR[\ODWHVK\DOXURQLFDFLG
DQGORZK\GURFKORULFDFLGRXWSXWZLOODOOKLQGHUFDOFLXPDEVRUSWLRQ

If a patient exhibits an increased calcium value, consider the following:


• +\SHUSODVLDRUWXPRURIWKHWK\URLG
• Hyperparathyroidism
• Hypervitaminosis D
• Multiple myeloma
• Bone metastases

The following nutritional agents may be considered for those patients exhibiting an
increased calcium value:
• HCl
Metagest²WDEOHWVDWHQGRIHDFKPHDO
• Calcium citrate
Osteo-Citrate²WDEOHWVWLPHVGDLO\
• Decrease vitamin D
• Treat underlying disease state

If a patient exhibits a decreased calcium value, consider the following:


• Diarrhea
• Malnutrition
• Hypoparathyroidism
• 9LWDPLQ'GH¿FLHQF\
• Nephrosis
• 3QHXPRQLD
• 6HYHUHLQIHFWLRQVRIDQ\W\SH
• /RZFDOFLXPDQGHOHYDWHGSKRVSKRUXVPD\EHSRRUJDOOEODGGHUHPXOVL¿FDWLRQ
• /RZ FDOFLXP DQG WULJO\FHULGHV DQG HOHYDWHG /'+ PD\ EH SDQFUHDWLF HQ]\PH GH¿FLHQF\ DV PD\ DOWHUHG
calcium, elevated uric acid and protein.

The following nutritional agents may be considered for those patients exhibiting a
decreased calcium value:
• HCl
Metagest²WDEOHWVDWHQGRIHDFKPHDO
• Calcium citrate
Osteo-Citrate²WDEOHWVDWHQGRIHDFKPHDO
• 'LHWDU\PRGL¿FDWLRQWRDYRLGDJHQWVUHVSRQVLEOHIRUSRRUDEVRUSWLRQ
• 3DQFUHDWLFHQ]\PHV SODQWEDVHG
SpectraZyme ²WDEOHWVPLGPHDOZLWKHDFKPHDO
Blood Interpretation 55

• Vitamin D
D3-5000 ²FDSVXOHVGDLO\
• Treat underlying disease process.
0XFKKDVEHHQZULWWHQDERXWWKHW\SHRIFDOFLXPWREHXVHGEDVHGXSRQXULQDU\S+PHDVXUHGKRXUVDIWHUD
typical meal.
• ,IWKHXULQDU\S+LV!FRQVLGHU+&/DVFRUELFDFLGFDOFLXPFKORULGHODFWDWHRUSK\WDWH &DO0DJ
• ,IWKHXULQDU\S+LV±FRQVLGHUFDOFLXPRURWDWHODFWDWHDVFRUELFDFLG &DO0DJ
• ,IWKHXULQDU\S+LV±FRQVLGHUFDOFLXPFLWUDWHSKRVSKDWHRUSURWHLQDWH 2VWHR&LWUDWHRU&DO0LQ
• ,IWKHXULQDU\S+LV±FRQVLGHUFDOFLXPFLWUDWHJOXFRQDWHRUFDUERQDWH 2VWHR&LWUDWHRU7UDFH0LQ
3OXV
• ,IWKHXULQDU\S+LV±FRQVLGHUFDOFLXPFLWUDWHJOXFRQDWHFDUERQDWHRUYLWDPLQ' 2VWHR&LWUDWHRU
7UDFH0LQ3OXV
• ,IWKHXULQDU\S+LV±FRQVLGHUFDOFLXPFLWUDWH GRQ¶WXVHYLWDPLQIRU±KRXUVWKHQ\RXPD\XVH
DEXIIHUHGYLWDPLQ& 2VWHR&LWUDWH

Phosphorus
(normal range 3.4 – 4.0)
3KRVSKRUXVLVTXLWHLPSRUWDQWLQERQHSK\VLRORJ\DQGDOVRLQWKHIRUPDWLRQRIELRORJLFDOO\DFWLYHFRPSRXQGVVXFK
DVSKRVSKROLSLGVQXFOHLFDFLGV$73FUHDWLQHSKRVSKDWHDQGFRPSOH[HVUHTXLUHGIRUWKHXWLOL]DWLRQRIJOXFRVH
ZLWKLQWKHERG\
*HQHUDOO\VSHDNLQJSKRVSKRUXVLVDQLQGLFDWRURIGLJHVWLYHIXQFWLRQ)XUWKHULWLVDJRRGLQGLFDWRURILQWHVWLQDO
S+,IORZWKHJXWLVDFLGLIHOHYDWHGWKHJXWLVDONDOLQH+RZHYHUFHUWDLQO\VHYHUDOIDFWRUVDUHLPSRUWDQW
SOD\HUVLQUHJXODWLQJVHUXPSKRVSKRUXVLQFOXGLQJ37+DQGWKHIXQFWLRQDOVWDWHRIWKHNLGQH\VDVZHOODVGLHW
VRIWGULQNV"

If the patient exhibits an increased serum phosphorus level, consider the following:
• Hypoparathyroidism
• 5HQDOLQVXI¿FLHQF\
• Hypervitaminosis D
• 1RUPDOO\IRXQGHOHYDWHGLQFKLOGUHQDQGERQHUHSDLU
• 3RUWDOFLUUKRVLV
• Bone neoplasm
• Edema
• Diabetes
• 2YDULDQK\SHUIXQFWLRQ
• :KHQHOHYDWHGZLWKHOHYDWHG&DOFLXPFRQVLGHUK\GURFKORULFDFLGGH¿FLHQF\RU
• :KHQHOHYDWHGZLWKGHFUHDVHGFDOFLXPFRQVLGHUSRRUJDOOEODGGHUHPXOVL¿FDWLRQ

The following nutritional agents may be considered for those patients exhibiting an elevated
phosphorus:
• Hydrochloric acid
Metagest ²WDEOHWVDWHQGRIHDFKPHDO
• Folic acid
Intrinsi B12/Folate²WDEOHWVWLPHVGDLO\
• B12
• Bile salts
Lipoplex²WDEOHWZHDFKPHDO
5HQDJHQ'7;²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• Reduce Vitamin D supplementation
• Treat the underlying disease
56 Blood Interpretation

If the patient exhibits a decreased serum phosphorus level, you may want to consider the
following:
• 2VWHRPDODFLD
• 0\[HGHPD WK\URLGSUREOHPV
• Hyperparathyroidism
• Lobar pneumonia
• 'HFUHDVHGGXRGHQDOS+ZLWKODFNRISDQFUHDWLFELFDUERQDWH
• /RZSKRVORZ&DOFLXPORZELOLUXELQFRQVLGHUSRRUIDWDEVRUSWLRQ
• &RPPRQO\YLWDPLQ'GH¿FLHQF\
• ,IORZZLWKDQDOWHUHG KLJKRUORZ VHUXPJOREXOLQK\SRFKORUK\GULDLVSUREDEOH
• 'LHWVKLJKLQUH¿QHGVXJDUV
• Elevated blood viscosity
• 2YDULDQK\SRIXQFWLRQ
• Diabetes
• 3URWHLQPDOQXWULWLRQ

The following nutritional agents may be considered for those patients exhibiting a decreased
serum phosphorus:
• 9LWDPLQ' VRPHSDWLHQWVPD\UHTXLUHXSWR,8'IRUDVKRUWSHULRG
D3-5000 ²FDSVXOHVGDLO\
• 3HSVLQEURPHODLQODFWDVH
Muconell²FDSVXOHVGDLO\
• Lipase
Azeo-Pangen²WDEOHWVZLWKHDFKPHDO
• HCl
Metagest ²WDEOHWVDWHQGRIHDFKPHDO
• 5HGXFHUH¿QHGFDUEV
• Treat underlying disease process
1RWHWKHQRUPDOFDOFLXPWRSKRVSKRUXVUDWLRLVSDUWVRIFDOFLXPWRSDUWVRISKRVSKRUXV7KLVUDWLRPD\EH
KHDYLHURQWKHFDOFLXPVLGHLQVXEDFXWHSULPDU\K\SRWK\URLGLVPDQGDOVRLQVHFRQGDU\K\SRWK\URLGLVPGXHWR
the anterior pituitary.
8VDEOHFDOFLXP [SKRVSKRUXV QRUPDOUDQJHLV±
&DOFLXPSKRVSKRUXV LQGH[  XVDEOH FDOFLXP DERYH  [ SKRVSKRUXV  RU   SKRVSKRUXV VTXDUHG [  QRUPDO
range is 30.0 – 40.0)

Alkaline Phosphatase
(normal range 60 – 80)
$ONDOLQHSKRVSKDWDVHLVRQHPHPEHURIDJURXSRI]LQFPHWDORSURWHLQHQ]\PHV7KHUHIRUHLWLVD]LQFGHSHQGDQW
HQ]\PH$ONDOLQHSKRVSKDWDVHLVIRXQGLQVHYHUDOWLVVXHVLQFOXGLQJOLYHUERQHLQWHVWLQDOPXFRVDDQGSODFHQWD

If the patient exhibits an increased alkaline phosphatase level, consider the following possible
clinical scenarios:
• 3ULPDU\ERQHOHVLRQVLQFOXGLQJFDUFLQRPDRIERQHVDUFRPDRVWHRPDODFLDPHWDVWDWLFGLVHDVHWRWKHERQH
SDJHW¶VGLVHDVHKRGJNLQ¶VZLWKERQHLQYROYHPHQWPXOWLSOHP\HORPD
• /LYHU LQYROYHPHQW LQFOXGLQJ OLYHU DEFHVVHV KHSDWLWLV YLUDO RU WR[LF  SULPDU\ OLYHU GLVHDVH FLUUKRVLV OLYHU
cancer, primary sclerosing cholingitis, parenchymal jaundice, etc.)
• Biliary duct obstruction
• 1RUPDOO\LQFUHDVHGLQWRKRXUVDIWHUDIDWW\PHDO
• 1RUPDOO\LQFUHDVHGLQSDWLHQWVZKRDUH/HZLVSRVLWLYHVHFUHWRUVRIEORRGW\SH2DQG%
• 1RUPDOO\IRXQGLQJURZLQJFKLOGUHQ ERQHVDUHJURZLQJ
• 1RUPDOO\HOHYDWHGLQERQHIUDFWXUHKHDOLQJ PD\EHLQFUHDVHGXSWRWR
• During attempts at bone repair (osteoporosis)
Blood Interpretation 57

The following nutritional agents may be considered for those patients exhibiting an elevated
alkaline phosphatase:
• 5DZOLYHUJODQGXODU
Heprone²WDEOHWVWKUHHWLPHVGDLO\LQEHWZHHQPHDOV
• 6LO\PDULQ²WDEOHWVWKUHHWLPHVGDLO\
Liv. 52²WDEOHWVWKUHHWLPHVGDLO\
• Ascorbates
Ultra Potent-C 1000²WDEOHWVWLPHVGDLO\
• Treat the underlying disease process

If the patient exhibits a decreased alkaline phosphatase level, consider the following :
• Anemia
• Hypothyroidism
• Celiac disease
• Severe chronic nephritis
• 8VXDOO\D]LQFGH¿FLHQF\
• Estrogen therapy
• Hypothyroidism occasionally

The following nutritional agents may be considered for those patients with a decreased alkaline
phosphatase:
• =LQF PD\WDNHPRQWKVIRUDONDOLQHSKRVSKDWDVHWRDFKLHYHDQRUPDOUDQJHZKLOHRQ=Q 
Zinc AG — 3 tablets daily
• &RQVLGHUUHPRYLQJIURP+57
• Treat underlying disease process

Total Protein
(normal range is 7.1 – 7.6)
$OEXPLQDQGWRWDOJOREXOLQDUHWKHFRPSRQHQWVWKDWPDNHXSWRWDOSURWHLQ2QHFDQVHHWKDWLWLVSRVVLEOHWRKDYH
DQRUPDOWRWDOSURWHLQ\HWKDYHDEQRUPDOLQGLFHVRIJOREXOLQRUDOEXPLQ

If a patient exhibits elevated total serum protein levels, you may consider the following:
• Neoplasm
• Multiple myeloma
• 3QHXPRQLD
• 3RRU HQ]\PDWLRQ ORZ SURWHDVH HQ]\PH RXWSXW  ZKHQ HOHYDWHG SURWHLQ HOHYDWHG XULF DFLG DQG DOWHUHG
calcium level
• Hypochlorhydria
• Dehydration
• +LJKSURWHLQDQGKLJKFDORULHGLHWLIHOHYDWHGSURWHLQHOHYDWHG$*UDWLRDQGHOHYDWHGFKROHVWHURO
• /LYHUELOLDU\G\VIXQFWLRQ
• Rheumatoid arthritis
Note: a climbing total protein level is a serious clinical condition

The following nutritional agents may be considered for those patients with an elevated serum
protein level:
• 3URWHDVHHQ]\PHV SODQWEDVHG
SpectraZyme²WDEOHWVZLWKHDFKPHDO
• HCl
Metagest²WDEOHWVDWHQGRIHDFKPHDO
• 3RVVLEO\UHGXFHSURWHLQFRQVXPSWLRQ
58 Blood Interpretation

• Calcium, vitamin D
Cal Apatite Forte ²WDEOHWVGDLO\
• Treat underlying disease process

If the patient exhibits a decreased serum protein level, you may consider the following:
• Hyperthyroidism
• Birth control pills
• (GHPD JURVVHGHPDZLOOPDQLIHVWZKHQWKHSDWLHQW¶VVHUXPSURWHLQOHYHOIDOOVEHORZ
• Malnutrition
• Leukemia
• /LYHUGLVHDVH IDWW\OLYHUFRQJHVWLRQZKHQGHFUHVHGSURWHLQGHFUHDVHGFKROHVWHURODQG6*37  KHSDWLF
LQVXI¿FLHQF\ZKHQGHFUHDVHGSURWHLQDQG%81DQGDOWHUHG6*37
• 'LJHVWLYHWUDFWLQÀDPPDWRU\GLVHDVHVWDWHV FROLWLVFURKQ¶VJDVWULWLVLOHLWLVHWF
• CHF
• 5HQDOG\VIXQFWLRQ XVXDOO\GXHWRGLDEHWHVRUK\SHUWHQVLRQ
• 3RRUSURWHLQDVVLPLODWLRQZKHQGHFUHDVHGSURWHLQDQGFDOFLXP

The following nutritional agents may be considered for those patients with a decreased serum
total protein level:
• ,IGXHWRK\SHUWK\URLGFRQVLGHULRGLQH
Iodex²GURSVWLPHVGDLO\
• ,IGXHWRELUWKFRQWUROSLOOVFRQVLGHUDOWHUQDWHIRUPVRIELUWKFRQWURO
• ,IGXHWROLYHUGLVHDVH IDWW\OLYHU FRQVLGHULQRVLWRODQGFKROLQH
Lipo-Gen²WDEOHWVGDLO\
• ,IWKHNLGQH\VDUHLQYROYHGFRQVLGHU/DUJLQLQHDQGUDZNLGQH\JODQGXODU
Arginine Plus²FDSVXOHVGDLO\LQEHWZHHQPHDOV
5HQDJHQ'7;²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
CoQ10 ST-100 ²FDSVXOHVGDLO\
L-Carnitine 500²WDEOHWVGDLO\LQEHWZHHQPHDOV
• ,IGXHWRK\SHUWHQVLRQFRQVLGHUGLHW
CoQ10 ST-100²FDSVXOHVGDLO\
L-Carnitine 500²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• Treat the underlying disease process

Albumin
(normal range is 4 – 4.5)
7KHDOEXPLQZLWKLQWKHERG\LVDOPRVWHQWLUHO\SURGXFHGE\WKHOLYHU$OEXPLQLVUHVSRQVLEOHIRUDSSUR[LPDWHO\
RIWKHFROORLGRVPRWLFSUHVVXUHEHWZHHQEORRGDQGWLVVXHÀXLGV

If the patient exhibits an increased serum albumin level, you may consider the following:
• Dehydration

The following may be considered in the treatment for the dehydrated patient:
• LQFUHDVHÀXLGV

If the patient exhibits a decreased serum albumin level, you may consider the following:
• 6LQFHPRVWRIWKHDOEXPLQLVSURGXFHGE\WKHOLYHULIORZFOHDUO\OLYHUGLVHDVHPXVWEHFRQVLGHUHGLQFOXGLQJ
hepatitis, cirrhosis, or acute cholecystitis
• .LGQH\UHODWHGGLVRUGHUVLQFOXGLQJQHSKURVLVDQGQHSKULWLV
• Malnutrition or visceral protein loss
• %HORZLQGLFDWHVDSRVVLEOHVHULRXVSDWKRORJ\ QHRSODVP
• 'LJHVWLYHLQÀDPPDWRU\GLVHDVHV XVXDOO\VHFRQGDU\WRWKHQHHGIRU+&/
• Hyperthyroidism
• 3UHJQDQF\
Blood Interpretation 59

The following nutritional agents may be considered for those patients with a decreased albumin
level:
• Address liver condition(s) appropriately (methionine, choline,and inositol)
Lipogen ²WDEOHWVGDLO\
• ,INLGQH\FRQVLGHU/DUJLQLQHDQGUDZNLGQH\JODQGXODU
Arginine Plus ²WDEOHWVGDLO\LQEHWZHHQPHDOV
5HQDJHQ'7;²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
• ,IGLJHVWLYHLQÀDPPDWRU\GLVHDVHFRQVLGHU
8OWUD,QÀDP;²PRGLI\VWHSSURJUDP VHH'HWR[L¿FDWLRQVHFWLRQ
Probioplex IC²WVSGDLO\
• Treat underlying disease process
1RWH$OEXPLQOHYHOVDQGUDWLRVZLWKRWKHUHQWLWLHVSOD\DVLJQL¿FDQWUROHLQDVVHVVLQJWKHSDWLHQW¶VPRUELGLW\ULVN
7KUHH  RIWKHRPLQRXVVLJQVLQFOXGHDOEXPLQLQWKHHTXDWLRQ3HUKDSVWKHPRVWRPLQRXVRIWKHRPLQRXV
VLJQVLVDQDOEXPLQWKDWLVRUEHORZZLWKDWRWDODEVROXWHO\PSKRF\WHFRXQWOHVVWKDQ7KHSDWLHQWZLWK
WKLVRPLQRXVVLJQSRVVHVVHVDWLPHVJUHDWHUULVNIRUPRUELGLW\DQGDWLPHVJUHDWHUULVNIRUPRUWDOLW\WKDQ
the general population.

Globulin
(normal range is 2.8 – 3.5)
6HYHUDOFRPSRQHQWVPDNHXSWKHWRWDOJOREXOLQVHUXPOHYHORIWKHSDWLHQW7KH\LQFOXGHWKHDOSKDIUDFWLRQ
DOSKDIUDFWLRQEHWDIUDFWLRQDQGWKHJDPPDIUDFWLRQ7KHUHIRUHYDU\LQJOHYHOVRIDQ\RIWKHVHIUDFWLRQVFDQ
LQÀXHQFHWRWDOJOREXOLQOHYHOV*OREXOLQLVDVRSKLVWLFDWHGIRUPRISURWHLQ,WLQGLFDWHVWKHDPRXQWRIFLUFXODWLQJ
FROORLGDOSURWHLQWKDWLVXVHGWRPDQXIDFWXUHDQWLERGLHVEORRGFHOOVDQGHQ]\PHV*OREXOLQZLOOFRPELQHVZLWK
SKRVSKRUXVFRSSHULRGLQHDQGLURQLQRUGHUWRKDYHIXQFWLRQLQJ,J*$0DQG(LPPXQRJOREXOLQV

If the patient exhibits an increased globulin level, you may consider:


• ,QIHFWLRQ
• Neoplasm (early malignancy or multiple myeloma)
• 3DUDVLWLFLQIHFWLRQV
• Hepatitis
• +&/GH¿FLHQF\
Note: a climbing total globulin is a serious clinical matter.

The following nutritional agents may be considered for those patients with an increased
globulin level:
• ,IGXHWRLQIHFWLRQPXVWGLVFHUQZKDWW\SHDQGWUHDWDFFRUGLQJO\
• ,IGXHWRQHRSODVPVHHWUHDWPHQWSURWRFROVZLWKLQWKH&DQFHU0RGXOHVRIKRXU'LSORPDWH,QWHUQLVWFRXUVH
or chiropractic injectable nutrient pharmacotherapy course.
• ,IGXHWRLQIHFWLRXVKHSDWLWLVFRQVLGHU:ULJKWDQG*DE\SURWRFRO
Silymarin 80 [900 mg]²WDEOHWVWLPHVGDLO\
Lipoic Acid [600 mg] — 2 capsules 3 times daily
Selenase [400 mcg] — 2 capsules 2 times daily
• Betaine HCL
Metagest²WDEOHWVDWHQGRIHDFKPHDO

If the patient exhibits a decreased globulin level, you may consider:


• Anemia
• &KURQLFYLUDORUEDFWHULDOLQIHFWLRQV
• Hemorrhage
• /LYHUG\VIXQFWLRQ
1RWH$GHFUHDVHGWRWDOJOREXOLQPD\VXJJHVWLQFUHDVHGXVHRIJOREXOLQE\WKHOLYHUVSOHHQWK\PXVNLGQH\V
or heart.
60 Blood Interpretation

The following nutritional agents may be considered for those patients with a decreased globulin
level:
• ,IGXHWRDQHPLDLVLWVHFRQGDU\WRDQ³RFFXOW´EOHHG"7UHDWDFFRUGLQJO\
• ,I GXH WR FKURQLF YLUDO RU EDFWHULDO LQIHFWLRQV XSUHJXODWH LPPXQH VWDWXV ZLWK & =Q *HUPDQLXP &R4
colostrums, thymus, etc.
Ultra Potent-C 1000²WDEOHWVWLPHVGDLO\
Zinc AG — 1 tablet 3 times daily
CoQ10 ST 100 ²FDSVXOHVGDLO\
Probioplex IC²FDSOHWVWZLFHGDLO\
Thymotrate²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
Olivir ²FDSVXOHVGDLO\
• ,IGXHWRKHPRUUKDJHZLWKLQXSSHU*,WUDFWFRQVLGHUROLYHRLOJDVWURPHWJDVWULFXPHHOHOKDVHFDOLQ
• ,IGXHWROLYHUG\VIXQFWLRQGLVFHUQZKDWW\SHDQGWUHDWDFFRUGLQJO\

Albumin/Globulin Ratio: (A/G Ratio)


(normal value is 1.2 – 1.5)
127($ORZ UHYHUVHGRULQYHUWHG $*UDWLROHVVWKDQLVRQHRIWKHRPLQRXVVLJQV7KHVHSHRSOHPD\
KDYHDVHULRXVGHYHORSLQJRUFXUUHQWO\PDQLIHVWLQJSDWKRORJLFDOSURFHVV

If the patient exhibits a decreased A/G ratio, consider the following:


• Neoplasm, including multiple myeloma or metastatic disease
• ,QIHFWLRXVGLVHDVHLQFOXGLQJ$,'6
• Intestinal disease
• Liver disease
• Renal disease
• 7KHFDFKH[LFSDWLHQW
• CHF

The following nutritional agents may be considered for those patients with a decreased A/G ratio:
• 7KHSK\VLFLDQPXVWGHWHUPLQHZKDWSDWKRORJ\LVGHYHORSLQJRUDOUHDG\SUHVHQWDQGWUHDWDFFRUGLQJO\
127(  ,I WKH SDWLHQW SRVVHVVHV DQ HOHYDWHG $* UDWLR WKLV SKHQRPHQRQ LV QRW FRQVLGHUHG WR EH FOLQLFDOO\
VLJQL¿FDQW

Calcium/Albumin Ratio: (Ca/A ratio)


(normal value is 2.2 – 2.5)
,IWKHSDWLHQWH[KLELWVDGHFUHDVHG&D$UDWLRLWLVFRQVLGHUXVXDOO\DVFOLQLFDOO\LQVLJQL¿FDQW
127(,IWKHUDWLRLVHOHYDWHGJUHDWHUWKDQWKLVLVFRQVLGHUHGRQHRIWKHRPLQRXVVLJQVGXHWRPDOQXWULWLRQ
or visceral protein loss secondary to a potential pathological process.

GGT (Gamma-glutamyl transferase)


(normal range is 1 – 40)
**7LVJHQHUDOO\FRQVLGHUHGWRQRWEHTXLWHDVVHQVLWLYHDPDUNHUDV6*37**7LVUHVSRQVLEOHIRUWUDQVSRUWLQJ
DPLQRDFLGVDFURVVWKHFHOOPHPEUDQHVIURPWKHH[WUDFHOOXODUWRWKHLQWUDFHOOXODUFRPSRQHQW7KLVIXQFWLRQUHTXLUHV
PROHFXOHVRI$73DQGPROHFXOHRIJOXWDWKLRQH**7LVFRPPRQO\HOHYDWHGLQDOFRKROLFV

If the patient exhibits an increased GGT level, consider the following:


• Hepatic disease
• 3DQFUHDWLFGLVHDVHHVSHFLDOO\LI!
• Cardiovascular disease
Blood Interpretation 61

• Diabetes
• Epilepsy
• Severe trauma

The following nutritional agents may be considered for those patients possessing an elevated
GGT:
• ,IGXHWRELOLDU\WUHHREVWUXFWLRQIROORZJDOOEODGGHUSURWRFRO
• ,IGXHWROLYHUGLVHDVHWUHDWDFFRUGLQJO\ PHWKLRQLQHUDZOLYHUKHSDWRSOH[HWF
Heprone ²WDEOHWVWKUHHWLPHVGDLO\LQEHWZHHQPHDOV
Liv. 52²WDEOHWVWKUHHWLPHVGDLO\
Lipogen²WDEOHWVGDLO\
• ,IGXHWRSDQFUHDWLWLVQRDOFRKROGLJHVWLYHHQ]\PHV
Azeo-Pangen²WDEOHWVPLGPHDOZLWKHDFKPHDOQRDOOHUJLFIRRGV,9¶V
• Treat the responsible disease process.
127(7KHUHLVQRVLJQL¿FDQWFOLQLFDOFRQFHUQZLWKDORZHUHGOHYHORI**7

SGOT: (also known as AST)


(normal levels are 18 – 26)
6*27LVIRXQGLQOLYHUVNHOHWDOPXVFOHEUDLQKHDUWDQGNLGQH\V,WZLOOHOHYDWHZLWKGHJHQHUDWLYHGHVWUXFWLYH
RUJDQSURFHVVHV ,QFDUGLDFUHODWHGFRQGLWLRQV6*27ZLOOQRWUHWXUQWRQRUPDODVTXLFNO\DV6*37

If the patient exhibits an elevated SGOT level, one may consider the following:
• 0\RFDUGLDOLQIDUFWLRQ FRQ¿UPZLWKWUHSRQLQ
• Hepatic conditions (parenchymal damage)
• 3DQFUHDWLWLV
• 3XOPRQDU\HPEROLVP
• Myositis / skeletal muscle damage
• Mono
• Neoplasm
• Alcoholics
• Diabetes
• Essential hypertension
• Rheumatoid arthritis

The following nutritional agents may be considered for those patients possessing an elevated
SGOT:
• %URDGVSHFWUXPSODQWEDVHGHQ]\PHV>DP\ODVHSURWHDVHOLSDVHFHOOXODVH@IRUSDQFUHDWLFLQYROYHPHQW
SpectraZyme ²WDEOHWVZLWKHDFKPHDO
• ,IOLYHULVLQYROYHGFRQVLGHUWKHSDWKRORJ\DQGWUHDWDFFRUGLQJO\
• ,IFDUGLDF 0,RUFRURQDU\DUWHU\LQVXII FRQVLGHU,9FKHODWLRQ'062DQGJOXWDWKLRQHIRUIUHHUDGLFDOGDPDJH
FRQWUROIRUWKHH[SDQGLQJLQIUDFWHGSHQXPEUD$OVRPDJQHVLXPWDXULQH&R4/FDUQLWLQHKDZWKRUQH
cralonin, cor compositum.
NAC-600²FDSVXOHVGDLO\
Cardiogenics Intensive Care²WDEOHWVGDLO\LQEHWZHHQPHDOV
CoQ10 ST 100 ²FDSVXOHVGDLO\
• Ascertain the underlying clinical condition, and treat accordingly

If the patient exhibits a decreased SGOT level, one must consider the following:
• 9LWDPLQ%GH¿FLHQF\ S\ULGR[LQH 
1RWH6*27LVD%GHSHQGHQWHQ]\PH,QRWKHUZRUGVIRUWKHERG\WRPDQXIDFWXUH6*27WKHUHPXVWEH
DGHTXDWHOHYHOVRIFLUFXODWLQJ%
62 Blood Interpretation

The following chiropractic nutritional pharmacotherapy agent may be considered for the patient with
decreased SGOT:
• 3\ULGR[LQH %
Pyridoxal-5'-Phosphate ²WDEOHWVGDLO\

SGPT: (also known as ALT)


(normal range is 18 – 26)
6*37LVDQHQ]\PHWKDWLVIRXQGLQOLYHUNLGQH\VKHDUWDQGVNHOHWDOPXVFOH

If the patient exhibits an elevated SGPT level, one may consider the following:
• +HSDWLFUHODWHGGLVRUGHUVZKHUHWKHOLYHULVVZROOHQDONDOLQHDQGLQÀDPHG HVSHFLDOO\KHSDWLWLV
• 3DQFUHDWLFFRQGLWLRQV
• Neoplasm
• Alcoholism
• CHF
• MI
• Hypertension
• RA
• Asthma

The following nutritional agents may be considered for the patient with elevated SGPT:
• ,IGXHWRKHSDWLWLVVLO\PDULQKHSDWDSOH[EHWDFDURWHQHJHUPDQLXPHWF
Silymarin 80 ²WDEOHWVWLPHVGDLO\
Liv. 52²WDEOHWVWKUHHWLPHVGDLO\
• ,IGXHWRSDQFUHDWLFSUREOHPVSODFHRQEURDGVSHFWUXPSODQWEDVHGGLJHVWLYHHQ]\PHV
SpectraZyme²WDEOHWVZLWKHDFKPHDO
• ,IGXHWRDGXOWRQVHWDVWKPD
VentiMax ²FDSVXOHVWZLFHGDLO\
• Determine the underlying pathology and treat accordingly

If the patient exhibits a decreased SGPT level, one may consider the following:
• Fatty liver congestion

The following nutritional agents may be considered for the patient with decreased SGPT
levels:
• /LSRWURSKLFIDFWRUVLQFOXGLQJPHWKLRQLQHLQRVLWROFKROLQH
Lipogen²WDEOHWVGDLO\
• Alkaline B vitamins
Glycogenics²WDEOHWVGDLO\
127(:KHQ6*37LVJUHDWHUWKDQ6*27 DQGPXVWEHKLJKHUWKDQWKHODERUDWRU\UHIHUHQFHUDQJHV«QRWRXU
KRPHRVWDWLFUDQJHVWKDWZHTXRWH WKLVW\SLFDOO\LQGLFDWHVDQH[WUDKHSDWLFFRQGLWLRQVXFKDVKHSDWLWLVH[WUD
KHSDWLFREVWUXFWLRQ LH*DOOVWRQHVLQELOHGXFW DQGWR[LFKHSDWLWLV:KHQ6*27LVJUHDWHUWKDQ6*37 DQG
DJDLQLWLVKLJKHUWKDQWKHODERUDWRU\UHIHUHQFHUDQJHV ZHDUHW\SLFDOO\ORRNLQJDWDQLQWUDKHSDWLFFRQGLWLRQVXFK
DVSULPDU\OLYHUFDQFHUFLUUKRVLVSULPDU\VFOHURVLQJFKROHQJLWLV&OHDUO\WKHODWWHUVFHQDULRLVDVVRFLDWHGZLWK
LQFUHDVHGULVNIRUPRUWDOLW\

LDH
(normal range is 120 – 160)
7RWDO/'+PD\HOHYDWHLQYLUWXDOO\DQ\GHVWUXFWLYHSURFHVVRUWUDXPDLQWKHERG\7KHHQ]\PHLVZLGHO\GLVWULEXWHG
in heart and skeletal muscle, liver, kidney, and red blood cells. Anytime an elevated total LDH is discovered, it
LVFOLQLFDOO\SUXGHQWWRRUGHUDQ/'+LVRHQ]\PHVVWXG\7KHUHDUHLVRHQ]\PHVZLWKVRPHFURVVRYHUQRWHG
Blood Interpretation 63

EHWZHHQVHWV
• /'+,VRHQ]\PHLVIRXQGLQKHDUWDQG5%&¶V
• /'+,VRHQ]\PHLVIRXQGLQKHDUWO\PSKDQG5%&¶V
• /'+,VRHQ]\PHLVIRXQGLQSXOPRQDU\VSOHHQDGUHQDODQGNLGQH\
• /'+,VRHQ]\PHLVIRXQGLQOLYHUVNHOHWDOPXVFOHSURVWDWHXWHUXV
• /'+,VRHQ]\PHLVIRXQGLQOLYHUDQGVNHOHWDOPXVFOH
$GHFUHDVHG/'+,VRHQ]\PHZLOORIWHQRFFXULQSDWLHQWVZKRKDYHH[SHULHQFHGORQJWHUPLQVLGLRXVH[SRVXUH
WRQR[LRXVJDVHV &2HWF %HZDUHLI\RXUSDWLHQWFRPSODLQVRIXQH[SODLQHGLOOQHVVIDWLJXHORVVRIPHPRU\
HWF&KHFNIRUOHDNV)XUWKHULIWKLVLVRHQ]\PHLVGHFUHDVHGLWFDQLQGLFDWHDKHDY\PHWDOEXUGHQ
%\RUGHULQJ/'+LVRHQ]\PHVWXG\LWLVSRVVLEOHWRQDUURZDGHYHORSLQJGLVHDVHSURFHVVE\RUJDQV\VWHPHDUO\
on in its development.
,I WKH SDWLHQW H[KLELWV DQ HOHYDWHG WRWDO /'+ UXQ WKH LVRHQ]\PH VWXG\ DQG WUHDW WKH DIÀLFWHG RUJDQWLVVXH
accordingly.
127(+HPRO\]HGEORRGGUDZVDPSOHVKDYHDODUJHDPRXQWRI/'+6*27DQG6*37LQWKHP%HDZDUHRI
WKDWZKHQGUDZLQJEORRGLQ\RXURI¿FHV

If the patient exhibits a decreased LDH, one may consider the following:
• Hypoglycemia

The following nutritional agents may be considered for those patients with decreased total
serum LDH levels:
• Hypoglycemic nutrients including: Cr, Zn, Vanadium, Magnesium, B vitamins, etc.
0HWD*O\FHP;²WDEOHWVGDLO\
Glycogenics²WDEOHWVGDLO\

Total Bilirubin
(normal range is .5 – .7)
7RWDOELOLUXELQLVDQHQGSURGXFWRIKHPRJORELQEUHDNGRZQE\WKHVSOHHQOLYHUDQGERQHPDUURZ7KHOLYHUZLOO
DOWHUELOLUXELQWRDIRUPWKDWLVH[FUHWHGWKURXJKWKHELOHRUE\WKHNLGQH\V:KHQWKHSDWLHQW¶VYDOXHJRHVDERYH
FRQVLGHUDOLYHUJDOOEODGGHUÀXVKLIVWRQHVDUHFRQ¿UPHGDQDUHFPLQGLDPHWHUDQGQRQFDOFL¿HG

If the patient exhibits an elevated total bilirubin, consider the following:


• Biliary obstruction
• Hemolytic anemia
• Liver injury
• Chronic cholecystitis
• 7K\PXVLQYROYHPHQWLI7ELOLLVHOHYDWHGZLWKDOWHUHGO\PSKRF\WHFRXQW
• 6SOHHQK\SHUIXQFWLRQLIHOHYDWHG7ELOL+JE+FWDQGORZ5%&FRXQW

The following nutritional agents may be considered for those patients with an elevated T.
bilirubin:
• ,IGXHWRJDOOVWRQHVFRQVLGHUDEGRPLQDO';86WRGHWHUPLQHVL]H FDQZRUNZLWKWKHPLIWKH\DUHFP
LQGLDPHWHU3HUIRUPDQDEGRPLQDOÀDWSODWHWRVHHLIVWRQHVDUHFDOFL¿HG LIFDOFL¿HGDQGSDWLHQWLVDFXWH
FRQVLGHUVXUJLFDOUHIHUUDO ,IVWRQHVDUHQRWFDOFL¿HGEHJLQZLWKELOHYLVFRVLW\WKLQQLQJDJHQWVVXFKDVDSSOH
FLGHUIRUWRGD\V7KHQSURFHHGWROLYHUJDOOEODGGHUÀXVK VHHDSSHQGL[
• 5DZWK\PXVJODQGXODU
Thymotrate²WDEOHWVGDLO\LQEHWZHHQPHDOV
• 5DZVSOHHQJODQGXODU
Splenotrate²WDEOHWVGDLO\LQEHWZHHQPHDOV
• Determine the underlying pathology and treat appropriately.

There is virtually no significance with a lowered T. bilirubin with the exception of possible
seconday aplastic anemia.
64 Blood Interpretation

CPK
(creatin kinase) (normal range is 30 – 180)
9LUWXDOO\ DQ\ SDWLHQW ZKR SRVVHVVHV D VLJQL¿FDQWO\ HOHYDWHG WRWDO &3. VKRXOG KDYH D &3. LVRHQ]\PH VWXG\
ordered.
&3. LV HOHYDWHG LQ FDUGLDF FRQGLWLRQV PXVFXODU G\VWURSK\ PXVFOH GDPDJHGHJHQHUDWLRQ EUDLQ GDPDJH
LQÀDPPDWLRQDQGVWUHQXRXVH[HUFLVHDOVRRWKHUFRQGLWLRQVLQFOXGHK\SRWK\URLGLVPHGHPDDQGLQÀXHQ]D

CPK isoenzymes are broken down into three (3) categories:


1. &.00±GHULYHGIURPVNHOHWDOPXVFOH
2. &.0%±GHULYHGIURPKHDUWPXVFOH
3. &.%%±GHULYHGIURPEUDLQDQGQHUYHWLVVXHDQGPD\DOVREHDXVHIXOPDUNHUIRUSURVWDWHEUHDVW
ovarian, colon, lung, and digestive tract cancers.

Serum Iron (Fe)


(normal range is 85 – 120)
6HUXPLURQLVMXVWWKDWWKHLQRUJDQLFIRUPRIFLUFXODWLQJLURQLQWKHEORRG

If the patient exhibits an increased serum iron, consider the following:


• Hemochromatosis
• The patient is on iron therapy
• /LYHUG\VIXQFWLRQ KHSDWLWLV
• Iron conversion anemias
• :DWHUVXSSO\"&RRNLQJXWHQVLOV"
• 0D\UHVXOWIURPGH¿FLHQF\LQ5%&SURGXFWLRQDQGRU5%&GHVWUXFWLRQ
• ,QSUHVHQFHRIGHFUHDVHG+FWSRVVLEOHLQWULQVLFIDFWRUGH¿FLHQF\
1RWH,URQLVYLWDOWRVSOHHQIXQFWLRQDQGUHWLFXORHQGRWKHOLDODFWLYLW\

The following nutritional agents may be considered for those with elevated serum iron
levels:
• Discontinue iron therapy
• Address liver involvement
• Determine the underlying cause and treat appropriately

If the patient exhibits a decreased total serum iron level, consider the following:
• ,IWKHVHUXPLURQLVEHORZ±PXVWUXOHRXWSDWKRORJLFDOEOHHGLQJ +HPRFXOWWHVW"
• &KURQLFLQIHFWLRQV
• Nephrosis
• Hypochromic anemias

The following nutritional agents may be considered for those with decreased serum iron
levels.
• 6SOHHQ UDZ
Splenotrate²WDEOHWVGDLO\LQEHWZHHQPHDOV
• Iron
Hemagenics²WDEOHWVGDLO\
• Vitamin C
Ultra Potent-C 1000²WDEOHWVGDLO\
1RWHPXVWFRQVLGHUWRUXQDWUDQVIHUULQJDQGVHUXPIHUULWLQ
Blood Interpretation 65

Thyroid Profile
T3: (tri-iodothyronine)(normal range is 36.0 – 40.0)
7FRPSULVHVDSSUR[LPDWHO\±RIWKHWRWDOFLUFXODWLQJKRUPRQH$SSUR[LPDWHO\RI7LVFRQYHUWHGWR
77LVSURGXFHGPDLQO\IURPWKHSHULSKHUDOFRQYHUVLRQRI7
*HQHUDOO\VSHDNLQJ7KDVDKLJKHUELRORJLFDODFWLYLW\WKDW7\HWZLOOELQGWRSURWHLQOHVVHI¿FLHQWO\WKDW77
LQVHUXPH[LVWVLQERWKDERXQGIRUPDQGDIUHHIRUPKRZHYHUOHVVWKDQLVLQWKHIUHHIRUP

If the patient exhibits an increased T3 value, consider the following:


• Hyperthyroidism
• 7K\URWR[LFRVLV
• Hypoproteinemia
• Nephrosis
• Neoplasm

If the patient exhibits a decreased T3 value, consider the following:


• Hypothyroidism
• 0\[HGHPD
• 3UHJQDQF\
• Birth control pills

T4: (tetra-iodothyronine)
(normal range is 7.0 – 9.0)
7LVWKHPDMRUKRUPRQHVHFUHWHGE\WKHWK\URLGPDNLQJXS±RIWKHKRUPRQH7H[LVWVDVERWKDERXQG
DQGQRQERXQGIRUP7LVSUHGRPLQDWHO\ERXQGWRWK\URLGELQGLQJJOREXOLQ 7%* SUHDOEXPLQDQGDOEXPLQ

If the patient exhibits an increased T4 value, consider the following:


• Hyperthyroidism
• 7K\URWR[LFRVLV
• Birth control pills
• 3UHJQDQF\
• Neoplasm

If the patient exhibits a decreased T4 value, consider the following:


• Hypothyroidism
• 0\[HGHPD
• Hypoproteinemia
• Nephrosis
• Simmonds disease

T7: (also known as FTI [free thyroid index])


(normal range is 2.6 – 3.6)
7HVVHQWLDOO\UHÀHFWVWKHPHWDEROLFLPSDFWRIWKHWK\URLGKRUPRQHRQWKHERG\7FDQEHFDOFXODWHGE\WKH
IROORZLQJHTXDWLRQ7 7[7
,W LV LQWHUHVWLQJ WR QRWH WKDW PDQ\ SDWLHQWV PD\ LQ IDFW ORRN OLNH DQG FRPSODLQ RI V\PSWRPV DVVRFLDWHG ZLWK
K\SRWK\URLGLVP\HWKDYHQRUPDORUQHDUO\QRUPDOWK\URLGLQGLFHV:KHQWKHEORRGZRUNDSSHDUVVRPHZKDW
unremarkable, yet you still are clinically thinking that this patient has hypothyroidism, consider having the patient
do the basal body temperature study.
66 Blood Interpretation

The following form is a common form utilized for the basal temperature test:
Basal Body Temperatute Studies for Thyroid Function:
2IDOOWKHSUREOHPVWKDWFDQDIIHFWKHDOWKQRQHFDQEHPRUHFRPPRQPRUHHDVLO\FRUUHFWHG\HWPRUHXQWUHDWHG
DQGXQVXVSHFWHGWKDQORZWK\URLGJODQGIXQFWLRQLQJFDOOHGK\SRWK\URLGLVP
7K\URLGIXQFWLRQPD\KDYHDQHIIHFWRQPDQ\RIWKHGHJHQHUDWLYHGLVHDVHSURFHVVHVWKDWZHHQFRXQWHUVXFKDV
KDUGHQLQJRIWKHDUWHULHVFKROHVWHURODEQRUPDOLWLHVKLJKEORRGSUHVVXUHVNLQGLVRUGHUVPHQVWUXDODEQRUPDOLWLHV
ORZUHVLVWDQFHWRLQIHFWLRQVDQGPDQ\RWKHUFRQGLWLRQV
$VLPSOHWHVWKDVEHHQGHYLVHGWRHYDOXDWHWK\URLGDFWLYLW\WKLVLVSHUIRUPHGVLPSO\E\WDNLQJWKHD[LOODU\ XQGHU
DUP WHPSHUDWXUHHYHU\PRUQLQJIRUWHQ  FRQVHFXWLYHGD\V

Instructions For Taking Basal Body Temperature:


• Use an ordinary oral or rectal thermometer.
• 6KDNHGRZQWKHWKHUPRPHWHUWKHQLJKWEHIRUHDQGSODFHLWRQ\RXUQLJKWVWDQG
• 7KH¿UVWWKLQJLQWKHPRUQLQJ%()25(\RXJHWRXWRIEHGSODFHWKHWKHURPHWHUXQGHU\RXUDUPIRUWHQ  
minutes.
• 5HFRUGWKHWHPSHUDWXUHUHDGLQJDQGGDWHLQWKHSODFHVEHORZ

Date: Temperature:

$IWHUWKHFRPSOHWLRQRIWKHWHQ  GD\F\FOHSOHDVHPDLOWKLVUHSRUWWRRXURI¿FHRUEULQJLWZLWK\RXIRU\RXU
QH[WDSSRLQWPHQW

Signature:
Normal Range: 97.6 to 98.2
• $YHUDJHVEHORZLQGLFDWHK\SRWK\URLGLVP
• Averages above indicate hyperthyroidism.
,I WKH SDWLHQW ZLQGV XS KDYLQJ D IDLUO\ QRUPDO WK\URLG SDQHO \HW WKH EDVDO WHPSHUDWXUHV DUH FRQVLVWHQWO\ OHVV
WKDQGHJUHHVIDUHQKHLW\RXPD\VWLOOFRQVLGHUWUHDWLQJWKHSDWLHQWIRUK\SRWK\URLGLVP7KHWUHDWPHQWZRXOG
SURFHHGIRUDSSUR[LPDWHO\GD\VWKHQUHHYDOXDWH

The following nutritional agents may be considered for a patient exhibiting hypothyroidism:
• Thyrosol — 1 tablet three times daily
• T-100²WDEOHWVWKUHHWLPHVGDLO\DZD\IURPIRRG

The following nutritional agents may be considered for a patient exhibiting


hyperthyroidism:
• T-100WDEOHWVWKUHHWLPHVGDLO\
Comprehensive Thyroid support Formula
• Thyrosol®WDEOHWVWKUHHWLPHVGDLO\
7K\URVROLVDQH[FLWLQJPXOWLIDFHWHGIRUPXODIHDWXULQJWDUJHWHGQXWULHQWVDQGKHUEVWKDWSURPRWHKHDOWK\
WK\URLGIXQFWLRQ
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[VXSSRUW
Blood Sugar Dysregulation / Metabolic Syndrome 67

Blood Sugar Dysregulation / Metabolic Syndrome


General nutritional support strategies for individuals with any dysglycemic response. i.e.
• Metabolic Syndrome (lnsulin Resistance and Hyperinsulinemia)
• Type II Diabetes
• Reactive Hypoglycemia.
127(³7\SH'LDEHWHV´VHH$XWRLPPXQH6HFWLRQ

Metabolic Syndrome Definition:


0HWDEROLF6\QGURPHGHVFULEHVDFOXVWHURIWZRRUPRUHUHODWHGKHDOWKSUREOHPV&HQWUDOWRWKHV\QGURPHLV
LQVXOLQUHVLVWDQFHWKHLQDELOLW\WRHI¿FLHQWO\XVHLQVXOLQWRKHOSEXUQEORRGVXJDU,WLVRIWHQDFFRPSDQLHGE\
abdominal obesity.
+HUH
VKRZLWGHYHORSV7KHPRUHUH¿QHGFDUERK\GUDWHV\RXFRQVXPHWKHIDVWHU\RXUEORRGVXJDUULVHVDIWHUD
PHDO,QUHVSRQVH\RXUERG\SXPSVRXWODUJHDPRXQWVRILQVXOLQWRKHOSPRYHWKDWEORRGVXJDULQWRFHOOV%XW
LQVXOLQ DSRZHUIXOKRUPRQH DOVRSURPRWHVIDWVWRUDJHLQFUHDVHGEORRGSUHVVXUHDQGHOHYDWHGFKROHVWHURODQG
triglyceride levels.
$SSUR[LPDWHO\RI$PHULFDQVDUHRYHUZHLJKWDVLJQRIPHWDEROLFV\QGURPH,QDGGLWLRQRIWKLQSHRSOH
KDYHLQVXOLQUHVLVWDQFHWKHFRUQHUVWRQHRIPHWDEROLFV\QGURPH%DVHGRQWKHVHQXPEHUVPRUHWKDWRI
$PHULFDQDGXOWVHLWKHUKDYHRUDUHDWULVNRIPHWDEROLFV\QGURPH
$OORIWKLVEORRGVXJDUDQGLQVXOLQJHQHUDWHVODUJHQXPEHUVRIKD]DUGRXVIUHHUDGLFDOVZKLFKDJHWKHERG\DQG
VHWWKHVWDJHIRUKHDUWGLVHDVHFDQFHU$O]KHLPHU
VDQGRWKHUGLVHDVHV

How is Metabolic Syndrome Diagnosed?


7KHUHDUHQRZHOODFFHSWHGFULWHULDIRUGLDJQRVLQJWKHPHWDEROLFV\QGURPH7KHFULWHULDSURSRVHGE\WKH1DWLRQDO
&KROHVWHURO(GXFDWLRQ3URJUDP 1&(3 $GXOW7UHDWPHQW3DQHO,,, $73,,, ZLWKPLQRUPRGL¿FDWLRQVDUHFXUUHQWO\
UHFRPPHQGHGDQGZLGHO\XVHG
The American Heart Association and the Nation Heart, Lung, and Blood Institute recommend that the metabolic
V\QGURPHEHLGHQWL¿HGDVWKHSUHVHQFHRIWKUHHRUPRUHRIWKHVHFRPSRQHQWV
• Elevated waist circumference:
Men – Equal to or greater than 40 inches (102 cm)
:RPHQ±(TXDOWRRUJUHDWHUWKDQLQFKHV FP
• Elevated triglycerides:
Equal to or greater than 150 mg/dL
• Reduced HDL ("good") cholesterol:
Men – Less than 40 mg/dL
:RPHQ±/HVVWKDQPJG/
• Elevated blood pressure:
Equal to or greater than 130/85 mm Hg
• Elevated fasting glucose level
Equal to or greater than 100 mg/dL

Ideal Laboratory Indices


• )DVWLQJ,QVXOLQPF,8PO
• )DVWLQJ*OXFRVHPJGO
• )DVWLQJ7ULJO\FHULGHVPJGO
• )DVWLQJ&KROHVWHUROPJGO
• +U3RVWSUDQGLDO,QVXOLQ/HVVWKDQPF,8PO
• +U3RVWSUDQGLDO*OXFRVH/HVVWKDQPJGO

Diabetes Definition
A syndrome characterized by abnormal insulin secretion and elevated blood glucose levels, accelerated
DWKHURVFOHURVLVQHXURSDWK\DQGWKLFNHQHGFDSLOODU\PHPEUDQHVUHVXOWLQJIURPDYDULDEOHLQWHUDFWLRQRIKHUHGLWDU\
DQGHQYLURQPHQWDOIDFWRUV
NOTE:'LDEHWHV0HOOLWXVLVFODVVL¿HGDV7\SH LQVXOLQGHSHQGHQW RU7\SH QRQLQVXOLQGHSHQGHQW $VWKH
68 Blood Sugar Dysregulation / Metabolic Syndrome

7\SHSDWLHQWLVWUHDWHGWKH\VKRXOGEHZDUQHGWKDWLQVXOLQUHTXLUHPHQWVPD\GLPLQLVKDQGFDUHVKRXOGEH
taken to titrate the dose according to need, not habit.

Hypoglycemia Definition
$FRQGLWLRQFKDUDFWHUL]HGE\VXGGHQGURSVLQEORRGVXJDUDVVRFLDWHGZLWKV\PSWRPVVXFKDVIDWLJXHKHDGDFKH
irritability, depression, nausea, rapid heartbeat, blurred vision, muscle pain, arthritis, or tinnitus.

Suggested Nutritional Supplementation


• Insulin Resistance and Hyperinsulinemia (Metabolic syndrome/Metabolic Syndrome)
• Type II Diabetes
• Reactive Hypoglycemia

Moderate
• Wellness Essentials™ Blood Sugar Support ²SDFNHWWZLFHGDLO\ZLWKIRRG
:HOOQHVV(VVHQWLDOV%ORRG6XJDU6XSSRUWLVDFRPELQDWLRQRIWKUHHSUHPLXPVXSSOHPHQWVLQFRQYHQLHQW
SDFNHWVWRSURYLGHHVVHQWLDOYLWDPLQVDQGPLQHUDOVRPHJDIDWW\DFLGVDQWLR[LGDQWVDQGSK\WRQXWULHQWV
WRVXSSRUWKHDOWK\EORRGVXJDUOHYHOVDOUHDG\LQWKHQRUPDOUDQJHDQGRYHUDOOKHDOWKZKHQWDNHQDVSDUWRI
a healthy diet.
• Insinase — 3 tablets daily.
6HOHFWLYHNLQDVHUHVSRQVHPRGXODWRUVIRUKHDOWK\LQVXOLQIXQFWLRQ
• FirstLine Therapy® Diet

Severe
• 8OWUD*O\FHP;
1XWULWLRQDO6XSSRUWIRUG\VJO\FHPLD
8OWUD*O\FHP;LVDVSHFL¿FDOO\IRUWL¿HGYHJHWDULDQSRZGHUHGPHGLFDOIRRGGHVLJQHGIRUQXWULWLRQDOVXSSRUW
RILQGLYLGXDOVZLWKLQVXOLQUHVLVWDQFHDQGK\SHULQVXOLQHPLD
Suggested Step Approach:
Days 1-2:
%HJLQE\PL[LQJVFRRS8OWUD*O\FHP;ZLWKRXQFHVRISXUHZDWHUDQGFRQVXPHWLPHVGDLO\IRU
days. Start on the dietary plan as instructed in the patient guide.
Days 3-7:
*UDGXDOO\LQFUHDVHWRVFRRSVRI8OWUD*O\FHP;PL[HGZLWKRXQFHVRISXUHZDWHUDQGFRQVXPH
times daily. Continue on the dietary plan.
Days 8-28:
&RQWLQXHZLWKVFRRSVRI8OWUD*O\FHP;PL[HGZLWKRXQFHVRISXUHZDWHUDQGFRQVXPHWLPHV
daily. Continue on the dietary plan.
Days 28 and Beyond:
$W WKLV SRLQW \RX DQG \RXU KHDOWKFDUH SUDFWLWLRQHU VKRXOG GLVFXVV \RXU UHVSRQVH WR WKH 8OWUD*O\FHP;
program. Your practitioner may suggest you continue on the program, continue the diet or the product
DORQHRUXVHVRPHRWKHUFRPELQDWLRQRIGLHWDQGPHGLFDOIRRGV
• Insinase — 3 tablets daily.
6HOHFWLYHNLQDVHUHVSRQVHPRGXODWRUVIRUKHDOWK\LQVXOLQIXQFWLRQ
• EPA-DHA 720²VRIWJHOWLPHVGDLO\ZLWKPHDOV
7KH RPHJD IDWW\ DFLGV DUH NH\ DGGLWLRQDO FRPSRQHQWV RI WKH 8OWUD*O\FHP; SURJUDP EHFDXVH RI WKHLU
JOXFRVHLQVXOLQPRGXODWLQJHIIHFWV
• FirstLine Therapy® Diet

Additional Nutritional Support For:


Diabetic Retinopathy
$FRPPRQFRPSOLFDWLRQRIDGYDQFHGRUVHYHUHGLDEHWHVOHDGLQJWRJUDGXDOORVVRIYLVLRQ
• Visioplex²FDSVXOHVWZLFHGDLO\
Nutrients and Herbs to nourish the eyes.
• Proantho-60²WDEOHWVWZLFHGDLO\
3URDQWKRF\DQLGLQVDUHNQRZQWREHDOGRVHUHGXFWDVHLQKLELWRUVZKLFKUHGXFHDFFXPXODWLRQDQGFU\VWDOOL]DWLRQ
RIVRUELWROLQWKHUHWLQD
Blood Sugar Dysregulation / Metabolic Syndrome 69

Diabetic Neuropathy
• Alpha Lipoic Acid ²FDSVXOHVWLPHVGDLO\
A study published in Diabetes CareUHSRUWVWKDWWKHDQWLR[LGDQWQXWULHQWDOSKDOLSRLFDFLG $/$ FDQSDUWO\
UHVWRUHGLDEHWLFQHUYHIXQFWLRQDIWHURQO\IRXUPRQWKVRIKLJKGRVH PJGDLO\ RUDOWUHDWPHQWDiabetes
Care
• N-Acettl-L-Carnitine — FDSVXOHVWZLFHGDLO\
$QWLR[LGHQWPXFRO\WLF$JHQWDQGLPPXQHVXSSRUW
• Neurosol²VRIWJHOWLPHVGDLO\
$OOLQRQHIRUPXODIRUQXWULWLRQDOQHUYHVXSSRUW
• &0HWKR[\ÀDYRQH — 2 tablets 3 times daily.
9LWDPLQ&DQGELRÀDYRQRLGVDUHNQRZQWREHKHOSIXOLQUHGXFLQJWKHQHXURSDWKLFHIIHFWVRIGLDEHWHV

Dietary Suggestions
• FirstLine Therapy® Diet
NOTE:7U\WRHDWHYHU\KRXUVLISRVVLEOH0DNHVXUHLWLVVRPHWKLQJKHDOWK\

Contributing Factors
 ‡2EHVLW\ ‡(QGRFULQRSDWKLHV
• Autoimmunity • Food sensitivities
 ‡/DFNRIH[HUFLVH ‡9LUDOLQIHFWLRQ
 ‡+LJKUH¿QHGVXJDUGLHW ‡$WKHURVFOHURVLV
 ‡+LJKIDWGLHW

Hypoglycemia Questionnaire
No = 0 Mild = 1 Moderate = 2 Severe = 3
&UDYHVZHHWV 1 2 3 4
,UULWDEOHLIDPHDOLVPLVVHG 1 2 3 4
)HHOWLUHGRUZHDNLIDPHDOLVPLVVHG 1 2 3 4
'L]]LQHVVZKHQVWDQGLQJVXGGHQO\ 1 2 3 4
Frequent headaches 1 2 3 4
3RRUPHPRU\ IRUJHWIXO RUFRQFHQWUDWLRQ 1 2 3 4
)HHOWLUHGDQKRXURUVRDIWHUHDWLQJ 1 2 3 4
Heart palpitations 1 2 3 4
Feel shaky at times 1 2 3 4
$IWHUQRRQIDWLJXH 1 2 3 4
Vision blurs on occasion 1 2 3 4
'HSUHVVLRQRUPRRGVZLQJV 1 2 3 4
2YHUZHLJKW 1 2 3 4
)UHTXHQWO\DQ[LRXVRUQHUYRXV 1 2 3 4

Total
Scoring:
/HVVWKDQ K\SRJO\FHPLDLVQRWOLNHO\DIDFWRU
 K\SRJO\FHPLDLVDOLNHO\IDFWRU
*UHDWHUWKDQ K\SRJO\FHPLDLVH[WUHPHO\OLNHO\
70 Blood Sugar Dysregulation / Metabolic Syndrome

Insulin Resistance Questionnaire


Not all products listed would be needed in all cases. Products are listed in sequence of importance.

Presence of associated diseases or biochemical abnormalities


Hyperglycemia:
• Type 2 diabetes 4
• ,PSDLUHGJOXFRVHWROHUDQFH ,*7 4
• *HVWDWLRQDOGLDEHWHV 3
• ,PSDLUHGIDVWLQJJOXFRVH PJGO 2

+\SHUWULJO\FHULGHPLD IDVWLQJ 
• 7ULJO\FHULGHV!PJGO+'/FKROHVWHURO 3
• Triglycerides > 150 mg/dl 2
• 7ULJO\FHULGHV!PJGO 1

Essential hypertension:
• Blood pressure > 140/90 mmHg 2
• %ORRGSUHVVXUH!PP+J 1

3RO\F\VWLFRYDULHV 4

3UHPDWXUHFRURQDU\KHDUWGLVHDVH XQGHUDJH\HDUV 3

Uric acid (> 8 mg/dl) 2

)DPLO\KLVWRU\ ¿UVWGHJUHHUHODWLYHV
Type 2 diabetes or impaired glucose tolerance 3

Essential hypertension (under age 60 years) 2

Hypertriglyceridemia 3

3UHPDWXUHFRURQDU\KHDUWGLVHDVH XQGHUDJH\HDUV 2

Presence of predisposing factors


/RZELUWKZHLJKW NJ 2

,QDFWLYLW\ PLQDHURELFH[HUFLVHZHHN 2

Evidence of mild obesity or central adiposity (maximum 4 points)


:HLJKWJDLQ!RUNJDIWHUDJH\HDUV : \HDUV 0 

%0,NJP 1, 2

:DLVW LQFKHV 
• ! : 1, 2
• ! 0 1, 2

Ethnic group at high risk* 


Blood Sugar Dysregulation / Metabolic Syndrome 71

021:LQGLYLGXDOHTXDOVDVFRUHRISRLQWVRUJUHDWHU6FKHPHDSSOLHVWRPHQDQGZRPHQDJHG\HDUVZLWKD%0,
NJP$VLPLODUVFKHPHZLWKPLQRUPRGL¿FDWLRQVFRXOGEHDSSOLHGWRLQGLYLGXDOVZLWKD%0,!NJP,QWKHODWWHUDGGLWLRQDO
SRLQWVZRXOGEHJLYHQIRUJUHDWHULQFUHDVHVLQWKHREHVLW\UHODWHGSDUDPHWHUV
:ZRPHQ0PHQ(WKQLFJURXSDWKLJKULVNLQFOXGHV LQRUGHURIDVFHQGLQJULVN EODFNZRPHQ-DSDQHVH$PHULFDQV/DWLQRV
0HODQHVLDQV3RO\QHVLDQV LQFOXGLQJ1HZ=HDODQG0DRULV ,QGLDQV$XVWUDOLDQDERULJLQHV0LFURQHVLDQV LQFOXGLQJ1DUXDQV 
DQGVRPH$PHULFDQ,QGLDQWULEHV7KHULVNLVHVSHFLDOO\KLJKLQWKRVHZKRKDYHDGRSWHGD:HVWHUQOLIHVW\OH
5HSULQWHG ZLWK SHUPLVVLRQ IURP WKH SXEOLVKHU RI ³7KH 0HWDEROLFDOO\ 2EHVH 1RUPDO:HLJKW ,QGLYLGXDO 5HYLVLWHG´ E\ 1HLO
5XGHUPDQ'RQDOG&KLVKROP;DYLHU3L6XQ\HUDQG6WHSKHQ6FKQHLGHU'LDEHWHV0D\YROS&RS\ULJKW
by the American Diabetes Association.

5HSULQWHG ZLWK SHUPLVVLRQ IURP WKH SXEOLVKHU RI ³7KH 0HWDEROLFDOO\ 2EHVH 1RUPDO:HLJKW ,QGLYLGXDO 5HYLVLWHG´ E\ 1HLO
5XGHUPDQ'RQDOG&KLVKROP;DYLHU3L6XQ\HUDQG6WHSKHQ6FKQHLGHU'LDEHWHV0D\YROS&RS\ULJKW
by the American Diabetes Association.
72 Body Composition

Body Composition
$OOH[SHUWVDJUHHWKDWREHVLW\HYHQEHLQJRYHUZHLJKWFRQWULEXWHVKHDYLO\WRDOOGHJHQHUDWLYHGLVHDVH7KH8QLWHG
6WDWHV6XUJHRQ*HQHUDOVWDWHGWKDWDIDLOXUHWRDGGUHVVH[FHVVLYHZHLJKWDQGREHVLW\³FRXOGZLSHRXWWKHJDLQV
ZH¶YHPDGHLQDUHDVVXFKDVKHDUWGLVHDVHVHYHUDOIRUPVRIFDQFHUDQGRWKHUFKURQLFKHDOWKSUREOHPV´
$OWKRXJKDWWHPSWVWRORVHZHLJKWDUHFRPPRQLQWKH86WKHSUHYDOHQFHRIREHVLW\KDVLQFUHDVHGGUDPDWLFDOO\
VLQFHWKH¶V%HFDXVHRIWKLVZHEHOLHYH\RX¶OO¿QGWKHIROORZLQJERG\FRPSRVLWLRQSURWRFROVYHU\YDOXDEOH
LQVXSSRUWLQJ\RXUSDWLHQWV¶HIIRUWVWRJHWFRQWURORIWKHLUKHDOWK:H¶YHGRQHWKLVLQVWHSVWREHWWHUPDWFKXSWR
\RXUSDWLHQWVQHHGVDQGDELOLW\WRIROORZWKURXJK

Basic Weight Management Protocol:


• UltraMeal²VHUYLQJWZLFHGDLO\DORQJZLWKORZFDORULH RUFDORULFRSWLRQV KLJKQXWULWLRQPHQXV
IURPWKH8OWUD0HDOSDWLHQWJXLGH
8OWUD0HDOLVDPHGLFDOIRRGGHVLJQHGWRWDUJHWIDWORVVDQGWRQXWULWLRQDOO\VXSSRUWWKHPDQDJHPHQWRIFRQGLWLRQV
DVVRFLDWHGZLWKDOWHUHGERG\FRPSRVLWLRQ
• Crave-Curb ²FDSVXOHVRQDQHPSW\VWRPDFKWZLFHGDLO\
&RQWDLQVQXWULWLRQDOQHXURWUDQVPLWWHUSUHFXUVRUVWKDWEHQH¿FLDOO\VDWLVI\WKHUHZDUGFDVFDGHRIWKHEUDLQWKXV
reducing carbohydrate/calorie cravings.

Intermediate Weight Management Protocol:


%DVLF3URWRFROSOXV
• 7•Keto DHEA²FDSVXOHWZLFHGDLO\
‡.HWR'+($LVDPHWDEROLWHRI'+($WKDWKDVEHHQVKRZQWRVLJQL¿FDQWO\LQFUHDVHWKHUHVWLQJPHWDEROLF
UDWHHYHQGXULQJFDORULHUHVWULFWLRQ7KLVIRUPRI'+($GRHVQRWLQFUHDVHRWKHUKRUPRQHOHYHOV HVWURJHQ
WHVWRVWHURQHHWF DQGLVDQRQVWLPXODWLQJWKHUPRJHQLFDLG5HVHDUFKKDVVKRZQDWLPHVJUHDWHUZHLJKW
ORVVWKDQGLHWDQGH[HUFLVHDORQHZLWKWKHPDMRULW\RILWFRPLQJIURPIDW
• Tonalin CLA ²FDSVWLPHVGDLO\ZLWKPHDOV
&RQMXJDWHGOLQROHLFDFLG &/$ LVVDIHZHOOWROHUDWHGDQGOHDGVWRORQJWHUPUHGXFWLRQRIERG\IDWPDVV$
UHFHQWVWXG\VKRZHGWKDWWKH&/$JURXS QRWSODFHER ORVWRIWKHLUERG\IDWPDVVZKLOHLQFUHDVLQJWKHLU
OHDQERG\PDVV PXVFOHPDVV &/$LVSDUWLFXODU\HIIHFWLYHLQUHGXFLQJDEGRPLQDOIDWVWRUHV
• L-Carnitine 500 ²FDSVXOHVWZLFHGDLO\
&DUQLWLQHLVHVVHQWLDOLQWKHEUHDNGRZQRIIDWVLQWRHQHUJ\DQGUHVXOWVLQVLJQL¿FDQWLPSURYHPHQWLQH[HUFLVH
tolerance.

Full Weight Management Protocol:


%DVLFDQG,QWHUPHGLDWH3URWRFROSOXV
• TRx²FDSVXOHVWZLFHGDLO\RQDQHPSW\VWRPDFK
&RQWDLQVGLLRGR/WK\URQLQH 7 ZKLFKLVDGHULYDWLYHRI7WKDWKDVEHHQVKRZQWRKDYHDJUHDWHULPSDFW
RQLQFUHDVLQJUHVWLQJPHWDEROLVPWKDQWKHWK\URLGKRUPRQH7,WDOVRKDVDPXFKORZHULQKLELWRU\HIIHFW
RQ 76+ 7K\URLG 6WLPXODWLQJ +RUPRQH  WKDQ 7 WKXV UHGXFLQJ D QHJDWLYH IHHGEDFN LPSDFW RQ ORQJWHUP
WK\URLGIXQFWLRQ7KHHIIHFWLYHXVHIRUIDWORVVZKLOHQRWVXSSUHVVLQJWK\URLGKRUPRQHOHYHOVLVWRWDNHWKH
FDSVXOHVWZLFHGDLO\IRUQRWPRUHWKDQZHHNVWKHQGLVFRQWLQXHIRUWKHVDPHDPRXQWRIWLPHEHIRUH
going back on it.
• (QHUJ\; ²FDSVXOHVWDNHQSUHIHUDEO\PLQXWHVEHIRUHZRUNRXWV
7KLVLVDWKHUPRJHQLFFRPSDQLRQWR75[DQGDELRVWLPXODWRUWKDWLPSURYHVHQHUJ\EDODQFHLQWKHERG\
7KLVLVDFFRPSOLVKHGE\HQKDQFLQJR[\JHQXWLOL]DWLRQDQGQXWULHQWVDWXUDWLRQRIEORRGDQGWLVVXHERRVWLQJ
the metabolism.

Additional Personalized Considerations:


Chronic Inflammation
3DWLHQWDOVRKDVDQLQÀDPPDWRU\FRQGLWLRQ HJDUWKULWLVLQÀDPPDWRU\ERZHOLQÀDPPDWRU\VNLQHWF RUKDVDQ
HOHYDWHG&5HDFWLYH3URWHLQ &53 ZKLFKLVDJHQHUDOLQGLFDWRURILQÀDPPDWLRQ
• EPA-DHA 6:1²FDSVXOHVWLPHVGDLO\ZLWKPHDOV
(3$'+$KHOSVOHVVHQFKURQLFKLJKOHYHOVRISURLQÀDPPDWRU\LQVXOLQWKDWUHVXOWVLQLQVXOLQUHVLVWDQFHDQG
VWRUDJHRIIDW,WDOVRDFWLYDWHV33$56LQFHOOVZKLFKLQFUHDVHVWKHEXUQLQJRIERG\IDW LQFUHDVHVWKHUPRJHQHVLV 
LQFUHDVHVLQVXOLQVHQVLWLYLW\ZKLOHGHFUHDVLQJOHYHOVRILQÀDPPDWLRQ
Body Composition 73

Stress/Adrenal Fatigue
,QGLFDWHGE\WKH5DJODQ3RVWXUDOEORRGSUHVVXUHWHVWV\VWROLFEORRGSUHVVXUHGRHVQ¶WUDLVHRUGURSVZKHQJRLQJ
IURPDO\LQJWRVWDQGLQJSRVLWLRQ
• Adreset²FDSVXOHWLPHVGDLO\
7KLVKHUEDODGDSWRJHQLFIRUPXODLVGHVLJQHGWRHQKDQFHVWDPLQDDQGHQHUJ\DVZHOODVVXSSRUWDKHDOWK\
EDODQFHGUHVSRQVHWRVWUHVV&KURQLFVWUHVVSURGXFHVFKURQLFDOO\KLJKOHYHOVRIFRUWLVRO RQHRIWKH¿JKWRU
ÀLJKWKRUPRQHV ZKLFKFDQFDXVHFRQWLQXHGKXQJHUDQGGHSRVLWLRQRIDEGRPLQDOIDW9LVFHUDOIDW DEGRPLQDO
IDWDQGIDWVXUURXQGLQJRXURUJDQV LVWKH³WR[LF´IDWWKDWLQFUHDVHVULVNIRUKHDUWGLVHDVHDQGGLDEHWHV
• Phosphatidyl Serine (PS) ²7DNHEHWZHHQPJGDLO\HLWKHUWHDVSRRQWZLFHGDLO\RIWKHSRZGHU
IRUPRUFDSVXOHVWZLFHGDLO\RIRXUFDSVXOHIRUPRI3KRVSKDWLG\O6HULQH
36ZLOOQDWXUDOO\EOXQWH[FHVVLYHSURGXFWLRQRIFRUWLVROWKDWOHDGVWRLQKLELWLRQRIWKH7WR7FRQYHUVLRQWKDW
VORZVWKHPHWDEROLVP7KLVEOXQWLQJHIIHFWRIH[FHVVFRUWLVROPD\SURYLGHVRPHLQVLJKWLQWRWKHHIIHFWRI36
RQGHSUHVVLRQDVK\SHUFRUWLVROLVPLVDFRPPRQ¿QGLQJLQGHSUHVVLRQ

Hypo-thyroidism
,QGLFDWHGE\$[LOODU\7HPSHUDWXUH7HVW
• T-100 or Thyrodex²WDEOHWVWLPHVGDLO\RQDQHPSW\VWRPDFK
%RWKIRUPXODVDUHFRPSOHWHQXWULWLRQDOVXSSRUWVWRWK\URLGIXQFWLRQ:KHQWK\URLGOHYHOVDUHWRRORZERG\
SURFHVVHV VWDUW VORZLQJ GRZQ 7KH ERG\ SURGXFHV OHVV KHDW DQG HQHUJ\ DQG RUJDQV OLNH WKH EUDLQ DQG
ERZHOVPRYHPRUHVORZO\3HRSOHDOVRQRWLFHWKDWWKH\IHHOFROGHUWLUHHDVLO\JHWGULHUVNLQDQGEHFRPH
PRUHIRUJHWIXODQGGHSUHVVHG

Developing an Athletic Build


• Ultimate Protein±VFRRSVWLPHVGDLO\
7KLVKLJKTXDOLW\ZKH\SURWHLQZDVVKRZQLQDUHFHQWVWXG\RXWRIWKH-RXUQDORI1XWULWLRQWRUHGXFHHQHUJ\
LQWDNHDORQJZLWKYLVFHUDODQGVXEFXWDQHRXVIDW,WDOVRUHGXFHGSODVPDLQVXOLQFRQFHQWUDWLRQDQGLPSURYHG
LQVXOLQVHQVLWLYLW\$QRWKHUDUWLFOHVKRZHGDFOHDUUHGXFWLRQLQDEGRPLQDOREHVLW\ZLWKDKLJKSURWHLQLQWDNH)RU
WKHJUHDWHVWVXSSRUWWRPXVFOHUHSDLUEXLOGLQJWDNHDWJUDPVSHUSRXQGRIERG\ZHLJKWSHUGD\5HFHQW
DFFXUDWHVWXGLHVVKRZQRVWUHVVWRWKHNLGQH\VOLYHUDWWKLVOHYHORISURWHLQLQWDNH
• Kre-Alkalyn±FDSVXOHVEHIRUHDQGFDSVXOHVDIWHUZRUNRXW$OVRWDNHRQGD\VQRWZRUNLQJRXW
7KH¿UVWDQGRQO\FUHDWLQHWKDWGRHVQ¶WFRQYHUWWRFUHDWLQLQHLQOLTXLGVEHIRUHUHDFKLQJPXVFOH&UHDWLQHLV
involved in muscle energy production increasing both strength and recovery.
• Tribestan PHQRUZRPHQ ±WDEOHWSHUSRXQGVRIERG\ZHLJKWSHUGD\
$OOWKHUHVHDUFKRQWULEXOXVKDVEHHQGRQHRQWKH%XOJDULDQSURGXFW7ULEHVWDQ,WFRQWDLQVWKHVWHURLGDO
VDSRQLQVQHHGHGIRUIHHGEDFNWRWKHSLWXLWDU\WRLQFUHDVHVH[KRUPRQHSURGXFWLRQ7KLVLVVLPLODUWRUHVHWWLQJ
DWKHUPRVWDWUHVXOWLQJLQDJUHDWHUDQDEROLFUHSDLUDWLYHHIIHFWIRUEXLOGLQJPXVFOHDQGUHGXFLQJERG\IDW,WLV
DOVRYHU\HIIHFWLYHLQWUHDWLQJPDOHDQGIHPDOHVH[XDOG\VIXQFWLRQ
• Pure L-Glutamine ±JUDPVRUPRUHGDLO\SUHIHUDEO\DIWHUZRUNRXWV
*OXWDPLQHLVDQLPSRUWDQWDPLQRDFLGWKDWKHOSVWREXLOGDQGPDLQWDLQPXVFOHERRVWWKHLPPXQHV\VWHP
VXSSRUWJDVWURLQWHVWLQDOKHDOWKDQGVXVWDLQKHDOWK\JURZWKKRUPRQHOHYHOV
• D-136/IGF ±GURSV XQGHUWRQJXH WLPHVGDLO\RQDQHPSW\VWRPDFK
7KLVLVDKRPHRSDWKLFJURZWKKRUPRQH +*+ DQGLQVXOLQOLNHJURZWKIDFWRU ,*) WKDWRQDQHQHUJHQLF
EDVLVKHOSVWRVWUHQJWKHQFHOOVLJQDOOLQJZLWKLQWKHQHXURLPPXQRHQGRFULQHV\VWHP3DWLHQWVZKRSDUWLFLSDWHG
LQDVWXG\XVLQJKRPHRSDWKLF+*+VDZGHFUHDVHGIDWLQFUHDVHGPXVFOHLPSURYHGVOHHSVNLQTXDOLW\DQG
SK\VLFDODSSHDUDQFH7KLVLVYHU\JRRGIRUDQWLDJLQJDVLWVXSSRUWVFHOOWRFHOOFRPPXQLFDWLRQDQGUHJXODWRU\
SURFHVVHVWKDWGHFOLQHDVZHDJH
74 Bursitis

Bursitis
$FXWHRUFKURQLFLQÀDPPDWLRQLQDEXUVD%XUVDHDUHWKLQZDOOHGVDFVOLQHGZLWKV\QRYLDOÀXLGDQGIXQFWLRQWR
OXEULFDWHDQGHDVHWKHPRYHPHQWRIWKHWHQGRQVDQGPXVFOHVRYHUERQ\SURPLQHQFHV&DXVHVRIEXUVLWLVLQFOXGH
WUDXPDV\VWHPLFGLVHDVH VXFKDVDUWKULWLVRUUKHXPDWRLGDUWKULWLV JRXWUHSHWLWLYHRUH[FHVVLYHIULFWLRQDOIRUFH
RULQIHFWLRQ0RVWFRPPRQO\EXUVLWLVLVVHHQLQWKHVKRXOGHUDOWKRXJKPDQ\RWKHUMRLQWVFDQEHFRPHLQÀDPHG
ROHFUDQRQSUHRUVXSUDSDWHOODUWURFKDQWHULFLVFKLDODQVHULQH
Unless treated, the bursitis tends to become chronic or consistently recur. Bursitis may cause splinting muscle
VSDVPVZKLFKIXUWKHUFRPSUHVVDQGLUULWDWHWKHEXUVD$GYDQFHGGLVHDVHFDQOHDGWRDIUR]HQVKRXOGHUIURP
PDUNHGFROODJHQRXVDGKHVLRQIRUPDWLRQ

Symptoms
• Acute:3DLQGHFUHDVHGUDQJHRIPRWLRQORFDOWHQGHUQHVVRQSDOSDWLRQVZHOOLQJDQGUHGQHVVLVYLVXDOL]HG
LIWKHEXUVDLVVXSHU¿FLDO HJROHFUDQRQDQGSUHSDWHOODU 
• Chronic:7KLFNHQHGEXUVDZDOOIRUPDWLRQRIDGKHVLRQFDOFDUHRXVGHSRVLWVPXVFOHDWURSK\IURPQRWXVLQJ
LWYDULRXVGHJUHHVRISDLQWHQGHUQHVVVZHOOLQJPXVFOHZHDNQHVVW\SLFDOO\WKHUDQJHRIPRWLRQLVTXLWH
decreased.
• Shoulder:%LFLSLWDOWHQGLQLWLVWHQGHUQHVVRYHUWKHELFLSLWDOJURRYHDQGSDLQZLWKHOERZÀH[LRQ6XEDFURPLDO
EXUVLWLVSDLQDQGWHQGHUQHVVORFDOO\DQGSDLQZLWKDOOPRYHPHQWVHVSHFLDOO\URWDWLRQ6XSUDVSLQDWXVWHQGLQLWLV
QRURWDWLRQDOSDLQEXWSDLQZKHQDEGXFWLRQUHDFKHVGHJUHHV

Nutrients Involved
%URPHODLQYLWDPLQ%YLWDPLQ&ELRÀDYRQRLGVRPHJDIDWW\DFLGV

Suggested Nutritional Supplementation


• Protrypsin²FDSOHWVGDLO\EHWZHHQPHDOVRQDQHPSW\VWRPDFK
Select proteolytic enzymes.
• EZ-Flex²WDEOHWVGDLO\ZLWKPHDOV
1XWULWLRQDOVXSSRUWIRUWHQGRQQHUYHDQGPXVFOHIXQFWLRQ
• EPA-DHA 6:1²VRIWJHOVWLPHVGDLO\ZLWKPHDOV
(VVHQWLDOIDWW\DFLGVIURPFROGZDWHU¿VK

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW

Exercise Considerations
5DQJHRIPRWLRQH[HUFLVHIRUVKRXOGHU
To break adhesions:ÀH[IRUHDUPWRULJKWDQJOHJUDVSZULVWZLWKRQHKDQGDQGSRLQWRIHOERZZLWKRWKHUKDQG
DQG HOHYDWH VKRXOGHU E\ SXVKLQJ XS RQ HOERZ VWURQJO\ VXSLQDWH DQG SURQDWH IRUHDUP PDLQWDLQLQJ VKRXOGHU
HOHYDWLRQGRWKLVDWYDULRXVGHJUHHVRIDEGXFWLRQIROORZZLWKKHDW
Ice pack:IRUDFXWHNHHSRQPLQXWHVUHPRYHIRUPLQXWHUHSHDWWLPHV
Heat applications:WRUHOLHYHSDLQIRUPLQXWHVIROORZHGE\VKRZHU

Wall-Walking Exercise:
1. )DFHWKHZDOODWDUP¶VOHQJWKDQGOHDQLQWRKDQGVSODFHGDJDLQVWZDOO
2. 6WDUWLQJVOLJKWO\DERYHWKHOHYHORIWKHZDLVWZDONKDQGRYHUKDQGDVKLJKDVSRVVLEOHZLWKRXWSDLQ
3. 5HSHDWIRXUWLPHVGDLO\
Cancer 75

Cancer
Nutritional Support Strategies in Treatment

Immune/Antioxidant Support
Immune System Support
$QRSWLPDOO\IXQFWLRQLQJLPPXQHV\VWHPLVHVVHQWLDOIRUWKHERG\WRDGGUHVVDQ\GLVHDVHLQFOXGLQJFDQFHU²
7KHIROORZLQJLVDQRYHUYLHZRIVSHFLDOL]HGLPPXQHFHOOVDQGFRPSRQHQWV
• Natural Killer (NK) FHOOV DUH GHVFULEHG DV WKH ³VHQWLQHO´ FHOO LQ WKH LPPXQH V\VWHP EHFDXVH LQ KHDOWK\
LQGLYLGXDOVWKH\DUHWKH¿UVWFHOOVWRHQFRXQWHUFDQFHUFHOOVLQYDGLQJEDFWHULDDQGYLUDOO\LQIHFWHGFHOOV7KH\
FDQWDNHRQDQGNLOOPXOWLSOHGLVHDVHFHOOVVLPXOWDQHRXVO\DQGDOVRKDYHDUHJXODWRU\HIIHFWRQWKHUHVWRI
the immune system.
• Macrophages DUHWKH³3DFPHQ´RIWKHLPPXQHV\VWHP7KH\HQJXOIGLVHDVHFHOOVGLJHVWWKHPDQGGLVSOD\
IUDJPHQWVRIWKHGLJHVWHGLQYDGHUZKLFKEHFRPH³DQWLJHQV´WKDWVWLPXODWHWKHDSSURSULDWH%FHOODQG7FHOO
SUROLIHUDWLRQ
• Lymphocyte LVDW\SHRIZKLWHEORRGFHOOWKDWLVORQJOLYHGDQGFDUULHVPHPRU\RISDVWLQIHFWLRQV$VWKH\
mature they eventually turn into B and T cells.
• T cells DUHDFODVVRIO\PSKRF\WHV DOVRFDOOHG7O\PSKRF\WHV GHULYHGIURPWKHWK\PXVWKDWFRQWUROFHOO
PHGLDWHGLPPXQHUHDFWLRQVDQGWKHGHYHORSPHQWRI%FHOOV7KHUHDUHWKUHHIXQGDPHQWDOO\GLIIHUHQWW\SHV
RI7FHOOVKHOSHUNLOOHUDQGVXSSUHVVRU(DFKKDVPDQ\VXEGLYLVLRQV
• B cells DUHDW\SHRIO\PSKRF\WHQRUPDOO\LQYROYHGLQWKHSURGXFWLRQRIDQWLERGLHVWRFRPEDWLQIHFWLRQ'XULQJ
LQIHFWLRQVLQGLYLGXDO%FHOOFORQHVPXOWLSO\DQGDUHWUDQVIRUPHGLQWRSODVPDFHOOVZKLFKSURGXFHODUJHDPRXQWV
RIDQWLERGLHVDJDLQVWSDUWLFXODUDQWLJHQRQDIRUHLJQPLFUREH
• Interleukin-12 LVUHOHDVHGE\PDFURSKDJHVLQUHVSRQVHWRLQIHFWLRQDQGEHJLQVWKHSURFHVVRIFXVWRPL]LQJ
LPPXQHV\VWHPFHOOVWRVXLWWKHVSHFL¿FLQYDGHU,WHQKDQFHVWKHDELOLW\RI1DWXUDO.LOOHU 1. FHOOVWRGHVWUR\
PLFUREHVDQGFDQFHUFHOOVLQGXFHVLQWHUIHURQSURGXFWLRQDQGVWLPXODWHVWKHSURGXFWLRQRIDFWLYDWHG7FHOOV
DQG1.FHOOV
• Interleukin-2 is a chemical messenger, a substance that can improve the body’s response to disease. It
VWLPXODWHVWKHJURZWKRIFHUWDLQGLVHDVH¿JKWLQJEORRGFHOOVLQWKHLPPXQHV\VWHP
• Tumor Necrosis Factor (TNF) LVUHOHDVHGE\PDFURSKDJHVDQGLQGXFHVIHYHU,WNLOOVFDQFHUFHOOVDQGFDXVHG
WKHSURGXFWLRQRIO\PSKRNLQHV
• Interferon UHIHUVWRDIDPLO\RIJO\FRSURWHLQVGHULYHGIURPKXPDQFHOOVZKLFKQRUPDOO\KDVDUROHLQ¿JKWLQJ
YLUDOLQIHFWLRQVE\SUHYHQWLQJPXOWLSOLFDWLRQLQFHOOV

AHCC Immune Support


$+&&LVDQH[WUDFWRIDXQLTXHK\EULGL]DWLRQRIVHYHUDOPHGLFDOPXVKURRPVNQRZQIRUWKHLULPPXQHHQKDQFLQJ
DELOLWLHV 2Q WKHLU RZQ HDFK PXVKURRP KDV D ORQJ PHGLFDO KLVWRU\ LQ -DSDQ ZKHUH WKHLU H[WUDFWV DUH ZLGHO\
SUHVFULEHGE\SK\VLFLDQV%XWZKHQFRPELQHGLQWRDVLQJOHK\EULGPXVKURRPWKHUHVXOWLQJDFWLYHLQJUHGLHQWLV
VRSRWHQWWKDWGR]HQVRIULJRURXVVFLHQWL¿FVWXGLHVKDYHQRZHVWDEOLVKHG$+&&WREHRQHRIWKHZRUOG¶VPRVW
SRZHUIXO²DQGVDIH²LPPXQHVWLPXODWRUV
,QYLWURDQLPDODQGKXPDQVWXGLHVFRQ¿UPWKDW$+&&HIIHFWLYHO\WUHDWVDQGLQVRPHFDVHVHYHQSUHYHQWVWKH
UHRFFXUUHQFHRIOLYHUFDQFHUSURVWDWHFDQFHUPXOWLSOHP\HORPDEUHDVWFDQFHU$,'6DQGRWKHUOLIHWKUHDWHQLQJ
FRQGLWLRQV ZLWK QR GDQJHURXV VLGH HIIHFWV ,Q VPDOOHU GRVHV$+&& FDQ DOVR ERRVW WKH LPPXQH IXQFWLRQ RI
KHDOWK\SHRSOHKHOSLQJWRSUHYHQWLQIHFWLRQVDQGSURPRWHZHOOEHLQJ0DQ\KHDOWKSUREOHPVLQFOXGLQJVRPH
WKDWZHUHSUHYLRXVO\WKRXJKWWREHXQUHODWHGWRWKHLPPXQHV\VWHPDUHQRZNQRZQWRUHVXOWIURPVRPHGHJUHH
RI LPPXQH GH¿FLHQF\ 6XEWOH WR VHYHUH LPPXQH G\VIXQFWLRQ FDQ FRPELQH ZLWK RWKHU IDFWRUV WR FDXVH PDQ\
illnesses, including:
 ‡*XPGLVHDVH ‡5HFXUUHQWLQIHFWLRQVVXFKDVFROGVÀXDQGSDUDVLWHV
 ‡+HDUWGLVHDVH ‡3HSWLFXOFHU
 ‡&DQFHU ‡6ORZKHDOLQJZRXQGV
• Digestive problems • AIDS
 ‡0XOWLSOH6FOHURVLV ‡$XWRLPPXQHLOOQHVVHV
• Stress associated illness • Chronic Fatigue Syndrome
76 Cancer

)RU\HDUVFRQYHQWLRQDOPHGLFLQHKDVWULHGWRFRSHZLWKWKHVHDQGRWKHUFRQGLWLRQVDVVHSDUDWHLOOQHVVHVRIWHQ
UHO\LQJRQLQYDVLYHDQGSRWHQWLDOO\GDQJHURXVGLVHDVHVSHFL¿FGUXJVVXUJHU\DQGRWKHUWUHDWPHQWV1RWRQO\
has this approach yielded only moderate success, in many cases it has created additional health problems:
FKHPRWKHUDS\VLGHHIIHFWVVXUJLFDOFRPSOLFDWLRQVGUXJUHDFWLRQVVXSHUUHVLVWDQWEDFWHULDDQGRWKHUSUREOHPV
WKDWLQVRPHFDVHVPD\EHDVEDGDV RUZRUVHWKDQ WKHVSHFL¿FGLVHDVH,QIDFWDFFRUGLQJWRWKHJournal of the
American Medical Association, (v279, April 1998) prescription medications kill more than 100,000 people a year,
PDNLQJDGYHUVHGUXJUHDFWLRQVWKHIRXUWKOHDGLQJFDXVHRIGHDWKLQWKH8QLWHG6WDWHV
7KH FXWWLQJ HGJH LQ PHGLFLQH WRGD\ LV WR VKLIW DZD\ IURP GLVHDVHVSHFL¿F LQWHUYHQWLRQV DQG WR IRFXV RQ WKH
IXQGDPHQWDOXQGHUO\LQJFDXVHVRIKHDOWKDQGGLVHDVHWKHSURSHUIXQFWLRQLQJRILQWHUGHSHQGHQWERG\V\VWHPV
such as the nervous system, the endocrine system and the immune system.
5HVHDUFK)LQGV5HPDUNDEOH,PPXQH6\VWHP%RRVWLQ0XOWLSOH:D\V
6HYHUDOVFLHQWL¿FVWXGLHVRIWKHH[WUDFWRI$+&&SXEOLVKHGLQUHVSHFWHGSHHUUHYLHZHGMRXUQDOVVXFKDVInternational
Journal of Immunology, Anti-Cancer Drugs, and Society of Natural Immunity KDYHHVWDEOLVKHGWKHKHDOWKEHQH¿WV
DQGVDIHW\RI$+&&PRUHFRQFOXVLYHO\WKDQQHDUO\DQ\RWKHUQDWXUDOVXSSOHPHQW:KDWLVHVSHFLDOO\UHPDUNDEOH
DERXW$+&&LVWKDWLWVRFRQVLVWHQWO\DQGHIIHFWLYHO\ERRVWVLPPXQHV\VWHPIXQFWLRQLQWKHIROORZLQJZD\V
• ,WVWLPXODWHVF\WRNLQH ,/,/715Ơ and IFNƠSURGXFWLRQZKLFKDFWWRVWLPXODWHLPPXQHIXQFWLRQ
• ,WLQFUHDVHV1.FHOODFWLYLW\DJDLQVWGLVHDVHGFHOOVDVPXFKDVSHUFHQW
• ,WLQFUHDVHVWKHIRUPDWLRQRIH[SORVLYHJUDQXOHVZLWKLQ1.FHOOV7KHPRUHDPPXQLWLRQHDFK1.FHOOFDUULHV
the more invaders it can destroy.
• ,WLQFUHDVHVWKHQXPEHUDQGDFWLYLW\RIO\PSKRF\WHVVSHFL¿FDOO\LQFUHDVLQJ7FHOOVE\XSWRSHUFHQW
• ,WLQFUHDVHV,QWHUIHURQOHYHOVZKLFKLQKLELWWKHUHSOLFDWLRQRIYLUXVHVDQGVWLPXODWHV1.FHOODFWLYLW\
• ,WLQFUHDVHVWKHIRUPXODWLRQRI71)DJURXSRISURWHLQVWKDWKHOSGHVWUR\FDQFHUFHOOV
7KHVH GUDPDWLF LPPXQH HIIHFWV WUDQVODWH LQWR SURIRXQG KHDOWK EHQH¿WV$  FOLQLFDO WULDO SXEOLVKHG LQ WKH
International Journal of Immunotherapy VKRZHGWKDWJUDPVRI$+&&SHUGD\VLJQL¿FDQWO\ORZHUHGWKHOHYHORI
WXPRUPDUNHUV VXEVWDQFHVWKDWGHWHFWWKHSUHVHQFHRIWXPRUV IRXQGLQSDWLHQWVZLWKVHYHUDOGLIIHUHQWW\SHVRI
cancer, including prostate cancer, ovarian cancer, multiple myeloma, and breast cancer. This study documented
FRPSOHWHUHPLVVLRQVLQVL[RISDWLHQWVDQGVLJQL¿FDQWLQFUHDVHVLQ1.FHOODFWLYLW\LQQLQHRISDWLHQWV7DQG
B cell activity levels also rose considerably.

No Side Effects Reported from AHCC


8QOLNH FRQYHQWLRQDO FDQFHU WUHDWPHQWV$+&& VHHPV WR EH FRPSOHWHO\ QRQWR[LF (YHQ DIWHU \HDUV RI XVH DW
WKHUDSHXWLFGRVDJHOHYHOVWR[LFLW\WHVWVFRQ¿UPHGWKDWWKLVQDWXUDOH[WUDFWFDXVHGQRWR[LFLW\DGYHUVHUHDFWLRQV
RU XQZDQWHG VLGH HIIHFWV ([SHUWV VD\ WKLV LV EHFDXVH$+&& ZRUNV WR HQKDQFH WKH DFWLYLWLHV RI WKH LPPXQH
V\VWHPUDWKHUWKDQDWWDFNFDQFHUFHOOVGLUHFWO\DVFKHPRWKHUDS\GRHV$+&&FDXVHVQRVLGHHIIHFWVEHFDXVH
LWVWLPXODWHVWKHERG\¶VQDWXUDOGHIHQVHV\VWHPWRVHHNRXWDQGVHOHFWLYHO\GHVWUR\LQYDGLQJEDFWHULDYLUXVHV
parasites, and cancer cells.
7KHUHDUHPDQ\LPPXQHVWLPXODWRUVRQWKHPDUNHWWRGD\VRPHEDFNHGE\UHVHDUFKGRFXPHQWLQJLQFUHDVHVLQ1.
FHOODFWLYLW\%XWRQO\$+&&KDVVKRZQWKHDELOLW\WRDFWXDOO\SURPRWHcancer remission in human clinical trials.

WGP Beta Glucan (Imucell™) Immune Support


What is WGP Beta Glucan (Imucell™)?
%HWDJOXFDQLVDQDWXUDOSRO\VDFFKDULGHGHULYHGIURPSaccharomyces cereviseae, PRUHFRPPRQO\NQRZQDV
%DNHU¶V\HDVW:KROH*OXFDQ3DUWLFOHV :*3 %HWD*OXFDQLVWKHVNHOHWDOVSKHUHWKDWRQFHSURYLGHGVWUXFWXUHWRWKH
\HDVWFHOOZDOO7KLVKLJKO\SXUL¿HG³FHOOZDOOJKRVW´ELQGVZLWKEHWDJOXFDQUHFHSWRUVRQWKHVXUIDFHRIPDFURSKDJH
FHOOVDQGRWKHUZKLWHEORRGFHOOVWKDWDUHWKHLPPXQHV\VWHP¶V¿UVWOLQHRIGHIHQVH7KHEHWDJOXFDQSULPHVWKH
PDFURSKDJHDQGWKHVHRWKHUFHOOVWRGHIHQGWKHERG\IURPDWWDFNE\LGHQWLI\LQJDQGGHVWUR\LQJIRUHLJQLQYDGHUV
DQGFRPPXQLFDWLQJWKHLUSUHVHQFHWRRWKHULPPXQHFHOOGHIHQGHUV7KLVSULPLQJLQLWLDWHVDFDVFDGHRIHYHQWV
OHDGLQJWRWKHH[SUHVVLRQRIDQRYHUDOOKHLJKWHQHGFHOOXODULQQDWHLPPXQHUHVSRQVHWKDWLQFOXGHVLQFUHDVHG
1. &HOOXODU PRELOL]DWLRQ ZKLFK LV WKH DELOLW\ WR UHFRJQL]H ³HQHPLHV´ DQG PRYH WR WKH VLWH RI D IRUHLJQ
challenge
2. 3KDJRF\WLFFDSDFLW\RUWKHDELOLW\WRHQJXOIIRUHLJQDQGFDQFHUFHOOV,QRQHVWXG\:*3%HWD*OXFDQ
LQFUHDVHGWKHNLOOLQJHI¿FLHQF\RIQHXWURSKLOVWRIROG
3. 3URGXFWLRQRIDQWLPLFURELDODJHQWVXFKDVUHDFWLYHR[\JHQLQWHUPHGLDWHVWKDWOHDGWRDQHQKDQFHG
DELOLW\RIWKHLPPXQHV\VWHPWRGHIHDWDFKDOOHQJH

WGP Beta Glucan (Imucell™) and Cancer


3UHFOLQLFDOUHVHDUFKKDVGHPRQVWUDWHGSRWHQWLDORI:*3%HWD*OXFDQDVDFDQFHUWUHDWPHQW0LFHLQDFRORQ
FDQFHUPRGHOWKDWZHUHWUHDWHGGDLO\ZLWKRUDO:*3%HWD*OXFDQIRUGD\VKDGDGHFUHDVHLQWXPRUZHLJKW
Cancer 77

DQGYROXPHFRPSDUHGZLWKPLFHLQWKHFRQWUROJURXS17KHWUHDWHGPLFHZHUHIRXQGWRKDYHLQFUHDVHGF\WRNLQH
OHYHOV,/ IROG ,)1JDPPD IROG DQG71)DOSKD IROG RYHUFRQWURODQLPDOV2
7KH UHVHDUFKHUV EHOLHYH WKDW :*3 %HWD *OXFDQ VWLPXODWHV WKH LQQDWH LPPXQH V\VWHP FHOOXODU FRPSRQHQWV
PDFURSKDJHVQHXWURSKLOVDQG1.FHOOV WRDKLJKHUIXQFWLRQDOOHYHOLQFUHDVLQJWKH¿UVWOLQHRIKRVWGHIHQVH
PHFKDQLVPV7KLVVWLPXODWLRQLVPHGLDWHGWKURXJKVSHFL¿FLQWHUDFWLRQVEHWZHHQ:*3%HWD*OXFDQDQGWKH%HWD
*OXFDQUHFHSWRUVRQWKH0FHOOVDQGPDFURSKDJHVZLWKLQ3H\HU¶VSDWFKHVLQWKHLQWHVWLQDOPXFRVDLQWKHJXW
DVVRFLDWHGO\PSKDWLFWLVVXH *$/7 WRVWLPXODWHDV\VWHPLFSURWHFWLYHF\WRNLQHVLJQDO
$ SUHFOLQLFDO VWXG\ XVLQJ D EUHDVW WXPRU PRGHO LOOXVWUDWHG WKH V\QHUJLVWLF SRWHQWLDO RI :*3 %HWD *OXFDQ ZLWK
PRQRFORQDODQWLERGLHV:*3%HWD*OXFDQUHGXFHGWXPRUZHLJKWE\QHDUO\KDOI%XWZKHQXVHGLQFRQMXQFWLRQ
ZLWKDPRQRFORQDODQWLERG\WKHDYHUDJHWXPRUZHLJKWVKUDQNE\PRUHWKDQ3
7KHXVHRI:*3%HWD*OXFDQLVRIVSHFLDOLQWHUHVWLQWKHFDQFHUSDWLHQWXQGHUJRLQJFKHPRWKHUDS\DQGRUUDGLDWLRQ
WUHDWPHQWZULWHV5XVVHOO/%OD\ORFN0'RIWKH8QLYHUVLW\RI0LVVLVVLSSL0HGLFDO&HQWHUVLQFH%HWD*OXFDQKDYH
VKRZQUHPDUNDEOHDELOLW\WRDFFHOHUDWHKHPRWRSHLWLFUHFRYHU\LQERWKVXEOHWKDOO\DQGOHWKDOO\LUUDGLDWHGPLFHHYHQ
ZKHQJLYHQDIWHUWKHUDGLDWLRQGRVH4

Vitamin C Therapy
&DQFHUWLVVXHOLEHUDWHVDQHQ]\PHFDOOHGK\DOXURQLGDVHZKLFKGLVVROYHVK\DOXURQLFDFLG DSURWHFWLYHDJHQWRI
WKHFRQQHFWLYHWLVVXH DQGDOORZVIRUWKHVSUHDGRIWXPRUV7KLVREVHUYDWLRQOHGWZRWLPH1REHOODXUHDWH/LQXV
3DXOLQJ3K'RI3DOR$OWR&DOLIRUQLDWRFRQFOXGHWKDWYLWDPLQ&ZRXOGEHRIYDOXHLQFXULQJFDQFHUEDVHGRQ
WKHSUHPLVHWKDWPRUHFROODJHQ¿EULOV VPDOOLQVROXEOHSURWHLQ¿EHUVWKDWDUHRIWHQFRPSRQHQWVRIDFHOO ZRXOG
EHIRUPHGSURYLGLQJDPRUHHIIHFWLYHZDOODJDLQVWWKHVSUHDGRIWKHWXPRU$FRQWUROOHGVWXG\SURYLGHGVWDUWOLQJ
HYLGHQFHWKDWPHJDGRVHVRIYLWDPLQ&LQFUHDVHGVXUYLYDOWLPHLQFDQFHUSDWLHQWV3DWLHQWVWUHDWHGZLWKYLWDPLQ
&OLYHGDQDYHUDJHRIGD\VORQJHUWKDQSDWLHQWVZKRZHUHQRWJLYHQVXSSOHPHQWDODPRXQWVRIWKHYLWDPLQ
3HUKDSVWKHJUHDWHVWHYLGHQFHRIWKHYDOXHRIODUJHGRVHVRIYLWDPLQ&LQ¿JKWLQJFDQFHUFRPHVIURPWKHFRPELQHG
ZRUNRI$EUDP+RIIHU0'3K'RI9LFWRULD%ULWLVK&ROXPELDDQG'U3DXOLQJ,QDUHFHQWVWXG\IRUW\SDWLHQWV
ZLWKFDQFHURIWKHEUHDVWRYDU\XWHUXVRUFHUYL[FRQWLQXRXVO\UHFHLYHGODUJHGDLO\GRVHVRIDVFRUELFDFLGDQG
RWKHUYLWDPLQV$QRWKHUVL[W\RQHSDWLHQWVZLWKRWKHUNLQGVRIFDQFHUIROORZHGWKHVDPHUHJLPHQZKLOHWKLUW\RQH
patients received no vitamin supplements and served as the control group. The control group lived an average
RIPRQWKV2IWKHRWKHUVSHUFHQWRIWKHSDWLHQWVZLWKFDQFHURIWKHEUHDVWRYDU\FHUYL[RUXWHUXVKDGD
PHDQVXUYLYDOWLPHRIPRQWKVZKLOHIRUW\VHYHQSDWLHQWVZLWKWKHRWKHUNLQGVRIFDQFHUOLYHGIRUDQDYHUDJH
RIVHYHQW\WZRPRQWKV7KLVVWXG\VKRZVWKDWWKHOHQJWKRIOLIHIRUWKRVHXVLQJYLWDPLQ&ZDVWKLUWHHQWRWZHQW\
RQHWLPHVORQJHUWKDQWKRVHZKRGLGQRWUHFHLYHLW29

Vitamin C for Maximum Biological Response


9LWDPLQ&LVLQYROYHGLQPDQ\ELRFKHPLFDOUHDFWLRQVDQGSURFHVVHVFROODJHQIRUPDWLRQ1,2,3,4ZRXQGKHDOLQJ1,5
LQÀDPPDWRU\UHVSRQVH6IUHHUDGLFDOSURWHFWLRQ7 and perhaps most notably, immune response.8,9
$ QXPEHU RI UHVHDUFK VWXGLHV GHVFULEH WKH HIIHFW RI YLWDPLQ & XSRQ OHXNRF\WHV1 VXFK DV QDWXUDO NLOOHU 1. 
cells,10 neutrophils,8 and lymphocytes.89LWDPLQ&KDVDOVREHHQGHVFULEHGDVQHFHVVDU\IRUQRUPDOPDFURSKDJH
activity.11

Antioxidant Support
1XPHURXVDUWLFOHVDQGVHYHUDOUHYLHZVKDYHEHHQSXEOLVKHGRQWKHUROHRIDQWLR[LGDQWVDQGGLHWDQGOLIHVW\OH
PRGL¿FDWLRQVLQFDQFHUSUHYHQWLRQ+RZHYHUWKHSRWHQWLDOUROHVRIWKHVHIDFWRUVLQWKHPDQDJHPHQWRIKXPDQ
FDQFHU KDYH EHHQ ODUJHO\ LJQRUHG  ([WHQVLYH in vitro studies and limited in vivo studies have revealed that
LQGLYLGXDODQWLR[LGDQWVVXFKDVYLWDPLQ$YLWDPLQ(YLWDPLQ&DQGFDURWHQRLGVLQGXFHFHOOGLIIHUHQWLDWLRQDQG
JURZWKLQKLELWLRQWRYDULRXVGHJUHHVLQURGHQWDQGKXPDQFDQFHUFHOOVE\FRPSOH[PHFKDQLVPV
)XUWKHUPRUH DQWLR[LGDQW YLWDPLQV LQGLYLGXDOO\ RU LQ FRPELQDWLRQ HQKDQFH WKH JURZWKLQKLELWRU\ HIIHFWV RI [
LUUDGLDWLRQFKHPRWKHUDSHXWLFDJHQWVK\SHUWKHUPLDDQGELRORJLFDOUHVSRQVHPRGL¿HUVRQWXPRUFHOOVSULPDULO\LQ
YLWUR7KHVHYLWDPLQVLQGLYLGXDOO\DOVRUHGXFHWKHWR[LFLW\RIVHYHUDOVWDQGDUGWXPRUWKHUDSHXWLFDJHQWVRQQRUPDO
FHOOV/RZIDWDQGKLJK¿EHUGLHWVFDQIXUWKHUHQKDQFHWKHHI¿FDF\RIVWDQGDUGFDQFHUWKHUDSHXWLFDJHQWVWKH
SURSRVHGPHFKDQLVPVIRUWKHVHHIIHFWVLQFOXGHWKHSURGXFWLRQRILQFUHDVHGOHYHOVRIEXW\ULFDFLGDQGELQGLQJRI
SRWHQWLDOPXWDJHQVLQWKHJDVWURLQWHVWLQDOWUDFWE\KLJK¿EHUDQGUHGXFHGOHYHOVRIJURZWKSURPRWLQJDJHQWVVXFK
DVSURVWDJODQGLQVFHUWDLQIDWW\DFLGVDQGHVWURJHQE\ORZIDW:HSURSRVHWKHUHIRUHDZRUNLQJK\SRWKHVLVWKDW
PXOWLSOHDQWLR[LGDQWYLWDPLQVXSSOHPHQWVWRJHWKHUZLWKGLHWDQGOLIHVW\OHPRGL¿FDWLRQVPD\LPSURYHWKHHI¿FDF\
RIVWDQGDUGDQGH[SHULPHQWDOFDQFHUWKHUDSLHV29
Bio-Guard®LVDPLFHOOL]HGDQWLR[LGDQWFRPELQDWLRQRIEHWDFDURWHQHYLWDPLQ$YLWDPLQ(YLWDPLQ&DQGVHOHQLXP
%LR*XDUGDIIRUGVPD[LPXPDEVRUSWLRQRIIDWVROXEOHYLWDPLQV7KHVHYLWDPLQVKDYHEHHQUHGXFHGWRZDWHUVROXEOH
PLFHOOHV$PLFHOOHLVDYHU\WLQ\SDUWLFOHRIZDWHUVROXEOHIDW0LFHOOL]HGYLWDPLQVKDYHEHHQFOLQLFDOO\GHPRQVWUDWHG
WREHWKHIRUPPRVWHI¿FLHQWO\DEVRUEHGWKURXJKWKHLQWHVWLQDOZDOODQGLQWRWKHFHOO
78 Cancer

Supplements to Enhance Immune/Antioxidant Status


• AHCC ²FDSVXOHVGDLO\RQHPSW\VWRPDFK
For prevention, the recommended dose is one gram per day taken as one 500 mg capsule in the morning and
DJDLQDWQLJKW7KLVGRVHZLOOKHOSLQFUHDVH1.FHOODFWLYLW\DQGVXSSRUWLPPXQHV\VWHPIXQFWLRQLQJIRUJRRG
KHDOWKDQGJHQHUDOZHOOEHLQJ)RUWKRVHZLWKFDQFHU$,'6RURWKHUOLIHWKUHDWHQLQJFRQGLWLRQVWKHUHVHDUFK
LQGLFDWHVDWKHUDSHXWLFGRVHRIWZRFDSVXOHVLQWKHPRUQLQJWZRDWPLGGD\DQGWZRLQWKHHYHQLQJIRUDWRWDO
RIWKUHHJUDPVSHUGD\WRMXPSVWDUW1.FHOODFWLYLW\$IWHUZHHNVWKHGRVHFDQEHUHGXFHGWRRQHJUDPSHU
GD\ RQHFDSVXOHLQWKHPRUQLQJDQGRQHDWQLJKW WRPDLQWDLQWKHLQFUHDVHG1.DFWLYLW\OHYHO
• Imucell™ ²FDSVXOHVGDLO\RQHPSW\VWRPDFK
:*3%HWD*OXFDQ ,PXFHOO LVDQDWXUDOIRRGSURGXFWZKRVHLPPXQHHQKDQFLQJSURSHUWLHVKDYHEHHQWKH
VXEMHFWRI\HDUVRIUHVHDUFKDQGKXQGUHGVRIVFLHQWL¿FVWXGLHV'HULYHGIURPWKHFHOOZDOOVRI%DNHU¶V\HDVW
(Saccharomyces cerevisiae :*3%HWD*OXFDQSULPHVPDFURSKDJHVDQGRWKHULPPXQHV\VWHPFHOOVWR
GHIHQGWKHERG\DJDLQVWDEURDGUDQJHRIIRUHLJQFKDOOHQJHV
• Bio-Guard ²GURSSHUIXOWLPHVGDLO\ FDQEHPL[HGZLWK8OWUD3RWHQW& 
• UltraPotent-C® Powder ²WHDVSRRQVLQZDWHURUMXLFHWLPHVGDLO\
Ultra Potent-C®: More than Just Ascorbic Acid
8OWUD3RWHQW&LVDXQLTXHFRPELQDWLRQRIDVFRUEDWHVDVFRUEDWHPHWDEROLWHVDQGSUHFXUVRUV(DFKRIWKH
FRPSRQHQWVLQFOXGHGLQ8OWUD3RWHQW&LVGHVLJQHGWRSDUWLFLSDWHLQYLWDPLQ&PHWDEROLVPDQGHQKDQFH
XSWDNHDQGUHWHQWLRQ5HFHQWO\LQYHVWLJDWRUVFRPSDUHGWKHHIIHFWVRI8OWUD3RWHQW&WRDVFRUELFDFLGLQ
KHDOWK\DGXOWYROXQWHHUVLQDGRXEOHEOLQGVWXG\%RWK8OWUD3RWHQW&DQGDVFRUELFDFLGZHUHVKRZQ
WRHQKDQFH1.FHOOF\WRWR[LFLW\KRZHYHUWKHLQYHVWLJDWRUVUHSRUWHGDQDGYDQWDJHRI8OWUD3RWHQW&RYHU
DVFRUELFDFLGZKLFKLQFOXGHGLPSURYHG1.FHOODFWLYLW\GXULQJWKH¿UVWIRXUKRXUVSRVWDGPLQLVWUDWLRQD
JUHDWHULQFUHDVHLQSODVPDOHYHOVRIDVFRUELFDFLGDQGDJUHDWHULQFUHDVHLQSHULSKHUDOEORRGOHXNRF\WH
XSWDNHRIDVFRUELFDFLG²WRDERYHWKHOHYHOVUHSRUWHGZLWKVLPSOHDVFRUELFDFLG
,QWHUHVWLQJO\WKHDVFRUELFDFLGJURXSDFWXDOO\VKRZHGDGHSUHVVLRQLQ1.FHOOF\WRWR[LFDFWLYLW\GXULQJ
WKH¿UVWIRXUKRXUVDIWHUDGPLQLVWUDWLRQZKLOHWKH8OWUD3RWHQW&JURXSPDLQWDLQHGEDVHOLQHDFWLYLW\GXULQJ
WKLVVDPHWLPHSHULRG7KHVLJQL¿FDQFHRIWKLV¿QGLQJLVWKDWWKHUHLVSRWHQWLDOIRUWKHVXSSUHVVLRQRI1.
FHOODFWLYLW\WREHSURORQJHGLIDVFRUELFDFLGLVDGPLQLVWHUHGRQDUHJXODUEDVLV HJHYHU\IRXUKRXUV 

Enzyme Therapy
3DQFUHDWLFHQ]\PHVFDQKHOSLQWKHWUHDWPHQWRIFDQFHULQVHYHUDOZD\V(Q]\PHVKHOSH[SRVHDQWLJHQVRQWKH
VXUIDFHRIFDQFHUFHOOVVRWKH\FDQEHUHFRJQL]HGDVIRUHLJQDQGGHVWUR\HGE\WKHLPPXQHV\VWHP
7KH\DOVRKHOSGHVWUR\&,&¶VSURGXFHGZKHQFDQFHURXVFHOOVVKHGWKHLUDQWLJHQVLQWRWKHFLUFXODWLRQWRDYRLG
GHWHFWLRQ E\ WKH LPPXQH V\VWHP 3DQFUHDWLF HQ]\PHV FDQ VWLPXODWH 1DWXUDO .LOOHU &HOOV7&HOOV DQG7XPRU
1HFURVLV)DFWRU DQWLFDQFHUDJHQWV DOOWR[LFWRFDQFHUFHOOV
$FFRUGLQJWR'U6RORU]DQRE\UHPRYLQJWKH³VWLFN\´FRDWLQJIRXQGRQWXPRUFHOOVHQ]\PHVUHGXFHWKHULVNRI
WXPRUVDGKHULQJWRRWKHUDUHDVRIWKHERG\ LHSUHYHQWPHWDVWDVLV $QGSDQFUHDWLFHQ]\PHVFDQHQWHUFDQFHU
FHOOV LQ WKHLU UHSURGXFWLYH SKDVH ZKHQ WKH\ DUH QRW FRPSOHWHO\ IRUPHG DQG PRUH VXVFHSWLEOH WR GHVWUXFWLRQ
9LWDPLQ$LQFUHDVHVWKHVHHIIHFWVDVLWUHOHDVHVHQ]\PHVFRQWDLQHGLQO\VRVRPHV FRPSRQHQWVRIWKHLQWHUFHOOXODU
GLJHVWLYHV\VWHP DQGLVRIWHQJLYHQLQFRPELQDWLRQZLWKSDQFUHDWLFHQ]\PHV,Q*HUPDQ\SDQFUHDWLFHQ]\PH
solutions (Nutrizyme) have been injected directly into tumors, causing them to dissolve.24
• Azeo-Pangen™ Extra Strength±WDEOHWVWLPHVGDLO\$:$<)520)22' PLQEHIRUHRUPLQDIWHU 
$]HR3DQJHQ([WUD6WUHQJWKLVDFRPSUHKHQVLYHUDZSDQFUHDVHQ]\PHFRPSOH[
-OR-
• Nutrizyme ²WDEOHWVEHWZHHQPHDOVWLPHVGDLO\IRUGD\VWKHQWDEOHWVEHWZHHQPHDOVWLPHVGDLO\
3URWHRO\WLF(Q]\PH&RPSOH[

Protein Malnutrition in Cancer


0DOQXWULWLRQLVH[WUHPHO\FRPPRQLQSDWLHQWVZLWKPDOLJQDQWGLVHDVH$OWKRXJKWKHHWLRORJLHVDUHGXHWRPXOWLSOH
IDFWRUVWKHSUHGRPLQDQWIDFWRULVWKHLPEDODQFHEHWZHHQQXWULHQWDQGHQHUJ\LQWDNHDQGQXWULHQWDQGHQHUJ\
UHTXLUHPHQW7KHHYLGHQFHWRGDWHVXJJHVWVWKDWFDFKH[LDLVUHODWHGWRWKHKRVW¶VUHVSRQVHWRWKHSUHVHQFHRI
WKHWXPRU'LIIHULQJKLVWRORJLFW\SHVRIFDQFHUFDQFDXVHYDU\LQJGHJUHHVRIDQRUH[LD
%HWZHHQDQGRIKRVSLWDOL]HGSDWLHQWVVXIIHUIURPPDOQXWULWLRQ$GLVSURSRUWLRQDWHO\ODUJHQXPEHURIWKHVH
KDYHDGLDJQRVLVRIFDQFHU2QHVWXG\QRWHGWKDWRIKRVSLWDOL]HGFDQFHUSDWLHQWVKDGOHVVWKDQRISUHGLFWHG
FUHDWLQLQHKHLJKWUDWLRVDQGKDGGHFUHDVHGWULFHSVVNLQIROGWKLFNQHVV8VLQJWKHFULWHULDRIWKH3URJQRVWLF
1XWULWLRQDO,QGH[DQXPHULFFRQVWUXFWZHLJKWHGKHDYLO\IRUVHUXPDOEXPLQOHYHOVHYLGHQFHKDVEHHQSUHVHQWHG
GRFXPHQWLQJSURWHLQFDORULHPDOQXWULWLRQLQRIFDQFHUSDWLHQWVXQGHUJRLQJPDMRURSHUDWLYHSURFHGXUHV
Cancer 79

7KHUH LV VWURQJ HYLGHQFH VXJJHVWLQJ WKDW PDOQXWULWLRQ DVVRFLDWHG ZLWK PDOLJQDQF\ KDV VXEVWDQWLDO SURJQRVWLF
VLJQL¿FDQFH2QHVWXG\ZKLFKUHYLHZHGRYHUFDQFHUSDWLHQWVIRXQGWKDWSDWLHQWVZLWKRXWZHLJKWORVVDQG
VLJQL¿FDQWO\ORQJHUVXUYLYDOWKDQGLGSDWLHQWVZLWKZHLJKWORVV
0DOQXWULWLRQLVDOVRDSURJQRVWLFLQGLFDWRURISRRUUHVSRQVHWRPDQ\PHGLFDODQGVXUJLFDOSURFHGXUHV,QDVPDQ\
DVWZRWKLUGVRIFDQFHUSDWLHQWVGHDWKPD\EHDWWULEXWDEOHWRSURJUHVVLYHWLVVXHZDVWLQJ$OWKRXJKFDFKH[LDLV
almost universal in advanced malignancy and is common in gastrointestinal cancer, a consistent relationship does
QRWH[LVWEHWZHHQWKHGHYHORSPHQWRIFDFKH[LDDQGWKHVWDJHRIWKHGLVHDVHWXPRUKLVWRORJ\SULPDU\VLWHRU
GXUDWLRQRILOOQHVV,WLVFOHDUKRZHYHUWKDWFDFKH[LDLVUHODWHGWRWKHSUHVHQFHRIWKHPDOLJQDQF\$QLPDOVWXGLHV
KDYHGHPRQVWUDWHGWKDWWXPRULPSODQWDWLRQLQUDWVOHDGWRDUDSLGGHFUHDVHLQIRRGLQWDNHDQGUHVXOWDQWZHLJKW
ORVVH[FLVLRQRIWKHWXPRUOHDGVWRDUDSLGUHYHUVDORIWKHVHWUHQGV6XFFHVVIXODQWLWXPRUWKHUDS\LQKXPDQV
RIWHQOHDGVWRLPSURYHGDSSHWLWHDQGVHQVHRIZHOOEHLQJVRPHWLPHVRFFXUULQJEHIRUHDSSUHFLDWLRQRIREMHFWLYH
response.
$OWKRXJKLWDSSHDUVWKDWQXWULWLRQDOVXSSRUWLQKXPDQVGRHVQRWSUHIHUHQWLDOO\IHHGWKHWXPRURYHUWKHKRVWD
GH¿QLWLYHVWXG\RQWKHLPSDFWRIQXWULWLRQRQWXPRUJURZWKLQKXPDQVLVODFNLQJ1XWULWLRQDOUHSOHWLRQLVXVXDOO\JLYHQ
FXUUHQWO\ZLWKUDGLDWLRQVXUJHU\DQGFKHPRWKHUDS\7KXVDUDWLRQDOHIRUIHHGLQJFDQFHUSDWLHQWVFRPHVIURPDQ
DVVRFLDWLRQRILPSURYHGQXWULWLRQDOSDUDPHWHUVZLWKLPSURYHGRXWFRPHRIYDULRXVIRUPVRIRQFRORJLFWKHUDS\
BioPure Protein®LVDFRQYHQLHQWVRXUFHRISURWHLQDQGLPPXQRJOREXOLQVIRUSHRSOHZDQWLQJWRLPSURYHJHQHUDO
KHDOWKDQGVXSSRUWWKHLULPPXQHV\VWHP,WLVVXLWDEOHIRUFKLOGUHQWKHHOGHUO\DQGDWKOHWHVDVZHOODVWKRVHZKR
OHDGDEXV\OLIHVW\OHDQG¿QGLWGLI¿FXOWWRHDWDKHDOWK\EDODQFHGGLHW,WKHOSVPDQ\XVHUVPDLQWDLQDQGJDLQ
ZHLJKWDQGLVLGHDOO\VXLWHGWRLPSURYHOHDQPXVFOHPDVV:KHQSK\VLRORJLFGHPDQGVLQFUHDVHWKHERG\¶VSURWHLQ
UHTXLUHPHQWRUVXSSOHPHQWDOLPPXQRJOREXOLQVDUHGHVLUHG%LR3XUH3URWHLQLVDQH[FHOOHQWFKRLFH
%LR3XUH3URWHLQLVDELRDFWLYHSXUHZKH\SURWHLQFRQFHQWUDWHZLWKQDWXUDOO\RFFXUULQJLPPXQRJOREXOLQV,WVXSSOLHV
DQ DUUD\ RI YDOXDEOH FRQVWLWXHQWV LQFOXGLQJ SURWHLQV PLQHUDOV DQG HQ]\PHV ,W LV LGHDO QXWULWLRQDO VXSSRUW IRU
LQGLYLGXDOVZKRZLVKWRDGGKLJKTXDOLW\SURWHLQDQGLPPXQRJOREXOLQVWRWKHLUGLHWWRKHOSSURPRWHRSWLPDOKHDOWK
DQGZHOOEHLQJ
Concentrated Immunoglobulins: %LR3XUH3URWHLQVXSSOLHVDKLJKFRQFHQWUDWLRQRIQDWXUDOO\RFFXUULQJELRDFWLYH
LPPXQRJOREXOLQV DQWLERGLHV DORQJZLWKWKHSURWHLQ,PPXQRJOREXOLQVDUHDYLWDOFRPSRQHQWRIWKHLPPXQH
UHVSRQVHDQGPD\KHOSVXSSRUWKHDOWK\LQWHVWLQDOIXQFWLRQ7KLVLQWXUQKHOSVWKHERG\XWLOL]H%LR3XUH3URWHLQWR
KHOSPDLQWDLQDQGJDLQOHDQERG\PDVV7KHLPPXQRJOREXOLQELRDFWLYLW\LQ%LR3XUH
3URWHLQLVFRQVLVWHQWIURPEDWFKWREDWFKGXHWRWKHSURSULHWDU\SURFHVVE\ZKLFKLWLVGHULYHG
A Source of Glutathione: %LR3XUH3URWHLQLVDVXSHUEVRXUFHRIF\VWHLQHDQGJOXWDPLQHDPLQRDFLGVUHTXLUHG
IRUWKHSURGXFWLRQRIJOXWDWKLRQHDNH\IUHHUDGLFDOVFDYHQJHULQWKHERG\*OXWDWKLRQHDOVRSOD\VDQLPSRUWDQW
UROHLQZKLWHEORRGFHOOSURWHFWLRQDQGIXQFWLRQ
• BioPure Protein® ²VHUYLQJVGDLO\0L[VFRRSVZLWKDFROGEHYHUDJHRUDGGWR\RXUIDYRULWHUHFLSH
&RQVXPHLPPHGLDWHO\%LR3XUH3URWHLQLVYLUWXDOO\WDVWHOHVVDQGFDQEHWDNHQZLWKRUZLWKRXWIRRG

Systemic Detoxification

Metabolic Detoxification Program


'HWR[L¿FDWLRQ SURJUDPV GHDO ZLWK XQGHUO\LQJ WR[LFLW\ LVVXHV LQ FDQFHU LWVHOI DQG VWDQGDUG FDQFHU WKHUDSLHV
utilized.
• ,PSOHPHQWWKHDSSURSULDWHGHWR[L¿FDWLRQSURJUDPRXWOLQHGLQWKH'HWR[L¿FDWLRQVHFWLRQRIWKLVJXLGH

Chemotherapy and/or Radiation Therapy Support

Nutritional Support for the Patient Going Through Chemo or Radiation Therapy
&KHPRWKHUDS\ZRUNVE\WU\LQJWRGHVWUR\IDVWJURZLQJRUUHSOLFDWLQJFHOOV8QOLNHPRVWQRUPDOKHDOWK\FHOOV
ZKLFKJURZVORZO\FDQFHUFHOOVUHSOLFDWHYHU\TXLFNO\DPDVVLQJLQWRWXPRUVDQGPHWDVWDVL]LQJ VSUHDGLQJ WR
RWKHUDUHDVRIWKHERG\&KHPRWKHUDS\LVLQWHQGHGWRSRLVRQDQGNLOOTXLFNO\UHSOLFDWLQJFHOOV8QIRUWXQDWHO\
FKHPRWKHUDS\GRHVQRWKDYHWKHDELOLW\WRGLVFULPLQDWHUDSLGO\UHSOLFDWLQJFDQFHUFHOOVIURPUDSLGO\UHSOLFDWLQJ
QRUPDOKHDOWK\FHOOVVXFKDVKDLUQDLODQGVWRPDFKOLQLQJFHOOVZKLFKDUHNLOOHGRIIGXULQJFKHPRWKHUDS\7KLV
H[SODLQVZK\VRPDQ\FDQFHUSDWLHQWVHQGXUHKDLUORVVDQGYRPLWLQJGXULQJFKHPRWKHUDS\
• AHCCKHOSV¿JKWWKHVLGHHIIHFWVRIFKHPRWKHUDS\
• Liver Care ²FDSVXOHVWZLFHGDLO\
6HYHUDOUHVHDUFKVWXGLHVLQGLFDWHDQ$\XUYHGLFOLYHUIRUPXODVXFKDV/LYHU&DUHPD\SURWHFWDJDLQVWWKH
KHSDWRWR[LFLW\RIDQWLFDQFHUGUXJVWKXVPLQLPL]LQJWKHLUVLGHHIIHFWVDQGLPSURYLQJWKHLUHI¿FDF\
80 Cancer

Suggested Nutritional Supplementation

Proactive and Protective Nutrient Recommendations for Cancer Patients


3ODQWQXWULHQWVFRXQWHUDFWHYHU\SKDVHRISURJUHVVLRQ$ONDOL]H'HWR[&KHODWLQJ$JHQWV
• Phyto Complete® — 10 tablets 4 times daily
3K\WR &RPSOHWH LV D QXWULHQWULFK VXSHUIRRG IRUPXOD ZLWK ZKROH IRRG FRQFHQWUDWHV GHVLJQHG WR SURYLGH
synergistic phytonutrient nutrition.

$QWLR[LGDQWSURWHFWLRQDQGHQKDQFHGFHOOXODUIXQFWLRQ
• Multigenics® Intensive Care Formula without Iron — 8 tablets daily
0XOWLJHQLFV,QWHQVLYH&DUH)RUPXODZLWKRXW,URQLVDFRPSUHKHQVLYHPXOWLSOHYLWDPLQDQGPLQHUDOIRUPXOD
VXLWDEOHIRUDGROHVFHQWVDGXOWVDQGVHQLRUVWKDWSURYLGHVDQHVVHQWLDOFRPSUHKHQVLYHIRXQGDWLRQIRURSWLPDO
health.
• Ultra Potent-C® Powder ²WVSLQZDWHURUMXLFHWRWLPHVGDLO\
8OWUD3RWHQW&3RZGHULVDQH[FOXVLYHSDWHQWHGIRUPXODWKDWLVGHVLJQHGWRHQKDQFHWKHXWLOL]DWLRQRI9LWDPLQ
&3UHOLPLQDU\VFLHQWL¿FUHVHDUFKVXJJHVWVWKDWYLWDPLQ&LQWKHIRUPRI8OWUD3RWHQW&PD\UHVXOWLQLPSURYHG
XSWDNHE\ZKLWHEORRGFHOOVZKHQFRPSDUHGWRUHJXODUDVFRUELFDFLG

2LOV±$QWLLQÀDPPDWRU\SURYHQDQWLFDQFHUPHFKDQLVPV
• EPA-DHA High Concentrate Liquid™ — 1 teaspoon 4 times daily
High Concentrate(3$'+$/LTXLGSURYLGHVDWOHDVWPJSHUVHUYLQJRI(3$'+$DQGRWKHUSXULW\
FHUWL¿HGRPHJDHVVHQWLDOIDWW\DFLGVLQWULJO\FHULGHIRUP
• GLA Forte® — 2 capsules 4 times daily
*/$)RUWHIHDWXUHVERUDJHVHHGRLODQHVVHQWLDOIDWW\DFLGWKDWLVFRQYHUWHGLQWKHERG\WR'*/$ GLKRPR
JDPPDOLQROHQLFDFLG WKHGLUHFWSUHFXUVRURIEHQH¿FLDOVHULHVSURVWDJODQGLQV
• Ultra CLA® ²VRIWJHOVWZLFHGDLO\
8OWUD&/$LVDVWDELOL]HGPL[HGLVRPHUFRQMXJDWHGOLQROHLFDFLG &/$ IRUPXODLQWULJO\FHULGHUDWKHUWKDQIUHH
IDWW\DFLGIRUPIRUHQKDQFHGVWDELOLW\DQGWROHUDQFH

0HGLXP&KDLQ7ULJO\FHULGHVSURYLGHHQHUJ\ZRLQVXOLQLQFUHDVH
• UltraClear PLUS® 0HGLFDO)RRG²VFRRSVWZLFHGDLO\
0HWDEROLF'HWR[L¿FDWLRQIRU,PEDODQFHG'HWR[L¿HUV

5. Trophoblastic Theory
• Azeo-Pangen™ Extra Strength²WDEOHWVWLPHVGDLO\$:$<)520)22' PLQEHIRUHRUPLQ
DIWHU 
$]HR3DQJHQ([WUD6WUHQJWKLVDFRPSUHKHQVLYHUDZSDQFUHDVHQ]\PHFRPSOH[

3URWHLQ±OHDQFOHDQDQGORZLQÀDPPDWRU\SRWHQWLDO HQRXJKWRPDLQWDLQ%&0
• BioPure Protein® — 0L[VFRRSVZLWKDFROGEHYHUDJH
%LR3XUH 3URWHLQ LV D ELRDFWLYH SXUH ZKH\ SURWHLQ FRQFHQWUDWH ZLWK QDWXUDOO\ RFFXUULQJ LPPXQRJOREXOLQV
DQWLERGLHV DQG%UDQFK&KDLQ$PLQR$FLGVZKLFKDUHDQWLFDWDEROLF

*OXWDPLQHKDVDQWLFDQFHUPHFKDQLVPV
• Glutagenics®²WVSPL[HGZLWKZDWHUWLPHVGDLO\
*OXWDJHQLFVIHDWXUHVWKUHHNH\LQJUHGLHQWV²JOXWDPLQHGHJO\F\UUKL]LQL]HGOLFRULFH '*/ DQGDORHYHUD²WKDW
FRPSUHKHQVLYHO\VXSSRUWWKHLQWHJULW\DQGKHDOWK\IXQFWLRQRIWKHJDVWURLQWHVWLQDOOLQLQJ

'HWR[L¿FDWLRQRIFDUFLQRJHQVDQGFDQFHUWR[LQV
• AdvaClear®²FDSVXOHVWZLFHGDLO\
$GYD&OHDUSURYLGHVXQLTXHVXSSRUWIRUEDODQFHGDFWLYLW\RIWKHERG\¶VGHWR[L¿FDWLRQSURFHVVHV

9. Immune Stimulation
• AHCC — 2 capsules 3 times daily
$+&&LVDQH[WUDFWRIDXQLTXHK\EULGL]DWLRQRIVHYHUDOPHGLFDOPXVKURRPVNQRZQIRUWKHLULPPXQHHQKDQFLQJ
abilities.
• Imucell :*3%HWD*OXFDQ ²FDSVXOHVWLPHVGDLO\
,PXFHOOSULPHVPDFURSKDJHVDQGRWKHULPPXQHV\VWHPFHOOVWRGHIHQGWKHERG\DJDLQVWDEURDGUDQJHRI
IRUHLJQFKDOOHQJHV
Cancer 81

Dietary Suggestions
• FirstLine Therapy® Diet±/RZJO\FHPLFLQGH[DQGSK\WRQXWULHQWGHQVH

References AHCC:
1. .LWDGH+et al XXXIIIrd Cong. of Euro. Soc. for Surg. Research, p 74, 1998.
2. *KRQHXP0DPGRRK3K'Society of Natural Immunity, pp 56, 1997.
3. *KRQHXP0et al. International Journal of Immunology;,  SS

References WGB Beta Glucan


1. 2QGHUGRQN$%&LVQHURV5/et al. $QWLLQIHFWLYHRISRO\%JOXFRWULRVO\%JOXFRS\UDQRVHJOXFDQLQYLYRInfection and Immunity.

2. 5RVV*'9HWYLFND9<DQ-;LD<9HWYLFNRYD-7KHUDSHXWLFLQWHUYHQWLRQZLWKFRPSOHPHQWDQGEHWDJOXFDQLQFDQFHUImmunopharmacology.
0D\  5HYLHZ30,'>3XE0HG²LQGH[HGIRU0('/,1(@
3. -XQ<DQ9DFODY9HWYLFND<X;LD$QJHOD&R[RQ0LFKDHO(&DUUROO7DQ\D10D\DGDVDQG*RUGRQ'5RVV%*OXFDQD³6SHFL¿F´
%LRORJLF5HVSRQVH0RGL¿HU7KDW8VHV$QWLERGLHVWR7DUJHW7XPRUVIRU&\WR[LF5HFRJQLWLRQE\/HXNRF\WH&RPSOHPHQW5DFHSURW7\SH
(CD11b/CD18) J. Immunology 
4. %OD\ORFN5<HDVW%JOXFDQDQGLWVXVHVDJDLQVW$QWKUD[LQIHFWLRQDQGLQWKHWUHDWPHQWRIFDQFHUJ American Nutraceutical Ass’n.
v5 n2, Spring 2002.

References Protein:
1. %LVWULDQ%5HWDO3UHYDOHQFHRIPDOQXWULWLRQLQJHQHUDOPHGLFDOSDWLHQWV-$0$  
2. :LOOFXWWV+'1XWULWLRQDODVVHVVPHQWRIVXUJLFDOSDWLHQWVLQDQDIÀXHQWVXEXUEDQFRPPXQLW\KRVSLWDO-3DUHQWHU(QWHU1XWU
(1977).
3. 1L[RQ':HWDO3URWHLQFDORULHPDOQXWULWLRQLQKRVSLWDOL]HGFDQFHUSDWLHQWV$P-0HG  
4. %X]E\*3HWDO3URJQRVWLFQXWULWLRQDOLQGH[LQJDVWURLQWHVWLQDOVXUJHU\$P-6XUJ  
5. 'H:\V:'HWDO3URJQRVWLFHIIHFWRIZHLJKWORVVSULRUWRFKHPRWKHUDS\LQFDQFHUSDWLHQWV$P-0HG  
6. 3RSS0%HWDO3URVSHFWLYHUDQGRPL]HGVWXG\RIDGMXYDQWSDUHQWHUDOQXWULWLRQLQWUHDWPHQWRIDGYDQFHGGLIIXVHO\PSKRPD6XUJHU\
90:195 (1981).
7. 6KDPEHUJHU5&HWDO$SURVSHFWLYHUDQGRPL]HGVWXG\RIDGMXYDQWSDUHQWHUDOQXWULWLRQLQWKHWUHDWPHQWRIVDUFRPDV6XUJHU\
(1984).
8. 'DO\-0HWDO3DUHQWHUDOQXWULWLRQLQHVRSKDJHDOFDQFHUSDWLHQWV$QQ6XUJ  
9. +LFNPDQ'0HWDO6HUXPDOEXPLQDQGERG\ZHLJKWDVSUHGLFWRUVRISRVWRSHUDWLYHFRXUVHLQFRORUHFWDOFDQFHU-3DUHQWHU(QWHU1XWU
14 (1980).
10. :DUUHQ67KHLPPHGLDWHFDXVHVRIGHDWKLQFDQFHU$PHU-0HG6FL

References
1. 0DKDQ/.$UOLQ07Krouse’s Food, Nutrition, and Diet Therapy, WKHGSS3KLODGHOSKLD:%6DXQGHUV&R
2. &KRMNLHU 0 HW DO ³6SHFL¿FDOO\ GHFUHDVHG FROODJHQ ELRV\QWKHVLV LQ VFXUY\ GLVVRFLDWHG IURP DQG HIIHFW RQ SUROLQH K\GUR[\ODWLRQ DQG
FRUUHODWHZLWKERG\ZHLJKWORVVLQYLWURVWXGLHVLQJXLQHDSLJFDOYDULDOERQHV´J. Clin. Invest.
3. 6WDVVHQ)/+HWDO³$FWLYDWLRQRISURO\OK\GUR[\ODVHLQ/¿EUREODVWVE\DVFRUELFDFLG´Proc. Natl. Acad. Sci. USA, 
3.
4. 0\OO\OD5HWDO³7KHUROHRIDVFRUEDWHLQWKHSURO\OK\GUR[\ODVHUHDFWLRQ´Biochem. Biophys. Res. Commun.
5. 0XVVLQL(HWDO³&ROODJHQSUROLQHK\GUR[\ODVHLQZRXQGKHDOLQJJUDQXORPDIRUPDWLRQVFXUY\DQGJURZWK´Science, 
9.
6. $QGHUVRQ5³7KHLPPXQRVWLPXODWRU\DQWLLQÀDPPDWRU\DQGDQWLFSURSHUWLHVRIDVFRUEDWH´Adv. Nutr. Res.
7. %HQGLFK$HWDO³7KHDQWLR[LGDQWUROHRIYLWDPLQ&´Adv. Free Rad. Biol. Med., 
8. $QGHUVRQ5³$VFRUELFDFLGDQGLPPXQHIXQFWLRQV´,Q&RXQVHO-1+RUQLJ'+HGVVitamin C: Ascorbic Acid, London: Applied Science
3XEOLVKHUV
9. 3HWHUV (0 HW DO ³9LWDPLQ & VXSSOHPHQWDWLRQ UHGXFHV WKH LQFLGHQFH RI SRVWUDFH V\PSWRPV RI XSSHUUHVSLUDWRU\WUDFW LQIHFWLRQ LQ
ultramarathon runners,” Am. J. Clin. Nutr., 
10. 9RMGDQL$*KRQHXP0³,QYLYRHIIHFWRIDVFRUELFDFLGRQHQKDQFHPHQWRIKXPDQQDWXUDONLOOHUFHOODFWLYLW\´Nutr. Res., 
64.
11. *DQJXO\5HWDO³0DFURSKDJHIXQFWLRQRIYLWDPLQ&GH¿FLHQWJXLQHDSLJV´Am. J. Clin. Nutr., 
12. $QGHUVRQ7:HWDO³9LWDPLQ&DQGWKH&RPPRQ&ROG$GRXEOHEOLQGWULDO´Can. Med. Ass. J., 
13. &KDWWHUMHH$HWDO³(IIHFWVRI/O\VLQHDGPLQLVWUDWLRQRIFHUWDLQDVSHFWVRIDVFRUELFDFLGPHWDEROLVP´Int’l J. Vit. Nutr. Res., 

14. Martindale: The Extra Pharmacopeia, -()5H\QROGVHG/RQGRQ7KH3KDUPDFHXWLFDO3UHVV
15. 6RZGHQ-&³2FFXUUHQFHSURSHUWLHVDQGV\QWKHVLVRIWKHPRQRVDFFKDULGHV´,Q7KH&DUERK\GUDWHV&KHPLVWU\Biochemistry, Physiology,
S:3LJPDQHG1HZ<RUN$FDGHPLF3UHVV
16. /DQJ.Biochemie der Ernahrung, 'U'6WHLQNRSII9HUODJ'DUPVWDGWS
17. .DUUHU3Organic Chemistry, WK(QJOLVKHGS(OVHUQHU3XEOLVKLQJ&R,QF
18. %DQHUMHH6.HWDO³(IIHFWRIVXOSKXUFRQWDLQLQJDPLQRDFLGVDQGDQDEROLFVWHURLGRQWKHPHWDEROLVPRIDVFRUELFDFLGLQUDWVIHGRQ
necrogenic diets,” Ind. J. of Biochem. Biophys., 
19. /HZLQ6“Vitamin C: Its Molecular Biology and Medical Potential,” /RQGRQ$FDGHPLF3UHVV
20. 'L[RQ6-:LOVRQ-;³7UDQVIRUPLQJJURZWKIDFWRUEHWDVWLPXODWHVDVFRUEDWHWUDQVSRUWDFWLYLW\LQRVWHREODVWLFFHOOV´Endocrinology, 130
 S
21. -RKQVWRQ&6HWDO³9LWDPLQ&HOHYDWHVUHGEORRGFHOOJOXWDWKLRQHLQKHDOWK\DGXOWV´$P-&OLQ1XWU
22. 0LOOHU-=HWDO³7KHUDSHXWLFHIIHFWRIYLWDPLQ&$FRWZLQFRQWUROVWXG\´-$0$
23. &DKLO5-HWDO³(IIHFWVRIYLWDPLQDQWLR[LGDQWVXSSOHPHQWDWLRQRQFHOONLQHWLFVRISDWLHQWVZLWKDGHQRPDWRXVSRO\SV´*XW
24. $OWHUQDWLYH 0HGLFLQH 7KH 'H¿QLWLYH *XLGH &RPSLOHG E\ 7KH %XUWRQ *ROGEHUJ *URXS -DPHV 6WURKHFNHU ([HFXWLYH (GLWRU )XWXUH
0HGLFLQH3XEOLVKLQJ,QF3X\DOOXS:DVKLQJWRQ
25. Life Extension Report, Vol. 13, No. 5, April, 1993.
26. -DJHWLD*&*DQDSDWKL1*'HSWRI5DGLRELRORJ\.DVWXUED0HGLFDO&ROOHJH0DQLSDO.DUQDWDNDMutation Res. (1989): 224, 507.
82 Cancer

27. 7ULSDWKL610LVUD$.8SDGK\D\D.1'L[LW236ULYDVWDYD6.5HVHDUFK)HOORZ'HSWRI.D\DFKLNLWVD,QVWLWXWHRI0HGLFDO6FLHQFHV
%DQDUDV+LQGX8QLYHUVLW\9DUDQDVL83-Res. Ind. Med., Yoga & Homeo, (1977): 1, 49.
28. .LVKRUH%+D]UD'86DFKDQ$6$JUDZDO%0%KDUDGZDM$.DQG0HKURWUD001Probe (1978): 2, 125.
29. 3UDVDG.1HWDO³+LJKGRVHVRIPXOWLSOHDQWLR[LGDQWYLWDPLQV(VVHQWLDOLQJUHGLHQWVLQLPSURYLQJHI¿FDF\RIVWDQGDUGFDQFHUWKHUDS\´
-$PHU&ROOHJHRI1XWULWLRQ9RO1R  
30. 3UHYHQWDWLYH (IIHFW RI$FWLYH +H[RVH &RUUHODWHG &RPSRXQG $+&&  RQ WKH 5HFXUUHQFH RI 3RVWRSHUDWLYH+HSDWRFHOOXODU &DUFLQRPD
3DWLHQWV;;;,,,UG&RQJUHVVRIWKH(XURSHDQ6RFLHW\IRU6XUJLFDO5HVHDUFKS
31. ,PPXQRPRGXODWRU\DQG$QWL&DQFHU(IIHFWVRI$FWLYH+HPL&HOOXORVH&RPSRXQG $+&& ,QWHUQDWLRQDO-RXUQDORI,PPXQRWKHUDS\;, 
  *KRQHXP0:LPEOH\06DOHP)0F.ODLQ$$WWDOODK1*LOO*
32. 1.,PPXQRPRGXODWLRQE\$FWLYH+HPLFHOOXORVH&RPSRXQGLQ&DQFHU3DWLHQWV6RFLHW\RI1DWXUDO,PPXQLW\7DRUPLQD,WDO\0D\
S0DPGRRK*KRQHXP3K'
33. (QKDQFHPHQWRI+XPDQ1.&HOO$FWLYLW\,Q9LYRE\$FWLYH+HPLFHOOXORVH&RPSRXQG $+&& $EVWUDFWRIWK$QQXDO&RQIHUHQFHRQ
&OLQLFDO,PPXQRORJ\1RYHPEHU*KRQHXP0HWDO
34. &RPELQDWLRQWKHUDS\RIDFWLYHKH[RVHFRUUHODWHGFRPSRXQGSOXV8)7VLJQL¿FDQWO\UHGXFHVWKHPHWDVWDVLVRIUDWPDPPDU\DGHQRFDUFLQRPD
$QWL&DQFHU 'UXJV  Y SS .D]XKLUR 0DWVXVKLWD <DVXKLUR .XUDPLW]X <RXLFKL 2KLUR 0DQXED 2EDUD 0DVDQREX
.RED\DVKL<RQJ4LQJ/LDQG0DVXR+RVRNDZD
35. 3URWHFWLYH(IIHFWVRI$+&&RQ&DUERQ7HWUDFKORULGH,QGXFHG/LYHU,QMXU\LQ0LFH1DWXUDO0HGLFLQH6XQ%:DNDPH
.0XNRWD77R\RVKLPD$.DQD]DZD7.RVXQD.
36. $FWLYH +H[RVH &RUUHODWHG &RPSRXQG $+&&  3URWHFWV$JDLQVW &\WRVLQH$UDELQRVLGH ,QGXFHG$ORSHFLD LQ WKH 1HZERUQ 5DW 0RGHO
-DSDQHVH-RXUQDORI&DQFHU5HVHDUFKS0XNRGD76XQ%.RVXQD.
37. 7KH 'HYHORSPHQW DQG$SSOLFDWLRQ RI$FWLYH +HPLFHOOXORVH &RPSRXQG $+&&  %LR ,QGXVWU\ 6HSWHPEHU  9ROXPH  .HQLFKL
.RVXQD
38. 'L/X]LR15:LOOLDPV'/0F1DPHH5%(GZDUGV%).LWDKDPD$&RPSDUDWLYHWXPRULQKLELWRU\DQGDQWLEDFWHULDODFWLYLW\RIVROXEOH
and particulate glucan. Int J Cancer
39. ,PXUD+2KQR16X]XNL,<DGRPDH73XUL¿FDWLRQDQWLWXPRUDFWLYLW\DQGVWUXFWXUDOFKDUDFWHUL]DWLRQRI‰JOXFDQVIURPPeziza
vesiculosa. Chem Pharm Bull. 
40. <DGRPDH76WUXFWXUHDQGELRORJLFDODFWLYLWLHVRIIXQJDO‰JOXFDQVYakugaku Zasshi
41. 2JDVDZDUD00XUDWD-.DPLWDQL<+D\DVKL.6DLNL,,QKLELWLRQE\YDVRDFWLYHLQWHVWLQDOSRO\SHSWLGH 9,3 RIDQJLRJHQHVLVLQGXFHG
E\PXULQH&RORQ/FDUFLQRPDFHOOVPHWDVWDVL]HGLQOLYHUClin Exp Metastasis. 
42. 5RVV*'9HWYLFND9<DQ-;LD<9HWYLFNRYi-7KHUDSHXWLFLQWHUYHQWLRQZLWKFRPSOHPHQWDQG‰JOXFDQLQFDQFHUImmunopharmacol.

43. 1DNDQR72ND.+DQED.0RULWD6,QWUDWXPRUDODGPLQLVWUDWLRQRIVL]R¿ODQDFWLYDWHV/DQJHUKDQFHOODQG7FHOOLQ¿OWUDWLRQLQFHUYLFDO
cancer. Clin Immunol Immunopathol. 
44. 6X]XNL,+DVKLPRWR.2KQR17DQDND+<DGRPDH7,PPXQRPRGXODWLRQE\RUDOO\DGPLQLVWHUHG‰JOXFDQLQPLFHInt J Immunopharmac.

45. ,NX]DZD00DWVXQDJD.1LVKL\DPD61DNDMLPD6.RED\DVKL<$QGRK7.RED\DVKL$2KKDUD02KPXUD<:DGD77RVKLNXPL&
)DWHDQGGLVWULEXWLRQRIDQDQWLWXPRUSURWHLQERXQGSRO\VDFFKDULGH36. .UHVWLQ Int J Immunopharmacol. 
46. 7RULVX0+D\DVKLP<,VKPLWVX7)XMLPXUD7,ZDVDNL..DWDQR0<DPDPRWR+.LPXUD<7DNHVXH0.RQGR01RPRWR.6LJQL¿FDQW
SURSDJDWLRQRIGLVHDVHIUHHSHULRGJDLQHGE\RUDOSRO\VDFFKDULGH 36. DGPLQLVWUDWLRQDIWHUFXUDWLYHVXUJLFDORSHUDWLRQRIFRORUHFWDO
cancer. Canc Immunol Immunother. 
47. ;X*7KHHIIHFWVRI363RQLPSURYLQJLPPXQLW\IRUJDVWULFFDQFHUSDWLHQWV,Q<DQJ4.ZRN&HGVPSP International Symposium.
+RQJ.RQJ)XGDQ8QLYHUVLW\3UHVV$EVWUDFW
48. 1DPED+5HVXOWVRIQRQFRQWUROOHGFOLQLFDOVWXG\IRUYDULRXVFDQFHUSDWLHQWVXVLQJPDLWDNH'IUDFWLRQExplore
49. 6X]XNL,6DNXUL7+DVKLPRWR.2LNDZD60DVXGD$2KVDZD0<DGRPDH7,QKLELWLRQRIH[SHULPHQWDOSXOPRQDU\PHWDVWDVLVRI
/HZLVOXQJFDUFLQRPDE\RUDOO\DGPLQLVWHUHG‰JOXFDQLQPLFHChem Pharm Bull 
50. .DVDL6)XMLPRWR61LWWD.%DED+.XQLPRWR7$QWLWXPRUDFWLYLW\RISRO\PRUSKRQXFOHDUOHXNRF\WHVDFWLYDWHGE\DEHWD'JOXFDQ
J Pharmacobiodyn  
51. 0,WRPL77VXFKL\D6,LMLPD1$VR.6X]XNL.1,VKL\DPD.$PDQR77DNDKDVKL70XUD\DPD12ND+2\D.1RWR72JDZD1
5DQGRPL]HGFRQWUROOHGVWXG\RQDGMXYDQWLPPXQRFKHPRWKHUDS\ZLWK36.LQFXUDWLYHO\UHVHFWHGFRORUHFWDOFDQFHUDis Colon Rectum.

52. +D\DNDZD.0LWVXKDVKL16DLWR<7DNDKDVKL0.DQDWR66KLRMLPD.)XUXWD01LLEH+(IIHFWRINUHVWLQ 36. DVDGMXYDQWWUHDWPHQW
RIWKHSURJQRVLVDIWHUUDGLFDOUDGLRWKHUDS\LQSDWLHQWVZLWKQRQVPDOOFHOOOXQJFDQFHUAnticancer Res 
53. 5HGXFWLRQRIWKH6LGH(IIHFWVRI$QWLFDQFHU'UXJVE\$FWLYH+H[RVH&RUUHODWHG&RPSRXQGWK3URFHHGLQJVRIWKH$PHULFDQ$VVRFLDWLRQ
IRU&DQFHU5HVHDUFK%6XQHWDO $PLQR8S&KHPLFDO&R/WG 
54. 3URWHFWLYHHIIHFWVRI$+&&RQ&DUERQ7HWUDK\GURFKORULGH,QGXFHG/LYHU,QMXU\LQ0LFH1DWXUDO0HGLFLQHV    %6XQ
et al. (Amino Up Chemical Co., Ltd.) 1998.
55. $FWLYH+H[RVH&RUUHODWHG&RPSRXQG $+&& 3URWHFWV$JDLQVW&\WRVLQH$UDELQRVLGH,QGXFHG$ORSHFLDLQWKH1HZERUQ5DW$QLPDO0RGHO
WK$QQXDO0HHWLQJRIWKH-DSDQHVH&DQFHU$VVRFLDWLRQ70XNRGDHWDO $PLQR8S&KHPLFDO&R/WG 
56. &RPELQDWLRQ7KHUDS\RI$FWLYH+H[RVH&RUUHODWHG&RPSRXQG $+&& 3OXV8)76LJQL¿FDQWO\5HGXFHVWKH0HWDVWDVLVRI5DW0DPPDU\
&DUFLQRPD$QWL&DQFHU'UXJV.0DWVXVKLWDHWDO 8QLYHUVLW\
8QLYHUVLW\6FKRRORI0HGLFLQH/DERUDWRU\RI3DWKRORJ\&DQFHU
6FKRRO RI 0HGLFLQH /DERUDWRU\ RI 3DWKRORJ\ &DQFHU
Institute, Hokkaido) 1998.
57. 3URSK\ODFWLF(I¿FLHQF\RID%DVLGLRP\FHWHV3UHSDUDWLRQ$+&&DJDLQVW/HWKDO2SSRUWXQLVWLF,QIHFWLRQLQ0LFH<DNXJDNX=DVVL
+,VKLEDVKLHWDO 'HSDUWPHQWRI0LFURELRORJ\DQG,PPPXQRORJ\7HLN\R8QLYHUVLW\RI0HGLFLQH 
58. ,PSURYLQJ(IIHFWRI$FWLYH+H[RVH&RUUHODWHG&RPSRXQG $+&& RQWKH3URJQRVLVRI3RVWRSHUDWLYH+HSDWRFHOOXODU&DUFLQRPD3DWLHQWV
WK&RQJUHVVRIWKH(XURSHDQ6RFLHW\IRU6XUJLFDO5HVHDUFK %HUQ6ZLW]HUODQG <.DPL\DPLHWDO )LUVW'HSDUWPHQWRI6XUJHU\.DQVDL
Medical University) 1999.
Candida Albicans 83

Candida Albicans
&DQGLGLDVLVLVDQLQIHFWLRQZLWKDIXQJXVRIWKHCandida strain, usually limited to the skin and mucous membranes,
EXWVRPHWLPHVLVV\VWHPLFDQGOLIHWKUHDWHQLQJ
Candida albicansDUHDVLQJOHFHOO\HDVWIXQJXVWKDWLVIRXQGLQSUDFWLFDOO\RIWKHSRSXODWLRQ,WOLYHVRQWKH
PXFRXVPHPEUDQHVRIWKHERG\WKHGLJHVWLYHLQWHVWLQDOWUDFWYDJLQDDQGWKHVNLQMOST IMPORTANT, in the
proper environment, Candida albicansZLOOFRH[LVWZLWKQRQHJDWLYHVLGHHIIHFWV6RWRXQGHUVWDQGGLDJQRVHDQG
WUHDW³FDQGLGHPLD´ZHPXVWXQGHUVWDQGZKDWFDXVHVWKHCandida albicans relationship in our bodies to change
IURPDVDSURSK\WLFWRDSDUDVLWLFRQH
0RVWUHVHDUFKHUVDJUHHWKDWWKHSDWKRJHQHVLVRI³FDQGLGHPLD´LVSULPDULO\GXHWRDQDOWHUHGLPSURSHUEDODQFH
RIJXWPLFURÀRUD7KLVLVDUHVXOWRISULPDULO\ WKHLQGLVFULPLQDWHXVHRIDQWLELRWLFVLQERWKSHRSOHDQGDQLPDOV
IRRG KLJKEHHIIDWVXJDUDQGORZ¿EHUGLHWV XVHRIELUWKFRQWUROSLOOVFRUWLVRQHFRUWLVRQHOLNHGUXJVDQG
immunosuppressant drugs.
$VDUHVXOWZHHQGXSZLWKDGUDVWLFLPEDODQFHRIWKHPLFURHFRORJ\LQRXUERG\7KLVDOORZVWKHCandida yeast
DQG RWKHU ³HQHPLHV´ WR RYHUSRSXODWH FRQYHUW LQWR D IXQJDO IRUP ZKLFK SURGXFHV VRPH  QHXURWR[LQV DQG
LUULWDWHWKHJXWOLQLQJWRWKHSRLQWRIDOORZLQJPDFURPROHFXODUDEVRUSWLRQRIPDQ\WKLQJVQRWGHVLJQHGWRHQWHULQWR
the circulatory system including the Candida albicansWR[LQVDQGSRWHQWLDODOOHUJHQV,WLVWKHUHIRUHH[WUHPHO\
LPSRUWDQWWRLGHQWLI\DQGLPSOHPHQWDSURJUDPGHVLJQHGWRDSSURDFKWKLVSUREOHP

Identification
1. 'U&URRN¶VV\PSWRPTXHVWLRQQDLUHVIRUFDQGLGHPLDDUHH[FHOOHQWLQGLFDWRUV
2. The Candida DQWLERG\EORRGWHVWDORQJZLWKWKHF\WRSODVPLFDQWLJHQDQWLERG\WHVWKDYHEHHQXWLOL]HGE\
PDQ\SUDFWLWLRQHUVEXWDSSHDUWRKDYHDSSUR[LPDWHO\HUURUUDQJH
3. 7KHGDUN¿HOGLGHQWL¿FDWLRQRI\HDVWIRUPVKDVDKLJKGHJUHHRIDFFXUDF\UHOLDELOLW\
4. 7KHDSSOLHGNLQHVLRORJ\LGHQWL¿FDWLRQFRUUHODWHVZHOOZLWKGDUN¿HOGLGHQWL¿FDWLRQDQG'U&URRN¶VV\PSWRP
questionnaires.

Common Signals of Candida Overgrowth


Central Nervous Gastrointestinal Genitourinary Tract Generalized “Allergic”
System Tract Symptoms
Headache Chronic heartburn Yeast vaginitis Fatigue +D\IHYHU
Depression *DVWULWLV Irregular menses -RLQWSDLQVWLIIQHVV Sinusitis
Lethargy Colitis Cramping &ROGKDQGVIHHW Earaches
Agitation Distension/bloating Endometriosis Increased body hair Hives
Hyperirritability *DV Cystitis Numbness/tingling Asthma
Memory loss Constipation Urethritis Food cravings Food/chemical
Inability to Diarrhea .LGQH\EODGGHU /RVVRIOLELGR Sensitivities
Concentrate ,QIHFWLRQV

Treatment
7KHVWDQGDUGPHGLFDODSSURDFKWRFDQGLGHPLDKDVEHHQDSWO\WHUPHG³WKHVLOYHUEXOOHWDSSURDFK´UHIHUULQJWR
WKHLGHDRI¿QGLQJVRPHWKLQJWKDW³NLOOVRII´RQO\&DQGLGDDOELFDQVZKLFKLVQRWDYHU\ORJLFDODSSURDFK,I\RX
&28/'NLOOWKHPRIIFRPSOHWHO\WKH\ZRXOGMXVWFRPHEDFNDVVRRQDVWUHDWPHQWZRXOGVWRS6LQFHWKH\DUH
IRXQG3UDFWLFDOO\(YHU\ZKHUHLWLVHVVHQWLDOO\LPSRVVLEOHWRSUHYHQWWKHLUUHHQWU\LQWRWKHERG\
$ PRUH ORJLFDO IRFXV RI QXWULWLRQDO WUHDWPHQW SURWRFROV VKRXOG EH WR FUHDWH DQ HQYLURQPHQW ZKLFK NHHSV WKLV
QDWXUDOO\RFFXUULQJ\HDVWIRUPDWDQDSSURSULDWHVDSURSK\WLFSRSXODWLRQFRQFHQWUDWLRQDVZHOODVNHHSLQJLWLQLWV
\HDVWIRUPE\SUHYHQWLQJLWVFRQYHUVLRQWRWKHP\FHOLDOIXQJDOIRUPRIWKHRUJDQLVP7KHWUHDWPHQWSURWRFROV
outlined are designed to accomplish just that goal.
)ROORZLQJWKH&DQGLGD$OELFDQV'LHWDU\*XLGHFDQEHXVHGWRUHGXFH\HDVWRYHUJURZWKDQGHQKDQFHLPPXQH
IXQFWLRQIURPDGLHWDU\VWDQGSRLQW
84 Candida Albicans

Suggested Nutritional Supplementation

Candida Relief Program


• Caproyl²0L[DVGLUHFWHGEHORZ
*,$QWL)XQJDO$QWL<HDVW)RUPXOD±&DSU\OLFDFLGIURPFRFRQXWRLODQGROHLFDFLGIURPROLYHRLO
• Psyllium Cleanser ²0L[DVGLUHFWHGEHORZ
)LEHUIRU,QWHVWLQDO&OHDQLQJ±3RZGHUHG3ODQWDJRRYDWD>EORQGSV\OOLXPVHHG@SOXVKXVNV
• Bentonite Magma ²0L[DVGLUHFWHGEHORZ
*DVWURLQWHVWLQDO'HWR[L¿FDWLRQ6XSSRUW±'LVWLOOHGZDWHUDQGEHQWRQLWH SKDUPDFHXWLFDOJUDGHFOD\
• Ultra Flora IB ²0L[DVGLUHFWHGEHORZ
8OWUD)ORUD,%LVDQHQKDQFHGSRWHQF\SURELRWLFIRUPXODGHVLJQHGWRKHOSUHOLHYHERZHOLUULWDWLRQDQGUHODWHG
IXQFWLRQDOGLVFRPIRUWVE\SURPRWLQJDKHDOWK\EDODQFHRILQWHVWLQDOPLFURÀRUD

One dose is mixed as follows:


• R]ZDWHUR]XQVZHHWHQHGMXLFH
• 2 teaspoons Caproyl
• ZHOOURXQGHGWHDVSRRQ3V\OOLXP&OHDQVHU
• 1 Tablespoon Bentonite
• FDSVXOH8OWUD)ORUD,% RSHQFDSVXOHDQGPL[LQ
7ZLFHGDLO\ DZD\IURPIRRG FRPELQHLQDMDUVFUHZRQOLGDQGVKDNHYLJRURXVO\IRUWRVHFRQGV'ULQN
LPPHGLDWHO\'ULQNWRJODVVHVRIOLTXLGGDLO\WRNHHSWKHSV\OOLXPJHOPRYLQJWKURXJKWKHLQWHVWLQDOWUDFW

In conjunction with the above mixture, rotate through the following anti-candida formulas
• CandiBactin-AR® ²2QHVRIWJHOWLPHVGDLO\EHIRUHRUZLWKPHDOVIRUPRQWK
&DQGL%DFWLQ$5LVDEOHQGRIFRQFHQWUDWHGHVVHQWLDORLOVDQGKHUEDOH[WUDFWVIURPWKHDURPDWLFPLQWIDPLO\
LQDIRUPXODGHVLJQHGWRVXSSRUWLQWHVWLQDOPLFURELDOEDODQFHDQGSURSHUGLJHVWLRQ

Then transition to:


• CandiBactin-BR®²7ZRWDEOHWVWRWLPHVGDLO\IRUPRQWK
&DQGL%DFWLQ%5IHDWXUHVVWDQGDUGL]HGH[WUDFWVDQGFUXGHKHUEVLQFOXGLQJEHUEHULQHFRQWDLQLQJSODQWVWKDW
VXSSRUWLPPXQHIXQFWLRQDQGHQFRXUDJHWKHERG\WRSXUJHXQZDQWHGFRPSRXQGV

Then transition to:


• SuperGarlic 6000®²2QHWDEOHWWLPHVGDLO\IRUPRQWK
6XSHU*DUOLF  LV D VXSHUFRQFHQWUDWHG JDUOLF VXSSOHPHQW WKDW LV JXDUDQWHHG WR VXSSO\  PFJ RI
allicin—garlic’s most important active ingredient—per tablet.

Ongoing Maintenance (Indefinitely)


• Ultra Flora Plus® DF Capsules ²2QHFDSVXOHWRWLPHVGDLO\
8OWUD)ORUD3OXV')&DSVXOHVLVDQRQGDLU\SURELRWLFVXSSOHPHQWWKDWSURYLGHVKLJKO\YLDEOHSXUHVWUDLQVRI
/DFWREDFLOOXVDFLGRSKLOXV 1&)0ŠVWUDLQ DQG%L¿GREDFWHULXPODFWLV

Dietary Suggestions
• Candida Albicans Dietary Guide

Oral Thrush (Infant)


• ' &DQGLGD$OELFDQV +RPHRSDWKLF ;  ²  GURSV LQ PRXWK  WLPHV GDLO\ GXULQJ DFXWH
stage.
• UltraFlora Plus DF Powder ²  WVS LQ OXNHZDUP ZDWHU MXLFH RU IRUPXOD WKUHH WLPHV GDLO\
NOTE: Do not microwave.
• Caproyl (Liquid caprylic acid)²5XEWKHDQWL\HDVWIXQJXVOLTXLGRQWKHLQIDQW
VJXPDQGLQIHFWHG
DUHDVWLPHVGDLO\
Candida Albicans 85

Candida Albicans Dietary Guide

Food Permitted Foods Foods Not Permitted


6ZHHWV 8QSDVWHXUL]HGKRQH\XQVXOIXUDWHGEODFNVWUDSPRODVVHV 5H¿QHGVXJDUFDQG\FKRFRODWH
UDZVXJDUVRUJKXPE\WKHPVHOYHVRUXVHGDVVZHHWHQHUV
127(8VHLQPRGHUDWLRQ
Fish $OOZKLWHÀHVK¿VKZDWHUSDFNHGWXQDVDOPRQVKHOO¿VK $OOIULHGRURLOSDFNHG¿VKDQG
%DNHGRUEURLOHG9HU\IUHVK VHDIRRG
Meat /HDQWULPPHGEHHIYHU\IUHVKFDOIOLYHUFKLFNHQODPEDQG Bacon, ham, pork, smoked meat,
WXUNH\127(5HPRYHVNLQRQFKLFNHQDQGWXUNH\ sausage, and pork sausage.
0LON3URGXFWV 2FFDVLRQDO\RJXUW XQVZHHWHQHG RFFDVLRQDOSRZGHUHGPLON <RJXUW VZHHWHQHG ZKROHPLON
FKRFRODWHPLONVZHHWFUHDP
buttermilk, sour cream.
Fruits )UHVKIUXLWVRQO\DSSOHVSHDUVDSULFRWVEDQDQDVFKHUULHV &DQQHGIUXLWRUDQJHVPHORQV
grapes, guava, currants, nectarines, papaya, peaches, GULHGRUFDQGLHGIUXLWV
SOXPVTXLQFHWDQJHULQHVDYRFDGRVULSHSLQHDSSOH127(
)UXLWVVKRXOGEHOLPLWHGWRDPD[LPXPRIWZRSHUGD\
Juices 2QO\IUHVKMXLFHV0D\EHVHOHFWHGIURPOLVWRIYHJHWDEOHV &DQQHGMXLFHVDQGMXLFHVZLWK
SHUPLWWHGLQFOXGLQJWKHIROORZLQJJUHHQOHDYHVFKLFRU\ DUWL¿FLDOFRORULQJRUVZHHWHQLQJ
HQGLYHHVFDUROHOHWWXFH6ZLVVFKDUGDQGZDWHUFUHVV
Beverages 0LQHUDOZDWHUKHUEWHDPLQWWHDSDSD\DWHDIUHVKYHJHWDEOH $OFRKROFRIIHHWHDVRIWGULQNV
juices. containing preservatives.
Breads 5\HZKROHZKHDWVR\DEUDQZKROHJUDLQVWRQHJURXQG :KLWHEUHDGEOHDFKHGÀRXU
EUHDGV127(/LPLWWRDPD[LPXPRIWZRVOLFHVSHUGD\ products.
Cereals %XFNZKHDWFRUQPHDOFUDFNHGZKHDWPLOOHWRDWPHDO 5H¿QHGEOHDFKHGÀRXUDQGVXJDU
sesame, grits. coated cereals.
Cheese, Butter only very occasionally. Margarine, cheese
Butter
Eggs /LPLWWRWZRHJJVSHUGD\3RDFKHGKDUGRUVRIWERLOHG
2LOV &ROGSUHVVHGRLOVSUHIHUDEO\ÀD[VHHGVDIÀRZHUFDQRODRU Shortening, margarine, saturated
soya lecithin spread. RLOVDQGIDWV
Nuts )UHVKUDZQXWVVXFKDVDOPRQGVSHFDQVFDVKHZV%UD]LO Roasted and salted nuts. No
QXWVDQGZDOQXWV SHDQXWVYHU\RFFDVLRQDOO\  SHDQXWVLISDWLHQWKDVGLJHVWLYHRU
colon related problems.
Vegetables 5DZRUOLJKWO\FRRNHGDUWLFKRNHVDVSDUDJXVFDUURWV All canned vegetables.
FDXOLÀRZHUFHOHU\FKLYHVFRUQHJJSODQWHQGLYHVJUHHQ
leeks, green peas, green pepper, leeks, lentils, lima beans,
SRWDWRHVUDGLVKHVVSLQDFKVTXDVKWRPDWRHVZD[EHDQV
\DPV$Q\YHJHWDEOHVOLVWHGXQGHUVDODGV127(:DVKLQJ
YHJHWDEOHVLQD&ORUR[VROXWLRQDQGULQVLQJZHOOZLOO
UHGXFHPLFURELDOJURZWK
3RWDWRHV %DNHGERLOHGRUPDVKHG0D\VXEVWLWXWHEURZQULFHRUFRUQ )UHQFKIULHGFKLSVZKLWHULFH
Salads 7KHIROORZLQJUDZYHJHWDEOHVVKUHGGHGRU¿QHO\FKRSSHG $Q\RWKHU1RZKLWHRUFLGHU
VHSDUDWHGRUPL[HGEURFFROL%UXVVHOVVSURXWVFDUURWV vinegar.
FDXOLÀRZHUFHOHU\FKLFRU\JUHHQSHSSHUOHWWXFHRQLRQV
UDGLVKHV6ZLVVFKDUGWRPDWRHVWXUQLSVDQGZDWHUFUHVV
Seasonings Chives, garlic, onion, parsley, laurel, marjoram, sage, thyme, Spices, pepper, paprika, sodium
VDYRU\FXPLQRUHJDQRVDOWVXEVWLWXWHVVXFKDV&RVDOWRU VDOW1RZKLWHRUFLGHUYLQHJDU
other potassium salt, sea salt, kelp salt, and herbs.
Soups 9HJHWDEOHVRXS%DUOH\EURZQULFHRUPLOOHWFDQEHDGGHG &DQQHGDQGFUHDPHGVRXSIDW
stock, consomme.
86 Candida Albicans

Yeast Questionnaire — Adult Section C — Other Symptoms


(QWHUWKHDSSURSULDWHVFRUHIRUHDFKV\PSWRPEHORZ
,Q 6HFWLRQ $ FLUFOH WKH VFRUH IRU HDFK YES DQVZHU )RU 6HFWLRQV ,IDV\PSWRPLVoccasional or mild Score 1 points
%DQG&VFRUHDVLQGLFDWHG5HFRUGWRWDOVFRUHVDWWKHHQGRIWKHTXHVWLRQQDLUH ,IDV\PSWRPLV frequent or moderately severe Score 2 points
Add the totals to get your GRAND TOTAL SCORE.
,IDV\PSWRPLVsevere or disabling Score 3 points

Section A — History   'URZVLQHVV .............................................................. _________


 +DYH\RXWDNHQWHWUDF\FOLQHV 6XP\FLQ3DQP\FLQ9LEUD
2. Irritability or jitteriness .............................................. _________
P\FLQ0LQRFLQHWF RURWKHUDQWLELRWLFVIRUDFQHIRURQH
month or longer? ..........................................................................35 3. Incoordination .......................................................... _________
 +DYH\RXHYHUWDNHQRWKHU³EURDGVSHFWUXP´DQWLELRWLFV 4. Inability to concentrate............................................. _________
IRUXULQDU\UHVSLUDWRU\RURWKHULQIHFWLRQVIRUWZRPRQWKV
RUORQJHURULQVKRUWHUFRXUVHVIRXURUPRUHWLPHVLQD   )UHTXHQWPRRGVZLQJV ............................................ _________
one year period? ...........................................................................35 6. Headache ................................................................ _________
 +DYH\RXHYHUWDNHQD³EURDGVSHFWUXP´DQWLELRWLFGUXJ" .............6
  'L]]LQHVVORVVRIEDODQFH ........................................ _________
4. Have you ever been bothered by persistent prostatitis,
vaginitis, or other reproductive organ problems?..........................25   3UHVVXUHDERYHHDUVIHHOLQJRIKHDGWLQJOLQJ ......... _________
 +DYH\RXEHHQSUHJQDQWWZRRUPRUHWLPHV" ...............................5 9. Itching ...................................................................... _________
1 time? ............................................................................................3
 2WKHUUDVKHV ............................................................ _________
 +DYH\RXWDNHQELUWKFRQWUROSLOOVIRUPRUHWKDQWZR\HDUV" ........15
 )RUVL[PRQWKVWRWZR\HDUV" .........................................................8 11. Heartburn................................................................. _________
 +DYH\RXWDNHQSUHGQLVRQH'HFDGURQRURWKHUFRUWLVRQH 12. Indigestion ............................................................... _________
W\SHGUXJVIRUPRUHWKDQWZRZHHNV" ...........................................15
13. Belching and intestinal gas ...................................... _________
 )RUWZRZHHNVRUOHVV" ..................................................................6
 'RHVH[SRVXUHWRSHUIXPHVLQVHFWLFLGHVIDEULFVKRS 14. Mucus in stools ........................................................ _________
odors, and other chemicals provoke: 15. Hemorrhoids ........................................................... _________
Moderate to severe symptoms? ...................................................20
Mild symptoms? .............................................................................5 16. Dry mouth ................................................................ _________
 $UHV\PSWRPVZRUVHRQGDPSPXJJ\GD\VRULQPROG\ 17. Rash or blisters in mouth ......................................... _________
places? ........................................................................................20
18. Bad breath ............................................................... _________
 +DYH\RXKDGDWKOHWH¶VIRRWULQJZRUP³MRFNLWFK´RU
RWKHUFKURQLFIXQJRXVLQIHFWLRQVRIWKHVNLQRUQDLOV"  -RLQWVZHOOLQJRUDUWKULWLV .......................................... _________
Severe or persistent......................................................................20
20. Nasal congestion or discharge ................................ _________
Mild to moderate? .........................................................................10
11. Do you crave sugar?.....................................................................10  3RVWQDVDOGULS ......................................................... _________
12. Do you crave breads?...................................................................10 22. Nasal itching ............................................................ _________
13. Do you crave alcoholic beverages? .............................................10 23. Sore or dry throat..................................................... _________
14. Does tobacco smoke really bother you? ......................................10
24. Cough ...................................................................... _________
Section B — Major Symptoms  3DLQRUWLJKWQHVVLQFKHVW ........................................ _________
(QWHUWKHDSSURSULDWHVFRUHIRUHDFKV\PSWRPEHORZ
 :KHH]LQJRUVKRUWQHVVRIEUHDWK............................. _________
,IDV\PSWRPLVoccasional or mild Score 3 points
 8UJHQF\RUXULQDU\IUHTXHQF\ ................................. _________
,IDV\PSWRPLVfrequent or moderately severe Score 6 points
,IDV\PSWRPLVsevere or disabling Score 9 points 28. Burning on urination ................................................ _________
29. Failing vision ............................................................ _________
1. Fatigue or lethargy ..................................................... _________
 %XUQLQJRUWHDULQJRIH\HV ....................................... _________
  )HHOLQJRIEHLQJ³GUDLQHG´ .......................................... _________
  3RRUPHPRU\ .............................................................. _________  5HFXUUHQWLQIHFWLRQVRUÀXLGLQHDUV ......................... _________
  )HHOLQJ³VSDFH\´RU³XQUHDO´ ....................................... _________  (DUSDLQRUGHDIQHVV ............................................... _________
5. Depression ................................................................. _________
6. Numbness, burning, or tingling................................... _________ Scores: Section A ______ Section B ______ Section C ______
7. Muscle aches ............................................................. _________
  0XVFOHZHDNQHVVRUSDUDO\VLV.................................... _________ GRAND TOTAL SCORE ______________
9. Joint pain .................................................................... _________
The GRAND TOTAL SCOREZLOOKHOSGHWHUPLQHLI\RXUKHDOWKSUREOHPVDUH
10. Abdominal pain........................................................... _________
\HDVWFRQQHFWHG6FRUHVLQZRPHQZLOOUXQKLJKHUEHFDXVHPRUHTXHVWLRQV
11. Constipation ............................................................... _________ DSSO\RQO\WRZRPHQWKDQWRPHQ
12. Diarrhea...................................................................... _________
Yeast connected health problems are almost CERTAINLY PRESENT in
13. Bloating ...................................................................... _________
ZRPHQZLWKVFRUHVRYHUDQGLQPHQZLWKVFRUHVRYHU
14. Troublesome vaginal discharge ................................. _________
 3HUVLVWHQWYDJLQDOEXUQLQJRULWFKLQJ .......................... _________ Yeast connected problems are PROBABLY PRESENTLQZRPHQZLWKVFRUHV
 3URVWDWLWLV.................................................................... _________ RYHUDQGLQPHQZLWKVFRUHVRYHU
17. Impotence................................................................... _________ Yeast connected problems are POSSIBLY PRESENTLQZRPHQZLWKVFRUHV
 /RVVRIVH[XDOGHVLUH.................................................. _________ RYHUDQGLQPHQZLWKVFRUHVRYHU
19. Endometriosis............................................................. _________ 6FRUHVOHVVWKDQLQZRPHQDQGLQPHQ\HDVWVDUHOHVVDSWWRFDXVH
20. Cramps and/or other menstrual irregularities ............. _________ health problems.
 3UHPHQVWUXDOWHQVLRQ ................................................. _________
 6SRWVLQIURQWRIH\HV.................................................. _________
23. Erratic vision ............................................................... _________
Candida Albicans 87

Yeast Questionnaire — Children   +DV\RXUFKLOGEHHQODEHOHG³K\SHUDFWLYH´" 6FRUHLIPLOG


&LUFOHWKHDSSURSULDWHSRLQWVFRUHIRUTXHVWLRQV\RXDQVZHU³\HV´7RWDO\RXUVFRUH LIPRGHUDWHRUVHYHUH
DQGUHFRUGLWLQWKHER[DWWKHHQGRIWKHTXHVWLRQQDLUH ....................................................................................... 10 20
12. Is your child bothered by learning problems (even though his
  'XULQJWKHWZR\HDUVEHIRUH\RXUFKLOGZDVERUQZHUH\RX
HDUO\GHYHORSPHQWDOKLVWRU\ZDVQRUPDO"
bothered by recurrent vaginitis, menstrual irregularities, pre
.............................................................................................. 10
PHQVWUXDOWHQVLRQIDWLJXHKHDGDFKHGHSUHVVLRQGLJHVWLYH
GLVRUGHUVRU³IHHOLQJEDGDOORYHU´" 13. Does your child have a short attention span?
.............................................................................................. 30 .............................................................................................. 10

  :DV\RXUFKLOGERWKHUHGE\WKUXVK" 6FRUHLIPLOGLI 14. Is your child persistently irritable, unhappy, and hard to please?
severe or persistent.) .............................................................................................. 10
....................................................................................... 10 20 15. Has your child been bothered by persistent or recurrent diges
  :DV\RXUFKLOGERWKHUHGE\IUHTXHQWGLDSHUUDVKHVLQLQIDQF\" WLYHSUREOHPVLQFOXGLQJFRQVWLSDWLRQGLDUUKHDEORDWLQJH[FHV
6FRUHLIPLOGLIVHYHUHRUSHUVLVWHQW VLYHJDV" 6FRUHLIPLOGLIPRGHUDWHLIVHYHUH
....................................................................................... 10 20 ................................................................................ 10 20 30

  'XULQJLQIDQF\ZDV\RXUFKLOGERWKHUHGE\FROLFDQGLUULWDELO 16. Has your child been bothered by persistent nasal congestion,
LW\ODVWLQJRYHUPRQWKV" 6FRUHLIPLOGLIPRGHUDWHRU FRXJKDQGRUZKHH]LQJ"
severe.) .............................................................................................. 10
....................................................................................... 10 20 17. Is your child unusually tired or unhappy or depressed? (Score
  $UH\RXUFKLOG¶VV\PSWRPVZRUVHRQGDPSGD\VRULQGDPSRU LIPLOGLIVHYHUH
moldy places? ....................................................................................... 10 20
.............................................................................................. 20 18. Has your child been bothered by recurrent headaches, abdom
  +DV\RXUFKLOGEHHQERWKHUHGE\UHFXUUHQWRUSHUVLVWHQW³DWK LQDOSDLQRUPXVFOHDFKHV" 6FRUHLIPLOGLIVHYHUH
OHWH¶VIRRW´RUFKURQLFIXQJRXVLQIHFWLRQVRIKLVVNLQRUQDLOV" ....................................................................................... 10 20
.............................................................................................. 30   'RHV\RXUFKLOGFUDYHVZHHWV"
7. Has your child been bothered by recurrent hives, eczema, or .............................................................................................. 10
other skin problems?   'R\RXIHHOWKDW\RXUFKLOGLVQ¶WZHOO\HWGLDJQRVWLFWHVWVDQG
.............................................................................................. 10 studies haven’t revealed the cause?
8. Has your child received: .............................................................................................. 10
(A)RUPRUHFRXUVHVRIDQWLELRWLFGUXJVGXULQJWKHSDVW\HDU"
2UKDVKHUHFHLYHGFRQWLQXRXV³SURSK\ODFWLF´FRXUVHVRIDQWL
biotic drugs?
GRAND TOTAL SCORE
............................................................................................ 60
(B)RUPRUHFRXUVHVRI³EURDGVSHFWUXP´DQWLELRWLFV LH Yeasts POSSIBLY play a role in causing health problems in children
$PR[LFLOOLQ.HÀH[6HSWUD%DFWULPRU&HFORU GXULQJWKHSDVW ZLWKVFRUHVRIRUPRUH
3 years? Yeasts PROBABLY play a role in causing health problems in children
.............................................................................................. 30 ZLWKVFRUHVRIRUPRUH
  +DV\RXUFKLOGH[SHULHQFHGUHFXUUHQWHDUSUREOHPV" Yeasts ALMOST CERTAINLY play a role in causing health problems
.............................................................................................. 10 LQFKLOGUHQZLWKVFRUHVRIRUPRUH

10. Has your child had tubes inserted in his ears? Copyright 1984, William G. Crook, M.D.

.............................................................................................. 10
88 Cardiovascular Disease

Cardiovascular Disease
+HDUWGLVHDVHDQGVWURNHDUHWKHPRVWFRPPRQFDUGLRYDVFXODUGLVHDVHV7KH\DUHWKH¿UVWDQGWKLUGOHDGLQJ
FDXVHVRIGHDWKIRUERWKPHQDQGZRPHQLQWKH8QLWHG6WDWHVDFFRXQWLQJIRUQHDUO\RIDOODQQXDOGHDWKV
0RUHWKDQ$PHULFDQVGLHRIFDUGLRYDVFXODUGLVHDVHVHDFK\HDUZKLFKLVGHDWKHYHU\VHFRQGV
$OWKRXJKWKHVHODUJHO\SUHYHQWDEOHFRQGLWLRQVDUHPRUHFRPPRQDPRQJSHRSOHDJHGRUROGHUWKHQXPEHURI
VXGGHQGHDWKVIURPKHDUWGLVHDVHDPRQJSHRSOHDJHG±KDVLQFUHDVHG
,QDGGLWLRQPRUHWKDQPLOOLRQ$PHULFDQVFXUUHQWO\OLYHZLWKDFDUGLRYDVFXODUGLVHDVH&RURQDU\KHDUWGLVHDVH
LVDOHDGLQJFDXVHRISUHPDWXUHSHUPDQHQWGLVDELOLW\LQWKH86ZRUNIRUFH6WURNHDORQHDFFRXQWVIRUGLVDELOLW\
DPRQJDERXWPLOOLRQ$PHULFDQV0RUHWKDQPLOOLRQKRVSLWDOL]DWLRQVHDFK\HDUDUHEHFDXVHRIFDUGLRYDVFXODU
diseases.
7KHHFRQRPLFLPSDFWRIFDUGLRYDVFXODUGLVHDVHVRQRXUQDWLRQ¶VKHDOWKFDUHV\VWHPFRQWLQXHVWRJURZDVWKH
SRSXODWLRQDJHV7KHFRVWRIKHDUWGLVHDVHDQGVWURNHLQWKH8QLWHG6WDWHVLVSURMHFWHGWREHELOOLRQLQ
LQFOXGLQJKHDOWKFDUHH[SHQGLWXUHVDQGORVWSURGXFWLYLW\IURPGHDWKDQGGLVDELOLW\ KWWSZZZFGFJRYQFFGSKS
SXEOLFDWLRQVDDJSGIDDJBFYKSGI 

Definitions of Cardiovascular Disease Risk Factors


Total cholesterol
&KROHVWHURO LV D ZD[\ IDW OLNH VXEVWDQFH 7RWDO FKROHVWHURO UHIHUV WR WKH VXP RI WKH GLIIHUHQW VXEIUDFWLRQV RI
FKROHVWHURO WKDW DUH PHDVXUHG LQ WKH EORRG7RWDO FKROHVWHURO LV DQ LQGHSHQGHQW ULVN IDFWRU IRU FDUGLRYDVFXODU
GLVHDVH7KH1DWLRQDO&KROHVWHURO(GXFDWLRQ3URJUDPVD\VLVFRQVLGHUHGKLJK$SHUVRQZLWKWKLVOHYHOKDV
WZLFHWKHULVNRIKHDUWGLVHDVHFRPSDUHGZLWKVRPHRQHZKRVHFKROHVWHUROLVPJG/7RWDOFKROHVWHURO
LVERUGHUOLQHKLJKFKROHVWHURO$Q\FKROHVWHUROOHYHORIPJG/RUPRUHLQFUHDVHV\RXUULVN 0RUHWKDQ
KDOIWKHDGXOWVLQWKH8QLWHG6WDWHVKDYHOHYHOVDERYHPJG/ 

LDL cholesterol
/RZGHQVLW\OLSRSURWHLQ /'/ $VXEIUDFWLRQRIWRWDOFKROHVWHURO /LNHRLODQGYLQHJDUFKROHVWHURODQGEORRGGRQRW
PL[ZHOO6RIRUFKROHVWHUROWRWUDYHOWKURXJKLWLVFRDWHGZLWKDOD\HURISURWHLQWRPDNHLWDOLSRSURWHLQ+HQFH
WKHQDPH/'/FKROHVWHURO /'/LVWKH
EDG
RUDWKURJHQLFFKROHVWHUROIUDFWLRQ0RUHGLUHFWO\FRUUHODWHGZLWKULVN
IRU&9'WKHQWRWDOUHDOO\([FHVV/'/EXLOGVXSLQ\RXUDUWHULHV VLPSOLVWLFDOO\ 7KHKLJKHUWKHOHYHORI/'/WKH
JUHDWHU\RXUULVNIRUKHDUWGLVHDVH*HQHUDOO\DERYHLVFRQVLGHUHGKLJKEXWVRPHKLJKULVNLQGLYLGXDOVVKRXOG
KDYHWKDWHYHQORZHU

HDL cholesterol
+LJKGHQVLW\OLSRSURWHLQDVXEIUDFWLRQRIWRWDOFKROHVWHURO7KH
JRRG
RUQRQDUWKURJHQLFFKROHVWHUROIUDFWLRQ*HQHUDO
WKRXJKWWKDWWKHKLJKHUWKHEHWWHUDVLWDSSHDUVWR
SLFNXS
RUUHPRYHDWKURJHQLF/'/IURPWKHEORRGVWUHDP

Triglycerides
$QRWKHUW\SHRIIDWFDUULHGLQWKHEORRG0RVWRIWKHERG\
VIDWWLVVXHLVLQWKHIRUPRIWULJO\FHULGHVVWRUHGIRUXVH
DVHQHUJ\+LJKWULJO\FHULGHOHYHOVDOVRDUHDVVRFLDWHGZLWKLQFUHDVHG&9'ULVN

Cholesterol/HDL Ratio (tChol/HDL-C)


$UDWLRRIWKHWZRDQGDQLQGHSHQGHQWSUHGLFWRURI&9'*HQHUDOO\WUDFNVZLWK/'/EXWQRWDOZD\V<RXFDQVHH
WKDW\RXFDQKDYHDYHU\KLJK+'/DQGDPRGHVWO\HOHYDWHG&KROHVWHURODQGVWLOOKDYHDJRRGUDWLR:KDWLVD
JRRGUDWLR"0RVWOLWHUDWXUHVXJJHVWVLVDQH[FHOOHQWQXPEHUWRVKRRWIRU

Triglyceride/HDL Ratio (TG/HDL-C)


7KLVRQHLVQRWDVZHOONQRZQEXWLWLVDOVRDQLQGHSHQGHQWSUHGLFWRURI&9'3UREDEO\HYHQPRUHLPSRUWDQW
LW VHHPV WR EH D JRRG SUHGLFWRU RI LQVXOLQ UHVLVWDQFH RU 0HWDEROLF 6\QGURPH DQG KDV EHHQ XVHG E\ VRPH
LPSRUWDQWO\*HUDOG5HDYHQ DVDVXUURJDWHPDUNHUIRULQVXOLQUHVLVWDQFH:KDW
VJRRG"/HVVWKHQZRXOGEH
considered good

Fat Mass
ERG\IDWLVSUHWW\VHOIH[SODQDWRU\2QFHDZRPDQJRHVRYHUDERXWIDWWKHUHLVDGUDPDWLFFRUUHODWLRQ
ZLWKLOOQHVVDQGGLVHDVH:HLJKWVFDOHVFDQ
WGHWHUPLQHWKHOHDQWRIDWUDWLRRIWKDWZHLJKW$QLQGLYLGXDOFDQEH
RYHUZHLJKWDQGQRWRYHUIDW$ERG\EXLOGHUIRUH[DPSOHPD\EHERG\IDW\HWDWWZRKXQGUHGDQG¿IW\
SRXQGVPD\EHFRQVLGHUHGRYHUZHLJKWE\DW\SLFDOKHLJKWZHLJKWFKDUW7KHUHIRUHWKHVHFKDUWVDUHQRWDJRRG
LQGLFDWLRQRIDSHUVRQ
VLGHDOERG\ZHLJKWIRURSWLPDOKHDOWK
Cardiovascular Disease 89

Fat loss/Lean mass Ratio


)URPWKHSUHFHGLQJ\RXFDQVHHWKDWORVLQJPRUHIDWWKHQOHDQLVKLJKO\GHVLUDEOHDQGVRDJUHDWHUFKDQJHLQ
this ratio is a good thing.

High sensitivity C-reactive protein (hs-CRP)


$YHU\VHQVLWLYHPDUNHURIV\VWHPLFLQÀDPPDWLRQLQWKHERG\,W
VDFWXDOO\DQLQÀDPPDWRU\PHGLDWRUSURGXFHG
LQWKHOLYHU7KLVVHQVLWLYHWHVWPHDVXUHV
VXEDFXWH
LQÀDPPDWLRQ7KDWLVVRPHRQHZLWKUKHXPDWRLGDUWKULWLV
ZRXOGKDYHDYHU\KLJKOHYHO7KDW
VQRWVXEDFXWH+RZHYHULIWKLVPDUNHULVXVHGWRPHDVXUHLQÀDPPDWLRQLQ
LQGLYLGXDOVZKRGRQ
WKDYHRYHUWLQÀDPPDWRU\FRQGLWLRQVLWFDQSLFNXSVXEDFXWH
VPROGHULQJ
LI\RXZLOO,WFRXOG
EHDQ\WKLQJVPROGHULQJEXWWKHUHKDVEHHQDORWRIZRUNGRQHLQWKHSDVW\HDUVWKDWVXJJHVWVWKDWPDQ\
SHRSOHZLWKQRRYHUWLQÀDPPDWRU\FRQGLWLRQDQGZKRKDYHHOHYDWHGOHYHOV QRWDVKLJKDV5$PLQG\RX DUHDW
LQFUHDVHGULVNIRU&9'+HQFHWKLVLVDQLQGHSHQGHQWULVNIDFWRUIRU&9'DQGWKHJHQHUDODFFHSWDQFHWKDW&9'
LVLQSDUWDQLQÀDPPDWRU\PHGLDWHGFRQGLWLRQ

Homocysteine
$QRWKHUPHWDEROLWHPHDVXUHGLQWKHEORRG+RPRF\VWHLQHLVDFWXDOO\DE\SURGXFWRIFHUWDLQQRUPDOPHWDEROLFDPLQR
DFLGEUHDNGRZQDQGSURFHVVLQJ+RZHYHULILWLVHOHYDWHGLWVXJJHVWVD
VOXJJLVK
FRQYHUVLRQRUUHFRQYHUVLRQIURP
one amino acid to another. (This conversion is controlled by enzymes and these enzymes are driven in part, by
FHUWDLQYLWDPLQVWKDWDFWDVFRIDFWRUV+HQFH\RXFDQRIWHQGULYHRUTXLFNHQWKLVSURFHVVZLWKIROLFDFLG%%
etc.) The problem here is that homocysteine, akin to LDL cholesterol, appears to be athrogenic, i.e. it damages
WKHYHVVHOZDOO7KXVKLJKOHYHOVDUHLQGHSHQGHQWO\DVVRFLDWHGZLWK&9'$GGLWLRQDOO\KLJKOHYHOVDSSHDUWREH
LQGHSHQGHQWO\DVVRFLDWHGZLWKVWURNHVDQGGHPHQWLDDVZHOODVRWKHUWKLQJV

Hemoglobin A1C (HbA1C)


7KLVLVDPHDVXUHRIORQJWHUPEORRGVXJDUFRQWURO,WLVDFWXDOO\PHDVXULQJFKDQJHVLQWKHKHPRJORELQPROHFXOH
brought about by bouncing against glucose in the blood stream. Essentially glucose in the blood is bumping up
DJDLQVWUHGEORRGFHOOV ZKLFKFRQWDLQKHPRJORELQ 7KHPRUHJOXFRVH
EXPSV
DJDLQVW5%&
VWKHPRUH
SRFNPDUNV

it makes on that molecule. You can measure these marks as HbA1C. So you can see the higher the number, the
KLJKHUJOXFRVHLVRYHUDOOLQWKHEORRG6LQFH5%&
VVWD\DURXQGIRUGD\V\RXFDQJHWDJRRGDVVHVVPHQWRI
ORQJWHUPEORRGVXJDUFRQWURO,WLVJHQHUDOO\XVHGLQGLDEHWLFVKRZHYHULWLVQRZYHU\FOHDUWKDWHYHQPRGHVWO\
HOHYDWHG+E$&ZLWKLQWKHQRUPDOUDQJHLVDFWXDOO\DQLQFUHDVHGULVNIRU&9'

Fasting insulin
Insulin is a hormone secreted by the pancreas in response to glucose levels in the blood. Insulin's main action
LVWRRSHQXSRUXQORFNWKHFHOOXODU
GRRU
WRDOORZJOXFRVHWRJHWLQWRFHOOV*OXFRVHQHHGVLQVXOLQWRJHWLQWRD
FHOO,Q,QVXOLQUHVLVWDQFH 0HWDEROLF6\QGURPH LQVXOLQLVQRWZRUNLQJHI¿FLHQF\DQGVRWKHSDQFUHDVSRXUVRXW
PRUHLQVXOLQ7KLVLVJRRGEHFDXVHWKHQLQPDQ\SHRSOHWKHLUEORRGVXJDUUHPDLQVLQWKHQRUPDOUDQJH+RZHYHU
LWLVDOVREDGDVLQVXOLQKDVYDULRXVRWKHUPHWDEROLFHIIHFWVLWFDXVHVLQFUHDVHGWULJO\FHULGHVGHFUHDVHG+'/
LQFUHDVHGEORRGSUHVVXUHHWF6RKLJKHUOHYHOVRILQVXOLQDUHDVVRFLDWHGZLWK0HWDEROLF6\QGURPHDQG&9'

Blood Pressure
3UHVVXUHH[HUWHGE\WKHEORRGXSRQWKHZDOOVRIWKHEORRGYHVVHOVPHDVXUHGE\PHDQVRIDVSK\JPRPDQRPHWHU
%3FXII DQGH[SUHVVHGLQPLOOLPHWHUVRIPHUFXU\7KHQXPHUDWRULVWKHPD[LPXPSUHVVXUHWKDWIROORZVV\VWROH
SXPSLQJ RIWKHOHIWYHQWULFOHRIWKHKHDUWDQGWKHGHQRPLQDWRUWKHPLQLPXPSUHVVXUH WKDWDFFRPSDQLHVFDUGLDF
GLDVWROH  $GXOW EORRGSUHVVXUHLVFRQVLGHUHGQRUPDODWZKHUHWKH¿UVWQXPEHULVWKHV\VWROLFSUHVVXUHDQG
WKHVHFRQGLVWKHGLDVWROLFSUHVVXUH+\SHUWHQVLRQ WKHUHDUHGLIIHUHQWVWDJHV VWDUWVDWJUHDWHUWKHQ

Fasting glucose
7KHOHYHORIJOXFRVHRU
EORRGVXJDU
)DVWLQJDQ\WKLQJEHORZPJGOLVFRQVLGHUHGQRUPDOLVFRQVLGHUHG

LPSDLUHGJOXFRVHWROHUDQFH
 ,*7 DQGRUJUHDWHULVFRQVLGHUHGGLDEHWLF,*7MXVWPHDQVDVZLWKPDQ\WKLQJV
there is a continuum, and this is in the danger zone. Some people consider this 'prediabetic.'
90 Cardiovascular Disease

Therapeutic Lifestyle Changes (TLC)


7KHUDSHXWLF/LIHVW\OH&KDQJHV 7/& DUHUHFRPPHQGHGDVD¿UVWOLQHWUHDWPHQWIRUDYDULHW\RIFRPPRQKHDOWK
problems by many national health organizations, including:
• 1DWLRQDO,QVWLWXWHVRI+HDOWK 1,+
• 1DWLRQDO&KROHVWHURO(GXFDWLRQ3URJUDP $73,,,*XLGHOLQHV
• American Diabetes Association
• North American Menopause Society
• American Heart Association
• $PHULFDQ$VVRFLDWLRQRI&OLQLFDO(QGRFULQRORJLVWV
• And many others

Lifestyle-related, chronic health problems:


 ‡(OHYDWHG&KROHVWHURO ‡(OHYDWHG%ORRG3UHVVXUH
 ‡&DUGLRYDVFXODU'LVHDVH ‡2YHUZHLJKW2EHVLW\
• Type 2 Diabetes • Insulin Resistance or Metabolic Syndrome
 ‡2VWHRSRURVLV ‡2VWHRDUWKULWLV
• Conditions related to aging
FirstLine Therapy® )/7 LVDWKHUDSHXWLFOLIHVW\OHFKDQJHV 7/& SURJUDPWKDWLVFOLQLFDOO\HIIHFWLYH\HWHDV\WR
LPSOHPHQW)/7SURYLGHVWLPHVDYLQJWRROVWKDWPDNHLWHDV\IRU\RXWRLQWHJUDWHUHFRPPHQGDWLRQVIRUGLHWDQG
H[HUFLVHZLWKPHGLFDOIRRGVDQGRWKHUOLIHVW\OHFKDQJHVLQDIRUPDWWKDWSDWLHQWVFDQXQGHUVWDQGDQGIROORZ
0RVWLPSRUWDQWO\SDWLHQWVJHWUHVXOWVZLWKWKH)/7SURJUDP0DQ\DUHDEOHWRDFKLHYHWKHLUULVNUHGXFWLRQJRDOV
ZLWKRXWPHGLFDWLRQLQDVOLWWOHDVZHHNVRQ)/7

Moderate Risk Reduction


• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• Cardioauxin™ ²WDEOHWVWZLFHGDLO\
&DUGLRDX[LQTMLVDYHU\HI¿FDFLRXVOLSLGORZHULQJKHDUWULVNUHGXFWLRQIRUPXOD7KLVIRUPXODFRQWDLQV
DXQLTXHFRPELQDWLRQRIV\QHUJLVWLFQXWULHQWVWKDWSURYHGWRVLJQL¿FDQWO\ORZHUORZGHQVLW\OLSRSURWHLQ
FKROHVWHURO /'/& DQGWULJO\FHULGHV 7* ZKLOHUDLVLQJSURWHFWLYHKLJKGHQVLW\OLSRSURWHLQFKROHVWHURO
+'/& 

Therapeutic Lifestyle Change


• /RZ*O\FHPLF,QGH[GLHW VHHFirstLine Therapy® Diet)
• ([HUFLVHPLQZNRIDHURELFH[HUFLVH HJZDONLQJPLQGD\DWGD\VZN 

Severe Risk Reduction


• FirstLine Therapy® Program
)/7XVHVDORZJO\FHPLFLQGH[GLHWDU\UHJLPHQDQGH[HUFLVHSURJUDPZKLOHLQFRUSRUDWLQJPHGLFDOIRRGV
DQGQXWULWLRQDOVXSSOHPHQWV1HZUHVHDUFKKDVVKRZQWKDWORZJO\FHPLFGLHWVDUHPRUHHIIHFWLYHWKDQ
ORZ IDW GLHWV LQ WUHDWLQJ REHVLW\ LQVXOLQ UHVLVWDQFH G\VOLSLGHPLD FDUGLRYDVFXODU GLVHDVH DQG W\SH
diabetes.
• UltraMeal® Plus 360 ²VFRRSVWZLFHGDLO\
8OWUD0HDO3OXVLVDPHGLFDOIRRGIRUPXODWHGWRSURYLGHVSHFLDOL]HGPXOWLPHFKDQLVWLF
QXWULWLRQDOVXSSRUWIRUSDWLHQWVZLWKPHWDEROLFV\QGURPHDQGFDUGLRYDVFXODUGLVHDVHE\VXSSO\LQJD
FRPELQDWLRQRIDFDFLDH[WUDFWUHGXFHGLVRDOSKDDFLGV 5,$$ SODQWVWHUROVDQGKHDUWKHDOWK\VR\
SURWHLQDQGLVRÀDYRQHV
• EPA-DHA Extra Strength® — WRVRIWJHOVWZLFHGDLO\
&RQFHQWUDWHGDQG6WDELOL]HG3XULW\&HUWL¿HG2PHJD)DWW\$FLGV
• Cardioauxin™ ²WDEOHWVWZLFHGDLO\
&DUGLRDX[LQLVDYHU\HI¿FDFLRXVOLSLGORZHULQJKHDUWULVNUHGXFWLRQIRUPXOD
• Red Yeast Extract Extra Strength — 1 capsule three times daily
7DNHQRUDOO\UHG\HDVWH[WUDFWLVXVHGWRUHGXFHDQGPDLQWDLQGHVLUDEOHFKROHVWHURODQGOLSRSURWHLQOHYHOV
in hyperlipidemic individuals.
Cardiovascular Disease 91

Clinical Note
,I\RXUSDWLHQWVDUHRQFKROHVWHUROORZHULQJGUXJV HJVWDWLQV FRQVLGHUDGGLQJ
CoQ-10 ST-100™ ²VRIWJHOVGDLO\
&R467IHDWXUHVPJRIDVWDELOL]HGDOOQDWXUDOHQFDSVXODWLRQRIFRHQ]\PH4 &R4 PDQXIDFWXUHGWR
DFKLHYHH[TXLVLWHTXDOLW\SXULW\DQGELRDYDLODELOLW\
7KHGHSOHWLRQRIWKHHVVHQWLDOQXWULHQW&R4E\WKHLQFUHDVLQJO\SRSXODUFKROHVWHUROORZHULQJGUXJV+0*&R$
UHGXFWDVHLQKLELWRUV VWDWLQV KDVJURZQIURPDOHYHORIFRQFHUQWRRQHRIDODUP:LWKHYHUKLJKHUVWDWLQSRWHQFLHV
DQGGRVDJHVDQGZLWKDVWHDGLO\VKULQNLQJWDUJHW/'/FKROHVWHUROWKHSUHYDOHQFHDQGVHYHULW\RI&R4GH¿FLHQF\
LVLQFUHDVLQJQRWLFHDEO\$QHVWLPDWHGPLOOLRQ$PHULFDQVDUHQRZFDQGLGDWHVIRUVWDWLQGUXJWKHUDS\6WDWLQ
LQGXFHG&R4GHSOHWLRQLVZHOOGRFXPHQWHGLQDQLPDODQGKXPDQVWXGLHVZLWKGHWULPHQWDOFDUGLDFFRQVHTXHQFHV
LQERWKDQLPDOPRGHOVDQGKXPDQWULDOV7KLVGUXJLQGXFHGQXWULHQWGH¿FLHQF\LVGRVHUHODWHGDQGPRUHQRWDEOH
LQVHWWLQJVRISUHH[LVWLQJ&R4GH¿FLHQF\VXFKDVLQWKHHOGHUO\DQGLQKHDUWIDLOXUH1
3XEOLVKHG GDWD DOUHDG\ LQGLFDWHG WKDW VWDWLQV FDQ FDXVH P\RSDWKLHV DQG UKDEGRP\RO\VLV ZLWK UHQDO IDLOXUH
0RUHRYHURQ0D\WKH)'$LVVXHGDZDUQLQJDERXWOLYHUIDLOXUHDVDQDGYHUVHUHDFWLRQRIVWDWLQXVH
EDVHGRQUHSRUWVWKDWPRUHWKDQKDOIRISDWLHQWVZLWKOLYHUIDLOXUHGLHG$QHVWLPDWHFODLPVWKDWWKHGUXJVFDQ
FDXVHOLYHUDQGPXVFOHLQMXU\LQXSWRRIXVHUV)RUWKH86WKLVZLOOHTXDOXSWRSDWLHQWVZLWKOLYHU
DQGPXVFOHWR[LFLW\V\PSWRPV0RUHRYHUVWDWLQVXVHLVDOVRLPSOLFDWHGWKHLQFUHDVHGLQFLGHQFHRIFDWDUDFWV
neoplasia, peripheral neuropathies, and some psychiatric disturbances.2
6WDWLQLQGXFHG&R4GH¿FLHQF\LVFRPSOHWHO\SUHYHQWDEOHZLWKVXSSOHPHQWDO&R4ZLWKQRDGYHUVHLPSDFW
RQWKHFKROHVWHUROORZHULQJRUDQWLLQÀDPPDWRU\SURSHUWLHVRIWKHVWDWLQGUXJV1

References:
1. /DQJVMRHQ3+/DQJVMRHQ$07KHFOLQLFDOXVHRI+0*&R$UHGXFWDVHLQKLELWRUVDQGWKHDVVRFLDWHGGHSOHWLRQRIFRHQ]\PH4$UHYLHZ
RIDQLPDODQGKXPDQSXEOLFDWLRQV%LRIDFWRUV
2. %OL]QDNRY ( /LSLG ORZHULQJ GUXJV VWDWLQV  FKROHVWHURO DQG FRHQ]\PH 4 WKH %D\FRO FDVH ± D PRGHUQ SDQGRUD¶V ER[ %LRPHG
3KDUPDFRWKHU
92 Cardiovascular Disease

Angina Pectoris
AFXWHSDLQLQWKHFKHVWUHVXOWLQJIURPGHFUHDVHGEORRGVXSSO\WRWKHKHDUWPXVFOH P\RFDUGLDOLVFKHPLD $
V\QGURPH GXH WR P\RFDUGLDO R[\JHQ GH¿FLW FKDUDFWHUL]HG E\ SURORQJHG VXEVWHUQDO WKRUDFLF SDLQ ZKLFK LV
SUHFLSLWDWHGFKLHÀ\E\HPRWLRQH[HUFLVHRUWKHLQJHVWLRQRIDKHDY\PHDO,WLVFDXVHGE\DWHPSRUDU\LQDELOLW\
RIWKHFRURQDU\DUWHULHVWRVXSSO\VXI¿FLHQWEORRGWRWKHKHDUWPXVFOH

Nutrients Involved
'0*FRHQ]\PH4YLWDPLQ(OFDUQLWLQHWDXULQHPDJQHVLXPSRWDVVLXPVHOHQLXPFKURPLXPDQGFDOFLXP

Suggested Nutritional Supplementation


• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• CoQ10 ST-100²FDSVXOHWLPHVGDLO\ZLWKPHDOV
6WDELOL]HGKLJKO\DEVRUEDEOHFRHQ]\PH4ZLWKQDWXUDOYLWDPLQ(DQGEHWDFDURWHQH
• E-Complex 1:1²VRIWJHOVGDLO\ZLWKPHDOV
(&RPSOH[LVDXQLTXHQDWXUDOYLWDPLQ(VXSSOHPHQWWKDWIHDWXUHVDUDWLRRIDOSKDWRJDPPD
WRFRSKHUROWKLVUDWLRPRUHFORVHO\UHVHPEOHVWKHWRFRSKHUROSUR¿OHIRXQGQDWXUDOO\LQYLWDPLQ(ULFKSODQWV
$FFRUGLQJWR$ODQ5*DE\0'YLWDPLQ(VKRXOGEHLQFOXGHGLQWKHQXWULWLRQDOWUHDWPHQWRIDQJLQDUHODWLYH
WRLWVFDSDFLW\WRLPSURYHEORRGÀRZDQGWRSUHYHQWWKHSURGXFWLRQRIWLVVXHGDPDJLQJIUHHUDGLFDOV
• Cardiogenics Intensive Care — 3 tablets daily
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ
• DMG Sublingual²WDEOHWVWZLFHGDLO\
)RUHQKDQFHGR[\JHQXWLOL]DWLRQ
5HVHDUFKKDVVKRZQ'0*WREHDSK\VLRORJLFDOO\DFWLYHQXWULHQWWKDW  ,VDQDQWLVWUHVVDJHQWWKDWFDQ
VLJQL¿FDQWO\LPSURYHSK\VLFDODQGPHQWDOSHUIRUPDQFH  &DQLPSURYHDQGVWLPXODWHR[\JHQXWLOL]DWLRQ
DQGWKHUHE\UHGXFHK\SR[LF ORZR[\JHQ VWDWHVLQWKHERG\WLVVXHV  &DQFDXVHPDUNHGLPSURYHPHQWLQ
SDWLHQWVZLWKFLUFXODWRU\LQVXI¿FLHQF\DQGDQJLQDSHFWRULV  &DQUHGXFHHOHYDWHGFKROHVWHUROWULJO\FHULGHV
DQGLPSURYHFLUFXODWLRQ  DQGFDQORZHUKLJKEORRGSUHVVXUH
• L-Carnitine w/Chromium²WDEOHWVGDLO\EHWZHHQPHDOVZLWKMXLFH
6WXGLHVXVLQJ/FDUQLWLQHLQDQJLQDKDYHGHPRQVWUDWHGDQDELOLW\WRH[HUFLVHVLJQL¿FDQWO\ORQJHUEHIRUH
developing angina or electrocardiogram abnormalities.

Dietary Suggestions
• FirstLine Therapy® Diet
Cardiovascular Disease 93

Atherosclerosis
$WKHURVFOHURVLVLVDVORZFRPSOH[GLVHDVHLQZKLFKIDWW\VXEVWDQFHVFKROHVWHUROFHOOXODUZDVWHSURGXFWVFDOFLXP
DQGRWKHUVXEVWDQFHVEXLOGXSLQWKHLQQHUOLQLQJRIDQDUWHU\7KLVEXLOGXSLVFDOOHGSODTXH$WKHURVFOHURVLVLV
GHULYHGIURPWKH*UHHNZRUGVDWKHUR PHDQLQJJUXHORUSDVWH DQGVFOHURVLV PHDQLQJKDUGQHVV 7KHHIIHFWVRI
DWKHURVFOHURVLVGLIIHUGHSHQGLQJXSRQZKLFKDUWHULHVLQWKHERG\QDUURZDQGEHFRPHFORJJHGZLWKSODTXH)RU
H[DPSOHSODTXHEXLOGXSLQWKHYHVVHOVWKDWVXSSO\WKHKHDUWZLWKR[\JHQULFKEORRGPD\FDXVHFKHVWSDLQDQG
OHDGWRDKHDUWDWWDFNZKLOHSODTXHEXLOGXSLQWKHDUWHULHVWKDWVXSSO\EORRGWRWKHEUDLQPD\UHVXOWLQDVWURNH
$FFRUGLQJ WR WKH &HQWHUV IRU 'LVHDVH &RQWURO KHDUW GLVHDVH LV WKH OHDGLQJ FDXVH RI LOOQHVV DQG GHDWK LQ WKH
8QLWHG6WDWHVDQGPRVWRWKHU:HVWHUQFRXQWULHV&ORVHWRRQHPLOOLRQGHDWKVSHU\HDULQWKH8QLWHG6WDWHVDORQH
DUHDWWULEXWDEOHWRKHDUWGLVHDVHGRXEOHWKHQXPEHURIGHDWKVIURPFDQFHU%HFDXVHDWKHURVFOHURVLVLVKLJKO\
SUHYHQWDEOHDQGWKHULVNIDFWRUVDUHZHOOGRFXPHQWHGSUHYHQWLYHPHDVXUHVVXFKDVORZHULQJEORRGSUHVVXUH
DQG/'/ ³EDG´ FKROHVWHUROOHYHOVVPRNLQJFHVVDWLRQORVLQJZHLJKWDQGLQFUHDVLQJSK\VLFDODFWLYLW\VKRXOGEH
IROORZHG

Signs and Symptoms


$WKHURVFOHURVLVVKRZVQRV\PSWRPVXQWLODVLJQL¿FDQWSHUFHQWDJH  RIDYHVVHOEHFRPHVREVWUXFWHGZLWK
SODTXHDQGDFRPSOLFDWLRQRFFXUV6\PSWRPVYDU\GHSHQGLQJXSRQZKLFKDUWHULHVLQWKHERG\QDUURZDQGEHFRPH
FORJJHGZLWKSODTXH

Coronary Artery Disease (CAD)


&$'LVFDXVHGE\SODTXHEXLOGXSLQWKHYHVVHOVWKDWVXSSO\WKHKHDUWZLWKR[\JHQULFKEORRG:KHQWKHWLVVXHV
RIWKHKHDUWEHJLQWREHFRPHGHSULYHGRIR[\JHQ LVFKHPLD FKHVWSDLQ DQJLQD RFFXUV,IWKHDUWHU\EHFRPHV
FRPSOHWHO\EORFNHGFHOOVLQWKHKHDUWEHJLQWRGLHDQGDKHDUWDWWDFNPD\RFFXU6\PSWRPVRI&$'DUHXVXDOO\
WULJJHUHGE\SK\VLFDOH[HUFLVHVH[XDODFWLYLW\H[SRVXUHWRFROGZHDWKHUDQJHURUVWUHVV7KHPRVWFRPPRQ
V\PSWRPVRI&$'LQFOXGH
• &KHVWSDLQ JHQHUDOO\DKHDY\VTXHH]LQJRUFUXVKLQJVHQVDWLRQZLWKSRVVLEOHEXUQLQJRUVWDEELQJSDLQV 
• $EGRPLQDOQHFNEDFNMDZRUVKRXOGHUDUPSDLQ
• Nausea and vomiting
• 8QH[SODLQDEOHIDWLJXHDQGRUH[WUHPHIDWLJXHDIWHUSK\VLFDODFWLYLW\
• :HDNQHVV
• 3HUVSLUDWLRQ
• 6KRUWQHVVRIEUHDWK
• 'HSUHVVLRQDQGRUDQ[LHW\

Cerebrovascular Disease (Stroke)


&HUHEURYDVFXODUGLVHDVHLVFDXVHGE\SODTXHEXLOGXSLQWKHDUWHULHVWKDWVXSSO\WKHEUDLQZLWKR[\JHQULFKEORRG
&HUHEURYDVFXODUGLVHDVHFDXVHVWUDQVLHQWLVFKHPLFDWWDFN DVXGGHQORVVRIEUDLQIXQFWLRQZLWKFRPSOHWHUHFRYHU\
ZLWKLQKRXUV DQGVWURNH6\PSWRPVPD\LQFOXGH
• :HDNQHVVRUSDUDO\VLVRQRQHVLGHRIWKHERG\
• *DUEOHGVSHHFKDQGRULQDELOLW\WRFRPSUHKHQGVSHHFK
• /RVVRIYLVLRQLQRQHH\H
• 3DUDO\VLVRIIDFLDOPXVFOHV
• 0XVFOHZHDNQHVV
• Impaired senses
• Stupor
• 3RRUFRRUGLQDWLRQ
• ,QYROXQWDU\MHUN\PRYHPHQWVRQRQHVLGHRIWKHERG\
• Rapid, repetitious, involuntary eye movement
• Vertigo

Peripheral Artery Disease


3HULSKHUDODUWHU\GLVHDVHLVFDXVHGE\SODTXHEXLOGXSLQWKHDUWHULHVWKDWVXSSO\WKHH[WUHPLWLHVRIWKHERG\ VXFK
DVWKHKDQGVDQGIHHW ZLWKR[\JHQULFKEORRG6\PSWRPVPD\LQFOXGH
• 3DLQDFKLQJFUDPSVQXPEQHVVRUVHQVHRIIDWLJXHLQWKHPXVFOHVRIWKHORZHUH[WUHPLWLHV
• 'LPLQLVKHGSXOVHVLQWKHH[WUHPLWLHV
94 Cardiovascular Disease

• Decreased muscle mass


• %UXLWV EORZLQJ VRXQGV WKDW WKH SK\VLFLDQ KHDUV ZLWK D VWHWKRVFRSH WKDW LQGLFDWHV WXUEXOHQFH LQ EORRG
ÀRZ 
• Hair loss
• Thickened nails
• 6PRRWKVKLQ\VNLQVXUIDFH
• Skin that is cold to the touch
• *DQJUHQH
• Causes
0DQ\UHVHDUFKHUVEHOLHYHWKDWDWKHURVFOHURVLVLVFDXVHGE\GDPDJHWRWKHLQQHUPRVWOD\HURIWKHDUWHU\NQRZQDV
WKHHQGRWKHOLXP+LJKEORRGSUHVVXUHHOHYDWHG/'/ EDG FKROHVWHURODQDEQRUPDODFFXPXODWLRQRIKRPRF\VWHLQH
DQDPLQRDFLGSURGXFHGE\WKHKXPDQERG\ WREDFFRVPRNHGLDEHWHVKRUPRQDOFKDQJHVIROORZLQJPHQRSDXVH
DQGLQIHFWLRQDUHDOOWKRXJKWWRFRQWULEXWHWRHQGRWKHOLDOGDPDJH2QFHWKHHQGRWKHOLXPLVGDPDJHGLWEHFRPHV
HDVLHUIRUIDWVFKROHVWHUROFHOOXODUZDVWHSURGXFWVFDOFLXPDQGRWKHUVXEVWDQFHVWREHFRPHGHSRVLWHGLQWKH
DUWHU\ZDOO7KLVEXLOGXSWKLFNHQVWKHHQGRWKHOLXPVLJQL¿FDQWO\$VDUHVXOWWKHGLDPHWHURIWKHDUWHU\VKULQNV
EORRGÀRZGHFUHDVHVDQGR[\JHQVXSSO\LVGUDPDWLFDOO\UHGXFHG%ORRGFORWVPD\DOVRIRUPRQWRSRIWKHSODTXH
RUGDPDJHGHQGRWKHOLXPWKHUHE\EORFNLQJWKHDUWHU\DQGFRPSOHWHO\FXWWLQJRIIEORRGVXSSO\
%HFDXVHPDQ\SHRSOHGRQRWKDYHWKHFODVVLFULVNIDFWRUVRIDWKHURVFOHURVLV VXFKDVFLJDUHWWHVPRNLQJDQGKLJK
EORRGSUHVVXUH LWLVSRVVLEOHWKDWWKHUHPD\EHRWKHUFRQWULEXWLQJIDFWRUVRUFDXVHVRIDWKHURVFOHURVLVVXFKDV
LQÀDPPDWLRQIURPDQLQIHFWLRQRUDXWRLPPXQHGLVHDVH

Risk Factors
• Male gender
• /RZHUHGOHYHOVRIWKHKRUPRQHHVWURJHQIROORZLQJPHQRSDXVH
• 2OGHUDJH
• High blood pressure
• +LJK/'/ EDG FKROHVWHURODQGRUKLJKWULJO\FHULGHV
• Elevated homocysteine levels
• /RZ+'/ JRRG FKROHVWHURO
• )DPLO\KLVWRU\RIDWKHURVFOHURVLV ZKLFKPD\EHUHODWHGWROHDUQHGEHKDYLRUUDWKHUWKDQJHQHWLFIDFWRUV 
• &LJDUHWWHVPRNLQJDQGUHJXODUH[SRVXUHWRVHFRQGKDQGVPRNH
• Diabetes mellitus
• Insulin resistance
• 2EHVLW\SDUWLFXODUO\LQWKHDEGRPLQDOUHJLRQ
• 6HGHQWDU\OLIHVW\OH
• 'LHWVKLJKLQVDWXUDWHGIDWDQGWUDQVIDWW\DFLGV
• Stress
• Depression

Diagnosis
$KHDOWKFDUHSUDFWLWLRQHUFDQGHWHUPLQH\RXUULVNIRUKHDUWGLVHDVHE\FRQGXFWLQJDYDULHW\RIWHVWV%ORRGWHVWV
GHWHFWHOHYDWHGOHYHOVRIFKROHVWHUROKRPRF\VWHLQHDQGEORRGFORWWLQJIDFWRUV$VWUHVVWHVW RWKHUZLVHNQRZQDV
DQH[HUFLVHWROHUDQFHWHVW PRQLWRUVKHDUWUDWHDQGEORRGSUHVVXUHZKLOHDQLQGLYLGXDOZDONVRQDWUHDGPLOORUULGHV
DVWDWLRQDU\ELF\FOH$QHOHFWURFDUGLRJUDP (&* LVXVHGGXULQJDVWUHVVWHVWWRPHDVXUHDQGUHFRUGWKHHOHFWULFDO
DFWLYLW\RIWKHKHDUW(&*VFDQGHWHFWDEQRUPDOKHDUWUK\WKPVVFDUIRUPDWLRQLQWKHKHDUWPXVFOHIURPDSULRU
KHDUWDWWDFNDQGDUHDVRIGHFUHDVHGEORRGÀRZZKHQWKHKHDUWLVVWUDLQHG DVZLWKSK\VLFDODFWLYLW\ $GYDQFHG
LPDJLQJWHFKQLTXHVXVHGGXULQJDVWUHVVWHVW VXFKDVDQXOWUDVRXQG FDQGHWHUPLQHSUHFLVHDUHDVRIGHFUHDVHG
EORRGÀRZWRWKHKHDUW$QJLRJUDPV RUDQJLRJUDSK\ FDQUHYHDODUWHULDOGDPDJHDQGSODTXHEXLOGXS

Preventive Care
0DNLQJ FDUHIXO OLIHVW\OH FKRLFHV LV DQ LPSRUWDQW ¿UVW VWHS LQ SUHYHQWLQJ DWKHURVFOHURVLV 6RPH KHDOWK\ KDELWV
include:
• $FKLHYLQJDQGPDLQWDLQLQJQRUPDOZHLJKW
• Controlling high blood pressure, high cholesterol, diabetes, and other disorders that may contribute to the
EXLOGXSRISODTXHLQDUWHULHV
• $YRLGLQJFLJDUHWWHVPRNLQJDQGVHFRQGKDQGVPRNH
Cardiovascular Disease 95

• (DWLQJDGLHWORZLQVDWXUDWHGDQGK\GURJHQDWHGIDWVDQGFKROHVWHURODQGKLJKLQVWDUFKHV¿EHUIUXLWVDQG
vegetables
• ([HUFLVLQJKRXUVSHUZHHNRUPRUH VXFKDVPLQXWHVSHUGD\GD\VSHUZHHN 
• Reducing stress

Treatment Approach
$WKHURVFOHURVLV VKRZV QR V\PSWRPV XQWLO D FRPSOLFDWLRQ VXFK DV FKHVW SDLQ RU D KHDUW DWWDFN  RFFXUV )RU
WKLVUHDVRQOLIHVW\OHFKRLFHVVXFKDVDFKLHYLQJDQGPDLQWDLQLQJDQRUPDOZHLJKWORZHULQJEORRGSUHVVXUHDQG
FKROHVWHUROH[HUFLVLQJUHJXODUO\TXLWWLQJVPRNLQJ DQGUHGXFLQJVWUHVVDUHDOOLPSRUWDQWVWHSVLQSUHYHQWLQJ
DWKHURVFOHURVLV2QFHDFRPSOLFDWLRQRFFXUVKRZHYHUVXUJHU\DQGRWKHU3URFHGXUHVPD\EHUHTXLUHGWRUHPRYH
SODTXH IURP FORJJHG DUWHULHV RU WR FUHDWH D GHWRXU DURXQG D EORFNHG DUWHU\ +HDOWK\ GLHWV GHVLJQHG WR ORZHU
FKROHVWHUROEORRGSUHVVXUHDQGH[FHVVERG\ZHLJKWDUHHVVHQWLDOLQWKHWUHDWPHQWRIDWKHURVFOHURVLV1XWULWLRQ
DQGGLHWDU\VXSSOHPHQWVVXFKDVYLWDPLQ(RPHJDIDWW\DFLGVDQGIRODWH YLWDPLQ% PD\EHHIIHFWLYHZKHQ
XVHGLQDGGLWLRQWRFHUWDLQPHGLFDWLRQV+HUEVVXFKDVKDZWKRUQKDYHDOVRVKRZQSURPLVHLQORZHULQJFKROHVWHURO
OHYHOVDQGUHGXFLQJWKHULVNRIKHDUWGLVHDVH
6WRS6PRNLQJ²&LJDUHWWHVPRNLQJDFXWHO\LQFUHDVHVWKHKHDUWUDWHDQGDUWHULDOEORRGSUHVVXUHDQGPD\WKHUHIRUH
DIIHFWWKHSDWWHUQRIDUWHULDOEORRGÀRZ8VLQJDQRQLQYDVLYHXOWUDVRXQGWHFKQLTXHFLJDUHWWHVPRNLQJZDVVKRZQ
WRLQFUHDVHDUWHULDOZDOOVWLIIQHVVDQGWRDOWHUWKHSDWWHUQRIDUWHULDOEORRGÀRZ7KHVHHIIHFWVPD\KHOSWRH[SODLQ
ZK\VPRNLQJDQGVRPHRWKHUIDFWRUVIDYRUWKHGHYHORSPHQWRIDWKHURVFOHURVLV

Nutrition and Dietary Supplements


+HDOWK\HDWLQJKDELWVFDQKHOSUHGXFHKLJKEORRGFKROHVWHUROKLJKEORRGSUHVVXUHDQGH[FHVVERG\ZHLJKW
WKUHHRIWKHPDMRUULVNIDFWRUVIRUKHDUWGLVHDVH7KH$PHULFDQ+HDUW$VVRFLDWLRQ $+$ KDVGHYHORSHGGLHWDU\
JXLGHOLQHVWKDWKHOSORZHUIDWDQGFKROHVWHUROLQWDNHDQGUHGXFHWKHULVNRIKHDUWGLVHDVH7KHPDLQJRDORIWKHVH
JXLGHOLQHVLVWRSURPRWHDQRYHUDOOKHDOWK\HDWLQJSDWWHUQPDLQWDLQDQDSSURSULDWHERG\ZHLJKWDQGUHDFKGHVLUDEOH
FKROHVWHURODQGEORRGSUHVVXUHOHYHOV7KH$+$GRHVQRWUHFRPPHQGYHU\ORZIDWGLHWVDVWKHVHGLHWVPD\OHDG
WRGHSULYDWLRQRIHVVHQWLDOIDWW\DFLGVDVZHOODVDQXQGHVLUHGUHGXFWLRQLQ+'/ ³JRRG´ FKROHVWHUROOHYHOV7KH
$+$DOVRDGYLVHVDJDLQVWKLJKSURWHLQGLHWVGXHWRWKHODFNRIVFLHQWL¿FHYLGHQFHVXSSRUWLQJWKHLUZHLJKWORVV
HIIHFWLYHQHVVRUDQ\RWKHUFODLPVRIKHDOWKEHQH¿WV,QJHQHUDO:HVWHUQGLHWVDUHFRQVLGHUHGWREHWRRKLJKLQ
SURWHLQSDUWLFXODUO\DQLPDOSURWHLQ ZKLFKLVKLJKLQIDWDQGFKROHVWHURO ,QDGXOWVKLJKOHYHOVRISURWHLQFDQFDXVH
kidney damage and bone loss.
The AHA recommends the following to prevent the development or progression of atherosclerosis:
• $YDULHW\RIIUXLWVDQGYHJHWDEOHV WRVHUYLQJVGD\
• $YDULHW\RIJUDLQSURGXFWVZLWKDQHPSKDVLVRQZKROHJUDLQV RUPRUHVHUYLQJVGD\
• $WOHDVWVHUYLQJVRI¿VKSHUZHHN
• /LPLWWRWDOIDWLQWDNHWRDQGVDWXUDWHGIDWWRRIHQHUJ\5HSODFHGLHWDU\VDWXUDWHGIDWVDQGWUDQV
IDWW\ DFLGV ZLWK PRQRXQVDWXUDWHG DQG SRO\XQVDWXUDWHG IDWV LQFOXGLQJ IRRGV ULFK LQ RPHJD IDWW\ DFLGV 
)RRGVRXUFHVRIRPHJDIDWW\DFLGVLQFOXGHIDWW\¿VK VXFKDVVDOPRQ ÀD[VHHGDQGÀD[VHHGRLOVR\EHDQ
oil, canola oil, and nuts.
• /LPLWGDLU\SURGXFWVWRORZIDWRUIDWIUHHLWHPV WRVHUYLQJVGD\
• Limit sodium intake to 6 grams per day
• /LPLWDOFRKROLQWDNHWRGULQNVGD\IRUPHQDQGGULQNGD\IRUZRPHQ
• 0DLQWDLQDKHDOWK\ERG\ZHLJKWE\PDWFKLQJFDORULHLQWDNHWRHQHUJ\QHHGVWKLVLQFOXGHVDPRGHUDWHOHYHO
RIUHJXODUSK\VLFDODFWLYLW\ WRPLQXWHVZLWKLQWDUJHWKHDUWUDQJHPRVWGD\VSHUZHHN 
,QDGGLWLRQWRWKHUHFRPPHQGDWLRQVOLVWHGDERYHWKH$+$VXJJHVWVWKDWLQGLYLGXDOVZKRKDYHKHDUWGLVHDVHRU
DUHDWDKLJKULVNRIGHYHORSLQJKHDUWGLVHDVHFRQVLGHUWKHPRUHVSHFLDOL]HGGLHWVEHORZ

Diets for People with High Cholesterol


7KH1DWLRQDO&KROHVWHURO(GXFDWLRQ3URJUDP 1&(3 UHFRPPHQGVVDWXUDWHGIDWLQWDNHRIQRPRUHWKDQRI
WRWDOFDORULHVFKROHVWHUROOLPLWHGWROHVVWKDQPJGD\OLWWOHWRQRWUDQVIDWW\DFLGV VXFKDVIULHGIRRGV LQWDNH
RIERWKSODQWVWDQROVVWHUROV JUDPVGD\ DQGVROXEOH¿EHU WRJUDPVGD\ ZHLJKWORVVDQGH[HUFLVH
6WXGLHVKDYHDOVRVKRZQWKDWUHSODFLQJGLHWDU\DQLPDOSURWHLQZLWKVR\SURWHLQPD\UHGXFHWRWDOFKROHVWHURO/'/
³EDG´ FKROHVWHURODQGWULJO\FHULGHV DPDMRUIRUPRIIDWLQWKHEORRG ZLWKRXWDIIHFWLQJ+'/ ³JRRG´ FKROHVWHURO
OHYHOV7KH$+$DOVRUHFRPPHQGVDGLHWKLJKLQXQVDWXUDWHGIDWGLHWUDWKHUWKDQDYHU\ORZIDWGLHWIRULQGLYLGXDOV
ZLWKDWKHURJHQLFG\VOLSLGHPLD DFRQGLWLRQPDUNHGE\KLJKWULJO\FHULGHVORZ+'/FKROHVWHUROREHVLW\KLJKEORRG
pressure, and/or diabetes).
96 Cardiovascular Disease

Diets for People with High Blood Pressure


7KH 'LHWDU\$SSURDFKHV WR 6WRS +\SHUWHQVLRQ '$6+  GLHW HPSKDVL]HV D GLHW ULFK LQ IUXLWV YHJHWDEOHV DQG
ORZIDWRUQRQIDWGDLU\SURGXFWVWRSURYLGHKLJKLQWDNHRISRWDVVLXPPDJQHVLXPDQGFDOFLXPVRXUFHV6RGLXP
LQWDNHVKRXOGEHOHVVWKDQJGD\:HLJKWORVVUHJXODUSK\VLFDODFWLYLW\DQGOLPLWLQJRIDOFRKROLQWDNHDUHDOVR
YHU\LPSRUWDQWIDFWRUVIRUORZHULQJEORRGSUHVVXUH

Mediterranean Diet
7KH 0HGLWHUUDQHDQ 6W\OH 'LHW LV FRPSULVHG RI ZKROH JUDLQV IUHVK IUXLWV DQG YHJHWDEOHV ¿VK ROLYH RLO DQG
PRGHUDWHGDLO\ZLQHFRQVXPSWLRQ8QOLNHWKH$+$GLHWVWKH0HGLWHUUDQHDQ6W\OH'LHWLVQRWORZLQDOOIDWVLWLV
ORZLQVDWXUDWHGIDWEXWKLJKLQPRQRXQVDWXUDWHGIDWW\DFLGV,QDORQJWHUPVWXG\RISDWLHQWVZKRVXIIHUHG
DKHDUWDWWDFNWKRVHZKRIROORZHGD0HGLWHUUDQHDQ6W\OH'LHWKDGDWRORZHUULVNRIUHFXUUHQWKHDUW
GLVHDVHFRPSDUHGZLWKFRQWUROVZKRUHFHLYHGQRVSHFLDOGLHWDU\FRXQVHOLQJ7KHLQWHUYHQWLRQGLHWHPSKDVL]HG
EUHDGURRWDQGJUHHQYHJHWDEOHVGDLO\LQWDNHRIIUXLW¿VKDQGSRXOWU\ROLYHDQGFDQRODRLOVPDUJDULQHKLJKLQ
DOSKDOLQROHQLFDFLG DQRPHJDSRO\XQVDWXUDWHGIDWW\DFLGIRXQGLQÀD[VHHGZDOQXWVDQGFDQRODRLO DORQJ
ZLWKGLVFRXUDJHPHQWRILQJHVWLRQRIUHGPHDWDQGWRWDODYRLGDQFHRIEXWWHUDQGFUHDP

Supplements and Vitamins


Folic Acid, Vitamin B6, Vitamin B12, Betaine
0DQ\VWXGLHVLQGLFDWHWKDWSDWLHQWVZLWKHOHYDWHGOHYHOVRIWKHDPLQRDFLGKRPRF\VWHLQHDUHURXJKO\WLPHVPRUH
OLNHO\WRGHYHORSFRURQDU\DUWHU\GLVHDVHDQGWLPHVPRUHOLNHO\WRVXIIHUIURPDVWURNHWKDQWKRVHZLWKQRUPDO
OHYHOV+RPRF\VWHLQHOHYHOVDUHVWURQJO\LQÀXHQFHGE\GLHWDU\IDFWRUVSDUWLFXODUO\YLWDPLQ% IROLFDFLG YLWDPLQ
%YLWDPLQ%DQGEHWDLQH7KHVHVXEVWDQFHVKHOSEUHDNGRZQKRPRF\VWHLQHLQWKHERG\6RPHVWXGLHVKDYH
HYHQVKRZQWKDWKHDOWK\LQGLYLGXDOVZKRFRQVXPHKLJKHUDPRXQWVRIIROLFDFLGDQGYLWDPLQ%DUHOHVVOLNHO\WR
GHYHORSDWKHURVFOHURVLVWKDQWKRVHZKRFRQVXPHORZHUDPRXQWVRIWKHVHVXEVWDQFHV

Omega-3 Fatty Acids


7KHUHLVVWURQJHYLGHQFHWKDWRPHJDIDWW\DFLGV QDPHO\(3$DQG'+$ IRXQGLQ¿VKRLOFDQKHOSSUHYHQWDQG
WUHDWDWKHURVFOHURVLVE\LQKLELWLQJWKHGHYHORSPHQWRISODTXHVDQGEORRGFORWV,QRQHVWXG\RISDWLHQWVZLWK
FRURQDU\DUWHU\GLVHDVHWKRVHZKRUHFHLYHG¿VKRLOVXSSOHPHQWVGDLO\IRU\HDUVGHPRQVWUDWHGDVLJQL¿FDQW
LPSURYHPHQWLQV\PSWRPVFRPSDUHGWRWKRVHZKRGLGQRWUHFHLYHWKHVXSSOHPHQWV$VHFRQGVWXG\RIKHDUW
DWWDFNVXUYLYRUVIRXQGWKDWGDLO\VXSSOHPHQWDWLRQZLWKRPHJDIDWW\DFLGVGUDPDWLFDOO\UHGXFHGWKHUDWHRIGHDWK
subsequent heart attacks, and stroke.

L-Carnitine
6WXGLHVVXJJHVWWKDWSDWLHQWVZKRWDNH/FDUQLWLQHVXSSOHPHQWDWLRQVRRQDIWHUVXIIHULQJDKHDUWDWWDFNPD\EH
OHVVOLNHO\WRVXIIHUDVXEVHTXHQWKHDUWDWWDFNGLHRIKHDUWGLVHDVHDQGH[SHULHQFHFKHVWSDLQDQGDEQRUPDOKHDUW
UK\WKPV,QDGGLWLRQSHRSOHZLWKFRURQDU\DUWHU\GLVHDVHZKRXVH/FDUQLWLQHDORQJZLWKVWDQGDUGPHGLFDWLRQ
PD\EHDEOHWRVXVWDLQSK\VLFDODFWLYLW\IRUORQJHUSHULRGVRIWLPH

Antioxidants
(YLGHQFHVXJJHVWVWKDWDQWLR[LGDQWVPD\SOD\DUROHLQWKHSUHYHQWLRQRIDWKHURVFOHURVLV$QWLR[LGDQWVDUHEHOLHYHG
WRSUHYHQWIDWW\EXLOGXSLQWKHDUWHULHVE\VXSSUHVVLQJWKHR[LGDWLRQRI/'/ ³EDG´ FKROHVWHURO7KH\PD\DOVR
UHGXFHWKHOLNHOLKRRGRIEORRGFORWIRUPDWLRQDQGPD\KHOSUHOD[EORRGYHVVHOVWKHUHE\LPSURYLQJEORRGÀRZ

Vitamin E
3RSXODWLRQEDVHGVWXGLHVVXJJHVWWKDWYLWDPLQ(VXSSOHPHQWVPD\KHOSSUHYHQWWKHGHYHORSPHQWDQGSURJUHVVLRQ
RIKHDUWGLVHDVH

Selenium
/RZEORRGOHYHOVRIWKLVDQWLR[LGDQWPD\ZRUVHQDWKHURVFOHURVLV&LJDUHWWHVPRNLQJDQGDOFRKROLQJHVWLRQDUH
EHOLHYHGWRFRQWULEXWHWRVHOHQLXPGH¿FLHQF\,WLVQRWNQRZQKRZHYHUZKHWKHUVHOHQLXPVXSSOHPHQWDWLRQKDV
DQ\LQÀXHQFHRQWKHGHYHORSPHQWRUSURJUHVVLRQRIDWKHURVFOHURVLV

Coenzyme Q10 (CoQ10)


5HVHDUFKHUVEHOLHYHWKDW&R4LQKLELWVEORRGFORWIRUPDWLRQDQGERRVWVOHYHOVRIDQWLR[LGDQWV2QHVWXG\IRXQG
WKDWSHRSOHZKRUHFHLYHGGDLO\&R4VXSSOHPHQWVZLWKLQGD\VRIDKHDUWDWWDFNZHUHVLJQL¿FDQWO\OHVVOLNHO\WR
H[SHULHQFHVXEVHTXHQWKHDUWDWWDFNVDQGFKHVWSDLQDQGZHUHDOVROHVVOLNHO\WRGLHRIWKHFRQGLWLRQWKDQWKRVH
ZKRGLGQRWUHFHLYHWKHVXSSOHPHQWV
Cardiovascular Disease 97

Flavonoids
7HVWWXEHDQLPDODQGVRPHSRSXODWLRQEDVHGVWXGLHVVXJJHVWWKDWWKHÀDYRQRLGVTXHUFHWLQUHVYHUDWURODQG
FDWHFKLQV DOOIRXQGLQKLJKFRQFHQWUDWLRQLQUHGZLQH PD\KHOSUHGXFHWKHULVNRIDWKHURVFOHURVLV%\DFWLQJDV
DQWLR[LGDQWVWKHUHQXWULHQWVDSSHDUWRSURWHFWDJDLQVWWKHGDPDJHFDXVHGE\/'/FKROHVWHURO

Vitamin D
/RZ OHYHOV RI YLWDPLQ ' PD\ LQFUHDVH WKH ULVN RI FDOFLXP EXLOGXS LQ WKH DUWHULHV D VLJQL¿FDQW FRPSRQHQW RI
atherosclerotic plaque. Atherosclerotic plaque build up in blood vessels can lead to a heart attack or stroke.

Melatonin
/RZOHYHOVRIPHODWRQLQLQWKHEORRGKDYHEHHQDVVRFLDWHGZLWKKHDUWGLVHDVHEXWLWLVQRWFOHDUZKHWKHUPHODWRQLQ
OHYHOVDUHORZLQUHVSRQVHWRKDYLQJKHDUWGLVHDVHRULIORZOHYHOVRIPHODWRQLQSUHGLVSRVHSHRSOHWRGHYHORSLQJ
WKLVFRQGLWLRQ,QDGGLWLRQVHYHUDOVWXGLHVLQUDWVVXJJHVWWKDWPHODWRQLQPD\SURWHFWWKHKHDUWVRIWKHVHDQLPDOV
IURPWKHGDPDJLQJHIIHFWVRILVFKHPLD

Herbs
• +DZWKRUQ &UDWDHJXVPRQRJ\QD 8VHGWUDGLWLRQDOO\DVDUHPHG\IRUFDUGLRYDVFXODUGLVHDVHV$QLPDODQG
ODERUDWRU\VWXGLHVGHPRQVWUDWHWKDWWKLVKHUEKDVDQWLR[LGDQWSURSHUWLHVWKDWKHOSSURWHFWDJDLQVWWKHIRUPDWLRQ
RISODTXHVDQGPD\KHOSFRQWUROKLJKFKROHVWHURODQGKLJKEORRGSUHVVXUH
• *DUOLF $OOLXPVDWLYXP &OLQLFDOWULDOVKDYHVKRZQWKDWIUHVKJDUOLFDQGJDUOLFVXSSOHPHQWVPD\ORZHUFKROHVWHURO
levels, prevent blood clots, and destroy plaque.
• *UHHQ7HD &DPHOOLDVLQHQVLV 3RSXODWLRQVWXGLHVLQGLFDWHWKDWWKHDQWLR[LGDQWSURSHUWLHVRIJUHHQWHDPD\
prevent atherosclerosis, particularly coronary artery disease.
• *XJXOLSLG &RPPLSKRUDPXNXO 8VHGLQ$\XUYHGLFPHGLFLQHWRWUHDWKLJKFKROHVWHUROOHYHOV&HUWDLQLQJUHGLHQWV
LQWKLVKHUEDOUHPHG\PD\KDYHDQWLR[LGDQWSURSHUWLHVDQGPD\WKHUHIRUHFRQYH\KHDOWKEHQH¿WVVLPLODUWR
KDZWKRUQJDUOLFDQGJUHHQWHD
• 3VHXGRJLQVHQJURRWQRWRJLQVHQJURRW 3DQD[QRWRJLQVHQJ 8VHGLQ7UDGLWLRQDO&KLQHVH0HGLFLQHWRWUHDW
chest pain and coronary artery disease. Laboratory studies suggest this herb may help prevent blood clots
DQGSURWHFWDJDLQVWWKHIRUPDWLRQRISODTXHV

Suggested Nutritional Supplementation

Moderate
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• Cardiogenics Intensive Care — 3 tablets daily
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ
• E-Complex 1:1 ²VRIWJHOVGDLO\ZLWKPHDOV
(&RPSOH[LVDXQLTXHQDWXUDOYLWDPLQ(VXSSOHPHQWWKDWIHDWXUHVDUDWLRRIDOSKDWRJDPPDWRFRSKHURO
WKLVUDWLRPRUHFORVHO\UHVHPEOHVWKHWRFRSKHUROSUR¿OHIRXQGQDWXUDOO\LQYLWDPLQ(ULFKSODQWV
• EPA/DHA 720 ²VRIWJHOVWLPHVGDLO\ZLWKPHDOV
6WXGLHVLQGLFDWHWKDWRPHJDIDWW\DFLGV (3$'+$ PD\SURWHFWDJDLQVWGHFUHDVHVLQFHUHEUDOEORRGÀRZ
DQGFHUHEUDOHGHPDLQWKHSUHVHQFHRIDQDFXWHFDURWLGRFFOXVLRQ

Severe
• FirstLine Therapy® 3URJUDP
)/7XVHVDORZJO\FHPLFLQGH[GLHWDU\UHJLPHQDQGH[HUFLVHSURJUDPZKLOHLQFRUSRUDWLQJPHGLFDOIRRGVDQG
QXWULWLRQDOVXSSOHPHQWV1HZUHVHDUFKKDVVKRZQWKDWORZJO\FHPLFGLHWVDUHPRUHHIIHFWLYHWKDQORZIDWGLHWV
LQWUHDWLQJREHVLW\LQVXOLQUHVLVWDQFHG\VOLSLGHPLDFDUGLRYDVFXODUGLVHDVHDQGW\SHGLDEHWHV
• UltraMeal® Plus 360°²VFRRSVWZLFHGDLO\
8OWUD0HDOŠ3OXVƒLVDPHGLFDOIRRGIRUPXODWHGWRSURYLGHVSHFLDOL]HGPXOWLPHFKDQLVWLFQXWULWLRQDOVXSSRUW
IRUSDWLHQWVZLWKPHWDEROLFV\QGURPHDQGFDUGLRYDVFXODUGLVHDVHE\VXSSO\LQJDFRPELQDWLRQRIDFDFLD
H[WUDFWUHGXFHGLVRDOSKDDFLGV 5,$$ SODQWVWHUROVDQGKHDUWKHDOWK\VR\SURWHLQDQGLVRÀDYRQHV
• High Concentrate EPA-DHA Liquid™²WVSWZLFHGDLO\
High Concentrate(3$'+$/LTXLGSURYLGHVDWOHDVWPJSHUVHUYLQJRI(3$'+$DQGRWKHUSXULW\
FHUWL¿HGRPHJDHVVHQWLDOIDWW\DFLGVLQWULJO\FHULGHIRUP
98 Cardiovascular Disease

• Cardiogenics® Intensive Care±WRWDEOHWVWZLFHGDLO\EHWZHHQPHDOV


&DUGLRJHQLFV ,QWHQVLYH &DUH LV D FRPSUHKHQVLYH KHDUW PXVFOH VXSSRUW IRUPXOD WKDW IHDWXUHV H[WUDFWV RI
KDZWKRUQDQGDUMXQDZLWKDKLVWRU\RIWUDGLWLRQDOXVHVXSSRUWLQJWKHKHDUWSRVVLEO\E\KHOSLQJWRPDLQWDLQ
EORRGYHVVHOGLODWLRQDQGKHDOWK\EORRGSUHVVXUHDOUHDG\ZLWKLQWKHQRUPDOUDQJH&RPSOHPHQWLQJWKHVH
KHUEVLVDEOHQGRIDPLQRDFLGVDQGPLQHUDOV²LQFOXGLQJPDJQHVLXPSRWDVVLXPDQGFDOFLXP²WKDWSOD\
LPSRUWDQWUROHVLQKHDUWPXVFOHIXQFWLRQ
• Mag Glycinate™ - WDEOHWVWZLFHGDLO\ZLWKPHDOV
0DJ*O\FLQDWHLVDUHYROXWLRQDU\IXOO\UHDFWHGDPLQRDFLGFKHODWHSURGXFHGE\DXQLTXHSDWHQWHGSURFHVV
WKDWLVGHVLJQHGWRHQKDQFHDEVRUSWLRQDQGLQWHVWLQDOWROHUDQFHRIPDJQHVLXP
+DQV1LHSHU0'QRWHGWKDWWUHDWPHQWZLWKPDJQHVLXPIRUPRQWKVLPSURYHGEORRGYHVVHOHODVWLFLW\
PHDVXUHGE\FDSLOODULRVFRS\ LQDERXWRISDWLHQWVWRDQH[WHQWFORVHWRQRUPDO

Dietary Suggestions
• FirstLine Therapy® Diet.)RUWKHPD[LPXPHIIHFWLYHQHVVRIWKLVSURJUDPLWLVUHFRPPHQGHGWKDWDKLJK
¿EHUKLJKFRPSOH[FDUERK\GUDWHGLHWVXFKDVWKH9LWDO/LIH'LHWEHLPSOHPHQWHG
NOTE: Avoid alcoholic beverages.

Acupuncture
$FXSXQFWXUHPD\EHSDUWLFXODUO\XVHIXOIRUUHGXFLQJULVNIDFWRUVIRUKHDUWGLVHDVH,WLVFRQVLGHUHGDQH[FHOOHQW
WUHDWPHQWIRUSHRSOHZKRZLVKWRTXLWVPRNLQJDQGVRPHVWXGLHVLQGLFDWHWKDWLWPD\DLGLQZHLJKWORVVDVZHOODV
cholesterol and blood pressure reduction.

Massage and Physical Therapy


$OWKRXJKIHZVWXGLHVKDYHH[DPLQHGWKHHIIHFWLYHQHVVRIPDVVDJHWKHUDS\RQDWKHURVOHURVLVPDVVDJHKDVD
UHOD[LQJHIIHFWDQGLWKDVEHHQVKRZQWRUHGXFHVWUHVVUHODWHGKRUPRQHOHYHOV/RZHULQJVWUHVVKRUPRQHOHYHOV
SRVLWLYHO\LQÀXHQFHVFKROHVWHURODQGEORRGSUHVVXUHDQGPD\WKHUHIRUHUHGXFHWKHULVNRIKHDUWGLVHDVH,QDGGLWLRQ
UHOD[DWLRQWHFKQLTXHVPD\KHOSLQGLYLGXDOVFRPSO\ZLWKKDELWVQHFHVVDU\WRUHGXFHULVNRIDWKHURVFOHURVLVVXFK
DVGLHWLQJTXLWWLQJVPRNLQJDQGH[HUFLVLQJ$OVRDWOHDVWRQHVWXG\KDVIRXQGWKDWPDVVDJHFDQORZHUEORRG
pressure.
Cardiovascular Disease 99

Cardiomyopathy/Enlarged Heart
Cardiomyopathy (Kar“de-o-mi-op'ah-the): a general diagnostic term designating primary myocardial
disease
Alcoholic cardiomyopathy: &RQJHVWLYH FDUGLRP\RSDWK\ UHVXOWLQJ LQ FDUGLDF HQODUJHPHQW DQG ORZ FDUGLDF
RXWSXWRFFXUULQJLQFKURQLFDOFRKROLFVWKHKHDUWGLVHDVHLQEHULEHUL WKLDPLQHGH¿FLHQF\ LVDOVRDVVRFLDWHGZLWK
alcoholism.
Congestive cardiomyopathy:6\QGURPHFKDUDFWHUL]HGE\FDUGLDFHQODUJHPHQWHVSHFLDOO\RIWKHOHIWYHQWULFOH
P\RFDUGLDOG\VIXQFWLRQDQGFRQJHVWLYHKHDUWIDLOXUH
,Q¿OWUDWLYH FDUGLRP\RSDWK\  0\RFDUGLDO GLVHDVH UHVXOWLQJ IURP GHSRVLWLRQ LQ WKH KHDUW WLVVXH RI DEQRUPDO
substances, as may occur in amyloidosis, hemochromatosis, and other disorders.

Nutrients Involved
Vitamin E, selenium, coenzyme Q10, and carnitine

Suggested Nutritional Supplementation

Moderate
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• CoQ10 ST-100²FDSVXOHWLPHVGDLO\ZLWKPHDOV
6WXGLHV LQGLFDWH FRHQ]\PH 4 KDV OHDG WR UHPDUNDEOH FOLQLFDO LPSURYHPHQW LQ SDWLHQWV ZLWK
cardiomyopathy.
• Cardiogenics Intensive Care — 3 tablets daily.
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ
• E-Complex 1:1²FDSVXOHVGDLO\ZLWKPHDOV
(&RPSOH[LVDXQLTXHQDWXUDOYLWDPLQ(VXSSOHPHQWWKDWIHDWXUHVDUDWLRRIDOSKDWRJDPPDWRFRSKHURO
WKLVUDWLRPRUHFORVHO\UHVHPEOHVWKHWRFRSKHUROSUR¿OHIRXQGQDWXUDOO\LQYLWDPLQ(ULFKSODQWV
• L-Carnitine w/Chromium ²WDEOHWVWLPHVGDLO\ZLWKMXLFHRQHPSW\VWRPDFK
$QH[SHULPHQWDOVWXG\LQGLFDWHGDQ/FDUQLWLQHGH¿FLHQF\PD\FDXVHFDUGLRP\RSDWK\

Severe
• FirstLine Therapy® Program
)/7XVHVDORZJO\FHPLFLQGH[GLHWDU\UHJLPHQDQGH[HUFLVHSURJUDPZKLOHLQFRUSRUDWLQJPHGLFDOIRRGVDQG
QXWULWLRQDOVXSSOHPHQWV1HZUHVHDUFKKDVVKRZQWKDWORZJO\FHPLFGLHWVDUHPRUHHIIHFWLYHWKDQORZIDWGLHWV
LQWUHDWLQJREHVLW\LQVXOLQUHVLVWDQFHG\VOLSLGHPLDFDUGLRYDVFXODUGLVHDVHDQGW\SHGLDEHWHV
• UltraMeal® Plus 360°²VFRRSVWZLFHGDLO\
8OWUD0HDOŠ3OXVƒLVDPHGLFDOIRRGIRUPXODWHGWRSURYLGHVSHFLDOL]HGPXOWLPHFKDQLVWLFQXWULWLRQDOVXSSRUW
IRUSDWLHQWVZLWKPHWDEROLFV\QGURPHDQGFDUGLRYDVFXODUGLVHDVHE\VXSSO\LQJDFRPELQDWLRQRIDFDFLD
H[WUDFWUHGXFHGLVRDOSKDDFLGV 5,$$ SODQWVWHUROVDQGKHDUWKHDOWK\VR\SURWHLQDQGLVRÀDYRQHV

Dietary Suggestions
• FirstLine Therapy® Diet.
100 Cardiovascular Disease

Cardiac Arrhythmia
Arrhythmia (ah-rith'me-ah)9DULDWLRQIURPWKHQRUPDOUK\WKPHVSHFLDOO\RIWKHKHDUWEHDW
Sinus arrhythmia7KHSK\VLRORJLFF\FOLFYDULDWLRQLQKHDUWUDWHUHODWHGWRYDJDOLPSXOVHVWRWKHVLQRDWULDOQRGH
it occurs commonly in children and in the aged.

Nutrients Involved
(3$'+$RLOVWDXULQHPDJQHVLXPSRWDVVLXPFDOFLXPFKURPLXPFRHQ]\PH4

Suggested Nutritional Supplementation


• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• Cardiogenics Intensive Care — 3 tablets daily.
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ
• EPA-DHA Extra Strength²VRIWJHOVWLPHVGDLO\ZLWKPHDOV
&RQFHQWUDWHG(VVHQWLDO)DWW\$FLGVIRU'DLO\0DLQWHQDQFH
2PHJDIDWW\DFLGV (3$'+$ KDYHEHHQVKRZQWRKDYHEHQH¿FLDOHIIHFWVLQH[SHULPHQWDOVWXGLHVRI
cardiac arrhythmia.
• CoQ10 ST-100²FDSVXOHWLPHVGDLO\ZLWKPHDOV
&R467IHDWXUHVPJRIDVWDELOL]HGDOOQDWXUDOHQFDSVXODWLRQRIFRHQ]\PH4 &R4 PDQXIDFWXUHG
WRDFKLHYHH[TXLVLWHTXDOLW\SXULW\DQGELRDYDLODELOLW\
([SHULPHQWDOVWXG\VXJJHVWVWKDW&R4H[KLELWVDQHIIHFWLYHDQWLDUUK\WKPLFDFWLRQQRWPHUHO\RQRUJDQLF
KHDUWGLVHDVHEXWDOVRRQYHQWULFXODUSUHPDWXUHEHDWV 93%V VXSHUYHQLQJLQGLDEHWHVPHOOLWXV

Maintenance Supplementation
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ

Dietary Suggestions
• FirstLine Therapy® Diet.
• AVOID CAFFEINE.&DIIHLQHKDVEHHQVKRZQWRKDYHDQHJDWLYHHIIHFWRQDUUK\WKPLD
Cardiovascular Disease 101

Congestive Heart Failure


Congestive heart failure (CHF), RFFXUVDVDUHVXOWRILPSDLUHGSXPSLQJFDSDELOLW\RIWKHKHDUWDQGLVDVVRFLDWHG
ZLWKDEQRUPDOUHWHQWLRQRIZDWHUDQGVRGLXP7KHFRQGLWLRQUDQJHVIURPPLOGFRQJHVWLRQZLWKIHZV\PSWRPVWR
OLIHWKUHDWHQLQJÀXLGRYHUORDGDQGWRWDOKHDUWIDLOXUH
&+)UHVXOWVLQDQLQDGHTXDWHVXSSO\RIEORRGDQGR[\JHQWRWKHERG\¶VFHOOV7KHGHFUHDVHGFDUGLDFRXWSXWFDXVHV
DQLQFUHDVHLQWKHEORRGYROXPHZLWKLQWKHYDVFXODUV\VWHP&RQJHVWLRQZLWKLQWKHEORRGYHVVHOVLQWHUIHUHVZLWK
WKHPRYHPHQWRIERG\ÀXLGVLQDQGRXWRIWKHYDULRXVÀXLGFRPSDUWPHQWVDQGWKH\DFFXPXODWHLQWKHWLVVXH
spaces, causing edema.
Clinical symptoms: /HIWVLGHGKHDUWIDLOXUHSURGXFHVG\VSQHDRIYDU\LQJLQWHQVLW\,QWKHHDUO\VWDJHVVKRUWQHVV
RIEUHDWKRFFXUVRQO\ZKHQWKHSDWLHQWLVSK\VLFDOO\DFWLYH/DWHUDVWKHKHDUWDFWLRQEHFRPHVPRUHVHULRXVO\
LPSDLUHGWKHG\VSQHDLVSUHVHQWHYHQZKHQWKHSDWLHQWLVUHVWLQJ,QDGYDQFHGFDVHVWKHSDWLHQWPXVWVLWXSLQ
RUGHUWREUHDWKH RUWKRSQHD $WWDFNVRIEUHDWKOHVVQHVVVHYHUHHQRXJKWRZDNHWKHSDWLHQWIUHTXHQWO\RFFXUGXULQJ
VOHHS7KHVHDWWDFNVXVXDOO\DUHDFFRPSDQLHGE\FRXJKLQJDQGZKHH]LQJ FDUGLDFDVWKPD DQGWKHSDWLHQWVHHNV
UHOLHIE\VLWWLQJXSULJKW2UWKRSQHDDQGFDUGLDFDVWKPDRUSDUR[\VPDOQRFWXUQDOG\VSQHDDUHUHODWHGWRFRQJHVWLRQ
RIWKHSXOPRQDU\EORRGYHVVHOVDQGHGHPDRIWKHOXQJWLVVXHV7KH\DUHDJJUDYDWHGE\O\LQJGRZQEHFDXVHLQ
WKHSURQHSRVLWLRQTXDQWLWLHVRIEORRGLQWKHORZHUH[WUHPLWLHVPRYHXSZDUGLQWRWKHEORRGYHVVHOVRIWKHOXQJV
)OXLGUHWHQWLRQLVDQRWKHUFRPPRQV\PSWRPRI&+),QOHIWVLGHGIDLOXUHWKHUHLVKLJKHUWKDQQRUPDOSUHVVXUH
RIEORRGLQWKHSXOPRQDU\YHVVHOV7KLVLQFUHDVHGSUHVVXUHIRUFHVÀXLGRXWRIWKHLQWUDYDVFXODUFRPSDUWPHQW
DQGLQWRWKHWLVVXHVSDFHVRIWKHOXQJVFDXVLQJSXOPRQDU\HGHPD5LJKWVLGHGIDLOXUHFDXVHVFRQJHVWLRQLQWKH
FDSLOODULHVRIWKHSHULSKHUDOFLUFXODWLRQDQGUHVXOWVLQHGHPDDQGFRQJHVWLRQRIWKHOLYHUOHJVDQGIHHWDQGLQWKH
VDFUDOUHJLRQRIEHGULGGHQSDWLHQWV
Medical treatment: 0HGLFDOPDQDJHPHQWRIFRQJHVWLYHKHDUWIDLOXUHLVDLPHGDWLPSURYLQJFRQWUDFWLOLW\RIWKH
KHDUWUHGXFLQJVDOWDQGZDWHUUHWHQWLRQDQGSURYLGLQJUHVWIRUWKHKHDUWPXVFOH'UXJVXVHGWRDFFRPSOLVKWKHVH
goals include digitalisJO\FRVLGHVWRVORZDQGVWUHQJWKHQWKHKHDUWEHDWvasodilators, such as nitroprusside and
SKHQWRODPLQHWRUHGXFHUHVLVWDQFHWRWKHÀRZRIEORRGEHLQJSXPSHGIURPWKHKHDUWDQGdiuretics to assist in
WKHHOLPLQDWLRQRIZDWHUDQGVRGLXPLQWKHXULQH

Nutrients Involved
Coenzyme Q10, magnesium, taurine, potassium

Suggested Nutritional Supplementation

Moderate
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• CoQ10 ST-100²FDSVXOHWLPHVGDLO\ZLWKPHDOV
6WDELOL]HGKLJKO\DEVRUEDEOHFRHQ]\PH4ZLWKQDWXUDOYLWDPLQ(DQGEHWDFDURWHQH
• Mag Glycinate ²WDEOHWVWLPHVGDLO\ZLWKPHDOV
0DJ*O\FLQDWHLVDUHYROXWLRQDU\IXOO\UHDFWHGDPLQRDFLGFKHODWHSURGXFHGE\DXQLTXHSDWHQWHGSURFHVV
WKDWLVGHVLJQHGWRHQKDQFHDEVRUSWLRQDQGLQWHVWLQDOWROHUDQFHRIPDJQHVLXP
5HVHDUFKLQGLFDWHVP\RFDUGLDODQGVHUXPPDJQHVLXPGH¿FLHQF\LQFRQJHVWLYHKHDUWIDLOXUH6XSSOHPHQWDWLRQ
PD\DVVLVWLQWKHFRUUHFWLRQRIPXVFOHSRWDVVLXPGH¿FLHQFLHVDVZHOODVLQFRUUHFWLRQRIWKHGLVWXUEHG
UHODWLRQEHWZHHQH[WUDDQGLQWUDFHOOXODUHOHFWURO\WHV
• Cardiogenics Intensive Care²WDEOHWVWZLFHGDLO\EHWZHHQPHDOV
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ
• Pure Taurine ²FDSVXOHV±WLPHVGDLO\EHWZHHQPHDOVZLWKMXLFH
7DXULQHKDVEHHQGHPRQVWUDWHGWREHEHQH¿FLDOLQFRQJHVWLYHKHDUWIDLOXUH

Severe
• FirstLine Therapy® Program
)/7XVHVDORZJO\FHPLFLQGH[GLHWDU\UHJLPHQDQGH[HUFLVHSURJUDPZKLOHLQFRUSRUDWLQJPHGLFDOIRRGV
DQGQXWULWLRQDOVXSSOHPHQWV1HZUHVHDUFKKDVVKRZQWKDWORZJO\FHPLFGLHWVDUHPRUHHIIHFWLYHWKDQORZ
IDWGLHWVLQWUHDWLQJREHVLW\LQVXOLQUHVLVWDQFHG\VOLSLGHPLDFDUGLRYDVFXODUGLVHDVHDQGW\SHGLDEHWHV
• UltraMeal® Plus 360° ²VFRRSVWZLFHGDLO\
1XWULWLRQDO6XSSRUWIRUWKH0DQDJHPHQWRI&RQGLWLRQV$VVRFLDWHGZLWK0HWDEROLF6\QGURPHDQG&DUGLRYDVFXODU
Disease
102 Cardiovascular Disease

• EPA-DHA High Concentrate Liquid™ ²WHDVSRRQWLPHVGDLO\


+LJK&RQFHQWUDWH(3$'+$/LTXLGSURYLGHVDWOHDVWPJSHUVHUYLQJRI(3$'+$DQGRWKHUSXULW\
FHUWL¿HGRPHJDHVVHQWLDOIDWW\DFLGVLQWULJO\FHULGHIRUP
• CoQ10 ST-100 ²FDSVXOHWLPHVGDLO\ZLWKPHDOV
6WDELOL]HGKLJKO\DEVRUEDEOHFRHQ]\PH4ZLWKQDWXUDOYLWDPLQ(DQGEHWDFDURWHQH
• Cardiogenics Intensive Care²WDEOHWVWZLFHGDLO\EHWZHHQPHDOV
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ

If potassium deficient (due to prescription diuretic use), add:


• MG/K Aspartate ²WDEOHWWLPHVGDLO\ZLWKPHDOV
)HDWXUHVPDJQHVLXPDQGSRWDVVLXPLQWKHIRUPRIWUXHPLQHUDODVSDUWDWHVWRHQKDQFHDEVRUSWLRQ

Dietary Suggestions
• FirstLine Therapy® Diet
Cardiovascular Disease 103

Homocysteine (high)
)LUVWLGHQWL¿HGE\.LOPHU0F&XOO\0'DVDVLJQL¿FDQWULVNIDFWRULQYDVFXODUGLVHDVH+RPRF\VWHLQHLVDQDWXUDO
DPLQRDFLGPHWDEROLWHRIGLHWDU\PHWKLRQLQHDWORZFRQFHQWUDWLRQV([FHVVDFFXPXODWLRQRIKRPRF\VWHLQHKDV
been documented to lead to vascular damage and early stroke, atherosclerosis, and coronary heart disease. It has
DOVREHHQDVVRFLDWHGZLWKV\VWROLFK\SHUWHQVLRQUKHXPDWRLGDUWKULWLV$O]KHLPHU
VGLVHDVHDQGGHSUHVVLRQ
"An estimated 10-20% of all cardiovascular disease is caused by excessive plasma homocysteine concentrations."
².LOPHU0F&XOO\0'

Homocysteine Trends In U.S. Population


• 1RUPDOUDQJHPLFURPROHV/RIEORRG
• 'HVLUDEOHOHYHOPLFURPROHV/RIEORRG
• /RZULVNPLFURPROHV/RIEORRG
• 0HGLXPULVNPLFURPROHV/RIEORRG
• +LJKULVN!PLFURPROHV/RIEORRG RISRSXODWLRQ!+,*+5,6.
• 5HIHUHQFH5LPPHWDO-$0$)HE  

Causes of High Homocysteine


• ,QDGHTXDWHGLHWDU\IRODWH%%FKROLQHEHWDLQH 70*
• High protein intake — methionine loading
• $JH²KRPRF\VWHLQHLQFUHDVHVZLWKDGYDQFLQJDJH
• (Q]\PH GHIHFWV &\VWDWKLRQLQH V\QWKDVH PHWK\OWHWUDK\GURIRODWH KRPRF\VWHLQH PHWK\OWUDQVIHUDVH
PHWK\OHQHWHWUDK\GURIRODWHUHGXFWDVH KRPR]\JRXVLQ8.
• *DVWURLQWHVWLQDOGLVRUGHUVWKDWUHGXFH%XSWDNH
• *DVWULFDFLGLQKLELWRUV LH7DJDPHWHWF WKDWUHGXFHDYDLODELOLW\RILQWULQVLFIDFWRU
• +LJKKRPRF\VWHLQHLVDVVRFLDWHGZLWKUHQDOGLVHDVH

Risk Factors For High Homocysteine


• /RZIUXLWDQGYHJHWDEOHGLHW
• High protein intake
• Age (over 50)
• (Q]\PHGHIHFWV DSSUR[LPDWHO\RISRSXODWLRQ
• Hypochlorhydria
• Ulcer
• 8VHRIDQWDFLGVJDVWULFDFLGLQKLELWRUV
• 3RVWPHQRSDXVDO
• Elderly and institutionalized
• High stress
• Smoking
• Renal disease
• Hypothyroidism
• )DPLO\KLVWRU\RUSHUVRQDOKLVWRU\RIDWKHURVFOHURVLVSHULSKHUDODUWHU\GLVHDVHFHUHEUDOYDVFXODUGLVHDVH
Alzheimer's disease, diabetes, or high homocysteine
104 Cardiovascular Disease

Suggested Nutritional Supplementation


• Vessel Care²WDEOHWVGDLO\ZLWKIRRG
9HVVHO&DUHLVDFRPSUHKHQVLYHKRPRF\VWHLQHIRUPXODWKDWVXSSOLHVRSWLPDOOHYHOVRIIROLFDFLG%%
WULPHWK\OJO\FLQH EHWDLQH DQGFKROLQHQXWULHQWVNQRZQWRVXSSRUWKHDOWK\KRPRF\VWHLQHPHWDEROLVP
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• Cardioauxin™ ²WDEOHWVWZLFHGDLO\
&DUGLRDX[LQTMLVDYHU\HI¿FDFLRXVOLSLGORZHULQJKHDUWULVNUHGXFWLRQIRUPXOD7KLVIRUPXODFRQWDLQVDXQLTXH
FRPELQDWLRQRIV\QHUJLVWLFQXWULHQWVWKDWSURYHGWRVLJQL¿FDQWO\ORZHUORZGHQVLW\OLSRSURWHLQFKROHVWHURO /'/
& DQGWULJO\FHULGHV 7* ZKLOHUDLVLQJSURWHFWLYHKLJKGHQVLW\OLSRSURWHLQFKROHVWHURO +'/& 
NOTE: 5HWHVW KRPRF\VWHLQH OHYHOV LQ  ZHHNV :KHQ QRUPDOL]HG PRYH WR SUHYHQWLYH PDLQWHQDQFH
program.

Ongoing Maintenance
• Glycogenics ²WDEOHWVGDLO\ZLWKIRRG
*O\FRJHQLFV LV D EURDG VSHFWUXP EFRPSOH[ VSHFL¿FDOO\ GHVLJQHG WR VXSSRUW KHDOWK\ KRPRF\VWHLQH
metabolism

Dietary Suggestions
• FirstLine® Therapy Diet
Cardiovascular Disease 105

Hypertension (High Blood Pressure)


Blood pressure consistently higher than 140/90 mm Hg. NOTE:$FXWH+\SHUWHQVLRQ !PP+J RUORZHU
EORRGSUHVVXUHDFFRPSDQLHGE\V\PSWRPVVXFKDVKHDGDFKHYLVXDOGLVWXUEDQFHRUOHWKDUJ\LQGLFDWHQHHGIRU
immediate crisis intervention.
7KHWUHDWPHQWRIK\SHUWHQVLRQLVDFRPSOLFDWHGSUREOHPFRQIURQWLQJWKHFOLQLFLDQ0HGLFDWLRQVFXUUHQWO\XVHGIRU
EORRGSUHVVXUHPDQDJHPHQWLQFOXGHEHWDEORFNHUVGLXUHWLFVDQGRWKHUPHGLFDWLRQVWKDWKDYHQHJDWLYHVLGHHIIHFWV
$FFRUGLQJWRDIRXU\HDUVWXG\RIK\SHUWHQVLRQSXEOLVKHGLQ-$0$ ³VWXG\¿QGLQJVGHPRQVWUDWHGWKDWnutritional
therapy PD\VXEVWLWXWHIRUGUXJVLQDVL]DEOHSURSRUWLRQRIK\SHUWHQVLYHVRULIGUXJVDUHVWLOOQHHGHGFDQOHVVHQ
VRPHXQZDQWHGELRFKHPLFDOHIIHFWVRIGUXJWUHDWPHQW´7KHUHIRUHLWLVYDOXDEOHWRLGHQWLI\DQXWULWLRQDOSURJUDP
ZLWKRXWQHJDWLYHVLGHHIIHFWVWKDWZRXOGKDYHDEHQH¿FLDOHIIHFWRQUHGXFLQJEORRGSUHVVXUH

Nutrients Involved
%RQLWR¿VKSHSWLGHVJDUOLFFDOFLXPPDJQHVLXPSRWDVVLXPFRHQ]\PH4(3$'+$RLOVDUJLQLQH

Suggested Nutritional Supplementation


• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• Vasotensin²WDEOHWVWZLFHGDLO\ZLWKIRRG
9DVRWHQVLQSURYLGHVDFWLYHSHSWLGHVIURPERQLWR¿VKWRKHOSSUHYHQWWKHIRUPDWLRQRIDQJLRWHQVLQ,,DSRWHQW
YDVRFRQVWULFWRUWKURXJKWKHLULQWHUDFWLRQZLWKDQJLRWHQVLQFRQYHUWLQJHQ]\PH $&( 7KLVDFWLYLW\VXSSRUWV
KHDOWK\YDVFXODUIXQFWLRQIRURSWLPDOEORRGÀRZDQGKHDOWK\EORRGSUHVVXUHOHYHOV
• CoQ10 ST-100²FDSVXOHWLPHVGDLO\ZLWKPHDOV
6WDELOL]HG+LJKO\$EVRUEDEOH&RHQ]\PH4ZLWK1DWXUDO9LWDPLQ(
6WXGLHV VKRZ WKDW &R4 GH¿FLHQF\ LV SUHVHQW LQ  RI SHRSOH ZLWK K\SHUWHQVLRQ &R4 ORZHUV
EORRGSUHVVXUHE\ORZHULQJFKROHVWHUROOHYHOVDQGVWDELOL]LQJWKHYDVFXODUPHPEUDQHYLDLWVDQWLR[LGDQW
properties.
• Cardiogenics Intensive Care ²WDEOHWVWLPHVGDLO\EHWZHHQPHDOVZLWKMXLFH
1XWULWLRQDOVXSSRUWIRUKHDOWK\FLUFXODWLRQDQGFDUGLDFIXQFWLRQ
Calcium KDVEHHQVKRZQLQVWXGLHVWRQRWRQO\ORZHUEORRGSUHVVXUHEXWDOVRWRKHOSWRSUHYHQWLW6RPH
VFLHQWLVWVKDYHVWDWHGWKDWFDOFLXPFRXQWHUDFWVWKHHIIHFWVWKDWVRGLXPKDVRQEORRGSUHVVXUHMagnesium
LVDQRWKHUYDOXDEOHPLQHUDOIRUFRQWUROOLQJK\SHUWHQVLRQ1XPHURXVVWXGLHVVKRZWKDWPDJQHVLXPKDVD
SRVLWLYHHIIHFWRQK\SHUWHQVLRQ,WZRUNVE\UHOD[LQJDQGVPRRWKLQJWKHPXVFOHRIEORRGYHVVHOVDQGDOVR
plays a role in cell membrane permeability to sodium and calcium. PotassiumLVSHUKDSVWKHEHVWNQRZQ
QDWXUDOUHPHG\IRUORZHULQJEORRGSUHVVXUH2QHVWXG\SXEOLVKHGLQWKHJournal of the American Medical
Association IRXQGWKDWORZSRWDVVLXPOHYHOVFRQWULEXWHWRWKHGHYHORSPHQWRIK\SHUWHQVLRQ
• ActiFolate²WDEOHWVGDLO\ZLWKIRRG
$FWLIRODWHLVFRPSUHKHQVLYHIRODWHQXWULWLRQLQWKHDFWLYHIRUPV
6HYHUDOVWXGLHVKDYHGHPRQVWUDWHGWKDWKLJKGRVHIROLFDFLGDFXWHO\ORZHUVEORRGSUHVVXUHDQGHQKDQFHV
FRURQDU\YDVRGLODWRUIXQFWLRQLQSDWLHQWVZLWKFRURQDU\DUWHU\GLVHDVH-$P&ROO&DUGLRO
$P-&OLQ1XWU
• Super Garlic 6000 — 1 tablet 3 times daily.
6XSHU*DUOLFLVDVXSHUFRQFHQWUDWHGJDUOLFVXSSOHPHQWWKDWLVJXDUDQWHHGWRVXSSO\PFJRIDOOLFLQ
JDUOLF
VPRVWLPSRUWDQWDFWLYHLQJUHGLHQWSHUWDEOHW
0DQ\VWXGLHVFRQ¿UPLWVHIIHFWLYHQHVVLQORZHULQJERWKEORRGSUHVVXUHDQGFKROHVWHURO,WSURWHFWVDJDLQVW
KHDUWGLVHDVHDQGVWURNHVE\DIIHFWLQJWKHSURFHVVRIDWKHURVFOHURVLVDWPDQ\VWDJHV$FFRUGLQJWR0LFKDHO
T. Murray, N.D., in The Healing Power of Herbs 3ULPD ³WKHPRGHRIDFWLRQRIJDUOLFDVDQDQWL
K\SHUWHQVLYHDSSHDUVWREHUHODWHGWRLWVVXOIXUFRQWHQWDQGOLSLGORZHULQJSURSHUWLHV´

For the “high-stress” hypertensive individual add:


• Serenagen ²WDEOHWVWLPHVGDLO\ZLWKOXNHZDUPZDWHU
6HUHQDJHQLVDFODVVLFFRPSUHKHQVLYHKHUEDOVWUHVVPDQDJHPHQWIRUPXODWDUJHWLQJLQGLYLGXDOVZKRDUH
³VWUHVVHGDQGZLUHG´

Dietary Suggestions
• FirstLine Therapy® Diet
• “What YOU Can Do To Bring Your Blood Pressure Down”FKDUW QH[WSDJH
106 Cardiovascular Disease

What YOU Can Do To Bring Your Blood Pressure Down

Regular Chiropractic Adjustments Increase Your Leanness if Overweight


• 0DLQWDLQVYLWDOQHUYHÀRZWRWKHFDUGLRYDVFXODU • ,PSOHPHQW DQ HIIHFWLYH ZHLJKW ORVV
system. program.
• Reduces mechanical stress to the nervous • 6WD\DZD\IURPDOFRKRO
system.
• Enhances all nutritional and Dietary Control Your Caffeine Intake
6XJJHVWLRQV E\ DOORZLQJ IRU RSWLPDO • &RIIHH WHD FRODV DQG DQDOJHVLFV FRQWDLQ
assimilation. FDIIHLQHZKLFKFDQHOHYDWHEORRGSUHVVXUH

Give Your Body the Right Kinds of Increase Consumption of Calcium,


Food Garlic, Magnesium, Potassium-Rich
• 2EHVLW\ RIWHQ FDQ OHDG WR LQFUHDVHG EORRG
pressure. Foods
• *LYH XS ³HPSW\´ FDORULHV OLNH VXJDU ZKLWH • 6WXGLHVVKRZWKDWFDOFLXPPDJQHVLXPJDUOLF
EUHDGFDNHFRRNLHVSLHVDWXUDWHGIDWV ODUG DQGSRWDVVLXPPD\EHPRUHKHOSIXOLQORZHULQJ
shortening), hard alcohol. blood pressure than salt restriction.
• 7U\HDWLQJPRUH¿VKOHDQPHDWYHJHWDEOHV
DQGSRO\XQVDWXUDWHGIDWV OLTXLGFRUQRLO OHVV Increase Omega-3 Fatty Acids
butter, egg yolks, pork, bologna, sausage, • 6WXGLHVLQGLFDWHWKDWRLOVLQ¿VKPD\KHOSORZHU
juicy steaks. blood pressure.
• $SLQWRIEHHURUDERXWKDOIDVPXFKZLQHKDV
DERXWDVPDQ\FDORULHVDVDSDWRIEXWWHU6R Remember
DYRLGEHHUZLQHDQGOLTXRU
• High blood pressure is a dangerous
disease.,IQRWEURXJKWXQGHUFRQWUROLWFDQ
Cut Down on Salt lead to strokes and heart attacks.
• 7U\WRGHFUHDVHWKHVDOW\RXDGGZKLOHFRRNLQJ • High blood pressure is a silent disease.
and not add any salt at the table. <RXFDQQRWWHOOKRZKLJKLWLVE\KRZ\RXIHHO
• $YRLG VDOWORDGHG IRRGV VXFK DV FKLSV 7KHRQO\ZD\RIWHOOLQJLVLQWKHGRFWRU¶VRI¿FH
FUDFNHUVDQGFDQQHGIRRGVKLJKLQVRGLXP ZLWKDEORRGSUHVVXUHFXII
• ,QVWHDGRIVDOWWU\FRRNLQJZLWKRWKHUÀDYRULQJV • High blood pressure is a lifelong disease.
such as lemon juice, mint, mustard, herbs, 'LHWH[HUFLVHDQGTXLWWLQJVPRNLQJFDQEULQJ
FXUU\HWF8VH\RXULPDJLQDWLRQ EORRGSUHVVXUHXQGHUFRQWUROEXWLWZLOOJREDFN
XSDJDLQLIWKHVHPHDVXUHVDUHVWRSSHG
Quit Smoking
• Cigarette smokers not only drive up their blood
SUHVVXUHEXWDOVRUXQWZLFHWKHULVNRIKHDUW
attack as nonsmokers.

Get More Exercise


• :DONXSDQGGRZQVWDLUVUDWKHUWKDQWDNLQJ
WKHHOHYDWRU:DONWKHIHZEORFNVWRWKHVWRUH
rather than hopping in the car, etc.
• Try to be physically active every day, and
WZLFHDVDFWLYHRQZHHNHQGV
Cardiovascular Disease 107

Mitral Valve Prolapse


Mitral Valve:7KHOHIWDWULRYHQWULFXODUYDOYHWKHYDOYHEHWZHHQWKHOHIWDWULXPDQGWKHOHIWYHQWULFOHRIWKHKHDUW
LWLVFRPSRVHGRIWZRFXVSVDQWHULRUDQGSRVWHULRU&DOOHGDOVRWKHELFXVSLGYDOYH
Mitral Valve Prolapse (MVP): $FRQGLWLRQLQZKLFKVRPHSRUWLRQRIWKHPLWUDOYDOYHLVSXVKHGEDFNWRRIDUGXULQJ
YHQWULFXODUFRQWUDFWLRQ)RUUHDVRQVQRWIXOO\XQGHUVWRRG WKHUHLVQRHYLGHQWGLVHDVHSURFHVV WKHUHLVUHGXQGDQW
WLVVXHRQRQHRUERWKOHDÀHWVRIWKHYDOYH7KHSURODSVHGSRUWLRQRIWKHYDOYHFDXVHVDFOLFNLQJVRXQGDWWKH
HQGRIYHQWULFXODUFRQWUDFWLRQ7KLVVRXQGLVIROORZHGE\DV\VWROLFPXUPXUDVEORRGLVUHJXUJLWDWHGEDFNWKURXJK
WKHPLWUDOYDOYHDQGLQWRWKHOHIWDWULXP7KHFRQGLWLRQLVWKHUHIRUHDOVRNQRZQDVWKHclick-murmur syndrome.
(FKRFDUGLRJUDSK\FDQGHPRQVWUDWHWKHPLWUDOYDOYHDVLWSURODSVHVLQWRWKHOHIWDWULXP$QRWKHUQDPHIRU093
is Barlow’s syndrome,DIWHUWKHSK\VLFLDQZKRLQ¿UVWDVVRFLDWHGWKHSKHQRPHQRQZLWKVRPHSRWHQWLDOO\
VHULRXVFRPSOLFDWLRQVVXFKDVLQIHFWLYHHQGRFDUGLWLVWUDQVLHQWLVFKHPLFDWWDFNDQGDUUK\WKPLD+RZHYHULQWKH
YDVWPDMRULW\RISHUVRQVLQZKRP093FDQEHGHWHFWHGE\DXVFXOWDWLRQWKHUHDUHQRRWKHUV\PSWRPVDQGWKH
condition is so benign as to require no treatment.
093LVIRXQGLQSHUVRQVRIDOODJHVDQGLVIDLUO\FRPPRQ7KHIHZZKRKDYHSUREOHPVXVXDOO\H[SHULHQFHVRPH
FKHVW SDLQ G\VSQHD SDOSLWDWLRQV DQG IDWLJXH 6\QFRSH DQG DQ[LHW\ DOVR RFFXU WKRXJK OHVV FRPPRQO\ 0DQ\
SDWLHQWVEHFRPHOHVVDQ[LRXVZKHQWKH\XQGHUVWDQGWKHGLIIHUHQFHEHWZHHQ093DQGFRURQDU\KHDUWGLVHDVH
(OHFWURFDUGLRJUDSKLFVWXGLHVPD\VKRZVRPHSUHPDWXUHYHQWULFXODUFRQWUDFWLRQV 39&V EXWXQOLNHWKRVHLQFRURQDU\
KHDUWGLVHDVHWKH39&VDUHQRWKDUPIXOQRUGRWKH\LQGLFDWHLQMXU\WRWKHKHDUWPXVFOH
/RQJWHUPHIIHFWVRI093KDYHQRWEHHQWKRURXJKO\GRFXPHQWHGRZLQJWRWKHUHODWLYHO\VKRUWWLPHWKDWLWKDV
EHHQUHFRJQL]HGDVDGLVHDVHHQWLW\7KHUHDUHVXI¿FLHQWGDWDWRVKRZWKDWDOPRVWDOOSHUVRQVZLWK093FDQOHDG
QRUPDODQGIXOOOLYHV
Review Article:7KHKLVWRSDWKRORJ\VRPDWLFPRUSKRORJ\DQGJHQHWLFVRI093VXSSRUWWKHOHDGLQJWKHRU\WKDW
LWUHVXOWVIURPDKHUHGLWDU\GLVRUGHURIFRQQHFWLYHWLVVXH/DWHQWWHWDQ\GXHWRFKURQLFPDJQHVLXPGH¿FLWRFFXUV
LQRYHURIFDVHVDQG093FRPSOLFDWHVRIFDVHVRIODWHQWWHWDQ\0DJQHVLXPGH¿FLHQF\KLQGHUVWKH
PHFKDQLVPE\ZKLFK¿EUREODVWVGHJUDGHGHIHFWLYHFROODJHQLQFUHDVHVFLUFXODWLQJFDWHFKRODPLQHVSUHGLVSRVH
WRDUUK\WKPLDVWKURPERHPEROLFSKHQRPHQDDQGG\VUHJXODWLRQRIWKHLPPXQHDQGDXWRQRPLFQHUYRXVV\VWHP
PDJQHVLXPWKHUDS\UHOLHYHV093V\PSWRPV *DOODQG/'HWDO0DJQHVLXPGH¿FLHQF\LQWKHSDWKRJHQHVLVRI
mitral valve prolapse. Magnesium 5(3-4):165-74, 1986).
Experimental Study: FKLOGUHQZLWK093DJHGUHFLHYHG&R4PJNJGD\&R4ZDVIRXQG
WREHGH¿QLWHO\HIIHFWLYHIRUV\PSWRPDWLF093DQGLPSURYHGVWUHVVLQGXFHGFDUGLDFG\VIXQFWLRQLIWKHDSSURFLDWH
GRVHZDVJLYHQ1RVLGHHIIHFWVZHUHQRWHG:KHQWKHVXSSOHPHQWZDVZLWKGUDZQV\PSWRPVUHWXUQHG5DSLG
QRUPDOL]DWLRQFRXOGEHXVXDOO\EHDFKLHYHGLQZNRQGRVHVRIPJNJGD\ZLWKJUDGXDOGHFUHDVHVWRD
SDWLHQWGHSHQGDQWVWDELOL]DWLRQGRVH(Oda T. Effect of coenzyme Q10 on stress-induced cardiac dysfunction in
paediatric patients with mitral valve prolapse: A study by stress echocardiography. Drugs exp Clin Res 11(8):557-
76,1985).

Nutrients Involved
Magnesium, Coenzyme Q10

Suggested Nutritional Supplementation


• Mag Glycinate ²WDEOHWVWLPHVGDLO\ZLWKPHDOV
0DJ*O\FLQDWHDYDLODEOHH[FOXVLYHO\IURP0HWDJHQLFVLVDUHYROXWLRQDU\IXOO\UHDFWHGDPLQRDFLGFKHODWH
SURGXFHGE\DXQLTXHSDWHQWHGSURFHVVWKDWLVGHVLJQHGWRHQKDQFHDEVRUSWLRQDQGLQWHVWLQDOWROHUDQFHRI
magnesium.
0DJQHVLXPDSSHDUVWRSOD\DQLPSRUWDQWUROHLQWKHSDWKRJHQHVLVRIPLWUDOYDOYHSURODSVH
• CoQ10 200 mg²PJSHUOEVRIERG\ZHLJKWGDLO\LQLWLDOO\2QFHLPSURYHPHQWRFFXUVJUDGXDOO\
reduce to a maintenance dosage.
&R467IHDWXUHVPJRIDVWDELOL]HGDOOQDWXUDOHQFDSVXODWLRQRIFRHQ]\PH4 &R4 PDQXIDFWXUHG
WRDFKLHYHH[TXLVLWHTXDOLW\SXULW\DQGELRDYDLODELOLW\
&R4ZDVIRXQGWREHHIIHFWLYHIRUV\PSWRPDWLF093DQGLPSURYHVWUHVVLQGXFHGFDUGLDFG\VIXQFWLRQ

Dietary Suggestions
• FirstLine Therapy® Diet
108 Carpal Tunnel Syndrome

Carpal Tunnel Syndrome


$QHQWUDSPHQWQHXURSDWK\RIWKHPHGLDQQHUYHDQGOHVVFRPPRQO\FRPSUHVVLRQRIWKH¿QJHUÀH[RUWHQGRQV
SURGXFLQJ SDUHVWKHVLD DWURSK\ DQG ZHDNQHVV LQ WKH DIIHFWHG KDQG7KH V\QGURPH LV FDXVHG E\ FRQWLQXRXV
SUHVVXUHRQWKHPHGLDQQHUYHDVLWSDVVHVWKURXJKWKHDQWHULRUFDUSDOWXQQHOZKLFKLVGH¿QHGE\WKHFDUSDO
ERQHV SUR[LPDOO\SLVLIRUPDQGWKHWXEHUFOHRIWKHQDYLFXODUGLVWDOO\KRRNRIWKHKDPDWHDQGWKHWXEHUFOHRI
trapezium) and the transverse carpal ligament.
0DQ\IDFWRUVDUHDVVRFLDWHGZLWKWKHQDUURZLQJRIWKHFDUSDOWXQQHODFURPHJDO\P\[HGHPDUKHXPDWRLGDUWKULWLV
WHQRV\QRYLWLV IURP UHSHDWHG ÀH[LRQSURQDWLRQ VXSLQDWLRQ PRYHPHQWV RI WKH ZULVW VHZLQJ W\SLQJ GULQNLQJ 
DQWHULRUGLVORFDWLRQRUVXEOX[DWLRQRIWKHOXQDWHERQH3DJHW¶VGLVHDVHVZHOOLQJVHFRQGDU\WR&ROOHV¶IUDFWXUHRI
WKHGLVWDOHQGRIWKHUDGLXVVWUDLQVRUVSUDLQVRIWKHZULVWSUHPHQVWUXDOHGHPDRUHGHPDRISUHJQDQF\JRXW
WXEHUFXORVLVDQGDP\ORLGRVLV
,UULWDWLRQRIWKHQHUYHDWWKHEUDFKLDOSOH[XVRUDORQJLWVURXWHWRWKHZULVWVXFKDVDWWKHHOERZPDNHWKHPHGLDQ
QHUYHPRUHVXVFHSWLEOHWRLUULWDWLRQDWWKHFDUSDOWXQQHO ³GRXEOHFUXVKSKHQRPHQRQ´ 
7KHXQWUHDWHGFRXUVHXVXDOO\HQWDLOVDJUDGXDOO\ZRUVHQLQJVLWXDWLRQ&RQYHQWLRQDOPHGLFLQHDWWHPSWVWRVXUJLFDOO\
UHOHDVHWKHFRPSUHVVLRQE\UHVSHFWLQJWKHÀH[RUUHWLQDFXOXPDSURFHGXUHWKDWLVQRWHIIHFWLYHDQGLVRIWHQ
IROORZHGE\WKHGHYHORSPHQWRIWKHV\QGURPHLQWKHRWKHUSUHYLRXVO\QRUPDOKDQG

Symptoms
3DLQV LQ KDQGV HOERZV VKRXOGHUV RU NQHHV PRUQLQJ VWLIIQHVV RI ¿QJHUV LPSDLUHG ¿QJHU ÀH[LRQ WUDQVLWRU\
QRFWXUQDO SDUDO\VLV RI DUP DQG KDQG SDUHVWKHVLD RI KDQGV SRVVLEO\ DOVR RI IDFH  SDLQIXO DGGXFWLRQ URWDWLRQ
RIWKHWKXPEDWPHWDFDUSRSKDODQJHDOMRLQWZHDNQHVVRIKDQGJULSÀXFWXDWLQJHGHPDLQKDQGVIHHWRUDQNOHV
LPSDLUHG WDFWLOH VHQVDWLRQV LQ ¿QJHUV WHQGHUQHVV RYHU FDUSDO WXQQHO GURSSLQJ RI REMHFWV QRFWXUQDO PXVFOH
VSDVPVLQH[WUHPLWLHV

Office Evaluation
1. +ROGWKHKDQGVRXWZLWKSDOPVXS
2. %HQGWKH¿QJHUVDWWKHRXWHUMRLQWVRQO\OHDYLQJWKHPHWDFDUSRSKDODQJHDOMRLQWVLQDVWUDLJKWOLQHZLWK
WKHZULVWV
3. %ULQJWKHWLSVRIWKH¿QJHUVGRZQWRWKHSDOPVRIWKHKDQGVULJKWWRWKHFUHDVHWKDWVHSDUDWHV¿QJHUV
IURPKDQGV
4. ,I DQ\ RI WKHVH  MRLQWV FDQQRW EH EHQW FRPSOHWHO\ DQG ZLWKRXW SDLQ FDUSDO WXQQHO V\QGURPH LV
suspected.

Nutrients Involved
9LWDPLQ%PDJQHVLXPHVVHQWLDOIDWW\DFLGVYLWDPLQ%EURPHODLQELRÀDYRQRLGV

Suggested Nutritional Supplementation


• EZ Flex²WDEOHWVGDLO\ZLWKPHDOV
1XWULWLRQDOVXSSRUWIRUWHQGRQQHUYHDQGPXVFOHIXQFWLRQ
• EPA-DHA 6:1²VRIWJHOVWLPHVGDLO\ VHH(3$'+$VHFWLRQLQDSSHQGL[
)RUUHOLHIRIPLQRUSDLQ
• ,QÀDYRQRLG,QWHQVLYH&DUH²WDEOHWVGDLO\ZLWKPHDOV
)RUUHOLHIRIPLQRUSDLQ
-0(OOLV0'SXEOLVKHGDQDUWLFOHLQWKH6RXWKHUQ0HGLFDO-RXUQDOGRFXPHQWLQJWKHHIIHFWLYHQHVVRIYLWDPLQ%
LQFDUSDOWXQQHOV\QGURPH7KLVVWXG\LVLQWHUHVWLQJLQWKDWLWVKRZVWKDWWKHYLWDPLQ%GH¿FLHQF\ZDVFRUUHFWHG
ZLWKLQIRXUZHHNVEXWWKDWLWWRRN:((.6WRUHOLHYHWKHVLJQVRIWKHV\PSWRPVRIFDUSDOWXQQHOV\QGURPH
7KHZHHNUHVSRQVHWLPHLQFDUSDOWXQQHOV\QGURPHGHPRQVWUDWHVDXQLTXHDVSHFWRIQXWULWLRQDOKHDOWKFDUH
7UHDWPHQWVFDQWDNHPRQWKVLQVRPHFDVHV7KLVUHTXLUHVSDWLHQFHRQWKHSDUWRIWKHSDWLHQWDQGSHUVLVWHQFHE\
WKHGRFWRU7KHSDWLHQWVKRXOGDOZD\VUHPHPEHUWKDWZLWKQXWULWLRQSURJUHVVLVVRPHWLPHVVORZEXWVXFFHVVLV
XVXDOO\SHUPDQHQWDQGIUHHRIQHJDWLYHVLGHHIIHFWV

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW

Exercise Considerations
6WUHQJWKHQLQJH[HUFLVHVIRUWKHZULVWOLNHVTXHH]LQJDEDOOZULVWÀH[LRQDQGH[WHQVLRQZLWKVPDOOZHLJKWV
Cerebral Palsy 109

Cerebral Palsy
Pathological Considerations
$OVRFDOOHG/LWWOH¶V'LVHDVHRU&RQJHQLWDO6SDVWLF3DUDO\VLVWKLVFRQGLWLRQLVXVXDOO\WKHUHVXOWRIGHYHORSPHQWDO
GHIHFWVLQWKHEUDLQRUFHQWUDOQHUYRXVV\VWHPRUIURPWUDXPDDWELUWK,WLVDQRQSURJUHVVLYHV\PPHWULFDODQG
ELODWHUDO SDUDO\VLV DOWKRXJK WKH SK\VLFDO DQG PHQWDO GHIHFWV PD\ QRW EH IXOO\ HYLGHQW IRU VHYHUDO \HDUV DIWHU
birth.

Physiological Considerations
6SDVWLFDWD[LFDQGDWKHWRLGW\SHVRIWKLVSDUDO\VLVDUHVHHQGHSHQGLQJXSRQZKHWKHUWKHFRUWH[FHUHEHOOXP
RUWKHEDVDOJDQJOLDLVDIIHFWHGPRVWVHYHUHO\0L[WXUHVRIWKHVHW\SHVDUHWKHUXOH$ERXWRIWKHVHFDVHV
VKRZDSSDUHQWPHQWDOUHWDUGDWLRQ

Medical Approach
0D[LPDOLQGHSHQGHQFHZLWKLQWKHOLPLWVRIWKHSDWLHQW¶VPRWRUDQGDVVRFLDWHGKDQGLFDSVLVWKHJRDORIWUHDWPHQW
LQWKHVHFDVHV:LWKSURSHUPDQDJHPHQWRIWKHPRWRUKDQGLFDSWKHSDWLHQWFDQRIWHQOLYHDQHDUQRUPDOOLIH
+RZHYHU VHL]XUHV RIWHQ UHTXLUH WKH XVH RI DQWLFRQYXOVDQWV IRU FRQWURO 6XSSRUW IRU WKH SDWLHQW LQ WKH IRUP RI
VSHHFKWKHUDS\SK\VLFDOWKHUDS\RFFXSDWLRQDOWUDLQLQJLQFRQMXQFWLRQZLWKRUWKRSHGLFVXUJHU\DQGEUDFLQJZLWK
VSOLQWVDQGSODVWLFIRUP¿WWLQJGHYLFHVSURYLGHVERWKPHQWDODQGSK\VLFDOKHOSDQGHQFRXUDJHPHQW+RZHYHULW
LVQRWUHDOLVWLFIRUPDQ\RIWKHVHSDWLHQWVWRWU\WRUHDOL]HWRWDOVRFLDOLQGHSHQGHQFHEHFDXVHRIYDU\LQJGHJUHHV
RIDVVLVWDQFHDQGVXSHUYLVLRQQHHGHGWKURXJKRXWPRVWRIWKHLUOLYHV7KHSDUHQWVRIWKHVHFKLOGUHQRIWHQQHHG
FRQWLQXLQJ JXLGDQFH DQG DVVLVWDQFH LQ XQGHUVWDQGLQJ DQG FDULQJ IRU WKH FKLOG¶V ZHOIDUH LQ RUGHU WR UHDFK WKH
FKLOG¶VPD[LPDOSRWHQWLDO

Treatment
5HJDUGOHVVRIWKHH[WHQWRIWKHSDWKRORJ\DQGDFFRPSDQ\LQJV\PSWRPVWUHDWPHQWLVEDVLFDOO\WKHVDPHIURPD
QXWULWLRQDOYLHZSRLQW1XWULWLRQDOWKHUDS\ZLOOQRWUHVWRUHGHVWUR\HGEUDLQRUQHUYHFHOOVEXWLWFDQJUHDWO\DLGLQ
WKHGHYHORSPHQWRIIXQFWLRQDOFRQWUROYLDFROODWHUDOFHOOVLQWKHEUDLQDQGFHQWUDOQHUYRXVV\VWHP,WDOVRJRHVD
ORQJZD\LQUHOLHYLQJWKHWHUULEOHVWUHVVVHHQLQWKHVHSDWLHQWV,WFDQEXLOGVWUHQJWKDQGUHVLVWDQFHWRLQIHFWLRQ
DQGLQWHUFXUUHQWVHFRQGDU\GLVHDVHLQYDVLRQDQGLWYHU\RIWHQLPSURYHVWKHPHQWDORXWORRNRIWKHVHSDWLHQWVDV
they become mature.

Suggested Nutritional Supplementation


• Wellness Essentials — 2 packets daily
2SWLPDO GDLO\ QXWULWLRQ LQ HDV\WRXVH GDLO\ SDFNHWV ZKLFK SURYLGH D VSHFLDO FRPELQDWLRQ RI QXWULHQWV WKDW
XQLTXHO\VXSSRUWKHDOWK\SK\VLRORJ\DQDWRP\DQGVXSSRUWVGHWR[L¿FDWLRQ
• Lumina ²VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQLVVXHVUHODWHGWRSURSHUIRFXVDWWHQWLRQ
OHDUQLQJDQGPHPRU\WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQHJDPPD
DPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH'+$/HVVHQVLUULWDELOLW\DFKLHYHVJUHDWHUDOHUWQHVVDQGLV
RIWHQLQVWUXPHQWDOLQDIIHFWLQJEHWWHUEODGGHUFRQWURO
• Ceriva ²VRIWJHOVGDLO\
&HULYDLVIRUPXODWHGWRVXSSRUWKHDOWK\FRJQLWLYHIXQFWLRQLQWKRVHFRQFHUQHGDERXWPDLQWDLQLQJWKHLUEUDLQ
IXQFWLRQE\EHQH¿FLDOO\PRGXODWLQJDFHW\OFKROLQH
• Lipoic Acid²FDSVXOHVGDLO\
3RZHUIXODQWLR[LGDQW,WFDQDOVRSDVVWKURXJKWKHEORRGEUDLQEDUULHUDQGWKXVSURWHFWEUDLQFHOOVIURPIUHH
UDGLFDOGDPDJHLQFUHDVHEUDLQHQHUJ\DYDLODELOLW\DQGVNHOHWDOPXVFOHSHUIRUPDQFH
• SpectraZyme²WDEOHWVZLWKHDFKPHDO
(Q]\PHIDFWRUVZKLFKDLGLQLQWHVWLQDODEVRUSWLRQDQGDVVLPLODWLRQ$LGVSURWHLQGLJHVWLRQDQGDLGVLQSKDJRF\WLF
activity.
• Perfect Protein or Ultimate Protein²VFRRSVGDLO\
3URWHLQVXSSOHPHQWDWLRQLVDEVROXWHO\QHFHVVDU\LQWKHVHFDVHVWRVXSSRUWVSHFL¿FFRPSRQHQWVDIIHFWLQJ
muscle tissue tone and regeneration.
110 Cerebral Palsy

Diagnostic Tests Indicated


&%&XULQHDQDO\VLV YHU\LPSRUWDQWWRREVHUYHDQ\XULQDU\ORVVRIFUHDWLQHZKLFKLISUHVHQWLQWKHVHFDVHV
LQGLFDWHVPXVFOHGHVWUXFWLRQ OLYHUSUR¿OHWHVWVDQGNLGQH\SUR¿OHWHVWV
NOTE: 5HVHDUFKHUV DW WKH &HQWHUV )RU 'LVHDVH &RQWURO LQ $WODQWD FRQFOXGHG WKDW JLYLQJ SUHJQDQW ZRPHQ
PDJQHVLXPPD\VLJQL¿FDQWO\UHGXFHWKHLQFLGHQFHRIFHUHEUDOSDOV\LQLQIDQWVZKRDUHERUQZHLJKLQJOHVVWKDQ
SRXQGV -$0$'HFHPEHU  

Dietary Suggestions
• FirstLine Therapy® Diet
Chronic Fatigue Syndrome 111

Chronic Fatigue Syndrome


&KURQLFSHUVLVWHQWRUUHODSVLQJGHELOLWDWLQJIDWLJXHRUHDVLO\IDWLJXHGWKDWGRHVQRWUHVROYHZLWKEHGUHVWDQGWKDW
LVVHYHUHHQRXJKWRUHGXFHRULPSDLUDYHUDJHGDLO\DFWLYLW\EHORZRISUHPRUELGDFWLYLW\OHYHO$VVRFLDWHG
V\PSWRPVPLOGIHYHUVRUHWKURDWSDLQIXOO\PSKQRGHVPXVFOHZHDNQHVVP\DOJLDKHDGDFKHVDUWKUDOJLDQHXUR
psychological complaints, sleep disturbances.

International CFS Study Group Definition of Chronic Fatigue Syndrome


I. Clinically evaluated, unexplained persistent or relapsing chronic fatigue that:
• LVRIQHZRUGH¿QLWHRQVHW KDVQRWEHHQOLIHORQJ 
• LVQRWWKHUHVXOWRIRQJRLQJH[HUWLRQ
• is not substantially alleviated by rest.
• UHVXOWVLQVXEVWDQWLDOUHGXFWLRQLQSUHYLRXVOHYHOVRIRFFXSDWLRQDOHGXFDWLRQDOVRFLDORUSHUVRQDODFWLYLWLHV
II. The concurrent occurrence of four or more of the following symptoms, all of which must have persisted or
recurred during six or more consecutive months of illness and must not have predated the fatigue:
• VHOIUHSRUWHGLPSDLUPHQWLQVKRUWWHUPPHPRU\RUFRQFHQWUDWLRQVHYHUHHQRXJKWRFDXVHVXEVWDQWLDOUHGXFWLRQ
LQSUHYLRXVOHYHOVRIRFFXSDWLRQDOHGXFDWLRQDOVRFLDORUSHUVRQDODFWLYLWLHVVRUHWKURDW
• WHQGHUFHUYLFDORUD[LOODU\O\PSKQRGHV
• muscle pain
• PXOWLMRLQWSDLQZLWKRXWMRLQWVZHOOLQJRUUHGQHVV
• KHDGDFKHVRIDQHZW\SHSDWWHUQRUVHYHULW\
• XQUHIUHVKLQJVOHHS
• SRVWH[HUWLRQDOPDODLVHODVWLQJPRUHWKDQKRXUV

Suspected Etiologies for Chronic Fatigue Syndrome


• 9LUDOLQIHFWLRQVDQGWKHSRVWYLUDOIDWLJXHV\QGURPH
• Fibromyalgia
• 1HXUDOO\PHGLDWHGK\SRWHQVLRQ
• 3V\FKRJHQLFELRORJLFDOG\VIXQFWLRQ
• /RZQDWXUDONLOOHUFHOOV\QGURPH

Factors Suspected of Promoting Chronic Fatigue Syndrome


• +\SR[HPLD(QGRFULQHG\VIXQFWLRQ,PPXQHG\VIXQFWLRQ
• 6WUHVVUHODWHGG\VIXQFWLRQ
• 6RPDWRIRUPGLVRUGHU
• 0DUJLQDOQXWULWLRQDOGH¿FLHQFLHV,QWHVWLQDOK\SHUSHUPHDELOLW\
• 2YHUJURZWKRISDWKRJHQLFLQWHVWLQDOÀRUD G\VELRVLV
• Food and chemical sensitivities
• &KHPLFDOWR[LFLW\
• +HDY\PHWDOWR[LFLW\

Symptoms
Fatigue:7KHGHJUHHPD\EHPLOGEHLQJDEOHWRSHUIRUPDWZRUNRUKRPHEXWHDVLO\IDWLJXHGIURPLWRULWPD\
be intense, causing patients to give up their jobs and greatly curtailing other activities. Sometimes they may be
EHGULGGHQDQGVOLJKWDFWLYLWLHVVXFKDVKRXVHFOHDQLQJRUJRLQJIRUDZDONPD\QHFHVVLWDWHDUHFRYHU\SHULRG
RIGD\V8VXDOO\PRUHVWUHQXRXVH[HUWLRQDQGH[HUFLVLQJDUHLPSRVVLEOH)UHTXHQWO\WKRXJKSDWLHQWVKDYH
DOWHUQDWLQJSHULRGVRIIDWLJXHDQGQRUPDOF\7KHGLVHDVHXVXDOO\EHJLQVJUDGXDOO\ZLWKWKHIDWLJXHVORZO\JURZLQJ
XQWLOLWEHFRPHVRYHUZKHOPLQJ2WKHUV\PSWRPVLQFOXGH
• Recurrent pharyngitis • HEENT lymphadenopathy
 ‡5HFXUUHQWKHDGDFKHV ‡&KURQLFORZJUDGHIHYHU
• Myalgia and/or arthralgia • Inability to concentrate
 ‡*DVWURLQWHVWLQDOXSVHW ‡(PRWLRQDOXSVHWDQGRUGHSUHVVLRQ
 ‡7KHSDWLHQWPD\KDYHDKLVWRU\RIDOOHUJLHV
GLI¿FXOW\VOHHSLQJZHLJKWORVVRUJDLQ
112 Chronic Fatigue Syndrome

Lab Findings
:KLOHODERUDWRU\GLDJQRVLVRIWKLVFRQGLWLRQXVHGWREHSURKLELWLYHO\H[SHQVLYHDQGLQDGHTXDWHVRPHODEVQRZ
SURYLGHUHDVRQDEO\SULFHGFRPSUHKHQVLYHSDQHOVVKRZLQJWLWHUVRIGLIIHUHQWFDXVDWLYHDJHQWVXVXDOO\(SVWHLQ%DUU
YLUXV&\WRPHJDORYLUXVWR[RSODVPRVLV&DQGLGD6XEW\SLQJRIDQWLJHQVDOORZVDFFXUDWHGLDJQRVLVRISUHVHQW
FKURQLFDFWLYHRULQDFWLYHLQIHFWLRQVEXWVHYHULW\RIV\PSWRPVGRQRWDOZD\VFRUUHODWHZLWKWKHODE¿QGLQJV6RPH
SDWLHQWVZLWKH[WUHPHO\KLJKWLWHUVIRUDSDUWLFXODUDJHQWPD\EHV\PSWRPIUHHZKLOHRWKHUVZLWKORZWLWHUVPD\
EHH[WUHPHO\V\PSWRPDWLF0DQ\VHHGHFUHDVHG:%&FRXQWLQFUHDVHGO\PSKVRUDW\SLFDOO\PSKVRQSHULSKHUDO
smear.

Course and Prognosis


7KLVGLVRUGHULVQRWZHOOUHFRJQL]HGE\PRVWFRQYHQWLRQDOSK\VLFLDQVGHVSLWHHPSLULFDOHYLGHQFHDQGFOLQLFDO
UHVHDUFK&RQYHQWLRQDOWUHDWPHQWLQYROYHVVXSSUHVVLRQDQGRUSDOOLDWLRQRIV\PSWRPVHJVDOLF\ODWHVIRUIHYHU
KHDGDFKHVDQGP\DOJLD:LWKQRIXUWKHUGLDJQRVLVRUWUHDWPHQWWKHSDWLHQWLVOLNHO\WRKDYHERXWVRIUHPLVVLRQV
DQGH[DFHUEDWLRQVWKDWPD\GHYHORSLQWRDFRQVWDQWSHUVLVWHQWGLVHDVH$SSURSULDWHGLDJQRVLVDQGWUHDWPHQW
OHDGWRH[FHOOHQWUHFRYHU\UDWHVLQPRVWVXIIHUHUVZKRFRPSO\

Nutrients Involved
Vitamin B12 Note: CFS patients generally have B12 metabolism problems requiring much higher B12
VXSSOHPHQWDWLRQ 6XEOLQJXDO PDJQHVLXP DVVHVVPHQW LV PRUH LQGLFDWLYH RI PDJQHVLXP VWDWXV DV WKH FHOOV
VXEOLQJXDO DUHLQFUHDVLQJWXUQRYHUFHOOVZLWKPLWRFKRQGULDYV5%&KDYHQRPLWRFKRQGULD &)6SDWLHQWVKDYH
energy production problems).

Suggested Nutritional Supplementation


• AdvaClear® and UltraClear PLUS® $GYDQFHG %LIXQFWLRQDO 'HWR[L¿FDWLRQ 3URJUDP VHH 'HWR[L¿FDWLRQ
VHFWLRQIRUVSHFL¿FV
• EPA-DHA 720 ²FDSVXOHVGDLO\ZLWKIRRG
(3$'+$  SURYLGHV  PJ RI RPHJD HVVHQWLDO IDWW\ DFLGV IURP FROG ZDWHU ¿VK SHU VRIWJHO²
HLFRVDSHQWDHQRLFDFLG (3$ DQGGRFRVDKH[DHQRLFDFLG '+$
• Mitochondrial Resuscitate ²FDSVXOHVWLPHVGDLO\EHWZHHQPHDOV
0LWRFKRQGULDO5HVXVFLWDWHLVVFLHQWL¿FDOO\GHVLJQHGWRSURYLGHQXWULWLRQDOVXSSRUWIRUKHDOWK\FHOOXODUHQHUJ\
$73 SURGXFWLRQ
• CoQ10 ST-100™ VRIWJHOVGDLO\
6WDELOL]HG+LJKO\$EVRUEDEOH&RHQ]\PH4ZLWK1DWXUDO9LWDPLQ(DQG%HWD&DURWHQH
• Intrinsi B12/Folate ²WDEOHWVWLPHVGDLO\ZLWKIRRG
,QWULQVL%)RODWHSURYLGHVYLWDPLQ%DQGIRODWHVLQFRPELQDWLRQZLWKLQWULQVLFIDFWRUIRUHQKDQFHGDEVRUSWLRQ
and assimilation
• Kre-Alkalyn ²FDSVXOHVWZLFHGDLO\
S+&RUUHFW&UHDWLQHIRULQFUHDVHGPXVFOH$73

Dietary Suggestions
• 0RGL¿HG(OLPLQDWLRQ'LHW
Avoid:
• dairy
• LQFUHDVHGIDW
• red meat
• gluten
• DUJLQLQHULFKIRRGV
9LUDOSURWHLQVWUXFWXUHVDUHDUJLQLQHULFKYVKXPDQSURWHLQVWUXFWXUHVZKLFKDUHO\VLQHULFK HJ&)6SDWLHQWVLQ
JHQHUDOKDYHGHFUHDVHGDUJLQLQHE\DPLQRDFLGDQDO\VLVSRVVLEO\EHFDXVHRILQFUHDVHGYLUDOUHSOLFDWLRQ
Common Cold 113

Common Cold
7KHFRPPRQFROGLVDQXSSHUUHVSLUDWRU\LQIHFWLRQFDXVHGE\DYLUXV,QWKH8QLWHG6WDWHVDGXOWVKDYHEHWZHHQ
3 and 6 colds a year, and children have as many as 8 to 10.

Signs and Symptoms


• 6QHH]LQJDQGUXQQ\QRVHIURPQDVDOFRQJHVWLRQ
• Sore throat
• Cough
• Hoarseness
• )HYHU )RUORZHU 
• Headache

Causes
0RUHWKDQGLIIHUHQWW\SHVRIYLUXVHVFDXVHFROGV<RXFDQJHWDFROGE\WRXFKLQJDSHUVRQZLWKDFROG IRU
H[DPSOH E\ VKDNLQJ KDQGV ZLWK D SHUVRQ ZLWK D FROG  DQG WKHQ WRXFKLQJ \RXU QRVH RU H\HV &ROGV DUH DOVR
WUDQVPLWWHGWKURXJKWKHDLU([SRVXUHWRFROGRXWGRRUDLUDQGIDWLJXHGRQRWPDNH\RXPRUHOLNHO\WRJHWDFROG
although psychological stress may.

Risk Factors
3HRSOHPRUHOLNHO\WRJHWFROGVLQFOXGH
• Children and those over 65
• &KLOGUHQZKRKDYHSDUHQWVZKRVPRNH
• &KLOGUHQZKRDWWHQGGD\FDUH
• 6PRNHUVDQGWKRVHH[SRVHGWRVHFRQGKDQGVPRNH
• 7KRVHH[SRVHGWRLQGXVWULDOVPRNHWR[LFIXPHVRURWKHUDLUSROOXWDQWV
• 3HRSOH ZLWK LPPXQH V\VWHP GLVRUGHUV OLNH +,9$,'6 RU FDQFHU RU FRPSURPLVHG LPPXQH IXQFWLRQ OLNH
WKRVHWDNLQJVWHURLGVIRUDORQJWLPH
• 3HRSOHXQGHUDIDLUDPRXQWRIVWUHVV
,QDGGLWLRQFROGVDUHPRUHOLNHO\GXULQJWKHZLQWHUPRQWKVEXWQRWEHFDXVHRIH[SRVXUHWRFROGDLU7KLVLVOLNHO\
EHFDXVHRIWKHLQFUHDVHGFRQWDFWZLWKRWKHUVZKRDUHVLFNGXHWRPRUHWLPHVSHQWLQGRRUV

Diagnosis
0RVWSHRSOHUHFRJQL]HWKDWWKH\KDYHDFROGDQGWUHDWLWWKHPVHOYHVZLWKRXWVHHLQJDGRFWRU,I\RXGRVHH\RXU
GRFWRUWKHGLDJQRVLVZLOOEHPDGHEDVHGRQ\RXUV\PSWRPVDQGH[DP7HVWVDUHQRWQHFHVVDU\&ROGVJHQHUDOO\
JRDZD\RQWKHLURZQDIWHUDERXWWRGD\V,I\RXKDYHDQXQGHUO\LQJOXQJFRQGLWLRQKRZHYHUOLNHDVWKPDRU
HPSK\VHPD\RXVKRXOGOHW\RXUGRFWRUNQRZULJKWDZD\ZKHQ\RXJHWDFROG

Preventive Care
$OWKRXJKDQ\RQHDQGHYHU\RQHFDQJHWDFROGWKHUHDUHDIHZWKLQJVWKDW\RXFDQGRWKDWPD\KHOSLPSURYH\RXU
immune system and make you less susceptible to getting colds:
• ([HUFLVHUHJXODUO\
• (DWDSURSHUGLHWULFKLQIUXLWVDQGYHJHWDEOHVDQGORZLQIDW
• *HWVXI¿FLHQWUHVWDWDOOWLPHV
• 0LQLPL]H\RXUVWUHVVDQG\RXUUHDFWLRQWRVWUHVV&RQVLGHU\RJDWDLFKLRURWKHUIRUPVRIUHOD[DWLRQRQDQ
ongoing basis.
• :DVK\RXUKDQGVIUHTXHQWO\HVSHFLDOO\DIWHUFRPLQJLQWRFRQWDFWZLWKVRPHRQHZKRKDVDFROG

Treatment Approach
:LWKDFROGWKHJRDORIWUHDWPHQWLVWRLPSURYH\RXUV\PSWRPVDVTXLFNO\DVSRVVLEOH:LWKWKDWVDLGHYHQLI\RX
GRQRWKLQJWKH\VKRXOGJRDZD\ZLWKLQGD\V$QWLELRWLFV ZKLFKDUHIRUEDFWHULDOLQIHFWLRQV DQGDQWLKLVWDPLQHV
ZKLFKDUHIRUDOOHUJLHV FDQQRWKHOSFXUH\RXUFROG7KHUHDUHPHGLFDWLRQVKHUEVVXSSOHPHQWVDQGKRPHRSDWKLF
UHPHGLHVWKDWPD\PDNH\RXIHHOEHWWHUZKLOH\RXKDYHDFROG
114 Common Cold

Lifestyle
• 'ULQNDORWRIZDWHUWRKHOSORRVHQVHFUHWLRQV
• 5HVWWRUHVWRUH\RXUHQHUJ\DQGDYRLGFRPSOLFDWLRQVIURPWKHFROGOLNHEURQFKLWLVRUSQHXPRQLD
• (DWDGLHWULFKLQIUHVKIUXLWVDQGYHJHWDEOHV7KHVHIRRGVSURYLGHORWVRIDQWLR[LGDQWV VXEVWDQFHVWKDWPD\
help boost your immune system), especially vitamins A and C.

Suggested Nutritional Supplementation

Immune support for initial onset – 1st and 2nd Days of Immune Challenge
• Essential Defense®²WRWDEOHWVHYHU\KDOIKRXUDVQHHGHG
(VVHQWLDO'HIHQVHLVDWLPHKRQRUHGWUDGLWLRQDO&KLQHVHIRUPXODXVHGWRSURPRWHKHDOWK\LPPXQHIXQFWLRQ

Immune Support for the Duration


• Cold & Flu Remedy — Dissolve 15 drops in the mouth every 30 minutes, reducing to 3 to 4 times daily
&ROG )OX5HPHG\LVDKLJKTXDOLW\KDQGPDGHKRPHRSDWKLFIRUPXODGHVLJQHGWRUHOLHYHKHDGDFKHVIHYHU
FKLOOVUHVSLUDWRU\V\PSWRPVH[KDXVWLRQRUERG\DFKHV
• ImmuCore™ — 3 tablets daily
,PPX&RUHLVGHVLJQHGWRSURYLGHDPXOWLSOHPHFKDQLVWLFDSSURDFKWRVXSSRUWKHDOWK\LPPXQHV\VWHPIXQFWLRQ
WKURXJKHQKDQFLQJDFWLYLWLHVRIPDFURSKDJHVQDWXUDONLOOHUFHOOVDQG7FHOOVXEVHWV
• Andrographis Plus®²WDEOHWVHYHU\WZRKRXUVIRUKRXUVZLWKXQFKLOOHGZDWHU7KHQWDNHWDEOHW
WLPHVGDLO\EHWZHHQPHDOVIRU¿YHGD\V
$QGURJUDSKLV3OXVFRPELQHVDSURSULHWDU\EOHQGRI$\XUYHGLFDQG$VLDQKHUEVGHVLJQHGWRSURPRWHKHDOWK\
LPPXQHIXQFWLRQ
Depression 115

Depression
'HSUHVVLRQLVDPDMRUSUREOHPLQWKH8QLWHG6WDWHV1HDUO\PLOOLRQ$PHULFDQVZLOOVXIIHUWUXHFOLQLFDOGHSUHVVLRQ
HDFK\HDU'HSUHVVLRQLVDOVRDELJEXVLQHVVIRUGUXJFRPSDQLHVHVSHFLDOO\IRUWKHPDNHURI3UR]DF²(OL/LOO\
DQG&RPSDQ\7KHJRRGQHZVLVWKDWWKHUHDUHQDWXUDOPHDVXUHVWRGHDOZLWKGHSUHVVLRQWKDWDUHERWKVDIHUDQG
PRUHHIIHFWLYH
3URORQJHGSHUVLVWHQWGHSUHVVHGPRRGPD\EHDFFRPSDQLHGE\RQHRUPRUHRIWKHIROORZLQJSRRUDSSHWLWH
LQFUHDVHGDSSHWLWHLQVRPQLDH[FHVVLYHVOHHSLQJIDWLJXHK\SHUDFWLYLW\FRQVWDQWQHUYRXVQHVV MLWWHUV GHFUHDVHG
VH[XDOGULYHIHHOLQJVRIORZVHOIHVWHHPLQDELOLW\WRFRQFHQWUDWHRUUHFXUUHQWVXLFLGHFRPSXOVLRQ7KHSUHVHQFH
RI¿YHRUPRUHRIWKHVHV\PSWRPVGH¿QLWHO\LQGLFDWHVGHSUHVVLRQ
0RVWRIWKHKHDOWKSUREOHPVRI$PHULFDQVDUHUHODWHGWROLIHVW\OHDQGGLHWDU\SUDFWLFHV'HSUHVVLRQLVQRGLIIHUHQW
$WWKHURRWRIPDQ\FDVHVRIGHSUHVVLRQLVDQDGGLFWLRQWRQLFRWLQHFDIIHLQHDQGRWKHUVWLPXODQWV$FFRUGLQJWR
-RVHSK%HDVOH\0'WKHSULPDU\LQYHVWLJDWRULQYROYHGLQWKHIDPRXV.HOORJ5HSRUW7KH,PSDFWRI1XWULWLRQ
(QYLURQPHQWDQG/LIHVW\OHRQ,OOQHVVLQ$PHULFDWKH8QLWHG6WDWHVLVDQDWLRQRIDGGLFWV,QPDQ\LQVWDQFHV
people claim that they smoke, drink alcohol, or take drugs because it calms them. In reality, these substances
DFWXDOO\FRPSOLFDWHPDWWHUV7KHUHOD[DWLRQRUFKHPLFDOKLJKIURPWKHVHGUXJVLVVKRUWOLYHGDQGXOWLPDWHO\OHDGV
WRDGGLQJHYHQPRUHVWUHVVWRWKHV\VWHP,QGLYLGXDOVVXIIHULQJIURPGHSUHVVLRQRURWKHUSV\FKRORJLFDOFRQGLWLRQV
PXVWDEVROXWHO\VWRSVPRNLQJGULQNLQJDOFRKRODQGLQJHVWLQJFRIIHHDQGRWKHUVRXUFHVRIFDIIHLQH

Smoking and depression


&LJDUHWWHVPRNLQJLVDVLJQL¿FDQWIDFWRULQGHSUHVVLRQ&HQWUDOWRWKHHIIHFWRIQLFRWLQHLVWKHVWLPXODWLRQRIDGUHQDO
KRUPRQH LQFOXGLQJ FRUWLVRO VHFUHWLRQ (OHYDWHG FRUWLVRO OHYHOV DUH D ZHOOUHFRJQL]HG IHDWXUH RI GHSUHVVLRQ
2QHRIWKHNH\HIIHFWVRIFRUWLVRORQPRRGLVUHODWHGWRDFWLYDWLQJDQHQ]\PH WU\SWRSKDQR[\JHQDVH :KHQ
DFWLYDWHGWKLVHQ]\PHUHVXOWVLQOHVVWU\SWRSKDQEHLQJGHOLYHUHGWRWKHEUDLQ6LQFHWKHOHYHORIVHURWRQLQLQWKH
EUDLQLVGHSHQGHQWXSRQKRZPXFKWU\SWRSKDQLVGHOLYHUHGWRWKHEUDLQFRUWLVROGUDPDWLFDOO\UHGXFHVWKHOHYHO
RIVHURWRQLQDQGPHODWRQLQ,QDGGLWLRQFRUWLVRODOVR³GRZQUHJXODWHV´VHURWRQLQUHFHSWRUVLQWKHEUDLQPDNLQJ
WKHPOHVVVHQVLWLYHWRWKHVHURWRQLQWKDWLVDYDLODEOH6PRNLQJDOVROHDGVWRDUHODWLYHYLWDPLQ&GH¿FLHQF\DVWKH
YLWDPLQ&LVXWLOL]HGWRGHWR[LI\WKHFLJDUHWWHVPRNH/RZOHYHOVRIYLWDPLQ&LQWKHEUDLQFDQUHVXOWLQGHSUHVVLRQ
and hysteria.

Alcohol and depression


,QGLYLGXDOVZLWKGHSUHVVLRQPXVWDYRLGDOFRKRO$OFRKROLVDEUDLQGHSUHVVDQW,WDOVRLQFUHDVHVDGUHQDOKRUPRQH
RXWSXWLQWHUIHUHVZLWKPDQ\EUDLQFHOOSURFHVVHVDQGGLVUXSWVQRUPDOVOHHSF\FOHV$OFRKROLQJHVWLRQDOVROHDGVWR
K\SRJO\FHPLD7KHUHVXOWDQWGURSLQEORRGVXJDUSURGXFHVDFUDYLQJIRUVXJDUEHFDXVHLWFDQTXLFNO\HOHYDWHEORRG
VXJDU8QIRUWXQDWHO\LQFUHDVHGVXJDUFRQVXPSWLRQXOWLPDWHO\DJJUDYDWHVWKHK\SRJO\FHPLD+\SRJO\FHPLDDJJUDYDWHV
WKHPHQWDODQGHPRWLRQDOSUREOHPVRIWKHDOFRKROLF

Caffeine and depression


&DIIHLQH PXVW DOVR EH DYRLGHG E\ SDWLHQWV ZLWK GHSUHVVLRQ &DIIHLQH LV D VWLPXODQW 3HRSOH SURQH WR IHHOLQJ
GHSUHVVHGRUDQ[LRXVWHQGWREHHVSHFLDOO\VHQVLWLYHWRFDIIHLQH7KHWHUP³FDIIHLQLVP´LVXVHGWRGHVFULEHD
FOLQLFDOV\QGURPHVLPLODUWRJHQHUDOL]HGDQ[LHW\DQGSDQLFGLVRUGHUVWKDWLQFOXGHVXFKV\PSWRPVDVGHSUHVVLRQ
QHUYRXVQHVVSDOSLWDWLRQVLUULWDELOLW\DQGUHFXUUHQWKHDGDFKH7KHLQWDNHRIFDIIHLQHKDVEHHQSRVLWLYHO\FRUUHODWHG
ZLWKWKHGHJUHHRIPHQWDOLOOQHVVLQSV\FKLDWULFSDWLHQWV,QRWKHUZRUGVWKHPRUHFDIIHLQHWKDWLVFRQVXPHGWKH
JUHDWHUWKHPHQWDOLOOQHVVLQWKHVHSDWLHQWV7KHFRPELQDWLRQRIFDIIHLQHDQGUH¿QHGVXJDUVHHPVWREHHYHQZRUVH
WKDQHLWKHUVXEVWDQFHFRQVXPHGDORQH6HYHUDOVWXGLHVKDYHIRXQGDQDVVRFLDWLRQEHWZHHQWKLVFRPELQDWLRQ
and depression.

Exercise and depression


5HJXODUH[HUFLVHPD\EHWKHPRVWSRZHUIXODQWLGHSUHVVDQWDYDLODEOH9DULRXVFRPPXQLW\DQGFOLQLFDOVWXGLHVKDYH
FOHDUO\LQGLFDWHGWKDWH[HUFLVHKDVSURIRXQGDQWLGHSUHVVLYHHIIHFWV7KHVHVWXGLHVKDYHVKRZQWKDWLQFUHDVHG
SDUWLFLSDWLRQLQH[HUFLVHVSRUWVDQGSK\VLFDODFWLYLWLHVLVVWURQJO\DVVRFLDWHGZLWKGHFUHDVHGV\PSWRPVRIDQ[LHW\
UHVWOHVVQHVVWHQVLRQHWF GHSUHVVLRQ IHHOLQJVWKDWOLIHLVQRWZRUWKZKLOHORZVSLULWVHWF DQGPDODLVH UXQGRZQ
IHHOLQJLQVRPQLDHWF )XUWKHUPRUHSHRSOHZKRSDUWLFLSDWHLQUHJXODUH[HUFLVHKDYHKLJKHUVHOIHVWHHPIHHO
EHWWHUDQGDUHPXFKKDSSLHUFRPSDUHGWRSHRSOHZKRGRQRWH[HUFLVH0XFKRIWKHPRRGHOHYDWLQJHIIHFWVRI
H[HUFLVHPD\EHDWWULEXWHGWRWKHIDFWWKDWUHJXODUH[HUFLVHKDVEHHQVKRZQWRLQFUHDVHWKHOHYHORIHQGRUSKLQV
:KHQHQGRUSKLQOHYHOVDUHORZGHSUHVVLRQRFFXUV&RQYHUVHO\ZKHQHQGRUSKLQOHYHOVDUHHOHYDWHGVRLVRQH¶V
116 Depression

PRRG7KHUHKDYHEHHQDWOHDVWFOLQLFDOVWXGLHVZKHUHDQH[HUFLVHSURJUDPKDVEHHQXVHGLQWKHWUHDWPHQW
RIGHSUHVVLRQ,WZDVFRQFOXGHGWKDWH[HUFLVHFDQEHDVHIIHFWLYHDVRWKHUDQWLGHSUHVVDQWVLQFOXGLQJGUXJVDQG
SV\FKRWKHUDS\0RUHUHFHQWO\HYHQVWULFWHUVWXGLHVKDYHIXUWKHUGHPRQVWUDWHGWKDWUHJXODUH[HUFLVHLVDSRZHUIXO
DQWLGHSUHVVDQW7KHEHVWH[HUFLVHVDUHHLWKHUVWUHQJWKWUDLQLQJ ZHLJKWOLIWLQJ RUDHURELFDFWLYLWLHVVXFKDVZDONLQJ
EULVNO\MRJJLQJELF\F\OLQJFURVVFRXQWU\VNLLQJVZLPPLQJDHURELFGDQFHDQGUDFTXHWVSRUWV7KHLPSRUWDQW
WKLQJLVWRWUDLQZLWKDQLQWHQVLW\WKDWZLOONHHS\RXUKHDUWUDWHLQWKHWUDLQLQJ]RQH

Nutritional factors in depression


7KHUHDUHDQXPEHURILPSRUWDQWQXWULWLRQDOIDFWRUVWRFRQVLGHULQWKHGHSUHVVHGLQGLYLGXDO)LUVWRIDOOVLQFHWKH
EUDLQUHTXLUHVDFRQVWDQWVXSSO\RIEORRGVXJDUK\SRJO\FHPLDPXVWEHDYRLGHG6\PSWRPVRIK\SRJO\FHPLDFDQ
UDQJHIURPPLOGWRVHYHUHDQGLQFOXGHVXFKWKLQJVDVGHSUHVVLRQDQ[LHW\LUULWDELOLW\DQGRWKHUSV\FKRORJLFDO
GLVWXUEDQFHVIDWLJXHKHDGDFKHEOXUUHGYLVLRQH[FHVVLYHVZHDWLQJPHQWDOFRQIXVLRQLQFRKHUHQWVSHHFKEL]DUUH
EHKDYLRUDQGFRQYXOVLRQV7KHDVVRFLDWLRQEHWZHHQK\SRJO\FHPLDDQGGHSUHVVLRQLVODUJHO\LJQRUHGE\PRVW
SK\VLFLDQV²WKH\VLPSO\QHYHUHYHQFRQVLGHULWDVDSRVVLELOLW\GHVSLWHWKHIDFWWKDWVHYHUDOVWXGLHVKDYHVKRZQ
K\SRJO\FHPLDWREHYHU\FRPPRQLQGHSUHVVHGLQGLYLGXDOV7KHUHLVQRH[SODQDWLRQIRUWKLVRYHUVLJKWE\VRPDQ\
SK\VLFLDQVHVSHFLDOO\VLQFHGLHWDU\WKHUDS\ XVXDOO\VLPSO\HOLPLQDWLQJUH¿QHGFDUERK\GUDWHVIURPWKHGLHW LV
RFFDVLRQDOO\DOOWKDWLVQHHGHGIRUHIIHFWLYHWKHUDS\LQSDWLHQWVWKDWKDYHGHSUHVVLRQGXHWRUHDFWLYHK\SRJO\FHPLD
,QDGGLWLRQWRJOXFRVHWKHEUDLQDOVRUHTXLUHVDFRQVWDQWVXSSO\RIRWKHUQXWULHQWV,WLVDZHOOHVWDEOLVKHGIDFW
WKDWYLUWXDOO\DQ\QXWULHQWGH¿FLHQF\FDQUHVXOWLQLPSDLUHGPHQWDOIXQFWLRQ7RIXQFWLRQRSWLPDOO\WKHKXPDQEUDLQ
UHTXLUHVYLUWXDOO\HYHU\NQRZQQXWULHQW&RUUHFWLQJDQXQGHUO\LQJQXWULWLRQDOGH¿FLHQF\FDQUHVWRUHQRUPDOPHQWDO
IXQFWLRQDQGUHOLHYHGHSUHVVLRQ+RZHYHUDFFRUGLQJWR'U:HUEDFKWKHOHDGLQJH[SHUWLQWKH¿HOGRIQXWULWLRQ
DQGPHQWDOIXQFWLRQ³(YHQLQWKHDEVHQFHRIODERUDWRU\YDOLGDWLRQRIQXWULWLRQDOGH¿FLHQFLHVQXPHURXVVWXGLHV
XWLOL]LQJ ULJRURXV VFLHQWL¿F GHVLJQV KDYH GHPRQVWUDWHG LPSUHVVLYH EHQH¿WV IURP QXWULWLRQDO VXSSOHPHQWDWLRQ´
$KLJKSRWHQF\PXOWLSOHSURYLGHVDJRRGQXWULWLRQDOIRXQGDWLRQXSRQZKLFKWREXLOG:KHQVHOHFWLQJDPXOWLSOH
YLWDPLQDQGPLQHUDOIRUPXODLWLVLPSRUWDQWWRPDNHVXUHWKDWLWSURYLGHVWKHIXOOUDQJHRIYLWDPLQVDQGPLQHUDOVDW
KLJKSRWHQF\OHYHOV'H¿FLHQFLHVRIDQXPEHURIQXWULHQWVDUHTXLWHFRPPRQLQGHSUHVVHGLQGLYLGXDOV7KHPRVW
FRPPRQGH¿FLHQFLHVDUHIROLFDFLGYLWDPLQ%DQGYLWDPLQ%
$FFRUGLQJWRUHVHDUFKSXEOLVKHGLQ/DQFHWDQG$UFK*HQ3V\FKLDWU\WKHJHQHWLFLQDEOLW\WRHI¿FLHQWO\FRQYHUWIROLF
DFLGLQWRLWVWZRDFWLYHIRUPV /07+)DQG)RUP\O7+) LVDVVRFLDWHGZLWKDQ[LHW\DQGGHSUHVVLRQ

Dietary Guidelines
,W LV QRZ D ZHOOHVWDEOLVKHG IDFW WKDW FHUWDLQ GLHWDU\ SUDFWLFHV FDXVH ZKLOH RWKHUV SUHYHQW D ZLGH UDQJH RI
GLVHDVH4XLWHVLPSO\DKHDOWKSURPRWLQJGLHWSURYLGHVRSWLPDOOHYHOVRIDOONQRZQQXWULHQWVDQGORZOHYHOVRIIRRG
FRPSRQHQWVZKLFKDUHGHWULPHQWDOWRKHDOWKVXFKDVVXJDUVDWXUDWHGIDWVFKROHVWHUROVDOWDQGIRRGDGGLWLYHV
$ KHDOWKSURPRWLQJ GLHW LV ULFK LQ ZKROH ³QDWXUDO´ DQG XQSURFHVVHG IRRGV ,W LV HVSHFLDOO\ KLJK LQ SODQW IRRGV
VXFKDVIUXLWVYHJHWDEOHVJUDLQVEHDQVVHHGVDQGQXWVDVWKHVHIRRGVQRWRQO\FRQWDLQYDOXDEOHQXWULHQWVEXW
DGGLWLRQDOFRPSRXQGVZKLFKKDYHUHPDUNDEOHKHDOWKSURPRWLQJSURSHUWLHV

Final comments
Counseling therapy that has the most merit and support in the medical literature is called cognitive therapy. In
IDFWFRJQLWLYHWKHUDS\KDVEHHQVKRZQWREHHTXDOO\DVHIIHFWLYHDVDQWLGHSUHVVDQWGUXJVLQWUHDWLQJPRGHUDWH
GHSUHVVLRQ+RZHYHUZKLOHWKHUHLVDKLJKUDWHRIUHODSVHRIGHSUHVVLRQZKHQGUXJVDUHXVHGWKHUHODSVHUDWH
IRUFRJQLWLYHWKHUDS\LVPXFKORZHU3HRSOHWDNLQJGUXJVIRUGHSUHVVLRQWHQGWRKDYHWRVWD\RQWKHPIRUWKHUHVW
RIWKHLUOLYHV7KDWLVQRWWKHFDVHZLWKFRJQLWLYHWKHUDS\EHFDXVHWKHSDWLHQWLVWDXJKWQHZVNLOOVWRGHDOZLWK
GHSUHVVLRQ3V\FKRORJLVWVDQGRWKHUPHQWDOKHDOWKVSHFLDOLVWVWUDLQHGLQFRJQLWLYHWKHUDS\VHHNWRFKDQJHWKH
ZD\WKHGHSUHVVHGSHUVRQFRQVFLRXVO\WKLQNVDERXWIDLOXUHGHIHDWORVVDQGKHOSOHVVQHVV

Contributing Factors
()$GH¿FLHQF\IRRGVHQVLWLYLW\WR[LFPHWDOH[SRVXUHERZHOWR[HPLDLOOLFLWGUXJVSRRUGLHW‡K\SRFKORUK\GULD
WR[LFVROYHQWH[SRVXUHFDQGLGLDVLVHQGRFULQRSDWKLHV

Dietary Suggestions
• FirstLine Therapy® Diet

Suggested Nutritional Supplementation


• Symphora²WDEOHWVGDLO\
6\PSKRUDLVIRUPXODWHGWRSURPRWHDSRVLWLYHPRRGDQGPHQWDOZHOOEHLQJE\EHQH¿FLDOO\PRGXODWLQJFHUHEUDO
PHWDEROLVPRIWKHQHXURKRUPRQHFRUWLVRO
Depression 117

• Somnolin²WDEOHWVGDLO\
6RPQROLQLVGHVLJQHGWRVXSSRUWDSRVLWLYHPRRGDQGDQDOHUWUHOD[HGVWDWHGXULQJWKHGD\ZKLOHSURPRWLQJ
UHFXSHUDWLYHVOHHSDWQLJKWWKURXJKEHQH¿FLDOO\PRGXODWLQJWKHPHWDEROLVPRIVHURWRQLQ
• St. John's Wort²:LWK$FWL)RODWHŠDQG%WRWDEOHWVGDLO\
6W-RKQ¶V:RUWZLWK$FWL)RODWHDQG%LVIRUPXODWHGWRVXSSRUWDFDOPSRVLWLYHPRRGZLWKQXWULHQWVWKDW
may play a role in serotonin metabolism.
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[VXSSRUW

For severe depression add to above protocols:


• Cenitol²VFRRSVPL[HGLQMXLFHWLPHVGDLO\@
Nervous system support.
Caution: Not to be used by patients taking lithium.
118 Depression

Manic Depression / Bipolar Disorder


$ ELSRODU FRQGLWLRQ ZLWK F\FOLF VWDWHV RI PDQLD DQG GHSUHVVLRQ ,Q  RI FDVHV GHSUHVVLRQ GRPLQDWHV WKH
personality cycle.

Preventing and Reversing Lithium Toxicity and Side Effects With Essential Fatty Acids
2YHUDGHFDGHDJRDZRPDQYLVLWHG7DKRPD&OLQLFRQWKHDGYLFHRIKHUSV\FKLDWULVW6KHZDV³VHYHUHO\ELSRODU´
UHTXLULQJDPD[LPXPGRVHRIOLWKLXPFDUERQDWHWRNHHSKHUV\PSWRPVXQGHUFRQWURO'HVSLWHFORVHPRQLWRULQJRI
VHUXPOLWKLXPOHYHOVWRPDLQWDLQDVDIHUDQJHVKHZDVVWDUWLQJWRVKRZPDQ\VLJQVRIOLWKLXPWR[LFLW\LQFOXGLQJ
hypertension, tremor, nausea, and proteinuria. She and her psychiatrist had tried other medications, but none
SURYLGHGWKHFRQWURORIKHUELSRODUV\PSWRPVWKDWOLWKLXPGLG$VVKHDVNHG³,VWKHUHDQDOWHUQDWLYHWRHLWKHUWKH
SV\FKZDUGRUWKHPHGLFDOZLQJ"´
)RUWXQDWHO\WKHUHZDVDQGLV:LWKRXWFKDQJLQJKHUOLWKLXPGRVHVKHZDVDVNHGWRVWDUWRQÀD[VHHGRLORQH
tablespoon (15cc’s) three times daily along with 800 IUs of vitamin E (mixed tocopherols)2QHPRQWKODWHU
KHUEORRGSUHVVXUHKDGQRUPDOL]HGKHUWUHPRUDQGQDXVHDZHUHJRQHDQGWKHUHZDVQRIXUWKHUSURWHLQLQWKH
XULQH+HUELSRODUV\PSWRPVUHPDLQHGXQGHUFRQWURO6KHZDVDGYLVHGWRFXWWKHÀD[VHHGRLOWRRQHWDEOHVSRRQ
GDLO\DORQJZLWK,8VRIYLWDPLQ(6HYHUDO\HDUVODWHUKHUOLWKLXPWR[LFLW\KDVQ¶WUHWXUQHG
:H¶UHJUDWHIXOWR'U'DYLG+RUURELQIRUWKLVFOLQLFDOWLS'XULQJD\HDUVDJROHFWXUHRQIDWW\DFLGPHWDEROLVPKH
pointed out in passing that lithium could inhibit a vital step, but that this could be overcome by providing more
³SUHFXUVRU´IDWW\DFLGWRRYHUZKHOPWKDWLQKLELWLRQ7KLVVLPSOHSURFHGXUHZRUNVZHOOLQYLYRDVZHOODVLQYLWUR7R
EH³RQWKHVDIHVLGH´DGDLO\DPRXQWRIÀD[VHHGRLO RURWKHUHVVHQWLDOIDWW\DFLG DORQJZLWKYLWDPLQ(VKRXOGEH
UHFRPPHQGHGIRUDQ\RQHWDNLQJOLWKLXP:LWKORZGRVHOLWKLXPDWHDVSRRQIXORUWZRGDLO\LVXVXDOO\VXI¿FLHQW

Suggested Nutritional Supplementation


• Lumina²VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQLVVXHVUHODWHGWRSURSHUIRFXVDWWHQWLRQ
OHDUQLQJDQGPHPRU\WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQHJDPPD
DPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH
• Elo-Plex²WDEOHWVWLPHVGDLO\ZLWKMXLFHRQDQHPSW\VWRPDFK
Natural mood elevator
'RFXPHQWHGEHQH¿WVLQERWKELDQGXQLSRODUGHSUHVVLRQ
• Flax Seed Oil — 1 tablespoon 3 times daily
• E-Complex 1:1²VRIWJHOVWZLFHGDLO\ZLWKPHDOV
(&RPSOH[LVDXQLTXHQDWXUDOYLWDPLQ(VXSSOHPHQWWKDWIHDWXUHVDUDWLRRIDOSKDWRJDPPDWRFRSKHURO
WKLVUDWLRPRUHFORVHO\UHVHPEOHVWKHWRFRSKHUROSUR¿OHIRXQGQDWXUDOO\LQYLWDPLQ(ULFKSODQWV
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[VXSSRUW
• Lithinase²FDSVXOHVWLPHVGDLO\ZLWKPHDOV
%LRDYDLODEOHIRUPRIOLWKLXPGRFXPHQWHGLQPDQLFGHSUHVVLYHFDVHV
Caution: Not to be used by patients taking prescription lithium

References
1. %HDVOH\-7KH%HWUD\DORI+HDOWK7KHLPSDFWRIQXWULWLRQHQYLURQPHQWDQGOLIHVW\OHRQLOOQHVVLQ$PHULFD5DQGRP+RXVH1HZ<RUN
1991.
2. )LHOGLQJ-(6PRNLQJ+HDOWKHIIHFWVDQGFRQWURO1HZ(QJ-0HG
3. 0DWWVRQ0(3ROODFN(6DQG&XOOHQ-::KDWDUHWKHRGGVVPRNLQJZLOONLOO\RX"$P-3XEO+HDOWK
4. &DUUROO%-&XUWLV*&DQG0HQGHOV-&HUHEURVSLQDOÀXLGDQGSODVPDIUHHFRUWLVROFRQFHQWUDWLRQVLQGHSUHVVLRQ3V\FKRO0HG
44, 1976.
5. $OWDU&HWDO*OXFRFRUWLFRLGLQGXFWLRQRIWU\SWRSKDQR[\JHQDVH%LRFKHP3KDUPDFRO
6. .LQVPDQ5DQG+RRG-6RPHEHKDYLRUDOHIIHFWVRIDVFRUELFDFLGGH¿FLHQF\$P-&OLQ1XWU
7. &KRX7:DNHXSDQGVPHOOWKHFRIIHH&DIIHLQHFRIIHHDQGWKHPHGLFDOFRQVHTXHQFHV:HVW-0HG
8. *LOOLDQG.DQG%XOOLFN:&DIIHLQH$SRWHQWLDOGUXJRIDEXVH$GY$OFRKRO6XEVW$EXVH
9. *UHGHQ-HWDO$Q[LHW\DQGGHSUHVVLRQDVVRFLDWHGZLWKFDIIHLQLVPDPRQJSV\FKLDWULFSDWLHQWV$P-3V\FKLDWU\
10. 1HLO-)HWDO&DIIHLQLVPFRPSOLFDWLQJK\SHUVRPQLFGHSUHVVLYHGLVRUGHUV&RPSU3V\FKLDWU\
11. &KDUQH\'+HQQLQJHU*DQG-DWORZ3,QFUHDVHGDQ[LRJHQLFHIIHFWVRIFDIIHLQHLQSDQLFGLVRUGHUV$UFK*HQ3V\FKLDWU\
1984.
12. %ROWRQ6DQG1XOO*&DIIHLQHSV\FKRORJLFDOHIIHFWVXVHDQGDEXVH-2UWKRPRO3V\FKLDWU\
13. .UHLWVFK.HWDO3UHYDOHQFHSUHVHQWLQJV\PSWRPVDQGSV\FKRORJLFDOFKDUDFWHULVWLFVRILQGLYLGXDOVH[SHULHQFLQJDGLHWUHODWHGPRRG
GLVWXUEDQFH%HKDY7KHU
14. &KULVWHQVHQ/3V\FKRORJLFDOGLVWUHVVDQGGLHW±HIIHFWVRIVXFURVHDQGFDIIHLQH-$SO1XWU
15. 0DUWLQ-(DQG'XEEHUW30([HUFLVHDSSOLFDWLRQVDQGSURPRWLRQLQEHKDYLRUDOPHGLFLQH-&RQVXOW&OLQ3V\FKRO
16. :H\HUHU6DQG.XSIHU%3K\VLFDOH[HUFLVHDQGSV\FKRORJLFDOKHDOWK6SRUWV0HG
Depression 119

17. 'DQLHO&DUUHWDO3K\VLFDOFRQGLWLRQLQJIDFLOLWDWHVWKHH[HUFLVHLQGXFHGVHFUHWLRQRIEHWDHQGRUSKLQDQGEHWDOLSRSURWHLQLQZRPHQ1HZ
(QJO-0HG
18. /REVWHLQ'0RVEDFKHU%-DQG,VPDLO$+'HSUHVVLRQDVDSRZHUIXOGLVFULPLQDWRUEHWZHHQSK\VLFDOO\DFWLYHDQGVHGHQWDU\PLGGOHDJHG
PHG-3V\FKRVRP5HV
19. )ROLQV&+DQG6LPH:(3K\VLFDO¿WQHVVWUDLQLQJDQGPHQWDOKHDOWK$P3V\FKRORJLVW
20. 0DUWLQVHQ(:7KHUROHRIDHURELFH[HUFLVHLQWKHWUHDWPHQWRIGHSUHVVLRQ6WUHVV0HG
21. :H\HUHU6DQG.XSIHU%3K\VLFDOH[HUFLVHDQGSV\FKRORJLFDOKHDOWK6SRUWV0HG
22. %\UQH$DQG%\UQH'*7KHHIIHFWRIH[HUFLVHRQGHSUHVVLRQDQ[LHW\DQGRWKHUPRRGVWDWHVDUHYLHZ-3V\FKRVRP5HV
1993.
23. &DVSHU5&([HUFLVHDQGPRRG:RUOG5HY1XWU'LHW
24. :LQRNXU$ HW DO ,QVXOLQ UHVLVWDQFH DIWHU JOXFRVH WROHUDQFH WHVWLQJ LQ SDWLHQWV ZLWK PDMRU GHSUHVVLRQ$P - 3V\FKLDWU\ 
1988.
25. :ULJKW-+-DFLVQ--5DGLQ16HWDO*OXFRVHPHWDEROLVPLQXQLSRODUGHSUHVVLRQ%U-3V\FKLDWU\
26. +DGML*HRUJHRSRXOXV$HWDO(OHYDWHGK\SRJO\FHPLFLQGH[DQGODWHK\SHULQVXOLQLVPLQV\PSWRPDWLFSRVWSUDQGLDOK\SRJO\FHPLD-&OLQ
(QGRFULQRO0HWDERO
27. )DEU\NDQW 0 7KH SUREOHP RI IXQFWLRQDO K\SHULQVXOLQLVP RQ IXQFWLRQDO K\SRJO\FHPLD DWWULEXWHG WR QHUYRXV FDXVHV /DERUDWRU\ DQG
FOLQLFDOFRUUHODWLRQV0HWDEROLVP
28. :HUEDFK01XWULWLRQDO,QÀXHQFHVRQ,OOQHVV$6RXUFHERRNRI&OLQLFDO5HVHDUFK7KLUG/LQH3UHVV7DU]DQD&$
29. 6WDQWR-/DQG.HDVW'56HUXPFKROHVWHUROIDWLQWDNHDQGEUHDNIDVWFRQVXPSWLRQLQWKH86DGXOWSRSXODWLRQ-$P&ROO1XWU
72, 1989.
30. &UHOOLQ5%RWLJOLHUL7DQG5H\QROGV(+)RODWHVDQGSV\FKLDWULFGLVRUGHUV&OLQLFDOSRWHQWLDO'UXJV
31. &DUQH\0:3HWDO5HGFHOOIRODWHFRQFHQWUDWLRQVLQSV\FKLDWULFSDWLHQWV-$IIHFWLYH'LVRUGHUV
32. *RGIUH\36$HWDO(QKDQFHPHQWRIUHFRYHU\IURPSV\FKLDWULFLOOQHVVE\PHWK\OIRODWH/DQFHW
33. 5H\QROGV(HWDO)RODWHGH¿FLHQF\LQGHSUHVVLYHLOOQHVV%U-3V\FKLDW
34. %MHOODQG,7HOO*69ROOVHW6(5HIVXP+8HODQG30)RODWHYLWDPLQ%KRPRF\VWHLQHDQGWKH07+)5& 7SRO\PRUSKLVPLQ
DQ[LHW\DQGGHSUHVVLRQ$UFK*HQ3V\FKLDWU\
35. +LUDVKLPD)3DURZ$06WROO$/HWFO2PHJDIDWW\DFLGWUHDWPHQWDQG7ZKROHEUDLQUHOD[WDLRQWLPHVLQELSRODUGLVRUGHU$PHULFDQ
-RXUQDORI3V\FKLDWU\
120 Detoxification

Detoxification
/RZOHYHOORQJWHUPH[SRVXUHWRWR[LQVVXFKDVKHDY\PHWDOV HJOHDGPHUFXU\363DQGFDGPLXP SHVWLFLGHV
LQGXVWULDO FRPSRXQGV DQG SROOXWDQWV LV DVVRFLDWHG ZLWK FKURQLF IDWLJXH V\QGURPH &)6  PXOWLSOH FKHPLFDO
VHQVLWLYLWLHV 0&6 ¿EURP\DOJLD )0 QHXURGHJHQHUDWLYHGLVHDVHVVXFKDV3DUNLQVRQ¶VGLVHDVHDQGDWKHURVFOHURVLV
DVZHOODVPDQ\W\SHVRIFDQFHUV&RPPRQVLJQVDQGV\PSWRPVRIHQYLURQPHQWDOWR[LFLW\LQFOXGHDFQHUDVKHV
KHDGDFKHVDFKHVDQGSDLQVIDWLJXHPXVFOHZHDNQHVVWLQQLWXVIHUWLOLW\SUREOHPVPHPRU\ORVVDQGFKURQLF
immune system depression.

Common Clinical Symptoms and Conditions Associated with Environmental Toxicity:


• Headaches • Mineral Imbalances
 ‡)HUWLOLW\3UREOHPV ‡'HSUHVVLRQ
 ‡0XOWLSOH&KHPLFDO6HQVLWLYLWLHV ‡1RQ5HVSRQVLYHRU5HFXUUHQW<HDVW,QIHFWLRQV
• Learning Disorders • Chronic Fatigue Syndrome
• Fibromyalgia • Contact Dermatitis
 ‡%URDG0RRG6ZLQJV ‡8QXVXDO5HVSRQVHVWR0HGLFDWLRQVRU6XSSOHPHQWV
 ‡0HPRU\/RVV ‡3DUNLQVRQ¶V'LVHDVH
 ‡7LQQLWXV ‡0XVFOH:HDNQHVV
 ‡:RUVHQLQJRI6\PSWRPV$IWHU$QHVWKHVLDRU3UHJQDQF\ ‡&DQFHU
 ‡)DWLJXH ‡3DQLF$WWDFNV
 ‡$EQRUPDO3UHJQDQF\2XWFRPHV ‡&KURQLF,PPXQH6\VWHP
 ‡+LVWRU\RILQFUHDVLQJVHQVLWLYLW\WRH[RJHQRXVH[SRVXUHV
odors, or medications
7R[LQVPD\UHPDLQLQWKHERG\IRUPDQ\\HDUVWKHUHIRUHZHDUHH[SRVHGWRPXFKKLJKHUWR[LQGRVHVWKDQSUHVHQW
HQYLURQPHQWDOFRQFHQWUDWLRQVVXJJHVW5HVHDUFKVXJJHVWVWKDWZHDOOPDLQWDLQWR[LQFRQWDPLQDWLRQZLWKLQRXU
ERGLHVRQDUHJXODUEDVLVGXHWRWKLVOLIHWLPHRIH[SRVXUH

How does the body remove toxic substances?


$QLQGLYLGXDO¶VDELOLW\WRUHPRYHRUGHWR[LI\WR[LQVLVDSULPDU\IDFWRULQVXVFHSWLELOLW\WRWR[LQUHODWHGFRQGLWLRQV
,QRUGHUWRUHPRYH H[FUHWH WKHPXOWLWXGHRIGLYHUVHWR[LQVWKHERG\KDVDFRPSOH[V\VWHPWKDWFRQYHUWVWKHP
LQWRQRQWR[LFPROHFXOHVIRUUHPRYDO7KLVFRPSOH[V\VWHPRFFXUVLQWZRSKDVHV3KDVH,DQG3KDVH,,WKDW
FRQYHUW ELRWUDQVIRUP DWR[LFPROHFXOHLQWRDQRQWR[LFPROHFXOHWKDWFDQEHHDVLO\H[FUHWHG7KHPDMRULW\RI
GHWR[L¿FDWLRQRFFXUVLQWKHOLYHUKRZHYHUDOOWLVVXHVKDYHVRPHDELOLW\WRGHWR[LI\LQFOXGLQJWKHLQWHVWLQHVVNLQ
and lungs.
,Q3KDVH,DIXQFWLRQDOJURXSLVDGGHGWRWKHWR[LFPROHFXOHSURGXFLQJDQLQWHUPHGLDWHWKDWQHHGVWREHIXUWKHU
WUDQVIRUPHG3KDVH,,GHWR[L¿FDWLRQLQYROYHVDSURFHVVFDOOHGFRQMXJDWLRQLQZKLFKYDULRXVHQ]\PHVLQWKHOLYHU
DWWDFKSURWHFWLYHFRPSRXQGVWRWKHLQWHUPHGLDWHPDNLQJLWOHVVKDUPIXODQGPRUHUHDGLO\H[FUHWDEOH%HFDXVH
WKHSURGXFWVRI3KDVH,FDQEHKLJKO\UHDFWLYHDQGPRUHKDUPIXOWKDQWKHRULJLQDOFRPSRXQGDFKLHYLQJDQG
PDLQWDLQLQJDEDODQFHEHWZHHQ3KDVH,DQG3KDVH,,SURFHVVHVLVFULWLFDO
)XUWKHUPRUHDVLJQL¿FDQWVLGHHIIHFWRIDOOWKLVPHWDEROLFDFWLYLW\LVWKHSURGXFWLRQRIIUHHUDGLFDOVDVWKHWR[LQV
LVWUDQVIRUPHGUHVXOWLQJLQR[LGDWLYHVWUHVV1XWULHQWVWKDWKHOSSURWHFWXVIURPR[LGDWLYHVWUHVVLQFOXGHYLWDPLQV
C and E, zinc, selenium and copper.

Achieving Balanced Detoxification


2SWLPDOGHWR[L¿FDWLRQUHTXLUHVWKDWERWK3KDVH,DQG3KDVH,,SDWKZD\VIXQFWLRQFRUUHFWO\DQGLQEDODQFHZLWK
HDFK RWKHU  %LIXQFWLRQDO PRGXODWRUV DUH SK\WRQXWULHQWV WKDW VXSSRUW EDODQFHG GHWR[L¿FDWLRQ E\ PRGXODWLQJ
3KDVH,DQGSURPRWLQJ3KDVH,,7KLVPLQLPL]HVGDPDJHE\UHDFWLYHLQWHUPHGLDWHVDQGIUHHUDGLFDOV)UXLWVDQG
YHJHWDEOHVFRQWDLQPDQ\ELIXQFWLRQDOPRGXODWRUVZKLFKLVRQHUHDVRQWKHVHIRRGVDUHDVVRFLDWHGZLWKUHGXFHG
susceptibilities to cancer and degenerative diseases.

Nutritional Support for Detoxification


'HWR[L¿FDWLRQLVDQHQHUJ\UHTXLULQJSURFHVVWKDWSXWVDPHWDEROLFEXUGHQRQWKHERG\7KHUHIRUHZDWHURUMXLFH
IDVWVDUHQRWEHQH¿FLDOEHFDXVHWKH\GHSOHWHWKHERG\RIWKHHVVHQWLDOQXWULHQWVUHTXLUHGIRUKHDOWK\GHWR[L¿FDWLRQ
7KHVHIDVWVKDYHPDQ\DGYHUVHKHDOWKHIIHFWVLQFOXGLQJGHFUHDVHGHQHUJ\SURGXFWLRQEUHDNGRZQRIOHDQWLVVXH
LQVWHDGRIIDWLQFUHDVHGR[LGDWLYHVWUHVVDQGXQEDODQFHGGHWR[L¿FDWLRQ
5DWKHU WKDQ GHFUHDVLQJ QXWULHQW VXSSRUW D IRFXVHG KLJKLPSDFW ORZ DOOHUJ\ SRWHQWLDO VRXUFH RI PLFUR DQG
macronutrients should be provided.
Detoxification 121

Summary
0LQLPL]LQJ H[SRVXUH WR WR[LQV LV RQO\ RQH SDUW WR D EHQH¿FLDO GHWR[L¿FDWLRQ SURJUDP  /RZ DOOHUJ\ SRWHQWLDO
WDUJHWHGQXWULWLRQSURYLGLQJWKHIXOOVSHFWUXPRI3KDVH,,VXSSRUWLYHFRIDFWRUVELIXQFWLRQDOPRGXODWRUVIRUEDODQFHG
GHWR[L¿FDWLRQDQGVXSSRUWIRUHQHUJ\SURGXFWLRQDQGH[FUHWLRQPD\RSWLPL]HEDODQFHGGHWR[L¿FDWLRQDQGSURPRWH
RSWLPDOKHDOWKWKURXJKRXWOLIH
:LWKWKH$GYD&OHDU'HWR[L¿FDWLRQ3URJUDPERWKWKHSDWLHQWDQGWKHGRFWRUKDYHJUHDWÀH[LELOLW\7KHVHJXLGHOLQHV
ZLOOJUHDWO\LQFUHDVHWKHHDVHLQZKLFKWRLPSOHPHQWDQHIIHFWLYHGHWR[L¿FDWLRQSURWRFRO
122 Detoxification

 



 


  

   


    
       
  
 
   
       
  
     

       
      


     ! "


  !" !# -  
   $ ! 
! ""  )   
#    &
 

 $  &
  
% 

    



 #  
. 
& 
  %!    / 
&
 
     $ ,  
 # % 
     
'    
     
!     
 
    &!" &  .  
 
 
)   
  %  
'(   
% 

$  
 
0   
% " 
)
   
'(    
"  
  
 )  
$!#! ,

 *  +  

   
%  
  

   ! 
% 

  
 )     
 

! 
     
)  
%  
! , 
%

 
1  
 
 

   

 

 
   
'(    
! 2 
 )
, (    
#
 
,   
  
   
!  
 
 + 


" )  
+    
,   
* 
   
%  
! 
  
"  
Detoxification 123

 #  #  !"

34, 
    5 >4!
(  A  B    5
 67348  67348 - 7:48
#    
 599997348
C4!
 (  (
 -7:48  5
;4, 
    

 <  67348 - 7:48 ! @  7:48


 5
4 ! 


   

  

5
 )   7;48
 67348 -7:48 ! @  7:48
 ,  7;48
 ' 
7;48 3:4! 
  
 '    
 . 
     7?48
=4#  
      


     


 )    7?48
 '(    78 78  
   2
 
 
    7?48
787=48  
 7=48
 '(    78 78  
   @7=48
787;48  ,

 
  7;48
 '(     78 78

     ,7348


7;48 334!     ( 
 

 '(      78 78

           


 5
7:48  67348 -7:48
4! 
  
> 

 3;4! 

      


5 
       

 67;48 -7:48 
5
?4 !           67348 -7:48 ! @  7:48
  5
 67348 - 7:48 ! @  7:48 " 

  
 


$ %%   & % 

 
   
(   +    72%D EFF8 2%D%)G'999999999 7 H?:I3?<J1 K38
EFF%)G'9999999997 H3:I?<J1 K8

  ' 


           
   

?:H 3:H  



  
  2 
   ;<
   &    
  (  
  
( 
 
 (     


  


3?<J ?<J 2



  
 2 
   3:<
    )      
  (  
 ( 
 
 (     


  


3K K 1 

  
  2   
 
   ( 


 ()  



   

$    . +     L    



  .  
.    
   

!      .  
.   
 
    2%D
 EFF(   
  
( 
4G 
  

  .  .

   


    (   
.           

   . 4
#   
"   
   .  
4


 

124 Detoxification

Advanced Bifunctional Detoxification Support

28-Day Metabolic Detoxification Program


7KLVGHWR[L¿FDWLRQSURJUDPLVGLYLGHGLQWRVWHSV7KHSURGXFWVQHHGHGWRFRPSOHWHGD\SURJUDPLQFOXGH
• /DUJH%RWWOHRIAdvaClear™
• &DQLVWHUVRIDSSURSULDWH Medical Food*
* See Suggested SupplementationIRUDSSURSULDWHQXWULWLRQDOVXSSRUWSURGXFWFRPELQDWLRQ V 
• Step 1 – Initial Clearing (Days 1-6)'XULQJ6WHS\RXZLOOHOLPLQDWHSRWHQWLDOO\DOOHUJHQLFIRRGVZKLOH\RXVORZO\
LQFUHDVHWKHLQWDNHRIWKHQXWULWLRQDOVXSSRUWSURGXFW V \RXUKHDOWKFDUHSUDFWLWLRQHUKDVUHFRPPHQGHG
• 6WHS±'HWR[L¿FDWLRQ (Days 7-13)'XULQJ6WHS\RXZLOOEHRQDVHOHFWQXPEHURIORZDOOHUJ\IRRGVDORQJ
ZLWKWKUHHVHUYLQJVDGD\RI\RXUQXWULWLRQDOVXSSRUWSURGXFW V 
• Step 3 – Reintroduction (Days 14-28)'XULQJ6WHS\RXZLOOVORZO\UHLQWURGXFHWKHIRRGVIURP6WHSEDFN
LQWRWKHGLHWDU\SODQDQGVORZO\GHFUHDVHWKHLQWDNHRI\RXUQXWULWLRQDOVXSSRUWSURGXFW V 

General Guidelines and Suggestions:


1. ,I \RX QRUPDOO\ FRQVXPH VLJQL¿FDQW DPRXQWV RI FDIIHLQDWHG EHYHUDJHV RU VLPSOH VXJDUV \RX PLJKW
H[SHULHQFHZLWKGUDZDOKHDGDFKHVLI\RXGLVFRQWLQXHWKHPDOODWRQFH:HUHFRPPHQGWKDW\RXJUDGXDOO\
GHFUHDVHWKHVHLWHPVLQ\RXUGLHWEHIRUHVWDUWLQJWKLVSURJUDP
2. )RUEHVWUHVXOWVRQ\RXUGD\SURJUDP\RXPXVWFDUHIXOO\DGKHUHWRWKHBasic Dietary Guidelines.
)RRGVWKDWDUHQRWIRXQG XQGHU Foods to IncludeVKRXOGQRWEHHDWHQXQOHVVGLVFXVVHGZLWK\RXU
KHDOWKFDUHSUDFWLWLRQHU$YRLGLQJSRWHQWLDOO\DOOHUJHQLFRUKHDYLO\SURFHVVHGIRRGVWKDWPD\LPSDLU\RXU
ERG\¶VDELOLW\WRFOHDQVHDQGGHWR[LI\LVYHU\LPSRUWDQWIRUWKHVXFFHVVRI\RXUSURJUDP
3. 'ULQNDWOHDVHRXQFHV HLJKWRXQFHFXSV RI¿OWHUHGZDWHUGDLO\
4. 0DQ\SHRSOHEHJLQWRIHHOEHWWHUZLWKLQDIHZZHHNVRIEHJLQQLQJWKHLUSURJUDP+RZHYHU\RXPD\
LQLWLDOO\H[SHULHQFHPLOGÀXOLNHV\PSWRPVVXFKDVKHDGDFKHVDQGMRLQWDFKHVRUVRPHFKDQJHVLQERZHO
habits. These are usually minor and temporary.
5. 2YHUWKHHQWLUHGD\SURJUDPPDQ\SHRSOHUHSRUWIHHOLQJPRUHHQHUJL]HG+RZHYHUGXULQJ6WHS
VRPHSDUWLFLSDQWVKDYHDVOXPSLQHQHUJ\<RXPD\ZLVKWRVKRUWHQRUFXUWDLOVWUHQXRXVSK\VLFDO
activities during this phase.
6. $GHTXDWH VOHHS DQG VWUHVV UHGXFWLRQ DUH LPSRUWDQW WR WKH VXFFHVV RI \RXU SURJUDP  <RXU ERG\ LV
UHFKDUJLQJDQGUHJHQHUDWLQJLWVHOIKHOSLWE\JHWWLQJDGHTXDWHUHVW

Step 1
• Day 1: %HJLQWRIROORZWKHBasic Dietary Guidelines, as outlined.
Take 1/2 scoop RI WKH SRZGHUHG SURGXFW  \RXU FOLQLFLDQ KDV UHFRPPHQGHG twice today. Also take 1
AdvaClearTMWZRWLPHVWRGD\
• Day 2: Take 1 scoop RI\RXUUHFRPPHQGHGSRZGHUtwice WRGD\&RQWLQXHZLWK$GYD&OHDUTMFDSVXOHWZR
times today.
• Day 3-6: Increase to 2 scoops RI\RXUUHFRPPHQGHGSRZGHUtwice each day, and 2 AdvaClearTM capsules
WZRWLPHVHDFKGD\DVZHOO

Step 2
• Days 7-13: From the Basic Dietary GuidelinesHDWRQO\IURPWKHVHFDWHJRULHV)UXLWV9HJHWDEOHV)DWV
Beverages, and Spices and Condiments. From Starch category, consume rice only. Increase to 2 scoops RI
\RXUUHFRPPHQGHGSRZGHUthree times each day, and AdvaClearTM to 2 capsules three times each day.

Step 3
• Days 14-15: $GG%UHDG&HUHDO6WDUFKDQG0LON6XEVWLWXWHVIURPBasic Dietary Guidelines&RQWLQXHZLWK
2 scoops RI\RXUUHFRPPHQGHGSRZGHUthree times GDLO\DORQJZLWK$GYD&OHDUTM capsules three times
each day.
• Days 16-18: $OVRDGG/HJXPHVDQG1XWVDQG6HHGVIURPBasic Dietary Guidelines. Reduce to 2 scoops
RI\RXUUHFRPPHQGHGSRZGHUtwice HDFKGD\DORQJZLWK$GYD&OHDUFDSVXOHVWZLFHHDFKGD\
• Days 19-28: $OVR DGG 0HDW DQG )LVK IURP Basic Dietary Guidelines &RQWLQXH ZLWK 2 scoops RI \RXU
UHFRPPHQGHGSRZGHUtwice HDFKGD\DORQJZLWK$GYD&OHDUTMFDSVXOHVWZLFHHDFKGD\
• After Day 28: 5HWXUQWR\RXUKHDOWKFDUHSUDFWLWLRQHUIRUIROORZXSDQGIXUWKHULQVWUXFWLRQV
Detoxification 125

Suggested Supplementation
7KHIROORZLQJLVDJXLGHWRKHOSWKHSUDFWLWLRQHUGHWHUPLQHWKHPRVWDSSURSULDWHFRPELQDWLRQRIQXWULWLRQDOVXSSRUW
products:
• Light to Moderate Toxicity:
AdvaClearTMZLWK8OWUD0HDO®
• Moderate to Severe Sensitivity:
AdvaClearTMZLWK8OWUD&OHDU3/86® RU8OWUD&OHDU3/86S+
• Insulin Resistance:
AdvaClearTMZLWK8OWUD*O\FHP;®
• 3DLQ,QÀDPPDWLRQ
AdvaClearTMZLWK8OWUD,QÀDP;®
• GI Permeablility (Leaky Gut):
AdvaClearTMZLWK8OWUD,QÀDP;® DQG(QGHIHQŒ
• Hormone Imbalances:
AdvaClearTMZLWK(VWULXPTM

Basic Product Mixing Instructions


&RPELQHVFRRSVRIWKHSRZGHUHGSURGXFW\RX¶YHEHHQLQVWUXFWHGWRFRQVXPHZLWKRXQFHVRIZDWHURU
RWKHUOLTXLG%ULVNO\VWLURUEOHQGWKHSURGXFWXQWLOWKRURXJKO\PL[HG
126 Detoxification

Modified Elimination Diet


Foods to Include Foods to Avoid
Fruits 8QVZHHWHQHGIUHVKIUR]HQZDWHU
SDFNHGRUFDQQHGXQVZHHWHQHGIUXLW
2UDQJHV

MXLFHVH[FHSWRUDQJH

Vegetables $OOIUHVKUDZVWHDPHGVDXWpHG
juiced, or roasted vegetables
&RUQFUHDPHGYHJHWDEOHV

Starch Rice, oats, millet, quinoa, amaranth,


WHIIWDSLRFDEXFNZKHDW
:KHDWFRUQEDUOH\VSHOWNDPXWU\H
DOOJOXWHQFRQWDLQLQJSURGXFWV

Bread/Cereal 3URGXFWVPDGHIURPULFHRDW
EXFNZKHDWPLOOHWSRWDWRÀRXU
3URGXFWVPDGHIURPZKHDWVSHOW
NDPXWU\HEDUOH\DOOJOXWHQ
WDSLRFDDUURZURRWDPDUDQWKTXLQRD containing products

Legumes All beans, peas, and lentils unless


RWKHUZLVHLQGLFDWHG
6R\EHDQV‚WRIXWHPSHKVR\EHDQV
soy milk, other soy products

Nuts and Seeds $OPRQGVFDVKHZVZDOQXWVVHVDPH


WDKLQL VXQÀRZHUDQGSXPSNLQ
3HDQXWVSHDQXWEXWWHU

VHHGVEXWWHUVPDGHIURPWKHVHQXWV
and seeds

Meat and Fish $OOFDQQHG ZDWHUSDFNHG IUR]HQRU


IUHVK¿VKFKLFNHQWXUNH\ZLOGJDPH
%HHISRUNFROGFXWVIUDQNIXUWHUV
sausage, canned meats, eggs,
lamb VKHOO¿VK

Dairy Products & Milk Milk substitutes such as rice milk,


almond milk, oat milk, coconut milk,
Milk, cheese, cottage cheese, cream,
\RJXUWEXWWHULFHFUHDPIUR]HQ
Substitutes other nut milks \RJXUW³QRQGDLU\´FUHDPHUV

Fats &ROGH[SHOOHUSUHVVHGROLYHÀD[
FDQRODVDIÀRZHUVXQÀRZHUVHVDPH
Margarine, butter, shortening,
processed (hydrogenated) oils,
ZDOQXWSXPSNLQRUDOPRQGRLOV mayonnaise, spreads

Beverages )LOWHUHGRUGLVWLOOHGZDWHUKHUEDOWHD
VHOW]HURUPLQHUDOZDWHU
6RGDSRSRUVRIWGULQNVDOFRKROLF
EHYHUDJHVFRIIHHWHDRWKHU
FDIIHLQDWHGEHYHUDJHV

Spices & Condiments $OOVSLFHVXQOHVVRWKHUZLVHLQGLFDWHG


)RUH[DPSOHXVHFLQQDPRQFXPLQ
Chocolate††, ketchup, mustard, relish,
chutney, soy sauce, barbeque sauce,
dill, garlic, ginger, carob, oregano, other condiments
parsley, rosemary, tarragon, thyme,
turmeric, vinegar

Sweeteners %URZQULFHV\UXSIUXLWVZHHWHQHU
blackstrap molasses, stevia
:KLWHRUEURZQUH¿QHGVXJDUKRQH\
PDSOHV\UXSFRUQV\UXSKLJKIUXFWRVH
FRUQV\UXSFDQG\GHVVHUWVPDGHZLWK
WKHVHVZHHWHQHUV
‚1RWHWKDWVR\LVDQLQJUHGLHQWLQVRPHRIWKHUHFRPPHQGHGPHGLFDOIRRGVDQGVXSSOHPHQWIRUPXODV7KHUHIRUHWKRVH
SURGXFWVDUHRQO\UHFRPPHQGHGLI\RXUKHDOWKFDUHSUDFWLWLRQHUKDVGHWHUPLQHG\RXKDYHQRLQWROHUDQFHWRVR\
‚‚1RWHWKDWFKRFRODWHLVDQLQJUHGLHQWLQVRPHRIWKHUHFRPPHQGHGPHGLFDOIRRGV7KHUHIRUHWKRVHSURGXFWVDUHRQO\
UHFRPPHQGHGLI\RXUKHDOWKFDUHSUDFWLWLRQHUKDVGHWHUPLQHG\RXKDYHQRLQWROHUDQFHWRFKRFRODWH
Detoxification 127
128 Detoxification
Diets 129

Dietary Programs
Anti-Inflammatory Diet
130 Diets

Candida Albicans Dietary Guide


Food Permitted Foods Foods Not Permitted
6ZHHWV 8QSDVWHXUL]HGKRQH\XQVXOIXUDWHGEODFNVWUDSPRODVVHV 5H¿QHGVXJDUFDQG\FKRFRODWH
UDZVXJDUVRUJKXPE\WKHPVHOYHVRUXVHGDVVZHHWHQHUV
127(8VHLQPRGHUDWLRQ
Fish $OOZKLWHÀHVK¿VKZDWHUSDFNHGWXQDVDOPRQVKHOO¿VK $OOIULHGRURLOSDFNHG¿VKDQG
%DNHGRUEURLOHG9HU\IUHVK VHDIRRG
Meat /HDQWULPPHGEHHIYHU\IUHVKFDOIOLYHUFKLFNHQODPEDQG Bacon, ham, pork, smoked meat,
WXUNH\127(5HPRYHVNLQRQFKLFNHQDQGWXUNH\ sausage, and pork sausage.
0LON3URGXFWV 2FFDVLRQDO\RJXUW XQVZHHWHQHG RFFDVLRQDOSRZGHUHGPLON <RJXUW VZHHWHQHG ZKROHPLON
FKRFRODWHPLONVZHHWFUHDP
buttermilk, sour cream.
Fruits )UHVKIUXLWVRQO\DSSOHVSHDUVDSULFRWVEDQDQDVFKHUULHV &DQQHGIUXLWRUDQJHVPHORQV
grapes, guava, currants, nectarines, papaya, peaches, GULHGRUFDQGLHGIUXLWV
SOXPVTXLQFHWDQJHULQHVDYRFDGRVULSHSLQHDSSOH127(
)UXLWVVKRXOGEHOLPLWHGWRDPD[LPXPRIWZRSHUGD\
Juices 2QO\IUHVKMXLFHV0D\EHVHOHFWHGIURPOLVWRIYHJHWDEOHV &DQQHGMXLFHVDQGMXLFHVZLWK
SHUPLWWHGLQFOXGLQJWKHIROORZLQJJUHHQOHDYHVFKLFRU\ DUWL¿FLDOFRORULQJRUVZHHWHQLQJ
HQGLYHHVFDUROHOHWWXFH6ZLVVFKDUGDQGZDWHUFUHVV
Beverages 0LQHUDOZDWHUKHUEWHDPLQWWHDSDSD\DWHDIUHVKYHJHWDEOH $OFRKROFRIIHHWHDVRIWGULQNV
juices. containing preservatives.
Breads 5\HZKROHZKHDWVR\DEUDQZKROHJUDLQVWRQHJURXQG :KLWHEUHDGEOHDFKHGÀRXU
EUHDGV127(/LPLWWRDPD[LPXPRIWZRVOLFHVSHUGD\ products.
Cereals %XFNZKHDWFRUQPHDOFUDFNHGZKHDWPLOOHWRDWPHDO 5H¿QHGEOHDFKHGÀRXUDQGVXJDU
sesame, grits. coated cereals.
Cheese, Butter only very occasionally. Margarine, cheese
Butter
Eggs /LPLWWRWZRHJJVSHUGD\3RDFKHGKDUGRUVRIWERLOHG
2LOV &ROGSUHVVHGRLOVSUHIHUDEO\ÀD[VHHGVDIÀRZHUFDQRODRU Shortening, margarine, saturated
soya lecithin spread. RLOVDQGIDWV
Nuts )UHVKUDZQXWVVXFKDVDOPRQGVSHFDQVFDVKHZV%UD]LO Roasted and salted nuts. No
QXWVDQGZDOQXWV SHDQXWVYHU\RFFDVLRQDOO\  SHDQXWVLISDWLHQWKDVGLJHVWLYHRU
colon related problems.
Vegetables 5DZRUOLJKWO\FRRNHGDUWLFKRNHVDVSDUDJXVFDUURWV All canned vegetables.
FDXOLÀRZHUFHOHU\FKLYHVFRUQHJJSODQWHQGLYHVJUHHQ
leeks, green peas, green pepper, leeks, lentils, lima beans,
SRWDWRHVUDGLVKHVVSLQDFKVTXDVKWRPDWRHVZD[EHDQV
\DPV$Q\YHJHWDEOHVOLVWHGXQGHUVDODGV127(:DVKLQJ
YHJHWDEOHVLQD&ORUR[VROXWLRQDQGULQVLQJZHOOZLOO
UHGXFHPLFURELDOJURZWK
3RWDWRHV %DNHGERLOHGRUPDVKHG0D\VXEVWLWXWHEURZQULFHRUFRUQ )UHQFKIULHGFKLSVZKLWHULFH
Salads 7KHIROORZLQJUDZYHJHWDEOHVVKUHGGHGRU¿QHO\FKRSSHG $Q\RWKHU1RZKLWHRUFLGHU
VHSDUDWHGRUPL[HGEURFFROL%UXVVHOVVSURXWVFDUURWV vinegar.
FDXOLÀRZHUFHOHU\FKLFRU\JUHHQSHSSHUOHWWXFHRQLRQV
UDGLVKHV6ZLVVFKDUGWRPDWRHVWXUQLSVDQGZDWHUFUHVV
Seasonings Chives, garlic, onion, parsley, laurel, marjoram, sage, thyme, Spices, pepper, paprika, sodium
VDYRU\FXPLQRUHJDQRVDOWVXEVWLWXWHVVXFKDV&RVDOWRU VDOW1RZKLWHRUFLGHUYLQHJDU
other potassium salt, sea salt, kelp salt, and herbs.
Soups 9HJHWDEOHVRXS%DUOH\EURZQULFHRUPLOOHWFDQEHDGGHG &DQQHGDQGFUHDPHGVRXSIDW
stock, consomme.
Diets 131

FirstLine Therapy® Diet


7KHIROORZLQJIRRGFKRLFHVJXLGHOLQHVDUHGHVLJQHGWRKHOS\RXDFKLHYHVXVWDLQHGPRGHUDWHIDWORVVDQGLPSURYHGERG\
FRPSRVLWLRQ)RRGVZLWKDORZJO\FHPLFLQGH[DUHHPSKDVL]HGZLWKWKHJRDORIFRQWUROOLQJLQVXOLQOHYHOVDQGLPSURYLQJ
\RXUERG\¶VDELOLW\WRXWLOL]HLQVXOLQ2IFRXUVH\RXUPHQXSODQVKRXOGEHLQGLYLGXDOL]HGGHSHQGLQJRQ\RXUFDORULFQHHGV
personal health issues, and health goals.

1,000 1,300 1,600 1,800 2,000 2,200 2,400


Calorie Calorie Calorie Calorie Calorie Calorie Calorie
*Meal 1 serving 2 servings 2 servings 2 servings 2 servings 2 servings 2 servings
Replacement per day per day per day per day per day per day per day
Legumes 1 serving 1 serving 2 servings 2 servings 2 servings 3 servings 3 servings
per day per day per day per day per day per day per day
Category 1 Unlimited Unlimited Unlimited Unlimited Unlimited Unlimited Unlimited
Vegetables
Category 2 1 serving 1 serving 2 servings 2 servings 2 servings 2 servings 2 servings
Vegetables per day per day per day per day per day per day per day
**Concentrated 2 servings 2 servings 3 servings 3 servings 3 servings 3 servings 4 servings
Protein per day per day per day per day per day per day per day
Oil 3 servings 4 servings 4 servings 6 servings 6 servings 6 servings 7 servings
per day per day per day per day per day per day per day
Nuts and Seeds 1 serving 1 serving 1 serving 1 serving 2 servings 2 servings 2 servings
per day per day per day per day per day per day per day
Fruit 1 serving 2 servings 2 servings 3 servings 3 servings 3 servings 3 servings
per day per day per day per day per day per day per day
Dairy 0 servings 0 servings 1 servings 1 servings 1 servings 1 servings 2 servings
per day per day per day per day per day per day per day
Grain 1 serving 1 serving 1 serving 1 serving 1 serving 1 serving 2 servings
per day per day per day per day per day per day per day
*1 serving = 2 scoops
VHUYLQJ RXQFHVRISURWHLQ FKLFNHQRUEHHI
5HIHUWR3DWLHQW*XLGH%RRNIRULQIRUPDWLRQRQVHUYLQJVL]HV

Legumes
6HUYLQJVL]HFXSFRRNHGRUDVLQGLFDWHG VHUYLQJ DSSUR[LPDWHO\FDORULHV 
• %HDQV  JDUEDQ]R SLQWR NLGQH\ EODFN OLPD FDQQHOOLQL QDY\ PXQJ EHDQV IDWIUHH UHIULHG JUHHQ VR\
beans
• Bean soups, 3/4 cup
• Hummus, 1/4 cup
• 6SOLWSHDVVZHHWJUHHQSHDVOHQWLOV

Category 1 Vegetables
6HUYLQJVL]HFXSVHUYLQJVXQOLPLWHG)UHVKMXLFHVPDGHIURPWKHVHDUHDOORZHG
VHUYLQJ DSSUR[LPDWHO\FDORULHV 
• Artichokes
• Asparagus
• Bamboo shoots
• Bean sprouts
• Bell or other peppers
• %URFFROL%URFFRÀRZHU
• Brussels sprouts
• Cabbage (all types)
• &DXOLÀRZHU&HOHU\
132 Diets

• Chives, onion, leeks, garlic


• Cucumber,
• Dill pickles
• Eggplant
• *UHHQ%HDQV
• *UHHQV ERN FKR\ HVFDUROH 6ZLVV FKDUG NDOH FROODUG JUHHQV VSLQDFK GDQGHOLRQ PXVWDUG RU EHHW
greens
• /HWWXFH0L[HG JUHHQV URPDLQH UHG DQG JUHHQ OHDI HQGLYH VSLQDFK DUXJXOD UDGLFFKLR ZDWHUFUHVV
chicory
• Mushrooms
• 2NUD
• Radishes
• 6DOVD VXJDUIUHH 
• Sea vegetables (kelp, etc.)
• 6QRZSHDV
• Sprouts
• 7RPDWRHVRUPL[HGYHJHWDEOHMXLFH
• :DWHUFKHVWQXWVZKROH
• =XFFKLQL\HOORZVXPPHURUVSDJKHWWLVTXDVK

Category 2 Vegetables
6HUYLQJVL]HFXSRUDVLQGLFDWHG VHUYLQJ DSSUR[LPDWHO\FDORULHV
• %HHWVZLQWHUVTXDVKVXFKDVDFRUQRUEXWWHUQXWVTXDVK
• &DUURWVFXSFRRNHGRUPHGLXPUDZRUEDE\FDUURWV
• 6ZHHWSRWDWRVRU\DPVPHGLXPEDNHG
• <XNRQ*ROG3RWDWRPHGLXP

Concentrated Protein
6HUYLQJVL]HR]FRRNHGRUDVLQGLFDWHG0HDWSRXOWU\DQG¿VKVKRXOGEHJULOOHGEDNHGRUURDVWHG¿VKFDQ
DOVREHSRDFKHG.HHSFKHHVHLQWDNHORZGXHWRVDWXUDWHGIDW VHUYLQJ DSSUR[LPDWHO\FDORULHV
• (JJVZKROHRUHJJZKLWHVSOXVZKROHHJJ
• Egg substitute, 2/3 cup
• )LVKVKHOO¿VKR]IUHVKRUFXSFDQQHGLQZDWHU
• 3RXOWU\FKLFNHQRU&RUQLVKKHQ EUHDVWRQO\ WXUNH\
• /HJRIODPEOHDQURDVW
• %HHIYHU\OHDQ
• 7RIXR]RUFXS IUHVK RUR]FXEH EDNHG
• Tempeh, 3 oz. or 1/2 cup
• Soy or veggie burger, 4 oz.
• &RWWDJHFKHHVHQRQIDWRUORZIDWFXS
• 5LFRWWDSDUWVNLPRUQRQIDWFXS
• 0R]]DUHOODSDUWVNLPRUQRQIDWR]RUFXSVKUHGGHG
• 3DUPHVDQFKHHVH JUDWHG WEOVS
• 793 VR\SURWHLQFRQFHQWUDWH FXS

Nuts and Seeds


6HUYLQJVL]HDVLQGLFDWHG VHUYLQJ DSSUR[LPDWHO\FDORULHV
• $OPRQGVRUKD]HOQXWVZKROHQXWV
• :DOQXWRUSHFDQKDOYHV
• 3HDQXWVQXWVRUWEVS
• 3LVWDFKLRVVXQÀRZHUSXPSNLQRUVHVDPHVHHGVWEVS
• 1XWEXWWHUWEVSPDGHIURPDERYHQXWV
Diets 133

Oils
6HUYLQJVL]HWVSRUDVLQGLFDWHG2LOVVKRXOGEHFROGSUHVVHG VHUYLQJ DSSUR[LPDWHO\FDORULHV
• Avocado, 1/8
• )OD[VHHGRLO UHIULJHUDWH 
• :DOQXWRLO
• ([WUDYLUJLQROLYHRLO SUHIHUDEOH  FDQRODRLOIRUFRRNLQJ
• 0D\RQQDLVH IURPFDQRODRLO
• 2OLYHVPHGLXP

Fruit
6HUYLQJVL]HDVLQGLFDWHG VHUYLQJ DSSUR[LPDWHO\FDORULHV
• Apple, 1 medium
• Apricots, 3 medium
• %HUULHVEODFNEHUULHV EOXHEHUULHVFXSUDVEHUULHV VWUDZEHUULHVFXSV
• Cantaloupe, 1/2 medium
• Cherries, 15
• )UHVK¿JV
• *UDSHIUXLWZKROH
• *UDSHV
• +RQH\GHZPHORQVPDOO
• Mango, 1/2 medium
• Nectarines, 2 small
• 2UDQJHODUJH
• 3HDFKHVVPDOO
• 3HDUPHGLXP
• 3OXPVVPDOO
• Tangerines, 2 small
• :DWHUPHORQFXSV

Dairy
6HUYLQJVL]HR]RUDVLQGLFDWHG VHUYLQJ DSSUR[LPDWHO\FDORULHV
• Buttermilk
• )DWIUHH\RJXUWSODLQ
• /RZIDW\RJXUWSODLQR]
• 1RQIDWRUPLON6R\PLONSODLQ

Grain
6HUYLQJVL]HFXSFRRNHGRUDVLQGLFDWHG VHUYLQJ DSSUR[LPDWHO\FDORULHV
• $PDUDQWKWHIIRUTXLQRD
• %DVPDWLRURWKHUEURZQULFHZLOGULFH
• %DUOH\EXFNZKHDWJURDWVRUPLOOHW
• %XOJXU FUDFNHGZKHDW
• :KROHRDWVUDZFXSFRRNHGRDWPHDOFXS
• :KROHZKHDWVSHOWRUNDPXWEHUULHV
• ZKROHZKHDWVSHOWRUNDPXWSDVWD
• :KROHJUDLQU\HFUDFNHUVHDFK
• %UHDGPL[HGZKROHJUDLQRUZKROHU\HVOLFH
• :KROHZKHDWWRUWLOODRUSLWD
• /RZFDUEWRUWLOODVVPDOORUODUJH

Condiments
Servings: unlimited
• Cinnamon
• Mustard
• Tamari Soy Sauce
134 Diets

• Vinegar
• Lime
• Lemon
• )ODYRUHG([WUDFWV HJYDQLOODRUDOPRQG
• 2WKHUKHUEVVSLFH
• Stevia

What Does a Serving look like?


Foods Average Serving Size Equivalent Size
Legumes FXS Tennis Ball
Vegetables
5DZ&DUURWV 1/2 cup EDE\FDUURWVVWLFNV
6DODG*UHHQV FXS %DVHEDOORU6RIWEDOO
Fruits
Apple Meduim or Large Tennis Ball or Baseball
*UDSHV 15
Whole Grains
&RRNHG*UDLQV5LFH 1/2 cup 3/4 Tennis Ball
Nuts / Seeds
Nut Butters 2 tbsp. 3LQJ3RQJ%DOO
Fish R]JULOOHGEDNHG Checkbook
Poultry/Meat 4 oz. 'HFNRIFDUGV
Dairy
Cheese 1 oz. 3DLURI'LFH
Cottage Cheese 3/4 cup 6PDOO'LVSRVDEOH&RIIHH&XS
Oils
&DQROD2LOV 1 tsp. Thumb Tip
Salad Dressing 2 tbsp. 3LQJ3RQJ%DOO
Beverages 64 oz. 6PDOO'LVSRVDEOH&RIIHH&XSV
Diets 135

Glycemic Index (GI) of Common Foods


Low-Glycemic Foods Moderate-Glycemic Foods High-Glycemic Foods
Barley (pearl) 3XPSHUQLFNHOEUHDG U\HNHUQHO :KLWHEUHDGULFHEUHDGZKHDWEUHDG
rye crackers
0LONZKROH ORZIDW %XFNZKHDW NDVKD :DIÀHSDQFDNHVGRQXWV
\RJXUWZKROH ORZIDW 6ZHHWFRUQ Bagel, tortilla, pita bread
Soy yogurt, soy milk 3DVWDZKROHZKHDW ZKLWH 5LFHZKLWHEURZQEDVPDWL
Apricot dried %XOJXU FUDFNHGZKHDW Rice pasta, rice cakes
$SSOHIUHVK GULHG 0DQJRNLZL 0RVWEUHDNIDVWFHUHDOV
3HDUSHDFK 2UDQJH RUDQJHMXLFH &UHDPRIZKHDWRDWPHDO
Cherries $SSOHMXLFHXQVZHHWHQHG 3LQHDSSOHEDQDQD
*UDSHIUXLW *UDSHIUXLWMXLFH Honey, table sugar
3OXPSUXQHV Tomato juice Dates, raisins
Black beans *UHHQSHDV 3RWDWRHV
.LQGH\EHDQV 6ZHHWSRWDWR\DP Rutabaga, parsnips
Lima beans Beets 3UHW]HOVSRSFRUQ
Soybeans 3LQWREHDQV Ice cream
Split peas, lentis Custard 6RGDSRSVZHHWHQHGVSRUWVGULQNV
Chickpeas (garbanzo beans) Carrots Hot chocolate
Mung bean noodles
3HDQXWV
Fructose
:KLOHDOOULFHSURGXFWVKDYHVLPLODU*,YDOXHVEURZQDQGEDVPDWLULFHDUHVXSHULRUWRZKLWHULFHLQQXWULHQWDQG¿EHUFRQWHQW
136 Diets

Food Groups FirstLine TherapyTM Menu Plan Worksheet


____ Medical 2 servings Name____________________________Day / Date___________________
Food per day
____ Legumes ___ serving(s) Concentrated Protein (continued) Wake up
per day -Fish, shellfish, 3 oz. fresh or 3/4 cup time:_______
____ Category 1 unlimited canned in water
Vegetables -Poultry: chicken or Cornish hen (breast Morning
only), turkey Meal
____ Category 2 ___ serving(s) -Leg of lamb, lean roast time:_______
Vegetables per day -Beef, very lean
____ Concentrated ___ servings -Tofu, 8 oz. or 1 cup (fresh), or 3.5 oz.
Protein per day cube (baked)
-Tempeh, 3 oz. or 1/2 cup
____ Oil ___ serving(s) -Soy or veggie burger, 4 oz.
per day -Cottage cheese, nonfat or lowfat, 3/4 cup
____ Nuts and ___ servings -Ricotta, part skim or nonfat, 1/2 cup
Seeds per day -Mozzarella, part skim or nonfat, 2 oz. or
1/2 cup shredded
____ Fruit ___ servings -Parmesan cheese (grated), 4 tblsp.
per day -TVP (soy protein concentrate), 2/3 cup Snack
____ Dairy ___ serving(s) time:_______
per day Nuts and Seeds
____ Grain ___ serving(s) Serving size as indicated
per day (1 serving = approximately 100 calories)
-Almonds or hazelnuts, 10-12 whole nuts Mid-day
________ Total Calories Per Day -Walnut or pecan halves, 7-8 Meal
-Peanuts, 18 nuts or 2 tbsp. time:_______
Legumes -Pistachios, sunflower, pumpkin, or
Serving size: 1/2 cup cooked, or as indicated sesame seeds, 2 tbsp.
(1 serving = approximately 110 calories) -Nut butter, 1 tbsp. made from above nuts
-Beans - garbanzo, pinto, kidney, black,
lima, cannellini, navy, mung beans, Oils
fat-free refried, green soy beans Serving size: 1 tsp. or as indicated
-Bean soups, 3/4 cup Oils should be cold pressed
-Hummus, 1/4 cup (1 serving = approximately 40 calories)
-Split peas, sweet green peas, lentils -Avocado, 1/8
-Flaxseed oil (refrigerate) -Walnut oil
Category 1 Vegetables -Extra virgin olive oil (preferable) Snack
Serving size: 1/2 cup - servings unlimited & canola oil for cooking time:_______
Fresh juices made from these are allowed -Mayonnaise (from canola oil)
(1 serving = approximately 10-25 calories) -Olives, 8-10 medium
-Artichokes -Asparagus -Bamboo shoots
-Bean sprouts -Bell or other peppers Fruit
-Broccoli, Broccoflower -Brussels sprouts Serving size as indicated
Evening
-Cabbage (all types) -Cauliflower -Celery (1 serving = approximately 80 calories)
Meal
-Chives, onion, leeks, garlic -Cucumber, time:_______
-Apple, 1 medium -Apricots, 3 medium
-Dill pickles -Eggplant -Green Beans -Berries: blackberries & blueberries, 1 cup;
-Greens: bok choy, escarole, Swiss chard, rasberries & strawberries, 1 1/2 cups
kale, collard greens, spinach, dandelion, -Cantaloupe, 1/2 medium -Cherries, 15
mustard, or beet greens -Fresh figs, 2 -Grapefruit, 1 whole
-Lettuce/Mixed greens: romaine, red and -Grapes, 15 -Honeydew melon, 1/4 small
green leaf, endive, spinach, arugula, -Mango, 1/2 medium -Nectarines, 2 small
radicchio, watercress, chicory -Orange, 1 large -Peaches, 2 small
-Mushrooms -Okra -Radishes -Pear, 1 medium -Plums, 2 small
-Salsa (sugar-free) -Sea vegetables -Tangerines, 2 small -Watermelon, 2 cups
(kelp, etc.) -Snow peas -Sprouts Snack
-Tomatoes or mixed vegetable juice time:_______
-Water chestnuts, 5 whole Dairy
-Zucchini, yellow, summer, or Serving size: 6 oz., or as indicated
spaghetti squash (1 serving = approximately 80 calories)
-Buttermilk -Fat-free yogurt, plain Water
Category 2 Vegetables -Lowfat yogurt, plain, 4 oz. (ounces):
Serving size: 1/2 cup, or as indicated -Nonfat, 1%, or 2% milk, Soy milk, plain
(1 serving = approximately 45 calories) Other Drinks
-Beets, winter squash, such as acorn or Grain (not listed with
butter nut squash Serving size: 1/2 cup cooked, or as indicated meals above):
-Carrots, 1/2 cup cooked or 2 medium (1 serving = approximately 75-100 calories)
Activity/
raw or 12 baby carrots -Amaranth, teff, or quinoa Exercise
-Sweet potatos or yams, 1/2 medium baked -Basmati or other brown rice, wild rice Type:
-Yukon Gold Potato, 1/2 medium -Barley, buckwheat groats, or millet Duration:
-Bulgur (cracked wheat)
Concentrated Protein -Whole oats, raw, 1/3 cup; cooked oatmeal Relaxation
Serving size: 3-6 oz. cooked, or as indicated. 3/4 cup Type:
Meat, poultry and fish should be grilled, -Whole wheat, spelt, or kamut berries Duration:
baked or roasted; fish can also be poached. -100% whole wheat, spelt, or kamut pasta
Keep cheese intake low due to saturated fat. -Whole grain rye crackers, 3 each
(1 serving = approximately 150 calories) -Bread: mixed whole grain or 100% whole Duration:
-Eggs, 2 whole, or 3 egg whites plus 1 rye, 1 slice Copyright © 2003, 2007 by Metagenics. Reproduction, photocopying,
whole egg -Whole wheat tortilla or pita, 1/2 storage or transmission by magnetic, electronic or any other means
-Egg substitute, 2/3 cup (continued) -Low-carb tortillas, 2 small or 1 large without permission is strictly prohibited by law.
-%4  
Diets 137

Modified Elimination Diet


Foods to Include Foods to Avoid
Fruits 8QVZHHWHQHGIUHVKIUR]HQZDWHU
SDFNHGRUFDQQHGXQVZHHWHQHGIUXLW
2UDQJHV

MXLFHVH[FHSWRUDQJH

Vegetables $OOIUHVKUDZVWHDPHGVDXWpHG
juiced, or roasted vegetables
&RUQFUHDPHGYHJHWDEOHV

Starch Rice, oats, millet, quinoa, amaranth,


WHIIWDSLRFDEXFNZKHDW
:KHDWFRUQEDUOH\VSHOWNDPXWU\H
DOOJOXWHQFRQWDLQLQJSURGXFWV

Bread/Cereal 3URGXFWVPDGHIURPULFHRDW
EXFNZKHDWPLOOHWSRWDWRÀRXU
3URGXFWVPDGHIURPZKHDWVSHOW
NDPXWU\HEDUOH\DOOJOXWHQ
WDSLRFDDUURZURRWDPDUDQWKTXLQRD containing products

Legumes All beans, peas, and lentils unless


RWKHUZLVHLQGLFDWHG
6R\EHDQV‚WRIXWHPSHKVR\EHDQV
soy milk, other soy products

Nuts and Seeds $OPRQGVFDVKHZVZDOQXWVVHVDPH


WDKLQL VXQÀRZHUDQGSXPSNLQ
3HDQXWVSHDQXWEXWWHU

VHHGVEXWWHUVPDGHIURPWKHVHQXWV
and seeds

Meat and Fish $OOFDQQHG ZDWHUSDFNHG IUR]HQRU


IUHVK¿VKFKLFNHQWXUNH\ZLOGJDPH
%HHISRUNFROGFXWVIUDQNIXUWHUV
sausage, canned meats, eggs,
lamb VKHOO¿VK

Dairy Products & Milk Milk substitutes such as rice milk,


almond milk, oat milk, coconut milk,
Milk, cheese, cottage cheese, cream,
\RJXUWEXWWHULFHFUHDPIUR]HQ
Substitutes other nut milks \RJXUW³QRQGDLU\´FUHDPHUV

Fats &ROGH[SHOOHUSUHVVHGROLYHÀD[
FDQRODVDIÀRZHUVXQÀRZHUVHVDPH
Margarine, butter, shortening,
processed (hydrogenated) oils,
ZDOQXWSXPSNLQRUDOPRQGRLOV mayonnaise, spreads

Beverages )LOWHUHGRUGLVWLOOHGZDWHUKHUEDOWHD
VHOW]HURUPLQHUDOZDWHU
6RGDSRSRUVRIWGULQNVDOFRKROLF
EHYHUDJHVFRIIHHWHDRWKHU
FDIIHLQDWHGEHYHUDJHV

Spices & Condiments $OOVSLFHVXQOHVVRWKHUZLVHLQGLFDWHG


)RUH[DPSOHXVHFLQQDPRQFXPLQ
Chocolate††, ketchup, mustard, relish,
chutney, soy sauce, barbeque sauce,
dill, garlic, ginger, carob, oregano, other condiments
parsley, rosemary, tarragon, thyme,
turmeric, vinegar

Sweeteners %URZQULFHV\UXSIUXLWVZHHWHQHU
blackstrap molasses, stevia
:KLWHRUEURZQUH¿QHGVXJDUKRQH\
PDSOHV\UXSFRUQV\UXSKLJKIUXFWRVH
FRUQV\UXSFDQG\GHVVHUWVPDGHZLWK
WKHVHVZHHWHQHUV
‚1RWHWKDWVR\LVDQLQJUHGLHQWLQVRPHRIWKHUHFRPPHQGHGPHGLFDOIRRGVDQGVXSSOHPHQWIRUPXODV7KHUHIRUHWKRVH
SURGXFWVDUHRQO\UHFRPPHQGHGLI\RXUKHDOWKFDUHSUDFWLWLRQHUKDVGHWHUPLQHG\RXKDYHQRLQWROHUDQFHWRVR\
‚‚1RWHWKDWFKRFRODWHLVDQLQJUHGLHQWLQVRPHRIWKHUHFRPPHQGHGPHGLFDOIRRGV7KHUHIRUHWKRVHSURGXFWVDUHRQO\
UHFRPPHQGHGLI\RXUKHDOWKFDUHSUDFWLWLRQHUKDVGHWHUPLQHG\RXKDYHQRLQWROHUDQFHWRFKRFRODWH
138 Ear Dysfunction

Ear Dysfunction
Ear Infection (Otitis Media)
$FXWHRWLWLVPHGLDLVDYLUDORUEDFWHULDOLQIHFWLRQRIWKHPLGGOHHDUXVXDOO\VHFRQGDU\WRD85,,WLVPRVWFRPPRQ
LQFKLOGUHQVL[WRPRQWKVROGDQGWKHQDJDLQDW\HDUVROG,WLVWKHPRVWIUHTXHQWGLDJQRVLVRIFKLOGUHQLQ
DFOLQLFDOVHWWLQJDQGLWLVHVWLPDWHGWKDWDERXWELOOLRQGROODUVVSHQWHDFK\HDUIRUFRQYHQWLRQDOPHGLFDODQG
VXUJLFDOWUHDWPHQWRIWKHFRQGLWLRQ

Etiology
7KHHXVWDFKLDQWXEHLVWKHIRFDOSRLQWRIFRQFHUQLQPRVWFDVHVRIDFXWHRWLWLVPHGLD7KHHXVWDFKLDQWXEHSURWHFWV
WKHPLGGOHHDUIURPQDVRSKDU\QJHDOVHFUHWLRQVUHJXODWHVJDVSUHVVXUHLQWKHPLGGOHHDUSUHYHQWVEDFWHULDDQG
YLUXVHVIURPKDYLQJHDV\DFFHVVLQWRWKHPLGGOHHDUIURPWKHPRXWKDQGQDVRSKDU\Q[DQGFOHDUVVHFUHWLRQVIURP
the middle ear. In the child, the tube is at a horizontal level in the head (the tube becomes slightly vertical in the
DGXOW PDNLQJLWHDVLHUIRURUJDQLVPVWRPRYHIURPWKHQDVRSKDU\Q[LQWRWKHPLGGOHHDU7KHWXEHRSHQVGXULQJ
WKHDFWRIVZDOORZLQJGXHWRWKHFRQWUDFWLRQRIWKHWHQVRUYHOLSDODWLQLPXVFOH2EVWUXFWLRQRIWKHWXEHDQGRU
DEQRUPDOSDWHQF\DUHWKHLQLWLDWLQJIDFWRUVFDXVLQJDFXWHRWLWLVPHGLD2EVWUXFWLRQPD\EH
1. Function: Due to an abnormal opening mechanism and/or increased tubal compliance.
2. Mechanical:'XHWRDEQRUPDOK\SHUSODVLDRIWKHWLVVXHVDURXQGWKHWXEHVRSHQLQJLQWRWKHQDVRSKDU\Q[
RUVZHOOLQJRIWKHWXEHLWVHOI
3. Infection/Allergy: $IIHFWLQJQHDUE\WLVVXHVFDXVLQJWKHPWRVZHOODQGRFFOXGHWKHWXEH
,QLQIDQWVWKHEDFWHULDPRVWLQYROYHGDUHE. coli and S. aureusLQROGHUFKLOGUHQ EXWOHVVWKDQHLJKW\HDUVROG 
the most common bacteria are 6SQHXPRQLD+LQÀXHQ]D*URXS$EHWDKHPRO\WLFVWUHSWRFRFFLDQGS. aureus.
2YHUHLJKW\HDUVRIDJH+LQÀXHQ]DLVOHVVLQYROYHGLQLQIHFWLRQVRIWKHHDUDQGWKHRWKHUWKUHHEDFWHULDDUHWKH
PDLQFDXVHV2WLWLVPHGLDXVXDOO\EHJLQVZKHQDYLUDO85,RUDFXWHRWLWLVPHGLDH[SHULHQFHVVHFRQGDU\LQYDVLRQ
E\RQHRIWKHVHEDFWHULDORUJDQLVPV
&DXVDWLYHIDFWRUVLQYROYHGLQVXVFHSWLELOLW\LQFOXGHVXEVWLWXWLQJHDUO\ERWWOHIHHGLQJIRUEUHDVWIHHGLQJ+XPDQ
EUHDVWPLONVHHPVWRKDYHDSURSK\ODFWLFHIIHFWRQDEDE\DOWKRXJKWKHH[DFWUHDVRQZK\LVQRWXQGHUVWRRG
WKDWLVZKHWKHULWKDVPRUHWRGRZLWKDQLQWROHUDQFHWRWKHFRZ¶VPLONRUWKHQDWXUDOLPPXQHERRVWSURYLGHGE\
PRWKHU¶VPLONRUDFRPELQDWLRQRIERWK$UHODWHGIDFWRUWRERWWOHIHHGLQJLVWKDWVXSLQHIHHGLQJZLWKWKHERWWOHKDV
EHHQVKRZQWRFDXVHUHJXUJLWDWLRQRIWKHPLONZKLFKWKHQKDVDFKDQFHRIHQWHULQJWKHHXVWDFKLDQWXEH$QRWKHU
YHU\FRPPRQHWLRORJLFDOIDFWRULQFKLOGUHQLVRQHRUPRUHIRRGRULQKDODQWDOOHUJLHV$OOHUJHQVPD\FDXVHDFXWH
RWLWLVPHGLDE\FDXVLQJPXFRXVSURGXFWLRQDQGPXFRXVPHPEUDQHVZHOOLQJ2QFHWKHDOOHUJHQVDUHGLVFRYHUHG
DQGUHPRYHGIURPWKHFKLOG¶VHQYLURQPHQWRUGLHWKHDOWKFDQJUHDWO\LPSURYH&RPPRQIRRGDOOHUJHQVLQFKLOGUHQ
LQFOXGHFRZ¶VPLONZKHDWVR\FRUQFLWUXVDQGHJJDOWKRXJKRWKHUIRRGVPD\EHLPSOLFDWHGRQDQLQGLYLGXDOEDVLV
,QKDODQWDOOHUJLHVLQFOXGHPROGVGXVWDQLPDOGDQGHUDQGKD\IHYHU3UHWHHQRWLWLVPHGLDVHHPVWREHUHODWHGWR
WUXHIRRGDOOHUJLHVZKLOHRWLWLVPHGLDLQDGXOWV \HDUVDQGROGHU VHHPVWREHPRVWO\IRRGVHQVLWLYLWLHV

Symptoms
7KHLQLWLDOFRPSODLQWRIDFXWHRWLWLVPHGLDLVXVXDOO\WKDWRIDSHUVLVWHQWSDLQIXOHDUDFKH&KLOGUHQPD\SXOORQ
WKHLUHDURUERUHWKHLU¿QJHULQWRWKHFDQDO7KHFKLOG¶VPRRGPD\RIWHQFKDQJHWRLUULWDELOLW\RUFOLQJLQHVV7KHUH
LVQRWLQIUHTXHQWO\DKLVWRU\RIUHFHQWYLUDO85,DOWKRXJKHXVWDFKLDQWXEHREVWUXFWLRQIURPDQ\FDXVHFDQOHDG
WRLQIHFWLRQ+HDULQJORVVPD\RFFXUEXWLVQRWWKDWFRPPRQ+LJKIHYHUFKLOOVQDXVHDYRPLWLQJDQGGLDUUKHD
PD\EHSUHVHQW7\PSDQLFPHPEUDQHLVK\SHUHPLFRSDTXHDQGEXOJLQJWKHFRQHRIOLJKWLVGLVSODFHGDQGWKH
ODQGPDUNVDUHKDUGWRGLVFHUQ,QVXIÀDWLRQVKRZVDW\PSDQLFPHPEUDQHWKDWGRHVQRWPRYH,IWKHW\PSDQLF
PHPEUDQH VSRQWDQHRXVO\ UXSWXUHV WKHUH LV VLJQL¿FDQW SDLQ UHOLHI DVVRFLDWHG ZLWK WKH ÀRZ RI EORRG\ VHURXV
and/or purulent otorrhea.

Course and Prognosis


7KHSRWHQWLDOFRPSOLFDWLRQVRIDFXWHRWLWLVPHGLDLQFOXGHDFXWHPDVWRLGLWLVSHWURVLWLVEUDLQDEVFHVVIDFLDOSDUDO\VLV
HSLGXUDODEVFHVVODE\ULQWKLWLVKHDULQJORVV FRQGXFWLYHDQGVHQVRULQHXUDO PHQLQJLWLVVXEGXUDOHPS\HPDODWHUDO
VLQXVWKURPERVLVRWLWLFK\GURFHSKDOXVDQGWKHGHYHORSPHQWRIVHURXVRWLWLVPHGLD6\PSWRPVRIWKHEHJLQQLQJ
RIRQHRIWKHVHULRXVFRPSOLFDWLRQV DOOEXWVHURXVRWLWLVPHGLD LQFOXGHKHDGDFKHFKLOOVDQGIHYHUYHUWLJRDQG
VXGGHQVHYHUHKHDULQJORVV7KHW\SLFDOFRXUVHIRUDFKLOGKDYLQJUHFXUUHQWLQIHFWLRQVDQGVHHLQJDQ0'IRU
WUHDWPHQWZRXOGEHFRQWLQXRXVXVHRIDQWLELRWLFVW\PSDQRVWRP\WXEHVWRQVLOOHFWRP\DQGDGHQRLGHFWRP\DOWKRXJK
WKHVHSURFHGXUHVKDYHQRVLJQL¿FDQWHI¿FDF\LQWKHOLWHUDWXUHZKHQFRPSDUHGWRWUHDWPHQWZLWKSODFHER,ID
FKLOGLVWDNHQRIIRIIRRGVVKHKHLVLQWROHUDQWRIDQGDYRLGVRWKHUDOOHUJHQVDFRPSOHWHFHVVDWLRQRIDFXWHRWLWLV
PHGLDHSLVRGHVPD\RIWHQHQVXH
6HURXVRWLWLVPHGLDDOVRNQRZQDVVHFUHWRU\RUQRQVXSSXUDWLYHRWLWLVPHGLDLVDFKURQLFHIIXVLRQLQWKHPLGGOH
HDUUHVXOWLQJIURPWKHLQFRPSOHWHUHVROXWLRQRIDFXWHRWLWLVPHGLDRUDFKURQLFREVWUXFWLRQRIWKHHXVWDFKLDQWXEH
,WPD\EHUHFRJQL]HGE\VHHLQJDQDLUÀXLGOHYHORUEXEEOHVEHKLQGWKHW\PSDQLFPHPEUDQHZLWKRWRVFRS\DV
ZHOODVUHWUDFWLRQRIWKHPHPEUDQHDGLVSODFHGOLJKWUHÀH[DQGDQDELOLW\WRVHHWKHODQGPDUNVPRUHGLVWLQFWO\
,WLVIRXQGLQRIFKLOGUHQXQGHUVL[\HDUVROGDQGPD\FDXVHFRQGXFWLYHKHDULQJORVV2QFXOWXUHWKH
Ear Dysfunction 139

H[XGDWHSUHVHQWLVXVXDOO\VWHULOHEXWPD\FRQWDLQSDWKRJHQLFEDFWHULD$OOHUJLHVKDYHEHHQ¿UPO\LPSOLFDWHGLQ
SDWLHQWVZLWKVHURXVRWLWLVPHGLDHLWKHULQKDODQW  IRRG  RUERWK  3DWLHQWVZKRDUHWUHDWHGIRU
DOOHUJLHVE\UHPRYLQJWKHRIIHQGLQJDQWLJHQDQGRUE\GHVHQVLWL]DWLRQVKRZDYHU\JRRGVXFFHVVUDWHLQFXULQJ
serous otitis media.

General Treatment Strategies in otitis media


1. $VVXPHSUREOHPKDVDGLHWDU\FRPSRQHQWXQWLOSURYHQRWKHUZLVH
2. (OLPLQDWHDOOGDLU\SURGXFWVIRUDWOHDVWWKUHHZHHNV
3. (OLPLQDWHUH¿QHGVXJDUVDQG³MXQNIRRG´
4. $GGUHVVIRRGLQWROHUDQFH EHJLQZLWKPRVWVLPSOHDQGLQH[SHQVLYH 
‡HOLPLQDWHIRRGVWKHFKLOGFRPPRQO\HDWVWKDWDUHRQWKH³FRPPRQRIIHQGHUV´OLVWRU
‡SHUIRUPHOLPLQDWLRQSURYRFDWLRQ (3 WHVWLQJ
‡LI(3LVXQVXFFHVVIXO\RXPD\ZLVKWRSURFHHGWRVHUXP,J*,J(RU,J0²LQYDVLYHDQGFRVWO\EXW
 YHU\XVHIXO
5. (OLPLQDWHWUDQVIDWW\DFLGVIURPGLHW
6. 'HFUHDVHRPHJDLQWDNHZKLOHLQFUHDVLQJRPHJDLQWDNH
7. 5HGXFHLQWDNHRIPHDWDQGHJJVXQOHVVFKLOGLVPDOQRXULVKHG
8. Address biomechanical problems.

Suggested Nutritional Supplementation

Acute Otitis Media Nutritional Protocol


• D89-1²GURSVGLUHFWO\LQWKHHDURUDSSOLHGWRFRWWRQDQGLQVHUWHGLQWKHHDU
• D89²GURSVXQGHUWRQJHWLPHVGDLO\
• Mycelized Children’s Multi-Vitamin — 1 ml 2 times daily.

Chronic Otitis Media Nutritional Protocol


• D89-1²GURSVGLUHFWO\LQWKHHDURUDSSOLHGWRFRWWRQDQGLQVHUWHGLQWKHHDU
• UltraFlora Plus²WHDVSRRQPL[HGLQOXNHZDUPZDWHUGLOXWHGMXLFHRUIRUPXODWLPHVGDLO\
• Ultracare for Kids® ² RQH OHYHO VFRRS  WR HLJKW WR WHQ RXQFHV RI SXUH GLVWLOOHG RU ¿OWHUHG ZDWHU
1XWULWLRQDO6XSSRUWIRU&KLOGUHQZLWK)RRG6HQVLWLYLWLHV

Additional Considerations
• &KLOGUHQZKRKDYHEHHQRQUHSHDWHGFRXUVHVRIDQWLELRWLFVPD\QHHGUHVWRUDWLRQRIERZHOHFRORJ\(Ultra
Flora Plus and Probioplex Intensive Care).
• %UHDVWIHGFKLOGUHQPD\UHTXLUHDGGLWLRQDO]LQF(Zinc Drink). Zinc Tally may be used to determine the zinc
GH¿FLHQF\
• (VVHQWLDOIDWW\DFLGVGH¿FLHQF\ GU\VNLQÀ\DZD\KDLU PD\EHSUHVHQW(Balanced EPA-DHA LIquid).
• %RWWOHIHGFKLOGUHQPD\UHTXLUHDGGLWLRQDO*/$(GLA Forte).
• ,QFDVHVRIDOOHUJ\ +33DLQ ,QÀDPPDWLRQ5HPHG\RU3HULPLQH .

Additional Therapy
AcupunctureFDQEHXVHIXODVDQDGMXQFWLYHPHDVXUHHVSHFLDOO\6L)HQJLQEDELHVDQGWRGGOHUV$FXpressure
FDQSURYLGHV\PWRPDWLFUHOLHI
Main Points:*%*%*%6-6-6L)HQJH[WUD
If Needed, Add:
• /,WRFOHDUZLQG.,WRQHNLGQH\/9UHJXODWH/9/,'8'8FOHDUZLQGKHDW%/UHJXODWH
/9*%63WRQHVSOHHQ

Otitis in Breast-Fed Infants


• Child may be sensitized in utero
• 0RWKHU¶VFXUUHQWGLHW²SHUIRUP(OLPLQDWLRQ3URYRFDWLRQ
• ([FHVVLYHPDWHUQDOYLWDPLQRUGUXJLQWDNHLQSUHJQDQF\RUODFWDWLRQ
• 3RRUPDWHUQDO()$RU]LQFLQWDNH TXLWHFRPPRQ
• 8QUHODWHGWRIRRGRUQXWULWLRQ
• Suspect birth trauma
• &RQVLGHUYDFFLQHUHDFWLRQLIFKLOGKDVEHHQLPPXQL]HG
140 Ear Dysfunction

Meniere's Syndrome / Tinnitus


7KHGLVHDVHZDV¿UVWGLDJQRVHGLQE\3URVSHU0HQLHUH0HQLHUH¶VV\QGURPHLVDQLOOQHVVWKDWDIÀLFWVPRUHWKDQ
seven million Americans, according to the Journal of American Medical Association (July 25, 1990). It is generally
EHOLHYHGWREHFDXVHGE\DEXLOGXSRIÀXLGLQWKHLQQHUHDU7KHUHVXOWLQJSUHVVXUHFDQPDQLIHVWWKHIROORZLQJOLVWRI
V\PSWRPVULQJLQJRUEX]]LQJLQWKHHDUV 7LQQLWXV SDLQDQGSUHVVXUHLQWKHKHDGDQGHDUVLQWHUPLWWHQWGHDIQHVV
GL]]LQHVVQDXVHDYRPLWLQJDQGYHUWLJRDQGEDODQFHSUREOHPV7KHDIÀLFWHGPD\VXIIHUIURPDOORURQO\DSRUWLRQRI
WKHVHV\PSWRPV)OXLGUHWHQWLRQGXULQJWKHSUHPHQVWUXDOSHULRGLQZRPHQDOOHUJLHVDQGVSDVPVRIEORRGYHVVHOV
to the inner ear may cause this disorder.
&XUUHQW PHGLFDO PDQDJHPHQW RI 0HQLHUH¶V V\QGURPH LQFOXGHV XVH RI SUHVFULSWLRQ GLXUHWLFV WR UHOLHYH H[FHVV
ÀXLGZLWKLQWKHLQQHUHDU3RWDVVLXPVKRXOGEHSUHVFULEHGZLWKWKHPDVGLXUHWLFVFDQUDGLFDOO\GHSOHWHWKHERG\
RIWKLVLPSRUWDQWPLQHUDO

Contributing Factors
• 3RRU'LHW6WUHVV±0DQ\QXWULWLRQDOO\RULHQWHGSK\VLFLDQVEHOLHYHWKDW0HQLHUH¶VSDWLHQWVODFN%YLWDPLQV7KLV
LVQRWXQFRPPRQVWUHVVJHQHUDOOLIHVW\OHSRRUGLHWDQGWKHHQYLURQPHQWFDQGHSOHWH%YLWDPLQV
• )RRG6HQVLWLYLWLHV HVSHFLDOO\6DOLF\ODWHV ±6KRXOGEHDFFHVVHGLQLQQHUHDUG\VIXQFWLRQPDQDJHPHQW
• $QWLELRWLF8VH±$GGLQJDFLGRSKLOXVWRWKHGLHWLVUHFRPPHQGHGWRLQFUHDVHWKHLQWHVWLQHV¶FDSDELOLW\RIGLJHVWLQJ
WKHVHQXWULHQWVSURSHUO\,WKDVEHHQVSHFXODWHGWKDWHSLVRGHVRI0HQLHUH¶VV\QGURPHPD\RFFXUDIWHUWKH
VXIIHUHUKDVLQJHVWHGODUJHTXDQWLWLHVRIDQWLELRWLFV$QWLELRWLFVGLVUXSWWKHEHQH¿FLDOLQWHVWLQDOEDFWHULD
• +\SHUOLSLGHPLD ± ,PSDLUHG EORRG ÀRZ WR WKH EUDLQ IURP FORJJHG DUWHULHV DQG SRRU FLUFXODWLRQ PD\ EH D
cause
• /HDG$OXPLQXP7R[LFLW\PD\LQGLUHFWO\DIIHFWWKHHDUE\FDXVLQJPDOIXQFWLRQLQWKHEUDLQDQGRUV\PSDWKHWLF
nervous system

Dietary Suggestions
• FirstLine® Therapy Diet
• $YRLG&DIIHLQH±&DIIHLQHKDVEHHQVKRZQWREHDQLUULWDQWLQWKLVFRQGLWLRQHVSHFLDOO\LQWKHIRUPRIFRIIHH
• $YRLG$OFRKRODQG7REDFFR±7KHVHVXEVWDQFHVKDYHEHHQVKRZQWREHHVSHFLDOO\XQKHDOWK\LQWKLVFRQGLWLRQ
• $YRLG 6XJDU ± 6XJDU LV VDLG WR FDXVH LQQHU HDU G\VIXQFWLRQ E\ SURPRWLQJ G\VJO\FHPLD DQG FRQVHTXHQW
DGUHQDOLQHUHOHDVHZKLFKLQWXUQFDXVHVYDVRFRQVWULFWLRQ

Suggested Nutritional Supplementation


• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• CoQ10 ST 100 ²VRIWJHOWKUHHWLPHVGDLO\
6WDELOL]HG+LJKO\$EVRUEDEOH&RHQ]\PH4ZLWK1DWXUDO9LWDPLQ(
$FFRUGLQJ WR D *HUPDQ VWXG\ SXEOLVKHG LQ 2WRODU\QJRO +HDG 1HFN 6XUJ  -DQ    ³)RU
D 6XEJURXS RI SHRSOH &R4 PD\ SURYLGH UHOLHI IURP WKH V\PSWRPV RI WLQQLWXV´ 7KH WHVW JURXS ZDV
DGPLQLVWHUHGPJRI&R4WKUHHWLPHVGDLO\IRUZHHNV
• Gingko-Rose²WDEOHWVGDLO\LQEHWZHHQPHDOV
$*LQJNR5RVHPDU\FRPELQDWLRQGHVLJQHGIRULPSURYHGFLUFXODWLRQDQGKHDOWK\EUDLQIXQFWLRQ3URPRWHV
mental clarity and may improve tinnitus.

If a history of antibiotic use:


• Ultra Flora IB²FDSVXOHGDLO\ZLWKIRRG PLQLPXPRIERWWOHV
8OWUD)ORUD,%LVDQHQKDQFHGSRWHQF\SURELRWLFIRUPXODGHVLJQHGWRKHOSUHOLHYHERZHOLUULWDWLRQDQGUHODWHG
IXQFWLRQDOGLVFRPIRUWVE\SURPRWLQJDKHDOWK\EDODQFHRILQWHVWLQDOPLFURÀRUD

If on prescription diuretics:
• MG/K Aspartate²WDEOHWVGDLO\ZLWKIRRG
0DJQHVLXPDQG3RWDVVLXPFRPELQDWLRQGHVLJQHGWRRSWLPDOO\UHSODFHORVWSRWDVVLXPOHYHOV

If Vertigo is a complicating factor:


• D-29²WRGURSVXQGHUWKHWRQJXH KROGIRUVHFRQGVDQGWKHQVZDOORZ WKUHHWLPHVDGD\
In acute conditions 5 to 10 drops under the tongue every 20–30 minutes.
+RPHRSDWKLFIRUPXODGHVLJQHGVSHFL¿FDOO\IRU9HUWLJR
Enuresis (Bed-Wetting) 141

Enuresis (Bed-Wetting)
/RVVRIFRQWURORIWKHEODGGHUE\GD\E\QLJKWRUERWK1RWOLPLWHGWR\RXQJFKLOGUHQ0DQ\DGROHVFHQWVDQGDGXOWV
DUHDIÀLFWHGLQWKLVZD\HLWKHUFRQVWDQWO\RULQWLPHVRIVWUHVVRUDQ[LHW\
'U-RKQ:*HUDUG3URIHVVRURI3HGLDWULFVDWWKH8QLYHUVLW\RI6DVNDWFKHZDQSUHVHQWVHYLGHQFHWKDWEHGZHWWLQJ
LVVRPHWLPHVWKHUHVXOWRIDQDOOHUJ\³7KHSULPHSUREOHPLVWKDWWKHEHGZHWWLQJ\RXQJVWHUKDVDVPDOOEODGGHU
FDSDFLW\DQGWKHEODGGHUFDSDFLW\KDVVKUXQNEHFDXVHWKHGHWUXVRUPXVFOHLVLQVSDVPZKLFKLVRIWHQDPDQLIHVWDWLRQ
RIDQDOOHUJ\´&HUWDLQIRRGVVXFKDVPLONFKRFRODWHDQGHJJVFDQFDXVHEODGGHUK\SHUVHQVLWLYLW\ZKLFKLQWXUQ
FDXVHVEHGZHWWLQJ5HPRYDORIRIIHQGHUIRRGVUHVXOWVLQFHVVDWLRQRIZHWWLQJ
1XWULWLRQDQGVXSSRUWRIWKHQHUYRXVV\VWHPKDYHEHHQDPRVWHIIHFWLYHDSSURDFKIRUEHGZHWWLQJ

Suggested Nutritional Supplementation


• D-74 Uresinoct ²GURSVWLPHVGDLO\XQGHUWRQJXH+ROGVHFRQGVVZDOORZ
$OWKRXJKKRPHRSDWK\LVRQHRIWKHROGHVWDUWIRUPVRIKHDOLQJLWLVEHLQJUHGLVFRYHUHGWRGD\E\PDQ\PRGHUQ
GD\SUDFWLWLRQHUVDVRQHRIWKHPRVWUHOLDEOHG\QDPLFDQG\HWVDIHZD\VWRDVVLVWWKHERG\LQLQFUHDVLQJLWV
FHOOXODUHQHUJLHVWRHQDEOHWKHERG\WRUHSDLULWVHOI
• Hemagenics ²±WDEOHWVGDLO\ZLWKIRRG ,ILQGLFDWHGE\ODEYDOXHV
0RVWHIIHFWLYHDQGFRPSOHWHEORRGEXLOGHUZLWKLURQ,URQGH¿FLHQF\KDVORQJEHHQDVVRFLDWHGLQFRJQLWLYH
LQDELOLWLHVEHKDYLRUDOSUREOHPVDQGZHDNEODGGHUIXQFWLRQ+HPDJHQLFVLVWKHPRVWDEVRUEDEOHIRUPRILURQ
DQGZLOOQRWFDXVHDQ\LUULWDWLRQWRWKHGLJHVWLYHV\VWHP
• Ginkgo Biloba-60²FDSVXOHVGDLO\
*LQNJR%LOREDFDQKDYHDGLVWLQFWDQWLGLXUHWLFHIIHFWLQFHUWDLQGRVDJHV7KHSUHVXPHGPHWKRGRIDFWLRQLV
JLQNJR
VQRUPDOL]LQJHIIHFWRQFLUFXODWLRQLQFOXGLQJWKHYROXPHRIEORRGÀRZWKURXJKWKHNLGQH\V

Recovery/Maintenance
• Ultracare for Kids®0HGLFDO)RRG²RQHOHYHOVFRRS J WRHLJKWWRWHQRXQFHVRISXUHGLVWLOOHGRU
¿OWHUHGZDWHUGDLO\
1XWULWLRQDO6XSSRUWIRU&KLOGUHQZLWK)RRG6HQVLWLYLWLHV
-OR-
• Ultra Care First Start²)RUFKLOGUHQDJHVEOHQGVKDNHRUEULVNO\VWLUOHYHOVFRRSVRI8OWUDFDUH
)LUVW6WDUWLQWRRXQFHVRIFKLOOHGZDWHU)RUFKLOGUHQDJHVEOHQGVKDNHRUEULVNO\VWLUOHYHO
VFRRSLQWRRXQFHVRIFKLOOHGZDWHU
8OWUDFDUH)LUVW6WDUWLVDVSHFLDOW\PHGLFDOIRRGGULQNPL[GHVLJQHGWRPHHWWKHQXWULWLRQDOQHHGVRIFKLOGUHQ
and teenagers.

Dietary Suggestions
• FirstLine Therapy® Diet
142 Eye Conditions

Eye Conditions
Cataracts
&DWDUDFWVDUHFOXPSVRISURWHLQWKDWFROOHFWRQWKHOHQVRIDQH\HDQGLQWHUIHUHZLWKYLVLRQ1RUPDOO\OLJKWSDVVHV
WKURXJKWKHOHQV WKHFOHDUWLVVXHEHKLQGWKHSXSLO DQGIRFXVHVRQWKHUHWLQD7KHUHWLQDLVWKHOLJKWVHQVLWLYH
OD\HURIWKHH\HWKDWVHQGVYLVXDOVLJQDOVWRWKHEUDLQ$FDWDUDFWRFFXUVZKHQWKHQRUPDOO\FOHDUOHQVEHFRPHV
FORXG\0RVWFDWDUDFWVGHYHORSVORZO\RYHUWLPHDQGDUHDQDWXUDOUHVXOWRIDJLQJ2QFHFDWDUDFWVEHFRPHODUJH
HQRXJKWKDWYLVLRQORVVLQWHUIHUHVZLWKHYHU\GD\DFWLYLWLHVVXFKDVGULYLQJUHDGLQJRUZDWFKLQJWHOHYLVLRQWKH\
should be surgically removed.

Signs and Symptoms


• 'HFUHDVHGRUEOXUUHGYLVLRQ RIWHQGHVFULEHGDVDIRJ 
• Double vision
• Halo around lights
• 6HFRQGVLJKW±ZKHQDQLQGLYLGXDOZKRQRUPDOO\ZHDUVUHDGLQJJODVVHVFDQVXGGHQO\UHDGZLWKRXWWKHP
• %URZQVSRWVLQWKHYLVXDO¿HOG

What Causes It?


$FDWDUDFWGHYHORSVZKHQSURWHLQLQWKHOHQVFOXPSVWRJHWKHUDQGEORFNVOLJKWIURPUHDFKLQJWKHUHWLQD,WLVQRW
FOHDUZKDWFDXVHVWKHVHSURWHLQVWRFOXPSWRJHWKHUEXWVRPHUHVHDUFKHUVVSHFXODWHWKDWFDWDUDFWVPD\GHYHORS
DVDUHVXOWRIFKHPLFDOFKDQJHVLQWKHOHQVWKDWRFFXUZLWKDJLQJ2WKHUUHVHDUFKHUVEHOLHYHWKDWWKHUHPD\EH
VHYHUDOFDXVHVRIFDWDUDFWVLQFOXGLQJVPRNLQJGLDEHWHVDQGH[FHVVLYHH[SRVXUHWRVXQOLJKW

There are several different types of cataracts:


• $JHUHODWHGFDWDUDFWV±WKRVHWKDWGHYHORSZLWKROGHUDJH
• Congenital cataracts – those that are present at birth or develop in early childhood, usually in both eyes
• 6HFRQGDU\FDWDUDFWV±WKRVHWKDWGHYHORSLQSHRSOHZLWKPHGLFDOFRQGLWLRQV VXFKDVGLDEHWHV RULQWKRVH
ZKRXVHVWHURLGV
• 7UDXPDWLFFDWDUDFWV±WKRVHWKDWGHYHORSDVDUHVXOWRIDQH\HLQMXU\

Prevention
• :HDUXOWUDYLROHW 89 EORFNLQJVXQJODVVHV
• $EVWDLQIURPVPRNLQJFLJDUHWWHV
&HUWDLQ PHGLFDWLRQV PD\ KHOS GHOD\ FDWDUDFW IRUPDWLRQ SDUWLFXODUO\ LQ WKRVH ZLWK GLDEHWHV RU RWKHU KLJKULVN
FRQGLWLRQV EXWQRQHDUHNQRZQWRUHYHUVHWKHSURJUHVVLRQRIFDWDUDFWVRQFHWKH\IRUP

Lifestyle
• (OLPLQDWHDOOVXVSHFWHGIRRGDOOHUJHQVLQFOXGLQJGDLU\ PLONFKHHVHHJJVDQGLFHFUHDP ZKHDW JOXWHQ 
VR\FRUQSUHVHUYDWLYHVDQGFKHPLFDOIRRGDGGLWLYHV<RXUKHDOWKFDUHSURYLGHUPD\ZDQWWRWHVW\RXIRU
IRRGDOOHUJLHV
• (DWPRUHDQWLR[LGDQWULFKIRRGV VXFKDVJUHHQOHDI\YHJHWDEOHVDQGSHSSHUV DQGEHUULHV VXFKDVEOXHEHUULHV
FKHUULHVDQGUDVSEHUULHV %HUULHVFRQWDLQKLJKOHYHOVRIEHQH¿FLDODQWLR[LGDQWVIRUH\HKHDOWK
• $YRLGUH¿QHGIRRGVVXFKDVZKLWHEUHDGVSDVWDVDQGVXJDU
• (DWIHZHUUHGPHDWVDQGPRUHOHDQPHDWVFROGZDWHU¿VKWRIX VR\LIQRDOOHUJ\ RUEHDQVIRUSURWHLQ
• Use healthy cooking oils, such as olive oil or vegetable oil.
• 5HGXFHRUHOLPLQDWHWUDQVIDWW\DFLGVIRXQGLQVXFKFRPPHUFLDOO\EDNHGJRRGVDVFRRNLHVFUDFNHUVFDNHV
)UHQFKIULHVRQLRQULQJVGRQXWVSURFHVVHGIRRGVDQGPDUJDULQH
• $YRLGFRIIHHDQGRWKHUVWLPXODQWVDOFRKRODQGWREDFFR
• 'ULQNJODVVHVRI¿OWHUHGZDWHUGDLO\
• ([HUFLVHPRGHUDWHO\LIWROHUDWHGGD\VDZHHN
Eye Conditions 143

Suggested Nutritional Supplementation


• Visio Plex™ ²FDSVXOHVGDLO\ZLWKIRRG
Nutrients and Herbs to Nourish the Eyes
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ

Dietary Considerations
• FirstLine Therapy® Diet
144 Eye Conditions

Conjunctivitis
$QDFXWHLQIHFWLRQRIWKHFRQMXQFWLYDZKLFKPD\EHYLUDOEDFWHULDORUDOOHUJLF2QO\RIFDVHVDUHFDXVHGE\
EDFWHULD$OOHUJLHVDQGYLUXVHV HVSDGHQRYLUXVHV DUHUHVSRQVLEOHIRUPRVWRIWKHUHVWDORQJZLWKRWKHULUULWDWLRQV
WRWKHH\HDQGFRUQHDVXFKDVVPRNHGXVWZLQGVXQODPSVUHÀHFWLRQRIWKHVQRZWKHFRPPRQFROGH[DQWKHPV
DQGFRQWDFWOHQVHV,QQHRQDWHVWKHPRVWFRPPRQFDXVHVRIFRQMXQFWLYLWLVDUHFKHPLFDO VLOYHUQLWUDWH FKODP\GLD
JRQRUUKHDDQGRWKHUEDFWHULD VWUHSSQHXPRQLDVWDSKDXURXV+HPRSKLOXVLQÀXHQ]D DQGYLUXVHV HVS+HUSHV
6LPSOH[,DQG,, %DFWHULDOLQIHFWLRQVPD\VXSHULPSRVHYLUDORUDOOHUJLFFRQGLWLRQV
$OOHUJLFFRQMXQFWLYLWLVLVOLNHO\WRSHUVLVWXQWLOWKHVHDVRQLVRYHU HJIURPKD\IHYHULQVSULQJ XQWLOWKHDOOHUJHQLV
LGHQWL¿HGDQGUHPRYHGIURPWKHSDWLHQW¶VH[SRVXUHRUWKHV\PSWRPVDUHDGGUHVVHGZLWKKRPHRSDWKLFGHVHQVLWL]LQJ
drops and nutritional support.
9LUDOFRQMXQFWLYLWLVLVXVXDOO\VHOIOLPLWLQJLQZHHNVEXWLVKLJKO\FRQWDJLRXVDQGFDUHVKRXOGEHWDNHQWRQRWVSUHDG
WKHLQIHFWLRQIURPRQHH\HWRWKHRWKHURUWRDQRWKHUSHUVRQ)RUH[DPSOHWKHLQIHFWHGSHUVRQVKRXOGXVHVHSDUDWH
WRZHOV,QEDFWHULDOFRQMXQFWLYLWLVWUHDWPHQWVKRXOGEHLQLWLDWHGSURPSWO\WRDYRLGH\HGDPDJH
&RQWDFWZHDUHUVVKRXOGGLVFRQWLQXHZHDULQJWKHLUFRQWDFWVIRUDIHZGD\VVXSSRUWQXWULWLRQDOO\DQGEHJLQZHDULQJ
WKHPDJDLQVORZO\
,IWKHLUULWDWLQJIDFWRULVQRWUHPRYHGDFKURQLFFRQMXQFWLYLWLVPD\GHYHORSZLWKV\PSWRPVOHVVVHYHUHWKDQWKDWRI
WKHDFXWHGLVHDVHEXWVWLOOTXLWHQRWLFHDEOH UHGQHVVLWFKLQJVPDUWLQJIHHOLQJRIIRUHLJQERG\ 

Symptoms
Viral:&OHDUGLVFKDUJHPLQLPDORUDEVHQWOLGVZHOOLQJQRLWFKLQJRIWHQO\PSKDGHQRSDWK\RISHULDXULFXODUQRGH
is present.
Allergic:&OHDUPXFRLGGLVFKDUJHKLJKHRVLQRSKLOVPLOGWRPDUNHGOLGVZHOOLQJVHYHUHLWFKLQJZLWKLQFUHDVHG
ODFULPDWLRQQRQRGDOLQYROYHPHQW
Bacterial:3XUXOHQWJUHHQGLVFKDUJHKLJKSRO\PRUSKRQXFOHDUOHXNRF\WHVPRGHUDWHOLGVZHOOLQJQRLWFKLQJQR
QRGDOLQYROYHPHQWSRVVLEOHIHYHU
Contact Lens Wearers:0LOGWRPDUNHGOLGVZHOOLQJPLOGWRPRGHUDWHLWFKLQJXVXDOO\QRGLVFKDUJH
,QDQ\RIWKHVHFDVHVWKHSDWLHQWPD\ZDNHXSLQWKHPRUQLQJZLWKH\HOLGVDJJOXWLQDWHGVKXW&KLOGUHQPD\¿QG
WKLVYHU\WUDXPDWLFWKH¿UVWWLPHLWKDSSHQV

Neonatal Conjunctivitis
• *RQRUUKHDXVXDOO\RFFXUVZLWKLQGD\VRIELUWK
• &KODP\GLDXVXDOO\RFFXUVZLWKLQGD\VRIELUWK
• &KHPLFDOLUULWDWLRQIURPVLOYHUQLWUDWH QRZUDUHDVPRVWKRVSLWDOVKDYHVZLWFKHGWRHU\WKURP\FLQ RFFXUV
KRXUVDIWHULQVWLOODWLRQLQWRWKHH\HV

Suggested Nutritional Supplementation


• Mycelized Vitamin A²GURSVWLPHVGDLO\LQZDWHURUMXLFH
3URYLGHVSXUHYLWDPLQ$LQDVSHFLDOZDWHUVROXEOHPLFHOOL]HGIRUP0\FHOL]HG9LWDPLQ$LVDEVRUEHG
EHWWHUWKDQDQ\RWKHUIRUPRIYLWDPLQ$
• Visioplex²FDSVXOHVGDLO\ZLWKIRRG
Nutrients and Herbs to Nourish the Eyes
• &0HWKR[\ÀDYRQH²WDEOHWVWLPHVGDLO\ZLWKIRRG
9LWDPLQ&ZLWKKHVSHULGLQPHWKR[\ÀDYRQHFRPSOH[

Dietary Suggestions
• FirstLine Therapy® Diet
• Drug caution: Drugs that can damage the optic nerve, retina and other vital parts are ACTH, allopurinol
JRXW DQWLFRDJXODQWVDVSLULQFRUWLFRVWHURLGV'LDELQHVHGLXUHWLFVDQWLKLVWDPLQHVGLJLWDOVLQGRPHWKFLQ
VWUHSWRP\FLQVXOIXUGUXJVWHWUDF\FOLQHGLD]HSDPKDORSHULGROTXLQLQH
Eye Conditions 145

Glaucoma
*ODXFRPDLVDVORZO\SURJUHVVLQJGLVHDVHWKDWFDXVHVGDPDJHWRWKHH\H¶VRSWLFQHUYHDQGFDQUHVXOWLQEOLQGQHVV
2SHQDQJOHJODXFRPDWKHPRVWFRPPRQIRUPRIWKHGLVHDVHDIIHFWVDERXWWKUHHPLOOLRQ$PHULFDQV,WLVWKHOHDGLQJ
FDXVHRIEOLQGQHVVIRU$IULFDQ$PHULFDQV%HFDXVHWKHUHDUHXVXDOO\QRV\PSWRPVDW¿UVWKDOIRIWKHSHRSOHZLWKWKLV
GLVHDVHGRQ¶WNQRZWKH\KDYHLW:LWKHDUO\WUHDWPHQWVHULRXVYLVLRQORVVDQGEOLQGQHVVFDQXVXDOO\EHSUHYHQWHG

Signs and Symptoms


:KLOHV\PSWRPVGRQRWLQLWLDOO\RFFXUDVWKHGLVHDVHSURJUHVVHV\RXFDQORVHSHULSKHUDO VLGH YLVLRQDQGWKHQ
IRUZDUGYLVLRQ6RPHVLJQVFDQRQO\EHIRXQGGXULQJDQH\HH[DPVXFKDVLQFUHDVHGSUHVVXUHLQVLGHWKHH\H
and optic nerve abnormalities.

What Causes It?


$FOHDUÀXLGÀRZVLQDQGRXWRIWKHVSDFHDWWKHIURQWRIWKHH\HQRXULVKLQJQHDUE\WLVVXHV*ODXFRPDFDXVHV
WKHÀXLGWRSDVVWKURXJKWRRVORZO\RUWRVWRSGUDLQLQJDOWRJHWKHU$VWKHÀXLGEXLOGVXSWKHSUHVVXUHLQVLGHWKH
eye increases, causing damage to the optic nerve and vision loss.

Who's Most At Risk?


3HRSOHZLWKWKHIROORZLQJFRQGLWLRQVRUFKDUDFWHULVWLFVDUHDWULVNIRUJODXFRPD
• 2YHU\HDUVRIDJH
• Family history
• $IULFDQ$PHULFDQGHVFHQW
• Diabetes
• 0\RSLD QHDUVLJKWHGQHVV 
• Taking certain drugs, such as antihistamines or blood pressure medications
• Food sensitivities
• Stress
• 6HGHQWDU\OLIHVW\OH
• Hypothyroidism

Surgical and Other Procedures


:KLOHJODXFRPDVXUJHU\PD\VDYHUHPDLQLQJYLVLRQLWGRHVQRWLPSURYHVLJKW
• /DVHUVXUJHU\±PDNHVHYHQO\VSDFHGEXUQVWKDWVWUHWFKWKHGUDLQDJHKROHVLQWKHH\HDOORZLQJ
ÀXLGWRGUDLQPRUHHI¿FLHQWO\
• &RQYHQWLRQDOVXUJHU\±FUHDWHVDQHZFKDQQHOIRUÀXLGWRGUDLQIURPWKHH\H

Complementary and Alternative Therapies


$FRPSUHKHQVLYHWUHDWPHQWSODQIRUJODXFRPDPD\LQFOXGHDUDQJHRIFRPSOHPHQWDU\DQGDOWHUQDWLYHWKHUDSLHV
+RZHYHUJODXFRPDVKRXOGRQO\EHWUHDWHGE\DTXDOL¿HGRSKWKDOPRORJLVW8VHDOWHUQDWLYHPHGLFLQHDVVXSSRUW
IRUDKHDOWK\ERG\

Lifestyle
1XWULWLRQDOWLSVLQFOXGHWKHIROORZLQJ
• (OLPLQDWHDOOVXVSHFWHGIRRGDOOHUJHQVLQFOXGLQJGDLU\ PLONFKHHVHDQGHJJV ZKHDW JOXWHQ VR\FRUQ
SUHVHUYDWLYHVDQGIRRGDGGLWLYHV<RXUKHDOWKFDUHSURYLGHUPD\ZDQWWRWHVW\RXIRUIRRGDOOHUJLHV
• (DWPRUHDQWLR[LGDQWULFKIRRGV VXFKDVJUHHQOHDI\YHJHWDEOHVDQGSHSSHUV DQGIUXLWV VXFKDVEOXHEHUULHV
tomatoes, and cherries).
• $YRLGUH¿QHGIRRGVVXFKDVZKLWHEUHDGVSDVWDVDQGVXJDU
• (DWIHZHUUHGPHDWVDQGPRUHOHDQPHDWVFROGZDWHU¿VKWRIX VR\LIQRDOOHUJ\ RUEHDQVIRUSURWHLQ
• Use healthy cooking oils, such as olive oil or vegetable oil.
• 5HGXFHRUHOLPLQDWHWUDQVIDWW\DFLGVIRXQGLQVXFKFRPPHUFLDOO\EDNHGJRRGVDVFRRNLHVFUDFNHUVFDNHV
)UHQFKIULHVRQLRQULQJVGRQXWVSURFHVVHGIRRGVDQGPDUJDULQH
• $YRLGFRIIHHDQGRWKHUVWLPXODQWVDOFRKRODQGWREDFFR
• 'ULQNJODVVHVRI¿OWHUHGZDWHUGDLO\
• ([HUFLVHPRGHUDWHO\LIWROHUDWHGGD\VDZHHN
146 Eye Conditions

Suggested Nutritional Supplementation


• Visio Plex™ ²FDSVXOHVGDLO\ZLWKIRRG
Nutrients and Herbs to Nourish the Eyes
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ

Dietary Suggestions
• FirstLine Therapy® Diet
Eye Conditions 147

Iritis / Keratitis
,QIHFWLRQRIWKHLULV,WLVDOVRFDOOHGDQWHULRUXYHLWLVZKHQLWLQYROYHVERWKWKHLULVDQGWKHFLOLDU\ERG\ F\FOLWLV 
ZKLFKLVKRZLWW\SLFDOO\SUHVHQWV7KHFDXVHVDUHPDQ\DQGDUHUDUHO\LGHQWL¿HG,ULWLVXYHLWLVLVDVVRFLDWHGZLWK
PDQ\RWKHUGLVHDVHVNHUDWLWLV LQIHFWLRQRIWKHFRUQHD 5HLWHU¶VGLVHDVH%HKFHW¶VV\QGURPHKHUSHVVLPSOH[
LQIHFWLRQVVDUFRLGRVLVWXEHUFXORVLVV\SKLOLVFROODJHQYDVFXODUGLVHDVHVDVZHOODVFRUQHDOXOFHUVDQGRFXODU
WUDXPD,WPD\EHJUDQXORPDWRXVRUQRQJUDQXORPDWRXV
,ULWLVPD\ODVWIURPDIHZGD\VWRVHYHUDOZHHNVDQGUHFXUUHQFHVDUHQRWXQFRPPRQ,IWKHGLVHDVHEHFRPHV
FKURQLFLWPD\ODVWIURPPRQWKVWR\HDUV,IWKHLQÀDPPDWLRQLVVHYHUHLWPD\OHDGWRWKHIRUPDWLRQRIDGKHVLRQV
EHWZHHQWKHSRVWHULRUVXUIDFHRIWKHLULVDQGWKHOHQVFDSVXOHWKDWPD\HYHQWXDOO\EORFNWKHÀRZRIDTXHRXVKXPRU
FDXVLQJWKHLULVWREXOJHIRUZDUGLQLWLDWLQJDQDFXWHDQJOHFORVXUHJODXFRPDWKDWPD\FDXVHUDSLGEOLQGQHVV2U
OHVVLQWHQVHFKURQLFLQÀDPPDWLRQVPD\FDXVHWKHGHYHORSPHQWRIRSHQDQJOHJODXFRPDFDWDUDFWVRUFRUQHDO
disease.

Symptoms
0RGHUDWHSDLQLQDQGDURXQGWKHH\HODFULPDWLRQSKRWRSKRELDUHGQHVVRIFRQMXQFWLYDEOXUUHGYLVLRQLQMHFWLRQ
DURXQGWKHFRUQHDVSUHDGLQJRXWZDUGVVPDOOLUUHJXODUSXSLOGHWDLOVDURXQGLULVDUHREVFXUHGRQYLVXDOL]DWLRQ
DQGPD\EHVZROOHQH\HEDOOWHQVLRQLVXQXVXDOO\VRIWDQWHULRUFKDPEHULVQRUPDOGHSWK

Nutrients Involved
Vitamin A, vitamin C and rutin

Suggested Nutritional Supplementation


• Visio Plex™ - FDSVXOHVGDLO\ZLWKIRRG
Nutrients and Herbs to Nourish the Eyes
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
148 Eye Conditions

Macular Degeneration
0DFXODUGHJHQHUDWLRQLVDSDLQOHVVGHJHQHUDWLYHH\HGLVHDVHWKDWDIIHFWVPRUHWKDQPLOOLRQ$PHULFDQV,WLV
WKHOHDGLQJFDXVHRIOHJDOEOLQGQHVVLQSHUVRQVRYHUWKHDJHRILQWKH8QLWHG6WDWHV:KLOHFRPSOHWHEOLQGQHVV
GRHVQRWRFFXULQPRVWSHRSOHZLWKWKHGLVRUGHUPDFXODUGHJHQHUDWLRQRIWHQLQWHUIHUHVZLWKUHDGLQJGULYLQJRU
SHUIRUPLQJRWKHUGDLO\DFWLYLWLHV
7KHUHDUHWZRIRUPVRIPDFXODUGHJHQHUDWLRQ'U\PDFXODUGHJHQHUDWLRQDIIHFWVDERXWRIWKRVHZLWKWKH
GLVHDVHDQGFDXVHVJUDGXDOORVVRIFHQWUDOYLVLRQLQLWLDOO\RQO\LQRQHH\H:HWPDFXODUGHJHQHUDWLRQZKLFK
DFFRXQWVIRURIDOOVHYHUHYLVLRQORVVIURPWKHGLVHDVHLQYROYHVDYHU\VXGGHQORVVRIFHQWUDOYLVLRQ

Signs and Symptoms


0DFXODUGHJHQHUDWLRQLVDFFRPSDQLHGE\WKHIROORZLQJVLJQVDQGV\PSWRPV
• Slightly blurred vision
• 'U\W\SHDEOXUUHGVSRWLQWKHFHQWUDO¿HOGRIYLVLRQZKLFKPD\EHFRPHODUJHUDQGGDUNHU
• :HW W\SH VWUDLJKW OLQHV WKDW DSSHDU ZDY\ DQG WKH UDSLG ORVV RI FHQWUDO YLVLRQ VRPHWLPHV ZHW PDFXODU
GHJHQHUDWLRQVWDUWVZLWKDVXGGHQEOLQGVSRW

What Causes It?


'U\PDFXODUGHJHQHUDWLRQRFFXUVIURPWKHEUHDNGRZQRIWKHOLJKWVHQVLWLYHFHOOVLQWKHFHQWHURIWKHUHWLQDFDOOHG
WKHPDFXOD:HWPDFXODUGHJHQHUDWLRQRFFXUVZKHQQHZEORRGYHVVHOVEHKLQGWKHUHWLQDJURZWRZDUGWKHPDFXOD
DQGOHDNEORRGDQGÀXLG

Who’s Most At Risk?


3HRSOHZLWKWKHIROORZLQJFRQGLWLRQVRUFKDUDFWHULVWLFVDUHDWULVNIRUGHYHORSLQJPDFXODUGHJHQHUDWLRQ
• $JH±WKHULVNLQFUHDVHVZLWKDJH
• Cigarette smoking
• )DPLO\KLVWRU\RIPDFXODUGHJHQHUDWLRQ
• Cardiovascular disease
• (OHYDWHGOHYHOVRIFKROHVWHURO
• Light eye color
• ([FHVVLYHH[SRVXUHWRVXQOLJKW

Nutrition
$QWLR[LGDQWVWKDWSURWHFW\RXUUHWLQD²VXFKDVFDURWHQRLGVVHOHQLXP]LQFDQGYLWDPLQV&DQG(²PD\HLWKHU
GHOD\WKHSURJUHVVLRQRIPDFXODUGHJHQHUDWLRQLI\RXDOUHDG\KDYHWKHH\HFRQGLWLRQ PHDQLQJWKDW\RXUYLVLRQ
ZRQ¶WJHWZRUVHDVTXLFNO\ RUSUHYHQWWKHGHYHORSPHQWRIWKLVVHULRXVH\HGLVRUGHU7ZRSDUWLFXODUFDURWHQRLGV
OXWHLQDQG]HD[DQWKLQPD\EHSDUWLFXODUO\EHQH¿FLDO$QWLR[LGDQWVFDQEHREWDLQHGIURPIRRGVRUVXSSOHPHQWV
(DWLQJDGLHWKLJKLQYLWDPLQV&DQG(DQGFDURWHQRLGVLVOLNHO\DOOWKDW\RXQHHGWRORZHU\RXUFKDQFHVRIGHYHORSLQJ
PDFXODUGHJHQHUDWLRQLQWKH¿UVWSODFH ,QRWKHUZRUGVVXSSOHPHQWVDUHSUREDEO\QRWQHFHVVDU\IRUSUHYHQWLRQ 
9HJHWDEOHVULFKLQFDURWHQHLQFOXGHRUDQJHDQG\HOORZVTXDVKDQGGDUNOHDI\JUHHQVVXFKDVNDOHFROODUGV
VSLQDFKDQGZDWHUFUHVV

Suggested Nutritional Supplementation


• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
• Visio Plex™ –FDSVXOHVGDLO\ZLWKIRRGLQGLYLGHGGRVHV
Nutrients and Herbs to Nourish the Eyes
• Lutein±WRFDSVXOHVWZLFHGDLO\
$1DWXUDOO\2FFXUULQJ&DURWHQRLG

Dietary Suggestions
• FirstLine Therapy® Diet
Eye Conditions 149

Sty
$QDFXWHORFDOL]HGSXVIRUPLQJLQIHFWLRQRIHLWKHUWKHPHLERPLDQJODQGV LQWHUQDOVW\ RUWKHJODQGVRI=HLVRU0ROO
H[WHUQDOVW\ 0HGLFDOWHUPLV³KRUGHROXP´7KHXVXDOEDFWHULDODJHQWLV6WDSK\ORFRFFXV+RUGHROLDUHDVVRFLDWHG
ZLWKEOHSKDULWLV6WLHVQRUPDOO\UHVROYHTXLFNO\EXWUHFXUUHQFHVDUHFRPPRQ

Symptoms
Internal sty:RFFXUVRQWKHXQGHUVLGHRIWKHOLGQH[WWRWKHFRQMXQFWLYDDQGFDQLQFOXGHSDLQUHGQHVVHGHPD
VPDOO\HOORZDUHDRUHOHYDWLRQRIWKHOLGRQWKHFRQMXQFWLYDOVLGH XVXDOO\DQDEVFHVVGHYHORSVDWWKDWVSRWWKRXJK
it rarely spontaneously suppurates).
External sty:RFFXUVRQWKHOLGPDUJLQDQGFDQLQFOXGHSDLQUHGQHVVWHQGHUQHVVIRUPDWLRQRIDVPDOODUHD
RILQGXUDWLRQGHYHORSVD\HOORZVSRW SRLQWLQJ WKDWHYHQWXDOO\LVWKHDUHDWKURXJKZKLFKWKHDEVFHVVUXSWXUHV
EULQJLQJUHOLHIRISDLQORFDOHGHPDRFFDVLRQDOSKRWRSKRELDDQGRUODFULPDWLRQ

Nutrients Involved
9LWDPLQ$YLWDPLQ&ELRÀDYRQRLGV]LQF

Suggested Nutritional Supplementation


• Mycelized Vitamin A²GURSVWLPHVGDLO\LQZDWHURUMXLFH
3URYLGHVSXUHYLWDPLQ$LQDVSHFLDOZDWHUVROXEOHPLFHOOL]HGIRUP0\FHOL]HG9LWDPLQ$LVDEVRUEHG
EHWWHUWKDQDQ\RWKHUIRUPRIYLWDPLQ$
• UltraPotent-C Powder²WHDVSRRQVLQZDWHURUMXLFHWLPHVGDLO\
%XIIHUHGKLJKDEVRUSWLRQYLWDPLQ&
• Visioplex²WDEOHWVGDLO\ZLWKIRRG
&RPSUHKHQVLYHQXWULWLRQDOVXSSRUWIRUWKHH\H
• EPA-DHA Extra Strength ²VRIWJHOVWLPHVGDLO\
(VVHQWLDOIDWW\DFLGVXSSRUWIRURSWLPDOH\HIXQFWLRQ
+PL[HY`:\NNLZ[PVUZ
• FirstLine Therapy® Diet
150 Eye Conditions

Visual Disturbances
$Q\W\SHRIDEQRUPDOYLVXDOSUREOHP)RUH[DPSOH
• 6SRWV ÀRDWHUV 7KHVHDUHDFRPPRQDGXOWFRPSODLQW7KHVSRWVDUHDUHVXOWRIYLWUHRXVGHEULVIURPWKH
GHJHQHUDWLRQRIWKHPHPEUDQRXVDWWDFKPHQWRIWKHYLWUHRXVERG\WRWKHRSWLFQHUYHDQGUHWLQDHDUO\LQOLIH
7KHVSRWVDUHZRUVHLQEULJKWOLJKWDQGZLWK9DOVDOYDVWUDLQLQJ$OWKRXJKSRWHQWLDOO\ERWKHUVRPHWKH\DUH
ZLWKRXWSDWKRORJLFDOVLJQL¿FDQFH
• Retinal detachment:8VXDOO\IURPWUDXPDWRWKHKHDGRUH\HLWLVW\SLFDOO\SUHFHGHGE\DVKRZHURIVSDUNV
LQRQHTXDGUDQWRIWKHYLVXDO¿HOGIROORZHGE\WKHVHQVDWLRQRIDFXUWDLQIDOOLQJRYHUWKHH\H$OVRPDQLIHVWV
DVDGHJHQHUDWLYHSUREOHPZLWKDJLQJ
• Scotomas:$  VFRWRPDLVDEOLQGVSRWLQWKHYLVXDO¿HOG,WFDQRIWHQEHXQQRWLFHGE\WKHSDWLHQWXQOHVVLW
RFFXUVLQWKHFHQWUDOYLVLRQ$  VFRWRPDLVGHVFULEHGDVDOLJKWVSRWRUVFLQWLOODWLQJÀDVKDQGRFFXUVDVD
UHVSRQVHWRDEQRUPDOVWLPXODWLRQRIVRPHSRUWLRQRIWKHYLVXDOV\VWHP HJGXULQJDPLJUDLQHSURGURPH 
• Myopia (near-sightedness):7KLVRFFXUVDVWKHYLVXDOLPDJHVWULNHVLQIURQWRIWKHUHWLQDGXHWRDQHORQJDWHG
H\HEDOORUH[FHVVLYHUHIUDFWLYHSRZHU7KHSDWLHQWFDQVHHQHDUREMHFWVEXWQRWIDURQHV
• Hyperopia (far-sightedness): This occurs as the visual image strikes behind the retina due to a shortened
H\HEDOO RU ZHDN UHIUDFWLYH SRZHU ,W LV WKH PRVW FRPPRQ UHIUDFWLYH HUURU DQG SHUPLWV SDWLHQWV WR VHH IDU
REMHFWVEXWQRWREMHFWVWKDWDUHQHDU3UHVE\RSLDLVDK\SHURSLDWKDWRFFXUVZLWKDGYDQFLQJDJHDVWKHOHQV
becomes less pliable.
• Astigmatism:5HIUDFWLRQRIWKHH\HEDOOLVXQHTXDOLQLWVGLIIHUHQWPHULGLDQV
• Anisometropia:$GLIIHUHQWUHIUDFWLYHHUURULQHDFKH\H
• Strabismus (cross-eyes):'HYLDWLRQRIRQHH\HIURPSDUDOOHOYLHZ,IWKHFRQGLWLRQLVFRQJHQLWDOWKHUHLVQR
diplopia, as the vision in the deviated eye is suppressed by the brain. This suppression results in amblyopia,
ZKLFKLVUHGXFHGYLVXDODFXLW\&RUUHFWDEOHLIFDXJKWHDUO\
• Diplopia (double-vision):7KLVFDQRFFXUIRUDYDULHW\RIUHDVRQV,WLVRIWHQVHHQLQDFXWHRSKWKDOPRSOHJLD
DQGH[WUDRFXODUPXVFOHSDOVLHV
5HIUDFWLYHHUURUVDQGDVWLJPDWLVPDUHWUHDWHGZLWKHLWKHUFRUUHFWLYHOHQVHVRUH\HH[HUFLVHVWRFRPSHQVDWH,Q
DOPRVWDOOFDVHVEXWWKHPRVWVHYHUH WKRVHZKRDUHFRQVLGHUHGµOHJDOO\EOLQG´ YLVLRQFDQEHUHFRYHUHG
Retinal detachment is a medical emergency. Prompt surgery markedly improves prognosis.

Nutrients Involved
9LWDPLQ$%FRPSOH[ HVSYLWDPLQ% NHOSFRSSHU]LQFFDOFLXP

Suggested Nutritional Supplementation


• Visio Plex™ – 8 capsules daily with food.
Nutrients and Herbs to Nourish the Eyes
• Thyrosol²WDEOHWVWLPHVGDLO\RQDQHPSW\VWRPDFK
1XWULWLRQDOVXSSRUWIRUWK\URLGIXQFWLRQ
• EPA-DHA Extra Strength ²VRIWJHOVWLPHVGDLO\ VHH(3$'+$VHFWLRQLQWKHDSSHQGL[
(VVHQWLDOIDWW\DFLGVXSSRUWIRURSWLPDOH\HIXQFWLRQ

Itchy Eyes Due to Contacts


• Glycogenics²WDEOHWVGDLO\ZLWKIRRG
+RPRF\VWHLQEDODQFHG%FRPSOH[IRUPXOD
• +33DLQ ,QÀDPPDWLRQ5HPHG\ — 4 tablets 3 times daily on an empty stomach.
$KLJKTXDOLW\KDQGPDGHKRPHRSDWKLFIRUPXODGHVLJQHGWRUHOLHYHIHYHUVZHOOLQJSDLQHDUDFKHVdermatitis,
poison oak, or bee stings

Dietary Suggestions
• FirstLine Therapy® Diet
• ,QFUHDVHIRRGVULFKLQYLWDPLQ$DQG%FRPSOH[ EOXHEHUULHVFDUURWVEODFNEHDQV
Facet Syndrome 151

Facet Syndrome
)DFHWV\QGURPHLVXVHGWRGHVFULEHFKURQLFRUDFXWHLQÀDPPDWLRQRIWKHDUWLFXODUIDFHWMRLQWVZKLFKJXLGHYHUWHEUDO
PRWLRQ7KHVHMRLQWVDUHOLQHGE\FDUWLODJHDQGVXUURXQGHGE\FDSVXODUOLJDPHQWVZKLFKDUHULFKO\LQQHUYDWHGE\
SDLQ¿EHUV7KHVHMRLQWVDUHLQÀDPHGE\WUDXPD DVLQÀH[LRQH[WHQVLRQLQMXULHV³ZKLSODVK´ RULQRYHUORDGLQJ
LQMXULHV VXFK DV OLIWLQJ D KHDY\ ORDG DQG H[WHQGLQJ EDFN WR FDUU\ WKH ORDG RQ WKH IDFHW MRLQWV OXPEDU VSLQH 
:KHWKHULQGXFHGE\WUDXPDRURYHUORDGLQJWKLVFRQGLWLRQXVXDOO\ZRUVHQVXQOHVVWUHDWHG/RFDOPXVFOHVVSDVP
DQGFDXVHDEHUUDQWPRWLRQRIWKHMRLQWV7KHORFDOFRQQHFWLYHWLVVXHVLQÀDPHDQGEHJLQWRVFDUFDXVLQJIXUWKHU
aberrant motion.

Symptoms
%DFNDQGQHFNSDLQPXVFOHVSDVPVSDOSDEOHORFDOL]HGVZHOOLQJDQGWHQGHUQHVVDWWKHIDFHWMRLQWDQWDOJLDQHFN
KHOGLQÀH[LRQWRUHOLHYHWKHIDFHWSDLQZLWKVSLQDOH[WHQVLRQSDLQZLWKD[LDOORDGLQJ

Nutrients Involved
9LWDPLQ%FRPSOH[YLWDPLQ&PDQJDQHVHFDOFLXPPDJQHVLXPYLWDPLQ(

Suggested Nutritional Supplementation


• Chondro-Relief Intensive Care ²FDSVXOHVGDLO\ZLWKPHDOV
&RPSUHKHQVLYHMRLQW VRIWWLVVXHVXSSRUWZLWK060JUHHQOLSSHGPXVVHODQGK\DOXURQLFDFLG
• Glycogenics²WDEOHWVGDLO\ZLWKPHDOV
+RPRF\VWHLQHEDODQFHG%FRPSOH[IRUPXOD
• ,QÀDYRQRLG,QWHQVLYH&DUH²WDEOHWVGDLO\ZLWKPHDOV
6WDQGDUGL]HG+HUEDO5HOLHIIRU0LQRU3DLQ,QÀDYRQRLG,QWHQVLYH&DUHSURYLGHVWKHVDPHJUHDWLQJUHGLHQWVDQG
EHQH¿WVDVRULJLQDO,QÀDYRQRLGŠEXWZLWKDGGHGVXSSRUWIRUWKRVHZKRZDQWDPRUHDJJUHVVLYHDSSURDFK
• HP 17 Muscle Spasm Remedy²WDEOHWVWLPHVGDLO\RQDQHPSW\VWRPDFK

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW

Exercise Considerations
1. /\LQJRQEDFNUHOD[HGEULQJULJKWNQHHXSWRZDUGFKHVWFODVSLQJKDQGVDURXQGNQHHVWUDLJKWHQOHIW
OHJSRLQWLQJWRHXSZDUGWLJKWHQULJKWNQHHDVIDUDVSRVVLEOHWRFKHVWKROGWRFRXQWRIUHSHDWZLWK
RWKHUOHJGRHDFKOHJWLPHV
2. /\LQJRQEDFNUHOD[HGEULQJERWKNQHHVWRFKHVWE\FODVSLQJZLWKKDQGVPRYHNQHHVLQDFLUFOHZLWK
KDQGVVRURFNLQJRQVDFUXPUHSHDWFORFNZLVHWLPHVDQGFRXQWHUFORFNZLVHWLPHV
3. /\LQJRQEDFNUHOD[HGZLWKERWKNQHHVEHQWWLJKWHQPXVFOHVRIORZHUDEGRPHQZKLOHDOVRWLJKWHQLQJ
WKHEXWWRFNVSXVKLQJWKHEDFNÀDWDJDLQVWWKHEHGKROGWKLVSRVLWLRQIRUFRXQWDQGUHOD[VORZO\
UHSHDWWLPHV
4. /\LQJRQEDFNUHOD[HGZLWKOHIWNQHHEHQWDQGOHIWIRRWRQÀRRUUDLVHULJKWOHJXSDVIDUDVLVFRPIRUWDEOH
UHSHDWZLWKRWKHUOHJGRHDFKOHJWLPHV
5. /\LQJRQEDFNEULQJRQHNQHHWRFKHVWWKHQVWUDLJKWHQLWSRLQWLQJWRHXSZDUGDVIDUDVSRVVLEOHEHQG
NQHHEDFNWRFKHVWDQGUHWXUQWRRULJLQDOSRVLWLRQUHSHDWZLWKRWKHUOHJGRHDFKOHJWLPHV
6. /\LQJRQEDFNZLWKDUPVDWVLGHVSDOPVGRZQDQGNQHHVEHQWIHHWÀDWRQÀRRUUDLVHORZHUEDFNDQG
EXWWRFNVVHYHUDOLQFKHVRIIWKHÀRRUDQGKROGSRVLWLRQIRUVHFRQGVUHSHDWWLPHV
7. /\LQJRQEDFNDUPVDWVLGHVÀH[RQHKLSXQWLOYHUWLFDOWKHQFURVVLWRYHURWKHUKLSWRFUHDWHWZLVWLQVSLQH
KROGIRUVHYHUDOVHFRQGV
8. As back improves: lying on back, hold hips in air and pedal imaginary bicycle.
9. /\LQJRQVLGHGROHJUDLVHVUHSHDWWLPHVRQERWKVLGHV
10. 6LWWLQJRQHGJHRIFKDLUZLWKDUPVIROGHGORRVHO\LQIURQWRI\RXOHWERG\GURSXQWLOKHDGLVGRZQEHWZHHQ
OHJVSXOOERG\EDFNXSLQWRVLWWLQJSRVLWLRQZKLOHWLJKWHQLQJDEGRPLQDOPXVFOHV
11. 6LWWLQJRQÀRRUWU\WRXFKLQJWRHVZLWKRXWGLVFRPIRUWUHSHDWVORZO\WLPHV
12. 6WDQGLQJZLWKDUPVDWVLGHVEHQGVORZO\WRRQHVLGHEHJLQQLQJZLWKKHDGQHFNVKRXOGHUVFKHVWDQGORZHU
EDFNZLWK¿QJHUVGHVFHQGLQJWKHOHJRQWKDWVLGHUHSHDWIRURSSRVLWHVLGHUHSHDWWLPHVHDFK
13. 6WDUWLQJDWDVWDQGLQJSRVLWLRQVTXDWGRZQZKLOHNHHSLQJIHHWÀDWRQÀRRUZKLOHUHDFKLQJIRUZDUGDQG
GRZQZDUGZLWKRXWVWUHWFKHGDUPVUHSHDWWLPHV
152 Facet Syndrome

14. /\LQJRQVWRPDFKZLWKODUJHSLOORZXQGHUKLSVDQGORZHUSDUWRIDEGRPHQSODFHDUPVRXWWRVLGHVDQG
EHJLQWROLIWKHDGDQGVKRXOGHUVRIIÀRRUQRWIDUHQRXJKWRFDXVHSDLQNHHSKHDGLQOLQHZLWKVSLQHE\
ORRNLQJDWÀRRUDQGWLJKWHQSHOYLFPXVFOHVVRWKLJKUHPDLQVRQÀRRUKROGSRVLWLRQIRUVHYHUDOVHFRQGV
15. 5HVWLQJRQKDQGVDQGNQHHVH[WHQGQHFNUHOD[DEGRPLQDOPXVFOHVDQGDOORZOXPEDUVSLQHWRK\SHUH[WHQG
LHKHDGDQGWDLOULVH WKHQZKLOHH[KDOLQJGURSKHDGDQGWDLOSXVKLQJWKRUDFLFVWRZDUGFHLOLQJUHSHDW
WLPHVZLWKEUHDWKLQJF\FOH
16. .QHHOLQJRQIHHWH[WHQGDUPVRYHUKHDGDQGSXVKFKHVWWRZDUGVNQHHVKROGVHYHUDOVHFRQGVVWUHWFKLQJ
DUPVDVIDURXWLQIURQWDVSRVVLEOH
Female Conditions 153

Female Conditions
Amenorrhea
$EVHQFHRImenstruation. Amenorrhea may be primary (the girl has never begun her periods) or secondary (the
ZRPDQKDGKHUSHULRGVRQFHDQGWKHQVWRSSHGKDYLQJWKHP 3K\VLRORJLFDPHQRUUKHDLVWKHODFNRIPHQVHV
EHIRUHPHQDUFKHGXULQJSUHJQDQF\DQGHDUO\ODFWDWLRQDQGDIWHUPHQRSDXVH DOOFRQVLGHUHGQRUPDO $OORWKHU
FDXVHVRIDPHQRUUKHDDUHSDWKRORJLF

Causes of Primary Amenorrhea


Physiologic delay:7KHODWHRQVHWRIPHQVHVLQDSK\VLRORJLFDOO\QRUPDOIHPDOH1RZRUNXSLVQHFHVVDU\LQWKH
IHPDOHZKRKDVVHFRQGDU\VH[XDOFKDUDFWHULVWLFVEXWQRPHQVWUXDOF\FOHVXQWLOVKHLVKRZHYHULIQRVHFRQGDU\
FKDUDFWHULVWLFVDSSHDUE\DJHDQGQRPHQVHVKDVRFFXUUHGWKHQDZRUNXSVKRXOGEHVWDUWHGHDUOLHU7KHDJH
RIPHQDUFKHRIWKHPRWKHUZLOORIWHQSURYLGHFOXHVDVWRZKHQWKHIHPDOHFKLOGVKRXOGH[SHFWWREHJLQ
Primary ovarian failure:7KHVHSDWLHQWVDUHGLYLGHGLQWRWZRJURXSVWKRVHZLWKQRUPDOEXWLQIDQWLOHJHQLWDOLD HJ
7XUQHU¶VV\QGURPH DQGWKRVHZLWKDPELJXRXVJHQLWDOLD HJKHUPDSKURGLWHV .DU\RW\SLQJLVQHFHVVDU\&DXVHV
LQFOXGHK\SRWKDODPLFRUSLWXLWDU\IDLOXUH LQVXI¿FLHQF\RURUJDQLFGLVHDVHRIHLWKHURIWKRVHRUJDQV FRQJHQLWDO
abnormalities (vaginal agenesis, vaginal septa, cervical atresia, uterine agenesis, uterine septi, or bicornuate
XWHUXV LPSHUIRUDWHK\PHQ 7KLVFRXOGLPSHGHWKHRXWÀRZRIWKHPHQVWUXXP7KHJLUOZLOOUHSRUWPRQWKO\F\FOLFDO
DEGRPLQDOFUDPSLQJGXHWRWKHEXLOGXSRIWKHPHQVWUXDOÀRZ7UHDWPHQWLQFOXGHVRSHQLQJWKHK\PHQDIWHUD
QHHGOHDVSLUDWLRQRIWKHDUHDEHKLQGWKHK\PHQGHPRQVWUDWHVWKDWDYDJLQDH[LVWV

Causes of Secondary Amenorrhea


(QGRPHWULDOVFOHURVLV7KLVXVXDOO\RFFXUVDVDUHVXOWRID' &DIWHUZKLFKWKHWLVVXHVKHDOE\¿EURVLV
&HUYLFDOVWHQRVLV7KLVFDQRFFXUDIWHUDFHUYLFDOFRQL]DWLRQZKHUHWKHFHUYL[VFDUVRUWKHRVFDQQRWEHIRXQG
,QWUDXWHULQHJURZWKVPXVWEHUXOHGRXW
$QRYXODWLRQ7KLVPD\EHVSRUDGLFRUFRQVWDQW7KHVHFDQEHFDXVHVIRUDQRYXODWLRQ
• +\SRWKDODPLFFDXVHV 7KHRUJDQGLVRUGHUPD\EHGXHWRRUJDQLFOHVLRQV WXPRUVVFDUV RULQVXI¿FLHQF\
(polycystic ovarian disease, hyperprolactinemia amenorrhea).
• 3LWXLWDU\FDXVHV ,QFOXGLQJLQVXI¿FLHQF\ 6KHHKDQ¶VV\QGURPH RURUJDQLFGLVHDVH WXPRUVDGHQRPDV 
• 2YDULDQFDXVHV )URPVFDUULQJWXPRUVF\VWV
• /RZ%RG\)DWIURP([FHVV([HUFLVH  OHVVWKDQERG\IDW $OWKRXJKWKLVIRUPRIDQRYXODWLRQLVVLPLODUWR
WKDWZKLFKLVLQGXFHGZLWKDQRUH[LDQHUYRVDLQWKLVW\SHZKHQWKHSDWLHQWUHJDLQVZHLJKWRUVWRSVH[HUFLVLQJ
H[FHVVLYHO\WKHSHULRGZLOOUHWXUQ
• $GUHQDO'\VIXQFWLRQ+\SHUSODVLDDGHQRPDVWXPRUV
• 6\VWHPLF&DXVHVRI$QRYXODWLRQ&XVKLQJ¶VGLVHDVHSRVWRUDOFRQWUDFHSWLYHDJHQWV\QGURPHK\SHUSURODFWLQHPLD
ERWKRYHUDQGXQGHUDFWLYHWK\URLGSUREOHPVDQGRWKHUGLVHDVH XOFHUDWLYHFROLWLVGLDEHWHVPHOOLWXVVWHURLG
XVHIRUDXWRLPPXQHGLVHDVHVFHOLDFGLVHDVH 8VXDOO\ZKHQWKHVHGLVHDVHVDUHFRUUHFWHGWKHPHQVHVZLOO
return to normal.
*indicates primary or secondary causes, usually secondary

Suggested Nutritional Supplementation


• Estrium²VFRRSVPL[HGLQZDWHUWZLFHGDLO\
7DUJHWHGQXWULWLRQDOPHGLFDOIRRGIRUKHDOWK\HVWURJHQPHWDEROLVP
• GLA-Forte ²VRIWJHOGDLO\
PJJDPPDOLQROHQLFDFLG
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV

Contributing Factors
• 3RRUGLHW
• High stress
• ,PSDLUHGIDWW\DFLGFRQYHUVLRQ

Dietary Suggestions
• FirstLine Therapy® Diet
154 Female Conditions

Cervical Dysplasia
'\VSODVLDRIWKHXWHULQHFHUYL[(SLWKHOLDODW\SLDLQYROYLQJSDUWRIWKHVTXDPRXVHSLWKHOLXPPRUHFRPPRQLQ
\RXQJZRPHQ
&HUYLFDOG\VSODVLDLVQRZFRQVLGHUHGDVH[XDOO\WUDQVPLWWHGGLVHDVHEHFDXVHRIWKHLPSOLFDWHGUROHRIhuman
SDSLOORPDYLUXV +39 LQEULQJLQJDERXWWLVVXHFKDQJHV,WLVFRQVLGHUHGDSUHFDQFHURXVOHVLRQVLQFHG\VSODVWLF
FKDQJHVRIWHQSUHFHGHPDOLJQDQWWUDQVIRUPDWLRQ5LVNIDFWRUVLQFOXGH
• (DUO\DJHRI¿UVWLQWHUFRXUVH
• Multiple partners
• 6H[XDOH[SRVXUHWRPHQZKRKDYH+39 +XPDQ3DSLOORPD9LUXV
• 6H[XDOH[SRVXUHWRPHQVH[XDOO\H[SRVHGWRZRPHQZLWK&,1 &HUYLFDO,QWUDHSLWKHOLDO1HRSODVLD
• 6H[XDOH[SRVXUHWRPHQRIORZVRFLRHFRQRPLFVWDWXV

Cofactors in development of cervical cancer include:


 ‡6PRNLQJ ‡3RRU'LHW
 ‡/RQJWHUP2UDO&RQWUDFHSWLYH8VH • Chronic Cervicitis
 ‡+69,QIHFWLRQ ‡,PPXQH&RPSURPLVH
• Environmental Carcinogens

Signs and Symptoms


7KLVLVDPLFURVFRSLF¿QGLQJXVXDOO\IRXQGURXWLQHO\ZLWKD3$3VPHDU

Course and Prognosis


The condition may either progress through various stages, potentially ending in cervical intraepithelial neoplasia
&,1 RUUHJUHVVVSRQWDQHRXVO\RUZLWKWUHDWPHQW3URJQRVLVLVH[FHOOHQWZLWKDSSURSULDWHWUHDWPHQW&RQYHQWLRQDO
WUHDWPHQWLQFOXGHVODVHUVXUJHU\EXWGRHVQRWDGGUHVVWKHXQGHUO\LQJFDXVHV5HJXODU3$3VPHDUVDUHHVVHQWLDO
to monitor cervical status.

Differential Diagnosis
• carcinoma

Suggested Nutritional Supplementation


• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
• EstroFactors ²WDEOHWVGDLO\ZLWKIRRG
(VWUR)DFWRUVSURPRWHVKHDOWK\KRUPRQHEDODQFHLQZRPHQRIDOODJHVE\IHDWXULQJWDUJHWHGQXWULHQWVWKDW
VXSSRUWKHDOWK\HVWURJHQPHWDEROLVPDQGGHWR[L¿FDWLRQ
• Intrinsi B12/Folate²WDEOHWVWZLFHGDLO\ZLWKIRRG
B12DQGIRODWHZLWKLQWULQVLFIDFWRU
• E-Complex 1:1²VRIWJHOVGDLO\ZLWKIRRG
(&RPSOH[LVDXQLTXHQDWXUDOYLWDPLQ(VXSSOHPHQWWKDWIHDWXUHVDUDWLRRIDOSKDWRJDPPDWRFRSKHURO
WKLVUDWLRPRUHFORVHO\UHVHPEOHVWKHWRFRSKHUROSUR¿OHIRXQGQDWXUDOO\LQYLWDPLQ(ULFKSODQWV
• Zinc A.G.²WDEOHWWZLFHGDLO\ZLWKIRRG
Highly absorbable zinc/true amino acid chelate.

Contributing Factors
 ‡+LJK)DW'LHW ‡2EHVLW\
 ‡&DIIHLQH,QWDNH ‡,PSDLUHG)DWW\$FLG&RQYHUVLRQ
• Alcohol Intake

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
Female Conditions 155

Dysmenorrhea / Excessive Menstrual Cramps


'\VPHQRUUKHDRUSDLQIXOPHQVWUXDWLRQLVWKHVHFRQGPRVWFRPPRQJ\QHFRORJLFFRPSODLQWVXSHUVHGHGRQO\E\
SUHPHQVWUXDOWHQVLRQ'\VPHQRUUKHDKDVEHHQGHVFULEHGDVDGLVFUHWHFOLQLFDOHQWLW\FKDUDFWHUL]HGE\³ODERUOLNH´
SDLQV7KHPRUELGLW\DWWHQGLQJWKLVFRQGLWLRQLVPDQLIHVWHGLQWKHYROXPLQRXVKRXUVORVWLQWKHZRUNSODFHDQG
VFKRROVDVDUHVXOWRIG\VPHQRUUKHD
7KHUHDUHWKUHHW\SHVRIG\VPHQRUUKHD7KH¿UVWW\SHLVprimaryFKDUDFWHUL]HGE\WKHDEVHQFHRIDQRUJDQLF
HWLRORJ\7KLVPRVWFRPPRQO\RFFXUVLQDGROHVFHQFHDERXWWRPRQWKVSRVWPHQDUFKHDO'\VPHQRUUKHD
DOPRVWLQYDULDEO\LVDVVRFLDWHGZLWKRYXODWRU\F\FOHV7KXVZRPHQWDNLQJRUDOFRQWUDFHSWLYHVUDUHO\H[SHULHQFH
G\VPHQRUUKHD,WLVDPHOLRUDWHGLQPDQ\ZRPHQE\SUHJQDQF\GXHWRDGHFUHDVHGH[FLWDELOLW\RIDVVRFLDWHGQHUYH
¿EHUV +RZHYHU VRPH ZRPHQ H[SHULHQFH DQ LQFUHDVH RI SULPDU\ G\VPHQRUUKHD DIWHU SUHJQDQF\ ZLWK VRPH
ZRPHQFRQWLQXLQJWRH[SHULHQFHG\VPHQRUUKHDWKURXJKRXWPRVWRIWKHLUUHSURGXFWLYH\HDUV
$QRWKHUW\SHLVFODVVL¿HGDVsecondaryG\VPHQRUUKHDWKHSDLQEHLQJVHFRQGDU\WRVSHFL¿FSDWKRORJLHV7KHVH
LQFOXGHHQGRPHWULRVLV WKHPRVWFRPPRQVHFRQGDU\FDXVHDQGPLVGLDJQRVLVRISULPDU\G\VPHQRUUKHD RYDULDQ
F\VWVDGKHVLRQVSHOYLFLQÀDPPDWRU\GLVHDVH¿EURLGSRO\SVDGHQRP\RVLVFHUYLFDOVWHQRVLVDQGSRVVLEO\XWHULQH
GLVSODFHPHQWZLWK¿[DWLRQ
MembranousG\VPHQRUUKHDGHVFULEHVWKHWKLUGDQGPRVWLQIUHTXHQWW\SH,WLVFKDUDFWHUL]HGE\WKHSDVVDJHRI
DQLQWDFWFDVWRIWKHHQWLUHVHFUHWRU\HQGRPHWULXPWKURXJKDQRQGLODWHGFHUYL[

Prevalence
,QYHVWLJDWLRQVE\0RRV&RSSHQDQG.HVVHOKDYHQRWHGPRGHUDWHRUVHYHUHG\VPHQRUUKHDLQRIZRPHQ
VXUYH\HG$GGLWLRQDO VWXGLHV KDYH GHVFULEHG VLPLODU SUHYDOHQFH UDWHV$ VXUYH\ RI  SDWLHQWV IURP D IDPLO\
SUDFWLFH VHWWLQJ UHYHDOHG WKH LQFLGHQFH RI G\VPHQRUUKHD WR UDQJH IURP  WR  LQ DQ\ JLYHQ WZRPRQWK
SHULRG([WUDSRODWLRQVIURPFXUUHQWO\DYDLODEOHGDWDLQGLFDWHWKDWDSSUR[LPDWHO\RIZRPHQRIFKLOGEHDULQJ
DJHVXIIHUIURPVHYHUHSULPDU\G\VPHQRUUKHDUHQGHULQJWKHPXQDEOHWRFRQWLQXHWKHLUQRUPDOZRUNWDVNVDW
HPSOR\PHQWVFKRRORUKRPH%XGRIIUHSRUWVWKDWG\VPHQRUUKHDLVDPDMRUFDXVHRIZRUNDEVHQFHWRWDOLQJ
PLOOLRQZRUNKRXUVDQQXDOO\2QHVWXG\UHYHDOHGWKDWWRRIWHHQDJHJLUOVPLVVHGRQHWRWZRGD\VRIVFKRRO
each month due to dysmenorrhea.

Suggested Nutritional Supplementation

Mild
• EstroFactors²WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVP
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV

Moderate to Severe add


• Fem Premenstral²WDEOHWVWZLFHGDLO\GD\VSULRUWRPHQVHV
+HUEDOFRPELQDWLRQGHVLJQHGWRZRUNDVDQDQWLVSDVPDWLFVPRRWKPXVFOHUHOD[DQWDQGDQWLLQÀDPPDWRU\

Contributing Factors
• Impaired Fatty Acid Conversion
• High Fat Diet
• Hypothyroidism

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
156 Female Conditions

Endometriosis
7KHHFWRSLFRFFXUUHQFHRIHQGRPHWULDOWLVVXH$FRPPRQSUREOHPZKLFKKDVQRNQRZQHWLRORJ\EXWDKLJKHU
RFFXUUHQFHLVVHHQLQZRPHQZKRGHIHUSUHJQDQF\XQWLOODWHULQOLIH)LEHURSWLFODSDURVFRSLFWHFKQLTXHVDOORZD
direct look at the problematic tissue.
(QGRPHWULRVLVLVDSDLQIXOGHYDVWDWLQJGLVHDVHLQZKLFKVPDOOLVOHWVRIHQGRPHWULDOWLVVXHVRPHKRZPLJUDWHLQWR
WKHPXVFXODUZDOORIWKHXWHUXVRXWDORQJWKH)DOORSLDQWXEHVDQGHYHQWRWKHVXUIDFHRIWKHRYDULHVDQGWKHSHOYLF
FRQWHQWVLQFOXGLQJWKHQHDUE\FRORQ:KHQREVHUYHGDWVXUJHU\WKHVHVPDOOLVOHWVDSSHDUDVWLQ\FKRFRODWHFRORUHG
blobs scattered here and there, some so small as to be nearly invisible to the unaided eye. Being endometrial
WLVVXHWKH\UHVSRQGWRWKHPRQWKO\VXUJHVRIHVWURJHQDQGSURJHVWHURQHH[DFWO\OLNHWKHHQGRPHWULXPZLWKLQ
WKHXWHUXVLHWKH\VZHOOZLWKEORRGGXULQJWKHPRQWKDQGWKHQEOHHGDWPHQVHVWLPHFDXVLQJFRQVLGHUDEOH
SDLQVWDUWLQJVKRUWO\EHIRUHPHQVWUXDWLRQDQGQRWVXEVLGLQJXQWLODIWHUPHQVWUXDWLRQ7KHVPDOOGURSVRIEORRG
WUDSSHGLQWKHWLVVXHLQZKLFKWKHHQGRPHWULDOLVOHWVDUHHPEHGGHGEHFRPHFKRFRODWHFRORUHGRYHUWLPH:KHQ
FRQ¿QHGWRWKHPXVFXODUZDOORIWKHXWHUXVWKHFRQGLWLRQLVFDOOHGDGHQRP\RVLVDQGFDQFDXVHVLJQL¿FDQWSDLQ
ZLWKPHQVWUXDWLRQRWKHUZLVHNQRZQDVG\VPHQRUUKHD
7KHFDXVHRIWKLVGLVRUGHULVSUHVHQWO\XQNQRZQ7KHUHLVQRPHFKDQLVPNQRZQE\ZKLFKHQGRPHWULDOWLVVXHFRXOG
PLJUDWHWKURXJKRXWWKHSHOYLVDVVRPHFDQFHUVDUHDEOHWR7KHK\SRWKHVLVWKDWVFDWWHUHGLVOHWVRIHQGRPHWULDO
WLVVXHSHUVLVWIURPHPEU\RQDOWLPHOLNHZLVHLVXQSURYHG)XUWKHUWKHGLVRUGHUDSSHDUVWREHRIPRGHUQRULJLQLW
LVGLI¿FXOWWRLPDJLQHWKDWVXFKDSDLQIXOGLVRUGHUFRXOGKDYHH[LVWHGDFHQWXU\RUWZRDJRZLWKRXWVRPHPHGLFDO
FRPPHQWRILWEHLQJPDGH
6RPHKDYHK\SRWKHVL]HGWKDWLWKDVVRPHWKLQJWRGRZLWKWKHORQJWLPH DQGWKHPDQ\PHQVHV EHWZHHQPHQDUFKH
DQGWKH¿UVWSUHJQDQF\8QWLOWKLVFHQWXU\ZRPHQLQWKH1RUWKHUQKHPLVSKHUHW\SLFDOO\H[SHULHQFHGRQO\WZRRU
WKUHH\HDUVRIPHQVWUXDWLRQEHIRUHEHFRPLQJSUHJQDQWPHQDUFKHEHLQJDWDERXWDJHDQG¿UVWSUHJQDQFLHVDW
DERXWDJHRU1RZPHQDUFKHLVFRPPRQDWDJHDQGSUHJQDQF\LVRIWHQGHOD\HGXQWLODIWHUWKHPLG¶V
,WKDVEHHQFDOFXODWHGWKDWWKHQXPEHURIPHQVHVEHWZHHQPHQDUFKHDQG¿UVWSUHJQDQF\ZDVW\SLFDOO\OHVVWKDQ
ZKHUHDVQRZLWFXVWRPDULO\H[FHHGV7KHRXWZDUGPLJUDWLRQRIHQGRPHWULDOFHOOVPD\VRPHKRZUHVXOW
IURPVXFKDORQJUXQRIPHQVWUXDOF\FOLQJLQVH[XDOO\DFWLYHZRPHQZLWKRXWWKHKRUPRQDO³UHVW´RISUHJQDQF\
Further study is obviously needed.
0HGLFDOWUHDWPHQWRIWKLVGLVRUGHUKDVLQFOXGHGORZGRVHV\QWKHWLFHVWURJHQ WRVXSSUHVVHQGRJHQRXVHVWURJHQV 
KLJKGRVHV\QWKHWLFSURJHVWLQVWDNHQGDLO\RUDVORQJDFWLQJ,0LQMHFWLRQVRIV\QWKHWLFSURJHVWLQV WRVXSSUHVV
PHQVHV DQGDQDOJHVLFVLQFOXGLQJFRGHLQHDQGQDUFRWLFVIRUSDLQ7KHUHVXOWVDUHJHQHUDOO\XQVXFFHVVIXO7KH
IDYRULWHWUHDWPHQWIRU\RXQJZRPHQZLWKPLOGHQGRPHWULRVLVLVWRUHFRPPHQGSUHJQDQF\DVVRRQDVSRVVLEOH
7KLVLVRIWHQVXFFHVVIXOZKHQWKHUHFRPPHQGHGWUHDWPHQWFDQEHIROORZHG
6XUJLFDOWUHDWPHQWDWWHPSWVWRUHVHFWDOOYLVLEOHHQGRPHWULDOOHVLRQV7KLVLVUDUHO\VXFFHVVIXO$OPRVWLQYDULDEO\LW
EHFRPHVQHFHVVDU\WRDEODWH UHPRYHRUGHVWUR\ ERWKRYDULHVWXEHVDQGWKHXWHUXVUHJDUGOHVVRIWKHSDWLHQW¶V
DJH:KHQFRQ¿QHGWRWKHXWHUXV DGHQRP\RVLV K\VWHUHFWRP\LVXVXDOO\UHFRPPHQGHG
1DWXUDOSURJHVWHURQHRIIHUVDPRUHEHQLJQDOWHUQDWLYHVLQFHVXI¿FLHQWVHUXPSURJHVWHURQHLQKLELWV)6+DQG/+

Signs and Symptoms


,IWKLVWLVVXHLVJURZLQJDGMDFHQWWRRURQWKHOXPEDUQHUYHSOH[XVRURQWKHFRORQWKHV\PSWRPVFDQEHYDULHG
DQGWKHGLDJQRVLVKDUGWRSLQGRZQGXOODFKLQJFUDPSLQJSDLQEHDULQJGRZQSUHVVXUHLQWKHORZEDFNDQG
SHOYLVG\VSDUHXQLD SDLQZLWKLQWHUFRXUVH PD\RFFXUDEQRUPDOEOHHGLQJPD\RFFXUSDOSDEOHWHQGHUQRGXOHV
DORQJWKHXWHURVDFUDOOLJDPHQWVD¿[HGWHQGHUUHWURÀH[HGXWHUXVWKLFNHQLQJRIWKHDGQH[D

Course and Prognosis


7KHHFWRSLFHQGRPHWULDOWLVVXHFDQJURZDQ\ZKHUHDQGUHVSRQGVWRWKHVDPHKRUPRQDOPHVVDJHVDVRWKHUXWHULQH
WLVVXHVZHOOLQJDQGFKDQJLQJZLWKWKHPHQVWUXDOF\FOH3DLQWHQGVWRLQFUHDVHZLWKWLPHDQGEHJLQVSURJUHVVLYHO\
earlier in the menstrual cycle. Laser techniques to destroy it are currently popular in conventional medicine, as is
UHPRYLQJWKHXWHUXVRYDULHV DQGSHUKDSVDSSHQGL[ WKXVVWRSSLQJWKHPHQVWUXDOF\FOHDOWRJHWKHU

Differential Diagnosis
• musculoskeletal problems causing back and pelvic pain
• dysmenorrhea
• 3,'
• ovarian tumor
Female Conditions 157

Suggested Nutritional Supplementation


• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
• Femarone 17 —1/4 to 3/4 tsp on clean skin once daily (A.M.)
1DWXUDO3URJHVWHURQH&UHPH
'U-RKQ5/HH0'UHFRPPHQGVWRSDWLHQWVZLWKPLOGWRPRGHUDWHHQGRPHWULRVLVWKDWWKH\XVHQDWXUDO
SURJHVWHURQHIURPGD\WRGD\PRQWKO\LQFUHDVLQJWKHGRVHXQWLOWKH\DUHVDWLV¿HGWKDWWKHLUSHOYLF
SDLQVDUHGHFUHDVLQJ2QFHWKDWGRVHLVUHDFKHGWKH\FRQWLQXHLWIRU\HDUVEHIRUHJUDGXDOO\ORZHULQJLW
7KHLUPHQVWUXDOÀRZZLOOEHFRPHFRQVLGHUDEO\OHVVDQGWKHLUERGLHVZLOOKDYHWLPHWRKHDOWKHHQGRPHWULRVLV
OHVLRQV,IWKHSDLQVUHFXUVRPHSDWLHQWVZLOOFRQWLQXHWKLVWUHDWPHQWXQWLOPHQRSDXVH6LQFHQRQH
RIKLVSDWLHQWVZLWKPLOGWRPRGHUDWHHQGRPHWULRVLVKDYHKDGWRUHVRUWWRVXUJHU\
• EstroFactors²WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVPDQGRYHUDOOKRUPRQHEDODQFH
• Lipo-Gen²WDEOHWVWLPHVGDLO\ZLWKPHDOV
&RPSUHKHQVLYHOLSRWURSLFIRUPXOD
• GLA-Forte²VRIWJHOVWLPHVGDLO\ZLWKPHDOV
PJJDPPDOLQROHQLFDFLG

Contributing Factors
• High Stress
• High Fat Diet
• Impaired Fatty Acid Conversion

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
158 Female Conditions

Fibrocystic Breast Syndrome


0XOWLSOHQDPHVH[LVWWRGHVFULEHF\FOLFDOEUHDVWWLVVXHFKDQJHVDQGWKHFOLQLFDOV\PSWRPVWKDWRFFXUPRQWKO\
XQGHUWKHKRUPRQDOLQÀXHQFHRIWKHPHQVWUXDOF\FOH7KHQDPHVLQFOXGHF\FOLFPDVWDOJLD¿EURF\VWLFGLVHDVH
DEHUUDWLRQVRIQRUPDOGHYHORSPHQW $1', EHQLJQEUHDVWGLVHDVH¿EURXVGLVHDVHEHQLJQEUHDVWV\QGURPH
F\VWLFEUHDVWGLVHDVHDQGPDPPDU\G\VSODVLD,QWKLVQXWULWLRQDOKDQGRXWWKLVSKHQRPHQRQZLOOEHUHIHUUHGWR
DV)LEURF\VWLF%UHDVW6\QGURPH )%6 DVWKLVWHUPFRLQVWKHWZRPRVWFRPPRQEUHDVWFKDQJHVZKLFKRFFXU
F\VWLF¿EURXV DQGGH¿QHVWKHFRQGLWLRQDVDV\QGURPHDQGQRWDGLVHDVH
7KHFRQGLWLRQRI¿EURF\VWLFEUHDVWVKDVEHHQODEHOHGDV\QGURPHDQGLVQRORQJHUUHFRJQL]HGRUSURSHUO\UHIHUUHG
WRDVDQDFWXDOGLVHDVHPDQLIHVWDWLRQ,QGHHG+XWWHULQSRVHGWKHTXHVWLRQ³,VLWUHDVRQDEOHWRGH¿QHDVD
GLVHDVHDQ\SURFHVVWKDWRFFXUVFOLQLFDOO\LQDQGKLVWRORJLFDOO\LQRIZRPHQ"´$GGLWLRQDOO\WKH¿EURF\VWLF
EUHDVWZDVFODVVL¿HGDVDPDQLIHVWDWLRQGLVHDVHEDVHGXSRQWKHVSXULRXVEHOLHIWKDWZRPHQZLWKWKLVFRQGLWLRQ
ZHUHDWWRWLPHVWKHULVNRIGHYHORSLQJEUHDVWFDUFLQRPD7KLVLVFXUUHQWO\QRWFRQVLGHUHGWREHWKHFDVH0RVW
ZRPHQZLWKF\FOLFDO¿EURF\VWLFEUHDVWFKDQJHVDUHQRWDWLQFUHDVHGULVNRIFDQFHU5DWKHULWLVDVSHFLDOVXEVHW
RIWKHVHZRPHQZKRDUHDWULVN'XSRQWDQG3DJHLQGHPRQVWUDWHGLQDVWXG\RIEUHDVWELRSVLHV
RYHUDSHULRGRI\HDUVWKDWZRPHQDUHDWLQFUHDVHGULVNRIFDQFHURQO\LIWKHEUHDVWV\QGURPHLVKLVWRORJLFDOO\
DW\SLFDOK\SHUSODVLDDQGRUWKHUHLVDIDPLOLDOULVNIDFWRUWKHPDMRULW\RIZRPHQ  ZKRXQGHUZHQWEUHDVW
ELRSV\ZHUHQRWDWULVN

Incidence
7KHLQFLGHQFHRI)%6SHDNVLQWR\HDUROGZRPHQRFFXUULQJPRUHIUHTXHQWO\LQWKHOHIWEUHDVW,QPRVW
ZRPHQLWLVH[SHULHQFHGDVDPLOGWRPRGHUDWHDFKLQJEXUQLQJRULQWHUPLWWHQWVKDUSGLVFRPIRUWLQRQHRUERWK
EUHDVWVGXULQJWKHSUHPHQVWUXXPDWDQ\WLPHIURPRYXODWLRQWRWKHRQVHWRIWKHPHQVHV

Suggested Nutritional Supplementation

Mild
• Celapro²WDEOHWWLPHVGDLO\ZLWKPHDOV
3URPRWHVKHDOWK\FHOOXODUDJLQJ
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV

Moderate to Severe add


• EstroFactors²WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVP

Contributing Factors
 ‡+LJK)DW'LHW ‡2EHVLW\
 ‡&DIIHLQH,QWDNH ‡,PSDLUHG)DWW\$FLG&RQYHUVLRQ
 ‡,RGLQH'H¿FLHQF\ ‡$OFRKRO,QWDNH

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
Female Conditions 159

Menopause — Hormone Dysregulation


'XHWRWKHHDUO\WHUPLQDWLRQRIWKH1DWLRQDO,QVWLWXWHVRI+HDOWK 1,+ UHVHDUFKRQHormone Replacement Therapy
+57 PDQ\ZRPHQZKRDUHHLWKHURQ+57RUDUHFRQVLGHULQJLWKDYHDGLI¿FXOWGHFLVLRQWRPDNH:KHWKHU
RUQRWWRJRRQ+57LVDFULWLFDOGHFLVLRQEHFDXVHHVWURJHQLPEDODQFHLVUHVSRQVLEOHIRUPDQ\RIWKHDGYHUVH
HIIHFWVDVVRFLDWHGZLWKPHQRSDXVH(VWURJHQPD\EHRQRFFDVLRQDZRPDQ¶VEHVWIULHQGEXWLWVÀXFWXDWLRQ
WKURXJKRXWOLIHFDXVHVDKRVWRISUREOHPVIRUVRPHZRPHQ,WKDVEHHQGRFXPHQWHGWKDWLQWKH8QLWHG6WDWHV
synthetic estrogen pharmaceuticals are among the most commonly prescribed and dispensed drugs in community
SUDFWLFH+RZHYHUWKHUHDUHVLJQL¿FDQWULVNVDVVRFLDWHGZLWKWKLVIRUPRIWKHUDS\
The NIH study (Press Release: Tuesday July 9, 2002) and additional studies, including several published in the
Journal of the American Medical Association (JAMA) and in the New England Journal of Medicine, have indicated
WKDWWKHULVNVDVVRFLDWHGZLWK+57IDURXWZHLJKWKHEHQH¿WV6RPHRIWKHDGYHUVHVLGHHIIHFWVDVVRFLDWHGWRORQJ
WHUPXVHRI+57DUHLQYDVLYHEUHDVWFDQFHURYDULDQFDQFHUHQGRPHWULDOFDQFHUHQGRPHWULRVLVKHDUWDWWDFN
VWURNHEORRGFORWVLQVXOLQUHVLVWDQFHW\SH,,GLDEHWHVDGXOWRQVHWDVWKPDDQGDZLGHUDQJHRIRWKHUIUHTXHQW
DGYHUVHHIIHFWVVXFKDVDEGRPLQDOEORDWLQJPLJUDLQHRURWKHUNLQGVRIKHDGDFKHZHLJKWJDLQDQ[LHW\GHSUHVVLRQ
and breast tenderness.
,QVLPSOHWHUPVDFFRUGLQJWRWKHGDWDLQWKH1,+VWXG\LIZRPHQWRRNWKHGUXJVIRUD\HDUDQG
GLGQRWZRPHQLQWKH+57JURXSZRXOGKDYHPRUHFDVHVRILQYDVLYHEUHDVWFDQFHUPRUHFDVHVRIKHDUW
DWWDFNPRUHFDVHVRIVWURNHDQGPRUHLQVWDQFHVRIEORRGFORWV6LQFHPLOOLRQZRPHQDUHFXUUHQWO\RQ
KRUPRQH UHSODFHPHQW WKHUDS\ WKLV WUDQVODWHV WR DOPRVW  FDVHV RI OLIHWKUHDWHQLQJ DQG LQ VRPH FDVHV
OLIHWHUPLQDWLQJ VLGHHIIHFWV$QRWKHUVWXG\SXEOLVKHGLQ-$0$-XO\ 288:334-341 IROORZHGDJURXS
RIZRPHQIRU\HDUVRUPRUHZKRXVHG+57WKH\ZHUHIRXQGWREHDWVLJQL¿FDQWO\LQFUHDVHGULVNIRURYDULDQ
FDQFHU7KHVHVWXGLHVDOVRLQGLFDWHGWKDWWKHVWXG\SDUWLFLSDQWVZKRGHYHORSHGWKHVHGLVHDVHVKDGQRIDPLO\
KLVWRU\RIWKHGLVHDVH
:LWKWKHVHREYLRXVGRFXPHQWHGULVNVDOWHUQDWLYHWKHUDSLHVWR+57VKRXOGEHFRQVLGHUHGEHIRUHDQ\GHFLVLRQ
is made.

Some of the Natural Alternatives to Hormone Replacement Therapy


:RPHQZKRGHFOLQHWRXVH+57PD\FKRRVHIURPDYDULHW\RIQDWXUDOUHPHGLHVWKDWDUHDYDLODEOH7KHVHLQFOXGH
SODQWKRUPRQHVFDOOHGSK\WRHVWURJHQVZKLFKDUHIRXQGLQVR\EDVHGSURGXFWVDQGKHUEVVXFKDVEODFNFRKRVK
JLQVHQJGRQJTXDLDQGOLFRULFHURRWZKLFKKDYHEHHQXVHGVDIHO\IRUFHQWXULHVWRHOLPLQDWHPHQRSDXVDOV\PSWRPV
3DVWUHVHDUFKKDVLQGLFDWHGWKDWSK\WRHVWURJHQVPD\SUHYHQWKHDUWGLVHDVHDQGVORZERQHORVVZLWKRXWWKHULVNV
DVVRFLDWHGZLWK+57&UHDPVFRQWDLQLQJZLOG\DPH[WUDFWRIIHUHQ]\PDWLFDOO\FRQYHUWHGKRUPRQHVZLWKPROHFXODU
VWUXFWXUHVWKDWDUHLGHQWLFDOWRZKDWWKHERG\SURGXFHV0HQRSDXVDOV\PSWRPVVXFKDVKRWÀDVKHVDQGYDJLQDO
GU\QHVVFDQEHDGGUHVVHGXVLQJWKHVHELRLGHQWLFDOQDWXUDOKRUPRQHV

Natural versus Synthetic Estrogens


7RWHVWWKHHIIHFWRIQDWXUDOHVWURJHQVFDOOHGSK\WRHVWURJHQV IRXQGLQVR\IRRGVDQGKHUEVVXFKDV%ODFN&RKRVK 
UHVHDUFKHUVDW7XIWV8QLYHUVLW\6FKRRORI0HGLFLQHLQ%RVWRQH[SRVHGHVWURJHQGHSHQGHQWEUHDVWFDQFHUFHOOVWR
DYDULHW\RIV\QWKHWLFHVWURJHQV WKHVDPHKRUPRQHVIRXQGLQWUDGLWLRQDOKRUPRQHUHSODFHPHQWWKHUDS\ 
7KH\IRXQGWKDWWKHV\QWKHWLFHVWURJHQVSURPRWHGFHOOSUROLIHUDWLRQLQWKHEUHDVWFDQFHUFHOOVZKLOHWKHQDWXUDO
HVWURJHQVLQKLELWHGEUHDVWFDQFHUFHOOJURZWK Nutrition and Cancer, 1998;30;232-9.

The Benefits of Soy Isoflavones in Menopause


&RQVLGHUDEOHHYLGHQFHDSSHDUVWRLQGLFDWHWKDWVR\LVRÀDYRQHVLQWKHGLHWH[HUW³ZHDN´HVWURJHQLFHIIHFWVWKDWPD\
FRQIHUDQWLDJLQJEHQH¿WVKHOSSUHYHQWERQHDQGMRLQWGLVHDVHDQGFDQFHU7KH\DOVRSURPRWHFDUGLRYDVFXODU
ZHOOQHVVKHOSWRPDLQWDLQDKHDOWK\XULQDU\WUDFWDQGPRGLI\WKHV\PSWRPVRIPHQRSDXVH
(DUO0LQGHOO3K'LQKLVSRSXODUFRQVXPHUERRNWLWOHGEarl Mindell’s Soy MiracleSRLQWVWRWKHYDOXHRIVR\LQ
VXSSUHVVLQJPHQRSDXVDOV\PSWRPV'U0LQGHOOFOHDUO\UHSRUWVWKHUHVXOWVRIVWXGLHVE\&DQDGLDQUHVHDUFKHUV
RI-DSDQHVHZRPHQZKHUHPHQRSDXVDOFRPSODLQWVVXFKDVKRWÀDVKHVDUHPXFKOHVVSUHYDOHQWLQ-DSDQHVH
WKDQ :HVWHUQ ZRPHQ  'LHWDU\ VXSSOHPHQWDWLRQ ZLWK VR\ SK\WRHVWURJHQV RIIHUV D SRVVLEOH DOWHUQDWLYH WR WKH
FRPPHQFHPHQWRIV\QWKHWLFKRUPRQHUHSODFHPHQWWKHUDS\ZLWKDOOLWVNQRZQGUDZEDFNV
7KHSURVSHFWRIXVLQJDQDWXUDOPHDQVZLWKVR\LVRÀDYRQHVXSSOHPHQWDWLRQWRUHYHUVHWKHVHDGYHUVHDVVRFLDWLRQV
RIPHQRSDXVHLVYHU\H[FLWLQJ
Phytoestrogens for a Healthier Menopause by Steven Holt, MD published in Alternative and Complementary
Therapies-June 1997.
160 Female Conditions

The Benefits of Black Cohosh in Menopause


Black cohosh (Cimicifuga racemosa  KDV GHPRQVWUDWHG HVWURJHQLF HIIHFWV GXH WR WKH DFWLRQ RI VHYHUDO RI LWV
FRQVWLWXHQWV%RWKFOLQLFDOVWXGLHVDQGSDWLHQWUHSRUWVKDYHIRXQG%ODFNFRKRVKWREHHIIHFWLYHLQHOLPLQDWLQJ
PDQ\RIWKHV\PSWRPVRIPHQRSDXVHLQFOXGLQJKRWÀDVKHVYDJLQDOGU\QHVVGHSUHVVLRQDQGDQ[LHW\,QRQH
VWXG\UHVHDUFKHUVJDYHZRPHQHLWKHUDFRQFHQWUDWHGH[WUDFWRI%ODFNFRKRVKRUDSODFHERIRUZHHNV7KH
%ODFNFRKRVKJURXSKDGDVLJQL¿FDQWUHGXFWLRQLQOXWHLQL]LQJKRUPRQH /+ VHFUHWHGE\WKHSLWXLWDU\JODQGLQWKH
EUDLQ,WLVWKRXJKWWKDWKLJKOHYHOVRI/+DVZHOODVDQRWKHUKRUPRQHIURPWKHSLWXLWDU\FDOOHGIROOLFOHVWLPXODWLQJ
KRUPRQH )6+ DUHUHVSRQVLEOHIRUVRPHRIWKHXQSOHDVDQWV\PSWRPVDVVRFLDWHGZLWKPHQRSDXVH,IDZRPDQ
SURGXFHVHQRXJKHVWURJHQKRZHYHUH[FHVVLYHOHYHOVRI/+DQG)6+DUHXVXDOO\NHSWLQFKHFN
$QRWKHUVWXG\FRQGXFWHGLQ(XURSHVKRZHGWKDW%ODFNFRKRVKDFWXDOO\GHFUHDVHGPHQRSDXVDOV\PSWRPVEHWWHU
WKDQV\QWKHWLFHVWURJHQLQFOXGLQJV\PSWRPVRIYDJLQDOGU\QHVVDQGGLVFRPIRUW%ODFNFRKRVKDOVRKDVDUHFRUG
RIEHLQJH[WUHPHO\VDIH
Duker, EM., Kopanski, L., Jarry, H., et. al. “The effects of extracts from Cimicifuga racemosa on gonadotropin
release in menopausal women and ovariecustomized rats”. Planta Medica (1991)57;420-424.

The Benefits of Natural Estrogen and Progesterone Creams in Menopause


7UDQVGHUPDOFUHDPRIQDWXUDOO\GHULYHGSURJHVWHURQHDQGHVWURJHQFDQEHXVHIXOLQFRSLQJZLWKWKHV\PSWRPV
DVVRFLDWHGZLWKWKHGHFUHDVHLQKRUPRQHSURGXFWLRQGXULQJSHULPHQRSDXVHPHQRSDXVHDQGIROORZLQJDK\VWHUHFWRP\
7KHIRUPXODVKRXOGEHGHVLJQHGWRPDWFKWKHQDWXUDOSDWWHUQRIFLUFXODWLQJHVWURJHQVIRXQGLQWKHIHPDOHERG\
HVWULROHDFKRIHVWURQHDQGHVWUDGLRO3URJHVWHURQHVKRXOGEHQROHVVWKDQPJSHURXQFHRIFUHDP7KH
DGYDQWDJHRIWUDQVGHUPDODSSOLFDWLRQLVEHWWHUDEVRUSWLRQ,WJRHVGLUHFWO\LQWRWKHEORRGVWUHDPWKHUHE\E\SDVVLQJ
WKHSUREOHPVDVVRFLDWHGZLWKSRRUGLJHVWLRQDQGOLYHUEUHDNGRZQWKDWFDQRFFXUZLWKRUDOVXSSOHPHQWDWLRQ
Wright, JV., Morgenthaler, J. Natural Hormone Replacement. Smart Publications, Petaluma, CA, 94955, 1997.
Lee, JR., Hopkins, V. What Your Doctor May Not Tell You About Menopause, Warner Books, Inc., 1271 Avenue
of Americas, New York, NY 10020, 1996.

Types of Menopause
• Natural, or physiologic menopauseLVFDXVHGE\RYDULDQIDLOXUHGXHWRVHQHVFHQFH)RUH[DPSOHDWELUWK
WKHUHDUHDERXWPLOOLRQHJJVZLWKLQWKHRYDULHVDWSXEHUW\WKLVLVUHGXFHGWRDERXW$WPHQRSDXVH
the eggs are virtually absent.
• 6XUJLFDORUDUWL¿FLDOPHQRSDXVHUHIHUVWRWKHZRPDQZKRKDVKDGERWKRIKHURYDULHVVXUJLFDOO\UHPRYHG
8SRQUHPRYDORIWKHRYDULHVWKHSURGXFWLRQRIHVWURJHQLVGUDPDWLFDOO\UHGXFHG7KLVFUHDWHVDQDUWL¿FLDOO\
LQGXFHG\HWYHULWDEOHVWDWHRIPHQRSDXVH$FFRUGLQJWRRQHUHSRUWDVPDQ\DVRISRVWPHQRSDXVDO
ZRPHQ LQ WKH 8QLWHG 6WDWHV KDYH KDG PHQRSDXVH VXUJLFDOO\ LQGXFHG7KHVH ZRPHQ SRVVHVV WKH VDPH
FDSDFLW\WRVXIIHUIURPWKHFOLQLFDOV\PSWRPVDQGFRPSODLQWVDVVRFLDWHGZLWKQDWXUDOPHQRSDXVH
• Premature menopauseUHIHUVWRLGLRSDWKLFRYDULDQIDLOXUHEHIRUHWKHDJHRI3RVVLEOHFRQWULEXWLQJIDFWRUV
LQFOXGHUDGLDWLRQH[SRVXUHVPRNLQJFDQFHUGUXJVRUVXUJHU\WKDWUHGXFHVRYDULDQEORRGVXSSO\

Dietary Suggestions
• FirstLine Therapy® Diet
NOTE:'XHLQODUJHSDUWWRGLHWDU\IDFWRUVWKHUHLVQRZRUGIRUPHQRSDXVHLQWKH-DSDQHVHODQJXDJHEHFDXVH
-DSDQHVHZRPHQGRQRWH[SHULHQFHDQ\RIWKHV\PSWRPVDVVRFLDWHGZLWKWKLVQDWXUDOWUDQVLWLRQ-DSDQHVHZRPHQ
KDYHDGLHWKLJKLQLVRÀDYRQHVDQGKDYHYLUWXDOO\QRKRWÀDVKHV. SelestroIeatures NovaSoy®, a patented super
FRQFHQWUDWHRIVR\LVRÀDYRQHV

Suggested Nutritional Supplementation

Peri Menopause
Light to Moderate Symptoms
• EstroFactors ²WDEOHWVGDLO\ZLWKIRRG FDQEHWDNHQLQRQHGRVH
(VWUR)DFWRUVIHDWXUHVQXWULHQWVWKDWVXSSRUWKHDOWK\KRUPRQHEDODQFHDQGSURSHUGHWR[L¿FDWLRQRIXQKHDOWK\
synthetic estrogens that increase risk to cancer, heart disease and diabetes. EstroFactors contains no
KRUPRQDOFRQVWLWXHQWV(VWUR)DFWRUVLVUHFRPPHQGHGLIWKHSDWLHQWLVRUKDVEHHQRQV\QWKHWLFKRUPRQH
replacement therapy (HRT).
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
Female Conditions 161

Severe Symptoms Add


• Selestro ²WDEOHWRQHWRWZRWLPHVGDLO\
6HOHVWURFRQWDLQVERWKVR\LVRÀDYRQHVDQGEODFNFRKRVKWRKHOSPDQDJHPHQRSDXVDOFRPSODLQWVVXFKDV
KRWÀDVKHVQLJKWVZHDWVRFFDVLRQDOVOHHSGLVWXUEDQFHVPLOGPRRGVZLQJVDQGRFFDVLRQDOLUULWDELOLW\

Menopause Nutritional Support


Light to moderate symptoms
• EstroFactors ²WDEOHWVGDLO\ZLWKIRRG FDQEHWDNHQLQRQHGRVH
(VWUR)DFWRUVIHDWXUHVQXWULHQWVWKDWVXSSRUWKHDOWK\KRUPRQHEDODQFHDQGSURSHUGHWR[L¿FDWLRQRIXQKHDOWK\
synthetic estrogens that increase risk to cancer, heart disease and diabetes. EstroFactors contains no
KRUPRQDOFRQVWLWXHQWV(VWUR)DFWRUVLVUHFRPPHQGHGLIWKHSDWLHQWLVRUKDVEHHQRQV\QWKHWLFKRUPRQH
replacement therapy (HRT).
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
• Selestro ²WDEOHWRQHWRWZRWLPHVGDLO\
6HOHVWURFRQWDLQVERWKVR\LVRÀDYRQHVDQGEODFNFRKRVKWRKHOSPDQDJHPHQRSDXVDOFRPSODLQWVVXFKDV
KRWÀDVKHVQLJKWVZHDWVRFFDVLRQDOVOHHSGLVWXUEDQFHVPLOGPRRGVZLQJVDQGRFFDVLRQDOLUULWDELOLW\

Severe Symptoms Add


• Estro Pro Cream²îWHDVSRRQRQFHRUWZLFHGDLO\DSSOLHGWRSLFDOO\RULQWUDYDJLQDOO\IRUZRPHQZKRDUH
VHHNLQJUHOLHIRIYDJLQDOGU\QHVV$SSO\WRDQ\VRIWSDUWRIWKHERG\ LHIDFHQHFNEHOO\ZULVWXQGHUDUPRU
WKLJK URWDWLQJWRGLIIHUHQWDUHDVSHULRGLFDOO\
(VWUR3UR&UHDPLVDWUDQVGHUPDOFUHDPFRQWDLQLQJELRLGHQWLFDOKXPDQSURJHVWHURQHDQGHVWURJHQVGHVLJQHG
WRPDWFKWKHQDWXUDOSDWWHUQRIFLUFXODWLQJHVWURJHQVIRXQGLQWKHKHDOWK\IHPDOHERG\

Hot Flash Acute Management


• Fem Estro HP ²GURSVLQPRXWKHYHU\PLQXWHVUHGXFLQJWRWLPHVDGD\

Adreno Pause (Adrenal Insufficiency)


$VDZRPDQEHJLQVWRHQWHUPHQRSDXVHKHURYDULHVVWRSSURGXFLQJHVWURJHQDQGLWLVWKHDGUHQDOJODQGVWKDW
EHFRPHWKHSULPDU\VRXUFHRIHVWURJHQSURGXFWLRQ,I\RXFRQVLGHUWKHSUR¿OHRI\RXUSDWLHQWVZLWKPHQRSDXVDO
V\PSWRPVWKH\DUHPRUHWKDQOLNHO\VLQJOHPRWKHUVFDUHHUZRPHQDQGRUZRPHQZLWKDKLJKOHYHORIVWUHVVLQ
WKHLUOLYHV,WLVWKHDGUHQDOJODQGVWKDWVXSSRUWWKHERG\
VDELOLW\WRFRSHRUDGDSWWRVWUHVV7KXVLWLVLPSRUWDQW
IRUWKHFOLQLFLDQWRDGGUHVVDOWHUHGDGUHQDOIXQFWLRQLQPHQRSDXVHHVSHFLDOO\LQWKHSUHVHQFHRIWKHXQQHFHVVDU\
V\PSWRPVRIPHQRSDXVH HJ+RW)ODVKHVPRRGVZLQJVQLJKWVZHDWVHWF 

For Adreno Pause add:


• Adreset²WDEOHWVWZRWLPHVGDLO\EHWZHHQPHDOV
$GUHVHWFRQWDLQVQXWULHQWVDQGKHUEVWRVXSSRUWDGUHQDOIXQFWLRQDQGKRUPRQHEDODQFH7KHDGUHQDOVSLFN
XSWKHSURGXFWLRQRIKRUPRQHVDVWKHRYDULHVVKXWGRZQLIWKHDGUHQDOVDUHVWUHVVHGWKH\DUHXQDEOHWR
SHUIRUPWKLVIXQFWLRQFDXVLQJPRUHSURIRXQGV\PSWRPVRIPHQRSDXVH

Comprehensive Bone Nourishment for Women with Known Bone Loss


,WLVH[WUHPHO\LPSRUWDQWIRUDOOZRPHQHVSHFLDOO\WKRVHRIPHQRSDXVDO\HDUVWREHRQDFRPSUHKHQVLYHERQH
VXSSRUWIRUPXOD7KHGHFOLQHLQHVWURJHQFRQWULEXWHVWRDFFHOHUDWHGERQHORVV
• Cal Apatite Plus ²WDEOHWVWZLFHGDLO\ZLWKIRRGPD\WDNHXSWRWDEOHWVGDLO\IRUVLJQL¿FDQWERQHORVV
&DO$SDWLWH3OXVLVDFRPSOHWHERQHIRRGWKDWKDVEHHQGRFXPHQWHGLQVFLHQWL¿FOLWHUDWXUHWRUHJHQHUDWH
ERQH HYHQLQSRVWPHQRSDXVDOZRPHQ 7KHLSULÀDYRQHFRQWDLQHGLQ&DO$SDWLWH3OXVKDVEHHQVKRZQWR
UHGXFHRVWHRFODVWLFDFWLYLW\ ERQHEUHDNGRZQ ZKLOHLQFUHDVLQJRVWHREODVWLFDFWLYLW\ ERQHEXLOGLQJ ZLWKRXW
DQ\DGYHUVHVLGHHIIHFWV

Additional Considerations
,IKRUPRQDOWHVWLQJKDVEHHQSHUIRUPHGWKHIROORZLQJPD\EHFRQVLGHUHG
162 Female Conditions

Low Progesterone, Normal Estrogen and Testosterone


• Femarone 17²îWHDVSRRQRQFHRUWZLFHGDLO\DSSOLHGWRSLFDOO\RULQWUDYDJLQDOO\IRUZRPHQZKRDUH
VHHNLQJUHOLHIRIYDJLQDOGU\QHVV$SSO\WRDQ\VRIWSDUWRIWKHERG\ LHIDFHQHFNEHOO\ZULVWXQGHUDUP
RUWKLJK URWDWLQJWRGLIIHUHQWDUHDVSHULRGLFDOO\
)HPDURQHLVDWRWDOO\QDWXUDOSURJHVWHURQHFUHDPIURPZLOG\DPZKLFKLVHQ]\PDWLFDOO\FRQYHUWHGWRELR
identical human progesterone.

Low Progesterone, Low Estrogen, Normal Testosterone


• Estro Pro Cream ²îWHDVSRRQRQFHRUWZLFHGDLO\DSSOLHGWRSLFDOO\RULQWUDYDJLQDOO\IRUZRPHQZKR
DUHVHHNLQJUHOLHIRIYDJLQDOGU\QHVV$SSO\WRDQ\VRIWSDUWRIWKHERG\ LHIDFHQHFNEHOO\ZULVW
XQGHUDUPRUWKLJK URWDWLQJWRGLIIHUHQWDUHDVSHULRGLFDOO\
(VWUR3UR&UHDPLVDWUDQVGHUPDOFUHDPFRQWDLQLQJELRLGHQWLFDOKXPDQSURJHVWHURQHDQGHVWURJHQVGHVLJQHG
WRPDWFKWKHQDWXUDOSDWWHUQRIFLUFXODWLQJHVWURJHQVIRXQGLQWKHKHDOWK\IHPDOHERG\

Low Progesterone, Low Estrogen, Low Testosterone


• Estro Pro Cream ²îWHDVSRRQRQFHRUWZLFHGDLO\DSSOLHGWRSLFDOO\RULQWUDYDJLQDOO\IRUZRPHQZKR
DUHVHHNLQJUHOLHIRIYDJLQDOGU\QHVV$SSO\WRDQ\VRIWSDUWRIWKHERG\ LHIDFHQHFNEHOO\ZULVW
XQGHUDUPRUWKLJK URWDWLQJWRGLIIHUHQWDUHDVSHULRGLFDOO\
(VWUR3UR&UHDPLVDWUDQVGHUPDOFUHDPFRQWDLQLQJELRLGHQWLFDOKXPDQSURJHVWHURQHDQGHVWURJHQVGHVLJQHG
WRPDWFKWKHQDWXUDOSDWWHUQRIFLUFXODWLQJHVWURJHQVIRXQGLQWKHKHDOWK\IHPDOHERG\
• BioSôm ²VSUD\VHUYLQJXQGHUWRQJXHWLPHVGDLO\0L[ZLWKVDOLYDIRUVHFRQGVDQGVZDOORZ
%LR6{PLVDOLSRVRPDO'+($IRUPD[LPXPXSWDNHDQGHIIHFWLYHQHVV,QZRPHQ'+($FRQYHUWVGLUHFWO\DQG
VDIHO\LQWRWHVWRVWHURQHDOOHYLDWLQJV\PSWRPVRIORZWHVWRVWHURQHDQGVXSSRUWLQJDGUHQDOIXQFWLRQ

Contributing Factors
• 3RRU'LHW
• High Stress
• Impaired Fatty Acid Conversion
NOTE:(VWURJHQSOD\VDUROHLQWKHSDWKRSK\VLRORJ\RIDVWKPDDQGWKDWORQJWHUPXVHDQGRUKLJKGRVHVRI
SRVWPHQRSDXVDOKRUPRQHWKHUDS\LQFUHDVHVXEVHTXHQWULVNRIDVWKPD
— Am J Respir Crit Care Med,9ROSS
Female Conditions 163

Menorrhagia / Excessive Menstrual Blood Flow


'\VIXQFWLRQDO XWHULQH EOHHGLQJ DFFRXQWV IRU  RI DOO J\QHFRORJLFDO YLVLWV DQG  RI DOO GLODWDWLRQ DQG
FXUHWWDJHSURFHGXUHV)LIW\SHUFHQWRISDWLHQWVXQGHUJRLQJK\VWHUHFWRP\IRUPHQRUUKDJLDLQ2[IRUG(QJODQG
ZHUHVFKHGXOHGIRUVXUJHU\EHFDXVHRIUHJXODUKHDY\PHQVWUXDOEOHHGLQJRIXQNQRZQFDXVH7KHPRVWFRPPRQO\
RFFXUULQJFDXVHVRIWUXHH[FHVVLYHPHQVWUXDOEOHHGLQJDUHOHLRP\RPDV ¿EURLGV RIWKHXWHUXVSHOYLFLQÀDPPDWRU\
disease, endometriosis and adenomyosis, lesions in the uterine cavity, such as submucous leiomyoma, intrauterine
polyps, and intrauterine contraceptive devices.
,Q WKH DEVHQFH RI DQ\ FOLQLFDOO\ DSSDUHQW SHOYLF GLVHDVH DV GHVFULEHG DERYH H[FHVVLYHO\ KHDY\ PHQVWUXDO
EOHHGLQJLVFDOOHG³G\VIXQFWLRQDOXWHULQHEOHHGLQJ´%HQMDPLQDQG6HOW]HUGHVFULEHG\VIXQFWLRQDOXWHULQHEOHHGLQJ
DV³DEQRUPDOXWHULQHEOHHGLQJLQZKLFKWKHUHLVDEVROXWHO\QRRUJDQLFSDWKRORJLFDOFRQGLWLRQWREHGHWHFWHGRQ
FOLQLFDOSHOYLFH[DPLQDWLRQ´,QRQHVWXG\ZRPHQZKRXQGHUZHQWK\VWHUHFWRP\IRUH[FHVVLYHPHQVWUXDOEORRG
ORVVHVZHUHIRXQGWRKDYHQRREYLRXVSDWKRORJ\QRUDQH[FHVVLYHQXPEHURIDUWHULHVIRUDEQRUPDOJODQGXODU
GLVWULEXWLRQ,QRWKHUZRUGVLWLVFRPPRQIRUZRPHQWRVXIIHUIURPH[FHVVLYHPHQVWUXDOEOHHGLQJIRUQRNQRZQ
RUJDQLFFDXVH2IWHQWKHFDXVHLVGXHWRELRFKHPLFDOLPEDODQFHVSURGXFHGE\YLWDPLQDQGPLQHUDOGH¿FLHQFLHV
DQGRUHVVHQWLDOIDWW\DFLGLPEDODQFHVZKLFKPD\EHV\VWHPLFRUWLVVXHVSHFL¿F

Suggested Nutritional Supplementation

Mild
• EstroFactors²WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVP
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV

Moderate to Severe add


• Femarone 17²WHDVSRRQWZLFHGDLO\IRUWKHODVWGD\VRIWKHF\FOH
/LSRVRPHQDWXUDO863SURJHVWHURQH DQWLR[LGDQWERG\FUHPH
*UHDWHUWKDQRI'\VIXQFWLRQDO8WHULQH%OHHGLQJ '8% FDVHVDUHDVVRFLDWHGZLWKDQRYXODWLRQ7KH
EOHHGLQJ LQ DQRYXODWRU\ ZRPHQ LV JHQHUDOO\ D UHVXOW RI FRQWLQXHG VWLPXODWLRQ RI WKH HQGRQHWULXP ZLWK
XQRSSRVHGHVWURJHQ7KHVSHFL¿FKRUPRQHODFNLQJLQQRQRYXODWRU\'8%LVSURJHVWHURQH
• Hemagenics — 1 tablet 3 times daily.
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ

Contributing Factors
• High Fat Diet
• /RZ,URQ'HVSLWH1RUPDO
• Impaired Fatty Acid Conversion
• +HPDWRORJLFDO3DUDPHWHUV
• 2EHVLW\DQGH[FHVVDGLSRVHWLVVXH

Dietary Suggestions
• FirstLine Therapy® Diet
164 Female Conditions

Ovarian Cyst
$F\VWRQDQRYDU\:KHQDVVRFLDWHGZLWKRWKHUGLVRUGHUVRIWKHK\SRWKDODPLFSLWXLWDU\RYDULDQD[LVDQGPDQ\
F\VWVDUHSUHVHQWLWLVWHUPHG3RO\F\VWLF2YDU\6\QGURPH DND6WHLQ/HYHQWKDO6\QGURPH 2YDULDQF\VWVPD\
EHGXHWRHQGRPHWULRVLVIROOLFXODURUFRUSXVOXWHXPF\VWVPDOLJQDQF\RUGHUPRLGF\VWV,Q3RO\F\VWLF2YDU\
6\QGURPHIROOLFXODUF\VWVGHYHORSDVDUHVXOWRISLWXLWDU\RYHUSURGXFWLRQRI/+WRWU\WRLQLWLDWHRYXODWLRQ
2YDULDQF\VWVDUHSURGXFWVRIIDLOHGRUGLVRUGHUHGRYXODWLRQ2QHRUPRUHRYDULDQIROOLFOHVDUHGHYHORSHGPRQWKO\
E\WKHHIIHFWVRIIROOLFOHVWLPXODWLQJKRUPRQH )6+ /XWHLQL]LQJKRUPRQH /+ SURPRWHVDFWXDORYXODWLRQDQG
WKHWUDQVIRUPDWLRQRIWKHIROOLFOH DIWHURYXODWLRQ LQWRWKHFRUSXVOXWHXPZKLFKSURGXFHVSURJHVWHURQH,Q\RXQJ
ZRPHQGXULQJWKHHDUO\\HDUVRIPHQVWUXDOF\FOHVRYXODWLRQPD\FRLQFLGHZLWKDVPDOODPRXQWRIKHPRUUKDJH
DWWKHIROOLFOHVLWH7KLVZLOOFDXVHDEGRPLQDOSDLQRIWHQZLWKDVOLJKWIHYHUDWWKHWLPHRIRYXODWLRQ LQWKHPLGGOH
GD\VEHWZHHQSHULRGV LVFRPPRQO\FDOOHGPLWWHOVFKPHU] *HUPDQIRU³PLGGOH´DQG³SDLQ´ 7UHDWPHQWFRQVLVWV
RQO\RIPLOGDQDOJHVLFVUHDVVXUDQFHUHVWDQGSHUKDSVDZDUPSDFN,WLVXQOLNHO\WRUHFXUDQGSRUWHQGVQR
IXWXUHSUREOHPV
/DWHULQOLIHXVXDOO\DIWHUKHUPLG¶VDZRPDQPD\GHYHORSDQRYDULDQF\VWZKLFKPD\EHDV\PSWRPDWLFRU
PD\FDXVHYDULDEOHSHOYLFSDLQ3DOSDWLRQPD\GHWHFWDVPRRWKWHQGHUPDVVDWRQHRYDU\VLWHRUDF\VWPD\EH
IRXQGE\VRQRJUDPYLVXDOL]DWLRQ7KHF\VWPD\VLPSO\FROODSVHDQGGLVDSSHDUDIWHUDPRQWKRUWZRRULWPD\
SHUVLVWDQGLQFUHDVHLQVL]HDQGGLVFRPIRUWGXULQJVXFFHHGLQJPRQWKV6XFKF\VWVDUHFDXVHGE\DIDLOHGRYXODWLRQ
LQZKLFKIRUUHDVRQVSUHVHQWO\XQNQRZQWKHRYXODWLRQGLGQRWSURFHHGWRFRPSOHWLRQ:LWKHDFKVXFFHHGLQJ
PRQWK¶VVXUJHRI/+WKHIROOLFXODUVLWHVZHOOVDQGVWUHWFKHVWKHVXUIDFHPHPEUDQHFDXVLQJSDLQDQGSRVVLEOH
EOHHGLQJDWWKHVLWH6RPHF\VWVPD\EHFRPHDVODUJHDVDJROIEDOORUOHPRQEHIRUHGLVFRYHU\7UHDWPHQWPD\
UHTXLUHVXUJHU\GXULQJZKLFKWKHHQWLUHRYDU\PD\EHORVW
$QDOWHUQDWLYHWUHDWPHQWIRURYDULDQF\VWVLVQDWXUDOSURJHVWHURQH%LRIHHGEDFNPHFKDQLVPVGLFWDWHWKDWVXI¿FLHQW
gonadal hormones inhibit hypothalamic and pituitary centers, such that FSH and LH production are also inhibited.
7KDWLVLQWKHXVXDOFLUFXPVWDQFHVWKHVXFFHVVIXOUHVSRQVHWR)6+DQG/+KRUPRQHVLVWKHULVHLQSURJHVWHURQH
IURPWKHFRUSXVOXWHXP,IVXI¿FLHQWDQGQDWXUDOSURJHVWHURQHLVVXSSOHPHQWHGSULRUWRRYXODWLRQ/+OHYHOVDUH
LQKLELWHGDQGUHJXODURYXODWLRQGRHVQRWRFFXU7KLVLVWKHHIIHFWRIFRQWUDFHSWLRQSLOOVIRUH[DPSOH6LPLODUO\WKH
KLJKHVWULRODQGSURJHVWHURQHOHYHOVWKURXJKRXWSUHJQDQF\VXFFHVVIXOO\LQKLELWRYDULDQDFWLYLW\IRUQLQHPRQWKV
7KHUHIRUHDGGLQJQDWXUDOSURJHVWHURQHIURPGD\WRGD\RIWKHF\FOHVXSSUHVVHV/+DQGLWVOXWHLQL]LQJ
HIIHFWV7KXVWKHRYDULDQF\VWZLOOQRWEHVWLPXODWHGDQGLQWKHSDVVDJHRIRQHRUWZRVXFKPRQWKO\F\FOHVZLOO
YHU\OLNHO\UHJUHVVDQGDWURSK\ZLWKRXWIXUWKHUWUHDWPHQW

Signs and Symptoms


Non-Polycystic
2IWHQWKHVHF\VWVDUHDV\PSWRPDWLFDEGRPLQDOSUHVVXUHGLVFRPIRUWSDLQZLWKSDOSDWLRQKHDYLQHVV WKHUHLV
UDUHO\VKDUSVXGGHQSDLQWKDWZRXOGWHQGWRLQGLFDWHDGLIIHUHQWSDWKRORJ\VXFKDVUXSWXUHKHPRUUKDJHRURYDULDQ
WRUVLRQ EOHHGLQJZLWKRYXODWLRQPHWURUUKDJLD
Lab Findings :HQGRPHWULDOELRSV\LQZRPHQRYHU\HDUVROGODSDURVFRS\

Polycystic
1RUPDO PDWXUDWLRQ RI VH[XDO GHYHORSPHQW KLUVXWLVP XVXDOO\ RQO\ RQ WKH IDFH REHVLW\ DQRYXODWLQJ SHULRGV
LUUHJXODUSHULRGVZLWKH[WHQGHGSHULRGVRIDPHQRUUKHDLQIHUWLOLW\RYDULHVDUHHQODUJHGDQGSRO\F\VWLF
/DE¿QGLQJVLQFUHDVHGVHUXP/+DQGQRUPDO)6+VHUXPWHVWRVWHURQH LQFUHDVHG XULQH.6 LQFUHDVHG 
HQGRPHWULDOELRSV\ LQZRPHQRYHU\HDUVROG VHUXPDQGURVWHQHGLRQH LQFUHDVHG ZLWKOXWHDOF\VWV
NOTE:0HWDEROLF6\QGURPHLVRIWHQDVVRFLDWHGZLWKSRO\F\VWLFRYDU\V\QGURPH

Course and Prognosis


,QQRQSRO\F\VWLFF\VWVWUHDWPHQWLVRQO\QHHGHGLIWKHF\VWEHFRPHVV\PSWRPDWLF XQOHVVWKHUHLVDPDOLJQDQF\ 
Conventional treatment is usually surgery.
,Q SRO\F\VWLF RYDU\ V\QGURPH ZKLOH WKH FRXUVH LV W\SLFDOO\ EHQLJQ DFKLHYLQJ SUHJQDQF\ PD\ EH SUREOHPDWLF
XVXDOO\IHUWLOLW\PXVWEHGUXJLQGXFHG 2WKHUZLVHQRUPDOFRQYHQWLRQDOWUHDWPHQWFRQVLVWVRIVXSSUHVVLQJWKH
SLWXLWDU\UHOHDVHRI/+E\JLYLQJORZGRVHHVWURJHQ%&3V
Female Conditions 165

Suggested Nutritional Supplementation


• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
• EstroFactors²WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVP
• GLA Forte²FDSVXOHVGDLO\
PJJDPPDOLQROHQLFDFLG
• Zinc A.G.²WDEOHWWZLFHGDLO\ZLWKIRRG
Highly absorbable zinc/true amino acid chelate.
3URJHVWHURQH'H¿FLHQF\, LILQGLFDWHGE\ODERUDWRU\DVVHVVPHQW
• Femarone 17 ²*HQWO\UXEWRWHDVSRRQRQFOHDQVNLQ ZULVWVQHFNIDFHWZLFHGDLO\8VHGD\V
DQGVWRSIRUDZHHNDQGUHSHDW$SSOLFDWLRQLVLQWHQGHGIRUH[WHUQDOFRVPHWLFXVH
+LJKHU SRWHQF\ HQULFKHG PRLVWXUL]LQJ FUHPH ZLWK  PJ SURJHVWHURQH SKWRHVWURJHQ FRPSRXQGV DQG
DQWLR[LGDQWYLWDPLQV

Contributing Factors
 ‡+\SRWK\URLGLVP ‡2EHVLW\
 ‡/RZ)LEHU,QWDNH ‡/LYHU'DPDJH'\VIXQFWLRQ
 ‡+LJK)DW&DIIHLQH,QWDNH ‡+LJK6WUHVV
• Impaired Fatty Acid Conversion

Dietary Suggestions
• FirstLine Therapy® Diet
• 5HVWULFWFDIIHLQHDQGDOFRKRO
166 Female Conditions

PMS (Premenstrual Syndrome)


3UHPHQVWUXDO WHQVLRQ KDV EHHQ GHVFULEHG DV D SURJUHVVLYH V\PSWRP FRPSOH[ RFFXUULQJ VHYHQ WR WHQ GD\V
SUHPHQVWUXDOO\WKHUHDIWHULPSURYLQJZLWKPHQVHV&OLQLFDOH[SHULHQFHQRZVKRZVWKDW306PD\HQFRPSDVV
RQHWRGLIIHUHQWV\PSWRPVWKDWRFFXUF\FOLFDOO\LQZRPHQGXULQJWKHLUHVWURJHQDFWLYH\HDUV'U6XVDQ/DUN
GHVFULEHV306WREHRQHRIWKHPRVWFRPPRQSUREOHPVDIÀLFWLQJ\RXQJHUZRPHQ,WLVEHOLHYHGWRDIIHFWEHWZHHQ
RQHWKLUGDQGRQHKDOIRIDOO$PHULFDQZRPHQEHWZHHQWKHDJHVRIDQG²LQRWKHUZRUGV10 to 14 million
women'U3HQQ\%XGRIIVXFFLQFWO\VWDWHV³,WLVFXULRXVWKDWLQWKLVGD\DQGDJHZKHQZHDUHSURELQJRXWHU
VSDFHWKDWZHSHUPLWPRUHWKDQRIRXUSRSXODWLRQRIWKHZRUOGWRVXIIHU´

Suggested Nutritional Supplementation

Mild
• Fem Premenstrual ²WDEOHWVWZLFHGDLO\GD\VSULRUWRPHQVHVRUWDEOHWVGDLO\DOOPRQWKORQJ
3UHPHQVWUXDOVXSSRUWIRUPXOD
• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV

Moderate to Severe Add


• EstroFactors — WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVP
• Chasteberry Plus²WDEOHWWZLFHGDLO\
+HUEDOVXSSRUWIRUIHPDOHKRUPRQDOEDODQFH
$UDQGRPL]HGGRXEOHEOLQGSODFHERFRQWUROOHGVWXG\RIZRPHQUHSRUWHGVLJQL¿FDQWLPSURYHPHQWE\
RIWKHSDUWLFLSDQWVWDNLQJFKDVWHEHUU\British Medical Journal

Contributing Factors
• Hypothyroidism • Diuretic Use
 ‡2EHVLW\ ‡/LYHU'DPDJH'\VIXQFWLRQ
• Impaired Renal Clearance • High Stress
 ‡,PSDLUHG)DWW\$FLG&RQYHUVLRQ ‡+LJK)DW&DIIHLQH,QWDNH
 ‡/RZ)LEHU,QWDNH

Dietary Suggestions
• FirstLine Therapy® Diet
• 5HVWULFW&DIIHLQHDQG$OFRKRO
Female Conditions 167

Polycystic Ovarian Syndrome


3RO\F\VWLFRYDU\V\QGURPH 3&26 PD\EHWKHPRVWFRPPRQHQGRFULQHGLVRUGHULQZRPHQ,WLVHVWLPDWHGWR
EHSUHVHQWLQWRRISUHPHQRSDXVDOZRPHQ'HVSLWHLWVSUHYDOHQFHWKHHWLRORJ\RI3&26KDV\HWWREH
GHWHUPLQHG7KHGLDJQRVLVRI3&26DOVRNQRZQDV6WHLQ/HYHQWKDO6\QGURPHLVFRPSOLFDWHGE\WKHODFNRI
VWDQGDUGGLDJQRVWLFFULWHULDDQGWKHIDFWWKDWYHU\IHZSDWLHQWVSUHVHQWZLWKLGHQWLFDOFOLQLFDOV\PSWRPV
3&26LVDORRVHO\GH¿QHGKHWHURJHQHRXVGLVRUGHU,WLVFKDUDFWHUL]HGE\WKHSUHVHQFHRISRO\F\VWLFRYDULHV
DVVRFLDWHG ZLWK RQH RU PRUH RI WKH IROORZLQJ FRQGLWLRQV KLUVXWLVP REHVLW\ DQRYXODWLRQ LQIHUWLOLW\ PHQVWUXDO
GLVRUGHUVK\SHULQVXOLQHPLDLQVXOLQUHVLVWDQFHDQGKRUPRQDOLPEDODQFHV,QFOXGHGLQWKHGLIIHUHQWLDOGLDJQRVLV
RI3&26LV&XVKLQJ¶VV\QGURPHK\SHUSURODFWLQHPLDFRQJHQLWDODGUHQDOK\SHUSODVLDLGLRSDWKLFKLUVXWLVPDQG
DQGURJHQVHFUHWLQJWXPRUV
,QDGGLWLRQWRWKHGLVWUHVVLQJV\PSWRPVRI3&26SDWLHQWVZLWKWKLVV\QGURPHDUHDWLQFUHDVHGULVNIRUDYDULHW\RI
VHULRXVPHGLFDOFRPSOLFDWLRQV7KHVHLQFOXGHQRQLQVXOLQGHSHQGHQWGLDEHWHVPHOOLWXV 1,''0 K\SHUOLSLGHPLD
hypertension, cardiovascular disease, endometrial cancer, ovarian cancer, and possibly breast cancer. As a
UHVXOWWKHSURSHUGLDJQRVLVDQGWUHDWPHQWRIWKLVV\QGURPHLVYLWDOO\LPSRUWDQW

Diagnostic Criteria
7KHSUHVHQFHRISRO\F\VWLFRYDULHVLVDSULPDU\GLDJQRVWLFFULWHULRQRI3&263RO\F\VWLFRYDULHVDUHGHWHFWHGE\
WUDQVYDJLQDOXOWUDVRXQG7KH\DSSHDUDVLQFUHDVHGRYDULDQFHQWUDOVWURPDZLWKWKHSUHVHQFHRIHLJKWRUPRUH
SHULSKHUDOIROOLFXODUF\VWVPPRUOHVVLQGLDPHWHU,WLVLPSRUWDQWWRUHPHPEHUKRZHYHUWKDWSRO\F\VWLFRYDULHV
PD\EHSUHVHQWLQZRPHQZLWKRXW3&26RUPD\EHLQGLFDWLYHRIV\QGURPHVRWKHUWKDQ3&26

Role of Insulin Resistance


,QVXOLQUHVLVWDQFHDFRQGLWLRQFKDUDFWHUL]HGE\GHFUHDVHGWLVVXHVHQVLWLYLW\WRLQVXOLQLVDNH\FRPSRQHQWRIWKH
FOLQLFDOSLFWXUHRI3&26,QVXOLQUHVLVWDQFHOHDGVWRLQFUHDVHGLQVXOLQSURGXFWLRQ K\SHULQVXOLQHPLD SURJUHVVLYH
SDQFUHDWLFEHWDFHOOGH¿FLHQF\DQGLPSDLUHGJOXFRVHWROHUDQFHHYHQWXDOO\OHDGLQJWRWKHGHYHORSPHQWRI1,''0
2EHVLW\LVKLJKO\FRUUHODWHGZLWKLQVXOLQUHVLVWDQFHDQGDSSUR[LPDWHO\RIZRPHQZLWK3&26KDYHFHQWUDO
REHVLW\,QDGGLWLRQWRREHVLW\JHQHWLFSUHGLVSRVLWLRQSUHJQDQF\GUXJV VXFKDVFRUWLFRVWHURLGV DQGOLIHVW\OH
IDFWRUV VXFKDVVPRNLQJ FRQWULEXWHWRLQVXOLQUHVLVWDQFH
$VLWUHODWHVWR3&26DJURZLQJERG\RIHYLGHQFHSRLQWVWRLQVXOLQUHVLVWDQFHDVDFDXVHRIWKHKRUPRQDOGLVWXUEDQFHV
VHHQLQWKHK\SRWKDODPLFSLWXLWDU\RYDULDQD[LVLQSDWLHQWVZLWK3&267\SLFDOO\WKHKRUPRQDOSUR¿OHLQ3&26
VKRZVLQFUHDVHGJRQDGRWURSLQUHOHDVLQJKRUPRQH *Q5K LQFUHDVHGOXWHLQL]LQJKRUPRQH /+ SXOVHIUHTXHQF\
LQFUHDVHG/+QRUPDOIROOLFXODUVWLPXODWLQJKRUPRQH )6+  UHVXOWLQJLQLQFUHDVHG/+)6+UDWLR HOHYDWHGWHVWRVWHURQH
DQGHOHYDWHGLQVXOLQ$GGLWLRQDOO\DERXWRIZRPHQKDYHHOHYDWHG'+($6OHYHOVDQGDSSUR[LPDWHO\RI
3&26SDWLHQWVKDYHHOHYDWHGSURODFWLQOHYHOV

Other Lifestyle Factors in PCOS


:HLJKWPDQDJHPHQWDQGH[HUFLVHVKRXOGEHWRSSULRULWLHVLQD3&26WUHDWPHQWSODQ1XPHURXVVWXGLHVVXSSRUW
WKHXVHRIZHLJKWORVVDQGDHURELFH[HUFLVHDVHIIHFWLYHPHDQVRIORZHULQJLQVXOLQUHVLVWDQFH
:RPHQZLWK3&26VKRXOGDYRLGH[FHVVLYHLQWDNHRIFDIIHLQH2QHVWXG\VKRZHGWKDWGULQNLQJFRIIHHLQFUHDVHV
EORRGVXJDUOHYHOVVLJQL¿FDQWO\DVFRPSDUHGWRSODFHER7KHJUHDWHVWLQFUHDVHLQJOXFRVHOHYHOVRFFXUUHG
KRXUVDIWHUFRIIHHLQJHVWLRQ7KHPHFKDQLVPRIWKHK\SHUJO\FHPLFHIIHFWLVSRVWXODWHGWREHGXHWRFDIIHLQH
LQGXFHGFDWHFKRODPLQHUHOHDVH&LJDUHWWHVPRNLQJVKRXOGDOVREHDYRLGHGLQZRPHQZLWK3&26DVLWKDVEHHQ
VKRZQWRZRUVHQLQVXOLQUHVLVWDQFHLQSDWLHQWVZLWK1,''0

Suggested Nutritional Supplementation


• UltraMeal Plus 360 ±VFRRSVWZLFHGDLO\
1XWULWLRQDOVXSSRUWIRUWKHPDQDJHPHQWRIFRQGLWLRQVDVVRFLDWHGZLWKPHWDEROLFV\QGURPHDQGFDUGLRYDVFXODU
disease (CVD).
• High Concentrate EPA-DHA Liquid±WVSWZLFHGDLO\
High Concentrate EPA-DHA LiquidSURYLGHVDWOHDVWPJSHUVHUYLQJRI(3$'+$DQGRWKHUSXULW\
FHUWL¿HGRPHJDHVVHQWLDOIDWW\DFLGVLQWULJO\FHULGHIRUP
168 Female Conditions

• Cenitol±VFRRSWZLFHGDLO\
&HQLWROVXSSRUWVDKHDOWK\PRRGDQGRYHUDOOQHUYRXVV\VWHPIXQFWLRQE\IHDWXULQJLQRVLWRO²DQLPSRUWDQW
QDWXUDOO\RFFXUULQJFRPSRQHQWRIFHOOPHPEUDQHV&HQLWRODOVRVXSSOLHVPDJQHVLXPLQWKHIRUPRIDIXOO\
UHDFWHGDPLQRDFLGFKHODWHGHVLJQHGIRUHQKDQFHGQHUYRXVV\VWHPVXSSRUW
%DVHGRQSUHYLRXVVWXGLHVVFLHQWLVWVGLVFRYHUHGDGH¿FLHQF\RILQRVLWRODQXWULHQWUHODWHGWRLQVXOLQDFWLYLW\
LQSDWLHQWVZLWKGLDEHWHVLPSDLUHGJOXFRVHWROHUDQFHRULQVXOLQUHVLVWDQFH:LWKWKLVNQRZOHGJHVFLHQWLVWV
LQLWLDWHGDGRXEOHEOLQGSODFHERFRQWUROOHGFOLQLFDOWULDOWRHYDOXDWHWKHHIIHFWRILQRVLWRORQREHVHZRPHQ
ZLWK3&26%\WKHHQGRIWKHVWXG\WKHWUHDWPHQWJURXSKDGVLJQL¿FDQWLPSURYHPHQWVLQLQVXOLQDFWLRQ
DQG JOXFRVH WROHUDQFH &RQVHTXHQWO\ RYXODWRU\ IXQFWLRQ LPSURYHG DQG GHFUHDVHV RFFXUUHG LQ SODVPD
WULJO\FHULGHVVHUXPDQGURJHQVDQGEORRGSUHVVXUH,QWKHSODFHERWKHVHYDULDEOHVZHUHQRWVLJQL¿FDQWO\
altered.
• Estrium – 1 scoop daily
(VWULXP LV D ORZDOOHUJ\SRWHQWLDO SRZGHUHG PHGLFDO IRRG WKDW SURYLGHV D FRPELQDWLRQ RI PDFUR DQG
PLFURQXWULHQWVVSHFLDOO\VHOHFWHGIRUWKHLUDELOLW\WRSURPRWHRSWLPDOKRUPRQHEDODQFH
or
• EstroFactors — 3 tablets daily.
(VWUR)DFWRUVSURPRWHVKHDOWK\KRUPRQHEDODQFHLQZRPHQRIDOODJHVE\IHDWXULQJWDUJHWHGQXWULHQWVWKDW
VXSSRUWKHDOWK\HVWURJHQPHWDEROLVPDQGGHWR[L¿FDWLRQ
Suggested Mixing Instructions
• 2 scoop UltraMeal Plus 360
• 1 tsp. High Concentrate EPA-DHA Liquid
• 1 scoop Cenitol
• 1/2 scoop Estrium
%OHQGVKDNHRUEULVNO\VWLULQWRHLJKWRXQFHVRIFKLOOHGMXLFHVR\DOPRQGULFHRURUJDQLFFRZ¶VPLONRU
ZDWHU

Additional Nutritional Support Considerations


3URJHVWHURQH'H¿FLHQF\ LILQGLFDWHGE\ODERUDWRU\DVVHVVPHQW
• Femarone 17 ²*HQWO\UXEWRWHDVSRRQRQFOHDQVNLQ HJZULVWVQHFNIDFHHWF WZLFHGDLO\8VH
GD\VDQGVWRSIRUDZHHNDQGUHSHDW$SSOLFDWLRQLVLQWHQGHGIRUH[WHUQDOFRVPHWLFXVH
1DWXUDO3URJHVWHURQHDQG3K\WRHVWURJHQ7RSLFDO&UHDP

Dietary Suggestions
• FirstLine Therapy® Diet
Female Conditions 169

Pregnancy
Achieving a Healthy Pregnancy (adapted from the seminar "Achieving a Whole Pregnancy: Bringing
Holism into Birth" by Joel M. Evans, M.D.
%HFDXVHSUHJQDQF\LVSK\VLFDOO\GHPDQGLQJLW
VXVHIXOWRWKLQNDERXWUHDVRQDEOHFKDQJHVWRGLHWDQGOLIHVW\OHWKDW
\RXPLJKWPDNHLQRUGHUWRLPSURYH\RXUJHQHUDOKHDOWKDQGZHOOEHLQJDQGSUHSDUHWKHZD\IRUSUHJQDQF\
1. Reducing your chemical load: :KHQ\RXHDWIRRGVWKDWKDYHDORWRIDGGLWLYHVDQGSUHVHUYDWLYHV\RXFRQVXPH
FKHPLFDOVWKDWDUHPRUHGLI¿FXOWIRUWKHERG\WREUHDNGRZQ
,I\RXZDQWWREHJLQ\RXUSUHJQDQF\ZLWK\RXUERG\IXQFWLRQLQJDVZHOODVLWFDQLW
VEHWWHUWRHDWIRRGVZLWKIHZHU
FKHPLFDOV2YHUDOOWKDWPHDQVHDWLQJZKROHJUDLQVDQG¿YHWRVHYHQGDLO\VHUYLQJVRI SUHIHUDEO\RUJDQLF IUXLWV
DQGYHJHWDEOHVDQGDYRLGLQJIRRGVZLWKDUWL¿FLDOVZHHWHQHUVDVZHOODVSDFNDJHGIRRGV OLNHVQDFNIRRGV ZLWK
DORQJVKHOIOLIHAnd, if possible, detox before pregnancy!
2. Preparing for pregnancy: 2QFH\RXEHFRPHSUHJQDQW\RXQHHGPRUHYLWDPLQVDQGPLQHUDOVOLNHFDOFLXP
LURQ]LQFIROLFDFLGFKROLQHDQGWKHRPHJDIDWW\DFLGV (3$'+$ 
+RZ LPSRUWDQW LV GHWR[L¿FDWLRQUHGXFLQJ \RXU FKHPLFDO ORDG DQG LQFUHDVLQJ \RXU YLWDPLQV PLQHUDOV DQG IDWW\
acids?
• 2IWKHFKHPLFDOVGHWHFWHGLQXPELOLFDOFRUGEORRGFDXVHFDQFHULQKXPDQVRUDQLPDOVDUHWR[LF
WRWKHEUDLQDQGQHUYRXVV\VWHPDQGFDXVHELUWKGHIHFWVRUDEQRUPDOGHYHORSPHQWLQDQLPDOWHVWV1
• )HWXVHVRIZRPHQZKRDWHDQLPSUXGHQWGLHW LQFOXGLQJKLJKLQWDNHVRIFKLSVFULVSVVXJDUFRQIHFWLRQDU\
ZKLWHEUHDGVRIWGULQNVDQGUHGPHDWDQGORZLQWDNHVRIIUXLWYHJHWDEOHVULFHSDVWD\RJXUWDQGZKROHPHDO
EUHDG KDGUHGXFHGGXFWXVYHQRVXVVKXQWLQJDQGLQFUHDVHGOLYHUEORRGÀRZZKLFKKDYHORQJHUWHUPGHWULPHQWDO
FRQVHTXHQFHVIRUOLSLGDQGFORWWLQJIDFWRUKRPHRVWDVLV2
• Recent research has established that acute lymphoblastic leukemia (ALL), the most common childhood
FDQFHUDQGWKHVHFRQGPRVWFRPPRQFDXVHRIPRUWDOLW\LQFKLOGUHQDJHG\HDUVFDQRULJLQDWHLQXWHUR
DQGWKXVPDWHUQDOGLHWPD\EHDQLPSRUWDQWULVNIDFWRUIRU$//3

Omega-3 Fatty Acids


1XWULWLRQDOUROHVRIRPHJDIDWW\DFLGVGXULQJSUHJQDQF\DQGQHRQDWDOGHYHORSPHQWUHSRUWHGSRVLWLYHHIIHFWVRI
omega 3's in pregnancy:
• promote brain and eye development
• HQFRXUDJHIHWDOZHLJKWJDLQ
• reduce preterm labor, preeclampsia, gestational diabetes
• LQFUHDVHWKHQXWULWLRQDOYDOXHRIEUHDVWPLON
• impact the immune system to decrease childhood atopy, allergy and asthma
• stabilize mood and prevent depression

Choline
$YLWDPLQWKDWLVDSUHFXUVRUIRUDFHW\OFKROLQHSKRVSKROLSLGVDQGEHWDLQHRequired IRUWKHVWUXFWXUDOLQWHJULW\RI
cell membranes, cholinergic neurotransmission, lipid and cholesterol metabolism, and transmembrane signaling.
5DWVWXGLHVVKRZVLJQL¿FDQWLPSURYHPHQWVLQPHPRU\DQGEUDLQGHYHORSPHQW'LHWDU\LQWDNHVRIFKROLQHZHUH
DVVRFLDWHGZLWKUHGXFHGQHXUDOWXEHGHIHFW 17' ULVNV17'ULVNHVWLPDWHVZHUHORZHVWIRUZRPHQZKRVHGLHWV
ZHUHULFKLQFKROLQHIROLFDFLGEHWDLQHDQGPHWKLRQLQH3UHJQDQF\DQGODFWDWLRQDUHSHULRGVZKHQPDWHUQDO
UHVHUYHVRIFKROLQHDUHGHSOHWHG$WWKHVDPHWLPHWKHDYDLODELOLW\RIFKROLQHIRUQRUPDOGHYHORSPHQWRIEUDLQLV
FULWLFDO7KXVPHPRU\IXFWLRQLQWKHDJHGLVLQSDUWGHWHUPLQHGE\ZKDWPRWKHUDWH

Folic Acid
)ROLFDFLGDOVRNQRZQDVIRODWHLVDQXWULHQWLQWKH%FRPSOH[YLWDPLQJURXS WKHUHDUHHLJKW%YLWDPLQVDOWRJHWKHU 
,W
VEHHQVKRZQWRUHGXFHWKHUDWHRIIHWDODEQRUPDOLWLHVSDUWLFXODUO\GHIHFWVWRWKHEUDLQDQGVSLQDOFRUGVXFKDV
VSLQDEL¿GD DQRSHQLQJLQWKHVSLQH E\WRSHUFHQW,WDOVRUHGXFHVWKHUHFXUUHQFHUDWHRIWKHVHGHIHFWV
LQVXEVHTXHQWFKLOGUHQE\DVPXFKDVSHUFHQW,QDGGLWLRQDQLPDOVWXGLHVKDYHVKRZQWKDWSUHQDWDOIROLFDFLG
UHGXFHVWKHLQFLGHQFHRIFKLOGKRRGFDQFHUV)ROLFDFLGDOVRRIIHUVLPSRUWDQWKHDOWKEHQH¿WVWRDGXOWVORZHULQJ
WKHULVNRIKHDUWGLVHDVHFHUWDLQFDQFHUVGHSUHVVLRQDQGDEQRUPDO3DSVPHDUV
%HFDXVHWKHVSLQDOFROXPQDQGEUDLQEHJLQWRGHYHORSDOPRVWLPPHGLDWHO\DIWHUFRQFHSWLRQLW
VLGHDOWRKDYH
EHHQWDNLQJIROLFDFLGZKLOHWU\LQJWRFRQFHLYH²QRPDWWHUKRZORQJLWWDNHV+RZHYHULI\RXKDYHQ
WEHHQWDNLQJ
SUHQDWDOYLWDPLQVZKLOHWU\LQJWRFRQFHLYHLQFUHDVLQJ\RXUIROLFDFLGULJKWDIWHU\RXOHDUQ\RX
UHSUHJQDQWLVVWLOOD
JRRGLGHDIRU\RXDQG\RXUGHYHORSLQJFKLOG
170 Female Conditions

Calcium
$V\RXSUREDEO\NQRZ\RXDQG\RXUEDE\ERWKQHHGFDOFLXPIRUVWURQJWHHWKDQGERQHV%XWFDOFLXPGRHVPRUH
than build healthy bones—among other things, it helps the body maintain regular circulation, muscle action, and
QHUYHIXQFWLRQ6LQFHWKHEDE\ZLOOWDNHWKHFDOFLXPKHQHHGVIURP\RXQRPDWWHUZKDW\RXQHHGWRUHSOHQLVK
\RXURZQVWRUHVRIWKHQXWULHQW

Why Choose Wellness Essentials™ for Pregnancy?


:HOOQHVV(VVHQWLDOVŒIRU3UHJQDQF\LVFDUHIXOO\IRUPXODWHGWRFRPSUHKHQVLYHO\VXSSRUWNH\RUJDQV\VWHPVLQ
both mother and child—all in a once-daily program!

Featured Ingredients:
• Omega-3 fatty acids ² *XDUDQWHHV RSWLPDO GDLO\ LQWDNH RI (3$ DQG '+$ WR HQKDQFH IHWDO JURZWK DQG
development, support a smooth pregnancy, and help relieve postpartum negative mood.
• Folate ² 'HOLYHUV  PJ RI ERG\UHDG\ IRODWH WR VXSSRUW KHDOWK\ KRUPRQH PHWDEROLVP '1$ V\QWKHVLV
cardiovascular health, and neurological development.
• Choline ²)HDWXUHVHQKDQFHGOHYHOVRIFKROLQHWRVXSSRUWKHDOWK\GLJHVWLRQ SDUWLFXODUO\RIIDWV QHXURORJLFDO
KHDOWKDQGIHWDOEUDLQGHYHORSPHQW
• Calcium and magnesium — Supplies calcium and magnesium to help relieve muscle tension, promote a
VHQVHRIFDOPDQGVXSSRUWDVPRRWKSUHJQDQF\
• Antioxidants ²3URYLGHVDQXWULWLRXVEOHQGRIYLWDPLQ&PL[HGFDURWHQRLGV]LQFDQGVHOHQLXPWRVXSSRUW
RSWLPDOLPPXQHV\VWHPIXQFWLRQDQGKHOSPDLQWDLQUHSURGXFWLYHKHDOWK

For additional information on achieving a healthy pregnancy consider:


7KH:KROH3UHJQDQF\+DQGERRNE\-RHO0(YDQV0'2E*\Q

Suggested Nutritional Supplementation


• Wellness Essentials™ for Pregnancy ²SDFNHWGDLO\GXULQJVWDQGQGWULPHVWHUWKHQWZRSDFNHWV
daily during 3rd trimester and continuing through nursing
'DLO\(VVHQWLDOVIRU%HIRUH'XULQJ $IWHU3UHJQDQF\
When Should a Woman Begin Taking Wellness Essentials™ for Pregnancy?
$ZRPDQVKRXOGEHJLQWDNLQJ:HOOQHVV(VVHQWLDOVIRU3UHJQDQF\WKHPRPHQWVKHVWDUWVSODQQLQJWRKDYH
DFKLOGUDWKHUWKDQZDLWLQJXQWLODIWHUDSRVLWLYHSUHJQDQF\WHVW5HVHDUFKVKRZVWKDWIHWDOEUDLQDQGVSLQDO
FRUGGHYHORSPHQWEHJLQVLQWKHHDUOLHVWVWDJHVRISUHJQDQF\²DWLPHZKHQDZRPDQPD\QRWHYHQUHDOL]H
VKHLVSUHJQDQW±LQGLFDWLQJWKHQHHGWRHVWDEOLVKKHDOWK\OHYHOVRIVXSSRUWLYHQXWULHQWVHDUO\RQ7KLVLV
HVSHFLDOO\WUXHZKHQLWFRPHVWRSURSHUOHYHOVRIRPHJDIDWW\DFLGVIRODWHFKROLQHFDOFLXPPDJQHVLXP
DQGDQWLR[LGDQWV²HVVHQWLDOQXWULHQWVIRXQGLQWellness Essentials™ for Pregnancy.
• Probiotic Supplementation
• 3rd Trimester — UltraFlora Plus® DF Capsules — FDSVXOHWZLFHGDLO\
• Birth to 6 months — BifoViden ID™ — FDSVXOHWZLFHGDLO\
• 6 months to 1 year — UltraFlora Plus® DF Capsules — 1 capsule daily

References:
1. JAMA, July 20, 2005—Vol 294, No. 3
2. +DXJHQHWDO&LUF5HV-DQ
3. -HQVHQHWDO&DQFHU&DXVHV&RQWURO$XJ  
4. $QWHQDWDOGHWHUPLQDQWVRIQHRQDWDOLPPXQHUHVSRQVHVWRDOOHUJHQV
'HYHUHX[HWDO&OLQ([S$OOHUJ\-DQ  
5. )LVK2LO6XSSOHPHQWDWLRQLQ3UHJQDQF\0RGL¿HV1HRQDWDO3URJHQLWRUVDW%LUWKLQ,QIDQWVDW5LVNRI$WRS\
3HGLDWULF5HVHDUFK9RO1R)HE
6. )LVK2LO,QFUHDVHV,QVXOLQ6HQVLWLYLW\
3RSS6QLMGHUVHWDO'LDEHWHV5HV
7. (QJVWUgPHWDO3URVWDJODQGLQV/HXNRW(VVHQW)DWW\$FLGV
8. )LVK2LO6XSSOHPHQWDWLRQDIWHUZHHNV
±ORZHUVWKHULVNRISUHPDWXUHELUWKE\WR
±LQFUHDVHVWKHOHQJWKRISUHJQDQF\E\GD\V
±UHVXOWVLQEDELHVZLWKDJKLJKHUELUWKZHLJKW
6DOGHHQHWDO2EVWHW*\QHFRO6XUY2FW  
9. >3RVWHU  $PHULFDQ 7KRUDFLF 6RFLHW\ @ 0DWHUQDO )LVK &RQVXPSWLRQ GXULQJ 3UHJQDQF\ DQG 5LVN RI &KLOGKRRG$VWKPD
076DODPHWDO3UHYHQWLYH0HGLFLQH8QLYHUVLW\RI6RXWKHUQ&DOLIRUQLD/RV$QJHOHV&$
10. %RWKORZHU'+$FRQWHQWLQEUHDVWPLONDQGORZHUVHDIRRGFRQVXPSWLRQZHUHDVVRFLDWHGZLWKKLJKHUUDWHVRISRVWSDUWXPGHSUHVVLRQ
Female Conditions 171

+LEEHOQ-$IIHFW'LVRUG
11. ,QÀXHQFHRIWUDQVIDWW\DFLGVRQLQIDQWDQGIHWXVGHYHORSPHQW
0RMVND+$FWD0LFURELRO3RO6XSSO
12. 7KHHIIHFWRIVXSSOHPHQWDWLRQZLWK¿VKRLOGXULQJSUHJQDQF\RQEUHDVWPLONLPPXQRJOREXOLQ$VROXEOH&'F\WRNLQHOHYHOVDQGIDWW\
acid composition
'XQVWDQHWDO&OLQ([S$OOHUJ\$XJ  
13. &KDQJHVLQEUDLQFRQFHQWUDWLRQVRI'+$DUHSRVLWLYHO\DVVRFLDWHGZLWKFKDQJHVLQFRJQLWLYHRUEHKDYLRUDOSHUIRUPDQFH
$P-&OLQ1XWU$XJ
14. $P-(SLGHPLRO-XO  
15. =HLVHO6+$P&ROO1XWU2FW 6XSSO 66
16. 3HULFRQFHSWLRQDO'LHWDU\,QWDNHRI&KROLQHDQG%HWDLQHDQG1HXUDO7XEH'HIHFWVLQ2IIVSULQJ
$P-(SLGHPLRO-XO  
17. -$P&ROO1XWU'HF 6XSSO 66
172 Female Conditions

Morning Sickness/Nausea
Symptoms
0RUQLQJVLFNQHVVLVSUREDEO\RQHRIWKHPRVWXQFRPIRUWDEOHDVSHFWVRISUHJQDQF\6RPHZRPHQPD\HYHQ
IHDUWKDWQDXVHDDQGYRPLWLQJLVDVXEFRQVFLRXVUHMHFWLRQRIWKHEDE\%XWH[SHULHQFLQJQDXVHDDQGYRPLWLQJLV
DFWXDOO\DJRRGVLJQ²DQLQGLFDWLRQRIDKHDOWK\SUHJQDQF\$VDSUHJQDQWZRPDQNQRZLQJWKDWPD\DOORZ\RX
WRUHOD[DQGHQMR\\RXUSUHJQDQF\DQGXQGHUVWDQGLQJWKHFDXVHVFDQKHOSWRUHOLHYHDQ[LHW\
0RUQLQJVLFNQHVVFRPPRQO\RFFXUVGXULQJWKH¿UVWWULPHVWHURISUHJQDQF\LQDSSUR[LPDWHO\SHUFHQWRIH[SHFWDQW
ZRPHQHVSHFLDOO\WKRVHSUHJQDQWIRUWKH¿UVWWLPH6RPHZRPHQVXIIHUIURPQDXVHDWKURXJKRXWWKHQLQHPRQWKV
RISUHJQDQF\EXWLQPRVWFDVHVLWGLVDSSHDUVDIWHUWKUHHPRQWKVRUVR,WFDQRFFXUDWDQ\WLPHGXULQJWKHGD\
EXWLVPRVWIUHTXHQWO\IHOWLQWKHPRUQLQJDQGODWHDIWHUQRRQZKHQWKHVWRPDFKLVHPSW\6\PSWRPVUDQJHIURP
D VOLJKW IHHOLQJ RI QDXVHD XSRQ ZDNLQJ WR SHUVLVWHQW DQG IUHTXHQW ³SHUQLFLRXV´ YRPLWLQJ 7KH H[DFW FDXVH RI
QDXVHDDQGYRPLWLQJGXULQJSUHJQDQF\LVXQFOHDU²VRPHH[SHUWVEHOLHYHWKDWLWPD\EHGXHWRDYLWDPLQ%
S\ULGR[LQH RU]LQFGH¿FLHQF\1HZUHVHDUFKVKRZVWKDWQDXVHDPD\EHDWWULEXWHGWRORZEORRGVXJDUDQGWKH
H[FHVVSURWHLQUHTXLUHPHQWVRIWKHGHYHORSLQJIHWXV,QFUHDVHGKRUPRQHSURGXFWLRQGXULQJSUHJQDQF\FDQDOVR
cause nausea.
127(,QIHFWLRQZLWK+HOLFREDFWHUS\ORULWKHEDFWHULDWKDWFDXVHVVWRPDFKXOFHUVPD\DOVRFDXVHDVHYHUHIRUP
RIPRUQLQJVLFNQHVVLQSUHJQDQWZRPHQ5HVHDUFKHUVDWWKH8QLYHUVLW\RI9LHQQDLQ$XVWULDIRXQGWKDWRYHU
RI SUHJQDQW ZRPHQ ZLWK K\SHUHPHVLV JUDYLGDUXP²VHYHUH QDXVHD DQG YRPLWLQJ RIWHQOHDGLQJ WRZHLJKW ORVV
DQGHOHFWURO\WHGLVWXUEDQFHVZHUHLQIHFWHGZLWK+S\ORUL7KHUHVHDUFKHUVK\SRWKHVL]HWKDWLQWKHHDUO\SKDVH
RISUHJQDQF\FKDQJHVLQDZRPDQ¶VERG\ÀXLGFRQFHQWUDWLRQDIIHFWWKHDFLGLW\ S+ RIWKHVWRPDFKZKLFKPD\
LQWXUQDFWLYDWHODWHQW+S\ORULUHVLGLQJLQWKHVWRPDFK ,I\RXVXVSHFW+HOLFREDFWHUS\ORULVHHSURWRFROXQGHU
³8OFHU´VHFWLRQRIWKLVJXLGH

Indications
1DXVHDVLFNO\IHHOLQJ HJZKHQGULYLQJRUÀ\LQJ VHDVLFNQHVVQDXVHDLQSUHJQDQF\ VRRWKLQJHIIHFW 1DXVHDDVWKH
HIIHFWRIRWKHUGLVRUGHUVZHDNQHVVRIFRQGXFWLRQJDVWULFFDWDUUKSKDVHVRILPSUHJQDWLRQQDXVHDRIFKLOGUHQ DWURSK\
DQGG\VWURSK\ $FDHWRQHPLFYRPLWLQJRIVXFNOLQJVDQGFKLOGUHQ9RPLWLQJRQULVLQJDQGJDVWULFFDWDUUKRIKHDY\GULQNHUV
&ROGSHUVSLUDWLRQDQGQDXVHDHVSHFLDOO\LQZHDNQHVVRIWKHFRQGXFWLRQDQGSULRUWRELOLDU\FROLF&RPSOHPHQWDU\UHPHG\
LQUHQDOFROLFZLWKQDXVHDDQGYRPLWLQJ

Suggested Nutritional Supplementation


In addition to a good prenatal multivitamin/mineral supplement, such as Wellness Essentials™ for Pregnancy
or Fem-PrenatalLQFOXGHWKHIROORZLQJ
• Pyridoxal-5’ Phosphate &R(Q]\PH% ²WDEOHWVWKUHHWLPHVGDLO\ZLWKIRRG
7KHDFWLYHIRUPRI%
• Mag Glycinate²WDEOHWVWKUHHWLPHVGDLO\ZLWKIRRG
Highly absorbable magnesium.
NOTE:$QH[FHOOHQWKRPHRSDWKLF³5HVFXH5HPHG\´WREHXVHGDVQHHGHG
• D-52 Maldemar KRPHRSDWKLFIRUPXODIRUYRPLWLQJDQGQDXVHD ²'RVDJHGURSVXQGHUWKHWRQJXH
IRXUWLPHVGDLO\¿UVWDLGGRVDJHHYHU\PLQXWHVDFXWHGRVDJHPLQXWHVWRKRXUO\GHFUHDVLQJWR
WLPHVGDLO\FKURQLFGRVDJHWLPHVGDLO\

Diet
FirstLine Thearpy® Diet
• (DWVPDOOPHDOVRIWHQ+DYHIUHTXHQWVPDOOPHDOVZLWKFRPSOH[FDUERK\GUDWHVOLNHEUHDGULFHSDVWD LI\RX
FDQHDWZKROHJUDLQYHUVLRQV (DWVORZO\DQGFKHZ\RXUIRRGFRPSOHWHO\
• .HHSVQDFNVKDQG\.HHSFUDFNHUVE\\RXUEHGVLGHVRLI\RXZDNHXSYHU\KXQJU\RUQDXVHDWHGWKHUH
V
VRPHWKLQJULJKWWKHUHWRVHWWOH\RXUVWRPDFK /RRNIRUZKROHJUDLQFUDFNHUVWKDWGRQ
WKDYHVDWXUDWHGIDWVRU
K\GURJHQDWHGRLOV .HHSVQDFNVOLNHSUHW]HOVRUDOPRQGVLQRXUEDJRUGHVNVR\RXKDYHVRPHWKLQJWRQLEEOH
RQLI\RX
UHVWXFNLQWUDI¿FRUWLHGWR\RXURI¿FH<RXGRQ
WZDQWWRKDYHDQHPSW\VWRPDFK
• $YRLGVWURQJVPHOOVDQGVWURQJIRRGV6SLF\IULHGDQGIDWW\IRRGVDUHGLI¿FXOWWRGLJHVWVRDYRLGWKHP$OVR
VWURQJVPHOOVFDQWULJJHUERWKQDXVHDDQGYRPLWLQJ,IVPHOOVERWKHU\RXWU\WRSUHSDUHVLPSOHPHDOVRUDVN
\RXUSDUWQHURUDIULHQGWRSUHSDUHWKHPIRU\RX
• 6LSOLTXLG:DWHUJLQJHUWHDSHSSHUPLQWWHDUHGUDVSEHUU\OHDIWHDOHPRQDGHFOHDUVRXSHYHQFRODRUD
VSRUWVGULQNOLNH*DWRUDGH,I\RX
UHYRPLWLQJLW
VLPSRUWDQWWRPDNHVXUH\RXDUHJHWWLQJHQRXJKÀXLGV
Female Conditions 173

• (DWZKDW\RXFDQ7KHEDE\ZLOOJHWWKHQXWULHQWVVKHQHHGVVRHDWZKDWDSSHDOVWR\RX,IWKDWPHDQV\RX
DUHOLYLQJRQEDJHOVDQGFXFXPEHUVIRUDFRXSOHRIZHHNVVREHLW
• 7DNHSUHQDWDOYLWDPLQVVWUDWHJLFDOO\,I\RXUSUHQDWDOYLWDPLQWULJJHUVQDXVHDWDNHLWZLWK\RXUELJJHVWPHDO
RIWKHGD\HYHU\RWKHUGD\RUEHIRUH\RXJRWREHGVR\RXVOHHSWKURXJKWKHQDXVHD
• 9LWDPLQ%ULFKIRRGV6RPHZRPHQ¿QG%YLWDPLQVKHOSUHOLHYHQDXVHDWKH\
UHLQZKROHJUDLQVDYRFDGRV
FRUQQXWVOLYHU¿VKDQGFKLFNHQ
174 Female Conditions

Uterine Fibroids
0\RPHWULDOJURZWKVRIWKHXWHUXV$OVRWHUPHG³¿EURP\RPD´RU³OHLRP\RPD´7KHVHRFFXULQRIZRPHQRYHU
DJHDQGDUHRIWHQDV\PSWRPDWLFGLVFRYHU\EHLQJPDGHGXULQJWKHSHOYLFH[DP7KH\PD\KRZHYHUFDXVH
H[FHVVPHQVWUXDOEOHHGLQJDQGRUSHOYLFSDLQRUEORDWLQJ7KHLUJURZWKLVLQFUHDVHGGXULQJSUHJQDQF\DQGZLWK
HVWURJHQWKHUDS\DQGWKH\WHQGWRDWURSK\DIWHUPHQRSDXVH7KH\PD\HLWKHUJURZLQWRWKHOXPHQLQWRWKHSHOYLF
FDYLW\RUUHPDLQLQWKHZDOORIWKHXWHUXV
2WKHUZLVHNQRZQDVP\RPDRIWKHXWHUXV¿EURLGVDUHWKHPRVWFRPPRQQHRSODVPRIWKHIHPDOHJHQLWDOWUDFW7KH\
DUHGLVFUHWHURXQG¿UPEHQLJQOXPSVRIWKHPXVFXODUZDOORIWKHXWHUXVFRPSRVHGRIVPRRWKPXVFOHDQGFRQQHFWLYH
WLVVXHDQGDUHUDUHO\VROLWDU\8VXDOO\DVVPDOODVDQHJJWKH\JURZJUDGXDOO\WRRUDQJHRUJUDSHIUXLWVL]HFRPPRQO\
7KHODUJHVW¿EURLGRQUHFRUGZHLJKHGRYHUDKXQGUHGSRXQGV7KH\RIWHQFDXVHRUDUHFRLQFLGHQWDOZLWKKHDYLHU
SHULRGV K\SHUPHQRUUKHD LUUHJXODUEOHHGLQJ PHWURUUKDJLD DQGRUSDLQIXOSHULRGV G\VPHQRUUKHD 'XHWRWKHLUPDVV
WKH\PD\FDXVHDF\VWRFHOH GURSSHGXWHUXV ODWHULQOLIHZKHQSHOYLFÀRRUVXSSRUWVZHDNHQOHDGLQJWRVWUHVVXULQDU\
LQFRQWLQHQFH$IWHUPHQRSDXVHWKH\URXWLQHO\DWURSK\
&RQWHPSRUDU\PHGLFDOWUHDWPHQWXVXDOO\LVVXUJLFDO6RPHSDUWLFXODUO\VNLOOIXOVXUJHRQVDUHDGHSWDWH[FLVLQJRQO\WKH
P\RPDOHDYLQJWKHXWHUXVLQWDFW*HQHUDOO\KRZHYHUK\VWHUHFWRP\LVSHUIRUPHG+HUHDJDLQQDWXUDOSURJHVWHURQHRIIHUV
DEHWWHUDOWHUQDWLYH)LEURLGWXPRUVOLNHEUHDVW¿EURF\VWVDUHDSURGXFWRIHVWURJHQGRPLQDQFH(VWURJHQVWLPXODWHVWKHLU
JURZWKDQGODFNRIHVWURJHQFDXVHVWKHPWRDWURSK\(VWURJHQGRPLQDQFHLVDPXFKJUHDWHUSUREOHPWKDQLVUHFRJQL]HGE\
FRQWHPSRUDU\PHGLFLQH0DQ\ZRPHQLQWKHLU¶VEHJLQWRKDYHDQRYXODWRU\F\FOHV$VWKH\DSSURDFKWKHGHFDGHEHIRUH
PHQRSDXVHWKH\DUHSURGXFLQJPXFKOHVVSURJHVWHURQHWKDQH[SHFWHGEXWVWLOOSURGXFLQJQRUPDO RUPRUH HVWURJHQ7KH\
UHWDLQZDWHUDQGVDOWEUHDVWVVZHOODQGEHFRPH¿EURF\VWLFWKH\JDLQZHLJKW HVSHFLDOO\DURXQGWKHKLSVDQGWRUVR EHFRPH
GHSUHVVHGDQGORVHOLELGRWKHLUERQHVVXIIHUPLQHUDOORVVDQGWKH\GHYHORS¿EURLGV$OODUHVLJQVRIHVWURJHQGRPLQDQFH
LHUHODWLYHSURJHVWHURQHGH¿FLHQF\
:KHQVXI¿FLHQWQDWXUDOSURJHVWHURQHLVUHSODFHG¿EURLGWXPRUVQRORQJHUJURZLQVL]H JHQHUDOO\WKH\GHFUHDVHLQVL]H 
DQGFDQEHNHSWIURPJURZLQJXQWLOPHQRSDXVHDIWHUZKLFKWKH\ZLOODWURSK\7KLVLVWKHHIIHFWRIUHYHUVLQJHVWURJHQ
GRPLQDQFH$QRYXODWRU\SHULRGVFDQEHYHUL¿HGE\FKHFNLQJVHUXPSURJHVWHURQHOHYHOVWKHZHHNIROORZLQJVXSSRVHG
RYXODWLRQ$ORZUHDGLQJLQGLFDWHVODFNRIRYXODWLRQDQGWKHQHHGWRVXSSOHPHQWZLWKQDWXUDOSURJHVWHURQH7KHFDXVH
RIDQRYXODWLRQLVXQFHUWDLQEXWSUREDEO\DWWHVWVWRSUHPDWXUHGHSOHWLRQRIRYDULDQIROOLFOHVVHFRQGDU\WRHQYLURQPHQWDO
WR[LQVDQGQXWULWLRQDOGH¿FLHQFLHVFRPPRQLQWKH86WRGD\

Signs and Symptoms


0DQ\DUHDV\PSWRPDWLFPHQVWUXDOLUUHJXODULWLHVYDJLQDOGLVFKDUJHXWHULQHSDLQVRUFUDPSVDQHPLD
Lab Findings:XOWUDVRXQGODSDURVFRS\' &

Course and Prognosis


7UHDWPHQWVKRXOGRQO\RFFXULQV\PSWRPDWLFSDWLHQWV,QZRPHQZKRGRQRWGHVLUHWREHFRPHSUHJQDQWFRQYHQWLRQDO
SK\VLFLDQVJHQHUDOO\SHUIRUPDP\RPHFWRP\RUK\VWHUHFWRP\

Differential Diagnosis
 ‡2YDULDQF\VWVRUFDUFLQRPD ‡(QGRPHWULDOK\SHUSODVLD
• Cervical polyps • Uterine carcinoma
• Adenomyomas

Suggested Nutritional Supplementation


• Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUKHDOWK\KHDUWVDQGERQHV
• EstroFactors ²WDEOHWVGDLO\
7DUJHWHGQXWULWLRQDOVXSSRUWIRUKHDOWK\HVWURJHQPHWDEROLVP
• AdvaClear²FDSVXOHVGDLO\
$GYD&OHDUSURYLGHVXQLTXHVXSSRUWIRUEDODQFHGDFWLYLW\RIWKHERG\¶VGHWR[L¿FDWLRQSURFHVVHV

Progesterone Deficiency, if indicated by laboratory assessment


• Femarone 17 ²*HQWO\UXEWRWHDVSRRQRQFOHDQVNLQ ZULVWVQHFNIDFHWZLFHGDLO\8VHGD\V
DQGVWRSIRUDZHHNDQGUHSHDW$SSOLFDWLRQLVLQWHQGHGIRUH[WHUQDOFRVPHWLFXVH
+LJKHU SRWHQF\ HQULFKHG PRLVWXUL]LQJ FUHPH ZLWK  PJ SURJHVWHURQH SKWRHVWURJHQ FRPSRXQGV DQG
DQWLR[LGDQWYLWDPLQV
Female Conditions 175

Contributing Factors
 ‡,PSDLUHG)DWW\$FLG&RQYHUVLRQ ‡/RZ)LEHU,QWDNH
 ‡2EHVLW\ ‡/LYHU'DPDJH'\VIXQFWLRQ
 ‡+LJK)DW&DIIHLQH,QWDNH ‡+LJK6WUHVV
• Metabolic Syndrome/Insulin Imbalance

Dietary Suggestions
• FirstLine Therapy® Diet
• Avoid Chocolate
• 5HVWULFW&DIIHLQH$OFRKRODQG6SLF\)RRGV
176 Female Conditions

Vaginitis / Leukorrhea
,QÀDPPDWLRQDQGRULQIHFWLRQRIWKHYDJLQDZLWKSRVVLEOHFRQFXUUHQWLQÀDPPDWLRQRIWKHYXOYD9DJLQLWLVW\SLFDOO\
RFFXUVRQHRIWZRZD\V
 7KHRYHUJURZWKRIDQRUPDOSDUWRIWKHYDJLQDOÀRUDRUWKHLQWURGXFWLRQRIDIRUHLJQPLFURRUJDQLVPWKURXJK
VH[XDOUHODWLRQV
• 1RUPDOÀRUDWKDWFDQFDXVHGLVHDVH\HDVW RIWHQ&DQGLGDDOELFDQV PD\DOVRVSUHDGIURPWKHLQWHVWLQHVRU
VH[XDOO\+HPRSKLOXVYDJLQDOLWLV*DUGQHUHOODYDJLQDOLWLVRIWHQFDOOHG³QRQVSHFL¿FYDJLQLWLV´
• Foreign microorganisms: Trichomonas vaginalitis, Neisseria gonorrhea.
• In young girls it may be also caused by E. coli, strep, or staph due to poor hygiene.
 5HDFWLRQWRDQH[WHUQDODJHQWFDXVLQJDOOHUJLFRUFKHPLFDOUHDFWLRQ
Signs and Symptoms
• 9DJLQDO GLVFKDUJH ± ZKLWH DQG FXUGLVK \HDVW  FUHDP\ ZKLWH RU RIIZKLWH Gardnerella  JUHHQLVK\HOORZ
IURWK\ Trichomonas).
• Itching – may be severe.
• 2GRU±1RQH \HDVWDQGTrichomonas ¿VK\ Gardnerella).
• 9XOYDULUULWDWLRQDQGUHGQHVV±SRVVLEOHZLWKDOOWKUHHLQIHFWLRQVKRZHYHUCandidaLVW\SLFDOO\WKHZRUVWLUULWDQW
DQGFDQFDXVH¿VVXULQJDQGVZHOOLQJ
• 9DJLQD±QRUPDOH[FHSWIRUWKHSUHVHQFHRIPLOGWRH[WUHPHDPRXQWVRIGLVFKDUJH 
• Lab Findings:  :HWSUHSDQGRUFXOWXUHIRUPLFURRUJDQLVPLGHQWL¿FDWLRQ3DSVPHDUPD\VKRZLQÀDPPDWRU\
signs.
Course and Prognosis
:KLOHTrichomonas, Candida, and GardnerellaDUHEHQLJQLQIHFWLRQVFDXVLQJQRVHYHUHRUOLIHWKUHDWHQLQJSDWKRORJ\
WKH\FDQFDXVHVLJQL¿FDQWDQGXQUHOHQWLQJPRUELGLW\TrichomonasLQSDUWLFXODUVKRXOGEHWUHDWHGLQDVH[XDOO\
DFWLYHZRPDQWRSUHYHQWKHUSDVVLQJLWRQWRRWKHULQGLYLGXDOV&RQYHQWLRQDOWUHDWPHQWXVXDOO\FRQVLVWVRIQ\VWDWLQ
\HDVW PHWURQLGD]ROH Trichomonas DQGR[\WHWUDF\FOLQH Hemophilus :RPHQWUHDWHGWKLVZD\KDYHDKLJK
UHFXUUHQFHUDWH HVSHFLDOO\RI\HDVWDQGHemophilus).
Differential Diagnosis
• 'LIIHUHQWLDWHLQIHFWLRXVFDXVH
• )RUHLJQERG\ IRUJRWWHQWDPSRQ
• Malignancy
• 'LIIHUHQWLDWHDOOHUJLFLUULWDQWFDXVH

Suggested Nutritional Supplementation


Protocol for Normalization of Vaginal Flora
Two Week Program
Step 1:3XUFKDVHWKH)ROORZLQJ
9DJLQDOEXOEYDJLQDOV\ULQJHDQGK\GURJHQSHUR[LGHVROXWLRQ SKDUPDF\ GLVWLOOHGZDWHUOLYHFXOWXUHORZIDW
\RJXUWDQGDSSOHFLGHUYLQHJDU JURFHU\VWRUH DQGEHQH¿FLDOEDFWHULDVXFKDVUltraFlora Plus.
Step 2: Directions (Day 1 through 7)
0L[7DEOHVSRRQVRIWKHK\GURJHQSHUR[LGHLQRQHTXDUWRIGLVWLOOHGZDWHU)LOOWKHYDJLQDOEXOEDQGGRXFKH
WKRURXJKO\HDFKPRUQLQJRQDULVLQJDQGLQWKHHYHQLQJEHIRUHUHWLULQJ7KHGRXFKHPD\DOVREHXVHGGXULQJWKH
GD\LIV\PSWRPVZDUUDQWLW&RQWLQXHWKLVSURFHGXUHIRUGD\V,IV\PSWRPVKDYHDEDWHGSURFHHGWR6WHS,I
V\PSWRPVDUHSHUVLVWLQJUHSHDW6WHS,IDWWKHHQGRIWKLVVHFRQGZHHN\RXDUHVWLOOH[SHULHQFLQJV\PSWRPVRI
YDJLQLWLVEHVXUHWRQRWLI\\RXUGRFWRU
Step 3:5HLQWURGXFWLRQRI%HQH¿FLDO%DFWHULD 'D\WKURXJK
$GGWHDVSRRQRIUltraFlora Plus WR7DEOHVSRRQVRIOLYHFXOWXUHORZIDW\RJXUW 1RWH,QFDVHRIVHYHUH
hypersensitivity to dairy products, delete this step and simply add the bacteria to the apple cider vinegar solution
GHVFULEHGEHORZ /HWWKH\RJXUWEDFWHULDSUHSDUDWLRQVWDQGDWURRPWHPSHUDWXUHIRUPLQXWHVDQGWKHQ
LPSODQWLWZLWKWKHYDJLQDOV\ULQJHMXVWEHIRUHEHG,QVHUWDGHRGRUDQWIUHHWDPSRQWRLPSURYHUHWHQWLRQ2QDULVLQJ
WKHQH[WPRUQLQJUHPRYHWKHWDPSRQDQGGRXFKHZLWKWKHIROORZLQJVROXWLRQSLQWGLVWLOOHGZDWHU7DEOHVSRRQ
apple cider vinegar, and 1/2 teaspoon UltraFlora Plus.
&RQWLQXHWKLVSURFHGXUHIRUGD\
Female Conditions 177

Candida Albicans Nutrition Guide

Food Permitted Foods Foods Not Permitted


6ZHHWV 8QSDVWHXUL]HGKRQH\XQVXOIXUDWHGEODFNVWUDSPRODVVHV 5H¿QHGVXJDUFDQG\FKRFRODWH
UDZVXJDUVRUJKXPE\WKHPVHOYHVRUXVHGDVVZHHWHQHUV
127(8VHLQPRGHUDWLRQ
Fish $OOZKLWHÀHVK¿VKZDWHUSDFNHGWXQDVDOPRQVKHOO¿VK $OOIULHGRURLOSDFNHG¿VKDQG
%DNHGRUEURLOHG9HU\IUHVK VHDIRRG
Meat /HDQWULPPHGEHHIYHU\IUHVKFDOIOLYHUFKLFNHQODPEDQG Bacon, ham, pork, smoked meat,
WXUNH\127(5HPRYHVNLQRQFKLFNHQDQGWXUNH\ sausage, and pork sausage.
0LON3URGXFWV 2FFDVLRQDO\RJXUW XQVZHHWHQHG RFFDVLRQDOSRZGHUHGPLON <RJXUW VZHHWHQHG ZKROHPLON
FKRFRODWHPLONVZHHWFUHDP
buttermilk, sour cream.
Fruits )UHVKIUXLWVRQO\DSSOHVSHDUVDSULFRWVEDQDQDVFKHUULHV &DQQHGIUXLWRUDQJHVPHORQV
grapes, guava, currants, nectarines, papaya, peaches, GULHGRUFDQGLHGIUXLWV
SOXPVTXLQFHWDQJHULQHVDYRFDGRVULSHSLQHDSSOH127(
)UXLWVVKRXOGEHOLPLWHGWRDPD[LPXPRIWZRSHUGD\
Juices 2QO\IUHVKMXLFHV0D\EHVHOHFWHGIURPOLVWRIYHJHWDEOHV &DQQHGMXLFHVDQGMXLFHVZLWK
SHUPLWWHGLQFOXGLQJWKHIROORZLQJJUHHQOHDYHVFKLFRU\ DUWL¿FLDOFRORULQJRUVZHHWHQLQJ
HQGLYHHVFDUROHOHWWXFH6ZLVVFKDUGDQGZDWHUFUHVV
Beverages 0LQHUDOZDWHUKHUEWHDPLQWWHDSDSD\DWHDIUHVKYHJHWDEOH $OFRKROFRIIHHWHDVRIWGULQNV
juices. containing preservatives.
Breads 5\HZKROHZKHDWVR\DEUDQZKROHJUDLQVWRQHJURXQG :KLWHEUHDGEOHDFKHGÀRXU
EUHDGV127(/LPLWWRDPD[LPXPRIWZRVOLFHVSHUGD\ products.
Cereals %XFNZKHDWFRUQPHDOFUDFNHGZKHDWPLOOHWRDWPHDO 5H¿QHGEOHDFKHGÀRXUDQGVXJDU
sesame, grits. coated cereals.
Cheese, Butter only very occasionally. Margarine, cheese
Butter
Eggs /LPLWWRWZRHJJVSHUGD\3RDFKHGKDUGRUVRIWERLOHG
2LOV &ROGSUHVVHGRLOVSUHIHUDEO\ÀD[VHHGVDIÀRZHUFDQRODRU Shortening, margarine, saturated
soya lecithin spread. RLOVDQGIDWV
Nuts )UHVKUDZQXWVVXFKDVDOPRQGVSHFDQVFDVKHZV%UD]LO Roasted and salted nuts. No
QXWVDQGZDOQXWV SHDQXWVYHU\RFFDVLRQDOO\  SHDQXWVLISDWLHQWKDVGLJHVWLYHRU
colon related problems.
Vegetables 5DZRUOLJKWO\FRRNHGDUWLFKRNHVDVSDUDJXVFDUURWV All canned vegetables.
FDXOLÀRZHUFHOHU\FKLYHVFRUQHJJSODQWHQGLYHVJUHHQ
leeks, green peas, green pepper, leeks, lentils, lima beans,
SRWDWRHVUDGLVKHVVSLQDFKVTXDVKWRPDWRHVZD[EHDQV
\DPV$Q\YHJHWDEOHVOLVWHGXQGHUVDODGV127(:DVKLQJ
YHJHWDEOHVLQD&ORUR[VROXWLRQDQGULQVLQJZHOOZLOO
UHGXFHPLFURELDOJURZWK
3RWDWRHV %DNHGERLOHGRUPDVKHG0D\VXEVWLWXWHEURZQULFHRUFRUQ )UHQFKIULHGFKLSVZKLWHULFH
Salads 7KHIROORZLQJUDZYHJHWDEOHVVKUHGGHGRU¿QHO\FKRSSHG $Q\RWKHU1RZKLWHRUFLGHU
VHSDUDWHGRUPL[HGEURFFROL%UXVVHOVVSURXWVFDUURWV vinegar.
FDXOLÀRZHUFHOHU\FKLFRU\JUHHQSHSSHUOHWWXFHRQLRQV
UDGLVKHV6ZLVVFKDUGWRPDWRHVWXUQLSVDQGZDWHUFUHVV
Seasonings Chives, garlic, onion, parsley, laurel, marjoram, sage, thyme, Spices, pepper, paprika, sodium
VDYRU\FXPLQRUHJDQRVDOWVXEVWLWXWHVVXFKDV&RVDOWRU VDOW1RZKLWHRUFLGHUYLQHJDU
other potassium salt, sea salt, kelp salt, and herbs.
Soups 9HJHWDEOHVRXS%DUOH\EURZQULFHRUPLOOHWFDQEHDGGHG &DQQHGDQGFUHDPHGVRXSIDW
stock, consomme.
178 Fertility / Sexual Dysfunction - Male and Female

Fertility / Sexual Dysfunction - Male and Female


RIFRXSOHVH[SHULHQFHWKHLQDELOLW\WRFRQFHLYHDQGWKHSHUFHQWDJHLVJURZLQJ0HQDFFRXQWIRURI
IDLOXUHVWRFRQFHLYH2IWKHZRPHQZKRDUHUHVSRQVLEOHIDLOXUHWRRYXODWHDFFRXQWVIRURILQIHUWLOLW\SUREOHPV
SHOYLFIDFWRUV VXFKDVWXEDOGLVHDVHDQGHQGRPHWULRVLV DFFRXQWIRUFHUYLFDOSDWKRORJ\LVUHVSRQVLEOH
RIWKHWLPHDQGLQRIWKHZRPHQQRUHDVRQLVIRXQG

Contributing Factors
Infertility — Female
• 3RRUGLHW
• 7RRORZRUWRRKLJKERG\IDW
• ,QFUHDVHGFDIIHLQHFRQVXPSWLRQ
• Increased alcohol consumption
• 1XWULHQWGH¿FLHQF\RIWKHIROORZLQJYLWDPLQ&]LQF%IROLFDFLGVHOHQLXPLURQ
• Endometriosis
• Tubal obstructions
• Immunologic problems
• 3RO\F\VWLFRYDU\V\QGURPH

Infertility — Male
• 3RRUGLHW
• Increased alcohol consumption
• $ÀDWR[LQLQVHPHQ
• Impotence
• ([SRVXUHWRHQYLURQPHQWDO HVWURJHQPLPLF FKHPLFDOV
• ([SRVXUHWRUDGLDWLRQ LH&KHUQRE\O3RZHU6WDWLRQDFFLGHQWLQWKH8NUDLQH
• 2[LGDWLYHVWUHVV
• ([SRVXUHWRRUJDQLFVROYHQWV
• ([SRVXUHWRWR[LFPHWDOV LHOHDGPHUFXU\
• 1XWULHQWGH¿FLHQF\RIWKHIROORZLQJYLWDPLQ&]LQFFRSSHU%VHOHQLXP/DUJLQLQHJOXWDWKLRQHFDUQLWLQH

Impotence — Male
 ‡3RRUGLHW ‡ 7K\URLGGLVHDVH
 ‡$WKHURVFOHURVLV ‡ /RZWHVWRVWHURQH
 ‡3UHVFULSWLRQGUXJV ‡ 3URVWDWHGLVRUGHUV
 ‡$OFRKRO ‡ 3H\URQLHVGLVHDVH
• Tobacco • Decreased HDL ratio
 ‡'LDEHWHV ‡ %LF\FOLVWV ELF\FOHVHDWEORFNDJHRISHQLOHDUWHU\

Suggested Nutritional Supplementation

Female Preconception — Primary Nutritional Program


Supplements Breakfast Mid Morning Lunch Mid Afternoon Supper Mid Evening
Wellness 3DFN
Essentials™
for Pregnancy
Ultra Meal 1 Serving
PLUS 360
Glycogenics 1
AdvaClear 1 1
EstroFactors 1 1
0HWD*O\FHP; 2 2 2
Fertility / Sexual Dysfunction - Male and Female 179

• Wellness Essentials™ for Pregnancy — 1 packet daily


'DLO\(VVHQWLDOVIRU%HIRUH'XULQJ $IWHU3UHJQDQF\
• UltraMeal® Plus 360° — 2 scoops once daily.
1XWULWLRQDO6XSSRUWIRUWKH0DQDJHPHQWRI&RQGLWLRQV$VVRFLDWHGZLWK0HWDEROLF6\QGURPHDQG&DUGLRYDVFXODU
Disease (CVD)
• Glycogenics® — 1 tablet daily
*O\FRJHQLFVLVDQDGYDQFHGEDODQFHG%FRPSOH[IRUPXODWKDWIHDWXUHV$FWL)RODWHŠDORQJZLWKDEOHQGRI
other B vitamins and complementary nutrients.
• AdvaClear® ²FDSVXOHWZLFHGDLO\
$GYD&OHDUSURYLGHVXQLTXHVXSSRUWIRUEDODQFHGDFWLYLW\RIWKHERG\
VGHWR[L¿FDWLRQSURFHVVHV
• EstroFactors® ²WDEOHWWZLFHGDLO\
(VWUR)DFWRUVSURPRWHVKHDOWK\KRUPRQHEDODQFHLQZRPHQRIDOODJHVE\IHDWXULQJWDUJHWHGQXWULHQWVWKDW
VXSSRUWKHDOWK\HVWURJHQPHWDEROLVPDQGGHWR[L¿FDWLRQ
• 0HWD*O\FHP;ŒWDEOHWVWKUHHWLPHVGDLO\ZLWKIRRG
0HWD*O\FHP;LVDQDGYDQFHGIRUPXODWKDWLQFOXGHVDXQLTXHFRPELQDWLRQRIJUHHQWHDFLQQDPRQDOSKD
OLSRLFDFLGDQGDEURDGIRXQGDWLRQRIQXWULHQWVDVSDUWRIDKHDOWK\GLHWWRSURPRWHKHDOWK\EORRGVXJDUOHYHOV
already in the normal range.

If Toxicity is a concern,
&RQVLGHUDELIXQFWLRQDO'HWR[L¿FDWLRQSURJUDP VHH'HWR[L¿FDWLRQVHFWLRQ
• GD\ELIXQFWLRQDOGHWR[L¿FDWLRQSURJUDPKDVQHYHUEHHQHDVLHURUPRUHÀH[LEOHIRUSDWLHQWV
• UltraClear® PLUS GD\([SUHVV'HWR[

If Body Composition (body fat is high), is a concern,


• Consider UltraMeal® Plus 360° 3URJUDPZKLFKKDVEHHQVKRZQWRSURPRWHIDWORVVZKLOHSUHVHUYLQJOHDQ
ERG\PDVV±,QDGGLWLRQWKHVR\LVRÀDYRQHVLQ8OWUD0HDOFRQWULEXWHWRKRUPRQHEDODQFH

If Female Sexual Dysfunction is a concern,


• Consider using BioSõm '+($ VSUD\VLQPRXWKWZLFHGDLO\

Male Fertility/Sexual Dysfunction — Primary Nutritional Program


Supplements Breakfast Mid Morning Lunch Mid Afternoon Supper Mid Evening
Wellness AM pack 30SDFN
Essentials™ for
Men
Mitochondrial 1 1
Resuscitate
CoQ10 100 mg 100 mg
AdvaClear 1 1
Testralin 1 1
0HWD*O\FHP; 2 2 2

• Wellness Essentials™ for men ²SDFNHWWZLFHGDLO\


'DLO\IRXQGDWLRQQXWULWLRQZLWKDGGHGVXSSRUWIRUPDOHHQHUJ\DQGOLELGR
• Mitochondrial Resuscitate® ²WDEOHWWZLFHGDLO\
0LWRFKRQGULDO5HVXVFLWDWHLVVFLHQWL¿FDOO\GHVLJQHGWRSURYLGHQXWULWLRQDOVXSSRUWIRUKHDOWK\FHOOXODUHQHUJ\
$73 SURGXFWLRQ
• CoQ10 ST-100™ ²VRIWJHOWZLFHGDLO\
6WDELOL]HG+LJKO\$EVRUEDEOH&RHQ]\PH4ZLWK1DWXUDO9LWDPLQ(DQG%HWD&DURWHQH
• AdvaClear®²FDSVXOHWZLFHGDLO\
$GYD&OHDUSURYLGHVXQLTXHVXSSRUWIRUEDODQFHGDFWLYLW\RIWKHERG\
VGHWR[L¿FDWLRQSURFHVVHV
• Testralin® ²WDEOHWWZLFHGDLO\
7HVWUDOLQLVGHVLJQHGIRUPHQWRVXSSRUWKHDOWK\WHVWRVWHURQHDQGHVWURJHQEDODQFHDQGKHOSPDLQWDLQPDOH
UHSURGXFWLYHKHDOWK7KLVSRZHUIXOIRUPXODSURYLGHVVLJQL¿FDQWOHYHOVRINH\LQJUHGLHQWV²LQFOXGLQJJUHHQ
WHDÀD[OLJQDQVDQGSODQWVWHUROV²WRSURPRWHKHDOWK\OHYHOVRIWHVWRVWHURQHZKLOHKHOSLQJWRLQKLELWOHYHOV
RIFHUWDLQWHVWRVWHURQHDQGHVWURJHQPHWDEROLWHV
180 Fertility / Sexual Dysfunction - Male and Female

• 0HWD*O\FHP;Œ²WDEOHWVWKUHHWLPHVGDLO\ZLWKIRRG
0HWD*O\FHP;LVDQDGYDQFHGIRUPXODWKDWLQFOXGHVDXQLTXHFRPELQDWLRQRIJUHHQWHDFLQQDPRQDOSKD
OLSRLFDFLGDQGDEURDGIRXQGDWLRQRIQXWULHQWVDVSDUWRIDKHDOWK\GLHWWRSURPRWHKHDOWK\EORRGVXJDUOHYHOV
already in the normal range.

If Toxicity is a concern,
&RQVLGHUDELIXQFWLRQDO'HWR[L¿FDWLRQSURJUDP VHH'HWR[L¿FDWLRQVHFWLRQ
• GD\ELIXQFWLRQDOGHWR[L¿FDWLRQSURJUDPKDVQHYHUEHHQHDVLHURUPRUHÀH[LEOHIRUSDWLHQWV
• UltraClear® PLUS GD\([SUHVV'HWR[

If Body Composition (body fat is high), is a concern,


Consider UltraMeal® Plus 360° 3URJUDPZKLFKKDVEHHQVKRZQWRSURPRWHIDWORVVZKLOHSUHVHUYLQJOHDQERG\
mass.
• ,QDGGLWLRQWKHVR\LVRÀDYRQHVLQUltraMeal Plus 360° contribute to hormone balance.
Fibromyalgia 181

Fibromyalgia
Adapted from “Nutritional Therapies for Fibromyalgia Syndrome”, written by Kristi Hughes, ND
)LEURP\DOJLDLVDV\QGURPHFKDUDFWHUL]HGE\JHQHUDOL]HGPXVFXORVNHOHWDOSDLQDQGVWLIIQHVVFKURQLFDFKLQJ
IDWLJXHDQGPXOWLSOHDUHDVRIORFDOWHQGHUQHVVWKDWFDQEHLGHQWL¿HGGXULQJSK\VLFDOH[DPLQDWLRQ5HVHDUFK
VWXGLHVVXJJHVWWKDW¿EURP\DOJLDSDLQPD\EHWKHUHVXOWRIDFRPELQDWLRQRIIDFWRUVDIIHFWLQJWKHDFWLYLW\RIPXVFOH
FHOOVDQGWKHFHQWUDOQHUYRXVV\VWHP9DULRXVFRQYHQWLRQDOWUHDWPHQWPRGDOLWLHVKDYHEHHQWHVWHGLQ¿EURP\DOJLD
SDWLHQWVXQIRUWXQDWHO\WKHVHDUHRIWHQLQHIIHFWLYHDQGPD\UHVXOWLQDGYHUVHVLGHHIIHFWV$QDWXUDODSSURDFKWKDW
LQFRUSRUDWHVQXWULWLRQDOVXSSRUWIRUWKHERG\SURFHVVHVLPSOLFDWHGLQWKHSDWKHQRJHQHVLVRI¿EURP\DOJLDKROGV
JUHDWSURPLVHIRUWKHPLOOLRQVVXIIHULQJIURPWKLVFKURQLFV\QGURPH
)LEURP\DOJLD )0 LVDV\QGURPHWKDWSUHVHQWVZLWKFRQFXUUHQWVLJQVDQGV\PSWRPVFKDUDFWHUL]HGE\IDWLJXH
ZLGHVSUHDGPXVFXORVNHOHWDOSDLQDQGWHQGHUQHVVDWVSHFL¿FVLWHVLQWKHQHFNVSLQHVKRXOGHUVDQGKLSVUHIHUUHGWR
DV³WHQGHUSRLQWV´6OHHSGLVWXUEDQFHVPRUQLQJVWLIIQHVVKHDGDFKHVLUULWDEOHERZHOV\QGURPH ,%6 GHSUHVVLRQ
DQGDQ[LHW\DUHDOVRFRPPRQO\DVVRFLDWHGZLWKWKLVV\QGURPH1,2

Pathology
%HFDXVH)0LVDPXOWLIDFWRUDOV\QGURPHWKDWLQYROYHVDZLGHUDQJHRIERGLO\SURFHVVHVWUHDWLQJELRFKHPLFDO
SDWKRORJ\LVKHOSIXO$JRRGWUHDWPHQWSURJUDPDGGUHVVHVWKHIRXUPDLQDUHDVWKDWKDYHHVWDEOLVKHGUROHVLQWKH
HWLRORJ\RUSURJUHVVLRQRIWKHGLVHDVH7KHVHLQFOXGHPLWRFKRQGULDOG\VIXQFWLRQK\SRWKDODPXVSLWXLWDU\DGUHQDO
+3$ G\VUHJXODWLRQWR[LFLW\DQGLQWHVWLQHQHUYRXVV\VWHPDEQRUPDOLWLHV

Mitochondrial Dysfunction
0DOIXQFWLRQRIPLWRFKRQGULDLVEHOLHYHGWREHDSULPDU\IDFWRULQWKHHWLRORJ\RI)0DQGDEQRUPDOLWLHVRIWKH
PLWRFKRQGULDOPHPEUDQHVLQWKHVHSDWLHQWVKDYHEHHQUHSRUWHG0LWRFKRQGULDZKLFKDUHFRQFHQWUDWHGLQPXVFOH
WLVVXH DUH RIWHQ UHIHUUHG WR DV WKH ³SRZHUKRXVHV´ RI WKH FHOOV GXH WR WKHLU UROH LQ HQHUJ\ $73  SURGXFWLRQ 
&RPSURPLVHGPLWRFKRQGULDODFWLYLW\FDQUHVXOWLQDOWHUDWLRQVLQPXVFXODUIXQFWLRQDVZHOODVQHUYRXVLPPXQH
DQGFDUGLDFG\VIXQFWLRQ
&HUWDLQQXWULWLRQDOIDFWRUVSOD\DUROHLQPDLQWDLQLQJWKHLQWHJULW\DQGSURSHUIXQFWLRQLQJRIWKHPLWRFKRQGULD7KH
IROORZLQJIRUPXODVKDYHEHHQXVHGLQ)0SDWLHQWVLQFOLQLFDOVHWWLQJV
Mitochondrial Antioxidant Formula:$FRPELQDWLRQRIQXWULHQWVNQRZQWRSRVLWLYHO\LQÀXHQFHPLWRFKRQGULDOHQHUJ\
SURGXFWLRQDORQJZLWKDQWLR[LGDQWVPD\VXSSRUWDKLJKHUUDWHRI$73V\QWKHVLVDVZHOODVSURWHFWPLWRFKRQGULD
IURPIUHHUDGLFDOV1XWULHQWVVXFKDVOLSRLFDFLGDQG%YLWDPLQVVHUYHDVFRIDFWRUVIRUFHOOXODUHQHUJ\SURGXFWLRQ
DQGPHWDEROLVPWKLDPLQVXSSRUWVWKHDFWLYLW\RIHQ]\PHVWKDWLQÀXHQFHFLWULFDFLGF\FOHDFWLYLW\DQGDFWLYLWLHVRI
WKHUHVSLUDWRU\FKDLQDPLQRDFLGVOLNHFUHDWLQHDOORZPXVFOHVWRUHJHQHUDWH$73DQG1DFHW\O/FDUQLWLQHKHOSV
WUDQVSRUWQXWULHQWV LHIDWW\DFLGV LQWRWKHPLWRFKRQGULDIRUHQHUJ\SURGXFWLRQ)XUWKHUPRUHDQWLR[LGDQWVVXFK
as coenzyme Q10, /JOXWDWKLRQH1DFHW\OF\VWHLQHDQGYLWDPLQV&DQG(KHOSSUHYHQWR[LGDWLYHGDPDJHWKDWFDQ
DIIHFWFHOOXODUDQGRUPLWRFKRQGULDOIXQFWLRQQHJDWLYHO\
Malic Acid/Magnesium Aspartate Complex: 0DOLF DFLG LV D QDWXUDO FRPSRXQG WKDW LV QHFHVVDU\ IRU $73
production.8&RPELQHGVXSSOHPHQWDWLRQZLWKPJRIPDOLFDFLGDQGPJPDJQHVLXPDGPLQLVWHUHGLQD
GRVHHVFDODWHGIDVKLRQSURGXFHGVLJQL¿FDQWUHGXFWLRQVLQWKHVHYHULW\RISULPDU\SDLQWHQGHUQHVVPHDVXUHV
LQ)0SDWLHQWV,QDQRWKHUVWXG\VXSSOHPHQWDWLRQZLWKPDOLFDFLG PJ DQGPDJQHVLXP 
PJ UHVXOWHGLQVXEMHFWLYHLPSURYHPHQWVLQP\DOJLDZLWKLQKRXUVDQGUHGXFHGWHQGHUSRLQWLQGH[VFRUHVZHUH
UHFRUGHGDWZHHNV9
Magnesium/Potassium Aspartate Complex: Magnesium, potassium, and aspartate have roles in intermediary
PHWDEROLVP HQ]\PHFDWDO\]HGSURFHVVHVWKDWH[WUDFWHQHUJ\IURPQXWULHQWVWREXLOGQHZFHOOV WKDWPD\PLWLJDWH
SK\VLFDOIDWLJXH,QDVWXG\H[DPLQLQJWKHHIIHFWVRISRWDVVLXPPDJQHVLXPDQGDVSDUWDWH PJSRWDVVLXP
DVSDUWDWHDQGPJPDJQHVLXPDVSDUWDWHSHUGD\IRUZHHNV RQVXEMHFWVXQGHUJRLQJH[WUHPHO\IDWLJXLQJ
SK\VLFDOH[HUFLVHQRQDWKOHWHVGHPRQVWUDWHGLPSURYHGSK\VLFDOHQGXUDQFH103RWDVVLXPPDJQHVLXPDVSDUWDWH
VXSSOHPHQWDWLRQRIJHYHU\KRXUVIRUGD\VZDVVKRZQWRSURORQJH[HUFLVHFDSDFLW\5HVHDUFKHUVSRVWXODWH
WKDWWKHPHFKDQLVPEHKLQGWKLVDQWLIDWLJXHHIIHFWZDVWKHUHV\QWKHVLVRI$73DQGSKRVSKRFUHDWLQH11

HPA Dysregulation
0DQ\SDWLHQWVZLWK)0KDYHKDGH[SRVXUHWRVLJQL¿FDQWOLIHVWUHVVDQGRUKDYHLQRUGLQDWHUHVSRQVHVWRGDLO\
OLIHVWUHVVRUV12 $OWHUHGUHDFWLYLW\RIWKHK\SRWKDODPLFSLWXLWDU\DGUHQDO +3$ D[LVUHVXOWLQJLQK\SRVHFUHWLRQRI
adrenal androgens (e.g. cortisol) has been observed in these patients.13 2QHVWXG\KDVSRVWXODWHGWKDW+3$
G\VIXQFWLRQPD\LQYROYHVHURWRQHUJLFQHXURWUDQVPLVVLRQDQGDOWHUDWLRQVLQWKHDFWLYLW\RIDUJLQLQHYDVVRSUHVVLQ
$93 DQGFRUWLFRWURSKLQUHOHDVLQJKRUPRQH &5+ 14
+3$G\VUHJXODWLRQLVIDUUHDFKLQJDQGFDQLQWHUIHUHZLWKSURSHUIXQFWLRQLQJRIWKHK\SRWKDODPXVSLWXLWDU\WK\URLG
182 Fibromyalgia

+37 D[LV1HXURHQGRFULQHDEQRUPDOLWLHVDORQJWKH+37D[LVDUHDOVRFRPPRQLQ)0SDWLHQWV15,16,17 Furthermore,


GXHWRWKHDVVRFLDWLRQEHWZHHQK\SRWK\URLGLVPDQG¿EURVLWLVDQGP\DOJLDLWLVUHFRPPHQGHGWKDW)0SDWLHQWV
be given a comprehensive thyroid hormone test. 18,19,20
7KH XVH RI DGDSWRJHQV²KHUEV WKDW KHOS QRUPDOL]H ERGLO\ SURFHVVHV DQG LQFUHDVHV WKH DELOLW\ WR ³DGDSW´ WR
stress—and B vitamins provide a general approach to managing stress.
Traditional Holy Basil Combination: Adaptogens such as holy basil (Ocimum sanctum DVKZDJDQGD Withania
somnifera), and brahmi (Bacopa monnieri KDYHDKLVWRU\RIXVHLQ$\XUYHGLFPHGLFLQHDQGDUHVFLHQWL¿FDOO\ZHOO
supported to improve stress tolerance.21,22 $VKZDJDQGDZDVVKRZQWRHQKDQFHDGDSWDELOLW\WRERWKSK\VLFDODQG
FKHPLFDOVWUHVVLQDQLPDOVVKRZLQJWKHDELOLW\WRVXSSUHVVDGUHQDOHQODUJHPHQWDVZHOODVDGUHQDODVFRUELFDFLG
and corticosterone depletion.23$VKZDJDQGDDOVRSURGXFHVSRVLWLYHFKDQJHVLQVWUHVVUHODWHGSURVWDJODQGLQDQG
FDWHFKRODPLQHSURGXFWLRQ,QRWKHUDQLPDOWHVWLQJEUDKPLZDVVKRZQWRLPSURYHDGDSWDWLRQVLQVHQVRU\PRWRU
and motivational systems.24,QKXPDQVLWH[KLELWVEHQH¿FLDOHIIHFWVRQDQ[LHW\DVZHOODVPHQWDOIXQFWLRQVVXFK
DVPHQWDOIDWLJXH
B6/Pantothenic Acid Complex: The B vitamins, pantothenic acid and B6 are important in energy production
and the response to stress by supporting adrenal hormone production and regulation.25,26 ,QFRQMXJDWLRQZLWK
$73DQGF\VWHLQHSDQWRWKHQLFDFLGSOD\VDQLQWHJUDOUROHLQWKHV\QWKHVLVRIFRHQ]\PH$ZKLFKLQLWLDWHVYDULRXV
PHWDEROLFSURFHVVHVLQFOXGLQJWKHSURGXFWLRQRIJOXFRFRUWLFRLGV27 In an animal study, vitamin B6ZDVIRXQGWR
VWLPXODWHWKHVHFUHWLRQRIDGUHQDOFDWHFKRODPLQHV
Thyroid Support::KLOHQRUPDOL]LQJVWUHVVLQGXFHGFKDQJHVLQ+3$IXQFWLRQZLOOKDYHDSRVLWLYHLQÀXHQFHRQWKH
+37D[HVVRPHSDWLHQWVPD\QHHGDGGLWLRQDOWK\URLGVXSSRUW6HYHUDOQXWULHQWVDUHNQRZQWRVXSSRUWKHDOWK\
WK\URLGKRUPRQHV\QWKHVLVWRSURPRWHWKHFRQYHUVLRQRIWK\UR[LQH 7 WRWKHPRUHELRDFWLYHWULLRGRWK\URQLQH
7 DQGWRDGGUHVVUHFHSWRUG\QDPLFVDQGWKHH[SUHVVLRQRIWK\URLGKRUPRQHVHQVLWLYHJHQHV6XFKQXWULHQWV
include iodine, selenium, zinc, and vitamins E, A, and D.

Toxicity
7R[LQH[SRVXUHKDVEHHQVXJJHVWHGWRSOD\DVLJQL¿FDQWUROHLQWKHGHYHORSPHQWDQGSURJUHVVLRQRIERWK)0DQG
&)6DVDSSUR[LPDWHO\RISDWLHQWVZLWK)0DQGRISDWLHQWVZLWK&)6KDYHUHSRUWHGDWOHDVWRQH
HSLVRGHRIV\PSWRPH[DFHUEDWLRQDIWHUVSHFL¿FFKHPLFDOH[SRVXUH
3OHDVHVHH'HWR[L¿FDWLRQ6HFWLRQ

Intestine/Nervous System Support


$QRWKHUDUHDRILQWHUHVWLVWKHOLQNEHWZHHQLQWHVWLQDOG\VIXQFWLRQDQG)0$OWKRXJKVWDWLVWLFVYDU\UHVHDUFK
VXJJHVWVWKDWXSWRRISDWLHQWVZLWK)0FRPSODLQRIV\PSWRPVDVVRFLDWHGZLWKLUULWDEOHERZHOV\QGURPH
,%6   ,%6 LV D IXQFWLRQDO GLVRUGHU FKDUDFWHUL]HG E\ FKURQLF DEGRPLQDO SDLQ ZLWK DOWHUQDWLQJ GLDUUKHD DQG
constipation.34 ,QFRPSDULVRQZLWKKHDOWK\VXEMHFWVSDWLHQWVZLWK,%6DOVRWHQGWRH[SHULHQFHH[WUDLQWHVWLQDO
V\PSWRPVWKDWRYHUODSZLWK)0FRPSODLQWVLQFOXGLQJLQFUHDVHGQHUYHVHQVLWLYLW\PRUQLQJVWLIIQHVVKHDGDFKHV
VOHHSGLVWXUEDQFHVDQGIDWLJXH35
,PSURYHG *, KHDOWK FDQ EH DFKLHYHG ZLWK D QXWULWLRQDO UHJLPHQ NQRZQ DV WKH 5Š *, 5HVWRUDWLRQ 3URJUDP
ZKLFKDGGUHVVHVWKHIRXUSULPDU\VWDJHVRIKHDOLQJ5HPRYH5HSODFH5HLQRFXODWHDQG5HJHQHUDWH)RUPRUH
LQIRUPDWLRQRQWKH53URJUDPSOHDVHVHHSDJH

Natural Treatment Approaches


$QLPSRUWDQWQXWULWLRQDOIRXQGDWLRQIRURSWLPDOKHDOWKDQGKHDOLQJLQERWKKHDOWK\LQGLYLGXDOVDQGSDWLHQWVVXIIHULQJ
IURPFKURQLFFRQGLWLRQV HJ)0 LQFOXGHVDGLHWULFKLQIUXLWVDQGYHJHWDEOHVDQDGHTXDWHLQWDNHRIRPHJD
IDWW\DFLGVDQGDEDODQFHGPXOWLYLWDPLQPLQHUDOVXSSOHPHQW

Suggested Nutritional Supplementation


• Fibroplex²WDEOHWVWLPHVGDLO\IRURQHZHHNWKHQWDEOHWVWLPHVGDLO\IRUZHHNV
1XWULWLRQDOVXSSRUWIRUQHXURPXVFXODUIXQFWLRQ
• Mitochondrial Resuscitate²FDSVXOHVWLPHVGDLO\LQEHWZHHQPHDOV
6XSSRUWIRUFHOOXODUHQHUJ\SURGXFWLRQ
• 5 Hydroxytryptophan Extra Strength²WDEOHWVWZLFHGDLO\LQEHWZHHQPHDOV
+73LVWKHSUHFXUVRUWRVHULWRQLQDOWHUHGVHULWRQLQOHYHOVKDYHEHHQDVVRFLDWHGZLWK¿EURP\DOJLD
• $GYD&OHDUDQG8OWUD,QÀDP;²%LIXQFWLRQDO'HWR[L¿FDWLRQZLWKQXWULWLRQDOVXSSRUWIRULQÀDPPDWLRQ
• Endefen ²WDEOHVSRRQVWZLFHGDLO\IRUWKHUHSDLUDQGHQKDQFHWKH*,LPPXQHV\VWHPIXQFWLRQ
0XOWLGLPHQVLRQDOVXSSRUWIRU*,KHDOWK
Fibromyalgia 183

• Ultra Flora Plus DF ²PL[îíWHDVSRRQWZLFHGDLO\PL[HGZLWK(QGHIHQ


'DLU\IUHHDGYDQFHGSURELRWLFQXWULWLRQZLWKIUXFWRROLJRVDFFKDULGHV
• DHEA²FDSVXOHVWZRWLPHVGDLO\
'+($GH¿FLHQF\LVFRPPRQLQ¿EURP\DOJLDSDWLHQWV'+($LVDSXUHSKDUPDFHXWLFDOJUDGHIRRG
supplement in a hypoallergenic rice starch base.

If patient has sleep disturbance add:


• Benesom™²2QHWDEOHWRQHKRXUEHIRUHEHGWLPH
%HQHVRPLVIRUPXODWHGWRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVVE\EHQH¿FLDOO\
PRGXODWLQJWKHPHWDEROLVPRIPHODWRQLQDQG*$%$

Dietary Suggestions
FirstLine Therapy® Diet
&DQ PRQRVRGLXP JOXWDPDWH WULJJHU ¿EURP\DOJLD"  )RXU ZRPHQ ZLWK ¿EURP\DOJLD GXUDWLRQ RI LOOQHVV
 \HDUV  ZKR KDG SUHYLRXVO\ UHFHLYHG PXOWLSOH WUHDWPHQWV ZLWK OLPLWHG VXFFHVV KDG FRPSOHWH RU QHDUO\
FRPSOHWH UHVROXWLRQ RI WKHLU V\PSWRPV ZLWKLQ PRQWKV DIWHU HOLPLQDWLQJ PRQRVRGLXP JOXWDPDWH 06*  RU
06* SOXV DVSDUWDPH IURP WKHLU GLHW  ,Q HDFK SDWLHQW V\PSWRPV UHFXUUHG ZKHQHYHU 06* ZDV LQJHVWHG
Comment:06*DQGDVSDUWDWH RQHRIWKHWZRDPLQRDFLGVSUHVHQWLQDVSDUWDPH DFWVDVH[FLWDWRU\QHXURWUDQVPLWWHUV
DQGFDQOHDGWRQHXURWR[LFLW\ZKHQXVHGLQH[FHVV5HVHDUFKVXJJHVWVWKDW06*DORQHRU06*SOXVDVSDUWDPH
PD\EHDFDXVHRIV\PSWRPVLQVRPHSDWLHQWVZLWK¿EURP\DOJLD%HFDXVHQHLWKHU06*QRUDVSDUWDPHLVD
QHFHVVDU\FRPSRQHQWRIWKHGLHWDWKHUDSHXWLFWULDORIDYRLGLQJWKHVHVXEVWDQFHVVHHPVZRUWKZKLOHIRUSDWLHQWV
ZLWK¿EURP\DOJLD

Additional Considerations
)UHTXHQF\ VSHFL¿F PLFURFXUUHQW KDV DOVR EHHQ FOLQLFDOO\ HIIHFWLYH LQ PDQDJLQJ SDLQ DVVRFLDWHG ZLWK
¿EURP\DOJLD

Fibromyalgia References
1. 1DWLRQDO,QVWLWXWHRI$UWKULWLVDQG0XVFXORVNHOHWDO6NLQ'LVHDVHV1DWLRQDO,QVWLWXWHVRI+HDOWKFibromyalgia. Retrieved July 2, 2002
IURPKWWSZZZQLDPVJRYKLWRSLFV¿EURP\DOJLD¿EULIVKWP
2. Arthritis Foundation Disease Center. Fibromyalgia 5HWULHYHG -XO\   IURP KWWSZZZDUWKULWLVRUJFRQGLWLRQV'LVHDVH&HQWHU
¿EURP\DOJLDDVS
3. +RUURFNV/$<HR<.+HDOWKEHQH¿WVRIGRFRVDKH[DHQRLF '+$ Pharmacol Res  
4. .ZRQJ/..DP]DORY65HEULQ,et al(IIHFWVRIFRHQ]\PH4  DGPLQLVWUDWLRQRQLWVWLVVXHFRQFHQWUDWLRQVPLWRFKRQGULDOR[LGDQW
JHQHUDWLRQDQGR[LGDWLYHVWUHVVLQWKHUDWFree Radic Biol Med  
5. 'OXJRV]$3LRWURZVND'/LSLGSHUR[LGDWLRQVWLPXODWHGE\6ROYHVVR%DZDQRODQGPHWKDQRODQGLWVFRXQWHUDFWLRQE\DQWLR[LGDQWVLQ
human placental mitochondria. Toxicol In Vitro  
6. &XVWRGLR-%&DUGXVR&0$OPHLGD/07KLROSURWHFWLQJDJHQWVDQGDQWLR[LGDQWVLQKLELWWKHPLWRFKRQGULDOSHUPHDELOLW\
WUDQVLVLRQSURPRWHGE\HWRSRVLGHLPSOLFDWLRQVLQWKHSUHYHQWLRQRIHWRSRVLGHLQGXFHGDSRSWRVLVChem Biol Interact
  
7. Nakai A, Shibazaki Y, Taniuchi Y, et al  9LWDPLQV DPHOLRUDWH VHFRQGDU\ PLWRFKRQGULDO IDLOXUH LQ QHRQDWDO UDW EUDLQ 
Pediatr Neurol  
8. :HUEDFK051XWULWLRQDOVWUDWHJLHVIRUWUHDWLQJFKURQLFIDWLJXHV\QGURPHAltern Med Rev  
9. $EUDKDP*()OHFKDV-'0DQDJHPHQWRI¿EURP\DOJLDUDWLRQDOHIRUWKHXVHRIPDJQHVLXPDQGPDOLFDFLGJ Nutr
Med
10. 1DJOH )- %DONH % *DQVOHQ 5 et al  7KH PLWLJDWLRQ RI SK\VLFDO IDWLJXH ZLWK ³VSDUWDVH´  )$$ 2I¿FH RI$HURVSDFH
Medicine
11. $KOERUJ%(NHOXQG/*1LOVVRQ&*(IIHFWRISRWDVVLXPPDJQHVLXPDVSDUWDWHRQWKHFDSDFLW\IRUSURORQJHGH[HUFLVH
in man. Acta Physiol Scand
12. /LWWOHMRKQ *2 :DONHU -  $ UHDOLVWLF DSSURDFK WR PDQDJLQJ SDWLHQWV ZLWK ¿EURP\DOJLD  Curr Rheumatol Rep
  
13. 'HVVHLQ3+6KLSWRQ($-RIIH%,et al+\SRVHFUHWLRQRIDGUHQDODQGURJHQVDQGWKHUHODWLRQRIVHUXPDGUHQDOVWHURLGV
VHURWRQLQDQGLQVXOLQOLNHJURZWKIDFWRUWRFOLQLFDOIHDWXUHVLQZRPHQZLWK¿EURP\DOJLDPain  
14. 'HPLWUDFN 0$ &URIIRUG /-  (YLGHQFH IRU DQG SDWKRSK\VLFDO LPSOLFDWLRQV RI K\SRWKDODPLFSLWXLWDU\DGUHQDO D[LV
G\VUHJXODWLRQLQ¿EURP\DOJLDDQGFKURQLFIDWLJXHV\QGURPHAnn NY Acad Sci
15. :ROIH)7KHFOLQLFDOV\QGURPHRI¿EURVLWLVAm J Med
16. 0DVL$7<XQXV0%&RQFHSWVRILOOQHVVLQSRSXODWLRQVDVDSSOLHGWR¿EURP\DOJLDV\QGURPHVAm J Med
25.
17. 6P\WKH+$1RQDUWLFXODU5KHXPDWLVPDQG3V\FKRJHQLF0XVFXORVNHOHWDO6\QGURPHV,Q0F&DUW\'-HGArthritis
and Allied Conditions. 9thHG3KLODGHOSKLD/HD
18. *ROGHQEHUJ'/6LPPV5:*UHLJHU$et al+LJKIUHTXHQF\RI¿EURP\DOJLDLQSDWLHQWVZLWKFKURQLFIDWLJXHVHHQLQD
primary care practice. Arthritis Rheum
19. Campbell SM, Clarks, Tindall, EA, et al.&OLQLFDOFKDUDFWHULVWLFVRI¿EURVLWLV$EOLQGHGFRQWUROOHGVWXG\RIV\PSWRPV
and tender points. Arthritis Rheum
20. +HQULFNVRQ.*%HQJVWRQ$)LEURP\DOJLD²DFOLQLFDOHQWLW\" Can J Physiol Pharmacol
184 Fibromyalgia

21. 6HQ30DLWL3&3XUL6et al.0HFKDQLVPRIDQWLVWUHVVDFWLYLW\RIOcimum sanctum Linn, eugenol and Tinospora


malabaricaLQH[SHULPHQWDODQLPDOVIndian J Exp Biol  
22. 0LVKUD/&6LQJK%%'DJHQDLV66FLHQWL¿FEDVLVIRUWKHWKHUDSHXWLFXVHRIWithania somnifera DVKZDJDQGD D
UHYLHZAltern Med Rev  
23. 6LQJK $ 6D[HQD ( %KXWDQL ..  $GUHQRFRUWLFRVWHURQH DOWHUDWLRQV LQ PDOH DOELQR PLFH WUHDWHG ZLWK Trichopus
zeylanicus, Withania somnifera, and Panax ginseng preparations. Phytother Res  
24. 6LQJK+.5DVWRJL536ULPDO5&et al(IIHFWRIEDFRVLGHV$DQG%RQDYRLGDQFHUHVSRQVHVLQUDWVPhytother Res
  
25. )LGDQD]D$)ORULGL6/HQWL/3DQWKHQRODQGJOXFRFRUWLFRLGVBoll Soc Ital Biol Sper  
26. /DX&DP&$7KDGLNRQGD.3.HQGDOO%)6WLPXODWLRQRIUDWOLYHUJO\FRJHQRO\VLVE\YLWDPLQ%6DUROHIRUDGUHQDO
catecholamines. Res Commun Chem Pathol Pharmacol  
27. )LGDQD]D$)ORULGL6/HQWL/3DQWKHQRODQGJOXFRFRUWLFRLGVBoll Soc Ital Biol Sper  
28. :LWFKO0+HUEDOGUXJVDQGSK\WRSKDUPDFHXWLFDOV/RQGRQ&5&3UHVV
29. %URZQ.0$UWKXU-56HOHQLXPVHOHQRSURWHLQVDQGKXPDQKHDOWKDUHYLHZPublic Health Nutr % 
30. 1LVKL\DPD6)XWDJRLVKL6XJLQRKDUD<0DWVXNDUD0et al. Zinc supplementation alters thyroid hormone metabolism
LQGLVDEOHGSDWLHQWVZLWK]LQFGH¿FLHQF\J Am Coll Nutr  
31. *XSWD3.DU$&DGPLXPLQGXFHGWK\URLGG\VIXQFWLRQLQFKLFNHQKHSDWLFW\SH,LRGRWK\URQLQH¶PRQRGHLRGLQDVH
DFWLYLW\DQGUROHRIOLSLGSHUR[LGDWLRQComp Biochem Physiol C Pharmacol Toxicol Endocrinol  
32. 3DOOHW9$XGRXLQ&KHYDOOLHU,9HUUHW&et al5HWLQRLFDFLGGLIIHUHQWLDOO\PRGXODWHVWULLRGRWK\URQLQHDQGUHWLQRLFDFLG
receptors in rat liver according to thyroid status. Eur J Endocrinol  
33. 6KUDGHU00XOOHU.01D\HUL6et al. Vitamin D3—thyroid hormone receptors heterodimer polarity directs ligand
VHQVLWLYLW\RIWUDQVDFWLYDWLRQNature  
34. &KDQJ/7KHDVVRFLDWLRQRIIXQFWLRQDOJDVWURLQWHVWLQDOGLVRUGHUVDQG¿EURP\DOJLDEur J Surg Suppl
36.
35. &DQDWDURäOX<*PUGOX<(UGHP$et al3UHYDOHQFHRI¿EURP\DOJLDLQSDWLHQWVZLWKLUULWDEOHERZHOV\QGURPHTurk
J Gastroenterol   
Fingernails 185

Fingernails
Disorders That Show Up in the Nails
1DLOFKDQJHVPD\VLJQLI\DQXPEHURIGLVRUGHUVHOVHZKHUHLQWKHERG\7KHVHFKDQJHVPD\LQGLFDWHLOOQHVVHYHQ
EHIRUHWKHUHVWRIWKHERG\GRHV7KHIROORZLQJQXWULWLRQDOKHDOWKSUREOHPVFDQEHLQGLFDWHGE\WKHIROORZLQJ

Thick nails
0D\LQGLFDWHWKDWWKHYDVFXODUV\VWHPLVZHDNHQLQJDQGWKHEORRGLVQRWFLUFXODWLQJSURSHUO\
• Wellness Essentials™ Cardiovascular Health ²SDFNHWWZLFHGDLO\

Lengthwise grooves or ridges


0D\LQGLFDWHDNLGQH\GLVRUGHUDQGLVDVVRFLDWHGZLWKDJLQJ$QLURQGH¿FLHQF\PD\DOVRFDXVHULGJHV
• 5HQDJHQ'7;²WDEOHWVGDLO\ZLWKIRRG
• Hemagenics ²WDEOHWVGDLO\ZLWKIRRG LILURQGH¿FLHQF\

White moon area turns red


May indicate heart problems
• Wellness Essentials™ Cardiovascular Health ²SDFNHWWZLFHGDLO\

White moon area turns slate blue


,QGLFDWHVRYHUH[SRVXUHWRVLOYHURUOXQJWURXEOH
• Pneumo-Carotene ²WDEOHWVGDLO\ZLWKIRRG
• Metal Detox ²FDSVXOHVGDLO\DZD\IURPIRRG LIRYHUH[SRVXUHWRVLOYHU 

Brittle nails
6LJQLI\SRVVLEOHLURQGH¿FLHQF\WK\URLGSUREOHPVLPSDLUHGNLGQH\IXQFWLRQDQGFLUFXODWLRQSUREOHPV
• Hemagenics ²WDEOHWVGDLO\ZLWKIRRG LILURQGH¿FLHQF\
• T-100 ²WDEOHWVGDLO\RQDQHPSW\VWRPDFK LIWK\URLGLQYROYHPHQW
• 5HQDJHQ'7;²WDEOHWVGDLO\ZLWKIRRG LINLGQH\LQYROYHPHQW
• EPA-DHA Extra Strength ²VRIWJHOVGDLO\ZLWKIRRG

Flat nails
Can denote Raynaud’s disease
• see Autoimmune Section

Yellow nails
&DQLQGLFDWHLQWHUQDOGLVRUGHUVORQJEHIRUHRWKHUV\PSWRPVDSSHDU6RPHRIWKHVHDUHSUREOHPVZLWKWKHO\PSKDWLF
system, respiratory disorders, diabetes, and liver disorders
• Thymic Synergy ²WDEOHWVGDLO\ZLWKIRRG LPPXQH
• Pneumo-Carotene ²WDEOHWVGDLO\ZLWKIRRG OXQJ
• 0HWD*O\FHP;²WDEOHWVGDLO\ZLWKIRRG EORRGVXJDU
• Liv. 52 ²WDEOHWVGDLO\ OLYHU
• Bromelain 1400 ²WDEOHWVGDLO\ O\PSKDWLF

White nails
Indicate possible liver or kidney disorders and/or anemia
• Lipo-Gen ²WDEOHWVGDLO\ZLWKIRRG OLYHU
• Liv. 52 ²WDEOHWVGDLO\ OLYHU
• 5HQDJHQ'7;²WDEOHWVGDLO\ NLGQH\
186 Fingernails

Dark nails and/or thin, flat, spoon-shaped nails


$UHDVLJQRIYLWDPLQ%GH¿FLHQF\RUDQHPLD
• Hemagenics ²WDEOHWVGDLO\ZLWKIRRG

Deep blue nail beds


6KRZSXOPRQDU\REVWUXFWLRQVXFKDVDVWKPDRUHPSK\VHPD
• Pneumo-Carotene ²WDEOHWVGDLO\ZLWKIRRG
• DMG Sublingual — 3 tablets dissolved under tongue daily
• Ventimax ²FDSVXOHVGDLO\

Nail beading
,VDVLJQRIUKHXPDWRLGDUWKULWLV
• see Autoimmune Section

Pitted red-brown spots and frayed split ends


Indicate psoriasis
• EPA-DHA 6:1 ²VRIWJHOVWLPHVGDLO\
• Kaprex® ²VRIWJHOWZLFHGDLO\
• 1RQUHVSRQGHUVE\GD\PRYHWRVRIWJHOVGDLO\
• 7LPHWREHQH¿W,PPHGLDWHWRGD\V
.DSUH[LVDFOLQLFDOO\WHVWHGKHUEDOGLHWDU\VXSSOHPHQWWKDWSURYLGHVQDWXUDOMRLQWUHOLHIWKDWLVHDV\RQWKH
JDVWURLQWHVWLQDO *, WUDFW,WZRUNVE\LQWHUIHULQJZLWKVLJQDOVLQWKHERG\WKDWLQLWLDWHWKHSURGXFWLRQRIGDPDJLQJ
compounds that cause minor pain and negatively impact cartilage and other joint tissues.
• ActiFolate ²WDEOHWVWZLFHGDLO\
• Progain ²VFRRSVWZLFHGDLO\PL[HGLQZDWHU

Nails that chip, peel, crack, break easily


6KRZDQXWULWLRQDOGH¿FLHQF\DQGLQVXI¿FLHQWK\GURFKORULFDFLGSURWHLQDQGPLQHUDOV
• Metagest ²WDEOHWVZLWKHDFKPHDO
• ProGain ²VFRRSVWZLFHGDLO\PL[HGLQZDWHU
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[VXSSRUW

Brittle, soft, shiny nails without moon


May indicate an overactive thyroid
• see Autoimmune Section

White lines across nail


May indicate a liver disease
• Lipo-Gen ²WDEOHWVGDLO\ZLWKIRRG
• Liv. 52 ²WDEOHWVGDLO\

Thinning nails
May signal an itchy skin disease
• Omega EFA ²VRIWJHOVGDLO\ZLWKIRRG

Nails separated from nail bed


0D\VLJQLI\DWK\URLGGLVRUGHU
• T-100 ²WDEOHWVWLG
• Thyrosol ²WDEOHWVWLG
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[VXSSRUW
Fingernails 187

Half-white nail with dark-spotted tips


3RLQWVWRSRVVLEOHNLGQH\GLVHDVH
• 5HQDJHQ'7;²WDEOHWVGDLO\ZLWKIRRG

Raised nails at base with small white ends


6KRZ D UHVSLUDWRU\ GLVRUGHU VXFK DV HPSK\VHPD RU FKURQLF EURQFKLWLV 7KLV QDLO FRQGLWLRQ PD\ DOVR EH
hereditary
• Pneumo-Carotene ²WDEOHWVGDLO\ZLWKIRRG
• DMG Sublingual — 3 tablets daily under tongue
• Ventimax ²FDSVXOHVGDLO\

Red skin at bottom of nail


May indicate connective tissue disorder
• Chondro Relief Intensive Care ²FDSVXOHVGDLO\

Ridges
&DQVLJQLI\DSRVVLEOHLQIHFWLRQVXFKDVÀX
• Mycotaki ²FDSVXOHVGDLO\
• Thymic Synergy ²WDEOHWVGDLO\ZLWKIRRG
• Echinacea Synergy ²WDEOHWVGDLO\ZLWKIRRG

Downward curved nail ends


May denote heart, liver or respiratory problems
• Wellness Essentials™ Cardiovascular Health ²SDFNHWWZLFHGDLO\
• Liv. 52 ²WDEOHWVGDLO\ OLYHU
• Pneumo-Carotene ²WDEOHWVGDLO\ZLWKIRRG OXQJ

White lines
6KRZSRVVLEOHKHDUWGLVHDVHKLJKIHYHURUDUVHQLFSRLVRQLQJ
• Nutri Chelate ²WDEOHWVGDLO\RQHPSW\VWRPDFK
• Cardiogenics Intensive Care ²WDEOHWVGDLO\ZLWKIRRG KHDUW
• Hair Analysis 'HWHUPLQHKHDY\PHWDOWR[LFLW\

Ridges running up and down nail


Indicate a tendency to develop arthritis
• Alapars ²WDEOHWVGDLO\ZLWKIRRG
• Chondro Relief Intensive Care — 3 capsules daily

Nails resemble hammered brass


,QGLFDWHDWHQGHQF\WRZDUGSDUWLDORUWRWDOKDLUORVV
• see Alopecia

Unusually wide, square nails


Can suggest a hormonal disorder
• EstroFactors ²WDEOHWVGDLO\ ZRPHQ
• Testralin ²WDEOHWVGDLO\ PHQ
• Wellness Essentials™ for Men or Wellness Essentials™ for Women ²SDFNHWWZLFHGDLO\
188 Fingernails

Fungus
Forms under nails
• Tea Tree Oil ²GDERQZLWKFRWWRQVZDE
or
• Colloidal Silver ²GDERQZLWKFRWWRQVZDE
• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
'DLO\IRXQGDWLRQQXWULWLRQSOXVDGYDQFHGGHWR[VXSSRUW

Additional Recommendations
• $KLJKSURWHLQGLHWZLWKDSURWHLQVXSSOHPHQWLVQHFHVVDU\IRUKHDOWK\QDLOV(JJVDUHDJRRGVRXUFHRISURWHLQ
(DWRDWPHDOQXWVVHHGVJUDLQVDQGDIUXLWDQGYHJHWDEOHGLHW
• ,I\RXH[SRVH\RXUKDQGVWRWRRPXFKZDWHUDQGVRDSWKHQDLOPD\EHFRPHORRVHIURPWKHQDLOEHG:DWHU
FDXVHVWKHQDLOVWRVZHOODQGWKH\VKULQNZKHQGU\UHVXOWLQJLQORRVHDQGEULWWOHQDLOV
• 'RQRWFXWFXWLFOHV8QFRYHULQJWKHQDLOVWKLVZD\LVKDUVKDQGLUULWDWLQJFDXVLQJLQIHFWLRQ8VHEDE\RLORU
FUHDPDQGJHQWO\SXVKWKHPEDFN,I\RXKDYHGLDEHWHVVHH\RXUGRFWRULIWKHFXWLFOHVEHFRPHLQÀDPHG
EHFDXVHWKHLQIHFWLRQFDQVSUHDG'RQRWUHSHDWHGO\LPPHUVH\RXUKDQGVLQZDWHUWKDWFRQWDLQVGHWHUJHQWV
RUFKHPLFDOVWKLVUHVXOWVLQVSOLWQDLOV'LVFRORUHGQDLOVFDQEHFDXVHGE\SURORQJHGLOOQHVVVWUHVVQLFRWLQH
allergies, or diabetes.
• 8VHDEDVHFRDWEHIRUHXVLQJQDLOSROLVKWRSUHYHQW\HOORZLQJ,IQDLOVDUHJUHHQLWFRXOGEHDEDFWHULDOLQIHFWLRQ
RUDIXQJDOLQIHFWLRQZKLFKVHSDUDWHVWKHQDLOIURPWKHEHG
• :HDUFRWWRQOLQHGJORYHVZKHQGRLQJKRXVHZRUNVXFKDVGLVKHVDQGODXQGU\RUZKHQXVLQJIXUQLWXUHSROLVK
This protects your hands against harsh chemicals.
• +\SRWK\URLG8VHWKH$[LOODU\7HPSHUDWXUH7HVWWRGHWHUPLQHWK\URLGIXQFWLRQ3RRUWK\URLGIXQFWLRQPD\EH
UHÀHFWHGLQWKHQDLOV
Fracture 189

Fracture
$Q\EUHDNLQDERQH7KHUHDUHPDQ\W\SHVRIIUDFWXUHV
• Partial (incomplete): break across the bone is incomplete.
• Complete:ERQHLVEURNHQLQWZRSLHFHV
• Closed (simple): broken bone does not protrude through the skin.
• Comminuted: ERQHLVVSOLQWHUHGDWWKHEURNHQDUHDDQGPDQ\VPDOOHUIUDJPHQWVRIERQHDUHIRXQGEHWZHHQ
WKHWZRPDLQSLHFHV
• Greenstick:RQO\RFFXUVLQFKLOGUHQDQGLVGH¿QHGE\KDYLQJRQHVLGHRIWKHERQHEUHDNDQGWKHRWKHUVLGH
MXVWEHQG2IWHQVHHQLQWKHUDGLXV
• Spiral:EUHDNLQJIRUFHWZLVWVWKHERQHDSDUW
• Transverse: occurs at right angles to the bone.
• Impacted:RQHIUDJPHQWLVIRUFLEO\GULYHQLQWRWKHRWKHU
• Colles’:IUDFWXUHRIWKHGLVWDOHQGRIWKHUDGLXVDQGWKHIUDJPHQWLVGLVSODFHGSRVWHULRUO\
• Potts’:IUDFWXUHRIWKHGLVWDOHQGRIWKH¿EXODZLWKVHULRXVLQMXU\RIWKHGLVWDOWLELDODUWLFXODWLRQ
• Displaced:FRUUHFWDQDWRPLFDODOLJQPHQWRIWKHERQHLVQRWPDLQWDLQHG
• Nondisplaced:FRUUHFWDQDWRPLFDODOLJQPHQWRIWKHERQHLVPDLQWDLQHG
• Stress:SDUWLDOIUDFWXUHUHVXOWLQJIURPWKHLQDELOLW\RIWKHERQHWRZLWKVWDQGUHSHDWHGVWUHVVHV HJGRLQJ
DHURELFVRQKDUGVXUIDFHVUXQQLQJORQJGLVWDQFHV $OPRVWDTXDUWHURIWKHVWUHVVIUDFWXUHVLQYROYHWKH¿EXOD
particularly the distal third.
• Pathologic:IUDFWXUHWKDWLVDUHVXOWRIQRUPDOVWUHVVRQDZHDNHQHGERQH,WRFFXUVLQVXFKGLVHDVHVDV
osteoporosis, neoplasia, osteomyelitis, and osteomalacia.

Nutrients Involved
9LWDPLQV&'%DQG.%FRPSOH[FDOFLXP]LQFPDJQHVLXPERURQVLOLFD

Suggested Nutritional Supplementation


• HP 16 Traumatic Injury Remedy²GURSVXQGHUWKHWRQJXHWLPHVGDLO\RQHPSW\VWRPDFK IRU
bottle)
$ KLJK TXDOLW\ KDQGPDGH KRPHRSDWKLF IRUPXOD GHVLJQHG WR VXSSRUW UHFXSHUDWLRQ DIWHU WUDXPDWLF LQMXU\
5HVWULFWFDIIHLQHDQGPHQWKROV
• Cal-Apatite Plus ²WDEOHWVGDLO\ZLWKPHDOV IRUZHHNVRIKHDOLQJ
0&+&ZLWKLSULÀDYRQHDQGYLWDPLQ'
• Protrypsin²FDSOHWVWLPHVGDLO\IRUGD\VRQHPSW\VWRPDFK
Select proteolytic enzymes.
• Chondro-Relief Intensive Care ²FDSVXOHVGDLO\ZLWKPHDOV IRUDWOHDVWERWWOHV
&RPSUHKHQVLYHMRLQW VRIWWLVVXHVXSSRUWZLWK060

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
• ,QFUHDVHIRRGVULFKLQFDOFLXPYLWDPLQ&YLWDPLQ'DQG%FRPSOH[

Exercise Considerations
• Passive exercise:)RUHDFKMRLQWRQHLWKHUVLGHRIIUDFWXUHEHJLQDVVRRQDVSRVVLEOHZLWKLQOLPLWVRISDLQ
'RQRWRYHUGR%HFDXWLRXVRIFUHDWLQJPXVFOHVSDVPV
• Water exercises:/RZHUH[WUHPLWLHVIRUVWUHVVIUDFWXUHV
• Non-contact exercises:
1. 6LWWLQJDWHGJHRISRROZLWKIHHWLQZDWHUPDNHFLUFOHVZLWKRQHIRRWDWDWLPHEHLQJVXUHWRPRYHDQNOH
WKURXJKIXOOUDQJHRIPRWLRQ
2. :LWKIHHWGDQJOLQJLQZDWHUGRDQNOHÀH[LRQDQGH[WHQVLRQV
3. 6LWWLQJDWHGJHRISRROZLWKRQHIRRWVOLJKWO\LPPHUVHGWUDFHRXWWKHOHWWHUV$%&MXVWXQGHUWKHZDWHU
4. :LWKIHHWLQZDWHUXSWRWKHNQHHVVLWWLQJDWHGJHRISRRONLFNRXWDZD\IURPSRROHGJHRQHIRRWDWD
time.
5. :LWKERG\LQWKHSRROKROGRQWRSRROHGJHDQGGRVWUDLJKWOHJNLFNV
6. 6DPHDVH[FHSWXVLQJ¿QV
190 Fracture

Contact exercises
1. :DONLQZDWHUZKLFKLVDERXWFKHVWKLJK
2. 6WDQGLQJLQFKHVWKLJKZDWHUKROGRQWRHGJHRISRROZKLOHUDLVLQJXSRQWRHV
3. 6DPHDVH[FHSWGRRQHIRRWDWDWLPHZKLOHRWKHUOHJLVUDLVHGIURPERWWRPRISRRO
4. ,QVKRXOGHUKLJKZDWHUKRSRQRQHIRRW

Workout schedule
• Week 1 and 2:RQO\¿UVWH[HUFLVHVGD\VSHUZHHNVHWVDWUHSV
• Week 3 and 4:DGGH[HUFLVHVHDFKZHHNGD\VSHUZHHNVHWVDWUHSV
• Week 5 and 6:DGGPRUHH[HUFLVHVGD\VSHUZHHNVHWVDWUHSVHDFK
Frozen Shoulder 191

Frozen Shoulder
$V\QGURPHLQZKLFKDVWLIIVKRXOGHULVUHVWULFWHGDQGSDLQIXOLQERWKDFWLYHDQGSDVVLYHPRYHPHQW$OVRNQRZQDV
adhesive capsulitis, periarthritis, and pericapsulitis. The involved joints are the scapulothoracic and glenohumeral.
7KHUHLVQRERQ\DQN\ORVLV&DXVHVLQFOXGHDQ\W\SHRISDLQLQWKHVKRXOGHUXSRQPRYHPHQWDQGLPPRELOL]DWLRQ
IURPVKRXOGHULQMXU\)UR]HQVKRXOGHULVVHHQPRVWRIWHQLQSDWLHQWVZLWKWHQGHQF\WRWHQVLRQDQ[LHW\DQGSDVVLYH
apathy (termed the periarthritis personality FRPELQHGZLWKDORZSDLQWROHUDQFH7KHSDWKRORJ\RIIUR]HQVKRXOGHU
LVEHOLHYHGWREHDVIROORZVSDLQLQWKHVKRXOGHU QHXURORJLFYDVFXODUPXVFXORVNHOHWDORUUHIHUUHGYLVFHUDO FDXVHV
YDVRVSDVPZKLFKOHDGVWRFRQJHVWLRQDQGP\RVSDVPZKLFKOHDGVWRGLVXVHDQGIXUWKHUYDVFXODUFRQJHVWLRQ
7KLV LQLWLDWHV WKH GHYHORSPHQW RI ¿EURXV WLVVXHV WKDW DUH UHVSRQVLEOH IRU IXQFWLRQDO GLVDELOLW\ 7KH XQWUHDWHG
FRXUVHHQGVLQWRWDOLPPRELOL]DWLRQRIWKHVKRXOGHUMRLQW3UHYHQWLRQLVWKHEHVWWUHDWPHQW2QFHWKHFRQGLWLRQLV
HVWDEOLVKHGFXUHEHFRPHVLQFUHDVLQJO\GLI¿FXOW,WLVXQXVXDOIRUDFRPSOHWHUHFRYHU\WRRFFXULQIUR]HQVKRXOGHU
SDWLHQWV&RQYHQWLRQDOWUHDWPHQWFRQVLVWVRIGUXJWKHUDS\ PXVFOHUHOD[DQWVVHGDWLYHVWUDQTXLOOL]HUVDQDOJHVLFV 
PDQLSXODWLRQRIWKHVKRXOGHUSDVVLYHDQGDFWLYHUDQJHRIPRWLRQH[HUFLVHVLFHSK\VLRWKHUDS\DQGSV\FKRORJLFDO
FRXQVHOLQJWRGLVSHODQ\DQ[LHW\DQGGHSHQGHQF\WKDWPD\EHSULPDU\RUVHFRQGDU\WRWKHIUR]HQVKRXOGHU

Symptoms
3DLQIXOOLPLWDWLRQRIWKHJOHQRKXPHUDOMRLQWZKLFKJUDGXDOO\EHFRPHVOHVVSDLQIXOEXWPRUHUHVWULFWHGLQPRWLRQ
$EGXFWLRQLVQRUPDODW¿UVWDQGWKHQDVWKHFRQGLWLRQSURJUHVVHVLVUHVWULFWHGEHFDXVHRISDLQ
$GYDQFHGVWDWHVQRSDLQZLWKLPPRELOL]DWLRQEXWSDLQLQDOOUDQJHRIPRWLRQRIWKHVKRXOGHUSDWLHQWFDUULHVWKH
arm in adduction and internal rotation.

Nutrients Involved
%URPHODLQYLWDPLQ&LQKLJKGRVHVYLWDPLQ(ÀD[VHHGRLOFDOFLXPPDJQHVLXP

Suggested Nutritional Supplementation


• Bromelain 1400²WDEOHWVWLPHVGDLO\EHWZHHQPHDOV
High potency bromelain.
Each tablet is pH sensitized to assure release in the intestinal tract.
• C Aspa Scorb²WHDVSRRQLQMXLFHRUZDWHUWLPHVGDLO\
High potency Vitamin C/magnesium combination.
• EPA-DHA 6:1²VRIWJHOVWLPHVGDLO\ZLWKPHDOV VHH(3$'+$VHFWLRQLQDSSHQGL[ 
$QWL,QÀDPPDWRU\HVVHQWLDOIDWW\DFLGVIURPFROGZDWHU¿VK

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
192 Glossitis and Tongue Related Conditions

Glossitis and Tongue Related Conditions


$QDFXWHRUFKURQLFLQÀDPPDWLRQRIWKHWRQJXH*ORVVLWLVPD\EHHLWKHUDSULPDU\RUVHFRQGDU\PDQLIHVWDWLRQRI
GLVHDVH6\VWHPLFGLVRUGHUVWKDWPD\FDXVHWKHSUREOHPLQFOXGHYLWDPLQGH¿FLHQF\ HVS%YLWDPLQV DQHPLD
SHUQLFLRXVRULURQGH¿FLHQF\ DQGDPXOWLWXGHRIVNLQGLVHDVHV DSKWKRXVOHVLRQVSHPSKLJXVHU\WKHPDPXOWLIRUP
OLFKHQ SODQXV HWF  /RFDO SUREOHPV WKDW PD\ JLYH ULVH WR JORVVLWLV LQFOXGH PHFKDQLFDO WUDXPD SRRUO\ ¿WWLQJ
GHQWXUHVMDJJHGWHHWK VHQVLWL]DWLRQ WRRWKSDVWHVFDQG\JXPDGGLWLYHVPRXWKZDVKHV RUGLUHFWRUDOLUULWDQWV
DOFRKROWREDFFRVSLF\IRRGV 
:KHQWKHPDLQUHDVRQIRUWKHJORVVLWLVLVXQFRYHUHGWKHFRQGLWLRQPD\XVXDOO\EHTXLFNO\UHYHUVHGAll ulcerated
lesions that fail to heal after 1-2 weeks should be biopsied.

Symptoms
7KHPDQLIHVWDWLRQVRIJORVVLWLVYDU\LPPHQVHO\GHSHQGLQJRQWKHFDXVHDQGWKHSDWLHQW
VRZQUHVSRQVHWRWKH
LQLWLDWLQJIDFWRU2IWHQWKHVHYHULW\RIWKHOHVLRQVGRHVQRWFRUUHODWHZLWKWKHSDWLHQW
VUHSRUWRQV\PSWRPVHYHULW\
$V WKH WRQJXH LV RIWHQ D YDOXDEOH PLUURU IRU GLVHDVH LQ WKH ERG\ SDUWLFXODUO\ LQ &KLQHVH PHGLFLQH  D SDWLHQW
SUHVHQWLQJZLWKJORVVLWLVVKRXOGEHVWXGLHGFORVHO\RQDV\VWHPLFOHYHO

Suggested Nutritional Supplementation


3HOODJUDSHUQLFLRXVDQHPLDVPRNLQJPHFKDQLFDOLUULWDWLRQ5HGGHQHGHGJHVDQGWLSRIWRQJXH$OVRKHDUWGLVHDVH
&KLQHVHPHGLFLQH ,QODWHUVWDWHVRISHOODJUDWKHHQWLUHWRQJXHLV¿HU\UHGXOFHUDWHGDQGVZROOHQ

Iron and B12 Deficiency


The tongue is pale and smooth.
• Hemagenics²WDEOHWVGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ

Painful Ulcers
$SKWKRXVXOFHUVVWUHSLQIHFWLRQSHPSKLJXVHWF
• Ultra Potent C-1000²WDEOHWVWLPHVGDLO\
$YLWDPLQ&PHWDEROLWHDGPL[WXUHSURYHQWRHQKDQFHWKHIXQFWLRQDODFWLYLW\RIYLWDPLQ&¶VLPPXQHVWLPXODWLQJ
properties.
• Glycogenics²WDEOHWVGDLO\ZLWKIRRG
+RPRF\VWHLQHEDODQFHG%&RPSOH[)RUPXOD
• Ultra Flora Plus²FDSVXOHVWZLFHGDLO\
&RQWDLQVKLJKO\YLDEOHSXUHVWUDLQVRI/DFWREDFLOOXVDFLGRSKLOXV 1&)0VWUDLQ DQG%L¿GREDFWHULDLQIDQWLV
JXDUDQWHHGWRFRQWDLQDWOHDVWELOOLRQOLYLQJRUJDQLVPVRIHDFKVWUDLQDWH[SLUDWLRQ
• Colloidal Silver ²XVHDVDPRXWKULQVHDQGVZDOORZWLPHVGDLO\

White Patches
Leukoplakia, Candidiasis, lichen planus, syphilitic mucus patch.
• &0HWKR[\ÀDYRQH²WDEOHWVGDLO\ZLWKIRRG
&HUWL¿HGDFWLYHKHVSHULGLQPHWKR[\ÀDYRQHFRPSOH[
• Mycelized Vitamin A — 10 drops 3 times daily.
Enhanced absorption vitamin A.
• Ultra Flora Plus²FDSVXOHVWZLFHGDLO\
&RQWDLQVKLJKO\YLDEOHSXUHVWUDLQVRI/DFWREDFLOOXVDFLGRSKLOXV 1&)0VWUDLQ DQG%L¿GREDFWHULDLQIDQWLV
JXDUDQWHHGWRFRQWDLQDWOHDVWELOOLRQOLYLQJRUJDQLVPVRIHDFKVWUDLQDWH[SLUDWLRQ

Geographic/Wandering Tongue
$V\PSWRPDWLFSUHVHQWDWLRQRIGHQXGHGUHGSDWFKHVZDQGHULQJDFURVVWKHVXUIDFHRIWKHWRQJXH&DXVHGE\
UDSLGJURZWKDQGORVVRI¿OLIRUPSDSLOODH
• Glycogenics²WDEOHWVGDLO\ZLWKIRRG
+RPRF\VWHLQHEDODQFHG%&RPSOH[)RUPXOD
Glossitis and Tongue Related Conditions 193

Hairy Tongue
(ORQJDWLRQRI¿OLIRUPSDSLOODHLQWKHPHGLDQGRUVDODUHDWKDWPD\VWDLQEURZQWREODFNEHFDXVHRIWREDFFRVPRNH
IRRGRUFKURPRJHQLFEDFWHULDORYHUJURZWK2IWHQVHHQZLWKDQWLELRWLFXVHIHYHUVGHFUHDVHGVDOLYDWLRQDQGXVH
RIR[\JHQIUHHLQJPRXWKZDVKHV
• DMG Sublingual²WDEOHWVGDLO\
,QFUHDVHVR[\JHQDQGLPPXQHHQKDQFHPHQW
• Bio-Guard — 2 droppers daily.
0LFHOOL]HGDQWLR[LGDQWIRUPXOD

Moeller's Glossitis
Slick, shiny/glazed tongue.
• Hemagenics²WDEOHWVGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ
• Glycogenics²WDEOHWVGDLO\ZLWKIRRG
+RPRF\VWHLQHEDODQFHG%&RPSOH[)RUPXOD

Severe, Acute Glossitis


8VXDOO\DUHVXOWRIWUDXPDEXUQVRULQIHFWLRQ0D\GHYHORSUDSLGO\ZLWKVZHOOLQJDQGSDLQ0D\SUHVHQWDVLJQL¿FDQW
GDQJHU E\ EORFNLQJ WKH DLUZD\ &KHZLQJ VSHDNLQJ DQG VZDOORZLQJ FDQ EH VR SDLQIXO DV WR EH LPSRVVLEOH WR
SHUIRUP
• &0HWKR[\ÀDYRQH²WDEOHWVGDLO\ZLWKIRRG
&HUWL¿HGDFWLYHKHVSHULGLQPHWKR[\ÀDYRQHFRPSOH[
• Bio-Guard²GURSSHUVWLPHVGDLO\
0LFHOOL]HGDQWLR[LGDQWIRUPXOD

Glossodynia/Glossopyrosis
3DLQIXOEXUQLQJWRQJXHRIWHQZLWKRXWOHVLRQVYLVLEOHWRH[SODLQWKHSDLQ7KLVLVPRVWO\VHHQLQSRVWPHQRSDXVDO
ZRPHQ
• Glycogenics²WDEOHWVGDLO\ZLWKIRRG
+RPRF\VWHLQHEDODQFHG%&RPSOH[)RUPXOD

For all acute inflammation of tongue add:


• +33DLQ ,QÀDPPDWLRQ²WDEOHWVWLPHVGDLO\RQDQHPSW\VWRPDFK
+RPHRSDWKLFIRUPXODIRULQÀDPPDWLRQVZHOOLQJDQGSDLQ

Signs associated with various specific nutrient deficiencies

Biotin
*HRJUDSKLFWRQJXHOLQJXDOSDSLOODHDWURSK\
• Glycogenics — 3 tablets daily.
+RPRF\VWHLQHEDODQFHG%&RPSOH[)RUPXOD

Riboflavin
6RUHQHVVDQGLQWUDRUDOEXUQLQJFKHLORVLVDQJXODUVWRPDWLWLVJORVVLWLVZLWKPDJHQWDWRQJXH
• Glycogenics — 3 tablets daily.
+RPRF\VWHLQHEDODQFHG%&RPSOH[)RUPXOD

Niacin
,QWUDRUDO EXUQLQJ JORVVLWLV WRQJXH VZROOHQ UHG WLS DQG VLGHV VZROOHQ UHG IXQJLIRUP SDSLOODH LQÀDPHG DQG
DWURSKLHG¿OLIRUPSDSLOODH
• Lipotain²WDEOHWVWZLFHGDLO\
1XWULWLRQDOVXSSRUWIRUKHDOWK\OLSLGOHYHOVZLWKDXQLTXHQDWXUDOQRQÀXVKIRUPRIQLDFLQ
194 Glossitis and Tongue Related Conditions

Pyridoxine
,QWUDRUDOEXUQLQJJORVVLWLVPXFRVDOXOFHUDWLRQVDQGHURVLRQVFKHLORVLV
• Pyridoyal-5' Phosphate²WDEOHWVGDLO\ZLWKIRRG
7KHDFWLYHIRUPRI%

Folic Acid
*LQJLYLWLVJORVVLWLVZLWKDWURSK\RUK\SHUWURSK\RU¿OLIRUPSDSLOODHFKHLORVLV
• Intrinsi B12/Folate²WDEOHWVGDLO\ZLWKIRRG
B12DQGIRODWHZLWKLQWULQVLFIDFWRU

Cobalamin
,QWUDRUDOEXUQLQJPXFRVDOHURVLRQVDQGXOFHUDWLRQVSDLQIXOJORVVLWLVZLWKEHHI\RU¿HU\UHGDWURSKLHGWRQJXH
• Intrinsi B12/Folate ²WDEOHWVGDLO\ZLWKIRRG
B12DQGIRODWHZLWKLQWULQVLFIDFWRU

Vitamin C
• 6RUHDQGEOHHGLQJJXPVJXPVGHHSEOXHFRORUORRVHWHHWKIROOLFXODUK\SHUNHUDWRVLV
• &0HWKR[\ÀDYRQH²WDEOHWVGDLO\ZLWKIRRG
&HUWL¿HGDFWLYHKHVSHULGLQPHWKR[\ÀDYRQHFRPSOH[

Iron
&KHLORVLVDWURSKLFJORVVLWLVJLQJLYLWLV&DQGLGLDVLVLQWUDRUDOSDLQRUEXUQLQJPXFRVDOXOFHUDWLRQVDQGHURVLRQV
pallor
• Hemagenics²WDEOHWVGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ

Dietary Suggestions
• FirstLine Therapy® Diet
Gout 195

Gout
*RXWLVDW\SHRIDUWKULWLVWKDWRFFXUVZKHQWRRPXFKXULFDFLGEXLOGVXSLQWKHERG\FDXVLQJFU\VWDOVWRIRUPLQ
MRLQWVDQGMRLQWVWREHFRPHLQÀDPHG,WFDQEHKHUHGLWDU\RUWKHUHVXOWRIDQRWKHUFRQGLWLRQ*RXWXVXDOO\DIIHFWV
PHQRYHUZLWKDIDPLO\KLVWRU\RIJRXWEXWLWFDQRFFXUDWDQ\WLPHDQGDOVRDIIHFWVZRPHQHVSHFLDOO\DIWHU
PHQRSDXVH([FHVVLYHLQWDNHRIIRRGDQGDOFRKROVXUJHU\LQIHFWLRQSK\VLFDORUHPRWLRQDOVWUHVVRUWKHXVHRI
FHUWDLQGUXJVFDQOHDGWRWKHGHYHORSPHQWRIJRXWV\PSWRPV

Signs and Symptoms


• ([WUHPHSDLQLQDVLQJOHMRLQWXVXDOO\WKHEDVHRIWKHELJWRHEXWRWKHUMRLQWVFDQDOVREHDIIHFWHG VXFKDV
WKHIHHW¿QJHUVZULVWVHOERZVNQHHVRUDQNOHV 
• -RLQWLVVKLQ\UHGSXUSOHVZROOHQKRWDQGVWLII
• )HYHUDVKLJKDVƒ& ƒ) ZLWKRUZLWKRXWFKLOOV
• 6\PSWRPVFDQGHYHORSYHU\TXLFNO\ZLWKWKH¿UVWHSLVRGHRIWHQRFFXUULQJDWQLJKWWKHQJRDZD\DIWHU
days only to come back later
• ,QODWHUDWWDFNV\RXPD\VHHOXPSV FDOOHGWRSKL MXVWXQGHUWKHVNLQLQWKHRXWHUHDUKDQGVIHHWHOERZRU
knee
7KHERG\HLWKHUSURGXFHVWRRPXFKXULFDFLGGRHVQ
WH[FUHWHHQRXJKXULFDFLGRUERWKVRWKDWWKHDFLGDFFXPXODWHV
LQWLVVXHVLQWKHIRUPRIQHHGOHOLNHFU\VWDOVWKDWFDXVHSDLQ*RXWJHQHUDOO\RFFXUVEHFDXVHRIDSUHGLVSRVLWLRQ
WRWKHFRQGLWLRQEXWLWFDQUHVXOWIURPEORRGGLVRUGHUVRUFDQFHUVVXFKDVOHXNHPLDRUWKHXVHRIFHUWDLQGUXJV
5LVNIDFWRUVLQFOXGH
• )DPLO\KLVWRU\RIJRXW
• +LJKOHYHOVRIWULJO\FHULGHV
• Drinking too much alcohol
• (DWLQJIRRGVULFKLQSXULQHVVXFKDVPHDWVKHOO¿VKDQGVZHHWEUHDGV8ULFDFLGLVIRUPHGZKHQSXULQHV
EUHDNGRZQ

Complementary and Alternative Therapies


$FRPELQDWLRQRIWKHUDSLHVFDQEHYHU\HIIHFWLYHDWGHFUHDVLQJERWKWKHOHQJWKDQGIUHTXHQF\RIDWWDFNV

Lifestyle
• Improve body composition.
• 'ULQNSOHQW\RIZDWHUWRKHOSWKHNLGQH\VÀXVKXULFDFLGIURPWKHERG\'HK\GUDWLRQRIWHQWULJJHUVDJRXW
attack.
• 5HVWULFWSXULQHVLQ\RXUGLHW)RRGVZLWKDKLJKSXULQHFRQWHQWLQFOXGHEHHIJRRVHRUJDQPHDWVVZHHWEUHDGV
PXVVHOVDQFKRYLHVKHUULQJPDFNHUHODQG\HDVW)RRGVZLWKDPRGHUDWHDPRXQWRISXULQHVLQFOXGHPHDWV
SRXOWU\¿VKDQGVKHOO¿VKQRWOLVWHGDERYH6SLQDFKDVSDUDJXVEHDQVOHQWLOVPXVKURRPVDQGGULHGSHDV
DOVRFRQWDLQPRGHUDWHDPRXQWVRISXULQHV
• Do not drink alcohol, especially beer.
• &KHUULHV2QHKDOISRXQGRIFKHUULHVSHUGD\ IUHVKRUIUR]HQ IRUZHHNVORZHUVXULFDFLGDQGSUHYHQWV
DWWDFNV&KHUULHVDQGRWKHUGDUNUHGEHUULHV KDZWKRUQEHUULHVDQGEOXHEHUULHV FRQWDLQDQWKRF\DQLGLQVWKDW
LQFUHDVHFROODJHQLQWHJULW\DQGGHFUHDVHLQÀDPPDWLRQ<RXPD\SUHIHUWRWDNHFKHUU\IUXLWH[WUDFWDVDSLOO
PJWKUHHWLPHVSHUGD\GXULQJDQDWWDFNPJSHUGD\WRSUHYHQWDWWDFNV &KHUU\MXLFH 
R]SHUGD\ LVDOVRKHOSIXO
• Vitamin C, taken in high doses, can help decrease blood uric acid levels. Note that there is a small subset
RISHRSOHZLWKJRXWZKRZLOODFWXDOO\JHWZRUVHZLWKKLJKOHYHOVRIYLWDPLQ&
• )ROLFDFLGPFJSHUGD\LQKLELWV[DQWKLQHR[LGDVHZKLFKLVUHTXLUHGIRUXULFDFLGSURGXFWLRQ
• %URPHODLQDQHQ]\PHIRXQGLQSLQHDSSOHLVDQDQWLLQÀDPPDWRU\7DNHPJWKUHHWLPHVSHUGD\
EHWZHHQPHDOV$VWKHDWWDFNVXEVLGHVWDNHWZRWLPHVSHUGD\WRSUHYHQWIXWXUHDWWDFNV
• 4XHUFHWLQDELRÀDYRQRLGLVDQDQWLLQÀDPPDWRU\WKDWPD\DOVRKHOSUHGXFHXULFDFLGOHYHOV,WLVXVXDOO\WDNHQ
ZLWKEURPHODLQLQWKHVDPHDPRXQW PJWKUHHWLPHVSHUGD\ 
• (3$ HLFRVDSHQWDHQRLFDFLG IRXQGLQ¿VKRLOLQKLELWVSURLQÀDPPDWRU\OHXNRWULHQHV'RVHLVPJSHU
day.
• $YRLGWDNLQJH[WUDQLDFLQDQGYLWDPLQ$%RWKPD\SOD\DUROHLQVRPHDWWDFNVRIJRXW
196 Gout

Suggested Nutritional Supplementation


• ActiFolate®²WDEOHWVWKUHHWLPHVGDLO\
$FWL)RODWHLVDSURSULHWDU\EOHQGRI/PHWK\OWHWUDK\GURIRODWH /07+) IRUP\OWHWUDK\GURIRODWH IRUP\O
7+) DQGIROLFDFLG
• EPA-DHA 720™ ²VRIWJHOVWLPHVGDLO\ZLWKPHDOV
(3$'+$SURYLGHVPJRIRPHJDHVVHQWLDOIDWW\DFLGVIURPFROGZDWHU¿VKSHUVRIWJHO
• ,QÀDYRQRLG,QWHQVLYH&DUHŠ²WDEOHWVGDLO\ZLWKPHDOV
6WDQGDUGL]HG+HUEDO5HOLHIIRU0LQRU3DLQ
• Ultra Potent-C® Powder²WHDVSRRQVLQZDWHURUMXLFHWLPHVGDLO\
8OWUD3RWHQW&3RZGHULVDQH[FOXVLYHSDWHQWHGIRUPXODWKDWLVGHVLJQHGWRHQKDQFHWKHXWLOL]DWLRQRI
Vitamin C.

If Toxicity is a concern
• UltraClear PLUS GD\([SUHVV'HWR[3URJUDP±VHH'HWR[L¿FDWLRQVHFWLRQ

Dietary Considerations
• FirstLine Therapy® Diet
• $YRLGRUJDQPHDWVPHDWVKHOO¿VKKHUULQJDQFKRYLHVVDUGLQHVOHQWLOVGU\SHDVGU\EHDQVVHDIRRG
PXVKURRPVDOFRKRO HVSEHHUZKLFKKDVDKLJKHUSXULQHFRQWHQWWKDQZLQHRUVSLULWV FRIIHHWHDFRFRD
FRODUH¿QHGFDUERK\GUDWHVIUXFWRVH LQFUHDVHVXUDWHSURGXFWLRQ DQGVDWXUDWHGIDW
Headache 197

Headache
Headache: Nonvascular
+HDGDFKHZLWKRXWYDVFXODUFDXVH7KHPRVWFRPPRQO\GLDJQRVHGFRQGLWLRQLQWKH8QLWHG6WDWHVZLWKRI
WKHVHFDXVHGE\PXVFOHWHQVLRQ&DXVHVLQFOXGHVXERFFLSLWDOPXVFOHVSDVPVIURPLQMXU\ ZKLSODVK SRVWXUDO
VWUDLQ FDXVHGIRUH[DPSOHE\DFRPSXWHUVFUHHQDQJOHGLQFRUUHFWO\ SLOORZWRRODUJHWKDWIRUFHVÀH[LRQRIWKH
neck during rest.
8VXDOO\JUDGXDORQVHWEXWWHQGVWRSHUVLVWLQF\FOLFDOSDWWHUQVRIWHQVLRQDQGUHOD[DWLRQ,QWLPHSDWWHUQVZLOOEH
KHOGLQWHQVLRQDVVRPDWLFG\VIXQFWLRQOHDGVWRVHJPHQWDOPDOSRVLWLRQ

Symptoms
0RVWFRPPRQO\DULVLQJIURPWHQVLRQLQWKHVXERFFLSLWDOPXVFXODWXUHJHQHUDOO\GRQRWWKUREEXWDUHIHOWDVD
FRQVWDQWGXOODFKHLQYDULRXVDUHDVRIWKHKHDGDQGQHFNDUHDVRISDLQDUHYDULHGEHFDXVHWKH\DUHRIWHQUHIHUUHG
SDLQ]RQHVIURPWULJJHUSRLQWVLQQHFNDQGVNXOOPXVFOHV

Nutrients Involved
9LWDPLQV&(%%%FRPSOH[FDOFLXPPDJQHVLXP

Suggested Nutritional Supplementation


• Dynagesic²WDEOHWVHYHU\PLQXWHVDWRQVHW
$QH[FOXVLYHHQ]\PDWLFDOO\SUHSDUHGPL[WXUHRIDFWLYDWHG:KLWH:LOORZ%DUN6DOLFLQDQG)HYHU)HZ
• Cenitol²VFRRSVLQZDWHURUMXLFHWRWLPHVGDLO\
Nervous system support.
• Wellness Essentials™²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[L¿FDWLRQVXSSRUW

Dietary Suggestions
• FirstLine Therapy® Diet
• AvoidVSLF\IRRGVDOFRKROH[FHVVVWLPXODWLRQFRIIHHFDIIHLQHFKRFRODWHIULHGIRRGVVWLPXODWLQJIRRGV
06*DVSDUWDPHGDLU\IRRGV DOOHUJ\ W\UDPLQHIRRGV DJHGFKHHVHUHGZLQHIHUPHQWHGVDXVDJH
• IncreaseSRWDVVLXPIRRGVIRUWKH30RUHYHQLQJKHDGDFKH
198 Headache

Headache: Vascular / Migraine


+HDGDFKHVIURPYDVFXODUGLVWXUEDQFH7KHUHDUHVHYHUDOW\SHVRIYDVFXODUKHDGDFKHV
Migraine:3HULRGLFWKUREELQJKHDGDFKHV7KHSURGURPHVHHPVWREHGXHWRDYDVRFRQVWULFWLRQRIWKHFHUHEUDO
EORRGYHVVHOV RUWKHYHVVHOVOHDGLQJLQWRWKHEUDLQ ZKLOHWKHKHDGDFKHLWVHOIVHHPVWREHGXHWRDYDVRGLODWLRQ
RIWKHEORRGYHVVHOVZLWKVXEVHTXHQWFRQJHVWLRQRIWLVVXHVVHHQPRUHRIWHQLQZRPHQDQGLVWKRXJKWWRDIIHFW
XSWRRIWKHSRSXODWLRQXVXDOO\EHJLQVEHWZHHQWKHDJHVRIDQGUHPLVVLRQVFRPPRQO\RFFXUDIWHU
DJHVXJJHVWLQJDKRUPRQDOFDXVHGH¿QLWHIDPLOLDOFRPSRQHQW
Hypertension:7KHKHDGDFKHLVW\SLFDOO\WKUREELQJDQGORFDWHGLQWKHRFFLSXWRUYHUWH[,WLVSDUR[\VPDO7KHUH
LVDKLVWRU\RIUHQDORUFDUGLRYDVFXODUGLVHDVH
Cluster (histamine headaches):0XFKPRUHIUHTXHQWLQPHQDVVRFLDWHGKLVWDPLQLFV\PSWRPV
Miscellaneous:7R[LFVWDWHVLQIHFWLRQVDOFRKROLVPXUHPLDOHDGDUVHQLFPRUSKLQHFDUERQPRQR[LGHSRLVRQLQJ
HQFHSKDOLWLGHVKHDGDFKHLVPRGHUDWHLQLQWHQVLW\WKHUHLVDKLVWRU\RIH[SRVXUHWRDWR[LQRURWKHUVLJQVDQG
V\PSWRPVWKDWZRXOGSRLQWWRDQDVVRFLDWHGPLFURRUJDQLVP

Symptoms
Migraine:0D\EHXQLODWHUDORUELODWHUDORIWHQORFDWHGDERXWRUEHKLQGDQH\HDQGVSUHDGLQJWRRQHRUERWKVLGHV
RIWKHKHDGIUHTXHQWO\WKHUHLVQDXVHDDQGYRPLWLQJZLWKDGHVLUHIRUGDUNQHVVDQGTXLHWWKHKHDGDFKHODVWV
IURPKRXUVWRGD\VFODVVLFW\SHKDVDSURGURPHRIYDULRXVV\PSWRPVVFLQWLOODWLQJVFRWRPDVPRRGVZLQJV
GL]]LQHVVDQGWLQQLWXVGD]]OLQJ]LJ]DJVSHUKDSVIHHOLQJRILPSHQGLQJGRRP3K\VLFDODQGQHXURORJLFDO¿QGLQJV
EHWZHHQDWWDFNVDUHXQPDUNDEOHGXULQJDWWDFNVWKHUHPD\EHWUDQVLHQWQHXURORJLFDOVLJQV
Hypertension:3K\VLFDOH[DPZLOOUHYHDOK\SHUWHQVLRQZLWKUHWLQRSDWK\HGHPDDQGFDUGLDF¿QGLQJV*HQHUDOO\
WKHK\SHUWHQVLYHKHDGDFKHLVDVVRFLDWHGZLWKDGYDQFHGK\SHUWHQVLYHGLVHDVHRUDWWDFNVRISRWHQWLDOO\VHULRXV
hypertension.
Cluster:+HDGDFKHVDUHSDUR[\VPDORIWHQZDNHWKHSDWLHQWDWQLJKWDEUXSWRQVHWRIVHYHUHSDLQWKDWODVWV
KRXUVRFFXUW\SLFDOO\LQFOXVWHUVRIGD\VWRZHHNVDQGWKHQDUHQRWH[SHULHQFHGDJDLQIRUPRQWKVRU\HDUV
XQLODWHUDOZLWKDVVRFLDWHGKLVWDPLQLFV\PSWRPV ODFULPDWLRQSOXJJHGQRVHSWRVLVFKHHNVÀXVKHGDQGHFGHPLF 
UHPLVVLRQVPD\RFFXUODVWLQJIRU\HDUVRUSHUPDQHQWO\7KHSK\VLFDOH[DPVKRZVIDFLDOYDVRFLODWLRQSXSLOODU\
FRQVWULFWLRQLQMHFWHGFRQMXQFWLYDWHQGHUQHVVWRSDOSDWLRQRIH[WHUQDODQGFRPPRQFDURWLGDUWHULHV
Miscellaneous:7KHUHLVDKLVWRU\RIH[SRVXUHWRDWR[LQRURWKHUVLJQVDQGV\PSWRPVWKDWZRXOGSRLQWWRDQ
associated microorganism.

Course and Prognosis


In general, migraine and cluster headaches are chronic conditions that recur and are not cured by conventional
treatment. Although they are both benign, the pain can be debilitating and cause much morbidity. Conventional
WUHDWPHQW XVXDOO\ LQYROYHV HUJRWDPLQH SURSK\OD[LV DQG QDUFRWLF DQDOJHVLFV 7KH K\SHUWHQVLYH KHDGDFKH LV
FRUUHFWDEOHE\FRQWUROOLQJWKHSDWLHQW¶VK\SHUWHQVLRQ,IXQFRQWUROOHGWKHQVHULRXVK\SHUWHQVLYHVHTXHODHPD\
RFFXU HJVWURNH 7KHWR[LFKHDGDFKHLVWUHDWHGE\GHDOLQJZLWKWKHWR[LFH[SRVXUHDQGULGGLQJWKHERG\RIWKH
VXEVWDQFH3URJQRVLVIRUPLJUDLQHKHDGDFKHLVIDYRUDEOHLIWKRURXJKDVVHVVPHQWDQGDYRLGDQFHRIWULJJHUVDORQJ
ZLWKELRFKHPLFDOPHWDEROLFWKHUDS\LVXQGHUWDNHQ

Nutrients Involved
• %FRPSOH[FKROLQHRPHJDDQGRPHJDIDWW\DFLGVPDJQHVLXPTXHUFHWLQEXWWHUEXUSHULOOD
NOTE:LQDOOIRUPVRIKHDGDFKHVVHQVLWLYLWLHVWRFHUWDLQIRRGRUHQYLURQPHQWDOIDFWRUVFDQEHDVLJQL¿FDQW
HQWLW\WRDGGUHVV,IGHWHUPLQHGWREHDGGWRWKHRXWOLQHGSURWRFROV3HUPLQH

Suggested Nutritional Supplementation

Migraine Headache
$W2QVHW
• Trancor™ - 4 capsules daily.
7UDQFRULVIRUPXODWHGWRVXSSRUWDVHQVHRIWUDQTXLOLW\LQWKRVHZKRPD\IHHOZRUULHGRUQHUYRXVE\EHQH¿FLDOO\
PRGXODWLQJWKHEDODQFHEHWZHHQWKHFDOPLQJLQÀXHQFHRI*$%$DQGWKHH[FLWDWRU\HIIHFWVRIJOXWDPDWH
• Dynagesic²WDEOHWVHYHU\PLQXWHVDWRQVHW
$QH[FOXVLYHHQ]\PDWLFDOO\SUHSDUHGPL[WXUHRIDFWLYDWHG:KLWH:LOORZ%DUN6DOLFLQDQG)HYHU)HZ
Headache 199

Preventive Maintanence
• Petadolex²FDSVXOHVWZLFHGDLO\ZLWKPHDOV
Helps maintain proper muscle tone in cerebral blood vessels especially important in migraine headaches.
• Trancor — 4 capsules daily.
• 5-Hydroxytryptophan Extra Strength²FDSVXOHVGDLO\ LQWKH$0DQGLQWKH30 $IWHUKHDGDFKHV
DUHXQGHUFRQWUROIRUZHHNVGHFUHDVHE\SLOOSHUZHHNXQWLOORZHVWGRVHLVIRXQGWKDWPDLQWDLQVWKH
patient symptoms.
• EPA-DHA Extra Strength²VRIWJHOVWLPHVGDLO\ZLWKPHDOV VHH(3$'+$VHFWLRQLQDSSHQGL[
(VVHQWLDOIDWW\DFLGVIURPFROGZDWHU¿VK
1DWXUDODQWLLQÀDPPDWRU\GRFXPHQWHGWREHQH¿WPLJUDLQHVXIIHUHUV

Hypertension Headache
• Vasotensin²WDEOHWVGDLO\ZLWKIRRG
9DVRWHQVLQSURYLGHDFWLYHSHSWLGHVIURPERQLWR¿VKWRKHOSSUHYHQWWKHIRUPDWLRQRIDQJLRWHQVLQ,,DSRWHQW
YDVRFRQVWULFWRUWKURXJKWKHLULQWHUDFWLRQZLWKDQJLRWHQVLQFRQYHUWLQJHQ]\PH $&( 7KLVDFWLYLW\VXSSRUWV
KHDOWK\YDVFXODUIXQFWLRQIRURSWLPDOEORRGÀRZDQGKHDOWK\EORRGSUHVVXUHOHYHOV
• Lipotain²WDEOHWVGDLO\
1XWULWLRQDOVXSSRUWIRUKHDOWK\EORRGOLSLGOHYHOV

Cluster
• Lipo-Gen²WDEOHWVGDLO\ZLWKPHDOV
&RPSUHKHQVLYHOLSRWURSLFIRUPXOD
• Lipotain²WDEOHWVGDLO\ZLWKPHDOV
1XWULWLRQDOVXSSRUWIRUKHDOWK\EORRGOLSLGOHYHOV

Toxic Headache
• $SSURSULDWH'HWR[L¿FDWLRQ3URJUDPVHH'HWR[L¿FDWLRQVHFWLRQ

Dietary Suggestions
• 0RGL¿HG(OLPLQDWLRQ'LHW
200 Hepatitis

Hepatitis
,QÀDPPDWLRQRIWKHOLYHUFKDUDFWHUL]HGE\SDWFK\RUJHQHUDOL]HGKHSDWRFHOOXODUQHFURVLV
7KHUHDUHPDMRUNLQGVRIKHSDWLWLVW\SH$W\SH%W\SH'DQGW\SHQRQ$QRQ%7KHGLVHDVHLVYLUDOLQRULJLQ
DQGDOWKRXJKW\SHV$%DQG'FDQEHGLVWLQJXLVKHGE\WKHLUDQWLJHQLFSURSHUWLHVDOOIRXUGLVSOD\DFOLQLFDOO\
VLPLODUSLFWXUH2WKHUOHVVFRPPRQLQIHFWLYHFDXVHVRIKHSDWLWLVLQFOXGHLQIHFWLRXVPRQRQXFOHRVLV\HOORZIHYHU
F\WRPHJDORYLUXVDQGOHSWRVSLURVLV+HSDWLWLVPD\DOVRIROORZH[SRVXUHWRVXEVWDQFHVOLNHFDUERQWHWUDFKORULGH
benzene, tetracyclines, amanita mushrooms, arsenic, phosphorus and alcohol.
Hepatitis A:7KHDVVRFLDWHGPLFURRUJDQLVPLVDQHQWHURYLUXVDQGWKHGLVHDVHLVVSUHDGE\WKHIHFDORUDOURXWH,W
LVFRQWDJLRXVGXULQJWKHLQFXEDWLRQSHULRGRIZHHNVEXWRQO\IRUDIHZGD\VRQFHV\PSWRPVDSSHDU(SLGHPLFV
DUHIUHTXHQWDVWKHYLUXVLVVSUHDGYHU\HDVLOO\WKURXJKIRRGDQGZDWHU2IWHQWKHGLVHDVHPD\EHVRPLOGLWLV
XQUHFRJQL]HGDQGRQO\EORRGZRUNZRXOGGLVHUQWKHYLUXV¶VSUHVHQFH,WGRHVQRWFUHDWHDFDUULHUVWDWHDQGGRHV
QRWOHDGWRFKURQLFOLYHUGLVHDVH8QOLNHWKHRWKHUKHSDWLWLVW\SHVZKLFKDUHVHHQLQDOODJHVHTXDOO\KHSDWLWLV$
is seen in mostly in children and young adults.
Hepatitis B:7KLVW\SHKDVDPRUHYDULHGUDQJHRIH[SUHVVLRQLQFOXGLQJVXEFOLQLFDOFDUULHUVWDWHDFXWHKHSDWLWLV
FKURQLFKHSDWLWLVSRVWKHSDWLFQHFURVLVDQGOLYHUFDQFHU+HSDWLWLV%LVVSUHDGSDUHQWHUDOO\PRVWQRWDEO\WKURXJK
WKHLQIHFWHGQHHGOHVRIGUXJDGGLFWVVSUHDGWKURXJKVH[XDOUHODWLRQVLVSRVVLEOHEXWRIDPXFKOHVVHUULVN0HGLFDO
SHUVRQQHOHVSHFLDOO\VXUJHRQVGHQWLVWGLDO\VLVVWDIIDQGRWKHUVLQFRQWDFWZLWKEORRGDUHDWSDUWLFXODUULVNIRU
DFFLGHQWDOWUDQVPLVVLRQ7KHLQFXEDWLRQWLPHUDQJHVIURPZHHNV DYHUDJHLVGD\V 
Hepatitis C:+HSDWLWLV&LQSDUWLFXODULVDQ$,'6OLNHYLUXVWKDWLVVSUHDGYLDEORRGWREORRGFRQWDFW,WLVXQFOHDU
KRZHYHUZKHWKHUWKH&VWUDLQLVVSUHDGWKURXJKVHPHQRUVDOLYD)RUPHUO\NQRZDV³QRQ$QRQ%´KHSDWLWLV&
ZDVLGHQWL¿HGLQZKHQDWHVWIRUVSHFL¿FDQWLERGLHVWRWKHYLUXVEHFDPHDYDLODEOH7KHPRVWFRPPRQPRGHV
RIWUDQVPLVVLRQLQFOXGHEORRGWUDQVIXVLRQVSULRUWR,9GUXJXVHKHPRGLDO\VLVWDWWRRLQJVKDULQJUD]RUVDQG
WRRWKEUXVKHVERG\SLHUFLQJDQGFRFDLQHVQRUWLQJ6H[XDOLQWHUFRXUVHLVQRWDFRPPRQPRGHRIWUDQVPLVVLRQ
Hepatitis D:7KLVFDQRQO\LQIHFWDSHUVRQZKRLVLQDFDUULHUVWDWHRIKHSDWLWLV%

Signs and Symptoms


0D\UDQJHIURPDPLQRUÀXOLNHLOOQHVVWRDVHYHUHOLYHUGLVHDVHHQGLQJLQKHSDWLFIDLOXUHDQGGHDWKWKHUHDUH
usually several distinct stages:

Anicteric phase:
• malaise
• IHYHU
• aversion to cigarettes
• DOWHUHGOLYHUIXQFWLRQWHVWV

Preicteric phase:
• malaise • myalgia
 ‡HQODUJHGWHQGHUOLYHU ‡ZHDNQHVV
 ‡KHDGDFKH ‡DQRUH[LDQDXVHDDQGYRPLWLQJ
 ‡IHYHU ‡GDUNXULQH
 ‡RFFDVLRQDOO\DSDWLHQWZLOOH[SHULHQFHDUWKDOJLDVDQGKLYHV

Jaundice phase: follows 3-10 days later


• OLYHUHQODUJHGDQGWHQGHUWKHHGJHLVVPRRWK
• PLOGVSOHQRPHJDO\LVSUHVHQWLQRISDWLHQWV
• GDUNXULQHDQGMDXQGLFHLQFOXGLQJWKHVFOHUDMDXQGLFHZRUVHQVIRUZHHNVDQGWKHQJUDGXDOO\GLVDSSHDUV
GXULQJWKHZHHNUHFRYHU\SHULRGZKHQWKHMDXQGLFHDSSHDUVPRVWSDWLHQWVEHJLQWRIHHOEHWWHUDVWKH
systemic symptoms decline
Hepatitis 201

Lab findings
• $676*27XQLWV GRHVQRWFRUUHODWHZLWKGLVHDVHVHYHULW\
• $/76*37XQLWV GRHVQRWFRUUHODWHZLWKGLVHDVHVHYHULW\
•  XULQDU\ELOLUXELQ
• GLIIHUHQWLDODW\SLFDOO\PSKRF\WHV
• :%&VORZQRUPDO
•  VHUXPELOLUXELQ XVXDOO\GLUHFW

Suggested Nutritional Supplementation


• Wellness Essentials™ ²SDFNHWWZLFHGDLO\
%DVHQXWULWLRQZLWKHVVHQWLDOIDWW\DFLGVDQGGHWR[VXSSRUW
• Liv 52²WDEOHWVWLPHVGDLO\
$QD\XUYHGLFKHUEDOSUHSDUDWLRQIRUOLYHUKHDOWKDQGUHJHQHUDWLRQ'RFXPHQWHGWREHDYDOXHLQKHSDWLWLV
• Lipogen²WDEOHWVHDFKPHDO
$VXSHULRUOLSRWURSKLFIRUPXODIRUQXWULWLRQDOVXSSRUWRIOLYHUIXQFWLRQ
• Ultra Potent C-1000²WDEOHWVWLPHVGDLO\
8OWUD3RWHQW&LVWKHVDPHH[FOXVLYHSDWHQWHGIRUPXODDV8OWUD3RWHQW&ŠEXWZLWKPJRI
vitamin C per tablet and a higher potency metabolite support system.

For Hepatitis B add:


• NAC (n-acetyl-l-cysteine) 600 mg²FDSVXOHVGDLO\
1$&KDVGHPRQVWUDWHGDQWLKHSDWLWLV%DFWLYLW\
• Mycotaki — 3 capsules daily.
0\FRWDNLLVDSRZHUIXOIRUPXODWKDWIHDWXUHVDFRQFHQWUDWHGZDWHUH[WUDFWRIQRXULVKLQJPXVKURRPVZLWK
DQH[WHQVLYHKLVWRU\RIXVHLQHQKDQFLQJKXPDQKHDOWK

For Hepatitis C add:


• Meta-Lipoate²FDSVXOHVWLPHVGDLO\
High quality alpha lipoic acid.
• Silymarin 80²WDEOHWVWLPHVGDLO\
+LJKTXDOLW\PLONWKLVWOHH[WUDFW
• Selenase ²FDSVXOHVWLPHVGDLO\
Naturally chelated selenium.
$FRPELQDWLRQRIOLSRLFDFLGVLO\PDULQDQGVHOHQLXP7KLVUHJLPHQZDVVHOHFWHGDVDFRQVHUYDWLYHWUHDWPHQW
IRUKHSDWLWLV&EHFDXVHWKHVHVXEVWDQFHVSURWHFWWKHOLYHUIURPIUHHUDGLFDOVDQGSURYLGHDQWLR[LGDQWVWKDW
LQWHUIHUHZLWKYLUDOSUROLIHUDWLRQ3DWLHQWVZKRIROORZHGWKLVWULSOHDQWLR[LGDQWSURJUDPUHFRYHUHGTXLFNO\
and their laboratory values remain remarkably improved.

Dietary Suggestions
• FirstLine Therapy® Diet
202 Herpes

Herpes
Herpes Simplex
Cold Sores/Fever Blisters
$VSUHDGLQJFXWDQHRXVHUXSWLRQ$Q\LQÀDPPDWRU\VNLQGLVHDVHFDXVHGE\DKHUSHVYLUXVDQGFKDUDFWHUL]HGE\
WKHIRUPDWLRQRIFOXVWHUVRIVPDOOYHVLFOHV:KHQXVHGDORQHWKHWHUPPD\UHIHUWRKHUSHVVLPSOH[RUWRKHUSHV
zoster.
Herpes simplex, caused by Type 1 virus and primarily spread by oral secretions, usually occurring as a concomitant
RIIHYHUEXWVRPHWLPHVDOVRGHYHORSLQJLQWKHDEVHQFHRIIHYHURUSULRULOOQHVVDQGFRPPRQO\LQYROYLQJWKHIDFLDO
UHJLRQHVSHFLDOO\WKHYHUPLOLRQERUGHURIWKHOLSVDQGWKHQDUHVWKHYHVLFXODUOHVLRQVDUHVHOIOLPLWHG$OVRFDOOHG
FROGVRUHDQGIHYHUEOLVWHU
Herpes simplexDJURXSRIDFXWHLQIHFWLRQVFDXVHGE\KHUSHVVLPSOH[YLUXV7\SHRU7\SHFKDUDFWHUL]HGE\
WKHGHYHORSPHQWRIRQHRUPRUHVPDOOÀXLG¿OOHGYHVLFOHVZLWKDUDLVHGHU\WKHPDWRXVEDVHRQWKHVNLQRUPXFRXV
PHPEUDQHDQGRFFXUULQJDVDSULPDU\LQIHFWLRQRUUHFXUULQJEHFDXVHRIUHDFWLYDWLRQRIDODWHQWLQIHFWLRQ7\SH
LQIHFWLRQVXVXDOO\LQYROYHQRQJHQLWDOUHJLRQVRIWKHERG\ZKHUHDVLQ7\SHLQIHFWLRQVWKHOHVLRQVDUHSULPDULO\
VHHQRQWKHJHQLWDODQGVXUURXQGLQJDUHDV3UHFLSLWDWLQJIDFWRUVLQFOXGHIHYHUH[SRVXUHWRFROGWHPSHUDWXUHRU
to ultraviolet rays, sunburn, cutaneous or mucosal abrasions, emotional stress, and nerve injury.
Traumatic herpesSULPDU\FXWDQHRXVKHUSHVVLPSOH[DFTXLUHGE\GLUHFWH[RJHQRXVLQIHFWLRQRIWUDXPDWL]HGVNLQ
XVXDOO\DVVRFLDWHGZLWKORFDOL]DWLRQRIOHVLRQVWRWKHDUHDRIWUDXPDDQGUHJLRQDOO\PSKDGHQRSDWK\DQGRIWHQE\
V\PSWRPVRIV\VWHPLFLOOQHVVVXFKDVIHYHUDQGPDODLVH6XFKLQIHFWLRQVKDYHEHHQVHHQLQZUHVWOHU¶VKHUSHV
DQGDFTXLUHGIURPPDWVRUERG\FRQWDFW

Nutrients Involved
9LWDPLQ&ELRÀDYRQRLGV/O\VLQHYLWDPLQ$(FKLQDFHD

Suggested Nutritional Supplementation


• L-Lysine²FDSVXOHVRQDQHPSW\VWRPDFKLQLWLDOO\WKHQFDSVXOHVWLPHVGDLO\RQDQHPSW\VWRPDFK
until lesions heal.
• ImmuCore ²WDEOHWVGDLO\
,PPX&RUHLVGHVLJQHGWRSURYLGHDPXOWLSOHPHFKDQLVWLFDSSURDFKWRVXSSRUWKHDOWK\LPPXQHV\VWHPIXQFWLRQ
WKURXJKHQKDQFLQJDFWLYLWLHVRIPDFURSKDJHVQDWXUDONLOOHUFHOOVDQG7FHOOVXEVHWV
• Echinacea Synergy²WDEOHWVWLPHVGDLO\
+HUEDOVXSSRUWIRULPPXQHIXQFWLRQ

Stress Support
• Serenagen ²WDEOHWVWLPHVGDLO\ZLWKOXNHZDUPZDWHULQEHWZHHQPHDOV
6HUHQDJHQLVDFODVVLFFRPSUHKHQVLYHKHUEDOVWUHVVPDQDJHPHQWIRUPXODWDUJHWLQJLQGLYLGXDOVZKRDUH
³VWUHVVHGDQGZLUHG´

Additional Considerations
$YRLG IRRGV HVSHFLDOO\ KLJK LQ DUJLQLQH ZKLFK VWLPXODWH KHUSHV RXWEUHDN FKRFRODWH SHDQXWV QXWV VHHGV
FHUHDOJUDLQVFDUREUDLVLQV $YRLGH[FHVVLYHVWUHVVDQ[LHW\DVWKLVLVRQHRIWKHJUHDWHVWSUHGLFWRUVRIKHUSHV
outbreak.

Dietary Suggestions
• FirstLine Therapy® Diet
Herpes 203

Herpes Zoster (Shingles)


Definition
$QDFXWHLQIHFWLRQFDXVHGE\UHDFWLYDWLRQRIWKHYDULFHOOD]RVWHUYLUXVDQGLQYROYLQJWKHGRUVDOURRWJDQJOLDFDXVHV
HUXSWLRQV DQG QHXUDOJLD RQ WKH VNLQ FRUUHVSRQGLQJ WR WKH GLVWULEXWLRQ RI WKH DIIHFWHG URRW JDQJOLD FRPPRQO\
NQRZQDV³VKLQJOHV´

Nutrients Involved
9LWDPLQ%YLWDPLQ&YLWDPLQ(3DQWRWKHQLF$FLGGO3KHQ\ODODQLQH

Suggested Nutritional Supplementation


• Neurosol²VRIWJHOWKUHHWLPHVGDLO\
$OOLQRQHIRUPXODIRUQXWULWLRQDOQHUYHVXSSRUW
• ImmuCore ²WDEOHWVGDLO\
,PPX&RUHLVGHVLJQHGWRSURYLGHDPXOWLSOHPHFKDQLVWLFDSSURDFKWRVXSSRUWKHDOWK\LPPXQHV\VWHPIXQFWLRQ
WKURXJKHQKDQFLQJDFWLYLWLHVRIPDFURSKDJHVQDWXUDONLOOHUFHOOVDQG7FHOOVXEVHWV
• E-Complex 1:1²FDSVXOHVGDLO\
1XWULWLRQDOVXSSRUWIRUSRVWKHUSHWLFQHXUDOJLD
• L-Lysine²FDSVXOHVRQDQHPSW\VWRPDFKLQLWLDOO\WKHQFDSVXOHWLPHVGDLO\RQDQHPSW\VWRPDFK
until lesions heal.
,QKLELWVDFWLYDWLRQRIKHUSHVYLUXV
(KKP[PVUHS*VUZPKLYH[PVUZ
• Tocophodermis Ointment — Apply topically to speed healing process, reduce scarring.
• D-68²GURSSHUIXOWLPHVGDLO\DVDKRPHRSDWKLFVXSSRUWLQKHUSHV]RVWHU

Dietary Suggestions
• FirstLine Therapy® Diet
204 Inflammatory Bowel Disease (IBD)

Inflammatory Bowel Disease (IBD)


Crohn's Disease, Ulcerative Colitis, Irritable Bowel Syndrome, and Celiac Disease

Crohn's disease
&URKQ
VGLVHDVH &' LVDFKURQLFFRQGLWLRQFKDUDFWHUL]HGE\SDWFK\DUHDVRILQÀDPPDWLRQDQGXOFHUV RSHQVRUHV 
DORQJWKHLQQHUPRVWOD\HURIWKHGLJHVWLYHWUDFW6XFKOHVLRQVFDQGHYHORSDQ\ZKHUHIURPWKHPRXWKWRDQXVEXW
WKHPDMRULW\RIFDVHVLQYROYHWKHVPDOOLQWHVWLQHRUWKH¿UVWSDUWRIWKHODUJHLQWHVWLQH%HWZHHQWKHVHSDWFKHVRI
LQÀDPPDWLRQDQGXOFHUDWLRQWKHUHUHPDLQVWUHWFKHVRIQRUPDOKHDOWK\WLVVXH
&'LVFORVHO\UHODWHGWRDVLPLODUFRQGLWLRQNQRZQDVXOFHUDWLYHFROLWLV 8& %RWK&'DQG8&DUHFRQVLGHUHG
LQÀDPPDWRU\ERZHOGLVHDVHV ,%' &'DIIHFWVEHWZHHQDQGRXWRISHRSOHDQGUHVHDUFKHUVEHOLHYH
WKDWWKHVHQXPEHUVDUHJURZLQJ&'GHYHORSVPRVWO\EHWZHHQWKHDJHVRIDQGDOWKRXJKFKLOGUHQDQGROGHU
DGXOWVPD\DOVRGHYHORSWKHFRQGLWLRQ3HRSOHRI-HZLVKKHULWDJHDUHXSWRVL[WLPHVPRUHOLNHO\WRGHYHORS&'
WKDQDUHSHRSOHLQWKHJHQHUDOSRSXODWLRQ$OWKRXJKPHGLFDWLRQDQGVWULFWGLHWVFDQUHGXFHWKHLQÀDPPDWLRQRI
&'PRVWSHRSOHZLWKWKHFRQGLWLRQZLOOUHTXLUHVXUJHU\WRUHPRYHSDUWRIWKHGLJHVWLYHWUDFWDWVRPHSRLQWLQWKHLU
OLYHV8QIRUWXQDWHO\KRZHYHUVXUJHU\GRHVQRWFRPSOHWHO\FXUHRUHUDGLFDWHWKHGLVHDVH

Ulcerative colitis
8OFHUDWLYHFROLWLV 8& LVDFKURQLFGLVHDVHWKDWFDXVHVLQÀDPPDWLRQDQGXOFHUV RSHQVRUHV LQWKHLQQHUPRVW
OD\HUVRIWKHODUJHLQWHVWLQH8&LVDQLQÀDPPDWRU\ERZHOGLVHDVH ,%' WKHJHQHUDOQDPHIRUGLVHDVHVWKDWFDXVH
LQÀDPPDWLRQLQWKHLQWHVWLQHV,Q8&VZHOOLQJW\SLFDOO\RFFXUVLQWKHUHFWXPDQGORZHUFRORQEXWWKHLQÀDPPDWLRQ
FDQVSUHDGWKURXJKRXWWKHHQWLUHFRORQ7KHXOFHUVEOHHGDQGSURGXFHSXVDQGPXFXVDQGWKHLQÀDPPDWLRQ
FDXVHVWKHFRORQWRHPSW\IUHTXHQWO\UHVXOWLQJLQGLDUUKHD
8&LVDUDUHEXWVHULRXVGLVHDVHWKDWDIIHFWVRXWRIHYHU\SHRSOHLQWKH8QLWHG6WDWHV$OWKRXJK
WKHFRQGLWLRQPRVWFRPPRQO\DIIHFWVWKRVHEHWZHHQWKHDJHVRIDQGFKLOGUHQDQGROGHUDGXOWVPD\DOVR
GHYHORSWKHGLVHDVH8&RFFXUV¿YHWLPHVPRUHIUHTXHQWO\LQWKRVHZLWKD-HZLVKKHULWDJHWKDQLWGRHVLQWKH
JHQHUDOSRSXODWLRQ$OWKRXJKPRVWSHRSOHZLWK8&FDQEHVXFFHVVIXOO\WUHDWHGZLWKRXWVXUJHU\URXJKO\ZLOO
QHHGDFROHFWRP\ VXUJLFDOUHPRYDORIWKHFRORQ 

Irritable Bowel Syndrome


,UULWDEOHERZHOV\QGURPH ,%6 RFFXUVZKHQPXVFOHVLQ\RXULQWHVWLQHVFRQWUDFWIDVWHURUVORZHUWKDQQRUPDO7KLV
FDXVHVSDLQFUDPSLQJJDVVLQHVVVXGGHQERXWVRIGLDUUKHDDQGFRQVWLSDWLRQ
7KHUHDUHWZRW\SHVRI,%63HRSOHZKRVXIIHUIURPVSDVWLFFRORQ,%6H[SHULHQFHFRQVWLSDWLRQGLDUUKHDRUERWKDQG
RIWHQKDYHSDLQDIWHUHDWLQJ3DLQOHVVGLDUUKHD,%6LQYROYHVWKHVXGGHQRQVHWRIGLDUUKHDGXULQJRUDIWHUPHDOVRU
XSRQZDNLQJ%HWZHHQRIWKHSRSXODWLRQKDV,%6DWVRPHWLPH7KHV\QGURPHRIWHQVWDUWVLQDGROHVFHQWV
RU\RXQJDGXOWV,WDIIHFWVDOPRVWWZLFHDVPDQ\ZRPHQDVPHQDQGLVRIWHQDVVRFLDWHGZLWKVWUHVV

Celiac Disease
&HOLDFGLVHDVHDOVRFDOOHGFHOLDFVSUXHLVDQLQKHULWHGGLVHDVHWKDWGDPDJHVWKHVPDOOLQWHVWLQHDQGLQWHUIHUHV
ZLWKGLJHVWLRQ3HRSOHZLWKWKLVGLVHDVHFDQQRWWROHUDWHDSURWHLQFDOOHGJOXWHQDQGDVDUHVXOWWKH\KDYHWURXEOH
DEVRUELQJQXWULHQWVIURPIRRG*OXWHQLVIRXQGLQZKHDWEDUOH\U\HDQGSRVVLEO\RDWSURGXFWV6RPHYLWDPLQV
and medicines also contain gluten.
7KHVPDOOLQWHVWLQHLVOLQHGZLWK¿QJHUOLNHSURMHFWLRQVFDOOHGYLOOLZKLFKKHOSDEVRUEQXWULHQWV,QFHOLDFGLVHDVH
WKHVHYLOOLEHFRPHÀDWWHQHGVRWKH\GRQ¶WZRUNDVZHOODQGWKHSHUVRQEHFRPHVPDOQRXULVKHG

Causes
5HVHDUFKHUVGRQ¶WNQRZWKHH[DFWFDXVHRIFHOLDFGLVHDVH2QFHWKRXJKWUDUHUHFHQWUHVHDUFKVXJJHVWVWKDWDQ
HVWLPDWHGRIHYHU\$PHULFDQVKDVFHOLDFGLVHDVH+RZHYHULQWKH8QLWHG6WDWHVRQO\DVPDOOIUDFWLRQRI
SHRSOHOLYLQJZLWKWKHGLVHDVHDUHGLDJQRVHG
3HRSOHZKRKDYHDIDPLO\KLVWRU\RIFHOLDFGLVHDVHDUHDWJUHDWHUULVNIRUGHYHORSLQJWKHFRQGLWLRQ,WLVPRVW
FRPPRQLQ&DXFDVLDQVDQGWKRVHRI(XURSHDQDQFHVWU\:RPHQDUHDIIHFWHGPRUHFRPPRQO\WKDQPHQ

Comprehensive GI Restoration (4R)


RemovingRIIHQGLQJVXEVWDQFHVIURPWKHGLHW)RRGDOOHUJHQVDQGRWKHUPDWHULDOVWKDWQHJDWLYHO\LQÀXHQFHWKH
LQWHVWLQDOHQYLURQPHQWFDQFDXVHORFDOL]HGLUULWDWLRQRUWULJJHUWKHUHOHDVHRIGDPDJLQJFKHPLFDOVLQWRJHQHUDO
FLUFXODWLRQDIIHFWLRQRWKHUWLVVXHVDQGRUJDQV
Inflammatory Bowel Disease (IBD) 205

ReplacingGLJHVWLYHHQ]\PHVDQGVWRPDFKDFLGZKHUHQHFHVVDU\'LJHVWLYHIDFWRUVDQGHQ]\PHVIDFLOLWDWHWKH
EUHDNGRZQRIIRRG$QLQVXI¿FLHQF\RIWKHVHFRPSRXQGVLVYHU\FRPPRQHVSHFLDOO\DVZHDJHZKLFKLQKLELWV
RSWLPDOGLJHVWLRQDQGXWLOL]DWLRQRIQXWULHQWVDVZHOODVWKHHOLPLQDWLRQRIZDVWH
ReinoculatingWKHERZHOZLWKSUHDQGSURELRWLFV5HLQWURGXFLQJKHDOWKSURPRWLQJ³IULHQGO\´EDFWHULDVXFKDV
/DFWREDFLOOXVDFLGRSKLOXV1&)0ŠKHOSVPDLQWDLQDGHVLUDEOHEDODQFHRI*,PLFURÀRUD7KLVEDODQFHLVFULWLFDOWR
LQWHVWLQDOWLVVXH PXFRVDO KHDOWKLPPXQHIXQFWLRQLQWHVWLQDOEDUULHUIXQFWLRQDQGGLJHVWLRQ
RegeneratingWKHJDVWURLQWHVWLQDOPXFRVDWKURXJKSURSHUQXWULWLRQDOVXSSRUW5HJHQHUDWLRQRI*,PXFRVDOFHOOV
LVQHFHVVDU\ZKHQHYHUWKHUHKDVEHHQDORVVRILQWHJULW\RIWKH*,PXFRVDOVWUXFWXUHRUIXQFWLRQDVPD\EH
FDXVHGE\DQ\*,LQVXOW

Suggested Nutritional Supplementation

Core Nutritional Support Protocol


• 8OWUD,QÀDP;Š3OXV²VFRRSVWZLFHGDLO\
0XOWLPHFKDQLVWLFVXSSRUWZLWKNH\QXWULHQWVSK\WRQXWULHQWVDQGVHOHFWLYHNLQDVHUHVSRQVHPRGXODWRUV
6.50V WRDGGUHVVXQGHUO\LQJLQÀDPPDWLRQ
• )ROORZHLWKHUWKH0RGL¿HG(OLPLQDWLRQ'LHW or the $QWL,QÀDPPDWRU\'LHW
• /DFWR)ODP;Œ²FDSVXOHGDLO\
/DFWR)ODP;IHDWXUHVL. plantarum 299V²DVWUDLQLGHQWL¿HGSURELRWLFWKDWKDVEHHQVSHFL¿FDOO\VKRZQ
WRVXSSRUWWKHLQWHJULW\DQGKHDOWK\IXQFWLRQRIWKHPXVFRVDOOLQLQJ
• EPA-DHA 6:1™ Enteric Coated ²VRIWJHOVWKUHHWLPHVGDLO\
(3$'+$(QWHULF&RDWHGRPHJDIDWW\DFLGVSURYLGLQJDUDWLRDSSURSULDWHIRUSDWLHQWVZLWKFKURQLF
LQÀDPPDWRU\FRQGLWLRQV
• Iso D3™ — 1 tablet three times daily.
9LWDPLQ'ZLWK,VRÀDYRQHV,VR'LVGHVLJQHGWRVXSSRUWRSWLPDOPHWDEROLVPRIYLWDPLQ'WRLWVDFWLYH
IRUP
If there is a soy sensitivity use:
• D3 1000™ — 2 microtablets three times daily.
+LJKSRWHQF\YLWDPLQ'²WKHPRVWELRDFWLYHIRUPRIVXSSOHPHQWDOYLWDPLQ'

Additional Nutritional Support Considerations


Gastrointestinal Restoration (4R Program)
• Endefen™ — 1 tsp. three times daily
(QGHIHQLVXQLTXHO\GHVLJQHGWRQXWULWLRQDOO\VXSSRUWWKHRYHUDOOKHDOWKDQGIXQFWLRQRIWKHXSSHUJDVWURLQWHVWLQDO
*, WUDFW
• UltraFlora I.B.™²FDSVXOHVGDLO\
8OWUD)ORUD,%LVDQHQKDQFHGSRWHQF\SURELRWLFIRUPXODGHVLJQHGWRKHOSUHOLHYHERZHOLUULWDWLRQDQGUHODWHG
IXQFWLRQDOGLVFRPIRUWVE\SURPRWLQJDKHDOWK\EDODQFHRILQWHVWLQDOPLFURÀRUD
• Glutagenics® — 2 tsp. three times daily
*OXWDJHQLFVIHDWXUHVWKUHHNH\LQJUHGLHQWV²JOXWDPLQHGHJO\F\UUKL]LQL]HGOLFRULFH '*/ DQGDORHYHUD²WKDW
FRPSUHKHQVLYHO\VXSSRUWWKHLQWHJULW\DQGKHDOWK\IXQFWLRQRIWKHJDVWURLQWHVWLQDOOLQLQJ

Body composition management


• High BMI ²,QWURGXFHORZHUFDORULH0RGL¿HG(OLPLQDWLRQRU$QWLLQÀDPPDWRU\'LHW
• Low BMI²,QWURGXFHKLJKHUFDORULH0RGL¿HG(OLPLQDWLRQRU$QWLLQÀDPPDWRU\'LHWDQGPHDVXUHKV&53
,IKV&53LVJUHDWHUWKDQPJOWKHQLQFUHDVH.DSUH[Š$,WRWDEOHWVWKUHHWLPHVGDLO\

Insulin resistance and dysglycemia


• 0HWDJO\FHP;Œ— 2 tablets, three times daily

Sex hormone dysregulation


• EstroFactors® — 3 tablets daily.
• Meta I3C® — 2 capsules daily.
• ActiFolate® — 1 tablet, three times daily.
206 Inflammatory Bowel Disease (IBD)

Hepatic detoxification imbalances/Drug or Chemical toxicity


• AdvaClear® — FDSVXOHVWZLFHGDLO\

TH1 dominance or chronic allergy


• EstroFactors® or Testralin® — 3 tablets daily.

Impaired biotransformation or hepatic detoxification imbalances


• AdvaClear® —FDSVXOHVWZLFHGDLO\
• Silymarin 80 — 3 tablets daily.

Oxidative stress
• Oxygenics® — WDEOHWVGDLO\
• Celapro® —VRIWJHOVGDLO\
• MetaLipoate® 300 —WDEOHWWZLFHGDLO\

Vitamin A insufficiency
• Ultra Pure Cod Liver Oil™ — 1 tsp, three times daily

Thyroid Support
• Thyrosol® —WDEOHWVWZLFHGDLO\

Dietary Considerations
• $QWL,QÀDPPDWRU\'LHW
Influenza 207

Influenza
,QÀXHQ]DRU³ÀX´LVDFRPPRQLQIHFWLRQFDXVHGE\DYLUXVDIIHFWLQJWKHUHVSLUDWRU\WUDFW OLNHWKHQRVHDQGXSSHU
DLUZD\V ,WVV\PSWRPVDUHXVXDOO\PRUHVHYHUHWKDQWKHFRPPRQFROGDQGDUHPRUHOLNHO\WRDIIHFWRWKHUSDUWV
RI\RXUERG\OLNH\RXUVWRPDFKDQGPXVFOHV7KHÀXLVYHU\FRQWDJLRXV±VSUHDGLQJHDVLO\IURPRQHSHUVRQWRWKH
QH[W:KLOHPRVWFDVHVUXQWKHLUFRXUVHLQRQHWRWZRZHHNVOLIHWKUHDWHQLQJFRPSOLFDWLRQVVXFKDVSQHXPRQLD
DUHSRVVLEOHHVSHFLDOO\LQWKHHOGHUO\RUSHRSOHZLWKFKURQLFLOOQHVVHV

Signs and Symptoms


• Fever that comes on suddenly (101 to 104 F)
• Chills
• Headache
• Muscle aches
• Fatigue
• Nonproductive cough
• Sore throat
• 6QHH]LQJUXQQ\QRVHVWXII\QRVH
• /RVVRIDSSHWLWH
• Nausea, vomiting, or diarrhea, especially in children

Causes
,QÀXHQ]DLVFDXVHGE\YLUXVHVWKDWDUHVSUHDGWKURXJKWKHDLUE\VQHH]HVDQGFRXJKV6RPHRIWKHVHYLUXVHV
FDXVHDYHU\PLOGLOOQHVVRUQRQHDWDOO2WKHUVFDXVHVHULRXVZLGHVSUHDGLOOQHVV

Risk Factors
3HRSOHPRVWOLNHO\WRJHWLQÀXHQ]DDUHWKRVHZKRVHLPPXQHV\VWHPVDUHQRWZRUNLQJSURSHUO\ IRUH[DPSOH
WUDQVSODQWUHFLSLHQWVRUSHRSOHZLWK+,9 RUWKRVHZKRVHOLIHVW\OHRUZRUNEULQJVWKHPLQWRIUHTXHQWFRQWDFWZLWK
VLFNSHRSOH OLNHKHDOWKFDUHZRUNHUV 
7KHIROORZLQJSXW\RXDWJUHDWHVWULVNIRUFRPSOLFDWLRQVIURPLQÀXHQ]D
• Age over 50
• Having a serious underlying medical condition like diabetes, heart disease, lung disease (such as asthma
RUF\VWLF¿EURVLV RUNLGQH\GLVHDVH
• +DYLQJDZHDNHQHGLPPXQHV\VWHP

Diagnosis
<RXUKHDOWKFDUHSURYLGHUZLOOSUREDEO\EHDEOHWRGLDJQRVH\RXUFDVHRIÀXIURPDSK\VLFDOH[DPLQDWLRQDQGD
GHVFULSWLRQRI\RXUV\PSWRPV+HRUVKHPD\WDNHDFKHVW;UD\LIWKHUHLVFRQFHUQDERXWFRPSOLFDWLRQVVXFK
as pneumonia.

Lifestyle
• 'ULQNDORWRIZDWHU
• Rest to restore your energy and avoid complications like pneumonia.
• (DWDGLHWULFKLQIUHVKIUXLWVDQGYHJHWDEOHV7KHVHIRRGVSURYLGHORWVRIDQWLR[LGDQWV VXEVWDQFHVWKDWPD\
help boost your immune system), especially vitamins A and C.
• ([HUFLVHUHJXODUO\ZKLFKPD\GLPLQLVK\RXUFKDQFHVRIJHWWLQJWKHÀX
• 0LQLPL]H\RXUVWUHVVDQG\RXUUHDFWLRQWRVWUHVV&RQVLGHU\RJDWDLFKLRURWKHUIRUPVRIUHOD[DWLRQRQDQ
RQJRLQJEDVLV6WUHVVFDQSXW\RXDWLQFUHDVHGULVNIRUYLUXVHVOLNHLQÀXHQ]D
208 Influenza

Suggested Nutritional Supplementation


• Flu Terminator — Ten drops several times daily
%URDG6SHFWUXPKRPHRSDWKLFUHPHG\IRULQÀXHQ]D
• Andrographis Plus® ²WDEOHWVHYHU\WZRKRXUVIRUKRXUVZLWKXQFKLOOHGZDWHU7KHQWDNHWDEOHWWLPHV
GDLO\EHWZHHQPHDOVIRU¿YHGD\V
$QGURJUDSKLV3OXVFRPELQHVDSURSULHWDU\EOHQGRI$\XUYHGLFDQG$VLDQKHUEVGHVLJQHGWRSURPRWHKHDOWK\
LPPXQHIXQFWLRQ
• ImmuCore™ — 3 tablets daily
,PPX&RUHLVGHVLJQHGWRSURYLGHDPXOWLSOHPHFKDQLVWLFDSSURDFKWRVXSSRUWKHDOWK\LPPXQHV\VWHPIXQFWLRQ
WKURXJKHQKDQFLQJDFWLYLWLHVRIPDFURSKDJHVQDWXUDONLOOHUFHOOVDQG7FHOOVXEVHWV
• NAC-600 — 1 tablet 2 to 3 times daily
• Ultra Flora Plus® DF Capsules — 2 capsuls 3 times daily
8OWUD)ORUD3OXV')&DSVXOHVLVDLVDQRQGDLU\SURELRWLFIRUPXODWKDWSURYLGHVKLJKO\YLDEOHSXUHVWUDLQVRI
/DFWREDFLOOXVDFLGRSKLOXV 1&)0ŠVWUDLQ DQG%L¿GREDFWHULXPODFWLVDORQJZLWKVXSSRUWLYHIDFWRUV

If Vomiting:
• Probioplex® Intensive Care ²WDEOHVSRRQLQXQFKLOOHGZDWHUWLPHVGDLO\
3URELRSOH[,QWHQVLYH&DUHLVDQLQQRYDWLYHSURELRWLFVXSSRUWIRUPXODIHDWXULQJFRQFHQWUDWHGZKH\SURWHLQFRPELQHG
ZLWKIUXFWRROLJRVDFFKDULGHV )26 DQGWKHDGYDQFHGSUHELRWLFIDFWRUVODFWRIHUULQDQGODFWRSHUR[LGDVH

If Diarrhea:
• Florastor®²FDSVXOHVWZLFHGDLO\
Intervertebral Disc Disease 209

Intervertebral Disc Disease


5XSWXUHRIWKHDQQXOXV¿EURVHVFDXVLQJOHDNLQJRIWKHQXFOHXVSXOSRVXVLQWRWKHLQWUDGXUDOVSDFH$OVRFDOOHG
herniated disc, herniated nucleus pulposus, ruptured disc, or disc syndrome.
7KHFDXVHLVGHJHQHUDWLRQRIWKH¿EHUVRIWKHDQQXOXV¿EURVXVRUWUDXPDRIWKHDUHDOHDGLQJWRWKHUXSWXUHRIWKH
DQQXOXV5XSWXUHXVXDOO\RFFXUVDWPLGGOHDJHRUROGHU7KHQWKHQRUPDOSUHVVXUHWKDWH[LVWVLQWKHVSLQHIRUFHV
WKHQXFOHXVSXOSRVXVWKURXJKWKHUXSWXUHZKLFKW\SLFDOO\RFFXUVLQWKHSRVWHULRURUSRVWHURODWHUDODVSHFWRIWKH
GLVF7KHPRVWIUHTXHQWO\DIIHFWHGGLVFVDUHEHWZHHQWKHWKOXPEDUDQGWKOXPEDUDQGEHWZHHQWKHWKOXPEDU
DQGWKH¿UVWVDFUDOYHUWHEUDH7KHRWKHUOXPEDUGLVFVUXSWXUHOHVVFRPPRQO\7KHWKRUDFLFVDUHUDUHO\DIIHFWHG
EXWKHUQLDWLRQDOVRRFFXUVEHWZHHQWKHWKDQGWKFHUYLFDODQGWKDQGWKFHUYLFDOYHUWHEUDH6\PSWRPVRIWKH
UXSWXUHRFFXUZKHQWKHQXFOHXVSXOSRVXVFRPSUHVVHVDQHUYHURRWXVXDOO\XQLODWHUDOO\EXWELODWHUDOFRPSUHVVLRQ
PD\UHVXOWLIWKHOHVLRQZDVODUJHHQRXJK
3URJQRVLVLVJRRGZLWKSURSHUWUHDWPHQW5HFXUUHQFHLVSRVVLEOHLIWKHSDWLHQWLVQRWLQVWUXFWHGKRZWRSUHYHQW
VLPLODUIXWXUHLQMXU\ OLIWZLWKNQHHVEHQWQRWZLWKWKHEDFNGRQ¶WOLIWDQGWZLVWHWF 

Symptoms
+LVWRU\RIWUDXPDOLIWLQJDKHDY\REMHFWDOLIWDQGWZLVWPDQHXYHUVXGGHQSDLQZKLFKPD\RIWHQEHVHYHUHDQG
GHELOLWDWLQJSDLQLVZRUVHZLWKPRYHPHQWÀH[LRQRIWKHWUXQNRUKLSVQHH]LQJFRXJKLQJVWUDLQLQJDWVWRROUDGLFXODU
SDLQSDUDHVWKHVLDGHFUHDVHG'75VPXVFOHVLQQHUYDWHGE\WKHFRPSUHVVHGQHUYHPD\IDVFLFXODWHEHFRPHZHDN
DQGDWURSK\WZLWFKRUVSDVP  VWUDLJKWOHJUDLVHDQGRWKHUPXVFXORVNHOHWDOFRQ¿UPLQJWHVWVXULQHUHWHQWLRQ
RULQFRQWLQHQFHIURPORVVRIEODGGHUFRQWURO WKLVLVDPHGLFDOHPHUJHQF\ 

Nutrients Involved
%LRÀDYRQRLGVYLWDPLQ&YLWDPLQ(

Suggested Nutritional Supplementation


• Chondro-Relief Intensive Care²FDSVXOHVGDLO\ZLWKIRRG
-RLQW VRIWWLVVXHVXSSRUWZLWK060*UHHQ/LSSHG0XVVHO+\DOXURQLF$FLGDQG$68
• ,QÀDYRQRLG,QWHQVLYH&DUH²WDEOHWVGDLO\ZLWKPHDOV
)RUUHOLHIRIPLQRUSDLQ
• E-Complex 1:1²VRIWJHOVGDLO\
UDWLRRIDOSKDDQGJDPPDWRFRSKHU\OV

Dietary Suggestions
FirstLine Therapy® Diet
210 Insomnia

Insomnia
,QVRPQLD LV WKH LQDELOLW\ WR VOHHS ZKHQ VOHHS VKRXOG QRUPDOO\ RFFXU 6XI¿FLHQW DQG UHVWIXO VOHHS LV D KXPDQ
QHFHVVLW\7KHDYHUDJHDGXOWQHHGVVOLJKWO\PRUHWKDQHLJKWKRXUVRIVOHHSSHUGD\DQGRQO\RI$PHULFDQ
DGXOWVFRQVLVWHQWO\JHWWKLVDPRXQWRIUHVW

People with insomnia tend to experience one or more of the following sleep disturbances:
• 'LI¿FXOW\IDOOLQJDVOHHSDWQLJKW
• :DNLQJWRRHDUO\LQWKHPRUQLQJ
• :DNLQJIUHTXHQWO\WKURXJKRXWWKHQLJKW
,QVRPQLDPD\VWHPIURPDGLVUXSWLRQRIWKHERG\
VFLUFDGLDQUK\WKPDQLQWHUQDOFORFNWKDWJRYHUQVWKHWLPLQJRI
KRUPRQHSURGXFWLRQVOHHSERG\WHPSHUDWXUHDQGRWKHUIXQFWLRQV:KLOHRFFDVLRQDOUHVWOHVVQLJKWVDUHQRUPDO
SURORQJHGLQVRPQLDFDQLQWHUIHUHZLWKGD\WLPHIXQFWLRQFRQFHQWUDWLRQDQGPHPRU\,QVRPQLDLQFUHDVHVWKHULVN
RIVXEVWDQFHDEXVHPRWRUYHKLFOHDFFLGHQWVKHDGDFKHVDQGGHSUHVVLRQ5HFHQWVXUYH\VLQGLFDWHWKDW
RISHRSOHVXIIHUIURPVOHHSGLI¿FXOWLHVDQGRIWKHPVWUXJJOHZLWKVXFKGLI¿FXOWLHVIRUDWOHDVW\HDU
2WKHUVWXGLHVVKRZWKDWRQHRXWRIWKUHHSHRSOHLQWKH8QLWHG6WDWHVKDYHLQVRPQLDEXWRQO\EULQJLWWRWKH
DWWHQWLRQRIWKHLUSK\VLFLDQV

Signs and Symptoms


• 1RWIHHOLQJUHIUHVKHGDIWHUVOHHS
• Inability to sleep despite being tired
• 'D\WLPH GURZVLQHVV IDWLJXH LUULWDELOLW\ GLI¿FXOW\ FRQFHQWUDWLQJ DQG LPSDLUHG DELOLW\ WR SHUIRUP QRUPDO
activities
• $Q[LHW\DVEHGWLPHDSSURDFKHV

Causes
3ULPDU\LQVRPQLDLVQRWFDXVHGE\DQ\NQRZQSK\VLFDORUPHQWDOFRQGLWLRQ7KHUHDUHQXPHURXVFDXVHVDQGULVN
IDFWRUV(YHU\GD\DQ[LHW\DQGVWUHVVFRIIHHDQGDOFRKRODUHWKHPRVWFRPPRQFXOSULWV
6HFRQGDU\LQVRPQLDLVRIWHQFDXVHGE\XQGHUO\LQJPHGLFDORUSV\FKRORJLFDOFRQGLWLRQVXFKDVGHSUHVVLRQ
$ERXWRILQVRPQLDFDVHVKDYHQRLGHQWL¿DEOHFDXVH
Some conditions or situations that commonly lead to insomnia include:
• 6XEVWDQFHDEXVHFRQVXPLQJH[FHVVLYHDPRXQWVRIFDIIHLQHDOFRKROUHFUHDWLRQDOGUXJVRUFHUWDLQSUHVFULSWLRQ
PHGLFDWLRQVVPRNLQJFDQFDXVHUHVWOHVVQHVVDQGTXLWWLQJVPRNLQJPD\DOVRFDXVHWHPSRUDU\LQVRPQLD
• 'LVUXSWLRQRIFLUFDGLDQUK\WKPVVKLIWZRUNWUDYHODFURVVWLPH]RQHVRUYLVLRQORVVFLUFDGLDQUK\WKPVDUH
UHJXODWHGLQSDUWE\UHOHDVHRIDKRUPRQHFDOOHGPHODWRQLQIURPWKHEUDLQ
• 0HQRSDXVHEHWZHHQDQGRIPHQRSDXVDOZRPHQH[SHULHQFHLQVRPQLDWKLVPD\EHGXHWRKRW
ÀDVKHVQLJKWVZHDWVDQ[LHW\DQGRUÀXFWXDWLRQVLQKRUPRQHV
• +RUPRQDOFKDQJHVGXULQJPHQVWUXDOF\FOHLQVRPQLDPD\RFFXUGXULQJPHQVWUXDWLRQVOHHSLPSURYHVPLG
F\FOHZLWKRYXODWLRQ
• $GYDQFHGDJHELRORJLFDOFKDQJHVDVVRFLDWHGZLWKDJLQJXQGHUO\LQJPHGLFDOFRQGLWLRQVDQGVLGHHIIHFWV
IURPPHGLFDWLRQVDOOFRQWULEXWHWRLQVRPQLD
• 0HGLFDOFRQGLWLRQVJDVWURHVRSKDJHDOUHÀX[ UHWXUQRIVWRPDFKFRQWHQWVLQWRWKHHVRSKDJXVIUHTXHQWO\
FDXVHVKHDUWEXUQ ¿EURP\DOJLDRURWKHUFKURQLFSDLQV\QGURPHVKHDUWGLVHDVHDUWKULWLVDWWHQWLRQGH¿FLW
K\SHUDFWLYLW\GLVRUGHUDQGREVWUXFWLYHVOHHSDSQHD GLI¿FXOW\EUHDWKLQJGXULQJVOHHS 
• 3V\FKLDWULFDQGQHXURORJLFFRQGLWLRQVDQ[LHW\GHSUHVVLRQPDQLFGHSUHVVLYHGLVRUGHUGHPHQWLD3DUNLQVRQ
V
GLVHDVHUHVWOHVVOHJV\QGURPH DVHQVHRILQGHVFULEDEOHXQHDVLQHVVWZLWFKLQJRUUHVWOHVVQHVVWKDWRFFXUV
LQWKHOHJVDIWHUJRLQJWREHG SRVWWUDXPDWLFVWUHVVGLVRUGHU
• &HUWDLQPHGLFDWLRQVGHFRQJHVWDQWVEURQFKRGLODWRUVDQGEHWDEORFNHUV
• ([FHVVLYHFRPSXWHUZRUN
• 3DUWQHUVZKRVQRUH

Risk Factors
7KHIROORZLQJIDFWRUVPD\LQFUHDVHDQLQGLYLGXDO¶VULVNIRULQVRPQLD
• $JHWKHHOGHUO\DUHPRUHSURQHWRLQVRPQLD
• 6WUHVVIXORUWUDXPDWLFHYHQW
Insomnia 211

• 1LJKWVKLIWRUFKDQJLQJZRUNVFKHGXOH
• Travel across time zones
• Substance abuse
• $VWKPDEURQFKRGLODWRUVRFFDVLRQDOO\FDXVHLQVRPQLD
• ([FHVVLYHFRPSXWHUZRUN

Preventive Care
7KHIROORZLQJOLIHVW\OHFKDQJHVFDQKHOSSUHYHQWLQVRPQLD
• ([HUFLVLQJ UHJXODUO\  EHVW ZKHQ GRQH EHIRUH GLQQHU H[HUFLVH VKRXOG QRW EH GRQH WRR FORVH WR EHGWLPH
because it can stimulate arousal
• $YRLGLQJFDIIHLQH HVSHFLDOO\DIWHUQRRQ DQGQLFRWLQH
• *HWWLQJ UHJXODU H[SRVXUH WR ODWH DIWHUQRRQ VXQ  VWLPXODWHV UHOHDVH RI PHODWRQLQ ZKLFK KHOSV UHJXODWH
circadian rhythm
• 3UDFWLFLQJVWUHVVUHGXFWLRQWHFKQLTXHVVXFKDV\RJDPHGLWDWLRQRUGHHSUHOD[DWLRQ
• (DUO\WUHDWPHQWRILQVRPQLDPD\DOVRKHOSSUHYHQWSV\FKLDWULFGLVRUGHUVVXFKDVGHSUHVVLRQ

Treatment Approach
7KH SUHIHUUHG WUHDWPHQWV IRU SHRSOH ZLWK FKURQLF LQVRPQLD DUH OLIHVW\OH FKDQJHV VHH /LIHVW\OHV VHFWLRQ  DQG
behavioral approaches that establish healthy sleeping habits. This is called improving sleep hygiene.
0LQGERG\WKHUDSLHVVXFKDVVWLPXOXVFRQWUROWKHUDS\EULJKWOLJKWWKHUDS\DQGFRJQLWLYHEHKDYLRUDOWKHUDS\DUH
SDUWLFXODUO\KHOSIXO
$FXSXQFWXUHDQGDFXSUHVVXUHKDYHDORQJWUDGLWLRQRIWUHDWLQJLQVRPQLDVXFFHVVIXOO\SDUWLFXODUO\LQWKHHOGHUO\
+RPHRSDWKLFUHPHGLHVPD\DOVRLPSURYHV\PSWRPVLQVRPHLQGLYLGXDOVLQFOXGLQJXVHRIWKHKHUEYDOHULDQ

Lifestyle
6WXGLHVUHYHDOWKDWKHDOWK\VOHHSKDELWVDUHHVVHQWLDOIRUWUHDWLQJLQVRPQLD
7KHIROORZLQJVWUDWHJLHV LQDGGLWLRQWRWKHVWHSVPHQWLRQHGLQWKH3UHYHQWLYH&DUHVHFWLRQ PD\KHOSWUHDWWKH
condition:
• 0DLQWDLQLQJDFRQVLVWHQWVOHHSLQJDQGZDNLQJWLPH
• (VWDEOLVKLQJWKHEHGURRPDVDSODFHIRUVOHHSDQGVH[XDODFWLYLW\RQO\QRWIRUUHDGLQJZDWFKLQJWHOHYLVLRQ
RUZRUNLQJ
• Avoiding naps, especially in the evening
• 7DNLQJDKRWEDWKDERXWWZRKRXUVEHIRUHEHGWLPH
• .HHSLQJWKHEHGURRPFRROZHOOYHQWLODWHGTXLHWDQGGDUN
• $YRLGLQJORRNLQJDWWKHFORFNWKLVSURPRWHVDQ[LHW\DQGREVHVVLRQDERXWWLPH
• $YRLGLQJÀXLGVMXVWEHIRUHEHGWLPH
• $YRLGLQJWHOHYLVLRQMXVWEHIRUHEHGWLPH
• (DWLQJDFDUERK\GUDWHVQDFNVXFKDVFHUHDORUFUDFNHUVMXVWEHIRUHEHGWLPH
• 0RYLQJWRDQRWKHUURRPZLWKGLPOLJKWLQJLIVOHHSGRHVQRWRFFXUZLWKLQWRPLQXWHVLQEHG

Suggested Nutritional Supplementation


• Benesom™²WDEOHWVRQHKRXUEHIRUHUHWLULQJ
%HQHVRPLVIRUPXODWHGWRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVVE\EHQH¿FLDOO\
PRGXODWLQJWKHPHWDEROLVPRIPHODWRQLQDQG*$%$
• Tran-Q® — 2 to 6 tablets daily
7UDQ4KDVEHHQWUDGLWLRQDOO\XVHGWRPDLQWDLQDFDOPVSLULWUHOD[WKHERG\DQGTXLHWWKHKHDUW
• Lumina™²VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQ²LVVXHVUHODWHGWRSURSHUIRFXVDWWHQWLRQ
OHDUQLQJDQGPHPRU\²WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQHJDPPD
DPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH

Dietary Suggestions
• FirstLine Therapy® Diet
212 Kidney Stones

Kidney Stones
8ULQDU\FDOFXOLRFFXUULQJLQDQ\SDUWRIWKHXULQDU\WUDFWDUHDEQRUPDOFRQFUHWLRQVXVXDOO\FRPSRVHGRIPLQHUDO
VDOWVVXFKDVPL[WXUHVRIFDOFLXPR[DODWHFDOFLXPSKRVSKDWHDQGPDJQHVLXPDPPRQLXPSKRVSKDWH7KH\YDU\
LQVL]HIURPPLFURVFRSLFWRVHYHUDOFHQWLPHWHUVLQGLDPHWHU$ERXWRIDOOXULQDU\VWRQHVFRQWDLQFDOFLXP7KH
PDMRULW\RIWKHVHDUHFRPSRVHGRIFDOFLXPR[DODWHContrary to previous notions, dietary calcium is seldom closely
OLQNHGWRWKHGHYHORSPHQWRIXULQDU\R[DODWHVWRQHIRUPDWLRQ'LHWDU\,QÀXHQFHVRQ6HUXPDQG8ULQDU\2[DODWH
in Healthy Subjects and Oxalate Stone Formers," Butz M, et al, Urol Int, 1980:35:309-315. 32760
,QIDFWFDOFLXPUHVWULFWLRQPD\EHFRQWUDLQGLFDWHGLQFDOFLXPVWRQHIRUPHUV7KHIROORZLQJLVDJHQHUDORYHUYLHZ
RIWUHDWPHQWIRUNLGQH\VWRQHV

Suggested Nutritional Supplementation


• Mag Citrate ²WDEOHWVWLPHVGDLO\ZLWKPHDOV
+LJKO\DEVRUEDEOHPDJQHVLXPZLWKFDOFLXP
• Pyridoxal 5-Phosphate²FDSVXOHVWLPHVGDLO\ZLWKPHDOV
7KHDFWLYHIRUPRI%
• UriCare (Cystone) ²FDSVXOHVWZLFHGDLO\
Natural urinary support that:
• )OXVKHVLPSXULWLHVIURPWKHNLGQH\VDQGFOHDUVWKHXULQDU\WUDFW
• .HHSVFDOFLXPFU\VWDOVGLVVROYHG
• 5HGXFHVZDWHUUHWHQWLRQDQGUHJXODWHVXULQH¶VFRPSRVLWLRQ
• Regulates calcium absorption.
• ChloroClear ²VRIWJHOVGDLO\ZLWKPHDOV
&RQWDLQVDKLJKSRWHQWF\VRGLXPFRSSHUFKORURSK\OOLQFRPSOH[

Dietary Suggestions
• FirstLine Therapy® Diet

Dietary Restrictions:
1. Avoid sugar.
2. 5HPRYHKLJKR[DODWHIRRGVVXFKDVFRIIHHUKXEDUEVSLQDFKEHDQVFRFRDWHD
3. Avoid Cola drinks "Effect of Cola Consumption on Urinary Biochemical and Physicochemical Risk Factors
Associated With Calcium Oxalate Urolithiasis," Rodgers A, Urol Res, 1999;27(1):77-81. (Address: A.
Rodgers, Dept Chem, Univ Capetown, South Africa.) 32790
4. Limit sodium intake.
5. $YRLGFDIIHLQH LQFUHDVHVXULQDU\FDOFLXPH[FUHWLRQ
6. )ROORZWKHFirstLine Therapy® Diet
Mouth / Lip Conditions 213

Mouth / Lip Conditions


Angular Stomatitis
5HGQHVVFUDFNLQJDQGÀDNLQJDWFRUQHUVRIPRXWK6LJQL¿FDQWLIELODWHUDORQO\5XOHRXWSRRUGHQWXUHVV\SKLOLV
herpes.

Nutrients Involved
5LERÀDYLQQLDFLQS\ULGR[LQHLURQ

Suggested Nutritional Supplementation


• Hemagenics²WDEOHWVWZLFHGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ
• Lipotain²WDEOHWVWZLFHGDLO\
1XWULWLRQDOVXSSRUWIRUKHDOWK\EORRGOLSLGOHYHOV

Dietary Suggestions
• FirstLine Therapy® Diet
214 Mouth / Lip Conditions

Canker Sores — Aphthous Stomatitis


,QÀDPPDWLRQRIWKHRUDOPXFRVDGXHWRORFDORUV\VWHPLFIDFWRUVZKLFKPD\LQYROYHWKHEXFFDODQGODELDOPXFRVD
SDODWHWRQJXHÀRRURIWKHPRXWKDQGWKHJLQJLYDH

Nutrients Involved
Folic acid, vitamin B12, iron, zinc, Lactobacillus acidophilus.

Contributing Factors
• Food sensitivities, especially gluten
• 6RGLXPODXU\OVXOIDWHVHQVLWLYLW\:KHQLQGLYLGXDOVZLWKFDQNHUVRUHVFKDQJHGWRDWRRWKSDVWHWKDWGLGQRW
FRQWDLQVRGLXPODXU\OVXOIDWHWKHQXPEHURIDSKWKRXVXOFHUVIHOOE\

Suggested Nutritional Supplementation


• L-Lysine²FDSVXOHVWLPHVGDLO\EHWZHHQPHDOVZMXLFHDWHDUOLHVWVLJQRIRXWEUHDN
7UHDWPHQW RI RXWEUHDNV ZLWK //\VLQH DW  PJ GDLO\ UHGXFHG GXUDWLRQ E\  *HQ 'HQW 
-DQ)HE SDJHV
• Hemagenics²WDEOHWVWZLFHGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ
• Ultra Flora Plus²FDSVXOHVWZLFHGDLO\IRUERWWOHV
$GYDQFHGSURELRWLFQXWULWLRQZLWKJOREXOLQSURWHLQFRQFHQWUDWH

Dietary Suggestions
• 0RGL¿HG(OLPLQDWLRQ'LHWRU$QWL,QÀDPPDWRU\'LHW
Mouth / Lip Conditions 215

Cheilosis
$FRQGLWLRQRIWKHOLSVFKDUDFWHUL]HGE\FKDSSLQJ¿VVXULQJ DQGVRPHWLPHVDEXUQLQJVHQVDWLRQ LQÀDPPDWLRQ
RIWKHPXFXVPHPEUDQHVRIWKHOLSVDQGWKHORVVRIWKHFOHDUGLIIHUHQWLDWLRQEHWZHHQWKHPXFRFXWDQHRXVERUGHU
RIWKHOLSV

Nutrients Involved
5LERÀDYLQQLDFLQS\ULGR[LQHLURQ

Suggested Nutritional Supplementation


• Hemagenics²WDEOHWVWZLFHGDLO\ZLWKIRRG
1XWULWLRQDOVXSSRUWIRUUHGEORRGFHOOIRUPDWLRQ
• Lipotain²WDEOHWVWZLFHGDLO\
1XWULWLRQDOVXSSRUWIRUKHDOWK\EORRGOLSLGOHYHOV

Dietary Suggestions
• FirstLine Therapy® Diet
216 Liver / Gallbladder

Liver / Gallbladder
Hepatopathy:DQ\GLVHDVHRIWKHOLYHU
Hepatotoxin:DWR[LQWKDWGHVWUR\VOLYHUFHOOV
Cholestasis:VWRSSDJHRUVXSSUHVVLRQRIELOHÀRZGXHWRIDFWRUVZLWKLQ LQWUDKHSDWLFFKROHVWDVLV RURXWVLGHWKH
OLYHU H[WUDKHSDWLFFKROHVWDVLV 
Cirrhosis:DOLYHUGLVHDVHFKDUDFWHUL]HGSDWKRORJLFDOO\E\WKHORVVRIWKHQRUPDOPLFURVFRSLFOREXODUDUFKLWHFWXUH
DQG UHJHQHUDWLYH UHSODFHPHQW RI QHFURWLF SDUHQFK\PDO WLVVXH ZLWK ¿EURXV EDQGV RI FRQQHFWLYH WLVVXH ZKLFK
HYHQWXDOO\FRQVWULFWDQGSDUWLWLRQWKHRUJDQLQWRLUUHJXODUQRGXOHV7KHWHUPLVVRPHWLPHVXVHGWRUHIHUWRFKURQLF
LQWHUVWLWLDOLQÀDPPDWLRQRIDQ\RUJDQ
&LUUKRVLVRIWKHOLYHULVDFWXDOO\DJURXSRIFKURQLFGLVHDVHVRIWKHOLYHU7KHGLVHDVHKDVDOHQJWK\ODWHQWSHULRG
XVXDOO\IROORZHGE\WKHVXGGHQDSSHDUDQFHRIDEGRPLQDOSDLQDQGVZHOOLQJKHPDWRP\HOLVGHSHQGHQWHGHPD
or jaundice. In advanced states, ascites, pronounced jaundice, portal hypertension, and central nervous system
GLVRUGHUVZKLFKPD\HQGLQKHSDWLFFRPDEHFRPHSURPLQHQW

Symptoms
7KHVLJQVDQGV\PSWRPVRIKHSDWLFFLUUKRVLVDUHPDQLIHVWDWLRQVRILQWHUIHUHQFHZLWKWKHPDMRUIXQFWLRQVRIWKH
OLYHUWKDWLV  WKHVWRUDJHDQGUHOHDVHRIEORRGWRPDLQWDLQDGHTXDWHFLUFXODWLQJYROXPH  WKHPHWDEROLVPRI
QXWULHQWVDQGWKHGHWR[L¿FDWLRQRISRLVRQVDEVRUEHGIURPWKHLQWHVWLQHV  WKHUHJXODWLRQRIÀXLGDQGHOHFWURO\WH
EDODQFHDQG  SURGXFWLRQRIFORWWLQJIDFWRUV
6\PSWRPVLQFOXGHLQWROHUDQFHWRJUHDV\IRRGVKHDGDFKHVDIWHUHDWLQJOLJKWFRORUHGVWRROIRXOVPHOOLQJVWRRO
OHVVWKDQRQHERZHOPRYHPHQWGDLO\FRQVWLSDWLRQKDUGVWRROVRXUWDVWHLQPRXWKJUH\FRORUHGVNLQ\HOORZ
LQZKLWHVRIH\HVEDGEUHDWKERG\RGRUIDWLJXHDQGVOHHSLQHVVDIWHUHDWLQJSDLQLQULJKWVLGHXQGHUULEFDJH
SDLQIXOWRSDVVVWRROUHWDLQZDWHUELJWRHSDLQIXOSDLQUDGLDWHVDORQJRXWVLGHRIOHJGU\VNLQKDLUEORRGLQVWRRO
KDYHKDGMDXQGLFHRUKHSDWLWLVKLJKEORRGFKROHVWHURODQGORZ+'/FKROHVWHUROFKROHVWHUROOHYHODERYH
triglyceride level above 115.

Nutrients Involved
&KROLQHLQRVLWROYLWDPLQ%IROLFDFLGYLWDPLQ%PDJQHVLXPWDXULQHYLWDPLQ&

Considerations
)RRG DOOHUJ\ H[HUFLVH K\SRWK\URLGLVP K\SRFKORUK\GULD ERZHO GHWR[L¿FDWLRQ XULQDU\ LQGLFDQ WHVW &DQGLGD
albicans.

Suggested Nutritional Supplementation


• Lipo-Gen²WDEOHWVZLWKHDFKPHDO
&RPSUHKHQVLYHOLSRWURSLFIRUPXOD
• Liver Care ²WDEOHWVZLWKHDFKPHDO
$\XUYHGLFOLYHUIRUPXOD
Liver / Gallbladder 217

Gallbladder Flush

Symptoms of Gallbladder Problems


<RXUKHDOWKFDUHSURIHVVLRQDOPD\UHFRPPHQGDJDOOEODGGHUÀXVKLI\RXKDYHDQ\RIWKHIROORZLQJV\PSWRPV
3DLQ Stools
8QGHUORZHUULEFDJH \HOORZJUHHQRUSDOH
,QIURQWRI\RXUVKRXOGHU )DWLQVWRROVVWRROVÀRDW
%HKLQGEDFNRINQHH
6ZHOOLQJDURXQGWKHNQHHDQGEHORZWRIHHW Temporal headaches,
)HHWVZHDW Eye pain
Leg cramps %HOFKLQJRUEORDWHGDIWHUIDWW\PHDOV
Restless Leg Syndrome (RLS) Constipation
&DQ¶WVOHHSIURP30WR$0 Diarrhea
$ZDNHXSGXULQJWKLVWLPH
6OHHSUHVWOHVVO\GXULQJWKLVWLPH
1DXVHDDIWHUPHDOV

Day 1 through 6 (usually Monday through Saturday)


'ULQNDVPXFKIUHVKRUJDQLFDSSOHMXLFHDV\RXFDQ ,GHDOO\FRQVXPHDKDOIJDOORQSHUGD\
• ,I\RXFDQQRWJHWIUHVKRUJDQLFDSSOHMXLFHSXUFKDVHWKHEHVWTXDOLW\RUJDQLFDSSOHMXLFHDYDLODEOH
• ,I\RXGRQRWWROHUDWHWKHVXJDULQDSSOHMXLFHGLOXWHWKHDSSOHMXLFHZLWKZDWHU,I\RXVWLOOGRQRWWROHUDWHWKH
DSSOHMXLFHWKHQHDWDWOHDVWWKUHHRUIRXUIUHVKRUJDQLFDSSOHVHDFKGD\LQSODFHRIWKHDSSOHMXLFH&KHZWKH
DSSOHVZHOODQGGULQNSOHQW\RISXUHVSULQJZDWHUWKURXJKRXWWKHGD\ RQHKDOI\RXUERG\ZHLJKWLQRXQFHV
per day).
*NOTE: ,I\RXKDYH\HDVWRYHUJURZWK'2127XVHDSSOHVRUMXLFHVLQVWHDGWDNHWDEOHWVRIFibroplex®
daily.
&RQWLQXHZLWK\RXUQRUPDOGLHWH[FHSWHOLPLQDWHDOORLOVDQGIDWIURP\RXUGLHW QREXWWHUPHDWV>H[FHSWIDWIUHH
PHDWV@FRRNLQJRLOVQXWVRUDYRFDGR 
$YRLGFKDPRPLOHWHD VWLPXODWHVELOHVHFUHWLRQIURPOLYHUFRXOGEULQJRQDQDWWDFNLQVXVFHSWLEOHSHRSOH 

Suggested Nutritional Supplementation


• Lipo-Gen™²WDEOHWVWKUHHWLPHVGDLO\ZLWKPHDOV
/LSR*HQLVDKLJKO\VSHFLDOL]HGIRUPXODWKDWIHDWXUHVDEURDGVSHFWUXPDQGXQLTXHEOHQGRIOLSRWURSLFQXWULHQWV
FRPELQHGZLWKVHOHFWDPLQRDFLGVYLWDPLQVDQGKHUEVWRVXSSRUWKHDOWK\OLYHUDQGJDOOEODGGHUIXQFWLRQ
• Liver Care®²FDSVXOHVWZLFHGDLO\
/LYHU&DUHLVDVSHFLDOO\IRUPXODWHGSURSULHWDU\KHUEDOIRUPXODIRUKHDOWK\OLYHUVXSSRUW/LYHU&DUHUHVWRUHV
WKH IXQFWLRQDO HI¿FLHQF\ RI WKH OLYHU E\ SURWHFWLQJ WKH KHSDWLF SDUHQFK\PD DQG SURPRWLQJ KHSDWRFHOOXODU
regeneration.
• AdvaClear®²FDSVXOHVWZLFHGDLO\
$GYD&OHDUSURYLGHVXQLTXHVXSSRUWIRUEDODQFHGDFWLYLW\RIWKHERG\¶VGHWR[L¿FDWLRQSURFHVVHV
• UltraFlora IB™ — 1 capsule daily.
8OWUD)ORUD,%LVDQHQKDQFHGSRWHQF\SURELRWLFIRUPXODGHVLJQHGWRKHOSUHOLHYHERZHOLUULWDWLRQDQGUHODWHG
IXQFWLRQDOGLVFRPIRUWVE\SURPRWLQJDKHDOWK\EDODQFHRILQWHVWLQDOPLFURÀRUD
NOTE$IWHUFRPSOHWLQJWKHJDOOEODGGHUÀXVKFRQWLQXHWKHVXSSOHPHQWUHJLPHQIRUWZRZHHNVRUXQWLOERWWOHV
are empty.
218 Liver / Gallbladder

Day 6 (usually Saturday)


Breakfast(DW\RXUQRUPDOKHDOWK\EUHDNIDVW
• 7DNHWDEOHWVRIMag Citrate™ZLWKDíFXSRIIUHVKVTXHH]HGOHPRQMXLFH  FDQVZHHWHQZLWK6WHYLD 
Lunch - Eat your normal, healthy lunch.
• 7DNHWDEOHWVRIMag Citrate™ZLWKDíFXSRIIUHVKVTXHH]HGOHPRQMXLFH  FDQVZHHWHQZLWK6WHYLD 
Two hours after lunch:
• 7DNHWDEOHWVRI Mag Citrate™ZLWKDíFXSRIIUHVKVTXHH]HGOHPRQMXLFH  FDQVZHHWHQZLWK6WHYLD 
For dinner:
• (DWRQO\IUHVKJUDSHIUXLW RUJDQLFLVSUHIHUUHG ,I\RXKDYHDSUREOHPZLWKJUDSHIUXLW\RXPD\HDWIUHVKDSSOHV
DQGGULQNIUHVKRUKLJKTXDOLW\RUJDQLFDSSOHMXLFH
At bedtime:
• 3UHSDUHDJODVVZLWKFXSRIRUJDQLFXQUH¿QHGFROGSUHVVHGROLYHRLO 6SHFWUXP1DWXUDOVEUDQGLVKLJKO\
recommended.)
• 3UHSDUH DQRWKHU JODVV ZLWK  FXS RI IUHVKO\ VTXHH]HG OHPRQ MXLFH  0L[ WKH WZR WRJHWKHU RU GULQN
separately.
• *RLPPHGLDWHO\WREHG/LHRQ\RXUULJKWVLGHZLWK\RXUULJKWNQHHSXOOHGXSFORVHWR\RXUFKHVWIRUPLQXWHV
*RWRVOHHS&DOO\RXUKHDOWKFDUHSURIHVVLRQDOLI\RXKDYHVHYHUHQDXVHDRISDLQXQGHUULJKWULEFDJH
**NOTE:,IWKHSDWLHQWLVDOOHUJLFWROHPRQVVXEVWLWXWHJUDSHIUXLWMXLFHRURUDQJHMXLFH

Day 7 (usually Sunday)


Breakfast(DWDOLJKWHUWKDQQRUPDOKHDOWK\EUHDNIDVW
• 7DNHWDEOHWVRIMag Citrate™ZLWKDíFXSRIIUHVKVTXHH]HGOHPRQMXLFH  FDQVZHHWHQZLWK6WHYLD 
• <RXPD\ZDQWWRGRWRPLQXWHVRIYLJRURXVH[HUFLVHPLQXWHVIROORZLQJWKHMag Citrate™.
**NOTE:,IWKHSDWLHQWLVDOOHUJLFWROHPRQVVXEVWLWXWHJUDSHIUXLWMXLFHRURUDQJHMXLFH
3ODQDUHOD[LQJUHVWIXOGD\DV\RXUERG\LVSXUJLQJLWVHOIDQGFRQWLQXHWRHDWORZIDWPHDOV<RXUJDOOEODGGHUKDV
MXVW³UXQDPDUDWKRQ´DQGLWQHHGVUHVWQRZRU\RXFRXOGSUHFLSLWDWHDJDOOEODGGHUDWWDFN
You may see a change in your stool color, and/or light to dark green gelatinous objects in your stool this day and
PD\EHWKHQH[W7KHVHFRQWDLQSXUJHGELOHIURPWKHJDOOEODGGHUDQGDUHKHOSLQJWRGHWR[LI\WKHOLYHUDQGUHOLHYH
FRQJHVWLRQLQWKHJDOOEODGGHU,IWKHUHDUHDODUJHQXPEHURIWKHVHREMHFWVLQWKHVWRRO\RXPD\UHSHDWWKHOLYHU
JDOOEODGGHUÀXVKLQWZRWRWKUHHZHHNV2WKHUZLVHWKHÀXVKPD\EHUHSHDWHGDVQHHGHGXSWRIRXUWLPHVD\HDU
&RQVXOW\RXUGRFWRUIRUKRZPDQ\ÀXVKHVQHHGHG

See your health care professional within 1-3 days after the flush!
Low Back Pain 219

Low Back Pain


3DLQIHOWHLWKHULQWKHOXPEDUOXPERVDFUDORUVDFURLOLDFDUHDV0RVWORZEDFNSDLQLVIURPGHJHQHUDWLYHMRLQW
GLVHDVHLQWKHOXPERVDFUDOUHJLRQSRRUSRVWXUHWKHEHHUEHOO\FRQVWLSDWLRQDQGVWUHVVLQGXFHGP\RVSDVPVRI
WKHOXPERVDFUDOUHJLRQ/RZEDFNSDLQLVFRPPRQO\DVVRFLDWHGZLWKVFLDWLFD
7KH SURJQRVLV GHSHQGV RQ WKH FDXVH *HQHUDOO\ WKH FRQGLWLRQ LV EHQLJQ DQG WKH SURJQRVLV LV H[FHOOHQW ZLWK
FRPSUHKHQVLYHSK\VLRWKHUDS\PDQLSXODWLRQQXWULWLRQPXVFOHUHOD[DQWVVWUHVVPDQDJHPHQWWHFKQLTXHVH[HUFLVH
DQGVWUHWFKLQJDGYLFHDQGERZHOFOHDQVLQJSURJUDPV 8OWUD&OHDU'HWR[L¿FDWLRQ3URJUDP 

Symptoms
2QVHWLVXVXDOO\JUDGXDO LIDFXWHWKHUHLVSUREDEO\DWUDXPDWLFFDXVH SDLQ PD\UDGLDWH WHQGHUQHVVZLWKPXVFOH
VSDVPVDQGLQÀDPPDWLRQHYLGHQWXSRQSDOSDWLRQGHFUHDVHGUDQJHRIPRWLRQYHUWHEUDOPDOSRVLWLRQ

Nutrients Involved
Vitamin C, calcium, magnesium, vitamin B6

Suggested Nutritional Supplementation


• ,QÀDYRQRLG,QWHQVLYH&DUH²WDEOHWVGDLO\ZLWKPHDOV
)RUUHOLHIRIPLQRUSDLQ
• Chondro Relief Intensive Care²FDSVXOHVGDLO\ZLWKPHDOV
-RLQW VRIWWLVVXHVXSSRUWZLWK060*UHHQ/LSSHG0XVVHO+\DOXURQLF$FLGDQG$68
• Myocalm P.M.²WDEOHWVGDLO\ZLWKPHDOVDWEHGWLPH
&DOFLXPDQGPDJQHVLXPZLWKPXVFOHUHOD[LQJKHUEV

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
• $GYD&OHDU'HWR[L¿FDWLRQ3URJUDP

Exercise Considerations
1. /\LQJRQEDFNUHOD[HGEULQJULJKWNQHHXSWRZDUGFKHVWFODVSLQJKDQGVDURXQGNQHHVWUDLJKWHQOHIW
OHJSRLQWLQJWRHXSZDUGWLJKWHQULJKWNQHHDVIDUDVSRVVLEOHWRFKHVWKROGWRFRXQWRIUHSHDWZLWK
RWKHUOHJGRHDFKOHJWLPHV
2. /\LQJRQEDFNUHOD[HGEULQJERWKNQHHVWRFKHVWE\FODVSLQJZLWKKDQGVPRYHNQHHVLQDFLUFOHZLWK
KDQGVVRURFNLQJRQVDFUXPUHSHDWFORFNZLVHWLPHVDQGFRXQWHUFORFNZLVHWLPHV
3. /\LQJRQEDFNUHOD[HGZLWKERWKNQHHVEHQWWLJKWHQPXVFOHVRIORZHUDEGRPHQZKLOHDOVRWLJKWHQLQJWKHEXWWRFNV
SXVKLQJWKHEDFNÀDWDJDLQVWWKHEHGKROGWKLVSRVLWLRQIRUFRXQWDQGUHOD[VORZO\UHSHDWWLPHV
4. /\LQJRQEDFNUHOD[HGZLWKOHIWNQHHEHQWDQGOHIWIRRWRQÀRRUUDLVHULJKWOHJXSDVIDUDVLVFRPIRUWDEOH
UHSHDWZLWKRWKHUOHJGRHDFKOHJWLPHV
5. /\LQJRQEDFNEULQJRQHNQHHWRFKHVWWKHQVWUDLJKWHQLWSRLQWLQJWRHXSZDUGDVIDUDVSRVVLEOHEHQG
NQHHEDFNWRFKHVWDQGUHWXUQWRRULJLQDOSRVLWLRQUHSHDWZLWKRWKHUOHJGRHDFKOHJWLPHV
6. /\LQJRQEDFNZLWKDUPVDWVLGHVSDOPVGRZQDQGNQHHVEHQWIHHWÀDWRQÀRRUUDLVHORZHUEDFNDQG
EXWWRFNVVHYHUDOLQFKHVRIIWKHÀRRUDQGKROGSRVLWLRQIRUVHFRQGVUHSHDWWLPHV
7. /\LQJRQEDFNDUPVDWVLGHVÀH[RQHKLSXQWLOYHUWLFDOWKHQFURVVLWRYHURWKHUKLSWRFUHDWHWZLVWLQVSLQH
KROGIRUVHYHUDOVHFRQGV
8. As back improves: lying on back, hold hips in air and pedal imaginary bicycle.
9. /\LQJRQVLGHGROHJUDLVHVUHSHDWWLPHVRQERWKVLGHV
10. 6LWWLQJRQHGJHRIFKDLUZLWKDUPVIROGHGORRVHO\LQIURQWRI\RXOHWERG\GURSXQWLOKHDGLVGRZQEHWZHHQ
OHJVSXOOERG\EDFNXSLQWRVLWWLQJSRVLWLRQZKLOHWLJKWHQLQJDEGRPLQDOPXVFOHV
11. 6LWWLQJRQÀRRUWU\WRXFKLQJWRHVZLWKRXWGLVFRPIRUWUHSHDWVORZO\WLPHV
12. 6WDQGLQJZLWKDUPVDWVLGHVEHQGVORZO\WRRQHVLGHEHJLQQLQJZLWKKHDGQHFNVKRXOGHUVFKHVWDQGORZHU
EDFNZLWK¿QJHUVGHVFHQGLQJWKHOHJRQWKDWVLGHUHSHDWIRURSSRVLWHVLGHUHSHDWWLPHVHDFK
13. 6WDUWLQJDWDVWDQGLQJSRVLWLRQVTXDWGRZQZKLOHNHHSLQJIHHWÀDWRQÀRRUZKLOHUHDFKLQJIRUZDUGDQG
GRZQZDUGZLWKRXWVWUHWFKHGDUPVUHSHDWWLPHV
14. /\LQJRQVWRPDFKZLWKODUJHSLOORZXQGHUKLSVDQGORZHUSDUWRIDEGRPHQSODFHDUPVRXWWRVLGHVDQG
EHJLQWROLIWKHDGDQGVKRXOGHUVRIIÀRRUQRWIDUHQRXJKWRFDXVHSDLQNHHSKHDGLQOLQHZLWKVSLQHE\
220 Low Back Pain

ORRNLQJDWÀRRUDQGWLJKWHQSHOYLFPXVFOHVVRWKLJKUHPDLQVRQÀRRUKROGSRVLWLRQIRUVHYHUDOVHFRQGV
15. 5HVWLQJRQKDQGVDQGNQHHVH[WHQGQHFNUHOD[DEGRPLQDOPXVFOHVDQGDOORZOXPEDUVSLQHWRK\SHUH[WHQG
LHKHDGDQGWDLOULVH WKHQZKLOHH[KDOLQJGURSKHDGDQGWDLOSXVKLQJWKRUDFLFVWRZDUGFHLOLQJUHSHDW
WLPHVZLWKEUHDWKLQJF\FOH
Lupus (Erythematosus) 221

Lupus (Erythematosus)
7KLVLVDFKURQLFLQÀDPPDWRU\DXWRLPPXQH WKHERG\LVDWWDFNLQJLWVHOI GLVHDVHWKDWDIIHFWVFRQQHFWLYHWLVVXH
WLVVXH WKDW ELQGV DQG VXSSRUWV YDULRXV VWUXFWXUHV RI WKH ERG\ DQG DOVR LQFOXGHV WKH EORRG  'LVFRLG OXSXV
HU\WKHPDWRVXV '/( LVDOHVVVHULRXVW\SHDIIHFWLQJH[SRVHGDUHDVRIWKHVNLQDQGVRPHWLPHVWKHMRLQWV6\VWHPLF
OXSXVHU\WKHPDWRVXV 6/( LVPRUHVHULRXVSRWHQWLDOO\IDWDODQGDIIHFWVPRUHRUJDQVRIWKHERG\

Symptoms
6\PSWRPV YDU\ DFFRUGLQJ WR WKH VHYHULW\ RI WKH LOOQHVV DQG ZKLFK RUJDQV DUH DIIHFWHG 6/( PD\ RFFXU YHU\
DEUXSWO\ZLWKDIHYHUDQGPLPLFDQDFXWHLQIHFWLRQRULWPD\RFFXUYHU\VORZO\RYHUPRQWKVDQG\HDUVZLWKRQO\
VHYHUDOHSLVRGHVRIIHYHUDQGIDWLJXH
0RVWSHRSOHZLWK6/(FRPSODLQRISDLQLQYDULRXVMRLQWVWKDWPLPLFVDUWKULWLVRULQFKLOGUHQVLPXODWHVJURZLQJSDLQV
,QDGXOWVWKHUHLVRIWHQDKLVWRU\RIJURZLQJSDLQV2YHUWLPHPXVFXODUFRQWUDFWLRQPD\GHIRUPWKHMRLQWV
0DQ\SDWLHQWVKDYHUDVKHVRQWKHIDFHRURWKHUDUHDVVXFKDVWKHQHFNXSSHUFKHVWDQGHOERZV,Q'/(WKH
UDVKVWDUWVDVUHGFLUFXODUWKLFNHQHGDUHDVWKDWOHDYHVFDUVPRVWRIWHQDIIHFWWKHIDFHDQGVFDOSDQGPD\FDXVH
SHUPDQHQWKDLUORVV,Q6/(WKHUHLVDFKDUDFWHULVWLFEXWWHUÀ\VKDSHGUDVKWKDWRFFXUVRQWKHFKHHNVDQGRYHU
WKHEULGJHRIWKHQRVH5DVKHVLQ6/(SDWLHQWVGRQRWVFDUDQGGRQRWFDXVHSHUPDQHQWKDLUORVV
8OFHUVRQPXFRXVPHPEUDQHVVXFKDVWKHPRXWKDQGQRVHDUHFRPPRQ5DVKHVDQGVZHOOLQJRIWKHKDQGVDQG
¿QJHUVPD\RFFXU6HQVLWLYLW\WROLJKW SKRWRSKRELD RFFXUVLQSHUFHQWRISHRSOHZLWK6/(2WKHUSUREOHPVPD\
EHNLGQH\GLVRUGHUVUHSHWLWLYHHSLVRGHVRISOHXULV\ LQÀDPPDWLRQRIOLQLQJRIWKHOXQJV SHULFDUGLWLV LQÀDPPDWLRQ
RIWKHPHPEUDQHVXUURXQGWKHKHDUW LURQGH¿FLHQF\DQHPLDDQGSXOPRQDU\K\SHUWHQVLRQ KLJKEORRGSUHVVXUH 
6ZHOOLQJRIVHYHUDORUPRUHO\PSKQRGHVLVFRPPRQHVSHFLDOO\LQFKLOGUHQ
6/(LVFODVVL¿HGDVPLOGLIWKHV\PSWRPVDUHPDLQO\IHYHUMRLQWSDLQUDVKKHDGDFKHVSOHXULV\DQGSHULFDUGLWLV
,WLVFRQVLGHUHGVHYHUHLILWLVDVVRFLDWHGZLWKOLIHWKUHDWHQLQJGLVHDVHV0LOG6/(PD\UHVSRQGZHOOWRQDWXUDO
WKHUDSLHV$VSLULQPD\EHXVHIXOEXWLQKLJKGRVDJHVLQSHRSOHZLWK6/(PD\FDXVHOLYHUWR[LFLW\$QWLPDODULDOV
XVHGWRWUHDWPDODULD PD\KHOSLQFRQGLWLRQVZKHUHMRLQWDQGUDVKV\PSWRPVDUHSUHGRPLQDQW
Severe SLE requires immediate corticosteroid therapy.

Occurrence
2FFXUVPRVWO\LQ\RXQJZRPHQ SHUFHQWRIFDVHV DQGLQ\RXQJFKLOGUHQ

Consider
5XOH RXW IRRG DOOHUJLHV UKHXPDWRLG DUWKULWLV RWKHU FRQQHFWLYH WLVVXH GLVHDVHV SDUDVLWHV FDQGLGLDVLV ERZHO
SUREOHPVDQGGLJHVWLYHHQ]\PHGH¿FLHQFLHVWKDWPD\FUHDWHV\PSWRPVWKDWPLPLF6/(RUZRUVHQ6/(5XOH
out migraines, epilepsy, and psychoses.

Special Notes
6/(LVRIWHQFKURQLFZLWKSHULRGVRILPSURYHPHQWDQGUHODSVHRYHUPDQ\\HDUV6RPHWLPHVWKHUHDUH\HDUVRI
UHPLVVLRQLQEHWZHHQSHULRGVRIV\PSWRPV%ORRGWHVWVIRUDQWLQXFOHDUDQWLERGLHV $1$ DQGVRPHWLPHVVNLQ
ELRSVLHVDUHGLDJQRVWLFIRUWKLVFRQGLWLRQ
$FFRUGLQJWRWKH$PHULFDQ5KHXPDWRLG$VVRFLDWLRQWKHUHPXVWEHIRXURIWKHIROORZLQJHLJKWV\PSWRPVSUHVHQW
IRUOXSXVWREHGLDJQRVHG$1$DQWLERGLHVLQWKHEORRGORZZKLWHEORRGFHOORUSODWHOHWFRXQWRUKHPRO\WLFDQHPLD
MRLQWSDLQLQWKHQXPEHURIMRLQWV DUWKULWLV EXWWHUÀ\UDVKRQFKHHNVDEQRUPDOFHOOVLQWKHXULQHOLJKWVHQVLWLYLW\
mouth sores, seizure or psychosis.
6RPHGUXJVJLYHDIDOVHSRVLWLYHWHVW ORRNVOLNH6/( K\GUDOD]LQHSURFDLQDPLGHDQGEHWDEORFNHUV6RPHWLPHV
WKHVHGUXJVSURGXFHDOXSXVOLNHFRQGLWLRQWKDWJRHVDZD\ZKHQWKHGUXJLVVWRSSHG
%LUWK FRQWURO SLOOV PD\ FDXVH ÀDUHXSV RI OXSXV 7UHDWPHQWV DUH DLPHG DW GHFUHDVLQJ V\PSWRPV $OORSDWKLF
PHGLFLQHGRHVQRWFRQVLGHUWKHUHWREHDFXUHIRUOXSXVEXWQDWXUDOO\RULHQWHGSK\VLFLDQVUHSRUWFXUHVRIOXSXV
E\HOLPLQDWLQJFDXVHVDQGWUHDWLQJWKHERG\DVDZKROH

Diet
:KROHIRRGVGLHW FirstLine Therapy® Diet $YRLGRYHUHDWLQJ PRUHIUHTXHQWVPDOOHUPHDOVLVVXJJHVWHG OLPLW
FRZ
VPLONDQGEHHISURGXFWVLQFUHDVHYHJHWDEOHV HVSHFLDOO\JUHHQ\HOORZDQGRUDQJH DQGFRQVXPH¿VK
222 Lupus (Erythematosus)

VHYHUDOWLPHVDZHHN$YRLGDOIDOIDVSURXWVRUWDEOHWVZKLFKFRQWDLQ/FDQDYDQLQHVXOIDWHDVXEVWDQFHWKDWPD\
aggravate lupus.

Assess and Treat for Food and Chemical Allergies


2QH KXQGUHG SHUFHQW RI DOO 6/( SDWLHQWV KDYH IRRG DOOHUJLHV DQG LPSURYH ZLWK DSSURSULDWH LGHQWL¿FDWLRQ DQG
treatment.

Suggested Nutritional Supplementation

Core Nutritional Support Protocol


• 8OWUD,QÀDP;Š3OXV²VFRRSVWZLFHGDLO\
0XOWLPHFKDQLVWLFVXSSRUWZLWKNH\QXWULHQWVSK\WRQXWULHQWVDQGVHOHFWLYHNLQDVHUHVSRQVHPRGXODWRUV
6.50V WRDGGUHVVXQGHUO\LQJLQÀDPPDWLRQ
• )ROORZHLWKHUWKH0RGL¿HG(OLPLQDWLRQ'LHW or the $QWL,QÀDPPDWRU\'LHW
• /DFWR)ODP;Œ²FDSVXOHGDLO\
/DFWR)ODP;IHDWXUHVL. plantarum 299V²DVWUDLQLGHQWL¿HGSURELRWLFWKDWKDVEHHQVSHFL¿FDOO\VKRZQ
WRVXSSRUWWKHLQWHJULW\DQGKHDOWK\IXQFWLRQRIWKHPXVFRVDOOLQLQJ
• EPA-DHA 6:1™ Enteric Coated ²VRIWJHOVWKUHHWLPHVGDLO\
(3$'+$(QWHULF&RDWHGRPHJDIDWW\DFLGVSURYLGLQJDUDWLRDSSURSULDWHIRUSDWLHQWVZLWKFKURQLF
LQÀDPPDWRU\FRQGLWLRQV
• Iso D3™ — 1 tablet three times daily.
9LWDPLQ'ZLWK,VRÀDYRQHV,VR'LVGHVLJQHGWRVXSSRUWRSWLPDOPHWDEROLVPRIYLWDPLQ'WRLWVDFWLYH
IRUP
If there is a soy sensitivity use:
• D3 1000™ — 2 microtablets three times daily.
+LJKSRWHQF\YLWDPLQ'²WKHPRVWELRDFWLYHIRUPRIVXSSOHPHQWDOYLWDPLQ'

Additional Nutritional Support Considerations


Body composition management
• High BMI ²,QWURGXFHORZHUFDORULH0RGL¿HG(OLPLQDWLRQRU$QWLLQÀDPPDWRU\'LHW
• Low BMI²,QWURGXFHKLJKHUFDORULH0RGL¿HG(OLPLQDWLRQRU$QWLLQÀDPPDWRU\'LHWDQGPHDVXUHKV&53
,IKV&53LVJUHDWHUWKDQPJOWKHQLQFUHDVH.DSUH[Š$,WRWDEOHWVWKUHHWLPHVGDLO\

Insulin resistance and dysglycemia


• 0HWDJO\FHP;Œ— 2 tablets, three times daily

Sex hormone dysregulation


• EstroFactors® — 3 tablets daily.
• Meta I3C® — 2 capsules daily.
• ActiFolate® — 1 tablet, three times daily.

Hepatic detoxification imbalances/Drug or Chemical toxicity


• AdvaClear® — FDSVXOHVWZLFHGDLO\

Gastrointestinal Restoration (4R Program)


• Endefen™ — 1 tsp, three times daily.
• UltraFlora I.B.™ —FDSVXOHVGDLO\
• Glutagenics® — 2 tsp, three times daily.

TH1 dominance or chronic allergy


• EstroFactors® or Testralin® — 3 tablets daily.
Lupus (Erythematosus) 223

Impaired biotransformation or hepatic detoxification imbalances


• AdvaClear® —FDSVXOHVWZLFHGDLO\
• Silymarin 80 — 3 tablets daily.

Oxidative stress
• Oxygenics® — WDEOHWVGDLO\
• Celapro® —VRIWJHOVGDLO\
• MetaLipoate® 300 —WDEOHWWZLFHGDLO\

Vitamin A insufficiency
• Ultra Pure Cod Liver Oil™ — 1 tsp, three times daily

Thyroid Support
• Thyrosol® —WDEOHWVWZLFHGDLO\
224 Memory Loss / Cognitive Function Decline

4LTVY`3VZZ*VNUP[P]L-\UJ[PVU+LJSPUL
3HUVRQVRYHU\HDUVROGQRZFRPSULVHRIWKH86SRSXODWLRQ0HPRU\ORVVLVRQHRIWKHPRVWFRPPRQ
symptoms

Nutrients Involved
&KROLQHLQRVLWROYLWDPLQ%YLWDPLQ%YLWDPLQ%IROLFDFLGSURWHLQJLQNJRELORED]LQF

Contributing factors
• 3RRUGLHW
• Alcoholism
• High blood pressure
• Alzheimer’s disease (rule out)
• 3URORQJHGXVHRIWUDQTXLOL]HUVDQGVOHHSPHGLFDWLRQV
• $WKHURVFOHURVLV ZKLFKFDQWULJJHUPLQLVWURNHVWKDWNLOOELWVRIEUDLQWLVVXHDQGHUDVHPHPRU\OLQNDJHV ?

Suggested Nutritional Supplementation


• Ceriva™ — VRIWJHOVGDLO\
&HULYDLVIRUPXODWHGWRVXSSRUWKHDOWK\FRJQLWLYHIXQFWLRQLQWKRVHFRQFHUQHGDERXWPDLQWDLQLQJWKHLUPHPRU\
E\EHQH¿FLDOO\PRGXODWLQJDFHW\OFKROLQH
• Ceralin® Forte ²WDEOHWWLPHVGDLO\ZLWKPHDOV
&HUDOLQ)RUWHLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJPXOWLSOH
SDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK
• Memories²WDEOHWVGDLO\
+HDOWK\EUDLQIXQFWLRQVXSSRUW
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ

Dietary Suggestions
• FirstLine Therapy® Diet

Cognitive Function Declines Gradually

Mild Cognitive Impairment Senile Dementia Alzheimer’s Disease


• )RUJHWIXO • ,QFUHDVLQJO\IRUJHWIXO • ,QDELOLW\WRIROORZLQVWUXFWLRQV
• Memory lapses • Memory loss becoming more • 8QDZDUHRIVXUURXQGLQJVRU
• Less attentive IUHTXHQW deteriorating condition
• Change in sleeping habits • 3RRUMXGJPHQW • /RVVRIVSHHFKÀXHQF\
• 1RWLFHGSUREOHPV¿QGLQJWKHULJKW • Declining ability to reason • 8QDEOHWRGUHVVRQHVHOI
ZRUGVWRFRPPXQLFDWH • 'LI¿FXOW\FRPPXQLFDWLQJ • 8QDEOHWRSHUIRUPVLPSOHWDVNVOLNH
• 3UREOHPVZULWLQJUHDGLQJ eating
organizing thoughts • /RVVRIMXGJPHQWDQGUHDVRQLQJ
• Delusional
• :DQGHULQJHDVLO\ORVW
• Incontinence
Multiple Sclerosis 225

Multiple Sclerosis
1HDUO\$PHULFDQVDUHDIIHFWHGE\RQHRIPHGLFLQH¶VPRVWPLVXQGHUVWRRGGLVHDVHVPXOWLSOHVFOHURVLV
$OWKRXJKWKHUHLVQRNQRZQFXUHDOWHUQDWLYHPHGLFLQHKDVUHFRJQL]HGDQXPEHURIFRQWULEXWLQJIDFWRUV2IWHQ
WKHHDUO\GHWHFWLRQDQGLGHQWL¿FDWLRQRIXQGHUO\LQJFDXVHVFRPELQHGZLWKVWULFWGLHWDU\DQGOLIHVW\OHJXLGHOLQHV
can stabilize or reverse the symptoms.
0XOWLSOHVFOHURVLV 06 DIIHFWVWKHFHQWUDOQHUYRXVV\VWHPDQGXVXDOO\RFFXUVLQHDUO\DGXOWOLIH1RUPDOO\QHUYH
¿EHUV DUH VXUURXQGHG E\ D OD\HU RI LQVXODWLRQ FDOOHG P\HOLQ 06 UHVXOWV ZKHQ WKH QHUYH ¿EHUV RI WKH FHQWUDO
QHUYRXVV\VWHPGHYHORSPXOWLSOHSDWFKHVRIGHP\HOLQDWLRQ UHPRYDORIWKHP\HOLQVKHDWK 1HUYHWUDQVPLVVLRQLV
GLVUXSWHGOHDGLQJWRIHHOLQJVRISLQVDQGQHHGOHVLQWKHKDQGVDQGIHHWQXPEQHVVORVVRIEDODQFHFOXPVLQHVV
VHQVLWLYLW\WRKHDWDQGFROGEOXUUHGRUGRXEOHYLVLRQDQGGLI¿FXOW\ZDONLQJ
3DWULFN.LQJVOH\0'RI/HLFHVWHUVKLUH(QJODQGDVSHFLDOLVWLQQXWULWLRQDQGHQYLURQPHQWDOPHGLFLQHZKRKDV
WUHDWHGRYHUWZRWKRXVDQGPXOWLSOHVFOHURVLVSDWLHQWVVWDWHVWKDW³,QDGYDQFHGVWDJHVRI06ZDONLQJEHFRPHV
PRUH GLI¿FXOW PRYHPHQWV EHFRPH PRUH VSDVWLF DUPV DQG KDQGV PD\ EHFRPH ZHDN VSHHFK FDQ EHFRPH
VOXUUHGDQGFKURQLFXULQDU\XUJHQF\RULQFRQWLQHQFHPD\GHYHORS)DWLJXHRQHRIWKH³VLOHQW´DQGPRVWGLVDEOLQJ
V\PSWRPVRIPXOWLSOHVFOHURVLVPD\UHQGHUHYHQWKHVPDOOHVWWDVNVGLI¿FXOW´
'U.LQJVOH\DGGV³$OWKRXJKWKHVWHUHRW\SHRIDQ06VXIIHUHULVWKDWRIDSHUVRQLQDZKHHOFKDLUPDQ\SHRSOH
ZLWK06DUHDEOHWRZDONDQGFRQWLQXHZRUNLQJ7KHGLVHDVHFDQEHEHQLJQZLWKDIHZPLQRUDWWDFNVVSUHDGRYHU
PDQ\GHFDGHVRUGHWHULRUDWLRQFDQEHUDSLG0RVWFDVHVIDOOVRPHZKHUHEHWZHHQWKHVHH[WUHPHV´
0XOWLSOHVFOHURVLVLVRIWHQGHVFULEHGDVDUHODSVLQJUHPLWWLQJGLVHDVHZKHUHDWWDFNVDUHIROORZHGE\UHPLVVLRQ
OHDYLQJWKH06VXIIHUHUZRUVHRIIWKDQKHZDVEHIRUHWKHH[DFHUEDWLRQ%HFDXVHQRWZRFDVHVRI06DUHLGHQWLFDO
WKHVHYHULW\RIDWWDFNVDQGWKHVWDWHRIKHDOWKIROORZLQJDUHPLVVLRQSHULRGGLIIHUVIURPSDWLHQWWRSDWLHQW8QOHVV
VWHSVDUHWDNHQWRVORZRUKDOWWKHGLVHDVHSDWLHQWVZLWKZLOOSUREDEO\EHFRPHSURJUHVVLYHO\ZRUVH

Etiology
7KHFDXVHLVLGLRSDWKLFWKRXJKWKHUHDUHWKHRULHVDERXWDXWRLPPXQLW\VORZYLUXVHVDQGP\HOLQLFHQ]\PHVHWF
QRVSHFL¿FPHFKDQLVPKDVEHHQSURYHQ0RVWFDVHVEHJLQEHWZHHQDQG\HDUVROGDQGUDUHO\DIWHU
)HPDOHVDUHDIIHFWHGVOLJKWO\PRUHWKDQPDOHV06VHHPVWREHDGLVHDVHRIWHPSHUDWHODWLWXGHVLQHLWKHUWKH
Northern or Southern hemispheres, and is rarely seen in equatorial regions. The characteristic lesion in MS is
RQHRISDWFK\GHP\HOLQDWLRQRIWKHP\HOLQVKHDWKVLQWKH&16SDUWLFXODUO\LQWKHZKLWHPDWWHU
$OWHUQDWLYHPHGLFLQHUHJDUGV06DVDFRPSOH[PXOWLIDFWRULDOGLVHDVHLQYROYLQJVHYHUDOFDXVHV:KHQWKHVH
causes are addressed, the symptoms may be alleviated or even reversed.

Signs and Symptoms


7KHGLVHDVHLVPXFKQRWHGE\LWVDSSDUHQWO\UDQGRPH[DFHUEDWLRQVDQGUHPLVVLRQV$VWKHGLVHDVHSURJUHVVHV
WKHUHPLVVLRQVEHFRPHOHVVFRPSOHWHDQGSHUPDQHQWGH¿FLWLVDSSDUHQW
2QVHWLVDOPRVWDOZD\VLQVLGLRXV6\PSWRPVDUHYDJXHDQGWKHGLDJQRVLVLVRIWHQPLVVHGLQWKHHDUO\VWDJHV
• 2SWLFQHXULWLV3DUWLDORUWRWDOORVVRIYLVLRQLQRQHH\HZLWKSDLQRQPRYLQJWKDWH\H
• Diplopia and other visual disorders
• 7LFGRORXUHDX[LQD\RXQJSHUVRQ
• $WD[LFJDLW
• 7LQJOLQJRUWLJKWQHVVLQWKHH[WUHPLWLHVDQGWKHSHUFHSWLRQRIDEDQGDFURVVRQH¶VPLGGOH
• %ODGGHUG\VIXQFWLRQ8UJHQF\KHVLWDQF\HWF
• 'HSUHVVLRQDSDWK\ODFNRIMXGJHPHQWK\VWHULD
• ,QFUHDVHGGHHSUHÀH[HV  %DELQVNL
• Charcot’s triad: In advanced disease: Nystagmus, intention tremor and scanning speech
• 2WKHUVVSHFL¿FWRWKHLQGLYLGXDO

Dietary and Nutritional Deficiencies


3HRSOHZLWKPXOWLSOHVFOHURVLVW\SLFDOO\KDYHQXWULWLRQDOGH¿FLHQFLHV6WXGLHVVKRZWKDWHVVHQWLDOIDWW\DFLGVWKH
EXLOGLQJEORFNVRIWKHEUDLQDQGQHUYRXVV\VWHPDUHODFNLQJLQPDQ\06SDWLHQWV0XOWLSOHVFOHURVLVLVPRVW
FRPPRQLQ:HVWHUQFRXQWULHVZKHUHSHRSOHFRQVXPHODUJHDPRXQWVRIPHDWVGDLU\SURGXFWVSURFHVVHGIRRGV
DQGFRFRQXWDQGSDOPRLOV²DOOIRRGVORZLQHVVHQWLDOIDWW\DFLGVDQGLVOHDVWFRPPRQLQFRXQWULHVZKHUHGLHWV
DUHKLJKLQXQVDWXUDWHGIDWVLQFOXGLQJVHHGRLOVROLYHRLORLO\¿VKIUHVKIUXLWVDQGYHJHWDEOHV²DOOIRRGVKLJK
LQHVVHQWLDOIDWW\DFLGV7KHFRQQHFWLRQZLWKVDWXUDWHGIDWLQWDNHZDV¿UVWQRWHGLQE\5R\6ZDQN0'RI
2UHJRQ+HDOWK6FLHQFHV8QLYHUVLW\LQ3RUWODQG2UHJRQDQGKDVEHHQFRQ¿UPHGLQPRUHUHFHQWVWXGLHV
226 Multiple Sclerosis

6WHSKHQ'DYLHV%0%&KZKRUXQVWKH%LRODE0HGLFDO8QLWLQ/RQGRQ(QJODQGKDVIRXQGWKDWHYHQZLWK
DEDODQFHGGLHW06SDWLHQWVKDYHGLI¿FXOW\DEVRUELQJHVVHQWLDOQXWULHQWV$OWKRXJKWKHVHGLIIHUIURPSHUVRQWR
SHUVRQVD\V'U'DYLHVWKHPRVWFRPPRQGH¿FLHQFLHVDUH%%%PDJQHVLXP]LQFIROLFDFLGDPLQR
DFLGVPDQJDQHVHVHOHQLXPDVZHOODVHVVHQWLDOIDWW\DFLGV

Food Sensitivities
,QWROHUDQFHWRFHUWDLQIRRGVLVFRPPRQLQSDWLHQWVZLWKPXOWLSOHVFOHURVLV$PRQJWKHPRVWIUHTXHQWDUHPLONDQG
GDLU\SURGXFWVFDIIHLQHWDQQLQ\HDVWVXJDUIXQJLZKHDWJOXWHQ IRXQGLQZKHDWEDUOH\RDWVDQGU\H FRUQ
IRRGDGGLWLYHVDQGIHUPHQWHGSURGXFWVVXFKDVNHWFKXSYLQHJDUDQGZLQH
,QDVWXG\LWZDVIRXQGWKDWRI06SDWLHQWVSHUFHQWKDGKLVWRULHVRIVLQXVLWLV LQÀDPPDWLRQRIWKH
VLQXV DFODVVLFV\PSWRPRILQWROHUDQFHWRPLONDQGGDLU\SURGXFWV

Candidiasis
&DQGLGLDVLVDQRYHUJURZWKRIWKH\HDVWCandida albicansLVDPDMRUFDXVHRIIRRGLQWROHUDQFHVDQGOLNHQXWULWLRQDO
GH¿FLHQFLHVFDQDGGWRWKHVWUHVVRQLQGLYLGXDOVZLWKPXOWLSOHVFOHURVLV:LOOLDP*&URRN0'RI-DFNVRQ
7HQQHVVHH¿UVWPDGHWKHFRQQHFWLRQEHWZHHQ06DQGWKH\HDVW&DQGLGDDOELFDQVGRFXPHQWLQJVHYHUDOFDVHV
LQZKLFKV\PSWRPVLPSURYHGRQFHWKHFDQGLGDZDVWUHDWHG
• )ROORZCandida Relief Program

Environmental Toxins
*DU\ 2EHUJ 0' SDVW 3UHVLGHQW RI WKH$PHULFDQ$FDGHP\ RI (QYLURQPHQWDO 0HGLFLQH QRWHV VHYHUDO ZD\V
LQ ZKLFK HQYLURQPHQWDO WR[LQV PD\ FRQWULEXWH WR PXOWLSOH VFOHURVLV ³7R[LQV PD\ FDXVH PHWDEROLF SRLVRQLQJ
LQWHUUXSWLQJWKHERG\¶VQRUPDOPHWDEROLFSDWKZD\VDQGGDPDJLQJWKHP\HOLQVKHDWKRIQHUYHVZKLFKLVWKHEDVLF
GHIHFWLQ06&HUWDLQVXEVWDQFHVZKLOHQRWWR[LFWRHYHU\RQHPD\LQLWLDWHDQDXWRLPPXQHUHDFWLRQLQVXVFHSWLEOH
LQGLYLGXDOV 7KHVH LQGLYLGXDOV PDNH DQWLERGLHV WR WKH IRUHLJQ VXEVWDQFH ZKLFK FURVVUHDFW ZLWK P\HOLQ WKXV
GDPDJLQJWKHQHUYHVDQGLQGXFLQJV\PSWRPVFKDUDFWHULVWLFRIPXOWLSOHVFOHURVLV´$FFRUGLQJWR'U2EHUJVRPH
RIWKHVXEVWDQFHVWKDWFDQSURGXFHRUDJJUDYDWHV\PSWRPVLQFOXGHFKHPLFDOVLQIRRGDQGWDSZDWHUFDUERQ
PRQR[LGHGLHVHOIXPHVIXPHVIURPGRPHVWLFJDVZDWHUKHDWHUVVROYHQWVDHURVROVSUD\VDQGFKLSERDUGDQG
IRDPLQIXUQLWXUHDQGFDUSHWV'U2EHUJDGGVWKDW06V\PSWRPVPD\DOVREHFDXVHGE\LQWHUQDOWR[LQV²WR[LQV
SURGXFHGE\EDFWHULDDQGIXQJLLQWKHJDVWURLQWHVWLQDOWUDFWLQFOXGLQJCandida albicans.

The Viral Connection


0HGLFDOUHVHDUFKHUVKDYHORQJVXVSHFWHGDYLUDOLQYROYHPHQWLQ065HFHQWUHVHDUFKRQSDWLHQWVLQIHFWHGZLWKWKH
(SVWHLQ%DUUYLUXV DIRUPRIKHUSHVYLUXVEHOLHYHGWREHWKHFDXVDWLYHDJHQWLQLQIHFWLRXVPRQRQXFOHRVLV VKRZV
WKDWOHYHOVRIHVVHQWLDOIDWW\DFLGVDUHYHU\ORZDIWHUWKHLOOQHVVVLPLODUWRWKHORZOHYHOVIRXQGLQ06SDWLHQWV
7KLVYLUXVLQWHUIHUHVZLWKWKHERG\¶VDELOLW\WRPHWDEROL]HHVVHQWLDOIDWW\DFLGVFDXVLQJDSDUWLDOEUHDNGRZQRIWKH
ERG\¶VLPPXQHV\VWHP$QDFXWHHSLVRGHRILQIHFWLRQZLWKWKH(SVWHLQ%DUUYLUXVGXULQJDGROHVFHQFHFRXOGOHDYH
the door open to chronic illness such as MS some years later.

Toxicity from Mercury Dental Amalgams


0HUFXU\LVDKLJKO\WR[LFPHWDOWKDWZKHQXVHGLQGHQWDODPDOJDP¿OOLQJVFDQVHHSLQWRERG\WLVVXHVZKHUHLW
DFFXPXODWHVDQGEHFRPHVFDSDEOHRISURGXFLQJV\PSWRPVLQWKHERG\WKDWDUHLQGLVWLQJXLVKDEOHIURPWKRVHRI
PXOWLSOHVFOHURVLV$FFRUGLQJWR+DO+XJJLQV''6RI&RORUDGR6SULQJV&RORUDGRPHUFXU\SRLVRQLQJRIWHQ
remains undetected because patients’ symptoms do not necessarily suggest mercury as the initiating cause, but the
HIIHFWVRIPHUFXU\WR[LFLW\DUHSRWHQWLDOO\GHYDVWDWLQJ0HUFXU\KDVEHHQUHFRJQL]HGDVDSRLVRQVLQFHWKHV
\HWPHUFXU\DPDOJDPVKDYHEHHQXVHGLQGHQWLVWU\VLQFHWKHV0HUFXU\KDVEHHQVKRZQWRELQGWRWKH'1$
RIFHOOVDQGFHOOPHPEUDQHVFDXVLQJFHOOGLVWRUWLRQDQGLQKLELWHGFHOOIXQFWLRQ:KHQWKLVKDSSHQVWKHLPPXQH
V\VWHPQRORQJHUUHFRJQL]HVWKHFHOODVSDUWRIWKHERG\DQGLQLWLDWHVDQDXWRLPPXQHUHDFWLRQGHVWUR\LQJP\HOLQ
LQWKHSURFHVV06SDWLHQWVKDYHEHHQIRXQGWRKDYHRYHUVHYHQWLPHVWKHOHYHOVRIPHUFXU\LQWKHLUFHUHEURVSLQDO
ÀXLG WKHÀXLGWKDWVXUURXQGVWKHEUDLQDQGVSLQDOFRUG DVFRPSDUHGWRQHXURORJLFDOO\KHDOWK\SDWLHQWV

Treating Multiple Sclerosis


$QHDUO\GLDJQRVLVLVDQHVVHQWLDO¿UVWVWHSLQWUHDWLQJPXOWLSOHVFOHURVLV)RUWKHEHVWUDWHRIVXFFHVVWUHDWPHQWRI
WKHGLVHDVHVKRXOGEHJLQDVVRRQDVSRVVLEOHDIWHUGLDJQRVLV2QFHWKHGLVDELOLW\KDVJDLQHGDKROGLWEHFRPHV
KDUGHUWRUHYHUVHWKHGDPDJH³7KHUHLVQRTXHVWLRQ´VD\V'U6ZDQN³DWOHDVWLQWKHPLQGVRIDOWHUQDWLYHSK\VLFLDQV
WKDWWKRVH06SDWLHQWVZKRVKRZWKHJUHDWHVWLPSURYHPHQWDUHWKHRQHVZKRVWDUWWUHDWPHQWHDUOLHVW´
0DQ\KHDOWKFDUHSURIHVVLRQDOVEHOLHYHWKDWLIWUHDWPHQWEHJLQVVRRQHQRXJKDQGLVDGKHUHGWRLWLVSRVVLEOHWR
FRQWUROPXOWLSOHVFOHURVLVLQPDQ\LIQRWDOOSDWLHQWV'U.LQJVOH\UHDVRQVWKDW³&XUHLVSRVVLEOHLIWKHFDXVHRU
Multiple Sclerosis 227

FDXVHVFDQEHIRXQGDQGWKHQHOLPLQDWHG´%HFDXVHPXOWLSOHVFOHURVLVDIIHFWVHDFKSDWLHQWGLIIHUHQWO\WUHDWPHQW
SURJUDPV DUH LQGLYLGXDOL]HG 'LHWDU\ DQG QXWULWLRQDO QHHGV DUH WR EH DGGUHVVHG DV DUH IRRG DOOHUJLHV DQG
HQYLURQPHQWDOWR[LQV5HFRPPHQGDWLRQVPD\EHPDGHIRUGHWR[L¿FDWLRQWKHUDS\DVZHOODVIRUWKHUHPRYDORI
PHUFXU\DPDOJDPGHQWDO¿OOLQJV$PRQJSUDFWLWLRQHUVRIDOWHUQDWLYHPHGLFLQHWKHUHLVDGHJUHHRIFRQVHQVXV²QRW
JHQHUDOO\VKDUHGE\FRQYHQWLRQDOGRFWRUV²WKDWPXOWLSOHVFOHURVLVFDQEHFRQWUROOHG7KLVW\SHRIDSSURDFKLQYROYHV
IXQGDPHQWDOQXWULWLRQDOHQYLURQPHQWDODQGOLIHVW\OHFKDQJHV

Diet
7KHEHVWGRFXPHQWHGVXFFHVVZLWKPXOWLSOHVFOHURVLVSDWLHQWVLV'U6ZDQN¶VZRUNZLWKDORZVDWXUDWHGIDWKLJK
SRO\XQVDWXUDWHGIDWGLHW
• )ROORZ0RGL¿HG(OLPLQDWLRQ'LHW

Suggested Nutritional Supplementation


• 8OWUD,QÀDP;® Plus 360 — VFRRSVWZLFHGDLO\
0XOWLPHFKDQLVWLF VXSSRUW ZLWK NH\ QXWULHQWV SK\WRQXWULHQWV DQG VHOHFWLYH NLQDVH UHVSRQVH PRGXODWRUV
6.50V WRDGGUHVVXQGHUO\LQJLQÀDPPDWLRQ
• )ROORZHLWKHUWKH0RGL¿HG(OLPLQDWLRQ'LHW or the $QWL,QÀDPPDWRU\'LHW
• /DFWR)ODP;Œ²1 capsule daily
/DFWR)ODP;IHDWXUHVL. plantarum 299V²DVWUDLQLGHQWL¿HGSURELRWLFWKDWKDVEHHQVSHFL¿FDOO\VKRZQWR
VXSSRUWWKHLQWHJULW\DQGKHDOWK\IXQFWLRQRIWKHPXVFRVDOOLQLQJ
• EPA-DHA 6:1™ Enteric Coated ²VRIWJHOVWKUHHWLPHVGDLO\
(3$'+$  (QWHULF &RDWHG RPHJD  IDWW\ DFLGV SURYLGLQJ D UDWLR DSSURSULDWH IRU SDWLHQWV ZLWK FKURQLF
LQÀDPPDWRU\FRQGLWLRQV
• Iso D3™ — 1 tablet three times daily.
9LWDPLQ'ZLWK,VRÀDYRQHV,VR'LVGHVLJQHGWRVXSSRUWRSWLPDOPHWDEROLVPRIYLWDPLQ'WRLWVDFWLYH
IRUP
• AdvaClear®²FDSVXOHVWZLFHGDLO\
$GYD&OHDUSURYLGHVXQLTXHVXSSRUWIRUEDODQFHGDFWLYLW\RIWKHERG\¶VGHWR[L¿FDWLRQSURFHVVHV
If there is a soy sensitivity use:
• D3 1000™ — 2 microtablets three times daily.
+LJKSRWHQF\YLWDPLQ'²WKHPRVWELRDFWLYHIRUPRIVXSSOHPHQWDOYLWDPLQ'
• Calcium AEP ²FDSVXOHVGDLO\GHSHQGLQJRQQHHG
'LHWDU\FDOFLXPVXSSOHPHQWWRVXSSRUWQHUYRXVV\VWHPIXQFWLRQ
• GLA Forte® ²VRIWJHOWZLFHGDLO\ZLWKIRRG
*/$)RUWHIHDWXUHVERUDJHVHHGRLODQHVVHQWLDOIDWW\DFLGWKDWLVFRQYHUWHGLQWKHERG\WR'*/$ GLKRPR
JDPPDOLQROHQLFDFLG WKHGLUHFWSUHFXUVRURIEHQH¿FLDOVHULHVSURVWDJODQGLQV
• Mag Glycinate™ ²WDEOHWVWZLFHGDLO\ZLWKIRRG
0DJ*O\FLQDWHDYDLODEOHH[FOXVLYHO\IURP0HWDJHQLFVLVDUHYROXWLRQDU\IXOO\UHDFWHGDPLQRDFLGFKHODWH
SURGXFHGE\DXQLTXHSDWHQWHGSURFHVVWKDWLVGHVLJQHGWRHQKDQFHDEVRUSWLRQDQGLQWHVWLQDOWROHUDQFHRI
magnesium.
• Azeo-Pangen™ Extra Strength ²WDEOHWVZLWKHDFKPHDO
$]HR3DQJHQ ([WUD 6WUHQJWK LV D FRPSUHKHQVLYH HQ]\PH FRPSOH[ WKDW KHOSV SURPRWH KHDOWK\ GLJHVWLYH
IXQFWLRQ

Dietary Suggestions
• 0RGL¿HG(OLPLQDWLRQ'LHW
228 Multiple Sclerosis

Attitude and Lifestyle Changes


'U.LQJVOH\DGYLVHVWKDW³WDNLQJDQDFWLYHUROHLQWUHDWPHQWVKRXOGEHWKH¿UVWFRQFHUQRIDSHUVRQGLDJQRVHG
ZLWKPXOWLSOHVFOHURVLV7KLVLQFOXGHVSRVLWLYHFRRSHUDWLRQZLWKWKHSUDFWLWLRQHUDVZHOODVSRVVLEOHIXQGDPHQWDO
OLIHVW\OHFKDQJHVLQZRUNUHODWLRQVKLSVDQGHQYLURQPHQWDOFRQGLWLRQV&KDQJHVPD\EHQHFHVVDU\WRLPSURYH
DSHUVRQ¶VFRQGLWLRQLWPD\EHLQDGYLVDEOHHYHQLPSRVVLEOHWRFDUU\RQDVLIQRWKLQJKDVKDSSHQHG´
'U6ZDQN¿QGVVWUHVVWREHWKHVHFRQGPRVWLPSRUWDQWFDXVHRI06DIWHUKLJKIDWGLHWV³&RQWLQXLQJVWUHVVVXFK
DVIURPOHJDODFWLRQVDQGIDPLO\SUREOHPVFDQFDXVH06´KHVD\V'U6ZDQNWUHDWVWKHVHSDWLHQWVWRKHOSWKHP
VOHHSDQGEHPRUHUHOD[HGGXULQJWKHGD\)RUPLOGVWUHVVKHVXJJHVWVWDNLQJDVKRUWUHVWLQWKHDIWHUQRRQDQG
IRUPRUHVHYHUHVWUHVVKHDGYLVHVDUHVWPLGPRUQLQJDVZHOO
• Trancor™ ²FDSVXOHVWZLFHGDLO\
7UDQFRULVIRUPXODWHGWRVXSSRUWDVHQVHRIWUDQTXLOLW\LQWKRVHZKRPD\IHHOZRUULHGRUQHUYRXVE\EHQH¿FLDOO\
PRGXODWLQJWKHEDODQFHEHWZHHQWKHFDOPLQJLQÀXHQFHRI*$%$DQGWKHH[FLWDWRU\HIIHFWVRIJOXWDPDWH
• Serenagen ²WDEOHWVWLPHVGDLO\ZLWKOXNHZDUPZDWHULQEHWZHHQPHDOV
6HUHQDJHQLVDFODVVLFFRPSUHKHQVLYHKHUEDOVWUHVVPDQDJHPHQWIRUPXODWDUJHWLQJLQGLYLGXDOVZKRDUH
³VWUHVVHGDQGZLUHG´

Physical Medicine
Exercise0DQ\SHRSOHZLWK06DUHPRUHGLVDEOHGWKDQWKH\QHHGEH*HQWOHH[HUFLVHZLOOKHOSNHHSVRPHRQHZLWK06
WRQHGVXSSOHDQGPRELOH0LOGDHURELFH[HUFLVHLQWKHRSHQFRRODLURIPRUQLQJRUHYHQLQJLVUHFRPPHQGHG
Manipulation*HQWOHPDVVDJHVSRQG\ORWKHUDS\ FRQFXVVLRQRI77WRLQFUHDVHFLUFXODWLRQWRVSLQDOFRUG 
FKHFNDQGDOLJQDWODVD[LVRIVSLQH RQO\DGMXVWDWODVWLPHVFKHFNSDUDV\PSDWKHWLF>FHUYLFDOVDFUXP@ 
Hydrotherapy&RQVWLWXWLRQDOK\GURWKHUDS\VKRXOGEHDSSOLHGWZRWR¿YHWLPHVZHHNO\&UXVKHGLFHZUDSSHG
LQZHWWRZHOVDSSOLHGWRVSDVWLFPXVFOHVIRUPLQXWHVIROORZHGE\H[HUFLVHFROG ƒ) LPPHUVLRQRIVSDVWLF
H[WUHPLW\IRUPLQXWHVIROORZHGE\H[HUFLVH
Aromatherapy 5XE DIIHFWHG SDUW ZLWK PL[WXUH RI  SHUFHQW ROLYH RLO DQG  SHUFHQW HVVHQFH RI MXQLSHU RU
rosemary.
Practical Hints$YRLGWKHXVHRIHOHFWULFKHDWLQJSDGVFKORULQDWHGZDWHUDVZHOODVÀXRULGDWHGZDWHUWRRWKSDVWH
DQGPRXWKZDVK
Myofibrositis 229

Myofibrositis
6FDUW\SHWLVVXHFDXVLQJUHVWULFWLRQRIWLVVXHPRWLRQ7UDXPDWLFWHDULQJRIVRIWWLVVXHVRUORQJVWDQGLQJPXVFOH
VSDVPVFDXVHSURGXFWLRQRIWKL[RWURSLFJHOZKLFKRUJDQL]HVLWVHOILQWRFROODJHQVFDUWLVVXH7KLVLVWKHERG\¶V
DWWHPSWWRVWDELOL]HZKDWLVSHUFHLYHGDVLQMXU\7KUHHSUREOHPVUHVXOWIURPWKLVVFDUIRUPDWLRQ
1. 7KHVFDUWLVVXHLVPRUHSDLQVHQVLWLYHWKDQQRUPDOVWUXFWXUDODQGFRQWUDFWLOHWLVVXH
2. 7KHVFDUWLVVXHLVOHVVÀH[LEOHDQGWKHUHIRUHGLPLQLVKHVMRLQWPRWLRQ
3. 7KHVFDUWLVVXHLVPRUHEULWWOHWKDQKHDOWK\WLVVXHDQGVXVFHSWLEOHWRUHLQMXU\
7KLVFRQGLWLRQRFFXUVDIWHUWUDXPDRULQORQJVWDQGLQJRYHUORDGLQJRIPXVFOHV7KLVFDQRFFXULQDSRVWXUDOVWUDLQ
VLWXDWLRQIRUH[DPSOHZKHQDSHUVRQZRUNVRYHUDGHVNGD\DIWHUGD\FDXVLQJFRQVWDQWUHOHQWOHVVFRQWUDFWLRQRI
the neck and upper back muscles. These muscles and the adjacent articular ligaments (rib joints and vertebral
MRLQWV PD\EHFRPHLQ¿OWUDWHGZLWKVFDUWLVVXHDGKHVLRQV
3URJQRVLVLVJRRGZLWKDSSURSULDWHWUHDWPHQWDQGHUJRQRPLFFKDQJHVGHVLJQHGWRSUHYHQWFKURQLFLW\

Symptoms
'LPLQLVKHGMRLQWSOD\SDLQZLWKGHHSSDOSDWLRQRIWKHWLVVXHDJULWW\IHHOHVSLQOLJDPHQWVDQGPXVFOHVORFDO
DUHDVRIPXVFOHVSDVP WULJJHUSRLQWV 

Nutrients Involved
%URPHODLQYLWDPLQ&ELRÀDYRQRLGV]LQFYLWDPLQ(YLWDPLQ%VHOHQLXPJOXFRVDPLQHFKRQGURLWLQ060

Suggested Nutritional Supplementation


• MyoCalm P.M.²WDEOHWVKRXUEHIRUHEHG
0\R&DOP30SURYLGHVWKHVDPHVSHFLDOL]HGIRUPXODDV0\R&DOPŠZLWKWKHDGGLWLRQRIOHPRQEDOPDQG
KRSV²KHUEVWUDGLWLRQDOO\XVHGWRSURPRWHUHOD[DWLRQDQGUHVWIXOVOHHS
• Bromelain 1400²WDEOHWVWLPHVGDLO\ZLWKPHDOV
High potency bromelain.
• Chondro Relief Intensive Care²FDSVXOHVGDLO\ZLWKPHDOV
&RPSUHKHQVLYHMRLQW VRIWWLVVXHVXSSRUWZLWK060*UHHQ/LSSHG0XVVHO+\DOXURQLF$FLGDQG$68
• E-Complex 1:1²VRIWJHOWLPHVGDLO\ZLWKIRRG
(&RPSOH[LVDXQLTXHQDWXUDOYLWDPLQ(VXSSOHPHQWWKDWIHDWXUHVDUDWLRRIDOSKDWRJDPPDWRFRSKHURO
WKLVUDWLRPRUHFORVHO\UHVHPEOHVWKHWRFRSKHUROSUR¿OHIRXQGQDWXUDOO\LQYLWDPLQ(ULFKSODQWV
• HP 17 Muscle Spasm Remedy — 4 tablets 3 times daily on an empty stomach.
$ KLJK TXDOLW\ KDQGPDGH KRPHRSDWKLF UHPHG\ GHVLJQHG WR UHOLHYH PXVFOH DFKHV VSDVPV RU SDLQ
$YRLGFDIIHLQHPHQWKROV

Dietary Suggestions
• $QWL,QÀDPPDWRU\'LHW
230 Neurological Conditions

Neurological Conditions
The Interplay of Neurotransmitters & Mental States
7KHERG\LVWKHWKHDWHUIRUHPRWLRQDODQGFRJQLWLYHVWDWHV:KHWKHUPRRGRUPHQWDOLVVXHVH[SUHVVWKHPVHOYHV
WKURXJKEHKDYLRURUSK\VLFDOIXQFWLRQLQJ²QHXURWUDQVPLWWHUVDUHRQHJURXSRIFKDUDFWHUVDWSOD\
Memory and cognitive processesDUHKHDYLO\GHSHQGHQWRQDFHW\OFKROLQHDQHXURWUDQVPLWWHUNQRZQWRGHFOLQH
ZLWKDJH
Attention, learning, and mental focusUHTXLUHDGHTXDWHVWLPXODWLRQZLWKH[FLWDWRU\QHXURWUDQVPLWWHUVSDUWLFXODUO\
GRSDPLQHDQGEDODQFHGOHYHOVRIQRUHSLQHSKULQH
Sense of tranquilityLVLQÀXHQFHGE\WKHFDOPLQJHIIHFWVRI*$%$DQLQKLELWRU\QHXURWUDQVPLWWHU
Feelings of nervousnessDUHLQÀXHQFHGE\JOXWDPDWHDQH[FLWDWRU\QHXURWUDQVPLWWHU
PerceptionLVLQÀXHQFHGE\DKHDOWK\QHXURQDOHQYLURQPHQWSDUWLFXODUO\E\WKHEDODQFHEHWZHHQ*$%$DQG
glutamate.
Mood, stressful feelings, and sense of well-beingDUHLQÀXHQFHGE\WKHOHYHORIEUDLQFRUWLVRO²DQHXURKRUPRQH
WKDWFDQEHFRPHHOHYDWHGGXULQJWLPHVRIVWUHVVZKLFKPD\LPSDFWVHURWRQLQ
Feeling happy, content, and relaxedLVUHODWHGWRWKHOHYHORIVHURWRQLQZKLFKLVDFRPPRQWDUJHWIRUPRGXODWLRQ
in conventional approaches.
Sleep and wake cyclesDUHGHSHQGHQWRQPHODWRQLQVWDWXV²DKRUPRQHGHULYHGIURPVHURWRQLQDQGSURGXFHG
in the pineal gland.

Addressing neurological health concerns


An estimated 1 in 4 Americans have mental health concerns. Neurotransmitter modulation is the primary goal
WRDGGUHVV QHXURORJLFDO KHDOWK ZLWK PDQ\ FRQYHQWLRQDOSURGXFWV²ZKLFKDUHQRWZLWKRXWDGYHUVHHIIHFWV,Q
FROODERUDWLRQZLWKDUHQRZQHGQHXURORJLVW0HWDJHQLFVKDVGHYHORSHGDQDWXUDOFOLQLFDOO\VXFFHVVIXOIDPLO\RI
QHXURORJLFDOKHDOWKSURGXFWVGHVLJQHGWRQXWULWLRQDOO\VXSSRUWEUDLQIXQFWLRQWRLQÀXHQFHQHXURWUDQVPLWWHUG\QDPLFV
DVVRFLDWHGZLWKVSHFL¿FFRJQLWLYHDQGHPRWLRQDOVWDWHV<RXUJXLGHWRVSHFLDOL]HGQHXURORJLFDOVXSSRUW,QWKLV
FOLQLFDOJXLGH\RX¶OO¿QGSURGXFWGHVFULSWLRQVUHFRPPHQGDWLRQVDQGDTXLFNUHIHUHQFHWRROH[SODLQLQJKRZWR
VXSSRUWYDULRXVDVSHFWVRIQHXURORJLFDOKHDOWK
• Neuroprotection
• )RUJHWIXOQHVV
• Distracted mind
• Nervousness
• Negative mood
• 2FFDVVLRQDOVOHHSOHVVQHVV

Foundation Neuroprotection
Multidimensional Brain & Nervous System Support
Ceralin® ForteLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJPXOWLSOH
SDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK'HVLJQHGWRDFWZLWKLQWKHEUDLQDQGQHUYRXVV\VWHPWKLVDGYDQFHG
IRUPXODIHDWXUHVVLJQL¿FDQWOHYHOVRIJUDSHVHHGH[WUDFWPHWK\OWHWUDK\GURIRODWH1DFHW\OF\VWHLQH 1$& DQG
DFHW\O/FDUQLWLQH

Suggested Nutritional Supplementation


• Ceralin Forte® — Three capsules daily.
&HUDOLQ)RUWHLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJPXOWLSOH
SDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ
Neurological Conditions 231

Patient benefits:
• 6XSSRUWVKHDOWK\FRJQLWLYHIXQFWLRQSRVVLEO\E\HQKDQFLQJFHOOXODUHQHUJ\G\QDPLFV
• 3URYLGHVSRWHQWDQWLR[LGDQWSURWHFWLRQIRUWKHFHQWUDOQHUYRXVV\VWHP
• 6XSSRUWVDKHDOWK\OLIHF\FOHRIQHXURQVDQGRWKHUFHOOV
• 0D\SURWHFWWKHEORRGEUDLQEDUULHUDQGQHUYHFHOOVIURPR[LGDWLYHVWUHVV
+HOSVPDLQWDLQRYHUDOOQHXURORJLFDOKHDOWKE\VXSSRUWLQJKHDOWK\PLWRFKRQGULDOIXQFWLRQPHWK\ODWLRQKRPRF\VWHLQH
PHWDEROLVPDQGFLUFXODWRU\IXQFWLRQ

Recommended uses:
• Multidimensional neuroprotection support
• Cerebrovascular support
&$87,21'RQRWXVHLISUHJQDQWIRUQXUVLQJ,ISDWLHQWLVWDNLQJPHGLFDWLRQLQFOXGLQJDQWLFRDJXODQWVXVHZLWK
caution.

Refrences:
1. $EGXO +0 &DODEUHVH 9 &DOYDQL 0 HW DO$FHW\O/FDUQLWLQHLQGXFHG XSUHJXODWLRQ RI KHDW VKRFN SURWHLQV SURWHFWV FRUWLFDO QHXURQV
DJDLQVWDP\ORLGEHWDSHSWLGHPHGLDWHGR[LGDWLYHVWUHVVDQGQHXURWR[LFLW\LPSOLFDWLRQVIRU$O]KHLPHU¶VGLVHDVH-1HXURVFL5HV
  
2. =DQHOOL 6$ 6ROHQVNL 0- 5RVHQWKDO 5( HW DO 0HFKDQLVPV RI LVFKHPLF QHXURSURWHFWLRQ E\ DFHW\O/FDUQLWLQH $QQ 1< $FDG 6FL

3. ,QDQR$6DL<1LNDLGR+HWDO$FHW\O/FDUQLWLQHSHUPHDELOLW\DFURVVWKHEORRGEUDLQEDUULHUDQGLQYROYHPHQWRIFDUQLWLQHWUDQVSRUWHU
2&71%LRSKDUP'UXJ'LVSRV  
4. 0DFNHQ]LH**=DJR03(UOHMPDQ$*HWDO$OSKDOLSRLFDFLGDQG1DFHW\OF\VWHLQHSUHYHQW]LQFGH¿FLHQF\LQGXFHGDFWLYDWLRQRI1)
NDSSD%DQG$3WUDQVFULSWLRQIDFWRUVLQKXPDQQHXUREODVWRPD,05FHOOV)UHH5DGLF5HV  
5. 0RQNV7-*KHUVL(JHD-)3KLOEHUW0HWDO6\PSRVLXPRYHUYLHZWKHUROHRIJOXWDWKLRQHLQQHXURSURWHFWLRQDQGQHXURWR[LFLW\7R[LFRO
6FL
6. +ZDQJ,.<RR.<.LP'6HWDO1HXURSURWHFWLYHHIIHFWVRIJUDSHVHHGH[WUDFWRQQHXURQDOLQMXU\E\LQKLELWLQJ'1$GDPDJHLQWKHJHUELO
KLSSRFDPSXVDIWHUWUDQVLHQWIRUHEUDLQLVFKHPLD/LIH6FL
7. /LQ<'HVERLV$-LDQJ6HWDO*URXS%YLWDPLQVSURWHFWPXULQHFHUHEHOODUJUDQXOHFHOOVIURPJOXWDPDWH10'$WR[LFLW\1HXURSKDUPDFRO
1HXURWR[LFRO
8. &RSSHQ $ %RODQGHU*RXDLOOH & 7UHDWPHQW RI GHSUHVVLRQ WLPH WR FRQVLGHU IROLF DFLG DQG YLWDPLQ % - 3V\FKRSKDUPDFRORJ\
  
9. /DPHUV<3ULQ]/DQJHQRKO50RVHU5HWDO6XSSOHPHQWDWLRQZLWK>6@PHWK\OWHWUDK\GURIRODWHRUIROLFDFLGHTXDOO\UHGXFHVSODVPD
WRWDOKRPRF\VWHLQHFRQFHQWUDWLRQVLQKHDOWK\ZRPHQ$P-&OLQ1XWU
10. :X'3DUGULGJH:0%ORRGEUDLQEDUULHUWUDQVSRUWRIUHGXFHGIROLFDFLG3KDUP5HV  
232 Neurological Conditions

Forgetfulness / Cognitive Function Decline


Acetylcholine Function
&HULYDΠLVIRUPXODWHGWRVXSSRUWKHDOWK\FRJQLWLYHIXQFWLRQLQWKRVHFRQFHUQHGDERXWPDLQWDLQLQJWKHLUPHPRU\E\
EHQH¿FLDOO\PRGXODWLQJWKHPHWDEROLVPRIWKHQHXURWUDQVPLWWHUDFHW\OFKROLQH'HVLJQHGWRDFWFHQWUDOO\ZLWKLQWKH
EUDLQ&HULYDIHDWXUHVKXSHU]LQH$PHWK\OWHWUDK\GURIRODWHDQGDOSKDWRFRWULHQRO IURP7RFRPLQŠ6XSUD%LRŒ 
ZKLFKUHVHDUFKVXJJHVWVPD\EHDEOHWRFURVVWKHEORRGEUDLQEDUULHU

Patient benefits:
• 6XSSRUWVWKHKHDOWK\PHWDEROLVPRIDFHW\OFKROLQHWKHSULPDU\QHXURWUDQVPLWWHUDVVRFLDWHGZLWKFRJQLWLYH
IXQFWLRQDQGWKHIRUPDWLRQDQGFRQVROLGDWLRQRIPHPRULHVX
• 3URYLGHV7RFRPLQŠ 6XSUD%LRŒ DQG KXSHU]LQH$ IRU QHUYH FHOO SURWHFWLRQ DJDLQVW H[FLWRWR[LF HIIHFWV DQG
RWKHUR[LGDWLYHLQÀXHQFHVX
• 6XSSRUWVDKHDOWK\OLIHF\FOHRIQHXURQVDQGRWKHUFHOOV

Suggested Nutritional Supplementation


• Ceriva™²VRIWJHOVGDLO\
&HULYDLVIRUPXODWHGWRVXSSRUWKHDOWK\FRJQLWLYHIXQFWLRQLQWKRVHFRQFHUQHGDERXWPDLQWDLQLQJWKHLUPHPRU\
E\EHQH¿FLDOO\PRGXODWLQJDFHW\OFKROLQH
• Exhilarin® — WDEOHWVGDLO\
([KLODULQLVDSURSULHWDU\EOHQGRI$\XUYHGLFKHUEVWKDWDUHWUDGLWLRQDOO\XVHGWRUHOLHYHVWUHVVDQGWRKHOS
PDLQWDLQPHQWDODFXLW\DQGVXSSRUWRYHUDOOZHOOEHLQJ
• Ceralin® Forte — 3 capsules daily
&HUDOLQ)RUWHLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJPXOWLSOH
SDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK
• Wellness Essentials™ Blood Sugar Support ²SDFNHWWZLFHGDLO\ZLWKIRRG
:HOOQHVV(VVHQWLDOV%ORRG6XJDU6XSSRUWLVDFRPELQDWLRQRIWKUHHSUHPLXPVXSSOHPHQWVLQFRQYHQLHQW
SDFNHWVWRSURYLGHHVVHQWLDOYLWDPLQVDQGPLQHUDOVRPHJDIDWW\DFLGVDQWLR[LGDQWVDQGSK\WRQXWULHQWV
WRVXSSRUWKHDOWK\EORRGVXJDUOHYHOVDOUHDG\LQWKHQRUPDOUDQJHDQGRYHUDOOKHDOWKZKHQWDNHQDVSDUWRI
a healthy diet.

Recommended uses:
• 0HPRU\FRQFHUQVDVVRFLDWHGZLWKDJLQJ
• &RJQLWLYHIXQFWLRQVXSSRUW

Refrences:
1. =KDQJ=:DQJ;&KHQ4HWDO&OLQLFDOHI¿FDF\DQGVDIHW\RIKXSHU]LQH$OSKDLQWUHDWPHQWRIPLOGWRPRGHUDWH$O]KHLPHUGLVHDVHD
SODFHERFRQWUROOHGGRXEOHEOLQGUDQGRPL]HGWULDO=KRQJJXD<L;XH=D=KL  &KLQHVH
2. :DQJ5<DQ+7DQJ;&3URJUHVVLQVWXGLHVRIKXSHU]LQH$DQDWXUDOFKROLQHVWHUDVHLQKLELWRUIURP&KLQHVHKHUEDOPHGLFLQH$FWD
3KDUPDFRO6LQ  
3. :DQJ57DQJ;&1HXURSURWHFWLYHHIIHFWVRIKXSHU]LQH$1HXURVLJQDOV
4. .KDQQD65R\66OLYND$HWDO1HXURSURWHFWLYHSURSHUWLHVRIWKHQDWXUDOYLWDPLQ(DOSKDWRFRWULHQRO6WURNH  
5. 2VDNDGD)+DVKLQR$.XPH7HWDO$OSKDWRFRWULHQROSURYLGHVWKHPRVWQHXURSURWHFWLRQDPRQJYLWDPLQ(DQDORJVRQFXOWXUHGVWULDWDO
QHXURQV1HXURSKDUPDFRORJ\  
6. /HYLWW 0 1L[RQ 3) 3LQFXV -+ HW DO 7UDQVSRUW FKDUDFWHULVWLFV RI IRODWHV LQ FHUHEURVSLQDO ÀXLG D VWXG\ XWLOL]LQJ GRXEO\ ODEHOHG 
PHWK\OWHWUDK\GURIRODWHDQGIRUP\OWHWUDK\GURIRODWH-&OLQ,QYHVW  
7. :X'3DUGULGJH:0%ORRGEUDLQEDUULHUWUDQVSRUWRIUHGXFHGIROLFDFLG3KDUP5HV  
8. /DPHUV<3ULQ]/DQJHQRKO50RVHU5HWDO6XSSOHPHQWDWLRQZLWK>6@PHWK\OWHWUDK\GURIRODWHRUIROLFDFLGHTXDOO\UHGXFHVSODVPD
WRWDOKRPRF\VWHLQHFRQFHQWUDWLRQVLQKHDOWK\ZRPHQ$P-&OLQ1XWU
9. 4XDGUL3)UDJLDFRPR&3H]]DWL5HWDO+RPRF\VWHLQHIRODWHDQGYLWDPLQ%LQPLOGFRJQLWLYHLPSDLUPHQW$O]KHLPHUGLVHDVHDQG
YDVFXODUGHPHQWLD$P-&OLQ1XWU
10. .UXPDQ,,0RXWRQ35(PRNSDH5HWDO)RODWHGH¿FLHQF\LQKLELWVSUROLIHUDWLRQRIDGXOWKLSSRFDPSDOSURJHQLWRUV1HXURSKDUPDFRO
1HXURWR[LFRO  
Neurological Conditions 233

Distracted Mind / Attention Deficit Behavior


Dopamine Function
/XPLQDŒ LVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQ²LVVXHVUHODWHGWRSURSHUIRFXVDWWHQWLRQ
OHDUQLQJDQGPHPRU\²WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQHJDPPD
DPLQREXW\ULF DFLG *$%$  DQG QRUHSLQHSKULQH )RUPXODWHG WR DFW FHQWUDOO\ ZLWKLQ WKH EUDLQ WKLV DGYDQFHG
IRUPXODIHDWXUHVGRFRVDKH[DHQRLFDFLG '+$ DQG/DFWLXP3XUHŒ²ZKLFKUHVHDUFKVXJJHVWVDUHDEOHWRFURVV
WKHEORRGEUDLQEDUULHU²DORQJZLWKWKHDQLQHIRUWDUJHWHGQHXURORJLFDOVXSSRUW

Patient benefits:
• 'RSDPLQH*$%$DQGQRUHSLQHSKULQHPHWDEROLVPDUHLPSOLFDWHGLQH[HFXWLYHEUDLQIXQFWLRQVVXFKDVIRFXV
attention, motivation, learning, and memoryu
• )HDWXUHV/DFWLXP3XUHŒDSDWHQWHGELRDFWLYHGHFDSHSWLGHWKDWKDVEHHQVKRZQWRVXSSRUWUHOD[DWLRQDQG
DKHDOWK\VWUHVVUHVSRQVHSRVVLEO\E\LQÀXHQFLQJ*$%$
• 3URYLGHVWKHDQLQHDQG'+$ZKLFKSUHOLPLQDU\UHVHDUFKVXJJHVWVPD\SRVLWLYHO\LQÀXHQFHWKHPHWDEROLVP
RIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQH*$%$DQGQRUHSLQHSKULQH

Suggested Nutritional Supplementation


• Lumina™ — VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQ²LVVXHVUHODWHGWRSURSHUIRFXVDWWHQWLRQ
OHDUQLQJDQGPHPRU\²WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQHJDPPD
DPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH
• Ceralin® Forte — 3 capsules daily
&HUDOLQ)RUWHLVIRUPXODWHGWRSURYLGHZHOOURXQGHGVXSSRUWIRUEUDLQDQGQHUYHSURWHFWLRQDGGUHVVLQJPXOWLSOH
SDWKZD\VLQYROYHGLQQHXURORJLFDOKHDOWK
• EPA-DHA 720 — VRIWJHOVGDLO\
(3$'+$SURYLGHVPJRIRPHJDHVVHQWLDOIDWW\DFLGVIURPFROGZDWHU¿VKSHUVRIWJHO²HLFRVDSHQWDHQRLF
DFLG (3$ DQGGRFRVDKH[DHQRLFDFLG '+$ ²WRKHOSGHOLYHUJUHDWHUVXSSRUWLQIHZHUVRIWJHOV

Recommended uses:
• Distracted mind
• 0HQWDOIRFXVVXSSRUW
• 5HOD[DWLRQVXSSRUW
&$87,21'RQRWXVHLISUHJQDQWRUQXUVLQJ$YRLGXVHLISDWLHQWLVWDNLQJEHQ]RGLD]HSLQHDQWLFRDJXODQWVRULV
FRQVXPLQJDOFRKRO'RQRWXVHEHIRUHVXUJHU\

Refrences:
1. 0HVVDRXGL 0 /HIUDQF0LOORW & 'HVRU ' HW DO (IIHFWV RI D WU\SWLF K\GURO\VDWH IURP ERYLQH PLON DOSKD6FDVHLQ RQ KHPRG\QDPLF
UHVSRQVHVLQKHDOWK\KXPDQYROXQWHHUVIDFLQJVXFFHVVLYHPHQWDODQGSK\VLFDOVWUHVVVLWXDWLRQV(XU-1XWU  
2. *XHVGRQ%0HVVDRXGL0/HIUDQF0LOORW&HWDO$WU\SWLFK\GURO\VDWHIURPERYLQHPLONDOSKD6FDVHLQLPSURYHVVOHHSLQUDWVVXEMHFWHG
WRFKURQLFPLOGVWUHVV3HSWLGHV  
3. :HLVV0%DUWKHO76FKQLWWNHU5HWDO&RUUHODWLRQVEHWZHHQFHQWUDOQHUYRXVSDUDPHWHUVDQGKRUPRQDOUHJXODWLRQVGXULQJUHFRYHU\
IURPSK\VLFDOVWUHVVDUHLQÀXHQFHGE\/WKHDQLQH$PLQR$FLGV 9LHQQD   
4. .RED\DVKL.1DJDWR<$RL1HWDO(IIHFWVRI/WKHDQLQHRQWKHUHOHDVHRIDOSKDEUDLQZDYHVLQKXPDQYROXQWHHUV1LSSRQ1RHJLNDJDNX
.DLVKL  
5. <RNRJRVKL+.DWR<6DJHVDND0HWDO5HGXFWLRQHIIHFWRIWKHDQLQHRQEORRGSUHVVXUHDQGEUDLQK\GUR[\LQGROHVLQVSRQWDQHRXVO\
K\SHUWHQVLYHUDWV%LRVFL%LRWHFK%LRFKHP  
6. 'H OD 3UHVD 2ZHQV 6 ,QQLV 60 'RFRVDKH[DHQRLF DQG DUDFKLGRQLF DFLG SUHYHQW D GHFUHDVH LQ GRSDPLQHUJLF DQG VHURWRQHUJLF
QHXURWUDQVPLWWHUVLQIURQWDOFRUWH[FDXVHGE\DOLQROHLFDQGDOSKDOLQROHQLFDFLGGH¿FLHQWGLHWLQIRUPXODIHGSLJOHWV-1XWU
7. $QGHUVRQ *- +RKLPHU $5 :LOOHNH *% 8SWDNH RI GRFRVDKH[DHQRLF DFLG E\ PLFURYHVVHOV IURP GHYHORSLQJ UDW EUDLQ /LIH 6FL
  
8. +DVKLPRWR07DQDEH<)XMLL<HWDO&KURQLFDGPLQLVWUDWLRQRIGRFRVDKH[DHQRLFDFLGDPHOLRUDWHVWKHLPSDLUPHQWRIVSDWLDOFRJQLWLRQ
OHDUQLQJDELOLW\LQDP\ORLGEHWDLQIXVHGUDWV-1XWU
9. )ORUHQW60DODSODWH$UPDQG&<RXVVHI,HWDO'RFRVDKH[DHQRLFDFLGSUHYHQWVQHXURQDODSRSWRVLVLQGXFHGE\VROXEOHDP\ORLGEHWD
ROLJRPHUV-1HXURFKHP  
10. /XNLZ:-&XL-*0DUFKHVHOOL9/HWDO$UROHIRUGRFRVDKH[DHQRLFDFLGGHULYHGQHXURSURWHFWLQ'LQQHXUDOFHOOVXUYLYDODQG$O]KHLPHU
GLVHDVH-&OLQ,QYHVW  
234 Neurological Conditions

Nervousness / Anxiety
GABA & Glutamate Balance
7UDQFRUŒLVIRUPXODWHGWRVXSSRUWDVHQVHRIWUDQTXLOLW\LQWKRVHZKRPD\IHHOZRUULHGRUQHUYRXVE\EHQH¿FLDOO\
PRGXODWLQJWKHEDODQFHEHWZHHQWKHFDOPLQJLQÀXHQFHRI*$%$DQGWKHH[FLWDWRU\HIIHFWVRIJOXWDPDWH'HVLJQHG
WRDFWFHQWUDOO\ZLWKLQWKHEUDLQWKLVDGYDQFHGIRUPXODIHDWXUHVWKHDPLQRDFLGV1$&DQGWDXULQH²ZKLFKUHVHDUFK
VXJJHVWVPD\EHDEOHWRFURVVWKHEORRGEUDLQEDUULHU²DORQJZLWKFRQFHQWUDWHGJUHHQWHDFDWHFKLQVYLWDPLQ%
DQGPDJQHVLXPPDODWHIRUWDUJHWHGQHXURORJLFDOVXSSRUW
3DWLHQWEHQH¿WV
• 6XSSRUWVDVHQVHRIWUDQTXLOLW\E\PRGXODWLQJWKHEDODQFHEHWZHHQJOXWDPDWHDQG*$%$ZLWK1$&JUHHQ
tea catechins, and vitamin B6
• +HOSVSURWHFWQHUYHFHOOVIURPWKHH[FLWRWR[LFHIIHFWVRIH[FHVVJOXWDPDWHDQGRWKHUSURR[LGDQWLQÀXHQFHV
ZLWKWDXULQHDQG(*&*
• 6XSSRUWVUHOD[DWLRQDQGDVHQVHRIFDOPZLWKPDJQHVLXPDQGYLWDPLQ%

Suggested Nutritional Supplementation


• Trancor™ — Four capsules daily
7UDQFRULVIRUPXODWHGWRVXSSRUWDVHQVHRIWUDQTXLOLW\LQWKRVHZKRPD\IHHOZRUULHGRUQHUYRXVE\EHQH¿FLDOO\
PRGXODWLQJWKHEDODQFHEHWZHHQWKHFDOPLQJLQÀXHQFHRI*$%$DQGWKHH[FLWDWRU\HIIHFWVRIJOXWDPDWH
• Serenagen®²WDEOHWVGDLO\
6HUHQDJHQLVDFODVVLFFRPSUHKHQVLYHKHUEDOVWUHVVPDQDJHPHQWIRUPXODWDUJHWLQJLQGLYLGXDOVZKRDUH
³VWUHVVHGDQGZLUHG´

Recommended uses:
• Nervousness
• 6XSSRUWIRUWUDQTXLOLW\
&$87,21'RQRWXVHLISUHJQDQWRUQXUVLQJ8VHZLWKFDXWLRQLISDWLHQWKDVFRQJHVWLYHKHDUWIDLOXUHRUNLGQH\
GLVHDVH RU LV WDNLQJ PHGLFDWLRQ ² LQFOXGLQJ DQWLFRDJXODQWV 0DLQWDLQ DGHTXDWH ÀXLG LQWDNH ZKLOH WDNLQJ WKLV
product.

Refrences:
1. )DUU6$3RRQ+)'RJUXNRO$N'HWDO7KHDQWLR[LGDQWVDOSKDOLSRLFDFLGDQG1DFHW\OF\VWHLQHUHYHUVHPHPRU\LPSDLUPHQWDQGEUDLQ
R[LGDWLYHVWUHVVLQDJHG6$03PLFH-1HXURFKHP  
2. 1HXZHOW($3DJHO0$+DVOHU%3HWDO7KHUDSHXWLFHI¿FDF\RIDRUWLFDGPLQLVWUDWLRQRI1DFHW\OF\VWHLQHDVDFKHPRSURWHFWDQWDJDLQVW
ERQHPDUURZWR[LFLW\DIWHULQWUDFDURWLGDGPLQLVWUDWLRQRIDON\ODWRUVZLWKRUZLWKRXWJOXWDWKLRQHGHSOHWLRQLQDUDWPRGHO&DQFHU5HV

3. $GDFKL17RPRQDJD67DFKLEDQD7HWDO  (SLJDOORFDWHFKLQJDOODWHDWWHQXDWHVDFXWHVWUHVVUHVSRQVHVWKURXJK*$%$HUJLFV\VWHP
LQWKHEUDLQ(XU-3KDUPDFRO
4. 9LJQHV00DXULFH7/DQWH)HWDO$Q[LRO\WLFSURSHUWLHVRIJUHHQWHDSRO\SKHQRO  HSLJDOORFDWHFKLQJDOODWH (*&* %UDLQ5HV
-XO>(SXE@
5. 3DXOD/LPD$&'H)HOLFH)*%ULWR0RUHLUD-HWDO$FWLYDWLRQRI*$%$ $ UHFHSWRUVE\WDXULQHDQGPXVFLPROEORFNVWKHQHXURWR[LFLW\
RIEHWDDP\ORLGLQUDWKLSSRFDPSDODQGFRUWLFDOQHXURQV1HXURSKDUPDFRO
6. 6WXPPHU:%HW]$/6KDNXL3HWDO%ORRGEUDLQEDUULHUWDXULQHWUDQVSRUWGXULQJRVPRWLFVWUHVVDQGLQIRFDOFHUHEUDOLVFKHPLD-&HUHE
%ORRG)ORZ0HWDE  
7. 2MD666DUDQVDDUL37DXULQHDVRVPRUHJXODWRUDQGQHXURPRGXODWRULQWKHEUDLQ0HWDE%UDLQ'LV  
8. 3ROHV]DN(6]HZF]\N%.HG]LHUVND(HWDO$QWLGHSUHVVDQWDQGDQ[LRO\WLFOLNHDFWLYLW\RIPDJQHVLXPLQPLFH3KDUPDFRO%LRFKHP
%HKDY  
9. 'H6RX]D0&:DONHU$)5RELQVRQ3$HWDO$V\QHUJLVWLFHIIHFWRIDGDLO\VXSSOHPHQWIRUPRQWKRIPJPDJQHVLXPSOXVPJ
YLWDPLQ%IRUWKHUHOLHIRIDQ[LHW\UHODWHGSUHPHQVWUXDOV\PSWRPVDUDQGRPL]HGGRXEOHEOLQGFURVVRYHUVWXG\-:RPHQV+HDOWK
*HQG%DVHG0HG  
10. 0F&DUW\0)+LJKGRVHS\ULGR[LQHDVDQµDQWLVWUHVV¶VWUDWHJ\0HG+\SRWKHVHV  
Neurological Conditions 235

Occasional Sleeplessness / Sleep Disorders


Melatonin Function
%HQHVRPŒLVIRUPXODWHGWRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVVE\EHQH¿FLDOO\
PRGXODWLQJWKHPHWDEROLVPRIPHODWRQLQDQG*$%$'HVLJQHGWRDFWFHQWUDOO\ZLWKLQWKHEUDLQ%HQHVRPIHDWXUHV
VXSSOHPHQWDOPHODWRQLQ²ZKLFKUHVHDUFKVXJJHVWVLVDEOHWRFURVVWKHEORRGEUDLQEDUULHU/DFWLXP3XUHŒ²D
SDWHQWHGELRDFWLYHGHFDSHSWLGHZLWKUHOD[LQJSURSHUWLHV²DQGSDVVLRQÀRZHUDUHDGGHGWRURXQGRXWWKLVIRUPXOD
IRUWDUJHWHGQHXURORJLFDOVXSSRUW
3DWLHQWEHQH¿WV
• 3URPRWHVUHVWIXOTXDOLW\VOHHSIRUWKRVHZLWKRFFDVLRQDOVOHHSOHVVQHVV
• )HDWXUHVPHODWRQLQDKRUPRQHQDWXUDOO\SURGXFHGLQWKHEUDLQWKDWKHOSVUHJXODWHVOHHSZDNLQJDQGWKH
body’s circadian rhythm (or time clock)
• 3URYLGHV/DFWLXP3XUHŒDQGSDVVLRQÀRZHUZKLFKPD\IDYRUDEO\PRGXODWHWKHPHWDEROLVPRI*$%$

Suggested Nutritional Supplementation


• Benesom™²2QHWDEOHWRQHKRXUEHIRUHEHGWLPH$W\SLFDOFRQVXPSWLRQUDQJHIRUPHODWRQLQLVPJ
PJIRUVXSSRUWLQJRFFDVLRQDOVOHHSOHVVQHVV
%HQHVRPLVIRUPXODWHGWRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVVE\EHQH¿FLDOO\
PRGXODWLQJWKHPHWDEROLVPRIPHODWRQLQDQG*$%$
• Tran-Q®²WDEOHWVGDLO\
7UDQ4KDVEHHQWUDGLWLRQDOO\XVHGWRPDLQWDLQDFDOPVSLULWUHOD[WKHERG\DQGTXLHWWKHKHDUW$FFRUGLQJWR
WUDGLWLRQDO&KLQHVHKHUERORJ\DVXVWDLQHGLQWHQVHHPRWLRQDOVWDWHFDXVHVDGLVKDUPRQ\EHWZHHQOLYHUDQG
heart energy resulting in nervousness and mild mood changes.
• Lumina™ — VRIWJHOVGDLO\
/XPLQDLVGHVLJQHGWRVXSSRUWKHDOWK\PHQWDOIXQFWLRQDQGUHOD[DWLRQ²LVVXHVUHODWHGWRSURSHUIRFXVDWWHQWLRQ
OHDUQLQJDQGPHPRU\²WKURXJKPRGXODWLQJWKHPHWDEROLVPRIQHXURWUDQVPLWWHUVVXFKDVGRSDPLQHJDPPD
DPLQREXW\ULFDFLG *$%$ DQGQRUHSLQHSKULQH

Recommended uses:
• 2FFDVLRQDOVOHHSOHVVQHVV
&$87,21'RQRWXVHLISUHJQDQWRUQXUVLQJ)RUDGXOWXVHRQO\$YRLGXVHLISDWLHQWKDVDKLVWRU\RIVHL]XUHVRU
GHSUHVVLRQLVWDNLQJEHQ]RGLD]HSLQHRUVHGDWLQJPHGLFDWLRQRULVFRQVXPLQJDOFRKRO8VHZLWKFDXWLRQLIWDNLQJ
DQWLRFRDJXODQWVRURWKHUPHGLFDWLRQVRULIRSHUDWLQJPDFKLQHU\1RWUHFRPPHQGHGIRUPRUHWKDQFRQVHFXWLYH
months.

Refrences:
1. =KGDQRYD,9:XUWPDQ5-5HJDQ00HWDO0HODWRQLQWUHDWPHQWIRUDJHUHODWHGLQVRPQLD-&OLQ(QGRFULQRO0HWDE
30.
2. 6PLWV0*YDQ6WHO+)YDQGHU+HLMGHQ.HWDO0HODWRQLQLPSURYHVKHDOWKVWDWXVDQGVOHHSLQFKLOGUHQZLWKLGLRSDWKLFFKURQLFVOHHS
RQVHWLQVRPQLDDUDQGRPL]HGSODFHERFRQWUROOHGWULDO-$P$FDG&KLOG$GROHVF3V\FKLDWU\  
3. YDQGHQ%HUJ030HUNXV35RPHLMLQ6*HWDO8SWDNHRIPHODWRQLQLQWRWKHFHUHEURVSLQDOÀXLGDIWHUQDVDODQGLQWUDYHQRXVGHOLYHU\
VWXGLHVLQUDWVDQGFRPSDULVRQZLWKDKXPDQVWXG\3KDUP5HV  
4. 3DUGULGJH:00LHWXV/-7UDQVSRUWRIDOEXPLQERXQGPHODWRQLQWKURXJKWKHEORRGEUDLQEDUULHU-1HXURFKHP  
5. +DUGHODQG 5 $QWLR[LGDWLYH SURWHFWLRQ E\ PHODWRQLQ PXOWLSOLFLW\ RI PHFKDQLVPV IURP UDGLFDO GHWR[L¿FDWLRQ WR UDGLFDO DYRLGDQFH
(QGRFULQH  
6. $NKRQG]DGHK61DJKDYL+59D]LULDQ0HWDO3DVVLRQÀRZHULQWKHWUHDWPHQWRIJHQHUDOL]HGDQ[LHW\DSLORWGRXEOHEOLQGUDQGRPL]HG
FRQWUROOHGWULDOZLWKR[D]HSDP-&OLQ3KDUP7KHU
7. 'KDZDQ..XPDU66KDUPD$$QWLDQ[LHW\VWXGLHVRQH[WUDFWVRI3DVVLÀRUDLQFDUQDWD/LQQHDXV-(WKQRSKDUPDFRO
70.
8. 0HVVDRXGL 0 /HIUDQF0LOORW & 'HVRU ' HW DO (IIHFWV RI D WU\SWLF K\GURO\VDWH IURP ERYLQH PLON DOSKD6FDVHLQ RQ KHPRG\QDPLF
UHVSRQVHVLQKHDOWK\KXPDQYROXQWHHUVIDFLQJVXFFHVVLYHPHQWDODQGSK\VLFDOVWUHVVVLWXDWLRQV(XU-1XWU  
9. *XHVGRQ%0HVVDRXGL0/HIUDQF0LOORW&HWDO$WU\SWLFK\GURO\VDWHIURPERYLQHPLONDOSKD6FDVHLQLPSURYHVVOHHSLQUDWVVXEMHFWHG
WRFKURQLFPLOGVWUHVV3HSWLGHV  
10. &DPSEHOO(/&KHELE0-RKQVWRQ*$7KHGLHWDU\ÀDYRQRLGVDSLJHQLQDQG  HSLJDOORFDWHFKLQJDOODWHHQKDQFHWKHSRVLWLYHPRGXODWLRQ
E\GLD]HSDPRIWKHDFWLYDWLRQE\*$%$RIUHFRPELQDQW*$%$ $ UHFHSWRUV%LRFKHP3KDUPDFRO  
236 Neurological Conditions

Negative Mood / Depression


The Cortisol Connection
6\PSKRUDŒLVIRUPXODWHGWRSURPRWHDSRVLWLYHPRRGDQGPHQWDOZHOOEHLQJE\EHQH¿FLDOO\PRGXODWLQJFHUHEUDO
PHWDEROLVPRIWKHQHXURKRUPRQHFRUWLVRO'HVLJQHGWRDFWFHQWUDOO\ZLWKLQWKHEUDLQ6\PSKRUDIHDWXUHVPHWK\O
WHWUDK\GURIRODWH²ZKLFKUHVHDUFKVXJJHVWVLVDEOHWRSDVVWKHEORRGEUDLQEDUULHU²DORQJZLWK'+($DQGYLWDPLQ
'IRUWDUJHWHGQHXURORJLFDOVXSSRUW
3DWLHQWEHQH¿WV
• &RUWLVROLVDJOXFRFRUWLFRLGKRUPRQHDVVRFLDWHGZLWKPRRGZHOOEHLQJDQGVWUHVVUHVSRQVH
• )HDWXUHV'+($ZKLFKUHVHDUFKVXJJHVWVPD\VXSSRUWDSRVLWLYHPRRGE\PRGXODWLQJWKHHIIHFWVRIEUDLQ
FRUWLVROGXULQJSHULRGVRIVWUHVV
• 3URYLGHVYLWDPLQ'DYLWDPLQWKDWKDVEHHQDVVRFLDWHGZLWKVHURWRQLQPHWDEROLVPDQGDSRVLWLYHPRRG
• 6XSSOLHV QHXURDFWLYH YLWDPLQ % DQG IRODWH²FRIDFWRUV LQ WKH V\QWKHVLV RI QHXURWUDQVPLWWHUV VXFK DV
serotonin

Serotonin Function
Somnolin®LVGHVLJQHGWRVXSSRUWDSRVLWLYHPRRGDQGDQDOHUWUHOD[HGVWDWHGXULQJWKHGD\ZKLOHSURPRWLQJ
UHFXSHUDWLYHVOHHSDWQLJKWWKURXJKEHQH¿FLDOO\PRGXODWLQJWKHPHWDEROLVPRIVHURWRQLQ7KLVIRUPXODIHDWXUHV
FOLQLFDOO\HIIHFWLYHOHYHOVRI+73DQGWKHDQLQHLQMXVWRQHWDEOHWGDLO\

Serotonin Uptake
6W-RKQ¶V:RUWZLWK$FWL)RODWHDQG%LVIRUPXODWHGWRVXSSRUWDFDOPSRVLWLYHPRRGZLWKQXWULHQWVWKDWPD\
SOD\DUROHLQVHURWRQLQPHWDEROLVP7KLVIRUPXODVXSSOLHVFOLQLFDOO\HIIHFWLYHOHYHOVRIVWDQGDUGL]HG6W-RKQ¶V
:RUWOHDIDQGÀRZHUH[WUDFWFRPELQHGZLWKDELRDFWLYHIRODWHEOHQGDQGYLWDPLQ%LQWZRWDEOHWVGDLO\

Suggested Nutritional Supplementation


• Symphora™²7ZRWDEOHWVGDLO\
6\PSKRUDLVIRUPXODWHGWRSURPRWHDSRVLWLYHPRRGDQGPHQWDOZHOOEHLQJE\EHQH¿FLDOO\PRGXODWLQJFHUHEUDO
PHWDEROLVPRIWKHQHXURKRUPRQHFRUWLVRO
• Somnolin® ²7DEOHWVGDLO\
6RPQROLQIHDWXUHVDFRPSOHPHQWDU\EOHQGRIQXWULHQWVLQFOXGLQJ+73WKHDQLQHDQGWDUJHWHG%YLWDPLQV
WRSURPRWHDUHVWIXOUHOD[HGVWDWHDQGUHOLHYHRFFDVLRQDOVOHHSOHVVQHVV
• St. John’s Wort ²7DEOHWVGDLO\
6W-RKQ¶V:RUWFRQWDLQVPJRIDSUHPLXPH[WUDFWRI6W-RKQ¶VZRUWVWDQGDUGL]HGWRK\SHULFLQV
FRPELQHGZLWKIRODWHVDQGYLWDPLQ%
• Appropriate Wellness Essentials™ IRUPXOD ²SDFNHWVGDLO\
.H\9LWDPLQV 0LQHUDOV(VVHQWLDO)DWW\$FLGV3/863DWLHQW6SHFL¿F1XWULWLRQ

Recommended uses:
• 3RVLWLYHPRRGVXSSRUW
• )HHOLQJRIZHOOEHLQJVXSSRUW
:$51,1*'212786(,)35(*1$17251856,1*)RUDGXOWXVHRQO\$YRLGXVHLISDWLHQWKDVRUKDV
DKLVWRU\RIKRUPRQHUHODWHGFDQFHUGLDEHWHVRUELSRODUGLVRUGHU,ISDWLHQWKDVDPHGLFDOFRQGLWLRQRUWDNHV
PHGLFDWLRQXVHZLWKFDXWLRQ'RQRWH[FHHGUHFRPPHQGHGGRVDJH

Refrences:
1. .LPRQLGHV9*.KDWLEL1+6YHQGVHQ&1HWDO'HK\GURHSLDQGURVWHURQH '+($ DQG'+($VXOIDWH '+($6 SURWHFWKLSSRFDPSDO
QHXURQVDJDLQVWH[FLWDWRU\DPLQRDFLGLQGXFHGQHXURWR[LFLW\3URF1DWO$FDG6FL86$
2. :RONRZLW]205HXV9,.HHEOHU$HWDO'RXEOHEOLQGWUHDWPHQWRIPDMRUGHSUHVVLRQZLWKGHK\GURHSLDQGURVWHURQH$P-3V\FKLDWU\
  
3. 6WURXV 5' 0DD\DQ 5 /DSLGXV 5 HW DO 'HK\GURHSLDQGURVWHURQH DXJPHQWDWLRQ LQ WKH PDQDJHPHQW RI QHJDWLYH GHSUHVVLYH DQG
DQ[LHW\V\PSWRPVLQVFKL]RSKUHQLD$UFK*HQ3V\FKLDWU\  
4. /DQVGRZQH$73URYRVW6&9LWDPLQ'HQKDQFHVPRRGLQKHDOWK\VXEMHFWVGXULQJZLQWHU3V\FKRSKDUPDFRORJ\ %HUO   
23.
5. 7DQLXUD+,WR06DQDGD1HWDO&KURQLF'WUHDWPHQWSURWHFWVDJDLQVWQHXURWR[LFLW\E\JOXWDPDWHLQDVVRFLDWLRQZLWKXSUHJXODWLRQRI
YLWDPLQ'UHFHSWRUP51$H[SUHVVLRQLQFXOWXUHGUDWFRUWLFDOQHXURQV-1HXURVFL5HV
6. %RWWLJOLHUL 7 /DXQG\ 0 &UHOOLQ 5 HW DO +RPRF\VWHLQH IRODWH PHWK\ODWLRQ DQG PRQRDPLQH PHWDEROLVP LQ GHSUHVVLRQ - 1HXURO
1HXURVXUJ3V\FKLDWU\
7. :X'3DUGULGJH:0%ORRGEUDLQEDUULHUWUDQVSRUWRIUHGXFHGIROLFDFLG3KDUP5HV  
8. 6SHFWRU5/RUHQ]R$9)RODWHWUDQVSRUWLQWKHFHQWUDOQHUYRXVV\VWHP$P-3K\VLRO  
9. 4XDGUL3)UDJLDFRPR&3H]]DWL5HWDO+RPRF\VWHLQHIRODWHDQGYLWDPLQ%LQPLOGFRJQLWLYHLPSDLUPHQW$O]KHLPHUGLVHDVHDQG
YDVFXODUGHPHQWLD$P-&OLQ1XWU
10. &RSSHQ $ %RODQGHU*RXDLOOH & 7UHDWPHQW RI GHSUHVVLRQ WLPH WR FRQVLGHU IROLF DFLG DQG YLWDPLQ % - 3V\FKRSKDUPDFRORJ\
  
Neurological Conditions 237

Neurobehavioral Symptom Checklist


3DWLHQW1DPH Date:
)URPWLPHWRWLPHHYHU\RQHIHHOVRXWRIVRUWVQRWWKHPVHOYHVQHUYRXVGHSUHVVHGLUULWDEOHRUDQ[LRXV,OOQHVV
and prescription medications
FDQDOWHUEHKDYLRUSHUFHSWLRQDQGPRRGVWDWHVDVZHOO7KHVHTXHVWLRQVDUHGHVLJQHGWRDVVLVW\RXDQG\RXU
KHDOWKFDUHSURYLGHULQLGHQWLI\LQJ
SDWWHUQV RI EHKDYLRU DQG IHHOLQJV WKDW WHQG WR DIIHFW WKH TXDOLW\ RI \RXU UHODWLRQVKLSV ZLWK IDPLO\ DQG IULHQGV
SHUIRUPDQFHDWZRUNDQG\RXU
RYHUDOOVHQVHRIZHOOEHLQJ%\VKDULQJWKLVLQIRUPDWLRQ\RXSDUWLFLSDWHDVDSDUWQHULQH[SORULQJVRPHRIWKH
SRVVLEOHXQGHUO\LQJFDXVHVRIDQ\
HPRWLRQDORUPHQWDOGLVFRPIRUW\RXPD\EHH[SHULHQFLQJ
Directions:
3OHDVHFKHFNWKHER[HVWKDWEHVWGHVFULEH\RXUIHHOLQJVDQGDELOLW\WRIXQFWLRQPRVWRIWKHWLPH:KHQDQVZHULQJ
each question, consider the
GHJUHHWRZKLFK\RXUGDLO\OLIHLVDIIHFWHG

2YHUWKHODVW\HDU,KDYHH[SHULHQFHG … +DYH WURXEOH IDOOLQJ DVOHHS RU VWD\LQJ


… %HFRPLQJIRUJHWIXO asleep
… Lapses in memory … 6ZHDWDQGKDYHKRWÀDVKHVLQDQWLFLSDWLRQ
… Becoming less attentive RIHYHQWV
… Less interest in normal activities … Feel irritable or short tempered
… Feeling less sharp … Have trouble letting things go
… 'LI¿FXOW\UHPHPEHULQJSHRSOH¶VQDPHV … *HWDQJU\IRUQRDSSDUHQWUHDVRQ
… 'LI¿FXOW\PDNLQJGHFLVLRQV … :RPHQRQO\*HWZRUVHV\PSWRPVSULRUWR
getting my period
… 3UREOHPV ILQGLQJ WKH ULJKW ZRUGV WR
communicate ,RIWHQ
… 'LI¿FXOW\VROYLQJURXWLQHSUREOHPV … Feel overly active and compelled to do things,
… 'LI¿FXOW\OHDUQLQJQHZWKLQJV like being driven by a motor
… 3UREOHPV ZULWLQJ UHDGLQJ RU RUJDQL]LQJ … +DYHGLI¿FXOW\UHOD[LQJDQGXQZLQGLQJZKHQ
thoughts ,KDYHWLPHWRP\VHOI
… 'LI¿FXOW\IROORZLQJLQVWUXFWLRQV … 0LVSODFHDQGKDYHGLI¿FXOW\¿QGLQJWKLQJV
… &UDYH FDIIHLQH DQG VWLPXODQWV WR NHHS PH
,H[SHULHQFH going
… /DFNRILQWHUHVWLQQRUPDODFWLYLWLHV … 'HOD\JHWWLQJVWDUWHGZKHQ,KDYHDWDVNRU
… /RVVRIHQHUJ\ ZRUNWKDW
… 2YHUVOHHSLQJRUVOHHSLQHVV … UHTXLUHVDORWRIWKRXJKW
… 6HQVHRIVDGQHVVIRUQRDSSDUHQWUHDVRQ … *HW HDVLO\ GLVWUDFWHG E\ DFWLYLW\ RU QRLVH
… ,QFUHDVHG DSSHWLWH HVSHFLDOO\ IRU around me
carbohydrates … +DYH GLI¿FXOW\ NHHSLQJ P\ DWWHQWLRQ ZKHQ
… Fatigue GRLQJERULQJDQGUHSHWLWLYHZRUN
… 6\PSWRPV WKDW XVXDOO\ JHW ZRUVH LQ WKH … )LGJHWRUVTXLUPZLWKP\KDQGVDQGIHHWZKHQ
ZLQWHU ,KDYHWRVLWGRZQIRUDORQJWLPH
… :HLJKWJDLQRUZHLJKWORVV … Leave my seat in meetings or other situations
… 'LIILFXOW\ FRQFHQWUDWLQJ DQG SURFHVVLQJ LQZKLFK,DPH[SHFWHGWRUHPDLQVHDWHG
LQIRUPDWLRQHVSHFLDOO\LQWKHDIWHUQRRQ … Have problems remembering appointments
… 'LPLQLVKHGVH[XDOGHVLUH or obligations
… +DYHGLI¿FXOW\FRQFHQWUDWLQJRQZKDWSHRSOH
,IUHTXHQWO\
VD\WRPHHYHQZKHQWKH\DUHVSHDNLQJWR
… )HHOWHQVHDQGKDYHWURXEOHUHOD[LQJ me directly
… Have headaches and other aches and … Move around and kick in my sleep
pains
… *HWFUDEE\RUJURXFK\ ,H[SHULHQFH
238 Neurological Conditions

… :DNLQJXSIUHTXHQWO\GXULQJWKHQLJKWZLWK
GLI¿FXOW\UHWXUQLQJWRVOHHS
… /RRNLQJIRUZDUGWRFDWFKLQJXSRQP\VOHHS
RQWKHZHHNHQGV
… 7DNLQJPRUHWKDQPLQXWHVWRIDOODVOHHS
at night
… Stomach problems or nausea
… :DNLQJXSUHSHDWHGO\WKURXJKRXWWKHQLJKW
… :DNLQJXSJURJJ\DQGQRWZHOOUHVWHG
… 3UHIHUULQJWRJRWRVOHHSODWHUWKDQPLGQLJKW
DQGZDNLQJXSODWHDIWHU$0
… 3UHIHUULQJDQHDUO\EHGWLPH²JRLQJWRVOHHS
EHWZHHQ30DQG30DQGZDNLQJXS
early, around 5:00 A.M.
… Jet lag
… 'LI¿FXOW\WXUQLQJRIIP\WKRXJKWVZKHQ,OD\
GRZQWRVOHHS

Additional Comments:
Neurological Conditions 239

Neurobehavioral Symptom Checklist Interpretation Key


240 Osteoarthritis

Osteoarthritis
2VWHRDUWKULWLV 2$ LVWKHPRVWFRPPRQIRUPRIDUWKULWLV,WLVDMRLQWGLVHDVHFDXVHGE\WKHEUHDNGRZQRIFDUWLODJH
±WKH¿UPUXEEHU\WLVVXHWKDWFXVKLRQVERQHVDWMRLQWV
+HDOWK\FDUWLODJHDOORZVERQHVWRJOLGHRYHURQHDQRWKHUDQGFDUWLODJHDEVRUEVHQHUJ\IURPWKHVKRFNRISK\VLFDO
PRYHPHQW ,Q 2$ FDUWLODJH EUHDNV GRZQ DQG ZHDUV DZD\$V D UHVXOW WKH ERQHV UXE WRJHWKHU FDXVLQJ SDLQ
VZHOOLQJDQGVWLIIQHVV
2$PD\DOVROLPLWWKHUDQJHRIPRWLRQLQDIIHFWHGMRLQWV0RVWRIWHQ2$GHYHORSVLQWKHKDQGVNQHHVKLSVDQG
spine.
7KHGLVHDVHDIIHFWVPHQDQGZRPHQQHDUO\HTXDOO\0RUHWKDQPLOOLRQSHRSOHLQWKH8QLWHG6WDWHVKDYH2$
6\PSWRPVWHQGWRDSSHDUZKHQLQGLYLGXDOVDUHLQWKHLU¿IWLHVDQGVL[WLHV

Signs and Symptoms


6LJQVDQGV\PSWRPVRI2$PD\LQFOXGHWKHIROORZLQJ
• -RLQWSDLQ RIWHQDGHHSDFKLQJSDLQ WKDWLVZRUVHQHGE\PRYHPHQWDQGLPSURYHGZLWKUHVW LQVHYHUHFDVHV
DSHUVRQPD\H[SHULHQFHFRQVWDQWSDLQ 
• 6WLIIQHVVLQWKHPRUQLQJRUDIWHUEHLQJLQDFWLYHIRUPRUHWKDQPLQXWHV
• -RLQWVZHOOLQJ
• -RLQWVWKDWDUHZDUPWRWKHWRXFK
• &UXQFKLQJRUFUDFNOLQJQRLVHZKHQWKHMRLQWPRYHV FUHSLWDWLRQ 
• /LPLWHGUDQJHRIPRWLRQ
• 0XVFOHZHDNQHVV
• $EQRUPDOJURZWKRIERQ\NQREVQHDUMRLQWVZKLFKFDXVHGHIRUPLWLHV VXFKDV+HEHUGHQ
VQRGHVLQZKLFK
EXPSVDSSHDURQWKHRXWHUPRVW¿QJHUMRLQWV

Causes
0RVWRIWKHWLPHWKHFDXVHRI2$LVXQNQRZQ,WLVSULPDULO\DGLVHDVHGXHWRDJLQJ+RZHYHUPHWDEROLFJHQHWLF
FKHPLFDODQGPHFKDQLFDOIDFWRUVFDQSOD\DUROHLQLWVGHYHORSPHQW

Risk Factors
5LVNIDFWRUVIRU2$LQFOXGH
• Increasing age
• *HQHWLFSUHGLVSRVLWLRQ
• 2EHVLW\
• Injury to the joint
• +LVWRU\RILQÀDPPDWRU\MRLQWGLVHDVH
• Metabolic or hormonal disorders (such as hemochromatosis and acromegaly)
• Bone and joint disorders present at birth
• 5HSHWLWLYHVWUHVVIXOMRLQWXVH VXFKDVZLWKFHUWDLQRFFXSDWLRQVOLNHEDVHEDOOEDOOHWGDQFLQJDQGFRQVWUXFWLRQ
ZRUN 
• 'HSRVLWVRIFU\VWDOVLQMRLQWV

Diagnosis
7KHUHLVQRVLQJOHWHVWWRGLDJQRVH2$VRPRVWGRFWRUVXVHDFRPELQDWLRQRIPHWKRGVWRGLDJQRVHWKHGLVHDVH
DQGUXOHRXWWKHSRVVLELOLW\RWKHUFDXVHV$SK\VLFDOH[DPFDQVKRZOLPLWHGUDQJHRIPRWLRQJUDWLQJRIDMRLQW
ZLWKPRWLRQMRLQWVZHOOLQJDQGWHQGHUQHVV$Q[UD\RIDIIHFWHGMRLQWVZLOOVKRZORVVRIWKHMRLQWVSDFHDQGLQ
DGYDQFHGFDVHVZHDULQJGRZQRIWKHHQGVRIWKHERQHDQGERQHVSXUV

Preventive Care
7KHIROORZLQJPHDVXUHVPD\UHGXFHWKHULVNRIGHYHORSLQJ2$
• 3URWHFWLQJDQLQMXUHGMRLQWIURPIXUWKHUGDPDJH
• ([HUFLVLQJ
• /RVLQJZHLJKW
• $YRLGLQJH[FHVVLYHUHSHWLWLYHPRWLRQV
• 3URYLGLQJSURSHUQXWULWLRQDOVXSSRUW
Osteoarthritis 241

Treatment Approach
7KHJRDOVRIWUHDWPHQWDUHWRUHOLHYHSDLQPDLQWDLQRULPSURYHMRLQWPRELOLW\LQFUHDVHWKHVWUHQJWKRIWKHMRLQWV
DQGPLQLPL]HWKHGLVDEOLQJDIIHFWVRIWKHGLVHDVH7KHVSHFL¿FWUHDWPHQWGHSHQGVXSRQWKHDIIHFWHGMRLQWV$
FRPELQDWLRQRIFRQYHQWLRQDOWUHDWPHQWDQGFRPSOHPHQWDU\DQGDOWHUQDWLYHPHGLFLQH &$0 PD\EHPRVWHIIHFWLYH
/LIHVW\OHDSSURDFKHVLQFOXGLQJH[HUFLVHDQGPDQ\DOWHUQDWLYHPHGLFDOWKHUDSLHVDUHEHFRPLQJPRUHSRSXODU
DQGDUHFRQVLGHUHGVDIHDQGHIIHFWLYHIRUWKHWUHDWPHQW2$
6HYHUDOQDWXUDOUHPHGLHVDUHDWOHDVWDVHIIHFWLYHDVFRQYHQWLRQDOPHGLFDWLRQIRUV\PSWRPUHOLHIDQGPD\KHOS
NHHSWKHGLVHDVHIURPJHWWLQJZRUVH$PHULFDQVVSHQGPRUHRQQDWXUDOUHPHGLHVIRU2$WKDQIRUDQ\RWKHU
PHGLFDOFRQGLWLRQ,QUHVHDUFKHUVFRQGXFWHGYDULRXVVXUYH\VDQGIRXQGWKDWDQ\ZKHUHIURPRI
SDWLHQWVZLWKSDLQIXOFRQGLWLRQVRIWKHPXVFOHVWHQGRQVMRLQWVDQGERQHVKDGWULHGVRPHIRUPRIFRPSOHPHQWDU\
and alternative medicine.
6RPHRIWKHPRVWSURPLVLQJFRPSOHPHQWDU\DSSURDFKHVIRUWUHDWLQJ2$LQFOXGH
• 5HGXFLQJSK\VLFDOVWUHVVRQWKHMRLQW ORVHZHLJKWDQGLPSURYHSRVWXUH 
• /LIHVW\OHFKDQJHV SDUWLFXODUO\H[HUFLVH 
• 6XSSOHPHQWVLQFOXGLQJ6DGHQRV\OPHWKLRQLQH 6$0H JOXFRVDPLQHDQGRUFKRQGURLWLQDQGDQWLR[LGDQWV
• +HUEVZLWKDQWLLQÀDPPDWRU\SURSHUWLHVLQFOXGLQJGHYLO
VFODZZLOORZEDUNDQGFDSVDLFLQ FUHDP 
• Acupuncture
• Chiropractic
• 3K\VLFDOWKHUDS\DQGPDJQHWWKHUDS\
• Yoga
• Tai chi

Exercise
([HUFLVHWRVWUHQJWKHQVWUHWFKDQGUHOD[PXVFOHVDURXQGDIIHFWHGMRLQWVLVDOPRVWDOZD\VLQFOXGHGLQDWUHDWPHQW
SODQIRU2$6HYHUDOVWXGLHVVXSSRUWWKHYDOXHRIH[HUFLVHIRUSHRSOHZLWK2$2QHUHFHQWVWXG\IRUH[DPSOH
IRXQGWKDWSHRSOHZLWK2$RIWKHNQHHZKRSDUWLFLSDWHGLQDKRPHH[HUFLVHSURJUDPH[SHULHQFHGDUHGXFWLRQ
LQ SDLQ FRPSDUHG ZLWK RQO\  UHGXFWLRQ LQ SHRSOH ZKR GLG QRW H[HUFLVH 2WKHU VWXGLHV DOVR VXJJHVW WKDW LQ
DGGLWLRQWRUHGXFWLRQRISDLQDQGGLVDELOLW\H[HUFLVHLPSURYHVVWUHQJWKUDQJHRIPRWLRQEDODQFHDQGFRRUGLQDWLRQ
endurance, and posture.

Medications
7KH PRVW FRPPRQ W\SH RI PHGLFDWLRQXVHG WR WUHDW RVWHRDUWKULWLV DUH QRQVWHURLGDO DQWLLQÀDPPDWRU\ GUXJV
16$,'V 7KH\DUHFRPPRQSDLQUHOLHYHUVWKDWUHGXFHSDLQDQGVZHOOLQJ7\SHVLQFOXGHDVSLULQLEXSURIHQ 0RWULQ
$GYLO1XSULQ DQGQDSUR[HQ $OHYH1DSURV\Q1DSUHODQ$QDSUR[ $OWKRXJK16$,'VZRUNZHOOORQJWHUPXVH
FDQFDXVHVWRPDFKSUREOHPVVXFKDVXOFHUVDQGEOHHGLQJ,Q$SULOWKH)'$DVNHGGUXJPDQXIDFWXUHUV
RI16$,'VWRLQFOXGHDZDUQLQJODEHORQWKHLUSURGXFWWKDWDOHUWVXVHUVRIDQLQFUHDVHGULVNIRUFDUGLRYDVFXODU
events and gastrointestinal bleeding.

Other medications used to treat OA include:


• &2; LQKLELWRUV FR[LEV  &R[LEVEORFN DQLQÀDPPDWLRQSURPRWLQJ HQ]\PH FDOOHG &2; 7KLVFODVV
RI GUXJVZDV LQLWLDOO\ EHOLHYHG WR ZRUN DV ZHOO DV WUDGLWLRQDO16$,'V EXW ZLWK IHZHU VWRPDFK SUREOHPV
+RZHYHUQXPHURXVUHSRUWVRIKHDUWDWWDFNVDQGVWURNHKDYHSURPSWHGWKH)'$WRUHHYDOXDWHWKHULVNVDQG
EHQH¿WVRIWKH&2;V5RIHFR[LE 9LR[[ DQGYDOGHFR[LE %H[WUD KDYHEHHQZLWKGUDZQIURPWKH86PDUNHW
IROORZLQJUHSRUWVRIKHDUWDWWDFNVLQVRPHSDWLHQWVWDNLQJWKHGUXJV&HOHFR[LE &HOHEUH[ ZDVVWLOODYDLODEOH
DWWKHWLPHRIWKLVUHSRUWEXWODEHOHGZLWKVWURQJZDUQLQJVDQGDUHFRPPHQGDWLRQWKDWLWEHSUHVFULEHGDWWKH
ORZHVWSRVVLEOHGRVHIRUWKHVKRUWHVWGXUDWLRQSRVVLEOH3DWLHQWVVKRXOGDVNWKHLUGRFWRUZKHWKHUWKHGUXJLV
DSSURSULDWHDQGVDIHIRUWKHP
• 6WHURLGV7KHVHPHGLFDWLRQVDUHLQMHFWHGGLUHFWO\LQWRWKHMRLQW7KH\PD\DOVREHXVHGWRUHGXFHLQÀDPPDWLRQ
and pain.
• $UWL¿FLDOMRLQWÀXLG 6\QYLVF+\DOJDQ 7KHVHPHGLFDWLRQVFDQEHLQMHFWHGLQWRWKHNQHH7KH\PD\WHPSRUDU\
UHOLHISDLQIRUXSWRPRQWKV
242 Osteoarthritis

Nutrition and Dietary Supplements


Glucosamine
*OXFRVDPLQHDQDWXUDOFRPSRXQGIRXQGLQDOOERG\WLVVXHVLVWKHIXQGDPHQWDOEXLOGLQJEORFNUHTXLUHGIRUWKH
V\QWKHVLVRIJO\FRVDPLQRJO\FDQVDQGSURWHRJO\FDQV)XUWKHUPRUHJOXFRVDPLQHLVDUDWHOLPLWLQJSUHFXUVRUIRU
WKHV\QWKHVLVRIK\DOXURQLFDFLGWKHEDFNERQHRISURWHRJO\FDQVDQGWKHPDMRURUJDQLFFRQVWLWXHQWRIV\QRYLDO
ÀXLG$VDFRPSRQHQWRIWKHVHPDFURPROHFXOHVJOXFRVDPLQHSOD\VDQLPSRUWDQWUROHLQWKHV\QWKHVLVRIWKH
FDUWLODJHPDWUL[DQGRWKHUWLVVXHV&ODVVL¿HGDVDFKRQGURSURWHFWLYHDJHQWVXSSOHPHQWDOJOXFRVDPLQHIXQFWLRQV
WRSURPRWHWKHV\QWKHVLVRIWKHVXEVWUDWHVUHTXLUHGIRUKHDOWK\FDUWLODJHPDWUL[DQGWRHQKDQFHWKHIXQFWLRQDO
DELOLW\RIWKHMRLQWV1,4,9&RQWLQXHGXVHLVUHTXLUHGWRPDLQWDLQEHQH¿WV

Chondroitin Sulfate
&KRQGURLWLQ6XOIDWHLVDPDMRUFODVVRIJO\FRVDPLQRJO\FDQVWKDWDUHUHTXLUHGIRUWKHIRUPDWLRQRISURWHRJO\FDQV
DQG DV VXFK WKH\ DUH HVVHQWLDO IRU WKH VWUXFWXUDO DQG IXQFWLRQDO LQWHJULW\ RI WKH MRLQW7KH PHFKDQLVP RI
DFWLRQRIVXSSOHPHQWDOFKRQGURLWLQVXOIDWHLVOLNHO\VLPLODULQQDWXUHWRWKDWRIJOXFRVDPLQHVLQFHLWDOVRSURYLGHV
VXEVWUDWHVIRUSURWHRJO\FDQV\QWKHVLV$VDFKRQGURSURWHFWLYHDJHQWLWKDVDPHWDEROLFHIIHFWDVZHOOLWVDFWLRQ
LVWRLQKLELWPDQ\RIWKHGHJUDGDWLYHHQ]\PHVWKDWEUHDNGRZQWKHFDUWLODJHPDWUL[

Glucosamine and Chondroitin


6XSSOHPHQWDOJOXFRVDPLQHDQGFKRQGURLWLQVXOIDWHPD\VWLPXODWHWKHV\QWKHVLVRISURWHRJO\FDQVE\FKRQGURF\WHV
LQKLELWWKHGHJUDGDWLRQRISURWHRJO\FDQVDQGHQKDQFHOXEULFDWLRQRIWKHMRLQWVWKHUHE\SURPRWLQJKHDOWK\MRLQW
FDUWLODJHVWUXFWXUHDQGIXQFWLRQ1,4,8,97KUHHFDSVXOHVSURYLGHPJRIJOXFRVDPLQHDQGPJRIFKRQGURLWLQ
VXOIDWH5HVHDUFKVXJJHVWVWKDWGDLO\VXSSOHPHQWDWLRQDWWKLVOHYHOLVVDIHDQGHIIHFWLYHIRUORQJWHUPXVH 

Methyl-sulfonyl-methane (MSM)
060LVDQDWXUDOO\RFFXUULQJVXOIXUFRPSRXQG6XOIXUWKHIRXUWKPRVWDEXQGDQWPLQHUDOLQWKHKXPDQERG\
EHKLQGFDOFLXPSKRVSKRUXVDQGPDJQHVLXP LVHVVHQWLDOIRUWKHQRUPDOIXQFWLRQLQJRIWKHERG\¶VJURZWKDQG
repair mechanisms.12
060LVPRVWRIWHQXVHGWRUHOLHYHPXVFOHDQGMRLQWSDLQ,WKDVEHHQXVHGIRUWKLVSXUSRVHLQYHWHULQDU\PHGLFLQH
since the early 1980’s.
([SHUWV EHOLHYH 060 VWRSV SDLQ LPSXOVHV EHIRUH WKH\ UHDFK WKH EUDLQ DFWLQJ DV DQ DQDOJHVLF DQG DQ DQWL
LQÀDPPDWRU\7KHVXOIXULQ060SOD\VDUROHLQWKHIRUPDWLRQRINHUDWLQ DQHVVHQWLDOSURWHLQIRUVNLQKDLUDQG
QDLOJURZWK DQGFROODJHQ DSURWHLQWKDWVXSSRUWVKHDOWK\VNLQDQGÀH[LEOHMRLQWV 6XOIXUDOVRKHOSVWKHERG\
SURGXFHLPPXQRJOREXOLQVZKLFKDUHLPSRUWDQWIRUQRUPDOLPPXQHIXQFWLRQ

S-adenosylmethionine (SAMe)
/DERUDWRU\DQGDQLPDOVWXGLHVVXJJHVWWKDW6$0HPD\UHGXFHSDLQDQGLQÀDPPDWLRQWRDVLPLODUGHJUHHDV
16$,'VEXWZLWKIHZHUVLGHHIIHFWV5HVHDUFKHUVDUHVWLOOLQYHVWLJDWLQJKRZWKLVZRUNV&OLQLFDOVWXGLHVZLWK
KXPDQV DOWKRXJKJHQHUDOO\VPDOOLQVL]HDQGRIVKRUWGXUDWLRQ KDYHDOVRVKRZQIDYRUDEOHUHVXOWVIRU6$0H
ZKHQXVHGWRUHOLHYH2$V\PSWRPV
,QVHYHUDOVKRUWWHUPVWXGLHV UDQJLQJIURPWRZHHNV 6$0HVXSSOHPHQWV PJGD\ FRPSDUHGIDYRUDEO\
WR16$,'VLQDGXOWVZLWKNQHHKLSRUVSLQHRVWHRDUWKULWLVLQWKHIROORZLQJZD\V
• 'LPLQLVKHGPRUQLQJVWLIIQHVV
• Decreased pain
• 5HGXFHGVZHOOLQJ
• ,PSURYHGUDQJHRIPRWLRQ
• ,QFUHDVHGZDONLQJSDFH
,QDQH[WHQVLYHUHYLHZRIVWXGLHVFRQGXFWHGZLWK6$0H FROOHFWLYHO\UHSUHVHQWLQJRYHUSHRSOH LQFOXGLQJ
WULDOVRIXSWRWZR\HDUVWKHVXSSOHPHQWZDVDVVRFLDWHGZLWKWKHIROORZLQJEHQH¿WV
• Improved symptoms
• )HZHUVLGHHIIHFWV
• 1RQHJDWLYHLQÀXHQFHVRQFDUWLODJHSURGXFWLRQ XQOLNH16$,'V 
• 5HGXFHGULVNIRUUHODSVH
Osteoarthritis 243

Vitamin D
9LWDPLQ'LVHVVHQWLDOWRERQHDQGFDUWLODJHKHDOWK6WXGLHVHYDOXDWLQJYLWDPLQ'XVHIRU2$KDYHIRXQGWKH
IROORZLQJ
• 9LWDPLQ'SUHYHQWVEUHDNGRZQRIFDUWLODJH
• /RZHULQWDNHRIYLWDPLQ'PD\EHOLQNHGWRJUHDWHUULVNRIKLS2$LQROGHUZRPHQDQG2$UHODWHGMRLQWFKDQJHV
YLVLEOHRQ;UD\V LQERWKPHQDQGZRPHQ

Antioxidants
$QWLR[LGDQWVDSSHDUWRVLJQL¿FDQWO\HDVHR[LGDWLYHVWUHVVDQGLQÀDPPDWLRQFDXVHGE\IUHHUDGLFDOVDQGPD\VORZ
WKHSURJUHVVLRQRI2$)UHHUDGLFDOVFDQEHSURGXFHGLQWKHMRLQWVDQGKDYHEHHQLPSOLFDWHGLQPDQ\GHJHQHUDWLYH
FKDQJHVLQWKHDJLQJERG\LQFOXGLQJGHVWUXFWLRQRIFDUWLODJHDQGFRQQHFWLYHWLVVXH$QWLR[LGDQWVDSSHDUWRRIIVHWWKH
GDPDJHFDXVHGE\IUHHUDGLFDOV$OWKRXJKIXUWKHUHYLGHQFHLVQHHGHGWRVXEVWDQWLDWHWKHVHFODLPVVWXGLHVRIJURXSV
RISHRSOHREVHUYHGRYHUWLPHVXJJHVWWKDWWKHIROORZLQJDQWLR[LGDQWVPD\KHOSUHGXFHWKHV\PSWRPVRI2$
• 9LWDPLQ$DQGEHWDFDURWHQH
• Vitamin C
• Vitamin E
,QDGGLWLRQH[WHQVLYHUHVHDUFKRQYLWDPLQ(KDVUHYHDOHGWKDWSHRSOHZLWK2$H[SHULHQFHGDVLJQL¿FDQWUHGXFWLRQLQ
SDLQDIWHUWDNLQJPJRIYLWDPLQ(SHUGD\FRPSDUHGZLWKWKRVHZKRUHFHLYHGSODFHER7KRVHZKRWRRNPJ
RIYLWDPLQ(WKUHHWLPHVDGD\H[SHULHQFHGVLJQL¿FDQWO\OHVVSDLQWKDQWKRVHZKRWRRNWKH16$,'GLFORIHQDF

Niacinamide
,QRQHSUHOLPLQDU\VWXG\SDWLHQWVZLWK2$ZHUHUDQGRPO\DVVLJQHGWRUHFHLYHQLDFLQDPLGHDIRUPRIYLWDPLQ
%RUSODFHER3DUWLFLSDQWVLQWKHQLDFLQDPLGHJURXSH[SHULHQFHGDLPSURYHPHQWLQV\PSWRPVFRPSDUHG
WRDZRUVHQLQJRIV\PSWRPVH[SHULHQFHGE\WKRVHLQWKHSODFHERJURXS3HRSOHWDNLQJQLDFLQDPLGHUHSRUWHG
WKHIROORZLQJ
• Improved joint mobility
• 5HGXFHGQHHGIRUDQWLLQÀDPPDWRU\PHGLFDWLRQV
7KHVWXG\DXWKRUVVSHFXODWHWKDWQLDFLQDPLGHPD\DLGFDUWLODJHUHSDLU,WGRHVDSSHDUKRZHYHUWKDWQLDFLQDPLGH
PXVWEHXVHGIRUDWOHDVWZHHNVEHIRUHWKHSDWLHQWZLOOH[SHULHQFHEHQH¿WV([SHUWVDOVRVXJJHVWWKDWORQJWHUP
XVH WR\HDUV PD\VORZWKHSURJUHVVLRQRIWKHGLVHDVH

Omega-3 Fatty Acids


2PHJDIDWW\DFLGVDUHIRXQGLQFROGZDWHUIDWW\¿VK VXFKDVVDOPRQPDFNHUHODQGKHUULQJ ÀD[VHHGUDSHVHHG
DQGZDOQXWV5HVHDUFKUHJDUGLQJWKHXVHRIRPHJDIDWW\DFLGRU¿VKRLOVXSSOHPHQWVIRULQÀDPPDWRU\MRLQWFRQGLWLRQV
KDVIRFXVHGDOPRVWHQWLUHO\RQUKHXPDWRLGDUWKULWLV%DVHGRQODERUDWRU\VWXGLHVKRZHYHUPDQ\UHVHDUFKHUVVXJJHVW
WKDWGLHWVULFKLQRPHJDIDWW\DFLGV DQGORZLQRPHJDIDWW\DFLGV PD\EHQH¿WSHRSOHZLWKRWKHULQÀDPPDWRU\
GLVRUGHUVLQFOXGLQJ2$,QIDFWVHYHUDOODERUDWRU\VWXGLHVRIFDUWLODJHFRQWDLQLQJFHOOVKDYHIRXQGWKDWRPHJD
IDWW\DFLGVGHFUHDVHLQÀDPPDWLRQDQGUHGXFHWKHDFWLYLW\RIHQ]\PHVWKDWEUHDNGRZQFDUWLODJH3DWLHQWVDOVR
VKRZHGLQFUHDVHGLPSURYHPHQWZKHQ¿VKRLOVXSSOHPHQWVZHUHXVHGLQFRPELQDWLRQZLWKROLYHRLO
$QRWKHUSRWHQWLDOVRXUFHRIRPHJDIDWW\DFLGVLVWKH1HZ=HDODQGJUHHQOLSSHGPXVVHO Perna canaliculus ),
XVHGIRUFHQWXULHVE\WKH0DRULSHRSOHIRUJRRGKHDOWK,QDWULDOLQYROYLQJSHRSOHZLWK2$QHDUO\RIWKRVH
ZKRUHFHLYHG3FDQDOLFXOXVH[WUDFWVH[SHULHQFHGWKHIROORZLQJ
• 'HFUHDVHGMRLQWVWLIIQHVVDQGSDLQ
• Increased grip strength
• (QKDQFHGZDONLQJSDFH
(7$UROŒLVDFROGSURFHVVHGSURSULHWDU\H[WUDFWRI1HZ=HDODQGJUHHQOLSSHGPXVVHOVDQGFRQWDLQVHVVHQWLDO
IDWW\DFLGVFDOOHGHLFRVDWHWUDHQRLFDFLGV (7$V 7KHVH(7$¶VSOD\DNH\UROHLQWKHUHGXFWLRQRIMRLQWVZHOOLQJ
GXHWRDUWKULWLV6WXGLHVVKRZWKDW(7$RLOVIURPVHDPXVVHOVDUHPRUHHIIHFWLYHDWUHGXFLQJLQÀDPPDWLRQWKDQ
DVSLULQRULEXSURIHQ
,Q DGGLWLRQ WR WKH 2PHJD IDWW\ DFLGV (7$¶V  (7$UROŒ DOVR FRQWDLQV QDWXUDOO\ FKHODWHG PLQHUDOV YLWDPLQV
QXFOHLFDFLGV 51$DQG'1$ JOXFRVDPLQHFKRQGURLWLQDQGJO\FRVDPLQRJO\FDQV*O\FRVDPLQRJO\FDQV *$*¶V 
ZKLFKDUHORQJXQEUDQFKHGFKDLQVRIFRPSOH[VXJDUDUHWKHSULQFLSOHFRPSRQHQWVRIFDUWLODJHDQGV\QRYLDOÀXLG
IRXQGLQWKHMRLQWV
7KHUH DUH QLQH SULQFLSOH FODVVHV RI *$*¶V  ,W KDV EHHQ SXEOLVKHG WKDW JOXFRVDPLQH DQG FKRQGURLWLQ FRQWDLQ
RQO\WZRRIWKHQLQHFODVVHVRI*$*¶V,QFRQWUDVW(7$UROŒFRQWDLQVDOOQLQHRIWKHVHSULQFLSOHFODVVHVZKLFK
HQKDQFHVWKHUHYHUVDORIWKHDUWKULWLFSURFHVVDQGSURYLGHVDOOWKHEXLOGLQJEORFNVQHFHVVDU\WRUHEXLOGGDPDJHG
cartilage.
244 Osteoarthritis

Manganese
Manganese is among the substances that the body needs to build cartilage. In a clinical trial studying glucosamine,
FKRQGURLWLQDQGPDQJDQHVHSHRSOHZLWKPLOGWRPRGHUDWH2$RIWKHNQHHVKRZHGVLJQL¿FDQWLPSURYHPHQW
LQV\PSWRPVDIWHUWDNLQJWKHVHVXSSOHPHQWVLQFRPELQDWLRQFRPSDUHGWRWKRVHWDNLQJSODFHER1RVHULRXVVLGH
HIIHFWVZHUHUHSRUWHG3HRSOHZLWKPRUHVHYHUHIRUPVRIWKHGLVHDVHGLGQRWVKRZLPSURYHPHQWDVDUHVXOWRIWDNLQJ
WKHFRPELQDWLRQKRZHYHU$OWKRXJKHDUOLHUVWXGLHVKDYHLQGLFDWHGWKDWORZOHYHOVRIPDQJDQHVHPD\FRQWULEXWH
WRGHJHQHUDWLYHMRLQWFRQGLWLRQVDQGERQHORVVLWLVQRWFOHDUIURPWKLVWULDOZKDWUROHPDQJDQHVH DVRSSRVHGWR
FKRQGURLWLQDQGJOXFRVDPLQH PD\KDYHSOD\HGLQWKHUHVXOWV,QWHUHVWLQJO\DQHVWLPDWHGRI$PHULFDQVKDYH
ORZOHYHOVRIPDQJDQHVHLQWKHLUGLHWV

Herbs
+HUEDOUHPHGLHVDUHDPRQJWKHPRVWSRSXODUDOWHUQDWLYHWKHUDSLHVXVHGE\LQGLYLGXDOVZLWKDUWKULWLV6FLHQWL¿F
HYLGHQFHVXJJHVWVWKDWWKHIROORZLQJKHUEVDUHPRVWHIIHFWLYHIRUWUHDWLQJ2$
• 'HYLO
VFODZ +DUSDJRSK\WXPSURFXPEHQV 
• :LOORZEDUN 6DOL[VSS 
• Stinging nettle (Urtica dioica)
• $FRPELQDWLRQRIDVSHQ 3RSXOXVWUHPXOD DVK )UD[LQXVH[FHOVLRU DQGJROGHQURG 6ROLGDJRYLUDXUHD 
• $Q$\XUYHGLFKHUEDOPL[WXUHFRQWDLQLQJH[WUDFWVRIDVKZDJDQGKD :LWKDQLDVRPQLIHUD ERVZHOOLD %RVZHOOLD
serrata), and turmeric (Curcuma longa)
• $FRPELQDWLRQRIZLOORZEDUN 6DOL[VSS EODFNFRKRVK &LPLFLIXJDUDFHPRVD VDUVDSDULOOD 6PLOD[VSS 
JXDLDFXP *XDLDFXPRI¿FLQDOH UHVLQDQGSRSODUEDUN 3RSXOXVWUHPXORLGHV
2WKHUKHUEVWKDWKDYHVKRZQSURPLVHLQWKHWUHDWPHQWRI2$LQFOXGH

Capsaicin (Capsicum frutescens)


&DSVDLFLQLVWKHPDLQFRPSRQHQWLQKRWFKLOLSHSSHUV DOVRNQRZQDVFD\HQQH $SSOLHGWRWKHVXUIDFHRIWKH
VNLQLWLVEHOLHYHGWRGHSOHWHVWRUHVRIDVXEVWDQFHWKDWFRQWULEXWHVWRLQÀDPPDWLRQDQGSDLQLQDUWKULWLV6HYHUDO
VWXGLHVKDYHVKRZQWKDWFDSVDLFLQFUHDPSURYLGHGPXFKEHWWHUSDLQUHOLHIWKDQDSODFHEREXWQRLPSURYHPHQW
LQMRLQWVZHOOLQJJULSVWUHQJWKRUIXQFWLRQIRUSHRSOHZLWK2$3DLQUHGXFWLRQJHQHUDOO\EHJLQVWRGD\VDIWHU
applying the capsaicin cream to the skin.

Avocado/Soybean extracts
/DERUDWRU\VWXGLHVVXJJHVWWKDWDYRFDGRVR\EHDQH[WUDFWVVWLPXODWHWKHJURZWKRIFROODJHQ WKHSULQFLSDOSURWHLQ
RIWKHVNLQWHQGRQVFDUWLODJHDQGERQH LQFDUWLODJHFHOOV,QDVWXG\RISHRSOHZLWK2$RIWKHNQHHRUKLS
UHVHDUFKHUVIRXQGWKDWSDUWLFLSDQWVZKRUHFHLYHGDYRFDGRVR\EHDQH[WUDFWVIRUPRQWKVH[SHULHQFHGWKHIROORZLQJ
LPSURYHPHQWVZLWKIHZRUQRVLGHHIIHFWV
• Reduction in pain and disability
• Increase in mobility
• 5HGXFHGQHHGIRU16$,'V
7KHUHYLVHGHGLWLRQRIThe Arthritis CureE\'U-DVRQ7KHRGRVDNLVOLVWV$68DORQJZLWKJOXFRVDPLQHDQGFKRQGURLWLQ
as the three nutrients essential to his program.

Suggested Nutritional Supplementation

Light to Moderate:
• Kaprex® ²VRIWJHOWZLFHGDLO\
• 1RQUHVSRQGHUVE\GD\PRYHWRVRIWJHOVGDLO\
• 7LPHWREHQH¿W,PPHGLDWHWRGD\V
.DSUH[LVDFOLQLFDOO\WHVWHGKHUEDOGLHWDU\VXSSOHPHQWWKDWSURYLGHVQDWXUDOMRLQWUHOLHIWKDWLVHDV\RQWKH
JDVWURLQWHVWLQDO *, WUDFW,WZRUNVE\LQWHUIHULQJZLWKVLJQDOVLQWKHERG\WKDWLQLWLDWHWKHSURGXFWLRQRIGDPDJLQJ
compounds that cause minor pain and negatively impact cartilage and other joint tissues.
• Chondro-Relief Intensive Care™±FDSVXOHVWZLFHGDLO\
&KRQGUR5HOLHI,QWHQVLYH&DUHLVDFRPSUHKHQVLYHMRLQWQXWULWLRQIRUPXODGHVLJQHGWRVXSSRUWKHDOWK\MRLQW
IXQFWLRQE\IHDWXULQJ*OXFRVDPLQH+&,&KRQGURLWLQ6XOIDWH0HWK\O6XOIRQ\O0HWKDQH 060  P. Canaliculus,
+\DOXURQLF$FLGDQG$YRFDGR6R\EHDQ8QVDSRQL¿DEOHV $68 LQDGGLWLRQWRRWKHUDQWLR[LGDQWVWKDWVXSSRUW
healthy connective tissue.
Osteoarthritis 245

Moderate to Severe:
• 8OWUD,QÀDP;Š3OXV²VFRRSVWZLFHGDLO\
0HGLFDOIRRGIRULQÀDPPDWLRQDQGELRWUDQVIRUPDWLRQ
• )ROORZWKH$QWL,QÀDPPDWRU\'LHW
• Chondro-Relief Intensive Care™±FDSVXOHVWZLFHGDLO\
&KRQGUR5HOLHI,QWHQVLYH&DUHLVDFRPSUHKHQVLYHMRLQWQXWULWLRQIRUPXODGHVLJQHGWRVXSSRUWKHDOWK\MRLQW
IXQFWLRQE\IHDWXULQJ*OXFRVDPLQH+&,&KRQGURLWLQ6XOIDWH0HWK\O6XOIRQ\O0HWKDQH 060  P. Canaliculus,
+\DOXURQLF$FLGDQG$YRFDGR6R\EHDQ8QVDSRQL¿DEOHV $68 LQDGGLWLRQWRRWKHUDQWLR[LGDQWVWKDWVXSSRUW
healthy connective tissue.
• EPA-DHA 6:1™ Enteric Coated ²VRIWJHOVWKUHHWLPHVGDLO\
(3$'+$  (QWHULF &RDWHG RPHJD  IDWW\ DFLGV SURYLGLQJ D UDWLR DSSURSULDWH IRU SDWLHQWV ZLWK FKURQLF
LQÀDPPDWRU\FRQGLWLRQV
• Iso D3™ — 1 tablet three times daily.
,VR'GHOLYHUV,8RI9LWDPLQ'3ZLWK,VRÀDYRQHVWKDWPD\KHOSIDFLOLWDWHWKHERG\¶VXWLOL]DWLRQRIYLWDPLQ
'IRUHQKDQFHGKHDOWKEHQH¿WV
If there is a soy sensitivity use:
• D3 1000™ — 2 microtablets three times daily.
%LRDFWLYH9LWDPLQ'LQDPLFURWDEOHWGHOLYHU\IRUP

Adjunctive Modalities
Acupuncture
6HYHUDOFRQWUROOHGWULDOVVXJJHVWWKDWWKHDQFLHQW&KLQHVHSUDFWLFHRIDFXSXQFWXUHLVDQHIIHFWLYHWUHDWPHQWIRU
SDLQDVVRFLDWHGZLWK2$DVZHOODVIRURWKHUDVSHFWVRIWKHFRQGLWLRQLQFOXGLQJGLPLQLVKHGMRLQWIXQFWLRQDQG
UHGXFHGZDONLQJDELOLW\,QIDFWDIHZVWXGLHVKDYHVKRZQWKDWSHRSOHZLWK2$H[SHULHQFHEHWWHUSDLQUHOLHIDQG
LPSURYHPHQWLQIXQFWLRQIURPDFXSXQFWXUHWKDQIURP16$,'VVXFKDVDVSLUR[LFDP,QDPRQWKVWXG\RI
SDUWLFLSDQWVIXQGHGE\WKH1DWLRQDO,QVWLWXWHVRI+HDWK 1,+ UHVHDUFKHUVIRXQGWKDWSDWLHQWVZKRUHFHLYHGWUXH
DFXSXQFWXUHKDGDLQFUHDVHLQIXQFWLRQZKLFKLVVLJQL¿FDQWO\EHWWHUWKDQWKRVHUHFHLYLQJWKHVKDPSURFHGXUH
$QRWKHUVWXG\RISHRSOHZLWK2$IRXQGWKDWDIWHUZHHNVRIWUHDWPHQWSDLQDQGMRLQWIXQFWLRQLPSURYHGPRUH
ZLWKDFXSXQFWXUHWKDQZLWKPLQLPDODFXSXQFWXUHRUQRDFXSXQFWXUHLQSDWLHQWVZLWK2$RIWKHNQHH
7KH1,+LVIXQGLQJDODUJHPXOWLFHQWHUFOLQLFDOWULDOGXHWREHFRPSOHWHGLQWRIXOO\HYDOXDWHHI¿FDF\DQG
VDIHW\RIDFXSXQFWXUHIRU2$

Chiropractic
$OWKRXJKWKHUHLVQRHYLGHQFHWKDWFKLURSUDFWLFFDUHFDQUHYHUVHWKHMRLQWGHJHQHUDWLRQWKDWFDXVHV2$VRPH
studies indicate that spinal manipulation may:
• ,QFUHDVHUDQJHRIPRWLRQ
• 5HVWRUHQRUPDOPRYHPHQWRIWKHVSLQH
• 5HOD[WKHPXVFOHV
• Improve joint coordination
• Reduce pain
,QIDFWDFRPSUHKHQVLYHUHYLHZRIWKHVFLHQWL¿FOLWHUDWXUHVXJJHVWVWKDWFKLURSUDFWLFHVSHFLDOO\ZKHQFRPELQHG
ZLWKJOXFRVDPLQHVXSSOHPHQWVDQGUHKDELOLWDWLYHVWUHWFKHVDQGH[HUFLVHLVDQHIIHFWLYHVXSSOHPHQWDOWUHDWPHQW
IRU2$&KLURSUDFWRUVZLOODYRLGXVLQJGLUHFWWKUXVWVRUSUHVVXUHRQUHGVZROOHQMRLQWV

Physical Therapy
3K\VLFDOWKHUDS\FDQEHXVHIXOWRLPSURYHPXVFOHVWUHQJWKDQGWKHPRWLRQDWVWLIIMRLQWV7KHUDSLVWVKDYHPDQ\
WHFKQLTXHVIRUWUHDWLQJ2$
0DQXDOWKHUDS\DQGVXSHUYLVHGH[HUFLVHPD\GHFUHDVHRUGHOD\WKHQHHGIRUVXUJHU\LQLQGLYLGXDOVZLWK2$,Q
DWULDOHYDOXDWLQJSK\VLFDOWKHUDS\DQGH[HUFLVHLQSHRSOHZLWK2$RIWKHNQHHSDUWLFLSDQWVZKRUHFHLYHGPDQXDO
WKHUDS\WRWKHOXPEDUVSLQHKLSDQNOHDQGNQHHVVKRZHGWKHIROORZLQJLPSURYHPHQWV
• /HVVVWLIIQHVV
• Reduced pain
• ,PSURYHGIXQFWLRQDODELOLW\
• ,PSURYHGZDONLQJGLVWDQFH
• /HVVQHHGIRUNQHHVXUJHU\\HDUODWHU
,IWKHUDS\GRHVQRWPDNH\RXIHHOEHWWHUDIWHUWRZHHNVWKHQLWOLNHO\ZLOOQRWZRUNDWDOO
246 Osteoarthritis

Balneotherapy (Hydrotherapy or spa therapy)


%DOQHRWKHUDS\LVRQHRIWKHROGHVWIRUPVRIWKHUDS\IRUSDLQUHOLHIIRUSHRSOHZLWKDUWKULWLV7KHWHUP³EDOQHR´
FRPHVIURPWKH/DWLQZRUGIRUEDWK EDOQHXP DQGUHIHUVWREDWKLQJLQWKHUPDORUPLQHUDOZDWHUV6XOIXUFRQWDLQLQJ
PXGEDWKVIRUH[DPSOHKDYHEHHQVKRZQWRUHOLHYHV\PSWRPVRIDUWKULWLV+RZHYHUK\GURWKHUDS\ZKLFKFDQEH
SHUIRUPHGXQGHUWKHJXLGDQFHRIFHUWDLQSK\VLFDOWKHUDSLVWVLVRFFDVLRQDOO\XVHGLQWHUFKDQJHDEO\ZLWKWKHZRUG
EDOQHRWKHUDS\7KHJRDOVRIEDOQHRWKHUDS\IRUDUWKULWLVLQFOXGH
• ,PSURYLQJUDQJHRIMRLQWPRWLRQ
• Increasing muscle strength
• Eliminating muscle spasm
• (QKDQFLQJIXQFWLRQDOPRELOLW\
• Easing pain
$OWKRXJKEDOQHRWKHUDS\LVPRVWRIWHQXVHGIRUSVRULDWLFRUUKHXPDWRLGDUWKULWLVVRPHPHGLFDOH[SHUWVEHOLHYH
WKDWLWPD\EHEHQH¿FLDOIRU2$DVZHOO

Ice Massage, Transcutaneous Nerve Stimulation (TENS), and Electroacupuncture


,Q D ZHOOGHVLJQHG WULDO FRPSDULQJ WKH HIIHFWLYHQHVV RI 7(16 HOHFWURDFXSXQFWXUH DQG LFH PDVVDJH IRU WKH
WUHDWPHQWRINQHH2$HDFKRIWKHVHPHWKRGVZHUHIRXQGWR
• Reduce pain at rest
• 5HGXFHVWLIIQHVV
• %RRVWZDONLQJVSHHG
• Increase quadriceps muscle strength
• ,QFUHDVHNQHHUDQJHRIPRWLRQ
7(16 LV D WHFKQLTXH XVHG E\ PDQ\ SK\VLFDO WKHUDSLVWV :KHQ WKH QHUYH VWLPXODWLRQ RI 7(16 LV DSSOLHG WR
acupuncture points, it is called electroacupuncture.

Mind/Body Medicine
&KURQLF SDLQ DQG GLVDELOLW\ FDQ PDNH GDLO\ IXQFWLRQLQJ GLI¿FXOW $ KROLVWLF DSSURDFK WR FDUH LQ WKHVH FOLQLFDO
FLUFXPVWDQFHVPD\SRVLWLYHO\DIIHFWERWKOLIHVW\OHDQGKRZRQHIHHOVRYHUDOO0DQ\SHRSOHUHSRUWWKDWUHOD[DWLRQ
WHFKQLTXHVVXFKDVJXLGHGLPDJHU\DQGPHGLWDWLRQDUHDQLPSRUWDQWSDUWRIFRPSUHKHQVLYHKROLVWLFFDUHDQG
KHOSWRDOOHYLDWHSDLQDQGRWKHUV\PSWRPVRI2$

Yoga
7KLVDQFLHQW,QGLDQSUDFWLFHLVZHOONQRZQIRULWVSK\VLFDOSV\FKRORJLFDOHPRWLRQDODQGVSLULWXDOEHQH¿WVDQGLV
RIWHQUHFRPPHQGHGLQWKH:HVWWRUHOLHYHPXVFXORVNHOHWDOV\PSWRPV,QRQHFOLQLFDOWULDOVWXG\LQJ2$RIWKHKDQG
WKHJURXSSUDFWLFLQJ\RJDVKRZHGVLJQL¿FDQWGHFUHDVHLQSDLQDQGLPSURYHGUDQJHRIPRWLRQFRPSDUHGWRWKRVH
SDUWLFLSDWLQJLQQRQ\RJDVWUHWFKLQJDQGVWUHQJWKHQLQJVHVVLRQV&HUWDLQ\RJD³DVDQDV´ SRVWXUHV VWUHQJWKHQ
WKHTXDGULFHSVDQGHPSKDVL]HVWUHWFKLQJERWKRIZKLFKEHQH¿WSHRSOHZLWK2$RIWKHNQHH3HRSOHZLWKDUWKULWLV
VKRXOGEHJLQDVDQDVVORZO\DQGWKH\VKRXOGEHSHUIRUPHGRQO\DIWHUDZDUPXS<RJDLVEHVWSHUIRUPHGXQGHU
WKHFDUHIXOJXLGDQFHRIDUHSXWDEOHLQVWUXFWRU

Herbal Remedies
7ZR UHFHQW WULDOV FRPSDULQJ$\XUYHGLF KHUEDO UHPHGLHV ZLWK SODFHER IRXQG WKDW SDUWLFLSDQWV ZKR FRQVXPHG
WKH$\XUYHGLFKHUEVH[SHULHQFHGVLJQL¿FDQWLPSURYHPHQW ZLWKRQO\PLOGVLGHHIIHFWV FRPSDUHGWRWKRVHLQWKH
SODFHERJURXS$Q$\XUYHGLFFRPELQDWLRQFRQWDLQLQJWKHIROORZLQJKHUEVVLJQL¿FDQWO\UHGXFHGSDLQDQGGLVDELOLW\
LQSHRSOHZLWK2$
• :LQWHUFKHUU\ Withania somnifera)
• %RVZHOOLD Boswellia serrata)
• Turmeric (Curcuma longa )
Osteoarthritis 247

Tai Chi
7KLVDQFLHQWIRUPRIFODVVLFDOFRQGLWLRQLQJSUDFWLFHGLQ&KLQDIRUFHQWXULHVKDVEHHQVKRZQWRSURGXFHDQXPEHU
RIEHQH¿WVLQFOXGLQJWKHIROORZLQJ
• ,PSURYHG¿WQHVV
• Increased muscular strength
• (QKDQFHGÀH[LELOLW\
• 5HGXFHGSHUFHQWDJHRIERG\IDW
• 'LPLQLVKHGULVNRIIDOOVLQWKHHOGHUO\
,QDWULDORIVXEMHFWVZLWK2$RIWKHNQHHRUKLS UDQJLQJLQDJHIURPWR WKRVHZKRSUDFWLFHGWDLFKLWZLFHD
ZHHNIRUWKUHHPRQWKVVKRZHGVLJQL¿FDQWLPSURYHPHQWFRPSDUHGWRWKRVHLQWKHFRQWUROJURXSLQWKHIROORZLQJ
areas:
• 2YHUDOOVHQVHRITXDOLW\RIOLIH
• 'LPLQLVKHGIHHOLQJVRIVWUHVVWHQVLRQ
• ,QFUHDVHGVDWLVIDFWLRQZLWKJHQHUDOKHDOWK
• 'HFUHDVHGIDWLJXH
• (DVLHUVHOIPDQDJHPHQWRIDUWKULWLVV\PSWRPV

References:
1. 'H/RV5H\HV*&.RGD57/LHQ(-*OXFRVDPLQHDQGFKRQGURLWLQVXOIDWHVLQWKHWUHDWPHQWRIRVWHRDUWKULWLVDVXUYH\3URJ'UXJ5HV

2. 'HDO&/0RVNRZLW]5:1XWUDFHXWLFDOVDVWKHUDSHXWLFDJHQWVLQRVWHRDUWKULWLV2VWHRDUWKULWLV  
3. /HIÀHU&73KLOLSSL$)/HIÀHU6*HWDO*OXFRVDPLQHFKRQGURLWLQDQGPDQJDQHVHDVFRUEDWHIRUGHJHQHUDWLYHMRLQWGLVHDVHRIWKHNQHH
RUORZEDFNDUDQGRPL]HGGRXEOHEOLQGSODFHERFRQWUROOHGSLORWVWXG\0LO0HG  
4. 5HJLQVWHU -< 'HURLV\ 5 5RYDWL /& HW DO /RQJWHUP HIIHFWV RI JOXFRVDPLQH VXOSKDWH RQ RVWHRDUWKULWLV SURJUHVVLRQ D UDQGRPL]HG
SODFHERFRQWUROOHGFOLQLFDOWULDO/DQFHW  
5. 7DSDGLQKDV 0- 5LYHUD ,& %LJQDPLQL$$ 2UDO JOXFRVDPLQH VXOIDWH LQ WKH PDQDJHPHQW RI DUWKURVLV UHSRUW RQ D PXOWLFHQWUH RSHQ
LQYHVWLJDWLRQLQ3RUWXJDO3KDUPDWKHUDSHXWLFD  
6. 0RUUHDOH30DQRSRXOR5*DODWL0HWDO&RPSDULVRQRIWKHDQWLLQÀDPPDWRU\HI¿FDF\RIFKRQGURLWLQVXOIDWHDQGGLFORIHQDFVRGLXPLQ
SDWLHQWVZLWKNQHHRVWHRDUWKULWLV-5KHXPDWRO
7. 8HEHOKDUW '7KRQDU (- 'HOPDV 3' (IIHFWV RI RUDO FKRQGURLWLQ VXOIDWH RQ WKH SURJUHVVLRQ RI NQHH RVWHRDUWKULWLV D SLORW VWXG\
2VWHRDUWKULWLV&DUWLODJH 6XSSO$ 
8. 0F$OLQGRQ7(/D9DOOH\03*XOLQ-3HWDO*OXFRVDPLQHDQGFKRQGURLWLQIRUWUHDWPHQWRIRVWHRDUWKULWLVDV\VWHPDWLFTXDOLW\DVVHVVPHQW
DQGPHWDDQDO\VLV-$0$  
9. .HOO\ *6 7KH UROH RI JOXFRVDPLQH VXOIDWH DQG FKRQGURLWLQ VXOIDWHV LQ WKH WUHDWPHQW RI GHJHQHUDWLYH MRLQW GLVHDVH$OWHUQ 0HG 5HY
  
10. %XFVL/3RRU*(I¿FDF\DQGWROHUDELOLW\RIRUDOFKRQGURLWLQVXOIDWHDVDV\PSWRPDWLFVORZDFWLQJGUXJIRURVWHRDUWKULWLV 6<6$'2$ LQ
WKHWUHDWPHQWRINQHHRVWHRDUWKULWLV2VWHRDUWKULWLV&DUWLODJH 6XSSO$ 
11. 8VKD351DLGX0855DQGRPL]HGGRXEOHEOLQGSDUDOOHOSODFHERFRQWUROOHGVWXG\RIRUDOJOXFRVDPLQHPHWK\OVXOIRQ\OPHWKDQHDQG
WKHLUFRPELQDWLRQLQRVWHRDUWKULWLV&OLQLFDO'UXJ,QYHVWLJDWLRQV  
12. -DFRE6/DZUHQFH50=XFNHU07KH0LUDFOHRI0607KH1DWXUDO6ROXWLRQIRU3DLQ1HZ<RUN3HQJXLQ3XWQDP
13. .HQGDOO 59 /DZVRQ -: +XUOH\ /$ 1HZ UHVHDUFK DQG D FOLQLFDO UHSRUW RQ WKH XVH RI
3HUQD&DQDOLFXOXVLQWKHPDQDJHPHQWRIDUWKULWLV7RZQVHQG/HWWHUIRU'RFWRUV 3DWLHQWV
14. *LEVRQ 6/0 *LEVRQ 5* 7KH WUHDWPHQW RI DUWKULWLV ZLWK D OLSLG H[WUDFW RI 3HUQD &DQDOLFXOXV D UDQGRPL]HG WULDO &RPSOLPHQWDU\
7KHUDSLHVLQ0HGLFLQH
15. $OWPDQ5'6WDWXVRIK\DOXURQLDQVXSSOHPHQWDWLRQWKHUDS\LQRVWHRDUWKULWLV&XUUHQW5KHXPDWRORJ\5HSRUWV
16. +HQURWLQ<(/DEDVVH$+-DVSDU-0HWDO³(IIHFWVRI7KUHH$YRFDGR6R\EHDQ8QVDSRQL¿DEOH0L[WXUHVRQ0HWDOORSURWHLQDVHV
&\WRNLQHVDQG3URVWDJODQGLQ(3URGXFWLRQE\+XPDQ$UWLFXODU&KRQGURF\WHV´&OLQLFDO5KHXPDWRORJ\  SDJHV
17. +HQURWLQ < 6DQFKH] & 'HEHUJ 0$ HW DO ³$YRFDGR6R\EHDQ 8QVDSRQL¿DEOHV ,QFUHDVH $JJUHFDQ 6\QWKHVLV DQG 5HGXFH
&DWDEROLFDQG3URLQÀDPPDWRU\0HGLDWRU3URGXFWLRQE\+XPDQ2VWHRDUWKULWLF&KRQGURF\WHV´-RXUQDORI5KHXPDWRORJ\  
SDJHV
18. $FHYHGR(&DVWDQHGD28JD]0HWDO7ROHUDELOLW\SUR¿OHVRIURIHFR[LE 9LR[[ DQG$UWKURWHF$FRPSDULVRQRIVL[ZHHNVWUHDWPHQWLQ
SDWLHQWVZLWKRVWHRDUWKULWLV6FDQG-5KHXPDWRO  
19. $QJHUPDQ3$YRFDGRVR\EHDQXQVDSRQL¿DEOHVLQWKHWUHDWPHQWRINQHHDQGKLSRVWHRDUWKULWLV8JHVNU/DHJHU$XJ  
5.
20. %HUEHUW$$.RQGR&5$OPHQGUD&/0DWVXR7'LFKL,6XSSOHPHQWDWLRQRI¿VKRLODQGROLYHRLOLQSDWLHQWVZLWKUKHXPDWRLGDUWKULWLV
1XWULWLRQ)HE  
21. %HUPDQ%06Z\HUV-3(]]R-7KHHYLGHQFHIRUDFXSXQFWXUHDVDWUHDWPHQWIRUUKHXPDWRORJLFFRQGLWLRQV5KHXP'LV&OLQ1RUWK$P
  
22. %OLGGDO+5RVHW]VN\$6FKOLFKWLQJ3HWDO$UDQGRPL]HGSODFHERFRQWUROOHGFURVVRYHUVWXG\RIJLQJHUH[WUDFWVDQGLEUXSURIHQLQ
RVWHRDUWKULWLV2VWHRDUWKULWLV&DUWLODJH
23. %OXPHQWKDO 0 *ROGEHUJ$ %ULQFNPDQ - HGV +HUEDO 0HGLFLQH ([SDQGHG &RPPLVVLRQ ( 0RQRJUDSKV 1HZWRQ 0DVV ,QWHJUDWLYH
0HGLFLQH&RPPXQLFDWLRQV
24. %UDGOH\-')OXVVHU'.DW]%3HWDO$UDQGRPL]HGGRXEOHEOLQGSODFHERFRQWUROOHGWULDORILQWUDYHQRXVORDGLQJZLWK6DGHQRV\OPHWKLRQLQH
6$0 IROORZHGE\RUDO6$0WKHUDS\LQSDWLHQWVZLWKNQHHRVWHRDUWKULWLV-5KHXPDWRO  
25. %UDQGW.'2VWHRDUWKULWLV,Q)DXFL$6%UDXQZDOG(,VVHOEDFKHU.-HWDOHGV+DUULVRQ¶V3ULQFLSOHVRI,QWHUQDO0HGLFLQHWKHG1HZ
<RUN1<0F*UDZ+LOO
26. &KRSUD$$\XUYHGLF0HGLFLQHDQGDUWKULWLV5KHXP'LV&OLQ1RUWK$P  
27. &RUYRO07'XPRQWLHU0)7VDJULV//DQJ)%RXUJXLJQRQ-&DUWLODJHDQGYLWDPLQ'LQYLWUR$QQ(QGRFULQRO
28. &XUWLV&/+XJKHV&()ODQQHU\&5/LWWOH&%+DUZRRG-/&DWHUVRQ%1IDWW\DFLGVVSHFL¿FDOO\PRGXODWHFDWDEROLFIDFWRUVLQYROYHG
LQDUWLFXODUFDUWLODJHGHJUDGDWLRQ-%LRO&KHP  
248 Osteoarthritis

29. &RYLQJWRQ0%2PHJDIDWW\DFLGV$P)DP3K\VLFLDQ-XO  


30. GD&DPDUD&&'RZOHVV*9*OXFRVDPLQHVXOIDWHIRURVWHRDUWKULWLV$QQ3KDUPDFRWKHU
31. 'DQDR&DPDUD7&6KLQWDQL777KHGLHWDU\WUHDWPHQWRILQÀDPPDWRU\DUWKULWLVFDVHUHSRUWVDQGUHYLHZRIWKHOLWHUDWXUH+DZDLL0HG
-  
32. 'DV$+DPPDG7$&RPELQDWLRQRIJOXFRVDPLQHDQGFKRQGURLWLQLQNQHH2$2VWHRDUWKULWLV&DUWLODJH  
33. 'DYLV *& &RUWH] & 5XELQ %5 3DLQ PDQDJHPHQW LQ WKH ROGHU DGXOW ZLWK UKHXPDWRLG DUWKULWLV RU RVWHRDUWKULWLV$UWKULWLV &DUH 5HV
  
34. 'HDO&/0RVNRZLW]5:1XWUDFHXWLFDOVDVWKHUDSHXWLFDJHQWVLQRVWHRDUWKULWLVWKHUROHRIJOXFRVDPLQHFKRQGURLWLQVXOIDWHDQGFROODJHQ
K\GURO\VDWH5KHXP'LV&OLQ1RUWK$P  
35. 'HDQ''%R\DQ%'0XQL]2(+RZHOO'66FKZDUW]=9LWDPLQ'PHWDEROLWHVUHJXODWHPDWUL[YHVLFOHPHWDOORSURWHLQDVHFRQWHQWLQD
FHOOPDWXUDWLRQGHSHQGHQWPDQQHU&DOFLI7LVVXH,QW
36. 'HODIXHQWH-&*OXFRVDPLQHLQWKHWUHDWPHQWRIRVWHRDUWKULWLV5KHXP'LV&OLQ1RUWK$P  
37. 'H\OH*'+HQGHUVRQ1(0DWHNHO5/5\GHU0**DUEHU0%$OOLVRQ6&(IIHFWLYHQHVVRIPDQXDOSK\VLFDOWKHUDS\DQGH[HUFLVHLQ
RVWHRDUWKULWLVRIWKHNQHH$UDQGRPL]HGFRQWUROOHGWULDO$QQ,QWHUQ0HG
38. GL3DYRGD&6DGHQRV\OPHWKLRQLQHLQWKHWUHDWPHQWRIRVWHRDUWKULWLV5HYLHZRIFOLQLFDOVWXGLHV$P-0HG VXSSO$ 
39. 'RPOMDQ=9UKRYDF%'XUULJO73XFDU,$GRXEOHEOLQGWULDORIDGHPHWLRQLQHYVQDSUR[HQLQDFWLYDWHGJRQDUWKURVLV,QW-&OLQ3KDUPDFRO
7HU7R[LFRO
40. (EHUKDUGW5=ZLQJHUV7+RIPDQQ5'062LQSDWLHQWVZLWKDFWLYHJRQDUWKURVLV$GRXEOHEOLQGSODFHERFRQWUROOHGSKDVHV,,,VWXG\
)RUWVKU0HG
41. (OND\DP22SKLU-%UHQHU6HWDO,PPHGLDWHDQGGHOD\HGHIIHFWVRIWUHDWPHQWDWWKH