Sie sind auf Seite 1von 31

35 3

Analyse von Proteinen


Guido Hermey

3.1 Antikörper – 36
3.1.1 Antikörper-Herstellung – 37
3.1.2 Das Antigen – 38
3.1.3 Reinigung von Antikörpern – 39

3.2 Reinigen und Nachweisen von Proteinen – 39


3.2.1 Reinigung von Proteinen – 39
3.2.2 Nachweis von Proteinen – 41

3.3 Subzelluläre Fraktionierung – 42


3.4 Auffinden und Nachweisen von Proteininteraktionen – 45
3.4.1 Immunpräzipitation – 46
3.4.2 Co-Immunpräzipitation – 48
3.4.3 Expression von Proteinen – 49
3.4.4 Protein-Tags – 50
3.4.5 Das Yeast-Two-Hybrid-System – 52
3.4.6 Phagen-Display – 58
3.4.7 Fluoreszenzbasierte Techniken zur Detektion von
Proteininteraktionen – 59
3.4.8 SPR-Analyse – 61

Literatur und World-Wide-Web-Links – 63

!"#$%&'%(#%)#*+",#!"#$%&'"#()"*+,+-#.$/"0#-1(22"*234,5+"*,##
-./#01"011234256765829687:46:;7,#<#=>%?)&@'#A?*B%'CDEF%&#G%&+*H#$%CB%+I%&H#8101#
36 Kapitel 3 • Analyse von Proteinen

Proteine haben eine Schlüsselstellung im Nerven- Leichte Kette


system, als Signalmoleküle, Rezeptoren oder Io- Papain-Spaltung
Schwere Kette
nenkanäle. Proteine bestehen aus Ketten von Ami-
nosäuren. 20 verschiedene Aminosäuren kommen
in Proteinen vor und durch ihre unterschiedliche
Kombination wird eine enorme strukturelle und
3 funktionelle Vielfalt erreicht. Als das Proteom be-
zeichnet man die Gesamtheit aller in einer Zelle
oder einem Lebewesen zu einem bestimmten Zeit-
punkt vorliegenden Proteine. Im Gegensatz zum Fc-Fragment Fab-Fragment
Genom ist es sehr dynamisch. Als Beleg für die konstanter Teil variabler Teil Disulfidbrücke
Vorrangigkeit der Erforschung der Proteine ver- . Abb. 3.1 Schematische Darstellung der Struktur eines
weisen einige Forscher aus der Proteom-Zunft ger- IgG-Moleküls
ne auf den Ursprung des Wortes »Protein«. Es leitet
sich von dem griechischen Wort proteios, »grund-
legend«, »an erster Stelle stehend«, ab. In diesem und immunhistologische Analysen durchgeführt
Zusammenhang sollte erwähnt werden, dass dieser und bewertet werden. Grundsätzlich sollte der Ex-
Begriff auf Gerardus Mulder (1802–1880) und Jöns perimentator immer an Antikörpern zweifeln und
Berzelius (1779–1848) zurückgeht. Mulder nahm versuchen, die Spezifität eines Antikörpers zu kon-
an, dass es einen »Grundstoff« gibt, welcher in al- trollieren.
len damals bekannten stickstoffhaltigen Substan- Antikörper werden bei der humoralen Immun-
zen identisch sei und dieser »Grundstoff« nur um antwort gebildet. Sie bilden eine Proteinfamilie,
ein Schwefel- oder Phosphoratom verändert wür- die als Immunglobuline (Ig) bezeichnet wird. In-
de. Diesen Grundstoff würden Pflanzen den Tie- nerhalb der Familie gibt es wiederum fünf Klassen,
ren liefern. Somit hat die Bezeichnung Protein, die IgG, IgM, IgA, IgD und IgE. Die meisten immun-
dann von Berzelius vorgeschlagen wurde, nichts chemischen Verfahren benutzen IgG, das 80 % der
mit dem Selbstverständnis, »wir sind die Nummer Serum-Immunglobuline ausmacht. Alle Immun-
eins«, sondern mit einem zu dem Zeitpunkt unver- globuline setzen sich aus vier Polypeptidketten zu-
standenen, in der Nahrungskette »grundlegenden« sammen, wobei jeweils zwei identische leichte und
und nur leicht modifizierten Grundstoff aller Ei- schwere Ketten (light and heavy chains) gepaart
weißmoleküle zu tun. sind. Je nach Schwere ihrer Ketten werden inner-
Im Folgenden wollen wir auf wichtige Werk- halb der fünf Klassen Subklassen unterschieden.
zeuge und Techniken zur Erforschung von Protei- Wir gehen hier nur kurz auf IgG Moleküle ein. Für
nen eingehen. mehr Information sei auf einschlägige Lehrbücher
verwiesen.
Wie in .  Abb.  3.1 dargestellt, sind die zwei je-
3.1 Antikörper weils identischen schweren und leichten Ketten
eines IgG-Antikörpers durch Disulfidbrücken mit-
Antikörper sind sehr nützlich zur Erforschung von einander verbunden. Das proteolytische Enzym
Proteinen. Sie ermöglichen den Nachweis oder die Papain spaltet einen typischen IgG-Antikörper in
Isolation von Proteinen. Daher sollte der Experi- drei Fragmente, 2 identische Fab (antibody binding
mentator diese Werkzeuge schätzen, aber nicht je- fragment) und ein Fc (crystalized fragment). Das
den Antikörper überschätzen. Dies kommt leider Fc-Fragment bindet und aktiviert das Komple-
immer wieder vor, denn nicht jeder Antikörper, mentsystem. In den einzelnen IgG Molekülen sind
ob selbst hergestellt, gekauft oder geschenkt be- häufig viele der 100–110 Aminosäuren an den N-
kommen ist spezifisch oder für jede Anwendung terminalen Enden sowohl der leichten wie auch der
geeignet. Es ist immer wieder erschreckend, mit schweren Ketten ausgetauscht. Dieser Teil wird als
welcher Naivität besonders immuncytochemische variable Region bezeichnet. Die übrigen Sequen-
3.1 • Antikörper
37 3
zen der schweren und leichten Ketten sind inner- Sie kein neues Verfahren entwickeln, wird das Her-
halb einer IgG-Unterklasse weitgehend gleich und stellen eines Antikörpers heutzutage nicht mehr als
werden als konstanter Teil bezeichnet. Einige Ami- eine große wissenschaftliche Leistung betrachtet,
nosäuren in der variablen N-terminalen Region, auch wenn dies sehr zeitaufwendig sein kann. Prü-
die besonders stark variiert werden (hypervaria- fen Sie deshalb immer, ob ein entsprechender Anti-
ble Region), bilden die Spezifität der Antigenbin- körper bereits zu kaufen ist oder ob jemand einen
dungsstelle aus. Eine hohe Affinität dieses Bereichs solchen bereits hergestellt hat und ihnen eventuell
gegenüber dem Antigen zeichnet in der Regel einen zur Verfügung stellt. Ist ein Antikörper bereits in
guten Antikörper aus. Hochaffine Antikörper bin- einer Publikation erfolgreich verwendet worden, so
den fester an das Antigen, werden bei Waschschrit- kann dies ein Qualitätshinweis sein.
ten nicht so leicht entfernt und können in geringe- Neben Kaninchen werden auch weitere Spezies
ren Konzentrationen eingesetzt werden. zur Herstellung polyklonaler Antikörper benutzt,
wie Schafe, Ziegen, Pferde, Meerschweinchen, Rat-
ten, Hühner etc. Monoklonale Antikörper werden
3.1.1 Antikörper-Herstellung traditionell in Mäusen generiert. Seit einiger Zeit ist
auch ein Verfahren zur Herstellung monoklonaler
Methoden, bei denen Antikörper zum Nachweis Antikörper in Kaninchen etabliert und wird von ei-
für Proteine eingesetzt werden, bezeichnet man nigen Firmen angeboten. Beim Planen seiner Ver-
als immunologische Techniken. Traditionell wer- suche sollte der Experimentator darauf achten, dass
den die meisten für immunologische Techniken neben dem richtigen 1. Antikörper auch der jewei-
eingesetzten Antikörper durch Injektion einer lig passende 2. Antikörper für die gewählte Spezies
Suspension des Antigens in Kaninchen erzeugt. problemlos benutzt werden kann. Für alle, die im
Den Tieren wird Blut abgenommen und nach dem Detail mehr über die Herstellung von Antikörpern
Gerinnen des Blutes wird das Serum abgetrennt. wissen möchten, verweisen wir auf die Experimen-
Obwohl die komplette Immunisierung und Blut- tatoren Proteinbiochemie und Immunologie.
entnahme in Eigenregie eine einschneidende Er-
fahrung ist, überlassen Sie es, wenn nur irgendwie kMonoklonal versus Polyklonal
möglich, einem Profi. Sonst findet sich der Experi- Es gibt zwei Typen von Antikörpern, monoklonale
mentator unter Umständen mit einem gestressten und polyklonale (. Abb. 3.2). Polyklonale Antikör-
Kaninchen auf dem Schoß sitzend wieder, ein Ohr per werden wie oben beschrieben erzeugt. Eigent-
des Kaninchens festhaltend, verzweifelt beruhigen- lich erhält man zunächst ein polyklonales Anti-
de Lieder singend, um Blut bettelnd das Ohr strei- serum. Dies enthält eine Reihe von Antikörpern,
chelnd. Irgendwann, das Kaninchen ist inzwischen die ein Antigen erkennen. Das Antigen weist ver-
entspannt, die Kollegen längst zu Hause, läuft das schiedene Epitope (Antigenbindungsstellen) auf,
Blut ohne zu enden und Sie haben zu wenig Röhr- und diese werden von den unterschiedlichen Anti-
chen greifbar, um das vermeintlich kostbare Rot körpern des Serums erkannt. Die Antikörper stam-
aufzufangen. men aus verschiedenen Plasmazellklonen, daher
Diverse Firmen bieten inzwischen die Herstel- polyklonal. Es handelt sich also um eine Mischung
lung von polyklonalen Antikörpern kostengüns- von Antikörpern, die an unterschiedlichen Stellen
tig an. Die Konkurrenz zwischen den Firmen ist das Antigen binden. Aus einem solchen Gemisch
groß. Sollten Sie geringe finanzielle Mittel haben, kann man keine homogene Population eines ein-
verhandeln Sie mit konkurrierenden Firmen oder zigen Immunoglobulinmoleküls heraus reinigen.
warten Sie Jahresendangebote ab. Es ist nicht nur Dies erreicht man nur durch die Herstellung eines
der enorme Aufwand, jemand muss die Tiere ver- monklonalen Antikörpers. Dabei handelt es sich
sorgen etc. Bedenken Sie, haben Sie keine ausrei- um identische Immunoglobulinmoleküle, die aus
chende Erfahrung, so quälen Sie nicht nur sich, einem einzigen Plasmazellklon stammen. Grund-
sondern mit großer Wahrscheinlichkeit auch das sätzlich haben beide Antikörpertypen Vor- und
Tier. Darüber hinaus sollten Sie bedenken, so lange Nachteile.
38 Kapitel 3 • Analyse von Proteinen

. Abb. 3.2 Polyklonale Antikör- polyklonale Antikötper monoklonale Antikörper


per und monoklonale Antikörper.
Polyklonale Antikörper stammen
von unterschiedlichen Plasma-
zellklonen ab und erkennen
verschiedene Epitope eines
Antigens. Monoklonale Anti-
3 körper stammen von nur einem
Plasmazellklon ab und erkennen
nur ein Epitop

Polyklonale Antikörper sind relativ leicht, 3.1.2 Das Antigen


schnell und kostengünstig herzustellen. Es werden
verschiedene Epitope des Antigens erkannt, dies Egal, ob Sie einen Antikörper herstellen lassen oder
kann gewünscht sein. Häufig ist ein polyklonaler dies selbst übernehmen, Sie benötigen ein Antigen.
Antikörper für eine Vielzahl von Anwendungen Ein Antigen ist eine Fremdsubstanz, die nach In-
geeignet, da bei Veränderungen einzelner Epitope jektion in die Gewebe eines Versuchstieres eine Im-
durch beispielsweise eine Fixierung ein Teil der munantwort hervorruft. Meist handelt es sich bei
Epitope nicht mehr, aber andere Epitope immer dieser Fremdsubstanz um ein Protein, aber auch
noch erkannt werden können. Ein großer Nachteil andere Stoffe, wie Lipide oder Polysaccharide, kön-
ist, dass nicht nur Antikörper gegen das gewünsch- nen immunreaktiv sein. Arbeiten Sie mit einem
te Epitop im Antiserum enthalten sind, sondern Protein, welches Ihnen gereinigt zur Verfügung
auch in geringen Mengen weitere Antikörper und steht, so können Sie dieses als Antigen verwenden.
auch Serumproteine, die in dem Versuchstier zir- In der Regel ist dies aber nicht der Fall und das zu
kulieren. Weiterhin ist die Produktion eines poly- bearbeitende Protein steht nicht zur Verfügung.
klonalen Antikörpers endlich, weil das Tier stirbt, Häufig wird ein Peptid, das einem Teil des Pro-
der Titer an gewünschtem Antikörpern zu Ende teins entspricht, ausgewählt und als Antigen ein-
geht oder Geld nicht weiter investiert werden soll. gesetzt. Es gibt verschiedene Vorhersagemethoden,
Monoklonale Antikörper sind teurer und auf- um die Antigenität einer Peptidsequenz abzuschät-
wendiger in der Herstellung. Hat man aber eine zen. Unterschiedliche Programme werden dafür als
stabile Hybridomazelllinie, so steht ein monoklo- Freeware im Internet angeboten. Das entsprechen-
naler Antikörper praktisch endlos zur Verfügung. de Peptid wird dann synthetisiert, was kommerziell
Weiterhin hat man einen gleichbleibenden Anti- relativ schnell geht. Die Peptide sind klein und ga-
körper, der nur ein Epitop bindet und so sehr re- rantieren keine ausreichende Immunogenität und
produzierbare Ergebnisse liefern sollte. Allerdings werden deshalb an einen Carrier gekoppelt, wie
kann dies auch zu einem Nachteil gereichen, da z. B. Keyhole Limpet Hemocyanin oder Sepharose.
bestimmte monoklonale Antikörper nur für be- Bei dieser Methode wird in der Regel ein polyklo-
stimmte Anwendungen funktionieren. Gehen Sie nales Antiserum in sehr kurzer Zeit generiert. Al-
den langwierigen Weg und produzieren einen lerdings ist dieses häufig nicht sehr spezifisch und
monoklonalen Antikörper selbst, so sollten Sie die erkennt andere Proteine, die ähnliche Epitope auf-
unterschiedlichen Klone für alle relevanten Assays weisen. Somit ist Vorsicht geboten, aber manchmal,
testen. Firmen, die die Herstellung anbieten, testen wenn man wirklich Glück hat, funktionieren gegen
häufig nur in einem Assay, meist im ELISA (Enzy- ein Peptid gerichtete Antikörper bei verschiedenen
me-linked Immunosorbent Assay). Anwendungen sehr gut.
Eine Alternative, ein Antigen zu erzeugen, ist
die rekombinante Expression des Proteins in Bak-
3.2 • Reinigen und Nachweisen von Proteinen
39 3
terien oder eukaryotischen Zellen. Häufig wird das . Tab. 3.1 Relative Bindungsstärke von IgG aus ver-
Protein dann über ein Protein-Tag gereinigt (siehe schiedenen Spezies an Protein A und G
Abschnitt unten). Hierbei werden mehr Epitope
Spezies Protein A Protein G
des spezifischen Proteins angeboten, was zu besse-
ren Antikörpern führen kann. Negativ wirken sich Ratte – +
aber Verunreinigungen aus, somit ist die Reinigung Ziege – ++
des Proteins ein kritischer Schritt. Schaf – ++
In den letzten Jahren wurde weiterhin die ge- Rind – ++
netische Immunisierung etabliert. Hierbei wird Pferd – ++
ein geeigneter DNA-Vektor, der das Antigen-Gen
Mensch ++ ++
trägt, zur Immunisierung benutzt.
Kaninchen ++ ++
Maus + ++

3.1.3 Reinigung von Antikörpern Meerschwein- ++ ++


chen

Wie zuvor beschrieben, besteht ein großer Nach- –, keine Bindung; +, Bindung; ++, starke Bindung
teil von polyklonalen Antiseren darin, dass nicht
nur Antikörper gegen das gewünschte Epitop im
Antiserum enthalten sind, sondern auch verschie-
dene Serumproteine sowie weitere Antikörper, Antigensäule gegeben, Antikörper, die das Antigen
die in dem Versuchstier zirkulieren. Mit Hilfe von binden, werden nach mehreren Waschschritten
bakteriellen Fc-bindenden Proteinen ist es jedoch mit saurem pH, eventuell auch noch mit sehr basi-
relativ einfach, spezifisch IgG aus einem Serum auf- schem pH eluiert. So kann man zwar sehr spezifi-
zureinigen. Am häufigsten werden Protein A aus sche Antikörper erhalten, verliert jedoch die wirk-
Staphylococcus aureus und Protein G aus Strepto- lich hochaffinen Antikörper, da diese schwer von
coccus verwendet. Beide Proteine binden reversibel der Antigensäule zu eluieren sind.
sowohl monoklonale als auch polyklonale Anti-
körper, allerdings ist die Affinität abhängig von
der Spezies und der IgG Unterklasse (.  Tab.  3.1). 3.2 Reinigen und Nachweisen von
Natives Protein G bindet außerdem Albumin, al- Proteinen
lerdings ist eine rekombinante Variante von Protein
G kommerziell verfügbar, bei der die Albuminbin- 3.2.1 Reinigung von Proteinen
destelle deletiert wurde. Viele Firmen vertreiben
an Sepharose-Beads gekoppeltes Protein A oder Die Reinigung bestimmter Proteine kann für den
G oder eine Mischung aus beiden. In der Regel neurowissenschaftlich arbeitenden Experimenta-
werden IgGs bei leicht alkalischen pH an die Säu- tor von Bedeutung sein. Sei es um Antikörper her-
le gebunden und mit einem Glycin Puffer bei pH zustellen, Proteinmodifikationen nachzuweisen,
2–3 eluiert. Am einfachsten ist der Nachweis, dass Bindungspartner zu identifizieren oder Interaktio-
Sie Antikörper gereinigt haben, durch die Bestim- nen zu charakterisieren. Wichtig ist, dass Sie das
mung der Proteinkonzentration der unterschiedli- gereinigte Protein nach der Reinigung mit einer
chen Fraktionen photometrisch bei 280 nm. Dem geeigneten Methode nachweisen können und ein
können dann weitere Nachweismethoden wie ein Ausgangsmaterial zur Verfügung steht, in welchem
Western Blot folgen. das zu reinigende Protein in hoher Konzentration
Es besteht auch noch die Möglichkeit für das vorkommt.
Antigen spezifische Antikörper zu reinigen. Für Zur Reinigung von Proteinen werden häufig
diese Affinitätsreinigung muss das Antigen an mehrere Techniken kombiniert. Zu beachten ist,
eine Matrix gekoppelt werden. Dann folgt eine Af- dass die optimale Kombination für jedes Protein
finitätschromatographie. Das Serum wird auf die empirisch ermittelt werden muss. Dies kann sehr
40 Kapitel 3 • Analyse von Proteinen

langwierig sein. Die verschiedenen Möglichkeiten Eine weitere Möglichkeit ist die Reinigung nach
zur Proteinreinigung sollen hier nur kurz darge- der Größe. Dies kommt bei der Größenausschluss-
stellt werden. Sehr detaillierte Erläuterungen fin- chromatographie bzw. Gelfiltration zur Anwen-
den sich zu den einzelnen Schritten beispielsweise dung. Das Probengemisch wird auf eine Säule von
im Experimentator Proteinbiochemie. porösen Kügelchen aufgetragen, diese bestehen aus
Meist dienen Zellen oder Gewebe als Aus- einem hydratisierten Polymer wie Agarose, Dext-
3 gangsmaterial, das aufgeschlossen werden muss. ran oder Polyacrylamid. Kleinere Moleküle können
Gewebe wird in der Regel zuvor zerkleinert und in diese Kügelchen eindringen, große Moleküle
dann homogenisiert. Zellen und Gewebe kann man nicht. Die großen Moleküle passieren so schneller
durch eine Ultraschallbehandlung, durch Einfrie- die Säule und werden zuerst eluiert.
ren und durch enzymatische oder chemische Ver- Die Affinitätschromatographie beruht auf der
fahren lysieren. Für die anschließende Reinigung spezifischen und reversiblen Bindung eines Prote-
wird in der Regel eine weitgehend partikelfreie ins an einen matrixgebundenen Liganden. Der Li-
Lösung benötigt. Diese erhält man durch Zentrifu- gand wird dafür kovalent an einer Matrix immobi-
gations- oder Filtrationsschritte. Wichtig ist die Zu- lisiert. Das zu reinigende Protein bindet selektiv an
gabe von Proteasehemmern, um das zu reinigende diesen und wird durch kompetetive Verdrängung
Protein vor Abbau zu schützen. Zur Hemmung ver- oder durch Änderung des pH-Wertes oder der Io-
wendet man entweder eine selbst hergestellte Mi- nenestärke eluiert. Die Affinitätschromatographie
schung aus PMSF (Phenylmethylsulfonylfluorid), ist eine sehr leistungsfähige Trennmethode. Aller-
Aprotinin, Pepstatin A, Leupeptin und EDTA oder dings hängt der Erfolg von der gewählten Matrix
einen käuflichen Mix von Proteasehemmern, der und dem Liganden ab. Neben spezifischen Ligan-
meist in Tablettenform angeboten wird. Beim Um- den kann man Antikörper einsetzen (Immunoaf-
gang mit Proteasehemmern sollten Sie beachten, finitätschromatographie), hierbei ist die Spezifität
dass diese sehr toxisch sind. des Antikörpers entscheidend. Andere Liganden
Ein klassischer Reinigungsschritt ist die Am- binden ganze Gruppen von Proteinen. Nucleinsäu-
moniumsulfatfällung. Man verwendet Ammo- ren binden Transkriptionsfaktoren oder Nucleasen,
niumsulfat, weil dieses Salz bis zu hohen Konzent- Lektine und Concavalin A binden Glycoproteine,
rationen löslich ist. Das Salz entzieht den Proteinen Gelantine bindet Fibronectine und Calmodulin
die Hydrathülle und fällt so die Proteine aus. Die- wird zur Reinigung Calcium-bindender Proteine
se können dann durch Zentrifugation abgetrennt eingesetzt. Ein besonderer Fall ist die Affinitäts-
werden. Weil sich Proteine in ihren Lösungseigen- chromatographie von rekombinant hergestellten
schaften unterscheiden, können diese durch Frak- Proteinen, welche einen so genannten Tag besitzen.
tionierung voneinander getrennt werden. Da die Darauf wird später in diesem Kapitel noch einge-
Auftrennung aber sehr grob und der Verlust sehr gangen.
groß ist, wird diese Methode nur noch selten als Bei den Chromatographie-Verfahren liegt das
Reinigungsschritt angewandt. Protein nach der Reinigung meist gelöst in einem
Bei der Ionenaustauschchromatographie wer- geringen Volumen vor. Trotzdem kann es nötig
den die Proteine aufgrund ihrer Nettoladung von- sein, das Protein anschließend weiter zu konzent-
einander getrennt. Die Auftrennung basiert auf der rieren. Eine Möglichkeit zur Volumenreduktion ist
reversiblen Interaktion zwischen dem geladenem die Fällung, allerdings ist der Proteinverlust dabei
Protein und der entgegengesetzt geladenen Säulen- groß. Beim Gefriertrocknen wird gefrorenen Pro-
matrix. Nach dem Beladen und Waschen der Säule teinlösungen Wasser entzogen (Sublimation). Bei
wird entweder durch Änderung der Salzkonzent- dieser Methode sollte das relevante Protein un-
ration oder des pH-Wertes eluiert. Die Methode empfindlich gegen Einfrieren und Auftauen sein.
zeichnet sich durch eine hohe Ladekapazität und Es ist aber auch möglich durch Zentrifugation das
Auflösung aus und kann sehr gut in einem großen Volumen zu reduzieren, entweder durch das Zen-
Maßstab angewandt werden. trifugieren unter Vakuum, in einer so genannten
Speed-Vac, oder über den Einsatz von speziellen
3.2 • Reinigen und Nachweisen von Proteinen
41 3

1 2

5 4 3
E

. Abb. 3.3 Western Blot. Proteine werden elektrophoretisch im Polyacrylamidgel aufgetrennt (1), elektrophoretisch auf eine
Membran übertragen (2), diese mit einem spezifischen primären Antikörper inkubiert (3), dann mit einem enzymgekoppel-
ten sekundären Antikörper inkubiert (4), durch eine enzymatische Reaktion wird das gesuchte Protein sichtbar gemacht (5)

Filtern. Solche Systeme werden kommerziell für ein zu finden sein. Gibt es weitere Banden, so können
breites Spektrum von Volumina angeboten (z.  B. diese Verunreinigungen sein, Abbauprodukte des
Amicon von Milipore). Es gibt unterschiedliche relevanten Proteins oder das Protein ist Teil eines
Filter, die Moleküle unterschiedlicher Größe pas- Proteinkomplexes, der die gesamte Reinigungspro-
sieren lassen. So ist auch eine weitere sehr einfache zedur überstanden hat. Wer sicher gehen möchte,
Trennung von Proteinen nach der Größe möglich. dass sich hinter einer Bande nicht mehrere Protei-
Allerdings eignen sich die Filter nur zur Abtren- ne verbergen, führt eine zweidimensionale Gelelek-
nung von Verunreinigungen, da sie bei sehr großen trophorese durch und färbt auch dieses Gel.
Proteinmengen zur Verstopfung neigen. Die Nachweisgrenze beim Silbergel liegt bei
5–20 ng pro Bande. Ähnlich sensitiv sind Fluores-
zenzfarbstoffe wie SYPRO-Ruby oder Deep-Purple.
3.2.2 Nachweis von Proteinen Allerdings brauchen Sie ein entsprechendes Gerät,
um die Färbung nachzuweisen. Wesentlich weniger
Nachdem Proteine in einem SDS-Gel elektropho- empfindlich (100–400 ng pro Bande) ist eine Co-
retisch aufgetrennt wurden, können diese sichtbar omassie-Färbung. Während bei der Silberfärbung
gemacht werden. Die Proteine werden zunächst im die Intensität der Färbung von Protein zu Protein
Gel fixiert. Meist wird dazu ein Ethanol/Essigsäure/ variiert (einige Proteine werden kaum angefärbt),
Wasser-Gemisch verwendet. Welche Färbung der so ist dies bei der Coomassie-Färbung nicht der
Experimentator zum Nachweis eines Proteins an- Fall. Deshalb eignet sich letztere eher zur quanti-
wenden sollte hängt von der Proteinmenge und den tativen Abschätzung von Proteinmengen. Soll ein
nachfolgenden Experimenten ab. Protein nach der Auftrennung im Gel sequenziert
Wollen Sie nachweisen, dass ein Protein ohne oder durch Massenspektrometrie analysiert wer-
Verunreinigung in ihrer Probe vorliegt, sollten Sie den, so informieren Sie sich zuvor unbedingt, ob
dies mit einer Silberfärbung zeigen. In diesem Fall ihre Färbemethode für die Analyse geeignet ist.
sollte nur eine Bande bei der zu erwartenden Größe Es gibt besondere Variationen und Vorlieben. Die
42 Kapitel 3 • Analyse von Proteinen

meisten Herrscher über Massenspektrometer lie- sehr großen Proteinen von über 150 kDa sollte man
ben Coomassie mehr als Silberfärbungen, einfach länger Blotten (beim Wet Blot bis zu 3 Stunden oder
weil durch die Färbemethode allein schon größere über Nacht, beim Dry Blot bleibt man bei ca. 10
Proteinmengen nachgewiesen werden und somit Minuten).
auch ausreichend viel Protein für die Analyse in Nach dem Blotten wird der Blot geblockt (z. B.
der Probe sein muss. Es gibt aber auch spezielle mit Milchpulver oder Albumin [Bovines Serum
3 Protokolle für Silberfärbungen, die Massenspekt- Albumin, BSA] kombiniert mit Tween 20), um ein
rometrie-tauglich sind. unspezifisches Binden an den Blot zu reduzieren.
Eine weitere Möglichkeit ein Protein nach- Dann wird der Blot mit einem spezifischen Anti-
zuweisen ist der Western- oder Immunoblot körper, der gegen das zu untersuchende Protein ge-
(.  Abb.  3.3). Dieser sagt allerdings nichts über die richtet ist, inkubiert (primärer Antikörper). Dieser
Reinheit des Proteins aus, sondern gibt Informatio- kann übrigens innerhalb einer kürzeren Zeitspanne
nen über seine Identität. Ein Western Blot ist eine (bis zu Wochen) aufbewahrt und für weitere Blots
sehr sensitive Nachweismethode, die Proteinmen- wiederverwendet werden. Nach mehreren Wasch-
gen im Pikogramm-Bereich detektieren kann. Die schritten folgt die Inkubation mit einem spezies-
elektrophoretisch aufgetrennten Proteine werden spezifischen Antikörper, der den konstanten Teil
vom SDS-Gel elektrophoretisch auf eine Membran des primären Antikörpers bindet. An diesen sekun-
(in der Regel Nitrocellulose oder Polyvinyliden- dären Antikörper ist eine Reporter-Markierung ge-
fluorid [PVDF]) übertragen, ein Vorgang, der als koppelt, die den Nachweis des Proteins ermöglicht.
blotten bezeichnet wird. Dabei sind drei Verfahren Die Markierung kann ein Enzym sein, z.  B. eine
etabliert. Welches der Experimentator verwendet, Peroxidase oder alkalische Phosphatase, ein Fluo-
hängt in der Regel von der Ausstattung des Labors reszenzfarbstoff oder auch ein radioaktiver Marker,
ab. Haben Sie eine Auswahl, so haben Sie die Qual wie 125I. Die radioaktive Markierung wird häufig für
der Wahl, denn kein Verfahren ist wirklich schlecht. die Quantifizierung von Proteinmengen eingesetzt.
Es gibt den Nass-Blot (Wet Blot) oder auch Tank Peroxidase katalysiert die Oxidation von Luminol
Blot genannt. Hierbei wird in einem Transferpuffer und löst so Chemilumineszenz aus, die auf einem
in einer gekühlten Kammer geblottet. Ein relativ Röntgenfilm sichtbar gemacht werden kann oder
schonendes Verfahren, dessen Nachteil in hohem mit Hilfe eines entsprechenden Imaging-Systems
Verbrauch von Transferpuffer (den man durchaus gleich digital abgespeichert wird. Luminolhaltige
ein zweites Mal verwenden kann), einem aufwen- Detektionsreagenzien für ECL (Enhanced Chemi-
digen Aufbau und einer langen Blotdauer liegt. Der luminescence) Western werden von verschiedenen
Semi-Dry-Blot wird ähnlich aufgebaut, allerdings Firmen angeboten, man kann diese aber auch selbst
braucht man weniger Puffer und der Vorgang ist herstellen (z. B. nach Haan und Bergmann, 2007).
schneller. Schließlich gibt es noch den so genannten In jüngerer Zeit werden immer häufiger fluores-
Dry Blot, welcher das Ionen-Reservoir im Gel aus- zenzmarkierte sekundäre Antikörper eingesetzt.
nutzt, aber nicht wirklich komplett »dry« ist. Dieser Hat man eine entsprechende apparative Ausstat-
ist am schnellsten. Allerdings müssen für das Dry- tung, so kann man in einem Blot primäre Anti-
Blotten, wie beim iBlot System von Invitrogen, spe- körper aus zwei unterschiedlichen Spezies mit zwei
zielle Puffer (im Set mit den Membranen) gekauft unterschiedlichen Farbstoffen nachweisen.
werden. Somit ist dies wohl die teuerste Möglich-
keit zu blotten. Die Dauer des Blottingvorgangs ist
abhängig von dem Verfahren, der angelegten Span- 3.3 Subzelluläre Fraktionierung
nung, Stromstärke und der Proteingröße. Zu hohe
Spannungen können die Geräte schädigen, auch In welcher Gehirnregion ein Protein vorkommt,
sollte eine zu starke Erhitzung vermieden werden. kann man durch die Präparation spezifischer Hirn-
Die Dauer des Blottens liegt meist beim Wet Blot areale, die Homogenisierung des Gewebes und
bei 1–2 Stunden, beim Semi-Dry-Blot bei 30–60 einen anschließenden Western Blot nachweisen.
Minuten und beim Dry Blot unter 10 Minuten. Bei Dieser Nachweis sagt allerdings nichts über die
3.3 • Subzelluläre Fraktionierung
43 3
subzellulären Strukturen, in welchen das Protein chens im einfachen Schwerkraftfeld ausdrücken.
lokalisiert ist, aus. Durch eine subzelluläre Fraktio- Dabei gibt man die relative Zentrifugalkraft (RCF,
nierung kann der Experimentator einzelne zellu- relative centrifugal force) als ein Vielfaches von der
läre Komponenten anreichern und so im Western Gravitationskonstante g (980  cm pro s2) an. Folgt
Blot die subzelluläre Lokalisation demonstrieren. oder dokumentiert man eine Arbeitsanweisung, so
Insbesondere ist beim Vergleich gleicher Protein- ist es sinnvoll, diese für Zentrifugationsschritte in
mengen auch eine quantitative Aussage über die g anzugeben. Denn diese Angabe lässt sich auf alle
subzelluläre Verteilung eines Proteins möglich. Rotoren übertragen. Eine Beschreibung der Zen-
So können dynamische, aktivitätsabhängige oder trifugation in U/min ist rotorspezifisch und sollte
krankhafte Veränderungen der Verteilung von vermieden werden. Verwendet man die Angabe U/
Proteinen nachgewiesen werden. In Kombination min doch, so sollte diese in Kombination mit dem
mit Immunpräzipitationen können auch posttrans- entsprechenden Rotor dokumentiert werden.
lationale Modifikationen, wie Protein-Phospho- Es gibt Festwinkel- und Swing-Out-Rotoren.
rylierung, in Abhängigkeit von der subzellulären In den Festwinkel-Rotoren stoßen Teilchen durch
Verteilung untersucht werden. Einzelne Fraktionen die Rotation auf die äußere Wandung des Zentri-
können der Ausgangpunkt zur Reinigung von Pro- fugenröhrchens, rutschen die Wandung herab und
teinen sein. Weiterhin erlaubt die Methode einzel- bilden am Boden des Röhrchens ein Pellet (Nieder-
ne Komponenten, wie synaptische Vesikel, aus den schlag). Das Sediment bildet sich schnell, allerdings
angereicherten Fraktionen zu charakterisieren. kann man Teilchen mit ähnlicher Sedimentations-
Die Ultrazentrifugation wurde von Svedberg charakteristik schwer voneinander trennen. Somit
bereits 1925 eingeführt und die Zentrifugation gilt lassen sich auf diese Weise nur Teilchen mit sehr
heute noch als ein klassisches Trennverfahren. Bei unterschiedlichen Sedimentationscharakteristika
der subzellulären Fraktionierung handelt es sich trennen. In Swing-Out-Rotoren (Ausschwingen-
um eine Form der präparativen Zentrifugation. den Rotoren) wandern Partikel fächerartig vom
Sie dient allgemein der Trennung, Isolierung und Rotormittelpunkt weg, treffen wiederum auf die In-
Reinigung von ganzen Zellen, subzellulären Orga- nenwand der Zentrifugenröhrchen und pelletieren.
nellen, Plasmamembranen, Polysomen, Nuclein- Durch Dichtegradienten, langsame Beschleuni-
säuren, Lipoproteinen oder Viren, um diese dann gung und langsame Abbremsung des Rotors kann
für weiterführende Untersuchungen einzusetzen. man Konvektionen und Turbulenzen so weit unter
Im Gegensatz dazu dient die analytische Zentri- Kontrolle bekommen, dass Teilchen mit ähnlicher
fugation vorwiegend der Analyse von gereinigten Sedimentationscharakteristik relativ gut getrennt
Makromolekülen oder Partikeln. Auf sie wird hier werden können.
nicht weiter eingegangen. Alle Dichtegradienten verwenden eine tragen-
Separation durch Zentrifugation beruht auf de Flüssigkeitssäule, deren Dichte zum Boden des
dem Verhalten von Teilchen in einem künstlichen Röhrchens ansteigt. Bei der Dichtegradientenzent-
Zentrifugalkraftfeld. In einer Lösung befindliche rifugation sedimentieren die Moleküle mit unter-
Teilchen verschiedener Größe, Dichte und Form schiedlicher Geschwindigkeit im Lösungsmittel,
setzen sich im Zentrifugalkraftfeld unterschiedlich bis die Dichte der Probe größer ist als die Dichte
schnell ab, sie sedimentieren. Diese Sedimenta- des Lösungsmittels. Je größer der Dichteunter-
tionsgeschwindigkeit hängt von den Eigenschaften schied zwischen den Proben, desto schneller erfolgt
der Teilchen sowie der sie umgebenden Lösung die Auftrennung. Beendet man die Zentrifugation
ab. Weiterhin von der eingesetzten Zentrifugal- zu einem geeigneten Zeitpunkt, so erhält man
kraft, die im Radius des Rotors nach außen wirkt unterschiedliche Banden. Dichtegradienten stellt
und durch die Winkelgeschwindigkeit des Rotors man entweder diskontinuierlich (Stufen-Gradien-
sowie durch den Abstand der Teilchen vom Mit- ten) oder als kontinuierliche Gradienten her. Zur
telpunkt des Rotors definiert wird. Man kann das Herstellung eines diskontinuierlichen Gradienten
Verhältnis der Masse eines Teilchens im Zentri- legt man im Zentrifugenröhrchen Lösungen mit
fugalkraftfeld zu dem Gewicht des gleichen Teil- abnehmender Dichte übereinander, dann setzt man
44 Kapitel 3 • Analyse von Proteinen

die Probe auf die Schicht mit geringster Dichte auf feldes. Die Zentrifugationsgeschwindigkeit wird
und zentrifugiert unter geeigneten Bedingungen. dabei so gewählt, dass charakteristische Anteile
Lässt man solch ein Röhrchen zu lange stehen, so der Probe während der Zentrifugationszeit pelle-
vermischen sich die einzelnen Lösungen zu einem tiert werden (.  Abb.  3.4). Anschließend werden
kontinuierlichen Gradienten. Die Vermischung Pellet und Überstand (Supernatant) voneinander
lässt sich durch Rühren beschleunigen. Weiterhin getrennt und je nach Bedarf das Pellet gewaschen
3 gibt es Gradientenmischer zur Herstellung eines und resuspendiert. Durch eine Wiederholung
kontinuierlichen Gradienten. Diese bestehen aus eines Zentrifugationsschrittes unter gleichen Be-
zwei Mischkammern, die Lösungen unterschied- dingungen kann eine bessere Trennung erreicht
licher Dichte enthalten und sich beim Füllen der werden. Ausgangsmaterial für die meisten Reini-
Zentrifugenröhrchen langsam mischen. Zum Sam- gungsschritte ist der postnucleäre Überstand (PNS,
meln der unterschiedlichen Fraktionen kann man postnuclear supernatant). Durch Homogenisierung
nach der Zentrifugation das Zentrifugenröhrchen und Lyse mit einer hypotonen Lösung lassen sich
mit einer Nadel unten anbohren und die Gradien- Synaptosomen und synaptische Vesikel gewinnen
tenflüssigkeit auffangen. Es gibt leider keinen uni- (. Abb. 3.4 und . Abb. 3.5). Verschiedene Protokol-
versellen Allzweckgradienten. Es werden je nach le nutzen Dichtegradienten, um Synaptosomen zu
Anwendung unterschiedliche gradientenbildende isolieren (Breukel et al., 1997; Hens 1997). Aus der
Substanzen, wie Saccharose, Ficoll oder Percoll, mit Synaptosomen-Fraktion kann weiterhin die Post-
unterschiedlichen Dichten eingesetzt. Traditionell synaptische-Dichte (PSD, post synaptic density) iso-
wird ein Saccharose Gradient zur Separation und liert werden (Carlin et al., 1980). Hierfür wird die
Konzentration von Organellen gewählt. Saccharose synaptosomale Membranfraktion mit 0,5 % Triton
ist ideal, da sie eine geringe Dichte in Lösung auf- X-100 solubilisiert. Der unlösliche Teil entspricht
weist und mit den meisten Makromolekülen nicht dann der PSD-Fraktion, der durch erneute Zent-
interagiert. Ein Nachteil der Saccharose ist ihre rifugationsschritte abgetrennt und weiter gereinigt
hohe Osmolarität in stark konzentrierten Lösun- werden kann. Grundsätzlich sollte die Reinheit
gen und ihr geringes Molekulargewicht (342), wes- aller relevanten Fraktionen im Western Blot mit
halb sie in Zellen eindringen kann. Deshalb werden entsprechenden Marker-Proteinen (Proteine, die
zum Trennen von Zellen, die intakt bleiben sollen, typisch für Organellen der Fraktion sind) überprüft
meist andere Trägersubstanzen benutzt. Die syn- werden. In der Regel werden die Komponenten
thetische Polysaccharose Ficoll hat ein wesentlich einer Fraktion sehr stark angereichert, sehr selten
größeres Molekulargewicht (400  000) als Saccha- liegen diese wirklich rein vor.
rose, ist gut löslich und stark konzentrierte Lösun- Durch Fraktionierung lassen sich intakte syn-
gen haben eine hohe Dichte mit physiologischer aptische Strukturen und Synapsenkomponenten
Osmolarität. Alternativ wird auch eine kolloidale präparieren. Verunreinigende Komponenten wie
Suspension von Silica-Partikeln, die mit Polyvinyl- Mitochondrien können zwar weitgehend abge-
pyrrolidon beschichtet sind, verwendet (Percoll). trennt werden, doch sollte sich der Experimentator
Auch diese Dichtegradienten sind osmotisch in- darüber im Klaren sein, dass diese Präparationen
aktiv und durch die Beschichtung sind die Silica- ein Gemisch verschiedener Synapsentypen darstel-
Partikel nicht mehr toxisch für Zellen. len und dies in mögliche Schlussfolgerungen mit
Um subzelluläre Fraktionen aus Gehirngewebe einbeziehen. Wer noch weiter Reinigen möchte,
zu isolieren, wird das Gewebe zunächst in einem kann z.  B. durch eine Immunaffinitätsreinigung
isotonischen Sucrose-Puffer pH 7,4 mit Hilfe eines eine definierte Populationen von synaptischen Ve-
Potters homogenisiert und größere Gewebereste sikeln isolieren und dann charakterisieren (Morcia-
durch Zentrifugation bei sehr geringer Geschwin- no et al., 2005; Urlaub et al., 2009).
digkeit (z. B. 800 × g für 10 Minuten) abgetrennt.
Bei der Differentialzentrifugation teilt man die zu
trennende Probe in verschiedene Fraktionen durch
eine stufenweise Erhöhung des Zentrifugalkraft-
3.4 • Auffinden und Nachweisen von Proteininteraktionen
45 3

Gehirnhomogenat
in 250 mM Saccharose Lösung

Zentrifugation
1000 g x 10 min

P1 S1

Zellkerne Zentrifugation
Zellbruchstücke 10.000 g x 20 min

P2 S2

Lyse mit hypotoner Lösung


Zentrifugation
165.000 g x 2 h
Zentrifugation im
Saccharose Dichtegradienten
25.000 g x 20 min

LP1 LS1 P3 S3

Synaptosomale Zentrifugation Mikrosomen Cytosol


Membranen 165.000 g x 2 h

LP2 LS2

Synaptische Vesikel

. Abb. 3.4 Beispielhaftes Protokoll zur subzellulären Fraktionierung von Gehirnhomogenat. S = Supernatant; P = Pellet. S1
wird auch als postnuclear supernatant (PNS) bezeichnet

3.4 Auffinden und Nachweisen von nale Modifikationen, oder über Transportvorgänge.
Proteininteraktionen Meist ist der Experimentator an einem bestimmten
Protein interessiert und sucht Interaktionspartner
Die Gesamtheit aller Interaktionen einer Zelle wird oder will eine Wechselwirkung nachweisen. Hier-
seit einigen Jahren gerne als das Interaktom einer für gibt es eine Reihe von Techniken, die sich nicht
Zelle bezeichnet. Der Begriff wird häufig auf Wech- nur methodisch unterscheiden, sondern unter-
selwirkungen zwischen Proteinen eingeschränkt. schiedlich gut für verschiedene Arten von Inter-
Das Auffinden und Nachweisen von Interaktionen aktionen geeignet sind. So sind schwache oder
zwischen Proteinen, von Proteinkomplexen und transiente Interaktionen nicht mit jeder Methode
funktionellen Netzwerken liefert Informationen leicht nachzuweisen. Ist eine neue Interaktion ge-
über die Funktion von Proteinen, über Signalwege, funden worden, so sollte diese mit einer zweiten
mögliche Prozessierungen, andere posttranslatio- Methode zum Nachweis einer Proteininteraktion
46 Kapitel 3 • Analyse von Proteinen

Synapse
3 AZ PSD
Axon Dendrit

Präsynapse Postsynapse

Mitochondrium

Synaptischer Vesikel

. Abb. 3.5 Schematische Darstellung einer Nervenzelle. Eine Synapse ist vergrößert dargestellt (innerhalb der
gestrichelten Linien). Einzelne Komponenten sind indiziert, wie die active zone (AZ), die post synaptic density (PSD),
synaptische Vesikel und Mitochondiren

verifiziert werden: wurde also eine Interaktion z. B. (Dithiotreithol oder β-Mercaptoethanol) eluiert.
im Yeast-2-Hybrid System gefunden, so sollte diese Der Erfolg der Präzipitation kann dann durch Gel-
z. B. durch eine Co-Immunpräzipitation oder einen Elektrophorese und Silber- bzw. Coomassie-Fär-
GST-pull down bestätigt werden. bung oder auch einen Western Blot überprüft wer-
den. Manchmal hilft es, das Lysat, bevor es mit dem
gekoppelten Antikörper inkubiert wird, Protein-A
3.4.1 Immunpräzipitation oder -G-Sepharose zu inkubieren (Preclearing).
Durch diesen Schritt sollten Proteine, die unspezi-
Bei einer Immunpräzipitation wird ein Antigen, fisch an die Beads binden, aus dem Lysat entfernt
z. B. ein Protein, durch die Bindung an einen Ma- werden.
trix-gekoppelten Antikörper isoliert. Die Herkunft Natürlich gibt es auch die Möglichkeit, Anti-
des zu präzipitierenden Proteins können Zellen körper direkt an Beads zu koppeln, dann sollten
oder Gewebe sein. Deshalb ist der erste Schritt die ursprünglichen Beads für das Preclearing ein-
das Herstellen eines entsprechenden Lysates. Pa- gesetzt werden. Zu bedenken ist bei einer direk-
rallel wird ein spezifischer Antikörper, der das zu ten Kopplung der Antikörper an die Beads, dass
präzipitierende Protein bindet, an Protein-A oder an die zuvor aktivierten Matrices Antikörper nicht
-G-Sepharose (Beads) gebunden (.  Abb.  3.6). An- in einer bestimmten Orientierung an die Beads ge-
schließend sollten die Beads gewaschen werden, koppelt werden. Benutzt man dagegen Protein-A
um überschüssige Antikörper zu entfernen. Dann oder -G-Sepharose, so werden die IgG Moleküle
werden die an die Beads gebundenen Antikörper spezifisch am Fc-Teil gebunden, somit gerichtet ge-
mit dem Lysat inkubiert und so das spezifische koppelt und alle Antigenbindungsstellen sind frei
Protein gebunden. Es folgen mehrere Waschschrit- zugänglich. Letztere Methode sollte eine höhere
te und schließlich wird das Protein durch eine De- Reproduzierbarkeit und Sensitivität gewährleisten.
naturierung bei hoher Temperatur (60–95°  C) in Es gibt Experimentatoren, die schwören darauf,
Gegenwart von SDS und reduzierenden Agenzien zuerst den Antikörper mit dem Lysat zu inkubie-
3.4 • Auffinden und Nachweisen von Proteininteraktionen
47 3
Lysat

Bindung des Pelletieren Waschen Elution


Antigens der Beads

Antikörper an
Protein A Beads Koppeln

. Abb. 3.6 Immunpräzipitation

ren und anschließend mit Protein-A oder -G- zu Bei der Immunpräzipitation können sich die
präzipitieren. Das geht natürlich auch. Allerdings Antikörper beweisen, denn sie ist sehr gut geeig-
bietet die Kopplung an Protein-A bzw. -G, wie net, ihre Spezifität nachzuweisen. Unspezifische
in .  Abb.  3.6. dargestellt, Vorteile. Ungebundene Bindungen kann man auch durch Erhöhung der Io-
Antikörper werden entfernt, somit ist sicherge- nenstärke (bis zu 1 M NaCl) oder dem Zugeben von
stellt, dass sämtliche Antikörper, die mit dem Lysat Detergenzien (1 % Triton oder NP-40) verringern.
inkubiert werden, auch präzipitiert werden. Außer- Ein spezifischer Antikörper sollte nur ein Protein
dem werden, wenn man mit einem polyklonalen präzipitieren (unter bestimmten Bedingungen auch
Antiserum arbeitet, alle anderen Proteine aus dem weitere Proteine Co-Präzipitieren, siehe unten).
Serum entfernt und man experimentiert nur mit Die Antikörperketten erscheinen aber meist eben-
IgGs. Dies führt meist zu einer Verringerung des falls beim Nachweis im Gel. Hat das präzipitierte
Anteils unspezifisch gebundener Proteine im Präzi- Protein ein vollständig anderes Molekulargewicht,
pitat, also zu einer Verringerung des Backgrounds. so stört dies in der Regel nicht. Läuft es aber auf
48 Kapitel 3 • Analyse von Proteinen

der Höhe der leichten oder schweren Ketten, so Proteinen transfiziert werden. Sollten keine Anti-
ist dies ein Problem. Dem geht man aus dem Weg, körper zur Verfügung stehen, so bietet es sich an
indem man das zu präzipitierende Protein zuvor mit Protein-Tags zu arbeiten. Die Lyse Bedingun-
radioaktiv markiert. Im Autoradiogramm werden gen können von großer Bedeutung sein. Je nach
die nicht radioaktiv markierten Antikörper nicht Natur der Proteininteraktion können variierende
sichtbar. Ist dies nicht möglich, so sollten Sie die Mengen von Salz und Detergens im Lysis-Puffer die
3 Antikörper irreversibel an die Präzipitationsmatrix Interaktion stören, auch kann die Geschwindigkeit
koppeln. Entweder koppeln Sie den Antikörper di- und Effizienz der Lyse einen Einfluss haben. Dies
rekt an eine aktivierte Matrix (z. B. CNBr-aktivierte gilt besonders für wenig lösliche Proteine, die mit
Sepharose) oder aber binden ihn an Protein-A oder makromolekularen Strukturen wie Membranen
-G-Beads und cross-linken dann Antikörper und oder dem Cytoskelett assoziieren. Grundsätzliche
Protein-A bzw -G (z. B. nach Gersten und Marcha- Komponenten eines Lysis Puffers sind in der Re-
lonis, 1978). Allerdings lösen sich trotz der kovalen- gel: Tris oder Hepes (20–50 mM, pH 7.5) Detergens
ten Kopplung leider häufig einige Antikörper von z. B. Triton-X 100 0,1–1 % (w/v), NP-40 oder Deo-
den Beads ab. Um das Ablösen der Antikörper von xycholat, Salz (NaCl oder KCl (100 mM–500 mM).
den Beads zu minimieren, sollten Sie das zu prä- Häufig werden Stabilisatoren verwendet, wie 10-
zipitierende Protein bei geringer Temperatur und 20  % (w/v) Glycerin, DTT (1  mM), EGTA oder
ohne reduzierende Agenzien eluieren. Weisen Sie EDTA (0,1–20  mM). Protease- und Phosphatase-
die Präzipitation im Western Blot nach, so können Inhibitoren helfen meist. Arbeiten Sie mit löslichen
Sie für den Blot einen Antikörper aus einer Spe- Proteinen, so können Sie auch auf Detergenzien
zies (z. B. Ziege) und zur Präzipitation einen Anti- verzichten und Zellen durch das wiederholte Pas-
körper aus einer anderen Spezies (z. B. Kaninchen) sagieren durch eine Kanüle aufschließen.
verwenden und hoffen, dass diese keine Kreuzre- Viel Beachtung sollten Sie beim Planen der Ex-
aktivität aufweisen. Eine weitere Möglichkeit ist die perimente den Kontrollen schenken. Eine Immun-
Biotinylierung des Antikörpers, der für den Wes- präzipitation kontrollieren Sie durch die Verwen-
tern Blot verwendet werden soll. Dann weisen Sie dung eines irrelevanten Antikörpers im gleichen
diesen mit Peroxidase an Avidin gekoppelt nach. Experiment. Arbeiten Sie mit einem Antiserum, so
können Sie zeigen, dass das Präimmunserum nicht
präzipitiert. Nutzen Sie monoklonale Antikörper,
3.4.2 Co-Immunpräzipitation so können Sie zeigen, dass ein anderes IgG nicht
zum gleichen Resultat führt. Arbeiten Sie mit Zel-
Die Immunpräzipitation eignet sich auch zum Auf- len, so können Sie Zellen nutzen, die das Antigen
spüren von neuen Interaktionspartnern oder zum nicht exprimieren. Eine weitere Kontrolle ist eine
Bestätigen von bereits identifizierten interagie- Präzipitation ohne spezifischen Antikörper, nur
renden Proteinen. Dann spricht man von Co-Im- mit den entsprechenden Beads. Testen Sie außer-
munpräzipitation. Bei dieser verfährt man genau dem, ob die Co-Immunpräzipitation in beiden
wie bei der Immunpräzipitation, versucht aber an- Richtungen funktioniert. Können Sie Protein A
schließend Proteine, die zusammen mit dem Anti- mit Protein B präzipitieren, dann sollten Sie auch
gen präzipitieren zu identifizieren. Möchte der Ex- Protein B mit A präzipitieren können. Funktioniert
perimentator eine Interaktion bestätigen, so bietet einer der beiden Ansätze nicht, so kann dies natür-
sich ein Western Blot als Nachweis an. Sollen neue lich auch experimentell bedingt sein, weil beispiels-
Interaktionspartner identifiziert werden, so folgen weise ein Antikörper ungeeignet ist.
meist ein Nachweis zusätzlicher Banden im Sil- Zu bedenken ist weiterhin, dass die Co-Immun-
ber- oder Coomassie-Gel und eine Identifizierung präzipitation zweier Proteine noch kein endgültiger
durch Massenspektrometrie. Nachweis für eine in vivo funktionelle Interaktion
Das Ausgangsmaterial kann ein Gewebe- oder ist. Meist müssen Sie die Bedeutung der Interaktion
Zell-Lysat sein. Soll eine bereits gefundene Inter- durch zusätzliche Experimente unterstützen. So
aktion bestätigt werden, können Zellen mit beiden können Sie versuchen, eine Co-Lokalisation beider
3.4 • Auffinden und Nachweisen von Proteininteraktionen
49 3
A B C . Abb. 3.7 Möglichkeiten,
Lösungen von Beads abzutren-
nen. Mit Hilfe einer Pipette oder
Kanüle nach einer Zentrifugation
(A). Durch das Zentrifugieren der
Lösung durch einen Membran
(B). Abtrennung von magne-
tischen Beads mittels eines
Magneten (C)

Proteine zu zeigen oder einen funktionellen Nach- ter Proteine. Am häufigsten werden Bakterien ein-
weis erbringen. gesetzt, weil diese einfach zu manipulieren sind,
ihre Kultivierung nicht aufwendig ist und auch
kBeads die Kosten gering sind. Zur bakteriellen Expres-
Dem Experimentator eröffnet sich beim Arbeiten sion gibt es unterschiedliche Systeme und es wer-
mit Beads ein Problem. Wie wasche ich meine den verschiedene Bakterien verwendet, meistens
Beads ohne großen Materialverlust? Gewöhnlich E.coli-Stämme. Die häufigsten Probleme bei der
werden die Beads rotierend inkubiert und an- bakteriellen Expression sind, dass kein Protein ge-
schließend durch Zentrifugation pelletiert. Wird bildet oder nachgewiesen werden kann oder aber,
der Überstand abgenommen, landet häufig ein Teil dass es in Einschlusskörperchen, so genannten
der Beads in der Pipette und der Verlust an Beads Inclusion-Bodies, akkumuliert. Es ist in der Regel
ist bei wiederholten Waschschritten enorm. Einige schwer, Proteine aus den Inclusion-Bodies als ak-
Experimentatoren versuchen durch den Gebrauch tive Proteine zu reinigen. Ein weiteres Problem der
von Kanülen das Problem zu kontrollieren, was bakteriellen Expression ist, dass die Proteine nicht
aber nur bedingt funktioniert, da die Beads diese glykosyliert werden.
auch passieren oder verstopfen können. Andere Nutzt man Hefen zur Proteinproduktion, so
zentrifugieren durch eine Fritte oder Membran, kann man ähnliche posttranslationale Modifikatio-
man kann z. B. Spin-Säulen verwenden und so Be- nen wie im Säuger erwarten. Das gleiche gilt für
ads und Flüssigkeit trennen. Als wirkliche Alter- den nicht pathogenen parasitären Einzeller Leish-
native setzen sich immer mehr magnetische Beads mania tarentolae, aber auch für Insektenzellen, wie
durch. Diese werden durch einen Magneten an den Sf9-Zellen, welche aus dem Nachtfalter Spo-
der Wand des Inkubationsgefäßes fixiert und die doptera frugiperda stammen. Diese werden in der
Flüssigkeit kann problemlos abgenommen werden Regel mit dem Baculovirus transfiziert. Auf die
(. Abb. 3.7). Transfektion und Proteinexpression in Säugerzel-
len wird im Kapitel Zellkultur eingegangen.
Zur Isolierung rekombinanter Proteine wer-
3.4.3 Expression von Proteinen den meist Affinitäts-Tags eingesetzt und über
diese in einem einstufigen Affinitätschromato-
Häufig stehen Proteine nicht zur Verfügung, weil graphie-Schritt gereinigt. Nicht immer verläuft
eine Reinigung nicht etabliert ist. Um ein relevantes die heterologe Expression unproblematisch, denn
Protein trotzdem zu erhalten, kann dies heterolog man exprimiert in einem Organismus ein Gen
exprimiert werden. Dafür wurden unterschiedliche aus einer anderen Spezies. Die Varianten des uni-
Systeme entwickelt, von denen viele induzierbar versellen genetischen Codes werden von verschie-
sind. Man bringt Bakterien, Hefen, Insektenzellen, denen Spezies unterschiedlich häufig verwendet.
Säugerzellen oder Einzeller zur Bildung gewünsch- Bestimmte Codons des degenerierten genetischen
50 Kapitel 3 • Analyse von Proteinen

Codes werden in unterschiedlichen Spezies bevor- einander geschalteten Argininen besteht. Arginin
zugt genutzt, was sich in der tRNA-Konzentration ist die basischste Aminosäure, und solch eine Kette
wiederspiegelt. Diese so genannte Codon-Usage von Argininen kann durchaus die Tertiärstruktur
spielt bei der Proteinbiosynthese eine große Rolle, des rekombinanten Proteins verändern, außerdem
seltene Codons können sich negativ auf die Trans- bindet der Arg-Tag hochaffin an Oberflächen und
lation auswirken. Bei der Planung einer heterolo- könnte somit in verschiedenen Tests eine Bindung
3 gen Expression sollten Sie deshalb unbedingt auf vortäuschen.
die Codon-Usage achten, vergleichen Sie diesbe- Beliebt zur Reinigung von Proteinen aus Bakte-
züglich das zu exprimierende Gen mit dem Ex- rien sind Histidin- und Gluthation-S-Transferase-
pressionssystem. Sie können Unterschiede durch Tags (GST-Tags). Die Reinigung erfolgt beim His-
Mutagenese oder Gensynthese ausgleichen und tidin-Tag zunächst über eine Bindung der Imida-
ihr Gen so dem System anpassen, oder gleich ein zolringe der Histidine an Metallionen, die an eine
anderes wählen. Wird ihr Protein posttranslational Matrix gekoppelt wurden (z.  B. Ni2+- oder Co2+-
modifiziert, so sollten Sie von der bakteriellen Ex- Beads). Nach mehreren Waschschritten folgt eine
pression Abstand nehmen. Auch die Auswahl des Elution mit 20–250 mM Imidazol oder durch eine
Protein-Tags will wohl überlegt sein, einige große pH-Wert-Erniedrigung. Sollten sehr viele nicht er-
hydrophile Tags können z. B. die Löslichkeit eines wünschte histidinhaltige Proteine beim Waschen
Proteins verbessern und so den Einschluss in Inclu- mit einem Tris/NaCl Puffer an den Beads hängen
sion-Bodies verhindern. bleiben, kann bereits dem Waschpuffer etwas Imi-
dazol (z. B. 5 mM) zugegeben werden. Dies sollte
Verunreinigungen beseitigen.
3.4.4 Protein-Tags GST-Fusionsproteine können an Glutathion-
Beads gebunden und anschließend durch Zugabe
Als Protein-Tags oder Affinitäts-Tags werden Pep- von reduziertem Glutathion eluiert werden. In Pull-
tidanhänge bezeichnet, die zur Reinigung oder zum Down-Experimenten werden GST-Fusionsproteine
Nachweis rekombinant hergestellter Proteine die- benutzt, um Interaktionspartner in Zellextrakten
nen. Ausgangspunkt ist ein entsprechender Expres- oder Gehirnlysaten zu binden und gemeinsam zu
sionsvektor, in dem die Sequenz, die für einen Tag präzipitieren. Diese werden dann mittels Massen-
codiert, einer cDNA vorangestellt oder angehängt spektrometrie identifiziert oder im Western Blot
wird, so dass der Tag N- oder C-Terminal mit dem nachgewiesen.
Zielprotein fusioniert wird. Zunächst ist es wichtig, Ein Nachteil bei der Reinigung kann durch die
ein geeignetes Expressionssystem und einen ent- verwendete Matrix entstehen. So sind Matrices, die
sprechenden Tag auszuwählen. Es gibt eine Viel- auf monoklonalen Antikörpern basieren, wie z. B.
zahl solcher Tags (.  Tab.  3.2), allerdings besitzen beim Anwenden von Flag- oder Myc-Tags, nicht
diese je nach Anwendung Vor- und Nachteile. Es immer stabil und die Antikörper lösen sich teilwei-
sollten die unterschiedlichen Größen der Tags, ihre se von der Matrix. Dies kann zur Folge haben, dass
mögliche Auswirkung auf die Struktur des Prote- neben dem gewünschten Protein auch massenhaft
ins, aber auch die Möglichkeiten der Reinigung schwere und leichte Ketten des verwendeten Anti-
und des Nachweises bedacht werden (. Tab. 3.3) Es körpers in der Reinigung auftauchen. Problema-
kann passieren, dass ein Tag im Protein verborgen tisch ist dies insbesondere beim Fehlschlagen der
ist und so schwer erkannt wird. In anderen Fällen Reinigung oder bei einer sehr geringen Ausbeute.
können Tags aber auch die Löslichkeit eines Pro- Läuft dann das gewünschte Protein im Gel auf
teins verstärken. Kleine Tags haben den Vorteil, der gleichen Höhe wie die leichten (25 kDa) oder
dass sie eigentlich die Konformation eines Proteins schweren Ketten (55 kDa), kann dies zu erheblichen
weniger beeinträchtigen sollten als große. Aller- Verwirrungen führen. Schon manch ein Experi-
dings sind die Bestandteile der Tags von enormer mentator hat die detektierten Antikörper-Banden
Bedeutung. Eines der zuerst beschriebenen Tags für sein zu reinigendes Protein gehalten. Wie man
ist der Arg-Tag, welcher aus fünf bis sechs nach-
3.4 • Auffinden und Nachweisen von Proteininteraktionen
51 3

. Tab. 3.2 Affinitäts-Tags

Tag Länge (Aminosäuren) Sequenz Größe


(kDa)

Poly-Arg 5–6 RRRRR 0,8


Poly-His 2–10 (meist 6) HHHHHH 0,84
FLAG 8 DYDDDDK 1,01
Strep-Tag II 8 WSHPQFEK 1,06
c-Myc 11 EQKLISEEDL 1,2
V5-Epitop 14 GKPIPNPLLGLDST 1,4
S-Tag 15 KETAAAKFERQHMDS 1,75
HAT 19 KDHLIHNVHKEFHAHAHNK 2,31
3x FLAG 22 DYKDHDGDYKDHDIDYKDDDDK 2,73
Calmodulin-Binde-Peptid 26 KRRWKKNFIAVSAANRFKKISSSGAL 2,96
Cellulose-Binde-Domäne 27–189 verschiedene Domänen 3,0–20,0
SBP 38 MDEKTTGWRGGHVVEGLAGELEQLRAR- 4,03
LEHHPQGQREP
Chitin-Binde-Domäne 51 TNPGVSAWQVNTAYTAGQLVTYNGKTYKCLQ- 5,59
PHTSLAGWEPSNVPALWQLQ
Glutathion S-Transferase 211 Protein 26,0
Maltose-Binde-Domäne 396 Protein 40,0

diesem Problem aus dem Weg gehen kann, ist im lichen. Ursprünglich wurde es zur Analyse des
Abschnitt Immunpräzipitation geschildert. Hefe-Interaktoms entwickelt, es wird aber auch zur
Manchmal ist es auch sinnvoll, das Fusions- Identifizierung von Proteininteraktionen aus Zell-
protein so zu konstruieren, dass der Tag mit einer linien und sogar transgenen Mäusen angewandt.
Protease abzuspalten ist. Dafür muss zuvor die Der klassische TAP-Tag besteht aus einem Prote-
entsprechende Erkennungssequenz zwischen Tag in A-Tag, gefolgt von einer TEV-Protease-Erken-
und Protein eingeführt werden. Die am häufigsten nungssequenz und einem Calmodulin-Binde-Pep-
verwendeten Proteasen sind: Enterokinase, Tabak- tid (CBP). Dieser klassische TAP-Tag hat aber viele
Etch-Virus (TEV) Protease, Thrombin und Fak- Nachteile, so ist die molekulare Masse relativ groß
tor Xa. Bemerkenswerterweise hat der FLAG-Tag (21 kDa) und CBP kann mit Calcium-abhängigen
(DYKDDDK) eine interne Erkennungssequenz für Signalwegen interferieren. Andere, kleinere TAP-
die Enterokinase (DDDKX). Es besteht natürlich Tags werden inzwischen häufig verwendet, wie die
immer die Möglichkeit, dass eine Protease auch in Kombination Strep-Tag II und FLAG-Tag, oder
dem zu untersuchenden Protein schneidet. Dies HAT- und FLAG-Tag. Diese können jeweils durch
sollte grundsätzlich zuvor über eine Sequenzana- eine Protease-Erkennungssequenz (z. B. TEV) von-
lyse, aber auch experimentell ausgeschlossen wer- einander getrennt werden. Bei vielen erfolgreichen
den. Weiterhin ist zu beachten, dass alle genannten Anwendungen des Systems wurden Tags mehr-
Proteasen bei unterschiedlichen Temperaturen ak- fach hintereinander geschaltet, z.  B. HAT-Tag,
tiv sind. TEV-, 3xFLAG-Tag. Ein entsprechender Vektor
Man kann auch mehrere Tags anwenden. Ein wird dann in eine Zelllinie transfiziert (am besten
spezielles Multi-Tag System ist das so genannte stabil), oder aber eine transgene Maus hergestellt.
tandem affinity purification-Tag (TAP-Tag). Dies Die Reinigung aus Zell- oder Gehirnlysat erfolgt
soll die Analyse bzw. Identifizierung von Protein- in vier Schritten: Bindung durch den ersten Tag,
interaktionen unter nativen Bedingungen ermög- Abspaltung durch eine Protease oder Elution, Bin-
52 Kapitel 3 • Analyse von Proteinen

. Tab. 3.3 Matrices und Elutionsbedingungen für Affinitäts-Tags

Affinitäts-Tag Chromatographie-Matrix Elutionsbedingungen

Poly-Arg Kationenaustauschchromatographie Linearer NaCl Gradient (0–400 mM), pH 8


Poly-His Metallaffinitätschromatographie: Imidazol 20–250 mM oder niedriger pH
3 Ni2+-NTA, Co2+-CMA (Talon)
FLAG Anti-FLAG-Antikörper pH 3 oder 2–5 mM EDTA oder FLAG-Peptid
Strep-Tag II Strep-Tactin 2,5 mM Desthiobiotin (Biotin Derivat)
c-Myc Anti-Myc-Antikörper niedriger pH
V5-Epitop Anti-V5-Antikörper niedriger pH
S-Tag S-Fragment der RNaseA 3 M Guanidinthiocyanat, 0,2 M Citrat, pH 2,
3 M Magnesiumchlorid
HAT Co2+-CMA (Talon) 150 mM Imidazol oder niedriger pH
Calmodulin-Binde- Calmodulin EGTA oder EGTA mit 1 M NaCl
Peptid
Cellulose-Binde- Cellulose Familie I: Guanidin HCl oder Harnstoff > 4 M
Domäne Familie II/III: Ethylenglycol
SBP Streptavidin 2 mM Biotin
Chitin-Binde- Chitin Fusioniert mit einem Intein:
Domäne 30–50 mM Dithiothreitol, β-Mercaptoethanol
Glutathion Glutathion 5–10 mM reduziertes Gluthation
S-Transferase
Maltose-Binde- Amylose 10 mM Maltose
Domäne

dung durch den zweiten Tag, Elution und Analyse liche Systeme zunutze, in denen eine Interaktion
auf einem Gel (. Abb. 3.8). Das ganze System sieht zwischen zwei Proteinen detektiert und dann die
in der Theorie sehr überzeugend aus, allerdings ist entsprechende cDNA identifiziert wird. Dazu ge-
zu beachten, dass für jedes Protein die Reinigungs- hört das Yeast-Two-Hybrid (Hefe-Zwei-Hybrid)-
prozedur ausprobiert werden muss, was sehr lang- System.
wierig und mühsam sein kann. Sollen dann neue Viele eukaryotische Transkriptionsfaktoren be-
Interaktionspartner identifiziert werden, muss stehen aus zwei distinkten funktionellen Domänen.
einerseits genug Material gereinigt werden, ande- Aus einer DNA-bindenden Domäne (DNA binding
rerseits muss ein talentierter Kooperationspartner domain, BD), die eine definierte Promotorsequenz
gefunden werden, der die Banden oder am besten bindet, und einer aktivierenden Domäne (activa-
gleich das gesamte Eluat analysieren kann. tion domain, AD), die mit dem RNA Polymerase
II Komplex interagiert und dadurch die Transkrip-
tion aktiviert (.  Abb.  3.9 A). Beim Yeast-Two-Hy-
3.4.5 Das Yeast-Two-Hybrid-System brid-System macht man sich diese Eigenschaften
zunutze. Exprimiert man einen transkriptionellen
Bei der Co-Immunpräzipitation und auch beim Aktivator als zwei physisch getrennte Domänen,
TAP-Tag-Ansatz werden Proteine aus ihrem na- so interagieren diese nicht und aktivieren nicht
türlichen Kontext isoliert und Interaktionspartner die Transkription eines Gens (.  Abb.  3.9 B). Beim
oder auch Proteinkomplexe, die diese Prozeduren Yeast-Two-Hybrid-System werden die BD und AD
an das relevante Protein assoziiert überstehen, jeweils als Fusionsproteine exprimiert. Die BD wird
isoliert. Andere Methoden machen sich künst- mit dem Bait-Protein (Köder-Protein) und die AD
3.4 • Auffinden und Nachweisen von Proteininteraktionen
53 3
A

HAT TEV 3xFLAG

U Bindung an Talon Beads

U ! U ! U
U U S ! "
HAT TEV 3xFLAG S S "
U ! ! ! "

Waschen und TEV-Protease Schnitt

U
HAT TEV 3xFLAG

S S
S "
U
" "

Bindung an FLAG-Matrix

S "
3xFLAG S S "
"

Waschen und Elution mit FLAG Peptid

3xFLAG
S S
"
S
" "

. Abb. 3.8 TAP-Tag-Aufreinigung. A) Schematische Darstellung eines TAP-Tag Konstruktes. HAT, HAT-Domäne; TEV, TEV-
Protease Erkennungssequenz; 3xFLAG, drei hintereinander geschaltete FLAG-Domänen, die schwarze Linie symbolisiert das
getagte Protein. B) Präzipitation mittels TAP-Tag. S, spezifisch interagierende bzw. assoziierende Proteine, U, unspezifisch
assoziierende Proteine
54 Kapitel 3 • Analyse von Proteinen

mit dem Prey-Protein (Beute-Protein) fusioniert. A


Exprimiert man die Fusionsproteine einzeln, so ak- AD
tivieren sie nicht die Transkription (.  Abb.  3.9 C, BD
D). Exprimiert man die Fusionsproteine gemein-
sam und interagieren Bait- und Prey-Protein, so on
aktivieren sie die Transkription eines Gens, dessen
3 Promotor von der BD erkannt wird (. Abb. 3.9 E ). B
Beim Yeast-Two-Hybrid-System verwendet AD
man genetisch modifizierte Hefestämme. In die-
sen stehen Reportergene unter der Kontrolle von BD
BD und AD. Im ursprünglich entwickelten System
wurden die DNA-bindende Domäne und die ak-
off
tivierende Domäne des Hefe GAL4-Proteins ver-
wendet. Alternativ wurde ein Yeast-Two-Hybrid-
System entwickelt, das das bakterielle LexA-Protein C
Bait
verwendet. Dieses bindet an den LexA-Operator,
welcher in den genetisch veränderten Hefen die Ex-
pression eines Reportergens kontrolliert. Es werden BD
in den verschiedenen Systemen unterschiedliche
Reportergene eingesetzt. Das LacZ-Gen vermittelt off
die Expression von β-Galactosidase und ermöglicht
eine Blaufärbung der Hefen. Andere Reportergene D
erlauben das Wachstum auf selektiven Medien, in- AD
dem sie die Synthese von essenziellen Substanzen Prey
vermitteln (auxotrophe Marker), wie Histidin oder
Adenin. Man weist die Interaktion von Bait- und
Prey-Protein somit entweder durch eine Farbreak- off
tion oder durch Wachstum der Hefen nach. Ana-
lysieren Sie die Interaktion zweier bekannter Pro- E AD
teine, dann ist dies der Nachweis. Suchen Sie nach Bait
Prey
neuen Interaktionspartnern, so isolieren Sie die
positiven Hefekolonien und extrahieren die Prey- BD
cDNA, um den möglichen Interaktionspartner zu
bestimmen. Von der Suche nach neuen Interak- on
tionspartnern leiten sich auch die Bezeichnungen
»Bait« und »Prey« ab. . Abb. 3.9 Das Two-Hybrid-System. AD, activation domain;
Egal, ob Sie mit dem Yeast-Two-Hybrid-Sys- BD, DNA binding domain; Bait, Köder-Protein; Prey, Beute-
tem eine Proteininteraktion untersuchen oder neue Protein; on, Transkription aktiviert; off, keine Transkription.
Weitere Erläuterungen siehe Text
Interaktionspartner finden wollen, Sie müssen sich
zunächst für ein Analysesystem entscheiden. Di-
verse Firmen bieten diese bestehend aus modifi- meist unklar und die unterschiedlichen Ergebnisse
zierten Vektoren, Hefestämmen und cDNA-Biblio- sind nicht vorhersagbar. Einige Experimentatoren
theken an. Es gibt kein Yeast-Two-Hybrid-System, bevorzugen das LexA-System, weil der Transkrip-
das den anderen in allen Belangen überlegen ist. Es tionsaktivator bakteriellen Ursprungs ist, deshalb
wird immer wieder beschrieben und wurde auch in der Hefe keinen endogenen Interaktionspartner
von uns beobachtet, dass einige Proteininterak- hat und dadurch weniger falsch Positive gefunden
tionen in einem System gefunden wurden, aber in werden sollten. Andere Experimentatoren sind
einem anderen nicht. Die Ursachen dafür bleiben der Meinung, dass das Gal4-System sensitiver ist.
3.4 • Auffinden und Nachweisen von Proteininteraktionen
55 3
Sollten Sie mehr als eine Möglichkeit haben eine teinen, die eine Autoreaktivität zeigen, der Grund
Interaktion nachzuweisen, z.  B. Farbreaktion und dafür nicht offensichtlich. Wollen Sie trotzdem mit
Wachstumsselektion oder mehrfache Wachstums- dem Yeast-Two-Hybrid-System nach Interaktions-
selektion, so nutzen Sie diese Möglichkeiten, um partnern suchen, so können Sie versuchen nur Tei-
die Anzahl an falsch Positiven zu reduzieren. Sie le bzw. bestimmte Domänen des Proteins für die
müssen sich weiterhin entscheiden, ob Sie die Analysen zu verwenden. Eine weitere Alternative
DNA-bindende Domäne N- oder C-Terminal an stellt das Membran-basierte Split-Ubiquitin-Sys-
ihr Protein fusionieren. In manchen Fällen ist es tem dar, welches später erläutert wird.
vorhersagbar, dass die Funktion oder eine post- Führen Sie einen Yeast-Two-Hybrid-Screen
translationale Modifikation durch die Fusion an durch, um neue Interaktionspartner zu identifizie-
einer Seite gestört wird, dann fusionieren Sie auf ren, so müssen Sie am Ende des Screens die Plas-
der anderen Seite. In anderen Fällen ist es nicht vor- mide aus den positiven Hefekolonien isolieren. Es
hersagbar, welche Form der Fusion bessere Ergeb- gibt große Unterschiede, einige Screens enden mit
nisse liefert und Sie müssen empirisch vorgehen. wenigen, andere mit sehr vielen positiven Hefeko-
In der Praxis wird die Bait-cDNA in einen Vek- lonien. Bei sehr vielen Kolonien sollten Sie versu-
tor kloniert, welcher ein Gen trägt, welches das chen identische cDNAs durch einen Restriktions-
Wachstum auf einem defizienten Medium ermög- verdau zu identifizieren. Dann brauchen nicht alle
licht, z.  B. auf Leucin-freiem Medium. Als Kont- sequenziert zu werden. Wenige positive Kolonien
rolle für eine erfolgreiche Transformation werden bedeuten noch keinen Misserfolg. Unter den we-
die Hefen auf diesem defizienten Medium plattiert. nigen Positiven können relevante Interaktionspart-
Der verwendete Hefestamm wächst nur, wenn er ner sein. Es gibt aber auch erfolglose Screens, ohne
erfolgreich transformiert wurde. Dann folgt ein positive Hefekolonien. Ein Screen kann durchaus
Test auf Autoreaktivität. Die transformierten He- 8 Wochen und länger dauern. Deshalb sollte auch
fen werden auf das Medium übertragen auf dem über solch einen Ausgang und mögliche Konse-
die Interaktion nachgewiesen werden soll, z. B. His- quenzen frühzeitig nachgedacht werden.
tidin freies Medium. Hier sollten die Hefen, die nur In der Regel identifiziert man nur partielle Gen-
mit einem Vektor transfiziert wurden, nicht wach- sequenzen möglicher Interaktionspartner. Bei den
sen. Tun sie dies doch, dann haben Sie ein Problem Sequenzanalysen sollten Sie unbedingt darauf ach-
Namens Autoreaktivität. Tritt dies auf, so haben Sie ten, dass im Hefevektor der richtige Leserahmen
verschiedene Möglichkeiten, dem Problem auszu- getroffen wurde und der identifizierte Sequenz-
weichen. Eine Möglichkeit besteht im Wechsel des abschnitt tatsächlich im offenen Leserahmen des
Systems, was manchmal hilft. Eine andere besteht Gens liegt. Wie bei anderen Screeningmethoden
in der Modifikation des Wachstumsmediums. De- findet man Proteine, die eine Interaktion aufwei-
tektieren Sie mit Ihrem System die Interaktion auf sen, obwohl diese Interaktion physiologisch nicht
Histidin-freiem Medium, können Sie diesem stei- relevant ist. Dies lässt sich nur durch zusätzliche
gende Konzentrationen (üblicherweise 3–15  mM) Experimente untersuchen. Es tauchen aber auch
3-AT (3-Amino-1, 2, 4-Triazol) zufügen. 3-AT ist falsch positive Proteine auf, die unspezifisch bin-
ein kompetitiver Inhibitor des His3-Proteins, wel- den oder als Interaktionspartner gar keinen Sinn
ches den entsprechenden Hefe Stämmen (z.  B. ergeben können. Interessanterweise sagt die Häu-
AH109) Wachstum auf Histidin-defizientem Me- figkeit mit der ein Gen in einem Screen gefunden
dium ermöglicht. Somit sorgt 3-AT für stringentere wird nichts über die funktionelle Relevanz der
Bedingungen und reduziert den Hintergrund. Interaktion aus. Es gibt weiterhin Gene, die immer
Es kann aber auch sein, dass ihr Protein eine wieder in Screens auftreten. Einige kodieren für
transkriptionelle Aktivierungsdomäne besitzt, was »klebrige« Proteine und stehen immer wieder im
sehr wahrscheinlich bei einem Transkriptionsfak- Verdacht unspezifische Interaktion zu vermitteln,
tor der Fall ist. Dann kann es sehr hilfreich sein, wie ribosomale Untereinheiten, Heat-Shock-Pro-
die Aktivierungs-Domäne aus dem Konstrukt zu teine oder Proteasomuntereinheiten (Serebriiskii
eliminieren. Allerdings ist bei vielen anderen Pro- und Golemis, 2001). Das Labor von Erica Golemis
56 Kapitel 3 • Analyse von Proteinen

hat sogar Listen mit häufigen falsch Positiven im A


Internet veröffentlicht (siehe Web-Links am Ende
des Kapitels).
Das Yeast-Two-Hybrid-System wurde erfolg- Prey AD
Bait
reich zur Analyse und Identifizierung von einer
Vielzahl von Protein-Interaktionen eingesetzt. Sei-
3 ne Anwendung wird allerdings durch eine Reihe BD

von Faktoren begrenzt. Es wird nur eine direkte


Interaktion zwischen zwei Proteinen analysiert. on
Diese müssen in den Kern transportiert werden
können. Etwa ein Drittel aller eukaryotischen Pro- B
teine sind Membran-Proteine. Weil diese nicht in
den Kern gelangen, können sie nicht mit einem Prey
herkömmlichen Yeast-Two-Hybrid-System unter-
sucht werden. Weiterhin ist eine posttranslationa- Bait AD
le Modifikation von Proteinen, die nicht nativ in
der Hefe vorkommen, nicht garantiert. Werden BD
diese Modifikationen nicht realisiert und sind sie
für eine Interaktion entscheidend, wird solch eine on
Interaktion nicht detektiert. Trotzdem ist der Yeast-
Two-Hybrid-Ansatz eine sehr ökonomische high- . Abb. 3.10 Das Yeast-Three-Hybrid-System. Es kann zum
throughput-Methode, die auch transiente Interak- Nachweis eines Komplexes aus drei Proteinen oder zur
Klonierung einer fehlenden Komponente genutzt werden,
tionen nachweisen kann.
wobei die Interaktion von Bait und Prey von einem dritten
Es gibt verschiedene Variationen des Systems, heterolog exprimierten Protein vermittelt wird (A) oder
die die möglichen Anwendungen erweitern. Durch aber das Prey-Protein eine zusammengesetzte Bindestelle
das Yeast-Two-Hybrid-System wird nur eine di- erkennt (B)
rekte Interaktion zwischen zwei Proteinen detek-
tiert. Viele Proteininteraktionen hängen aber von Hybrid-System werden Proteine, die mit DNA
der Anwesenheit eines dritten Proteins ab, welches interagieren, identifiziert. Das Yeast-Tri-Hybrid
ebenfalls gebunden wird oder eine Konformations- (oder Yeast-RNA-Three-Hybrid-System) dient
änderung induziert. Beim Yeast-Three-Hybrid- der Identifizierung und Analyse von RNA- und
System wird deshalb zusätzlich ein drittes Protein Proteininteraktionen.
exprimiert (. Abb. 3.10).
Proteininteraktionen können durch das Two- kDas Split-Ubiquitin-System
Hybrid-System auch in anderen Organismen als Ubiquitin ist ein konserviertes Protein aus 76 Ami-
der Hefe nachgewiesen werden. Grundsätzlich nosäuren. Wird es mit einem anderen Protein ver-
führt dabei eine Protein-Protein und eine Pro- knüpft, signalisiert dies den Abbau dieses Proteins.
tein-DNA-Interaktion zur Transkription eines Dabei wird der Ubiquitin-Anteil von Ubiquitin-
Reportergens. Das bakterielle Two-Hybrid-Sys- spezifischen Proteasen (UBPs) erkannt und das
tem kann zur schnellen Identifikation und Ana- angehängte Protein zum Abbau abgespalten. Im
lyse von Protein-Interaktionen, insbesondere zur Gegensatz zu vielen anderen Proteasen erkennen
Analyse verschiedener Mutanten, eingesetzt wer- UBPs nicht eine spezifische Aminosäuresequenz,
den. Die Verwendung des Two-Hybrid-Systems sondern die Struktur des Ubiquitinmoleküls. Ubi-
in Säugerzellen (Mammalian Two-Hybrid Sys- quitin kann in zwei Teilen exprimiert werden,
tem) hat den Vorteil, dass Säugerproteine in ihrer einem N-terminalen (Nub, Aminosäure 1–34) und
nativen Umgebung analysiert werden können. einem C-termnialen (Cub, Aminosäure 35–76).
Weiterhin gibt es Variationen zur Analyse von Aufgrund ihrer Affinität zueinander fügen sich
Proteinen mit Nucleinsäuren. Beim Yeast-One- Nub und Cub wieder zu einem Molekül zusammen
3.4 • Auffinden und Nachweisen von Proteininteraktionen
57 3
A . Abb. 3.11 Das Split-Ubiquitin-
N N System. Erläuterungen siehe Text
Cub C Cub C
+
Nub
Nub

Split-Ubiquitin
B
UBPs
N N
Cub Cub C
C C
Nub Nub +

Split-Ubiquitin Reporter

C
N N
Cub C Cub C
+
NubG NubG

D
Prey
Bait Prey Bait

+
Cub
NubG Cub
NubG

(.  Abb.  3.11A ). Ist Cub mit einem Reporterprotein Der Reporter ist mit Cub fusioniert. Cub wieder-
fusioniert und wird gemeinsam mit Nub in einer um ist an ein Membranprotein angefügt, welches
Zelle exprimiert, dann fusionieren Nub und Cub als Bait verwendet wird. Prey-Proteine werden mit
zu einem Ubiquitinmolekül und UBPs spalten NubG fusioniert. Voraussetzung damit das System
das Reporterprotein ab (.  Abb.  3.11B ). Exprimiert funktioniert ist natürlich, dass Cub und NubG auf
man ein mutiertes Nub bei dem Aminosäure Iso- der cytoplasmatischen Seite lokalisiert sind. Inter-
leucin-13 durch Glycin ersetzt ist (NubG), so ist agieren Bait- und Prey-Protein wird der Reporter
die Affinität von Nub und Cub herabgesetzt und abgespalten und aktiviert die Transkription eines
sie assoziieren nicht mehr spontan (.  Abb.  3.11C ). Reportergens. Somit ermöglicht dieses System,
Dies macht man sich beim Split-Ubiquitin-System Membranproteine im Two-Hybrid-Verfahren zu
zu nutze. Das Bait-Protein wird an Cub fusioniert, analysieren (.  Abb.  3.12A ). Außerdem eignet sich
gefolgt von einem Reporterprotein, und das Prey- das Split-Ubiquitin-System zur Analyse von Pro-
Protein wird an NubG fusioniert. Wenn Bait- und teinen, die im herkömmlichen Two-Hybrid-Ver-
Prey-Protein interagieren kommen NubG und Cub fahren autoreaktiv sind. Normalerweise frei im
nah genug, um von UBPs erkannt zu werden. Dies Cytosol vorkommende Bait-Proteine werden N-
mündet in der Freisetzung des Reporterproteins terminal an ein Transmembranprotein fusioniert
(. Abb. 3.11D ). exprimiert (.  Abb.  3.12B ). An den C-Terminus des
Das Split-Ubiquitin-System wurde weiter mo- Bait-Proteins schließt sich dann Cub, gefolgt vom
difiziert, um Interaktionen von Membranprotei- Reporterprotein an. Prey-Proteine werden mit
nen analysieren zu können. Als Reporterprotein NubG fusioniert. Eine Interaktion von Bait- und
wird meist ein Fusionsprotein aus LexA und dem Prey-Protein führt zur Assoziation von Cub und
Transaktivator VP16 aus Herpes simplex verwendet. NubG, dies induziert die Abspaltung des Reporter-
58 Kapitel 3 • Analyse von Proteinen

. Abb. 3.12 Das membran- A


basierte Split-Ubiquitin-System.
Erläuterungen siehe Text
Extrazellulär +
oder Lumen

3 Cytoplasma

Cub Cub
NubG NubG

Extrazellulär
oder Lumen

Cytoplasma +
Bait
Prey Bait
Prey
Cub
NubG Cub
NubG

proteins und die Expression des Reportergens. Das te (Pilus-positive) Bakterien mit Phagen, die eine
Split-Ubiquitin-System ist somit zur Analyse von ganze Genbibliothek enthalten, infiziert. Die Pha-
cytosolische Proteinen als auch von Membranpro- gen vermehren sich selbständig in den Bakterien,
teinen geeignet. Die Interaktion von Transmemb- präsentieren eine Vielzahl von eingeschleusten
ran-Proteinen kann auch dann detektiert werden, Fremdproteinen auf ihrer Oberfläche und werden
wenn diese nicht im Cytoplasma stattfinden, aber mit dem Zielprotein inkubiert. Nach Waschschrit-
die cytoplasmatische Domänen nah genug zusam- ten, werden die Phagen, welche an das Zielprotein
menführt. Ein Identifizieren von ausschließlich gebunden haben, eluiert, durch erneutes infizieren
extrazellulären Liganden ist mit dieser Methode von Bakterien vermehrt und erneut an das Ziel-
jedoch nicht möglich. protein gebunden. Dieses so genannte Biopanning
wird in der Regel 3–4 Mal wiederholt. Es werden
durch diese Methode die am besten bindenden Fu-
3.4.6 Phagen-Display sionsproteine angereichert. Anschließend wird die
Phagen-DNA isoliert und der relevante Bereich der
Phagen sind Viren, die spezifisch Bakterien be- DNA des Fusionsproteins sequenziert. Auf diese
fallen. Beim Phagen-Display werden Gene oder Weise werden Gensequenzen von möglichen Inter-
Genfragmente in die Gen-Sequenzen von Ober- aktionspartnern identifiziert.
flächenproteinen filamentöser Phagen kloniert. Phagenpartikel überstehen erstaunlich raue
Die Phagen bauen das kodierte Fusionsprotein in Bedingungen, wie pH 2,2 oder hohe Harnstoff-
ihre Hüllen ein und werden auf der Phagenoberflä- Konzentrationen ohne ihre infektiösen Eigenschaf-
che präsentiert (displayed). Zum Auffinden neuer ten zu verlieren. Dadurch können auch hochaffin
Proteininteraktionen wird das Protein, für das man bindende Proteine eluiert werden. Alternativ kann
einen Interaktionspartner sucht an eine Oberfläche, man auch durch Trypsin-Behandlung eluieren.
z. B. Beads, gebunden. Weiterhin werden geeigne- Dann werden nur die Phagen gelöst, die tatsächlich
3.4 • Auffinden und Nachweisen von Proteininteraktionen
59 3
durch Protein-Interaktionen gebunden wurden. Auf die Entdeckung von GFP folgte seine Opti-
Ein Vorteil der Methode besteht in dem schnellen mierung. Die Codon-Usage wurde für die Expres-
und effizienten Screenen von Genbibliotheken. sion in Säuger Zellen verbessert. Diese enhanced
Weiterhin können sehr seltene Interaktionspartner GFP (EGFP)-Variante wird heute immer noch am
identifiziert werden. Der entscheidende Nachteil häufigsten benutzt. Weiterhin wurden durch Mu-
ist, dass nur kurze Peptide bis ca. 12 Aminosäuren tagenese diverse Varianten erzeugt, die blau oder
auf der Oberfläche der Bakteriophagen präsentiert gelb leuchten. Und es wurde und wird immer noch
werden. Deshalb werden meist nur Fragmente von nach neuen fluoreszierenden Proteinen gesucht.
Proteinen identifiziert. Somit eignet sich die Me- Man wurde in weiteren Nesseltieren, vor allem
thode vor allem zur Identifizierung von Peptiden Korallen, fündig, und inzwischen deckt man mit
als Liganden für Rezeptoren, um Protein-Protein fluoreszierenden Proteinen das gesamte sichtbare
Interaktionen zu charakterisieren, um synthetische Lichtspektrum ab. Die entstandenen Variationen
Inhibitoren oder minimale Bindungssequenzen zu sind sehr vielfältig und für den Neuling schwer
identifizieren. Interessant sind fertige Phagen Ban- zu durchschauen. Bei der Auswahl spielen neben
ken in denen 7 oder 12 Aminosäuren lange Peptide der Verfügbarkeit die Reifung des Proteins von der
sämtliche möglichen Aminosäuren Kombinatio- Translation bis zum Leuchten, die Photostabilität,
nen repräsentieren. Weiterhin gibt es Banken, die die Helligkeit, sowie die Möglichkeit zur Analyse
durch die Ausbildung von Disulfidbrücken Pepti- (sind entsprechende Filter vorhanden usw.) eine
de mit Haarnadel-Schleifen präsentieren und so Rolle.
strukturelle Eigenschaften nachspielen (diese gibt Bei den grün fluoreszierenden Proteinen wird
es z. B. bei New England Biolabs). von den meisten Experimentatoren immer noch
EGFP verwendet. Für bestimmte Anwendungen
besitzen aber einige Varianten Vorteile. Das De-
3.4.7 Fluoreszenzbasierte Techniken rivat Emerald-GFP (durch Invitrogen vertrieben)
zur Detektion von Proteininter- besitzt vier zusätzliche Punktmutationen, die seine
aktionen Faltung verbessern und es heller erscheinen lassen.
Allerdings bleicht es leichter aus, was bei einigen
Seit der Reinigung des green fluorescent protein Anwendungen stören kann. GFP besitzt immer
(GFP) durch Shimomura 1962 und der Isolierung noch das breiteste Anwendungsspektrum und ist
der GFP-cDNA durch Prasher et al. 1992 sowie der nach wie vor beliebt. Häufig werden aber zusätz-
Einführung von GFP als leuchtenden Protein-Tag liche Fluorophore benötigt.
durch Chalfie 1997 hat sich die Markierung von Im blaugrünen Bereich gibt es das enhanced
Proteinen mit GFP und GFP-Varianten zu einer cyan fluorescent protein (ECFP). Heller und schnel-
Standardmethode entwickelt. Manch einer spricht ler faltend ist Cerulean, allerdings bleicht es schnel-
sogar von der »grünen Revolution«. GFP ist ein ler aus. Yellow fluorescent proteins (YFP) leuchten
fluoreszierendes Protein aus der Qualle Aequorea sehr hell, sind aber meist nicht sehr photostabil.
victoria. Wird GFP mit blauem Licht angeregt, so EYFP wurde vielfach benutzt, allerdings gibt es
strahlt es grünes Licht ab. Es wird für diese Re- immer mehr Experimentatoren, die mCitrine und
aktion keinerlei Substrat benötigt (7  siehe auch Venus favorisieren. Orange fluoreszierende Protei-
Kap. 4, Zelluläre Neurobiologie). Da es sich um ein ne passen von ihrem Exzitations- und Emissions-
Protein handelt, kann die GFP-cDNA einfach vor spektrum zu vielen Standardfiltern an Mikrosko-
oder hinter ein Gen kloniert und exprimiert wer- pen (entsprechen nahezu Tetramethyl-Rhodamin-
den. Es entsteht dann ein fluoreszierendes Fusions- isothiocyanat, TRITC, Filtern). Allerdings sind die
protein. Dies kann in allen Spezies gebildet werden, Namensgebungen häufig irreführend, so besitzen
von Bakterien, Hefen, Pflanzen und Tieren, und so- DsRed, TagRFP (Tag-Red-Fluorescent-Protein)
wohl in einzelnen Zellen in Kultur, als auch in Or- und tdTomato ein Emissionsprofil im orangen Be-
ganen oder gesamten Organismen zur Markierung reich und nicht wie die Namen vermuten lassen im
eingesetzt werden. roten. DsRed gilt als sehr schwach leuchtend (Sha-
60 Kapitel 3 • Analyse von Proteinen

ner et al., 2005). mOrange ist sehr hell leuchtend, Mit ihnen lässt sich z. B. die Sekretion an Synapsen
allerdings geht dies wiederum mit einer geringen verfolgen.
Stabilität einher. Zuletzt beschrieben wurden rote Ein Problem der fluoreszierenden Proteine
Fluorophore. Diese besitzen, im Vergleich zu den ist, dass viele bei einer Überexpression zum Ag-
meisten anderen, eine geringere Leuchtkraft. Ihr gregieren neigen können. Dies kann die Funktion
Vorteil besteht in der langwelligen Anregung. Das der Zelle beeinflussen. Wollen Sie die subzellulä-
3 Licht kann tiefer in Gewebe eindringen und erwei- re Lokalisation von Fusionsproteinen nachweisen,
tert insgesamt die Möglichkeiten für Mehrfachfär- so sollten Sie diverse Kontrollen durchführen, um
bungen. Die als gut funktionierend beschriebenen zu zeigen, dass beispielsweis durch Mutationen im
mStrawberry und mCherry (Emissions Maxima fusionierten Protein eine andere subzelluläre Loka-
bei 596 nm und 610 nm) gehören der so genannten lisation beobachtet wird oder mit anderen Protein-
Fruchtserie (Fruit Fluorescent Proteins) an. Diese Tags die gleiche Lokalisation zeigen.
wird durch mPlum ergänzt (Emissions Maximum Fluoreszierende Proteine lassen sich nicht nur
bei 649  nm), welches allerdings nicht sehr hell zur Lokalisation von Fusionsproteinen oder für
strahlt, dafür aber sehr stabil sein soll (Fruit Fluore- funktionelle Nachweise nutzen. Mit ihrer Hilfe ist
scent Proteins gibt es bei Clontech). es auch möglich Protein-Interaktionen in Zellen
Ein generelles Problem bei der Auswahl des nachzuweisen.
richtigen Farbstoffes ist häufig, dass bestimmte
Farbstoffe in der Literatur empfohlen werden, aber kFluoreszenz-Resonanz-Energie-Transfer (FRET)
kommerziell (noch) nicht zur Verfügung stehen. Beim Fluoreszenz-Resonanz-Energie-Transfer
Dies macht das Beschaffen der benötigten cDNA (FRET) wird Energie von einem fluoreszierenden
leider manchmal sehr mühsam. Im Anhang an die- Donor Molekül auf ein fluoreszierendes Akzeptor
ses Kapitel finden Sie einerseits Internetseiten, die Molekül übertragen (.  Abb.  3.13A). Der Prozess
auf die unterschiedlichen fluoreszenten Proteine wurde 1946 von Förster beschrieben und wird auch
eingehen, andererseits eine Liste von Firmen bzw. als Förster-Resonanz-Energie-Transfer-bezeichnet.
Internetseiten, die Vektoren für die aufgeführten Die Energie des angeregten Donorfluorophors
fluoreszierenden Proteine vertreiben. wird nicht in Form von Fluoreszenz abgegeben,
Egal welches Experiment Sie planen, versuchen ein Photon ist nicht beteiligt, sondern strahlung-
Sie für die jeweiligen Exzitations- und Emissions- slos über Dipol-Dipol-Wechselwirkungen auf den
profile möglichst optimale Filter zu verwenden. Akzeptor übertragen. Die Emission eines fluores-
Nicht nur bei Mehrfachfärbungen geben die opti- zierenden Akzeptors wird angehoben, indem das
malen Filter bessere Ergebnisse. Bei Mehrfachfär- Donormolekül angeregt wird. Gleichzeitig redu-
bungen sollten Sie außerdem darauf achten, dass ziert sich die Emission des Donormoleküls. FRET
die Emissionsspektra nicht überlappen. Weiterhin kann somit über eine Abnahme der Donorfluores-
gibt es eine neuere Generation von fluoreszieren- zenz oder eine Zunahme der Akzeptorfluoreszenz
den Proteinen, die entweder durch Licht von einem detektiert werden. Wie effizient die Energie dabei
nicht-fluoreszierenden Zustand in einen fluoreszie- übertragen wird, hängt vom Abstand von Donor
renden umgewandelt werden (Photoaktivierung) und Akzeptor ab. Die Intensität des FRET-Signals
oder die optisch konvertiert werden, von einer nimmt mit der 6. Potenz des Abstandes ab. Der
fluoreszierenden Form in eine andere (Photokon- Förster-Radius beschreibt den Abstand zwischen
version). Somit kann man fluoreszierende Protei- beiden Fluorophoren, bei dem die Energieübertra-
ne durch Bestrahlung mit Licht einer bestimmten gung eine Effizienz von 50  % hat. Je höher dieser
Wellenlänge »anschalten« oder ihre Farbe verän- Wert, desto größer ist der Abstand, über welchen
dern. Dies ermöglicht die Markierung bestimmter FRET detektiert werden kann. Der Förster-Radius
fluoreszierender Proteine und das Verfolgen ihres ist normalerweise kleiner als 7 nm und beträgt für
weiteren Verbleibs bzw. ihre Wanderung in der BFP-GFP 4 nm und für CFP-YFP 5 nm. Um eine
Zelle. Weiterhin gibt es pH-sensitive Varianten. Energieübertragung zu ermöglichen, muss das
Emissionsspektrum des Donors mit dem Absorp-
3.4 • Auffinden und Nachweisen von Proteininteraktionen
61 3
tionsspektrum des Akzeptors überlappen. Sehr gut Protein geteilt wird (splitting), bezeichnen einige
werden die FRET-Anforderungen von den fluores- Experimentatoren die Methode auch als Split-YFP.
zierenden Proteinpaarungen CFP-YFP, aber auch Meist wird EYFP verwendet und entweder
von BFP-GFP, erfüllt. Es gibt auch die Möglichkeit nach Aminosäure 155 oder 173 geteilt. So entstehen
mit fluoreszierenden Antikörpern zu arbeiten, z. B. die N-terminalen Hälften YN155 oder YN173 und
GFP-Cy3. Mit Hilfe der Fluoreszenzmikroskopie die C-terminalen Hälften YC155 und YC173. Die zu-
kann man FRET einfach nachweisen und messen. sammengelagerten EYFP-155-Fluorophore ergeben
Man sollte Band-Pass Filter verwenden, um die eine hellere Fluoreszenz. Andere Fragmente, wie
verwendeten Fluorophore klar unterscheiden zu die des fluoreszierenden Proteins Venus ergeben
können. FRET kann genutzt werden, um Inter- eine noch hellere Fluoreszenz, aber auch stärkere
aktionen zwischen zwei Proteinen nachzuweisen. Hintergrundsignale, deshalb wird von diesen ab-
Im Idealfall kann sogar der Abstand zwischen den geraten (Kerppola 2008). Man kann auch ECFP
Proteinen genau bestimmt werden. Hierzu wird verwenden und nach Aminosäure 155 teilen, es ent-
an das erste Protein ein Donorfluorophor und an stehen CN155 und CC155. Fusioniert man YN155,
das zweite Protein ein Akzeptorfluorophor gebun- CN155 und CC155 jeweils mit einem Protein, so gibt
den. Interagieren die beiden Proteine, so kann ein es die Möglichkeit konkurrierende Interaktionen,
FRET-Signal detektiert werden, das je nach Ab- die z.  B. auf unterschiedliche Kompartimente be-
stand der beiden modifizierten Proteine variiert. Je schränkt sind, zu visualisieren (mulitcolor fluore-
näher die Moleküle zueinander liegen, desto höher scence complementation). Denn bildet sich durch
ist die FRET-Effizienz. eine Proteininteraktion YN155/CC155, so wird
Mit der FRET-Technik erhält der Experimen- gelbe Fluoreszenz detektiert. Bildet sich CN155/
tator quantitative zeitliche und räumliche Informa- CC155, so wird blaugrüne Fluoreszenz detektiert
tionen über die Bindung und Interaktion zwischen (. Abb. 3.13C).
Proteinen in vivo. Indem man fluoreszierende Pro- Genau wie mit FRET, können auch mit BiFC
teine verwendet kann man mittels FRET, die Inter- Interaktionen in lebenden Zellen beobachtet wer-
aktion intrazellulärer Molekülgruppen in intakten den. Dadurch kann ausgeschlossen werden, dass
lebenden Zellen messen. Es gibt aber auch die die Interaktion auf Artefakten durch Zelllyse und
Möglichkeit FRET in fixierten Zellen zu analysie- das Mischen unterschiedlicher Kompartimente be-
ren. Durch die Verwendung von fluoreszenzmar- ruht. Die Verwendung lebender Zellen ermöglicht
kierten Antikörpern ist es außerdem möglich mit weiterhin die genaue Lokalisation der Interaktion.
dieser Methode posttranslationale Veränderungen, Somit vervollständigen diese Methoden die Mög-
wie Phosphorylierungen, nachzuweisen. lichkeiten Interaktionen zwischen Proteinen in vivo
zu untersuchen. Voraussetzung bei beiden Metho-
kBimolekulare Fluoreszenz-Komplementation den ist allerdings, dass die Fusionierung mit einem
(BiFC) fluoreszierenden Protein keinen negativen Effekt
Die Bimolekulare Fluoreszenz-Komplementation auf die Funktion oder Lokalisation der untersuch-
ähnelt FRET, weil die Methode ebenfalls die Inter- ten Proteine hat.
aktion zweier Proteine durch die Entstehung von
Fluoreszenz nachweist. Allerdings wird bei der
BiFC nur ein fluoreszierendes Protein exprimiert, 3.4.8 SPR-Analyse
dieses aber in zwei Hälften, die jede für sich nicht
fluoreszieren. Kommen beide Hälften zusammen, Wir sind in diesem Kapitel auf die verschiedenen
so geben sie ein fluoreszierendes Signal. Jede Hälfte Möglichkeiten eingegangen Interaktionen zwi-
wird mit einem Protein fusioniert. Interagieren die schen Proteinen zu finden und nachzuweisen.
Proteine, so bilden die beiden Hälften des fluores- Durch sie kann der Experimentator nur zeigen,
zierenden Proteins ein funktionelles Fluorophor dass eine Interaktion vorliegt. Aber es gibt unter-
und leuchten (. Abb. 3.13B ). Da das fluoreszierende schiedliche Arten von Interaktionen: funktionelle
und nicht-funktionelle, sowie hochaffine und nied-
62 Kapitel 3 • Analyse von Proteinen

A
FRET

YF
CFP CFP YFP

P
3

B
keine
Fluoreszenz

C
YN155 CC155 CN155

+ +

. Abb. 3.13 FRET und BiFC erlauben den Nachweis von Proteininteraktionen. (A) Zwei Fusionsproteine werden untersucht.
An das weiß dargestellte Protein ist der FRET-Donor (CFP) fusioniert, an das schwarz dargestellte Protein der FRET-Akzeptor
(YFP). Eine Anregung erfolgt mit Licht der Wellenlänge, die den Donor (CFP) anregt. Findet keine Proteininteraktion statt so
wird Donorfluoreszenz (CFP) emittiert. Interagieren die Proteine und bringen so die zwei Fluorophore nah genug, so kann
FRET entstehen und Akzeptorfluoreszenz (YFP) wird emittiert. (B) BiFC funktioniert ähnlich, allerdings sind an die relevanten
Proteine je zwei Hälften eines fluoreszierenden Proteins fusioniert. Nur wenn die relevanten Proteine interagieren kommen
die Hälften nah genug, so dass das fluoreszierende Protein Licht emittiert. (C) BiFC kann auch mit zwei alternativen Interak-
tionspartnern durchgeführt werden (multicolor fluorescence complementation). Das weiß dargestellte Protein kann alternativ
mit dem grau oder mit dem schwarz dargestellten Protein interagieren. In Abhängigkeit zum fusionierten fluoreszierenden
Protein wird entsprechendes Licht emittiert

rigaffine. Die meisten Experimentatoren suchen und wird durch die Dissoziationskonstante KD
hochaffine, funktionelle Interaktionen. Ob eine quantitativ erfasst. Je kleiner der KD-Wert ist, mit
Interaktion eine funktionelle Bedeutung hat, kann dem ein Ligand an eine Bindungsstelle bindet, des-
am besten durch in vivo-Methoden gezeigt werden. to höher seine Affinität. Hochaffin sind Bindungen
Die Affinität beschreibt die Stärke einer Bindung mit einem KD von 10 nM und kleiner. Die klassi-
Literatur und World-Wide-Web-Links
63 3
sche Methode, um die Affinität zu ermitteln, ist der welches reflektiert wird, hängt von der Masse von
Bindungstest. Das Protein wird mit einem radio- an der Dextran-Schicht gebundenen Molekülen ab.
aktiv markierten Liganden inkubiert. Der gebunde- So kann optisch die Bindung an den Sensorchip
ne Ligand wird vom ungebundenen Liganden ge- verfolgt werden und der Experimentator kann sehr
trennt. Dies kann durch Filtration, Zentrifugation schnell nachweisen welche Moleküle interagieren,
oder Absorption erfolgen. Nach der Quantifizie- sowie Affinität und Anzahl von Bindungsstellen
rung der Radioaktivität des gebundenen Liganden quantifizieren. Wer sich ausführlicher über die SPR
wird durch mathematische Verfahren (Hill-Blot, informieren möchte, dem sei die Web-Seite: http://
Scatchard-Plot) die Dissoziationskonstante und www.sprpages.nl/ empfohlen.
die Zahl der Bindungsstellen ermittelt. Bei einem Der Vorteil der Methode liegt in der Einfach-
Bindungstest muss das bindende Protein nicht voll- heit der Anwendung. Es werden nicht nur hoch-
ständig rein vorliegen, es kann sich z. B. um Mem- affine Bindungen erfasst, sondern auch Interaktio-
branfraktionen handeln. Jedem, der sich ausführ- nen niedriger Affinität. Im Gegensatz zum klassi-
licher über Bindungstests informieren möchte, sei schen Bindungstest ist SPR radioaktivitätsfrei. Man
die entsprechende und umfangreiche Abhandlung braucht nur ein paar Mikrogram seines Proteins
im Experimentator Proteinbiochemie empfohlen. und kann inzwischen sogar die Bindung sehr klei-
Als Alternative zu den Bindungstests hat sich ner Moleküle untersuchen, was früher bei der SPR
immer mehr die surface plasmon resonance (SPR) Analyse als unmöglich galt. Außerdem kann man
Analyse durchgesetzt. Die dazu benötigten und am mit dem Biosensor auch auf Hochdurchsatz-Scree-
häufigsten benutzten Geräte, Biosensoren, stam- nen sehr leicht die Pufferbedingungen ändern und
men ursprünglich von der schwedischen Firma so die Abhängigkeit der Bindung vom pH-Wert
BIAcore (inzwischen GE-Healthcare), deshalb be- oder anderen Variablen analysieren. Allerdings
zeichnen viele die Methode einfach nur als »Bia- scheinen Untersuchungen von schwer löslichen
core«. Hierbei werden häufig gereinigte Proteine Proteinen zum Teil problematisch zu sein. Außer-
eingesetzt und sehr reproduzierbare Ergebnisse dem muss natürlich überhaupt ein Biosensor zur
erzielt. Bei der SPR Analyse wird ein Bindungs- Verfügung stehen.
partner an einen Sensorchip kovalent gekoppelt.
Der Sensorchip besteht aus Glas und einer dün-
nen Goldschicht (48–50 nm) auf der sich eine ein- Literatur und World-Wide-Web-Links
schichtige Matrix befindet. Auf dieser befindet sich
Web Ressourcen:
eine Dextran-Schicht, die je nach Typ des Sensor-
Peptide und Antigene: http://immunax.dfci.harvard.edu/
chips, modifiziert ist. An diese Schicht wird der
Tools/antigenic.html
Bindungspartner an das carboxylierte Dextran Protein Sequenzdatenbanken: http://www.uniprot.org/
gekoppelt. Es gibt aber auch Chips, die Tags bin- Protein Sekundärstruktur: http://molbiol-tools.ca/Protein_
den und so heterolog exprimierte Proteine optimal secondary_structure.htm
präsentieren. Über den Sensorchip wird kontinu- Protein Familien, Domänen, Funktionelle Sites: http://www.
ebi.ac.uk/interpro/
ierlich Puffer gespült. So passiert der im Puffer ent-
Mammalian Protein-Protein Interaction Database: http://
haltene Bindungspartner diesen Sensorchip, asso- mips.gsf.de/proj/ppi
ziiert mit dem gebundenen Protein und dissoziiert Biomolecular Interaction Network Database: http://www.
wieder. Bei der Analyse wird der Brechungsindex bind.ca
des Lichtes, das auf den Sensorchip trifft, konti- Database of Interacting Proteins: http://dip.doe-mbi.ucla.
edu/dip/Main.cgi
nuierlich gemessen. SPR tritt auf, wenn Licht von
Two-Hybrid Analyse: http://www.fccc.edu/research/labs/
einem dünnen Film am Übergang zwischen zwei golemis/InteractionTrapInWork.html
Medien mit unterschiedlichen Brechungsindices Protein Netzwerke: http://www.cytoscape.org/
reflektiert wird. In den meisten Biosensoren ist der HUPO Brain Proteome Project: http://www.hbpp.org/
dünne Film die Goldschicht und das Glas und die Surface Plasmon Resonance: http://www.sprpages.nl/
BIAcore: http://www.biacore.com/lifesciences/index.html
Dextran-Schicht sind die zwei unterschiedlichen
Fluoreszente Proteine: http://www.microscopyu.com/
Medien. Der Brechungsindex und somit das Licht, articles/livecellimaging/fpintro.html
64 Kapitel 3 • Analyse von Proteinen

Fluoreszente Proteine: http://www.olympusfluoview.com/ signals and low background. J Immunol. Methods 318:
applications/fpcolorpalette.html 11–19
GFP: http://www.conncoll.edu/ccacad/zimmer/GFP-ww/ Kurien BT, Scofield RH (2003) Protein blotting: a review. J
GFP-1.htm Immunol. Methods 274: 1–15
FRET: http://zeiss-campus.magnet.fsu.edu/articles/
spectralimaging/spectralfret.html Immunipräzipitation:
BiFC: http://sitemaker.umich.edu/kerppola.lab/kerppola_ Bonifacino JS, Dell’Angelika EC (1998) Immunoprecipitation
3 lab_bifc Current Protocols in Cell Biology 7.2.1–7.2.21 John Wiley &
Sons, New York
Quellen für Fluoreszierende Protein (FP) cDNA: Elion EA (2006) Detection of Protein-Protein Interactions
http://www.addgene.org/ (Ein nonprofit Plasmid Archiv für by Coprecipitation. Current Protocols in Neuroscience
Wissenschaftler. Bietet zahlreiche Vektoren für FPs an.) 5.25.1–5.25.10 John Wiley & Sons, New York
http://www.allelebiotech.com/ (FPs: mTFP1, mWasabi) (Ver- Gersten DM, Marchalonis JJ (1978) A rapid, novel method
trieb Deutschland: http://www.biozol.com/) for solid-phase derivatization of IgG antibodies for
http://www.bdbiosciences.com/ (Baculovirus transfer Vekto- immune-affinity chromatography. J. Immunol. Methods
ren mit BFP und YFP Varianten.) 24: 305–309
http://www.clontech.com/ (»Living colors« FP Linie: AcGFP1, Springer TA (1996) Immunoprecipitation Current Protocols in
AmCyan1, AsRed2, DsRed2, DsRed-Express, DsRed-Mo- Immunology, John Wiley
nomer, HcRed1, ZsGreen1, ZsYellow1, mFruits.)
http://www.evrogen.com/ (»Turbo« und «Tag» FP Linien: Subzelluläre Fraktionierung
TurboGFP, YFP, RFP, FP602; TagCFP, GFP, YFP, RFP; PhiYFP, Breukel AIM, Besselsen E, Ghijsen WEJM (1997) Synaptoso-
JRed, TagRFP, mKate, dKatushka, PS-CFP2, Dendra2, mes, a model to study release of multiple classes of
KFP-Red, HyPer, KillerRed.) (Vertrieb Deutschlan: www. neurotransmitters. Methods Mol. Biol. 72:33–47
biocat.com) Carlin RK, Garb DJ, Cohen RS, Siekvitz P (1980) Isolation and
http://www.invitrogen.com/ (»Vivid colors« FP Linie: Eme- characterization of postsynaptic densities from various
rald, Topaz, CFP, BFP Cycle 3 GFP.) brain regions: enrichment of different types of postsyn-
http://www.lonzabio.com/ (»Amaxa« pmaxFP Linie: pmaxFP- aptic densities, J. Cell Biol. 86: 831–843
Green, pmaxFP-Yellow, pmaxFP-Yellow-m, pmaxFP-Red.) Hallet PJ, Collins TL, Standaert DG, Dunah AW (2008)
http://luxbiotech.com/ (»NanoLight« FP Linie: Renilla mulle- Biochemical fractionation of brain tissue for studies of
rei GFP, Ptilosarcus GFP, Renilla reniformis GFP.) (Vertrieb receptor distribution and trafficking Current Protocols in
Deutschland: http://www.pjk-gmbh.com) Neuroscience 1.16.1–1.16.16 John Wiley & Sons, New York
http://www.mblintl.com/ (»CoralHue» FP Linie: mAzami Hens JJH (1997) Preparation of synaptosomal plasma mem-
Green, mKusabira Orange, mKO2, Dronpa, Kaede, Kiku- branes by subcellular fractionation Methods Mol. Biol.
me Green-Red, Keima Red, Midoriishi-Cyan.) (Vertrieb 72:61–69
Deutschland: http://www.biozol.com/) Morciano M, Burré J, Corvey C, Karas M, Zimmermann H,
http://www.nanolight.com/ (»NanoLight« FP Linie: Renilla Volknandt W (2005) Immunoisolation of two synaptic
mullerei GFP, Ptilosarcus GFP, Renilla reniformis GFP.) vesicle pools from synaptosomes: a proteomic analysis,
http://las.perkinelmer.com/ (BRET2 assay Vektoren FP Linie: J. Neurochem. 95: 1732–1745
GFP2 humanized codon vectors.) Urlaub H, Gronberg M, Jahn R (2009) Synaptische Vesikel als
http://www.promega.com/ (»Monster green« FP Linie: Model, BioSpektrum 15: 16–19
phMGFP.)
http://www.stratagene.com/ (Vitality FP Vektoren: hrGFP Affinitäts-Tags:
and hrGFPII Nuc, Mito, Golgi, Peroxy.)
Fernandez, E. et al. (2009) Targeted tandem affinity purifica-
http://www.mobitec.de/ (EosFP – Green to Red Photocon-
tion of PSD-95 recovers core postsynaptic complexes
vertible FP)
and schizophrenia susceptibility proteins, Mol. Systems
Biology 5:1–17
Allgemein:
Gloeckner CJ, Boldt K, Ueffing M (2009) Strep/FLAG affinity
Luttmann et al (2009) Der Experimentator: Immunologie, 3. purification (SF-TAP) to study protein interactions,
Aufl, Spektrum Akademischer Verlag Current Protocols in Protein Science 19.20.1–19.20.19 John
Rehm/Letzel (2009) Der Experimentator: Proteinbiochemie/ Wiley & Sons, New York
Proteomics, 6. Aufl, Spektrum Akademischer Verlag Terpe K (2003) Overview of tag protein functions: from mo-
Tanford C, Reynolds JA (2003) Nature’s Robots: A History of lecular and biochemical fundamentals to commercial
Proteins, Oxford University Press systems. Appl. Microbiol Biotechnol 60:523–533

Western Blot:
Haan C, Behrmann I (2007) A cost effective non-commercial
ECL-solution for Western blot detections yielding strong
Literatur und World-Wide-Web-Links
65 3
Yeast-Two-Hybrid System:
Johnsson N, Varshavsky (1994) Split ubiquitin as a sensor
of protein interaction in vivio. Proc. Natl. Acad. Sci.
91:10340–10344.
Putz U, Skehel P, Kuhl D (1996) A tri-hybrid system for the
analysis and detection of RNA-protein interactions.
Nucleic Acids Res. 24:4838–4840.
Serebriiskii IG, Golemis EA (2001) Two-hybrid system and
false positive: Approaches to detection and elimination.
Methods Mol. Biol. 177:123–134.
Stagljar I, Korostensk C, Johnsson N, Te Heesen S (1998) A
genetic system based on split-ubiquitin for the analysis
of interactions between membrane proteins in vivo.
Proc. Natl. Acad. Sci. 95:5187–5192.

Fluoreszente Proteine:
Kerppola TK (2008) Bimolecular Fluorescence complementa-
tion (BiFC) analysis as a probe of protein interactions in
living cells. Annu. Rev. Biophys. 37:465–487.
Miesenböck G, De Angelis DA, Rothman JE (1998) Visualizing
secretion and synaptic transmission with pH-sensitive
green fluorescent proteins. Nature 394: 192–195
Prasher DC, Eckenrode VK, Ward WW, Prendergast FG,
Cormier MJ (1992) Primary structure of the Aequorea
Victoria green-fluorescent protein. Gene 111: 229–233.
Shaner NC, Steinbach PA, Tsien RY (2005) A guide to choo-
sing fluorsescent proteins. Nature Methods 2: 905–909
Shaner NC, Patterson GH, Davidson MW (2007) Advances in
fluorescent protein technology. J Cell Science 120:4247–
4260.
Wouters FS, Bastiaens PIH (2006) Imaging protein-protein
interaction by fluorescence resonance energy transfer
(FRET) microscopy. Current Protocols in Neuroscience
5.22.1–5.22.15 John Wiley & Sons, New York