Beruflich Dokumente
Kultur Dokumente
I ncluded w it h t h is b oo k
YOUR Guide to
I ncluded w it h t h is b oo k
DevBio Laboratory: Vade Mecum 3
labs.devbio.com 9
Designed to complement the textbook, this unique resource helps you understand the
organisms discussed in lecture and prepares you for the laboratory. DevBio Laboratory:
Vade Mecum3 is available online, which allows you the flexibility to use the software from
any computer or mobile device. The Genetics of
Over 140 interactive videos and 300 labeled photo- Axis Specification
in Drosophila
graphs take you through the life cycles of model organ-
isms used in developmental biology laboratories. The
easy-to-use videos provide you with the concepts, Opening Question
vocabulary, and motivation to enter the laboratory fully and Photo
prepared. A chapter on zebrafish addresses how to
raise the organism and the effects of various terato- Each chapter begins with
gens on embryonic development. The site also includes an intriguing question and THANKS LARGELY TO STUDIES spearheaded by Thomas Hunt Morgan’s laboratory
chapters on: the slime mold Dictyostelium discoideum; photo, encouraging your during the first two decades of the twentieth century, we know more about the genetics of
learning and discovery as Drosophila melanogaster than that of any other multicellular organism. The reasons have to
planarian; sea urchin; the fruit fly Drosophila melanogas- do with both the flies themselves and with the people who first studied them. Drosophila
the concepts unfold.
ter; chick; and amphibian. is easy to breed, hardy, prolific, and tolerant of diverse conditions. Moreover, in some
larval cells, the DNA replicates several times without separating. This leaves hundreds of
strands of DNA adjacent to each other, forming polytene (Greek, “many strands”) chro-
mosomes (FIGURE 9.1). The unused DNA is more condensed and stains darker than the
regions of active DNA. The banding patterns were used to indicate the physical location
ADDITIONAL FEATURES INCLUDE: of the genes on the chromosomes. Morgan’s laboratory established a database of mutant
strains, as well as an exchange network whereby any laboratory could obtain them.
n Movie excerpts from Differential Expressions 2: n Laboratory Manual: The Third Edition of Mary Historian Robert Kohler noted in 1994 that “The chief advantage of Drosophila initially
was one that historians have overlooked: it was an excellent organism for student proj-
Short video excerpts about key concepts in S. Tyler’s laboratory manual, Developmental ects.” Indeed, undergraduates (starting with Calvin Bridges and Alfred Sturtevant) played
development Biology: A Guide for Experimental Study, important roles in Drosophila research. The Drosophila genetics program, says Kohler, was
“designed by young persons to be a young person’s game,” and the students set the rules
n PowerPoint® slides of chick wholemounts and designed for use with the multimedia chapters for Drosophila research: “No trade secrets, no monopolies, no poaching, no ambushes.”
serial sections for self-quizzing and creating tests of DevBio Laboratory: Vade Mecum3 What changes in
Jack Schultz (originally in Morgan’s laboratory) and others attempted to relate the
The Punchline
burgeoning supply of data on the genetics of Drosophila to its development. But Drosophila
development caused
n Study Questions was a difficult organism on which to study embryology. Fly embryos proved complex
n Full video instruction on histological techniques this fly to have four Herenor
and intractable, being neither large enough to manipulate experimentally you will be clearly
transparent and
n Laboratory Skills Guides wings instead of two? quickly guided toward the
n Glossary: Every chapter of the Laboratory big principles that will be
Manual includes an extensive glossary. exemplified in the chapter.
The Punchline
The development of the fruit fly is extremely rapid, and its body axes are specified
by factors in the maternal cytoplasm even before the sperm enters the egg. The
To access DevBio Laboratory: Vade Mecum 3:
anterior-posterior axis is specified by proteins and mRNAs made in maternal nurse
3
1. Retrieve your VM registration code from your ebook bookshelf. Click here for directions. cells and transported into the oocyte, such that each region of the egg contains
different ratios of anterior- and posterior-promoting proteins. Eventually, gradients
2. Go to http://labs.devbio.com. of these proteins control a set of transcription factors—the homeotic proteins—that
specify the structures to be formed by each segment of the adult fly. The dorsal-
3. Click “Register Using a Registration Code”, and follow the instructions to create an account. ventral axis is also initiated in the egg, which sends a signal to its surrounding
4. Login at http://labs.devbio.com using your email and new password. follicle cells. The follicle cells respond by initiating a molecular cascade that leads
both to cell-type specification and to gastrulation. Specific organs form at the
intersection of the anterior-posterior axis and the dorsal-ventral axis.
Important Note: Each code is valid for only one registration. New registration codes
can be purchased online at labs.devbio.com.
YOUR Guide to
I ncluded w it h t h is b oo k
Developmental Biology
9
The Genetics of
Axis Specification
Opening Question
in Drosophila
and Photo
Scientists Speak (A) Antenna (B) fIgurE 9.26 (A) Head of a wild-type
fruit fly. (B) Head of a fly containing the
Antennapedia mutation that converts
antennae into legs. (A © Eye of Science/
In these interviews, Science Source; B © Science VU/Dr. F.
Rudolph Turner/Visuals Unlimited, Inc.)
emerging topics in
developmental biology
are discussed by lead-
ing experts in the field.
can be detected in specific regions of the embryo (see Figure 9.24B) and are especially developing Questions
prominent in the central nervous system.
Homeobox genes specify
the anterior-posterior body
SCIENTISTS SPEAK 9.3 Listen to this interview with Dr. Walter Gehring, who
axis in both Drosophila and
Web Topic spearheaded investigations that unified genetics, development, and evolution,
leading to the discovery of the homeobox and its ubiquity throughout the animal
humans. How come we do
not see homeotic mutations
kingdom. that result in extra sets of
limbs in humans, as can
Here you are provided with WEb Topic 9.5 INITIATIoN ANd mAINTENANCE of homEoTIC gENE ExPrES- happen in flies?
more information about SIoN Homeotic genes make specific boundaries in the Drosophila embryo. Moreover,
the protein products of the homeotic genes activate batteries of other genes, specifying
cutting-edge topics, as well as the segment.
This feature provides SCIENTISTS SPEAK 9.4 Two videos featuring Dr. Trudi Schupbach
Next Step Investigation
show how the anchoring and regulation of the Gurken protein are
insights into some of accomplished in the Drosophila embryo.
The precision of Drosophila transcription patterning is gene expression, and they may cooperate (B) or compete with
the field’s greatest remarkable, and a transcription factor may specify whole the main enhancer. Some of these shadow enhancers may
fIgurE 9.27 Expression of Gurken between the oocyte nucleus and the
challenges, inspiring regions or small parts. Some of the most important work under particular physiological stresses. New studies
dorsal anterior cell membrane. (A) The gurken mRNA is localized between the
regulatory genes in Drosophila, such as the gap genes, are showing that the robust phenotypes of flies may result
curiosity and further oocyte nucleus and the dorsal follicle cells of the ovary. Anterior is to the left;
have been found to have dorsal
“shadow enhancers,” secondary
faces upward. (B) A more mature oocyte from an entire
shows Gurkenseries of (yellow)
protein secondary enhancers that are able
enhancers that may be quite distant fromregion.
the gene. is stained red,toshowing
ActinThese improvise for differentAsconditions (Bothma et al. 2015).
exploration. across
shadow enhancers seem oocyte
the dorsal
to be critical
grows,for thecells
follicle fine-tuning of
migrate across
cell boundaries.
the top of the oocyte, where they
the
Closing Thoughts appendages follow similar rules for their extension. We now know that many mutations affecting segmentation
of the adult fly in fact work on the embryonic modular unit, the parasegment (see pp. 234 and 240). You should
on the Opening keep in mind that, in both invertebrates and vertebrates, the units of embryonic construction often are not the
same units we see in the adult organism. (Photograph courtesy of Nipam Patel.)
Photo
Snapshot Summary
Coming full circle, this 9 Snapshot Summary
This closing feature provides
feature relates chapter Drosophila Development and Axis Specification
Gilbert Developmental Biology 11/e
you with a step-by-step break-
concepts back to the 1. Drosophila cleavage is superficial. The nuclei divide 13 • There is a temporal order wherein different classes of
Gil_DevBio11e_09.27
times before forming cells. Before cell formation, the
down of the chapter text.
genes are transcribed, and01/19/16
the products of one gene
Opening Question and nuclei reside in a syncytial blastoderm. Each nucleus is often regulate the expression of another gene.
surrounded by actin-filled cytoplasm. • Boundaries of gene expression can be created by
Photo. 2. When the cells form, the Drosophila embryo undergoes the interaction between transcription factors and
a mid-blastula transition, wherein the cleavages become their gene targets. Here, the transcription factors
asynchronous and new mRNA is made. At this time, transcribed earlier regulate the expression of the next
there is a transfer from maternal to zygotic control of set of genes.
development. • Translational control is extremely important in the
3. Gastrulation begins with the invagination of the most early embryo, and localized mRNAs are critical in
ventral region (the presumptive mesoderm), which patterning the embryo.
causes the formation of a ventral furrow. The germ band • Individual cell fates are not defined immediately.
expands such that the future posterior segments curl just Rather, there is a stepwise specification wherein
behind the presumptive head. a given field is divided and subdivided, eventually
regulating individual cell fates.
4. The genes regulating pattern formation in Drosophila
operate according to certain principles: 5. Maternal effect genes are responsible for the initiation
All Web Topics, Dev Tutorials, Watch Development, and Scientists Speak
• There are morphogens—such as Bicoid and
Dorsal—whose gradients determine the specification
of anterior-posterior polarity. bicoid mRNA is bound by
its 3′UTR to the cytoskeleton in the future anterior pole;
nanos mRNA is sequestered by its 3′UTR in the future
of different cell types. In syncytial embryos, these
morphogens can be transcription factors. posterior pole. hunchback and caudal messages are
seen throughout the embryo.
enough to observe microscopically. It was not until the techniques of molecular biol-
ogy allowed researchers to identify and manipulate the insect’s genes and RNA that
its genetics could be related to its development. And when that happened, a revolution
occurred in the field of biology. This revolution is continuing, in large part because of
the availability of the complete Drosophila genome sequence and our ability to generate
transgenic flies at high frequency (Pfeiffer et al. 2009; del Valle Rodríguez et al. 2011).
Researchers are now able to identify developmental interactions taking place in very
small regions of the embryo, to identify enhancers and their transcription factors, and
Vade Mecum to mathematically model the interactions to a remarkable degree of precision (Henge-
Gilbert Developmental Biology 11/e
nius et al. 2014).
Gil_DevBio11e_09.01
01/19/15
This interactive website Early Drosophila Development
will help you understand We have already discussed the specification of early embryonic cells by cytoplasmic
determinants stored in the oocyte. The cell membranes that form during cleavage
the organisms discussed establish the region of cytoplasm incorporated into each new blastomere, and the mor-
in the course, preparing phogenetic determinants in the incorporated cytoplasm then direct differential gene
expression in each cell. But in Drosophila development, cell membranes do not form
you for the lab. until after the thirteenth nuclear division. Prior to this time, the dividing nuclei all
share a common cytoplasm and material can diffuse throughout the whole embryo.
vaDE mEcUm
The specification of cell types along the anterior-posterior and dorsal-ventral axes is
The fruit fly chapter has remark- accomplished by the interactions of components within the single multinucleated cell.
able time-lapse sequences, Moreover, these axial differences are initiated at an earlier developmental stage by the
including footage of cleavage position of the egg within the mother’s egg chamber. Whereas the sperm entry site may
and gastrulation. This chapter
fix the axes in nematodes and tunicates, the fly’s anterior-posterior and dorsal-ventral
also provides access to the fly
axes are specified by interactions between the egg and its surrounding follicle cells
Watch Development life cycle.
prior to fertilization.
Putting concepts into action, Watch DEvElopmEnt 9.1 The website “The Interactive Fly” features movies illustrat-
ing all aspects of Drosophila development.
these informative videos show
you real-life developmental
biology processes.
143 Chapter 5
1
There are many different stem cells and so their status as “undifferentiated” really only per-
tains to the retained ability to divide, but they are in fact a defined cell type.
Scott F. Gilbert
Swarthmore College and the University of Helsinki
Michael J. F. Barresi
Smith College
Printed in U.S.A.
5 4 3 2 1
To Daniel, Sarah, David, and Natalia
S. F. G.
To Scott Gilbert
who offered me this opportunity.
&
To my family, Heather, Samuel, Jonah, Luca, and Mateo
who enabled me to take advantage of this opportunity.
M. J. F. B.
Brief Contents
IV Building with Ectoderm: The Vertebrate Nervous System and Epidermis
Chapter 13 Neural Tube Formation and Patterning 413
Chapter 18 Intermediate and Lateral Plate Mesoderm: Heart, Blood, and Kidneys 581
Chapter 20 The Endoderm: Tubes and Organs for Digestion and Respiration 653
Chapter 22 Regeneration 693
Chapter 25 Development and the Environment: Biotic, Abiotic, and Symbiotic Regulation of Development 763
Chapter 1 Chapter 2
Making New Specifying Identity:
Bodies: Mechanisms Mechanisms of
of Developmental Developmental
Organization 1 Patterning 29
Stem Cells Fueling the Diverse Cell Lineages in Adult Other stem cells supporting adult tissue maintenance
Blood 161 and regeneration 165
The hematopoietic stem cell niche 161 The Human Model System to Study Development and
Regulatory mechanisms in the endosteal niche 163 Disease 167
Regulatory mechanisms in the perivascular niche 163 Pluripotent stem cells in the lab 167
The Mesenchymal Stem Cell: Supporting a Variety of Induced pluripotent stem cells 171
Adult Tissues 164 Organoids: Studying human organogenesis in a culture
Regulation of MSC development 165 dish 174
Stem Cells: Hope or Hype? 176
Chapter 7
Chapter 6 Fertilization:
Sex Determination Beginning a New
and Gametogenesis 181 Organism 217
Chapter 11
Amphibians Chapter 12
and Fish 333 Birds and Mammals 379
Chapter 15
Chapter 13 Neural Crest
Neural Tube Formation Cells and Axonal
and Patterning 413 Specificity 463
Adhesive specificities in different regions of the optic Formation of the Eye Field: The Beginnings of the
tectum: Ephrins and Ephs 506 Retina 521
Synapse Formation 508 The Lens-Retina Induction Cascade 523
A Program of Cell Death 509 Lens and cornea differentiation 525
Activity-dependent neuronal survival 511 Neural retina differentiation 526
Differential survival after innervation: The role of The Epidermis and Its Cutaneous
neurotrophins 511 Appendages 528
Origin of the Epidermis 528
The Ectodermal Appendages 529
Recombination experiments: The roles of epithelium and
Chapter 16 mesenchyme 530
Ectodermal Placodes and Signaling pathways 531
the Epidermis 517 Ectodermal appendage stem cells 533
Coda 537
Migration of the cardiac precursor cells 596 Turing’s model: A reaction-diffusion mechanism of
Initial heart cell differentiation 599 proximal-distal limb development 631
Blood Vessel Formation 601 Specifying the Anterior-Posterior Axis 635
Vasculogenesis: The initial formation of blood vessels 601 Sonic hedgehog defines a zone of polarizing activity 635
Angiogenesis: Sprouting of blood vessels and remodeling Specifying digit identity by Sonic hedgehog 636
of vascular beds 604 Sonic hedgehog and FGFs: Another positive feedback
Anti-angiogenesis in normal and abnormal loop 639
development 605 Hox specification of the digits 640
Hematopoiesis: Stem Cells and Long-Lived A Turing model for self-organizing digit
Progenitor Cells 605 skeletogenesis 642
Sites of hematopoiesis 606 Generating the Dorsal-Ventral Axis 644
The bone marrow HSC niche 608 Cell Death and the Formation of Digits and
Hematopoietic inductive microenvironments 609 Joints 645
Coda 610 Sculpting the autopod 645
Forming the joints 646
Continued limb growth: Epiphyseal plates 647
Fibroblast growth factor receptors: Dwarfism 648
Chapter 19 Evolution by Altering Limb Signaling Centers 649
Development of the
Tetrapod Limb 613
Chapter 20
Limb Anatomy 613 The Endoderm:
The Limb Bud 614 Tubes and Organs
Hox Gene Specification of Limb Skeleton for Digestion and
Identity 616 Respiration 653
From proximal to distal: Hox genes in the limb 616
From fins to fingers: Hox genes and limb evolution 617
Determining What Kind of Limb to Form and Where The Pharynx 655
to Put It 619 The Digestive Tube and Its Derivatives 657
Specifying the limb fields 619 Specification of the gut tissue 658
Induction of the early limb bud 620 Accessory organs: The liver, pancreas, and
Outgrowth: Generating the Proximal-Distal Axis of gallbladder 660
the Limb 625 The Respiratory Tube 666
The apical ectodermal ridge 625
Specifying the limb mesoderm: Determining the
proximal-distal polarity 627
Heterochrony 795
Heterometry 796
Chapter 26 Heterotypy 798
Development and Developmental Constraints on Evolution 799
Evolution: Developmental Selectable Epigenetic Variation 801
Mechanisms of Evolutionary Genetic assimilation 804
Change 785 Fixation of environmentally induced phenotypes 806
Coda 807
Descent with Modification: Why Animals Are Alike
and Different 786 Glossary G-1
Preconditions for Evolution: The Developmental
Structure of the Genome 786
Author Index AI-1
Modularity: Divergence through dissociation 787 Subject Index SI-1
Molecular parsimony: Gene duplication and
divergence 789
Deep Homology 792
Mechanisms of Evolutionary Change 793
Heterotopy 794
From the Authors
From Scott Gilbert adult cells are its descendants. The techniques of computer-
A BIOLOGIST, A PHILOSOPHER, AND A THEOLOGIAN enhanced visualization have given scientists amazing new
WALK INTO A BAR. Yes, it actually happened, in the chill of technologies to see embryonic development.
a winter night in Finland! A group of enthusiastic people lis- A fourth difference is the idea that animal development,
tened as the moderator asked what each of them considered to even that of mammals, is significantly influenced by the envi-
be the most important story people need to know. The Chris- ronment. The data that have accumulated for developmental
tian theologian said that the most important story was salva- plasticity and the roles of microbes in normal development
tion through God’s grace. The analytic philosopher disagreed, have increased remarkably over the past several years.
saying that the most important story for mankind was that of Finally, a fifth difference concerns the way science is taught.
the Enlightenment. The developmental biologist knew that he The “sage on the stage” model, where lectures generate the
was supposed to say “evolution.” But evolution is the conse- flow of information down a gradient from higher concentra-
quence of another, more fundamental story. So the biologist tion to lower, has been supplemented by the “guide on the
claimed that most inspiring and meaningful story was how the side.” Here, the professor becomes a facilitator or capacitator
embryo constructs itself. You pass from unformed zygote to the of discussion while the students are encouraged to discover the
adult organism with its heart, brain, limbs, and gut all properly information for themselves.
differentiated and organized. It is a story of how newness is Indeed, education is sometimes referred to as “develop-
created, how one keeps one’s identity while building oneself, ment,” and there are many similarities between education
and how global forces and local forces work together to gener- and embryology. The two fields have exchanged metaphors
ate a functional entity. This is the story we tell in this book. constantly for the past two centuries, and two German words
In the Ninth and Tenth editions of Developmental Biology, we that have been used for both development and education—Bil-
speculated that the study of animal development was undergo- dung and Entwicklung—connote education by experience and
ing metamorphosis. The field has not reached the climax phase education by instruction, respectively. Both work in different
yet, but certain differences between the previous edition and situations. So in this edition of Developmental Biology, we have
one in your hands (or on your screen) are definitely appar- tried to facilitate those professors who wish to experiment with
ent. The first can be seen on the cover. Developmental biology different teaching methods. As in embryology, we don’t expect
has been charged with a huge undertaking—nothing less than one method to be best for all occasions.
discovering the anatomical and genetic bases of neural orga- To all these ends, this book has metamorphosed to embrace a
nization and behaviors. This task was part of developmental co-author. Michael J. F. Barresi is expert in all these areas of stem
biology when it was reformulated in the early 1900s (especially cells, developmental neurobiology, and new techniques of learn-
by the American C. O. Whitman), but it had dropped out of ing and teaching. It’s been 30 years since the first edition of this
the portfolio as being “too complicated” and not amenable book was published, and I wanted a young professor to recon-
for study. Today, however, developmental neurobiology is an figure this book into a learning tool that a new generation of
increasingly large part of developmental biology. Among many teachers could use to inspire a new generation of students. Enter
other things, developmental biology is becoming necessary for Michael. Michael did not want just cosmetic changes in the book.
cognitive science. He proposed a radical re-envisioning of its mission: to educate
The second difference between this and previous editions is students to appreciate and participate in developmental biology.
the prominence of stem cells. From being a small area of devel- Michael convinced us that we needed to rearrange the order
opmental biology, stem cell research has grown so fast as to have of the chapters, add some chapters and shorten others, alter
its own scientific societies. Not only do stem cells provide expla- the ways that the material is presented within the chapters,
nations for organ development, they also hold the tantalizing and give all chapters more supplemental material for “flipped”
possibility of organ regeneration. Recent work, detailed in this classes, case studies, and other means of learning. The extra
book, shows how knowledge of developmental biology has been thought and effort that went into incorporating Michael’s new
critical in turning adult cells into stem cells that can functionally approaches have clearly been worth it.
replace missing and damaged tissue in laboratory animals. One other thing that has changed in the past decade is
A third difference is the incredible revolution in lineage the realization of how much our understanding of biology
studies made possible by in vivo labeling. We can look at each depends on our knowledge of development. If “nothing in biol-
cell developing in an early, living, embryo and discern which ogy makes sense except in the light of evolution,” we now find
xviii From the Authors
that “nothing in morphological evolution makes sense without The developmental biology stem cell produces new disci-
knowledge of development.” Changes in adult anatomy and plines even as it keeps its own identity. The field of stem cell
physiology are predicated on changes in morphogenesis and biology is directly linked to its parent discipline, and new stud-
differentiation during development. ies (many of them documented in this text) show how directing
This is also true of the history of biology, where developmen- stem cells to differentiate in particular ways demands knowl-
tal biology can be seen to play the unique role of “the stem cell of edge of their normal development.
biological disciplines,” constantly regenerating its own identity Developmental biology interacts with other disciplines to
while simultaneously producing lineages that can differentiate induce new ways of thinking. Ecological developmental biol-
in new directions. As Fred Churchill noted, cell biology “derived ogy, for instance, looks at the interactions between developing
from descriptive embryology.” The founders of cell biology were organisms and their abiotic and biotic environments. Even the
each trying to explain development, and their new conception field of paleontology has been revolutionized by developmental
of the cell helped them do it. The original theories of evolution perspectives that allow new and often surprising phylogenies
concerned themselves with how new variants arose from the to be constructed.
altered development of ancestors. Charles Darwin’s friend and In short, this is an exciting time for this textbook to promote
champion Thomas Huxley, expanded on this idea, which would an interactive way of perceiving and studying the natural world.
eventually flourish into the field of evolutionary developmental Pascal wrote that science is like a balloon expanding into the
biology. unknown. The more that we know, the greater the area in con-
Also during this Victorian age, a variant of developmental tact with the unknown. Developmental biology is a discipline
biology grew to become the field of immunology. Elie Metchnikoff where the unknown contains important questions yet to be
(who showed the pole cells of flies to be germ cell precursors answered, with new techniques and ideas for those ready to try.
and who studied gastrulation throughout the animal kingdom)
proposed a new cell theory of immunology in his attempt to find Acknowledgments
universal characters of the embryonic and larval mesoderm. It is becoming increasingly difficult to distinguish between
Similarly, but with more anguish, genetics directly descended an author, a curator, and a “nexus” in a node-link diagram.
from a generation of embryologists who dealt with whether the This book is a developing and symbiotic organism whose
nucleus or cytoplasm contained the determinants of embryonic acknowledgments must either be confined to an inner layer
development. Before his association with Drosophila, Thomas or else expand throughout the world. First and foremost, I sin-
Hunt Morgan was a well-known embryologist who worked on cerely acknowledge that without Michael Barresi’s enthusiasm,
sea urchin embryos, wrote a textbook on frog development, and expertise, and passion for this project, this edition of the book
was an authority on regeneration. Many of the first geneticists would not exist.
were originally embryologists, and it was only in the 1920s that The Sinauer Associates team, headed by Andy Sinauer and
Morgan formally separated the two fields. And regeneration is Rachel Meyers, has been remarkable. I have been incredibly
still intimately linked with development, for regeneration often is privileged over the years to work with Sinauer Associates. I
a recapitulation of embryonic processes. Ross Granville Harrison am also lucky to have had my words, sentences, and para-
and Santiago Ramon y Cajal founded the science of neurobiology graphs, rearranged, reordered, and realigned by Carol Wigg,
by showing how the brain and axons develop. To this day, neu- who has worked with me on all eleven editions to communi-
rology requires an understanding of the developmental origins cate the wonder of developmental biology in prose that is as
of the central and peripheral nervous systems. clear, accessible, and enjoyable for students as we can possibly
Several medical disciplines descend from embryology. Tera- make it.
tology (the study of congenital anomalies) has always studied This is a beautiful book, and I can say that because it is not
altered or disrupted development, but other medical disciplines my doing. It is due to talent of Chris Small and his production
also trace back to embryology. Cancer biology—oncology— staff; to Jefferson Johnson and his artistic mastery of Adobe
derives from developmental biology, as cancers have long been InDesign; to the expertise of the artists at Dragonfly Media
perceived and studied as a cell’s reversion to an embryonic Graphics; and to photo editor extraordinaire David McIntyre,
state. Although this view was at one time eclipsed by a strictly who manages to find incredible photographs to complement
genetic view of cancer, today it is being revived and revised by the many wonderful images my colleagues have so generously
the discoveries of cancer stem cells, paracrine factor regula- supplied for each edition.
tion of tumor initiation, and embryonic modes of cell migration I have been blessed with remarkable students who have
used by tumor cells. Medical disciplines such as cardiology and never been shy about asking me questions. Even today they
diabetes research are being invigorated by new developmental continue to send me “Did you see this?” emails that make sure
perspectives. And the new fields of endocrine disruption and I’m keeping current. I also thank all those people who continue
the developmental origin of health and disease, looking at how to send me emails of encouragement or who come up to me at
environmental factors experienced during pregnancy can alter meetings to pass on good words about the book and provide
adult phenotypes, have emerged from developmental biology me with even more information. This book is, and always has
with their own paradigms and rules of evidence. been, a community endeavor.
From the Authors xix
My wife, Anne Raunio, has put up with my textbook writing for underprepared students (Waldrop 2015; Freeman et al.
for most of our married life, and I know she’ll be glad that this 2014; Michelene et al. 2014). I want my students and yours to
edition is finished. Indeed, just as this book goes to press our learn the core concepts in developmental biology not by sim-
lives have shifted greatly with our move away from Swarth- ply memorizing the text or stressfully scribing bullets off of a
more. I would certainly be remiss if I didn’t acknowledge the PowerPoint, but by experiencing how these concepts can explain
many years of support I have enjoyed at Swarthmore College, known and unknown phenomena of development. How can a
a wonderful academic institution that deems textbook writ- textbook adapt to (1) support teachers in implementing effec-
ing a service to the scientific community and that encourages tive active learning approaches, and (2) encourage students to
interdisciplinary ventures. become active learners?
—S.F.G. Carrying out effective active learning exercises in class that
target concept acquisition and problem solving skill devel-
opment is challenging. Potential challenges include a lack
From Michael Barresi of activities to offer students and a lack of training on behalf
A NEUROSCIENTIST, AN ECO-EVO-DEVO BIOLOGIST, AND of the instructor to administer those exercises, a shortage of
A DEVELOPMENTAL BIOLOGIST WALK INTO A POOL. Yes, available class time (real or perceived), student reluctance to
it actually happened, on a scorching hot summer day in Cancun, participate in novel and challenging activities, uneven pre-
Mexico! It was at the first Pan American Society for Develop- paredness by students, and a whole range of associated fears.
mental Biology Conference when Scott Gilbert mentioned to We have transformed the Eleventh Edition of Developmental
Kathryn Tosney and me that he was considering a co-author for Biology to support a movement in pedagogy toward an active
the upcoming Eleventh Edition of Developmental Biology. While I experience for both the professor and student. For many of
waded in the water next to two of my heroes, Scott asked wheth- the chapters, Scott Gilbert and I have written and produced
er I might be interested in such an opportunity. “Dev Tutorials,” short (10–20 minutes) video recordings of
A combination of shock, excitement, and fear set in, pretty us explaining some of the basic principles of development.
much in that order. Shock, because I was in wonderment of These professionally produced videos are designed to deliver
how I could be considered; after all, I had neither published some basic amount of content outside of class, thus providing
a dozen papers a year nor had the historical perspective and instructors with a mechanism to conduct a “flipped” classroom
cultural scope that Scott has woven so intricately and uniquely (see Seery 2015).
through each edition. Excitement, because this textbook has To satisfy the in-class half of the “flipped” classroom, we
had such a great impact on my life. The chance to be part of wrote a set of case study problems that accompany the “Dev
a book that has been with me throughout my entire science Tutorials” to encourage team-based learning approaches. Prior
education would be a true honor. Then fear set in because, as it to conducting a case study activity, consider asking students to
does to me, this book means so much to so many in this field. read the “Punchline” for a specific chapter as well as watching
The undertaking required to maintain the standard that Scott the related “Dev Tutorial.” Completing this won’t take students
Gilbert has set for this work was daunting. However, if there very long, so instructors can expect that each student will
is one thing I have learned in 11 years as a college professor, walk into class with a baseline of content exposure sufficient
it is that fear can be the most significant barrier to innovative to actively engage in solving the case study. We intend to add
teaching and learning. more “Dev Tutorials” and “Case Studies” in the future, as user
I agreed to be Scott’s co-author because it presented an interest demands. We are excited to see how “Dev Tutorials”
opportunity to influence how this subject is taught around the and case study problems can be tailored to meet the learning
world. My enthusiasm for all aspects of the book is limitless, objectives of your own courses, and I, in particular, welcome
and I am passionately committed to improving the learning the chance to work with faculty to help support their imple-
experience for all students. There is certainly no replacing Scott mentation of these new active learning resources.
Gilbert, and I do not pretend to be Scott’s equivalent. What I Traditionally, the role of a textbook has been to introduce
can offer to this and future editions of Developmental Biology is a students to the core concepts of a given field; however, I don’t
complementary approach that builds upon Scott’s accuracy and feel this should be its only role. Textbooks can take advantage
style with increased creativity and an overarching philosophy of the fact that, usually, the student is reading about the subject
of student empowerment to learn about developmental biology. for the first time. This is the moment to capture a student’s
The textbook and the classroom have something in com- inquisitive spirit, build their confidence in discussing and ask-
mon. Neither can survive this digital age as a mere vessel for ing questions about the subject, and fuel their future learning
information: pages of dense content paired with even denser through a determined ownership of their place in the field.
lectures are not effective methods for “deep” learning. There Gaining a sense of identity in a particular field of science often
is overwhelming evidence that true active learning pedago- begins with the ability to engage in a dialogue. Unfortunately,
gies provide the most effective gains in conceptual under- for a student learning “the facts” for the first time, one of the
standing, longer retention of material, better problem-solving most difficult barriers is being able to articulate the questions
abilities, and greater persistence in STEM majors, particularly that would open up a substantive conversation.
xx From the Authors
Several unique mechanisms in the Eleventh Edition are I have been continually amazed by the stellar team at Sinauer
intended to empower students to engage actively with the field Associates, Publishers. I have been humbled by Andy Sinauer’s
of developmental biology. The “Developing Questions” found complete acceptance of me into this family. His open-minded
throughout each chapter function as suggested extensions and consideration of all of my ideas was a critical factor in my accep-
potential areas of future research on the topics being covered, tance to co-author this great book; thank you Andy for your
and indirectly provide a model for the type of thinking and support, and for compiling the most amazing staff! First Azelie
questions that developmental biologists might ask. These ques- Aquadro Fortier and then Rachel Meyers oversaw the entire pro-
tions would be a huge success if students repeated them in class duction of this edition, and both provided this new co-author
as a sort of ice-breaker to begin or further the discussion, or nothing but genuine encouragement and support at all times.
used them as entry points for supplemental literature research Carol Wigg, Sydney Carroll, and Laura Green worked together
on their own. Most of these questions do not have definitive to provide the precise editorial eyes needed, especially for this
answers. Sorry, but they are designed to spur interaction in the tired, father-of-four, first-time author. Your determination and
classroom and engage students with the actual research. The equally long hours on this project produced a new edition that I
potential of the thrill of discovery to motivate student interest know I can only be proud of because of your contributions.
cannot be underestimated. And students know the difference I sincerely appreciate the vast amount of energy and time
between quiz questions and life questions. To that end, each Sinauer’s art director Chris Small and the entire group at Drag-
chapter ends with a “Next Step Investigation”; these play a simi- onfly Media Graphics took to produce such a beautiful art pro-
lar role to the “Developing Questions,” except they attempt to gram. They also had to deal with me, an overprotective visu-
present a broader view of the directions the field may be moving al artist who was likely too critical to changes to his original
in. The hope is that students can use “Next Step Investigations” drawings! Thanks for your patience. I’d also like to thank Chris
as logical entry points for their own research. again, as well as Joanne Delphia and Jefferson Johnson, for their
One other objective for the Eleventh Edition has been to excellent design and layout of the book. David McIntyre, thank
introduce the actual voices of the biologists working today. “Sci- you for your help in researching and obtaining the many new
entists Speak” is a new resource linked throughout the textbook photographs.
to provide students (and faculty) with direct access to recorded A new book can only reach the hands of the students with
conversations with leading developmental biologists. Many of the help of strategic marketing, and Dean Scudder, Marie Sca-
these discussions took place between the lead investigators from votto, and Susan McGlew have been remarkable in highlight-
current and seminal papers and my own students at Smith Col- ing all of the new features. I thank you for always managing to
lege through web conferencing technology. For students, the present this new author in the best light. Jason Dirks and all of
unique benefit of this type of resource is a highly approachable the people working in Sinauer’s Media and Supplements depart-
dialogue with the scientists combined with a fantastic array of ment deserve a special thanks for designing an appealing web-
questions asked by their peers—often the only individuals stu- site and brainstorming with me about the best ways to present
dents really trust. all of our new interactive features.
I sincerely hope these many new resources help to increase The support of Smith College cannot go unrecognized. Smith
student engagement, improve their confidence to communicate, has allowed me to produce and disseminate my “Web Confer-
and truly invite everyone to become a significant participant in ences,” “Developmental Documentaries,” and the “Dev Tutori-
this most amazing science of development. als” used in this text. The commitment and talent of Kate Lee
and the overall support by Smith’s education technology services
Acknowledgments department have also made the production of these features
I wish to express my special and sincere thanks to Mary Tyler, possible. I would be remiss if I did not thank all of the scientists
who played a pivotal role as a content editor for my chapters. who over the years have volunteered their time to speak with my
Mary has held a great love for this textbook over the years, and students about their research. Hopefully your shared insights
her perspectives helped me achieve a perfect balance between will now reach many more students.
the past and present in this new edition. Thank you, Mary, for To my students at Smith College, both in my courses and in
all of your support and focused, substantive input. my research lab, I thank you for being my collaborators and the
The field of developmental biology is ever-expanding and best teachers I have ever had. Your enthusiasm, hard work, and
the pace of research seems like it is increasing exponentially. crazy ideas make all that I do worth it.
This comprehensive edition was only possible with the keen There are many things we do in our lives that could not be
oversight of the expert reviewers listed on the following page. possible without the support of family. However, in my experi-
Thanks to Johannah Walkowicz for her unique balance of per- ence, I have never had to rely on my family quite as much as was
sistence and kindness in organizing all of the reviewers. I extend required for this endeavor. True sacrifices were made by all in
a special acknowledgmentf to Willy Lensch and Bill Anderson, my family to meet the demands of this work. In my book, you
who spent significant time with me discussing the field of stem are all my co-authors! I thank you for your unconditional love
cells, which directly influenced the organization of the new stem and support.
cell chapter. —M.J.F.B.
Reviewers of the Eleventh Edition
The Punchline
Animal development is characterized by the differentiation of the fertilized egg into the
many cell types of the body and by the construction of functionally integrated organs.
Development is the route via which an organism goes from genotype to phenotype,
and it can be studied at any level of organization, from molecules to ecosystems. The
processes of development include fertilization, cleavage, gastrulation, organogenesis,
metamorphosis, regeneration, and senescence. These processes are among the
greatest sources of questions in science, questions such as: How do the various cell
types—blood cells, neurons, pancreas cells, etc.—form, and how do they become
different from one another? How do the cells become organized into functional organs?
How do the organs know their correct size? How do organisms make cells that can
reproduce? How can organisms regenerate tissues and missing parts? How can the
organism integrate cues from the environment to develop properly? And how can the
pathways of development change to produce new types of organisms?
2 Chapter 1
1
More than 210 different cell types are recognized in the adult human, but this number tells
us little about how many cell types a human body produces over the course of development.
A particular cell may play many roles during development, going through stages that are no
longer seen in adulthood. In addition, the role of some cell types is to activate specific genes
in neighboring cells, and once this function is accomplished, the activating cell type dies. The
primary notochord cells, for example, are not even listed in medical histology texts. Once this
task is done, most of them undergo programmed cell death so as not to disturb further neural
development. Because such a cell type is not seen in the adult, it and its importance are known
mainly by developmental biologists.
Making New Bodies 3
fingers are always at the tips of our hands, never in the middle; our eyes are
always in our heads, not in our toes or gut. This creation of ordered form is
called morphogenesis, and it involves coordinating cell growth, cell migra-
tion, and cell death.
• The question of growth If each cell in our face were to undergo just one
more cell division, we would be considered horribly malformed. If each cell
in our arms underwent just one more round of cell division, we could tie our
shoelaces without bending over. How do our cells know when to stop divid-
ing? Our arms are generally the same size on both sides of the body. How is
cell division so tightly regulated?
• The question of reproduction The sperm and egg are highly specialized
cells, and only they can transmit the instructions for making an organism
from one generation to the next. How are these germ cells set apart, and what
are the instructions in the nucleus and cytoplasm that allow them to form the
next generation?
• The question of regeneration Some organisms can regenerate every part
of their bodies. Some salamanders regenerate their eyes and their legs, while
many reptiles can regenerate their tails. While mammals are generally poor
at regeneration, there are some cells in our bodies— stem cells —that are able
to form new structures even in adults. How do stem cells retain this capacity,
and can we harness it to cure debilitating diseases?
• The question of environmental integration The development of many
(perhaps all) organisms is influenced by cues from the environment that sur-
rounds the embryo or larva. The sex of many species of turtles, for instance,
depends on the temperature the embryo experiences while in the egg. The
formation of the reproductive system in some insects depends on bacteria that
are transmitted inside the egg. Moreover, certain chemicals in the environ-
ment can disrupt normal development, causing malformations in the adult.
How is the development of an organism integrated into the larger context of
its habitat?
• The question of evolution Evolution involves inherited changes of devel-
opment. When we say that today’s one-toed horse had a five-toed ancestor,
we are saying that changes in the development of cartilage and muscles
occurred over many generations in the embryos of the horse’s ancestors. How
do changes in development create new body forms? Which heritable changes
are possible, given the constraints imposed by the necessity of the organism
to survive as it develops?
The questions asked by developmental biologists have become critical in molecu-
lar biology, physiology, cell biology, genetics, anatomy, cancer research, neurobiology,
immunology, ecology, and evolutionary biology. The study of development has become
essential for understanding all other areas of biology. In turn, the many advances of
molecular biology, along with new techniques of cell imaging, have finally made these
questions answerable. This is exciting; for, as the Nobel-prize winning developmental
biologist Hans Spemann stated in 1927, “We stand in the presence of riddles, but not
without the hope of solving them. And riddles with the hope of solution—what more
can a scientist desire?”
So, we come bearing questions. They are questions bequeathed to us by earlier gen-
erations of biologists, philosophers, and parents. They are questions with their own his-
tories, questions discussed on an anatomical level by people such as Aristotle, William
Harvey, St. Albertus Magnus, and Charles Darwin. More recently, these questions have
been addressed on the cellular and molecular levels by men and women throughout the
world, each of whom brings to the laboratory his or her own perspectives and training.
For there is no one way to become a developmental biologist, and the field has benefit-
ted by having researchers trained in cell biology, genetics, biochemistry, immunology,
and even anthropology, engineering, physics, and art.
4 Chapter 1
one of the first differentiations to occur during animal development. The germ
cells eventually migrate to the gonads, where they differentiate into gametes. The
development of gametes, called gametogenesis, is usually not completed until the
organism has become physically mature. At maturity, the gametes may be released
and participate in fertilization to begin a new embryo. The adult organism even-
tually undergoes senescence and dies, its nutrients often supporting the early
embryogenesis of its offspring and its absence allowing less competition. Thus, the
cycle of life is renewed.
WEb Topic 1.1 When does a human become a person? Scientists have pro-
posed different answers to this question. Fertilization, gastrulation, the first signs of brain
function, and the time around birth—each of these stages has its supporters as the start-
ing point of human personhood.
VADE MECUM
An Example: A Frog’s Life As seen in the segment on
amphibians, frogs display some
All animal life cycles are modifications of the generalized one described above. Here of the most dramatic of verte-
we will present a concrete example, the development of the leopard frog Rana pipiens brate life cycles.
(Figure 1.1).
Sperm
Morula
Blastula
Oocyte Location of
Sperm germ cells Blastocoel
(male gamete) Germ plasm
FERTILI- CLEAVAGE
Oocyte
ZATION Blastopore
(female gamete)
GAMETOGENESIS
GASTRULATION
Sexually Ectoderm
MATURITY
mature
adult Metamorphosis Mesoderm
(in some species)
ORGANOGENESIS Endoderm
LARVAL
Gonad STAGES
Hatching
Immature larval (birth)
stages
Figure 1.1 Developmental history of the leopard frog, Rana pipiens. The stages from fertil-
ization through hatching (birth) are known collectively as embryogenesis. The region set aside
for producing germ cells is shown in purple. Gametogenesis, which is completed in the sexu-
ally mature adult, begins at different times during development, depending on the species.
(The sizes of the varicolored wedges shown here are arbitrary and do not correspond to the
proportion of the life cycle spent in each stage.)
6 Chapter 1
Organogenesis
Organogenesis in the frog begins when the cells of the most dorsal region of the meso-
derm condense to form a rod of cells called the notochord . 2 These notochord cells
produce chemical signals that redirect the fate of the ectodermal cells above it. Instead
of forming epidermis, the cells above the notochord are instructed to become the cells
of the nervous system. The cells change their shapes and rise up from the round body
( Figure 1.2F ). At this stage, the embryo is called a neurula . The neural precursor
cells elongate, stretch, and fold into the embryo, forming the neural tube. The future
epidermal cells of the back cover the neural tube.
Once the neural tube has formed, it and the notochord induce changes in the
neighboring regions, and organogenesis continues. The mesodermal tissue adjacent
to the neural tube and notochord becomes segmented into somites —the precursors
of the frog’s back muscles, spinal vertebrae, and dermis (the inner portion of the skin).
The embryo develops a mouth and an anus, and it elongates into the familiar tadpole
structure (Figure 1.2G). The neurons make connections to the muscles and to other
2
Although adult vertebrates do not have notochords, this embryonic organ is critical for estab-
lishing the fates of the ectodermal cells above it, as we shall see in Chapter 13.
Making New Bodies 7
(A) (B)
(F) (G)
Brain
Expansion of
forebrain to touch
surface ectoderm
(induces eyes to form)
Stomodeum (mouth) Tailbud
Open neural tube
(H)
Figure 1.2 Early development of the frog Xenopus laevis. (A) Frogs mate by
amplexus, the male grasping the female around the belly and fertilizing the eggs
as they are released. (B) A newly laid clutch of eggs. The cytoplasm has rotated
such that the darker pigment is where the nucleus resides. (C) An 8-cell embryo.
(D) A late blastula, containing thousands of cells. (E) An early gastrula, showing
the blastopore lip through which the mesodermal and some endoderm cells
migrate. (F) A neurula, where the neural folds come together at the dorsal mid-
line, creating a neural tube. (G) A pre-hatching tadpole, as the protrusions of the
forebrain begin to induce eyes to form. (H) A mature tadpole, having swum away
from the egg mass and feeding independently. (Courtesy of Michael Danilchik
and Kimberly Ray.)
8 Chapter 1
neurons, the gills form, and the larva is ready to hatch from its egg. The hatched tadpole
will feed for itself as soon as the yolk supplied by its mother is exhausted.
(A) (B)
(C)
(D)
(E)
Figure 1.3 Metamorphosis of the frog. (A) Huge changes are obvious when one con-
trasts the tadpole and the adult bullfrog. Note especially the differences in jaw structure
and limbs. (B) Premetamorphic tadpole. (C) Prometamorphic tadpole, showing hindlimb
growth. (D) Onset of metamorphic climax as forelimbs emerge. (E,F) Climax stages. (F)
(A © Patrice Ceisel/Visuals Unlimited.)
Making New Bodies 9
Comparative Embryology
The fertilized egg has no heart. Where does the heart come from? Does it form the same
way in both insects and vertebrates? How is heart development in these two groups
similar and how is it different? How do the tissues that form a bird’s wing relate to the
tissues that form a fish fin or a human hand? Many of the questions in developmental
biology are of this type, and they stem from the field’s embryological heritage. The
first known study of comparative developmental anatomy was undertaken by Aristotle.
In The Generation of Animals (ca. 350 bce), he noted some of the variations on the life
cycle themes: some animals are born from eggs (oviparity, as in birds, frogs, and most
invertebrates); some by live birth (viviparity, as in placental mammals); and some by
producing an egg that hatches inside the body (ovoviviparity, as in certain reptiles and
sharks). Aristotle also identified the two major cell division patterns by which embryos
are formed: the holoblastic pattern of cleavage (in which the entire egg is divided into
successively smaller cells, as it is in frogs and mammals) and the meroblastic pattern
of cleavage (as in chicks, wherein only part of the egg is destined to become the embryo
while the other portion—the yolk—serves as nutrition for the embryo). And should
anyone want to know who first figured out the functions of the mammalian placenta
and umbilical cord, it was Aristotle.
There was remarkably little progress in embryology for the two thousand years fol-
lowing Aristotle. It was only in 1651 that William Harvey concluded that all animals—
even mammals—originate from eggs. Ex ovo omnia (“All from the egg”) was the motto
on the frontispiece of Harvey’s On the Generation of Living Creatures, and this precluded
the spontaneous generation of animals from mud or excrement. 3 Harvey also was the
first to see the blastoderm of the chick embryo (the small region of the egg containing
the yolk-free cytoplasm that gives rise to the embryo), and he was the first to notice
that “islands” of blood tissue form before the heart does. Harvey also suggested that
the amniotic fluid might function as a “shock absorber” for the embryo.
As might be expected, embryology remained little but speculation until the inven-
tion of the microscope allowed detailed observations (Figure 1.4). Marcello Malpighi
published the first microscopic account of chick development in 1672. Here, for the first
time, the neural groove (precursor of the neural tube), the muscle-forming somites, and
the first circulation of the arteries and veins—to and from the yolk—were identified.
(A) (B)
(C)
its amputated parts by rearranging existing elements (as we will see Chapter 22). Some
purposeful organizing force could be observed in operation, and it was thought to be
inherited through the germ cells. Thus, development could proceed through a prede-
termined force inherent in the matter of the embryo (Cassirer 1950; Lenoir 1980). In
this hypothesis, wherein epigenetic development is directed by preformed instructions,
we are not far from the view held by modern biologists that most (but by no means all)
of the instructions for forming the organism are already present in the fertilized egg.
1. Radial cleavage
Echinoderms, amphioxus
2. Spiral cleavage
Annelids, molluscs,
flatworms
3. Bilateral cleavage
Tunicates
4. Rotational cleavage
Mammals, nematodes
B. Mesolecithal
(Moderate vegetal yolk disposition)
1. Bilateral cleavage
Cephalopod molluscs
2. Discoidal cleavage
Fish, reptiles, birds
B. Centrolecithal
(Yolk in center of egg)
Superficial cleavage
Most insects
Gilbert
Making New Bodies 13
undergo meroblastic cleavage (Greek meros, “part”), wherein only a portion of the
cytoplasm is cleaved. The cleavage furrow does not penetrate the yolky portion of the
cytoplasm because the yolk platelets impede membrane formation there. Insect eggs
have yolk in the center (i.e., they are centrolecithal), and the divisions of the cytoplasm
occur only in the rim of cytoplasm, around the periphery of the cell (i.e., superficial
cleavage). The eggs of birds and fish have only one small area of the egg that is free
of yolk (telolecithal eggs), and therefore the cell divisions occur only in this small disc
of cytoplasm, giving rise to discoidal cleavage. These are general rules, however,
and even closely related species have evolved different patterns of cleavage in different
environments.
Yolk is just one factor influencing a species’ pattern of cleavage. There are also, as
Conklin had intuited, inherited patterns of cell division superimposed on the con-
straints of the yolk. The importance of this inheritance can readily be seen in isolecithal
eggs. In the absence of a large concentration of yolk, holoblastic cleavage takes place.
Four major patterns of this cleavage type can be described: radial, spiral, bilateral, and
rotational holoblastic cleavage.
WEb Topic 1.2 The cell biology of embryonic cleavage Cell cleavage is
accomplished by a remarkable coordination between the cytoskeleton and the chromo-
somes. This integration of part and whole is becoming better understood as better imag-
ing technologies become available.
Invagination Infolding of a sheet (epithelium) of cells, much like the Sea urchin endoderm
indention of a soft rubber ball when it is poked.
Ingression Migration of individual cells from the surface into the Sea urchin mesoderm,
embryo’s interior. Individual cells become mesen- Drosophila neuroblasts
chymal (i.e., separate from one another) and migrate
independently.
Delamination Splitting of one cellular sheet into two more or less Hypoblast formation in
parallel sheets. While on a cellular basis it resembles birds and mammals
ingression, the result is the formation of a new (addi-
tional) epithelial sheet of cells.
Naming the parts: The primary germ layers and early organs
The end of preformationism did not come until the 1820s, when a combination of new
staining techniques, improved microscopes, and institutional reforms in German uni-
versities created a revolution in descriptive embryology. The new techniques enabled
microscopists to document the epigenesis of anatomical structures, and the institutional
reforms provided audiences for these reports and students to carry on the work of
their teachers. Among the most talented of this new group of microscopically inclined
Figure 1.6 Axes of a bilaterally sym- investigators were three friends, born within a year of each other, all of whom came
metrical animal. (A) A single plane, the from the Baltic region and studied in northern Germany. The work of Christian Pander,
midsagittal plane, divides the animal into Heinrich Rathke, and Karl Ernst von Baer transformed embryology into a specialized
left and right halves. (B) Cross sections branch of science.
bisecting the anterior-posterior axis.
Later
al ior
Poster
Lateral Lateral
Horizontal plane
ne
al pla
ior zont
Anter Hori Later
al
ne Tran
itt a l pla ( s
cros verse pl
sag s se c a Ventral
Mid Ventral tion ne
)
Midsagittal plane
Making New Bodies 15
Ectoderm (outer layer) Mesoderm (middle layer) Endoderm (internal layer) Germ cells
Central Respir-
Outer nervous Neural Digestive atory
surface system crest Dorsal Paraxial Intermediate Lateral Head tube Pharynx tube Male Female
Epidermal Neuron Pigment Noto- Bone Tubule Red Facial Stomach Thyroid Lung Sperm Egg
cells of skin of cell chord tissue cell of the blood muscle cell cell cell
brain (melan- kidney cells (alveolar
ocyte) cell)
6
From the same root as “germination,” the Latin germen means “sprout” or “bud.” The names
of the three germ layers are from the Greek: ectoderm from ektos (“outside”) plus derma
Gilbert mesoderm from mesos (“middle”); and endoderm from endon (“within”).
(“skin”);
Developmental Biology 11e, Sinauer Associates
DevBio11e_01.07 Date 02-29-16
16 Chapter 1
layers generally gives rise to the same organs, whether the organism is a fish, a
(A) Neural tube frog, or a chick. He discovered the notochord, the rod of mesoderm that sepa-
rates the embryo into right and left halves and instructs the ectoderm above it to
become the nervous system (Figure 1.9). He also discovered the mammalian
egg, that minuscule, long-sought cell that everyone believed existed but no one
before von Baer had ever seen.
In 1828, von Baer reported, “I have two small embryos preserved in alcohol,
that I forgot to label. At present I am unable to determine the genus to which they
belong. They may be lizards, small birds, or even mammals.” Drawings of such
early-stage embryos allow us to appreciate his quandary (Figure 1.10). From his
detailed study of chick development and his comparison of chick embryos with
the embryos of other vertebrates, von Baer derived four generalizations. Now
often referred to as “von Baer’s laws,” they are stated here with some vertebrate
examples.
Somite Notochord
Figure 1.9 Two types of microscopy are used to
(B) Neural tube Notochord visualize the notochord and its separation of vertebrate
embryos (in this case a chick) into right and left halves. The
notochord instructs the ectoderm above it to become the
Gilbert nervous system (the neural tube at this stage of develop-
Developmental Biology 11e, Sinauer ment).
Associates
To either side of the notochord and the neural tube
DevBio11e_01.08 Date 02-29-16
are the mesodermal masses called somites, which will form
vertebrae, ribs, and skeletal muscles. (A) Fluorescence
micrograph stained with different dyes to highlight nuclear
DNA (blue), cytoskeletal microtubules (red, yellow), and the
extracellular matrix (green). (B) Scanning electron micro-
graph of the same stage, highlighting the three-dimensional
relationship of the structures. (A courtesy of M. Angeles
Rabadán and E. Martí Gorostiza; B courtesy of K. Tosney
Somites and G. Schoenwolf.)
Making New Bodies 17
1. The general features of a large group of animals appear earlier in Lizard Human
development than do the specialized features of a smaller group.
Although each vertebrate group may start off with different
patterns of cleavage and gastrulation, they converge at a very
similar structure when they begin forming their neural tube. All
developing vertebrates appear very similar right after gastrula-
tion. All vertebrate embryos have gill arches, a notochord, a spi-
nal cord, and primitive kidneys. The structure in Figure 1.9—a
notochord below a neural tube, flanked by somites—is seen in
every vertebrate embryo. It is only later in development that the
distinctive features of class, order, and finally species emerge.
2. Less general characters develop from the more general, until finally
the most specialized appear. All vertebrates initially have the same
type of skin. Only later does the skin develop fish scales, reptil- Figure 1.10 The vertebrates—fish, amphibians, reptiles,
ian scales, bird feathers, or the hair, claws, and nails of mam- birds, and mammals—all start development very differently
mals. Similarly, the early development of limbs is essentially the because of the enormous differences in the sizes of their eggs.
same in all vertebrates. Only later do the differences between By the beginning of neurulation, however, all vertebrate embry-
legs, wings, and arms become apparent. os have converged on a common structure. Here, a lizard
embryo is shown next to a human embryo at a similar stage.
3. The embryo of a given species, instead of passing through the adult As they develop beyond the neurula stage, the embryos of the
stages of lower animals, departs more and more from them.7 For different vertebrate groups become less and less like each
example, as seen in Figure 1.8, the pharyngeal arches start off other. (From Keibel 1904, 1908; see Galis and Sinervo 2002.)
the same in all vertebrates. But the arch that becomes the jaw
support in fish becomes part of the skull of reptiles and becomes
part of the middle ear bones of mammals. Mammals never go
through a fishlike stage (Riechert 1837; Rieppel 2011).
4. Therefore, the early embryo of a higher animal is never like a lower animal, but only like VADE MECUM
its early embryo. Human embryos never pass through a stage equivalent to an adult
The compound microscope has
fish or bird. Rather, human embryos initially share characteristics in common with
been the critical tool of develop-
fish and avian embryos. Later in development, the mammalian and other embryos
mental anatomists. Mastery of
diverge, none of them passing through the stages of the others.
microscopic techniques allows
Recent research has confirmed von Baer’s view that there is a “phylotypic stage” at one to enter an entire world of
which the embryos of the different phyla of vertebrates all have a similar physical struc- form and pattern.
ture, such as the stage seen in Figure 1.10. At this same stage there appears to be the
least amount of difference among the genes expressed by the different groups within
the same vertebrate phylum (Irie and Kuratani 2011).8
Fate maps
Given such a dynamic situation, one of the most important programs of descriptive
embryology became the tracing of cell lineages: following individual cells to see what
those cells become. In many organisms, resolution of individual cells is not possible,
but one can label groups of embryonic cells to see what that area becomes in the adult
organism. By bringing such studies together, one can construct a fate map. These
diagrams “map” larval or adult structures onto the region of the embryo from which
they arose. Fate maps constitute an important foundation for experimental embryol-
ogy, providing researchers with information on which portions of the embryo normally
become which larval or adult structures. Figure 1.11 shows fate maps of some verte-
brate embryos at the early gastrula stage.
Fate maps can be generated in several ways, and the technology has changed greatly
over the past few years. The ability to follow cells with molecular dyes and computer
imaging has altered our understanding of the origins of several cell types. Even our
views of where heart cells originate has been changed (Lane and Sheets 2006; Camp et
al. 2012). Mammalian embryos are among the most difficult to map (since they develop
inside another organism), and researchers are actively constructing, refining, and argu-
ing about the fate maps of mammalian embryos.
Making New Bodies 19
Figure 1.11 Fate maps of vertebrates at the early gastrula stage. Zebrafish Frog
All are dorsal surface views (looking “down” on the embryo at what A Epidermal A
will become its back). Despite the different appearances of the adult ectoderm
animals, fate maps of these four vertebrates show numerous similari-
ties among the embryos. The cells that will form the notochord occupy Neural
a central dorsal position, while the precursors of the neural system lie ectoderm
immediately anterior to it. The neural ectoderm is surrounded by less
Mesoderm
dorsal ectoderm, which will form the epidermis of the skin. A indicates
the anterior end of the embryo, P the posterior end. The dashed green Notochord
lines indicate the site of ingression—the path cells will follow as they Yolk
Endoderm
migrate from the exterior to the interior of the embryo.
P P
Mouse Chick
Direct observation of living embryos Epidermal
A A
Some embryos have relatively few cells, and the cytoplasms of their ectoderm
early blastomeres have differently colored pigments. In such for- Neural
tunate cases, it is actually possible to look through the microscope ectoderm
and trace the descendants of a particular cell into the organs they Notochord
generate. E. G. Conklin patiently followed the fates of each early
Mesoderm
cell of the tunicate (sea squirt) Styela partita (Figure 1.12; Conklin
1905). The muscle-forming cells of the Styela embryo always had Endoderm
a yellow color, derived from a region of cytoplasm found one par-
Extraembryonic
ticular pair of blastomeres at the 8-cell sage. Removal of this pair of P mesoderm P
blastomeres (which according to Conklin’s fate map should produce
the tail musculature) in fact resulted in larvae with no tail muscles,
thus confirming Conklin’s map (Reverberi and Minganti 1946).
WEb Topic 1.3 Conklin’s art and science The plates from Conklin’s remark-
able 1905 paper are online. Looking at them, one can see the precision of his observa-
tions and how he constructed his fate map of the tunicate.
Dye marking
Most embryos are not so accommodating as to have cells of different colors. In the early
years of the twentieth century, Vogt (1929) traced the fates of different areas of amphib-
ian eggs by applying vital dyes to the region of interest. Vital dyes stain cells but do
not kill them. Vogt mixed such dyes with agar and spread the agar on a microscope
Figure 1.12 The fates of individual cells. Edwin Conklin mapped the fates of early cells of
the tunicate Styela partita, using the fact that in embryos of this species many of the cells can
be identified by their different colored cytoplasms. Yellow cytoplasm marks the cells that form
the trunk muscles. (A) At the 8-cell stage, two of the eight blastomeres contain this yellow cyto-
plasm. (B) Early gastrula stage, showing the yellow cytoplasm in the precursors of the trunk
musculature. (C) Early larval stage, showing the yellow cytoplasm in the newly formed trunk
muscles. (From Conklin 1905.)
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_01.11 Date 02-29-16
20 Chapter 1
Section plane
Agar chips Dye stains of view (E)
with dye on embryo
(A) (B) (C) (D) 1
3
1 2 6
3 7 Dorsal lip 4
2
4 8 of blastopore 5
5 9 (where cells
10 10
Embryo 6 begin to
11 11 3
7 enter the
8 embryo)
9
11 10
4
(E)
2
1 Figure 1.13 Vital dye staining of amphibian embryos. (A) Vogt’s method for marking spe-
7 6 cific cells of the embryonic surface with vital dyes. (B–D) Dorsal surface views of stain on suc-
3 cessively later embryos. (E) Newt embryo dissected in a medial sagittal section to show the
8 9 10 stained cells in the interior. (After Vogt 1929.)
11
5
4 slide to dry. The ends of the dyed agar were very thin. Vogt cut chips from these ends
and placed them on a frog embryo. After the dye stained the cells, he removed the agar
chips and could follow the stained cells’ movements within the embryo (Figure 1.13).
One problem with vital dyes is that as they become more diluted with each cell divi-
sion, they become difficult to detect. One way around this is to use fluorescent dyes
that are so intense that once injected into individual cells, they can still be detected in
the progeny of these cells many divisions later. Fluorescein-conjugated dextran, for
VADE MECUM example, can be injected into a single cell of an early embryo, and the descendants of
that cell can be seen by examining the embryo under ultraviolet light (Figure 1.14).
Most cells must be stained in
order to see them; different dyes
Genetic labeling
stain different types of molecules.
A segment on histotechniques One way of permanently marking cells and following their fates is to create embryos
offers instructions on staining in which the same organism contains cells with different genetic constitutions. One of
cells to observe particular struc- the best examples of this technique is the construction of chimeric embryos —embryos
tures (such as the nucleus). made from tissues of more than one genetic source. Chick-quail chimeras, for example,
are made by grafting embryonic quail cells inside a chick embryo while the chick is still
Ventral Dorsal
Anterior
forebrain Posterior
forebrain
Figure 1.14 Fate mapping using a fluorescent dye. (A) Specific cells of a zebrafish embryo were
injected with a fluorescent dye that will not diffuse from the cells. The dye was then activated by laser
in a small region (about 5 cells) of the late cleavage stage embryo. (B) After formation of the central
nervous system had begun, cells that expressed the active dye were visualized by fluorescent light.
The fluorescent dye is seen in particular cells that generate the forebrain and midbrain. (C) Fate map
of the zebrafish central nervous system. Fluorescent dye was injected into cells 6 hours after fertiliza-
Gilbert
tion (left), and the results are color-coded onto the hatched fish (right). Overlapping colors indicate
Developmental
that cells from theseBiology 11e, Sinauer
regions Associates
of the 6-hour embryo contribute to two or more regions. (A,B from
DevBio11e_01.13
Kozlowski Date 02-29-16
et al. 1998, photographs courtesy of E. Weinberg; C after Woo and Fraser 1995.)
Making New Bodies 21
in the egg. Chicks and quail embryos develop in a similar manner (especially during
the early stages), and the grafted quail cells become integrated into the chick embryo
and participate in the construction of the various organs (Figure 1.15A). The chick
that hatches will have quail cells in particular sites, depending on where the graft was
placed. Quail cells also differ from chick cells in several important ways, including the
species-specific proteins that form the immune system. There are quail-specific pro-
teins can be used to find individual quail cells, even when they are “hidden” within
a large population of chick cells (Figure 1.15B). By seeing where these cells migrate,
fine-structure maps of the chick brain and skeletal system have been produced (Le Figure 1.15 Genetic markers as cell
Douarin 1969; Le Douarin and Teillet 1973). lineage tracers. (A) Experiment in which
Chimeras dramatically confirmed the extensive migrations of the neural crest cells cells from a particular region of a 1-day
quail embryo have been grafted into a
during vertebrate development. Mary Rawles (1940) showed that the pigment cells
similar region of a 1-day chick embryo.
(melanocytes) of the chick originate in the neural crest, a transient band of cells that After several days, the quail cells can
joins the neural tube to the epidermis. When she transplanted small regions of neural be seen by using an antibody to quail-
crest-containing tissue from a pigmented strain of chickens into a similar position in an specific proteins (photograph below). This
embryo from an unpigmented strain of chickens, the migrating pigment cells entered region produces cells that populate the
the epidermis and later entered the feathers ( Figure 1.15C ). Ris (1941) used simi- neural tube. (B) Chick and quail cells can
lar techniques to show that, although almost all of the external pigment of the chick also be distinguished by the heterochro-
matin of their nuclei. Quail cells have a
embryo came from the migrating neural crest cells, the pigment of the retina formed in
single large nucleus (dense purple), dis-
the retina itself and was not dependent on migrating neural crest cells. This pattern was tinguishing them from the diffuse nuclei
confirmed in the chick-quail chimeras, in which the quail neural crest cells produced of the chick. (C) Chick resulting from
their own pigment and pattern in the chick feathers. transplantation of a trunk neural crest
region from an embryo of a pigmented
Transgenic DNA chimeras strain of chickens into the same region
In most animals, it is difficult to meld a chimera from two species. One way of circum- of an embryo of an unpigmented strain.
The neural crest cells that gave rise to the
venting this problem is to transplant cells from a genetically modified organism. In
pigment migrated into the wing epider-
such a technique, the genetic modification can then be traced only to those cells that mis and feathers. (A,B from Darnell and
express it. One version is to infect the cells of an embryo with a virus whose genes have Schoenwolf 1997, courtesy of the authors;
C from the archives of B. H. Willier.)
(A) (B)
Quail cells
Quail cells
(C)
VADE MECUM
A movie by Dr. Nicole Le Douarin
of her chick-quail grafts allows
you to see how these grafts are
done.
22 Chapter 1
been altered such that they express the gene for a fluorescently active protein such as
green fluorescent protein , or GFP.9 A gene altered in this way is called a transgene,
because it contains DNA from another species. When the infected embryonic cells are
transplanted into a wild-type host, only the donor cells will express GFP; these emit
a visible green glow (see Affolter 2016; Papaioannou 2016). Variations on transgenic
labeling can give us a remarkably precise map of the developing body.
For example, Freem and colleagues (2012) used transgenic techniques to study the
migration of neural crest cells to the gut of chick embryos, where they form the neurons
that coordinate peristalsis—the muscular contractions of the gut necessary to eliminate
solid waste. The parents of the GFP-labeled chick embryo were infected with a replica-
tion-deficient virus that carried an active gene for GFP. This virus was inherited by the
chick embryo and expressed in every cell. In this way, Freem and colleagues generated
embryos in which every cell glowed green when placed under ultraviolet light (Figure
1.16A). They then transplanted the neural tube and neural crest of a GFP-transgenic
embryo into a similar region of a normal chick embryo ( Figure 1.16B ). A day later,
they could see GFP-labeled cells migrating into the stomach region (Figure1.16C), and
by 7 days, the entire gut showed GFP staining up to the anterior region of the hindgut
(Figure 1.16D).
9
Green fluorescent protein occurs naturally in certain jellyfish. It emits bright green fluores-
cence when exposed to ultraviolet light and is widely used as a transgenic label. GFP labeling
will be seen in many photographs throughout this book.
(D) Stomach
Neural crest cells
Foregut
Figure 1.16 Fate mapping with transgenic DNA shows that the
neural crest is critical in making the gut neurons. (A) A chick embryo
containing an active gene for green fluorescent protein expresses GFP
in every cell. The brain is forming on the left side of the embryo, and the
bulges from the forebrain (which will become the retinas) are contacting
the head ectoderm to initiate eye formation. (B) The region of the neural
tube and neural crest in the presumptive neck region (rectangle in A)
is excised and transplanted into a similar position in an unlabeled wild-
type embryo. One can see it by its green fluorescence. (C) A day later,
Esophagus Midgut Hindgut one can see the neural crest cells migrating from the neural tube to the
stomach region. (D) In 4 more days, the neural crest cells have spread
in the gut from the esophagus to the anterior end of the hindgut. (From
Freem et al. 2012; photographs courtesy of A. Burns.)
Making New Bodies 23
Evolutionary Embryology
Charles Darwin’s theory of evolution restructured comparative embryology and gave
it a new focus. After reading Johannes Müller’s summary of von Baer’s laws in 1842,
Darwin saw that embryonic resemblances would be a strong argument in favor of the
genetic connectedness of different animal groups. “Community of embryonic structure
reveals community of descent,” he would conclude in On the Origin of Species in 1859.
Darwin’s evolutionary interpretation of von Baer’s laws established a paradigm that was
to be followed for many decades—namely, that relationships between groups can be
established by finding common embryonic or larval forms.
Even before Darwin, larval forms were used in taxonomic classification. In the 1830s,
for instance, J. V. Thompson demonstrated that larval barnacles were almost identical
to larval shrimp, and therefore he (correctly) counted barnacles as arthropods rather
than mollusks ( Figure 1.17; Winsor 1969). Darwin, himself an expert on barnacle
taxonomy, celebrated this finding: “Even the illustrious Cuvier did not perceive that a
barnacle is a crustacean, but a glance at the larva shows this in an unmistakable man-
ner.” Alexander Kowalevsky (1871) made the similar discovery that tunicate larvae had
a notochord and pharyngeal pouches, and that these came from the same germ layers
as those same structures in fish and chicks. Thus, Kowalevsky reasoned, the inverte-
brate tunicate is related to the vertebrates, and the two great domains of the animal
kingdom—invertebrates and vertebrates— are thereby united through larval structures
(see Chapter 10). As he had endorsed Thompson, Darwin also applauded Kowalevsky’s
finding, writing in The Descent of Man (1874) that “if we may rely on embryology, ever
(B) Shrimp
24 Chapter 1
the safest guide in classification, it seems that we have at last gained a clue to the source
whence the Vertebrata were derived.” Darwin further noted that embryonic organisms
sometimes form structures that are inappropriate for their adult form, but demonstrate
their relatedness to other animals. He pointed out the existence of eyes in embryonic
moles, pelvic bone rudiments in embryonic snakes, and teeth in baleen whale embryos.
Darwin also argued that adaptations that depart from the “type” and allow an
organism to survive in its particular environment develop late in the embryo.10 He
noted that the differences among species within genera become greater as develop-
ment persists, as predicted by von Baer’s laws. Thus, Darwin
recognized two ways of looking at “descent with modifica-
tion.” One could emphasize common descent by pointing out
Human arm Hand, wrist, and fingers embryonic similarities between two or more groups of ani-
mals, or one could emphasize the modifications to show how
development has been altered to produce structures that
enable animals to adapt to particular conditions.
(C)
Bat
Mouse
normally occurs in the webbing between the fingers. As seen in Figure 1.19, mice
start off with webbing between their digits (as do humans and most other mammals).
This webbing is important for creating the anatomical distinctions between the fin-
gers. Once the webbing has served that function, genetic signals cause its cells to die,
leaving free digits that can grasp and manipulate. Bats, however, use their fingers for
flight, a feat accomplished by changing the genes that are active in the webbing. The
genes activated in embryonic bat webbing encode proteins that prevent cell death, as
well as proteins that accelerate finger elongation (Cretekos et al. 2005; Sears et al. 2006;
Weatherbee et al. 2006). Thus, homologous anatomical structures can differentiate by
altering development, and such changes in development provide the variation needed
for evolutionary change.
Charles Darwin observed artificial selection in pigeon and dog breeds, and these
examples remain valuable resources for studying selectable variation. For instance, the
short legs of dachshunds were selected by breeders who wanted to use these dogs to
hunt badgers (German Dachs, “badger” + Hund, “dog”) in their underground burrows.
The mutation that causes the dachshund’s short legs involves an extra copy of the Fgf4
gene, which makes a protein that informs the cartilage precursor cells that they have
divided enough and can start differentiating. With this extra copy of Fgf4, cartilage
cells are told that they should stop dividing earlier than in most other dogs, so the legs
stop growing (Parker et al. 2009). Similarly, long-haired dachshunds differ from their
short-haired relatives in having a mutation in the Fgf5 gene (Cadieu et al. 2009). This
gene is involved in hair production and allows each follicle to make a longer hair shaft
Gilbert
(Ota et al. 2002;
Developmental see11e
Biology Chapter
, Sinauer16). Thus, mutations in genes controlling developmental
Associates
DevBio11e_01.19
processes can generate Date 02-29-16 variation.
selectable
26 Chapter 1
(A) (B)
Absence of ear
Absent thumbs
Absence of arms
Dislocation of hip
Malformation of ear
Absence of legs
Malformed thumbs
34 38 42 46 50
Days after last menstruation
includes the genetic potentials of the organism. These 8. “Community of embryonic structure reveals community
preformed nuclear instructions include the ability to of descent” (Charles Darwin, On the Origin of Species).
respond to environmental stimuli in specific ways. 9. Homologous structures in different species are those
5. The three germ layers give rise to specific organ sys- organs whose similarity is due to sharing a common
tems. The ectoderm gives rise to the epidermis, nervous ancestral structure. Analogous structures are those
system, and pigment cells; the mesoderm generates organs whose similarity comes from serving a similar
the kidneys, gonads, muscles, bones, heart, and blood function (but which are not derived from a common
cells; and the endoderm forms the lining of the digestive ancestral structure).
tube and the respiratory system. 10. Congenital anomalies can be caused by genetic factors
6. Karl von Baer’s principles state that the general features (mutations, aneuploidies, translocations) or by envi-
of a large group of animals appear earlier in the embryo ronmental agents (certain chemicals, certain viruses,
than do the specialized features of a smaller group. As radiation).
each embryo of a given species develops, it diverges 11. Teratogens—environmental compounds that can alter
from the adult forms of other species. The early embryo development—act at specific times when certain organs
of a “higher” animal species is not like the adult of a are being formed. Similar genetic malformations can
“lower” animal. occur when communication between cells is interrupted
7. Labeling cells with dyes shows that some cells differenti- or eliminated. The molecular signal and its receptor on
ate where they form, whereas others migrate from their the responding cell are both critical.
original sites and differentiate in their new locations.
Migratory cells include neural crest cells and the precur-
sors of germ cells and blood cells.
Further Reading
Affolter, M. 2016. Seeing is believing, or how GFP changed my Papaioannou, V. E. 2016. Concepts of cell lineage in mamma-
approach to science. Curr. Top. Dev. Biol. 116: 1–16. lian embryos. Curr. Top. Dev. Biol. 117: 185–198.
Cadieu, E. and 19 others. 2009. Coat variation in the domes- Pinto-Correia, C. 1997. The Ovary of Eve: Egg and Sperm and
tic dog is governed by variants in three genes. Science 326: Preformation. University of Chicago Press, Chicago.
150–153. Weatherbee, S. D., R. R. Behringer, J. J. Rasweiler 4th and L. A.
Larsen, E. and H. McLaughlin. 1987. The morphogenetic alpha- Niswander. 2006. Interdigital webbing retention in bat wings
bet: Lessons for simple-minded genes. BioEssays 7: 130–132. illustrates genetic changes underlying amniote limb diversifi-
Le Douarin, N. M. and M.-A. Teillet. 1973. The migration of cation. Proc. Natl. Acad. Sci. USA 103: 15103–15107.
neural crest cells to the wall of the digestive tract in the avian Winter, R. M. 1996. Analyzing human developmental abnor-
embryo. J. Embryol. Exp. Morphol. 30: 31–48. malities. BioEssays 18: 965–971.
Nishida, H. 1987. Cell lineage analysis in ascidian embryos by Woo, K. and S. E. Fraser. 1995. Order and coherence in the fate
intracellular injection of a tracer enzyme. III. Up to the tissue- map of the zebrafish embryo. Development 121: 2595–2609.
restricted stage. Dev. Biol. 121: 526–541.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
2
Specifying Identity
Mechanisms of
Developmental Patterning
The Punchline
Undifferentiated cells go through a process of maturation that begins when they
become committed to a specific cell lineage, progresses through a stage when cell
fate is determined to become that of a specific cell type, and ends in differentiation as
cells acquire the gene expression pattern characteristic of a specific cell type. In some
organisms, cell fate is determined very early by the specific molecules present in the
cytoplasm apportioned to each cell as the fertilized egg divides. In other organisms,
cell fate remains plastic or changeable in the early embryo and becomes restricted
over time through cell-cell interactions. In some species (notably the fruit fly), initially
only the nuclei divide, creating a syncytium of many nuclei within a single undivided
cytoplasm. In these embryos, anterior-posterior gradients of informational molecules
in the cytoplasm determine which genes will be expressed in the different nuclei once
they become separated into individual cells. Using powerful new imaging techniques
such as Brainbow, researchers today are able to map the fates of individual cells from
zygote to adult.
30 Chapter 2
Levels of Commitment
To the naked eye, individual grains of sand on an expansive beach look unorganized,
yet the grains can be molded together to create complex structures, as illustrated by a
sand sculpture of an octopus holding children in its tentacles (FIGURE 2.1). How can
disordered units become ordered, a pile of sand become a structured creation, or a col-
lection of cells become a highly complex embryo? Did the sand grains that became the
octopus’s eye know they were going to become an eye as they washed up on the beach
earlier that morning? Obviously, significant energy had to be applied to the inanimate
and inorganic sand grains to get them to become the sculpture’s eye. What about the
cells of your eye? Did they know they were destined to become part of an eye? If so,
when did they know it, and how set were they in adopting this fate?
Cell differentiation
The generation of specialized cell types is called differentiation, a process during which
a cell ceases to divide and develops specialized structural elements and distinct func-
tional properties. Differentiation, though, is only the last, overt stage in a series of
events that commit an undifferentiated cell of an embryo to become a particular cell
type (TABLE 2.1). A red blood cell obviously differs radically in its protein composition
and cell structure from a lens cell in the eye or a neuron in the brain. But these differ-
ences in cellular biochemistry and function are preceded by a process that commits the
cell to a certain fate. During the course of commitment, the cell might not look different
from its nearest or most distant neighbors in the embryo and show no visible signs of
differentiation, but its developmental fate has become restricted.
Commitment
The process of commitment can be divided into two stages (Harrison 1933; Slack 1991).
The first stage is specification. The fate of a cell or tissue is said to be specified when
it is capable of differentiating autonomously (i.e., by itself) when placed in an environ-
ment that is neutral with respect to the developmental pathway, such as in a petri dish
or test tube (FIGURE 2.2A). At the stage of specification, cell commitment is still labile
(i.e., capable of being altered). If a specified cell is transplanted to a population of dif-
ferently specified cells, the fate of the transplant will be altered by its interactions with
its new neighbors (FIGURE 2.2B). It is not unlike many of you who may have entered
Specifying Identity 31
Table 2.1 Some differentiated cell types and their major products
Type of cell Differentiated cell product Specialized function
Specification
is irreversible
Autonomous Specification
One major strategy of cell commitment is autonomous specification. Here, the blasto-
meres of the early embryo are apportioned a set of critical determination factors within
the egg cytoplasm. In other words, the egg cytoplasm is not homogeneous; rather,
different regions of the egg contain different morphogenetic determinants that will
influence the cell’s development. These determinants, as you will learn in Chapter 3,
are molecules—often transcription factors—that regulate gene expression in a manner
that directs the cell into a particular path of development. In autonomous specification,
the cell “knows” very early what it is to become without interacting with other cells.
For instance, even in the very early cleavage stages of the snail Patella, blastomeres
that are presumptive trochoblast cells can be isolated in a petri dish. There, they will
develop into the same ciliated cell types that they would give rise to in the embryo and
with the same temporal precision ( FIGURE 2.3). This continued commitment to the
trochoblast fate suggests that these particular early blastomeres are already specified
and determined to their fate.
Animal pole Figure 2.5 Autonomous specification in the early tunicate embryo. When the
Ectoderm four blastomere pairs of the 8-cell embryo are dissociated, each forms the struc-
Nervous tures it would have formed had it remained in the embryo. The tunicate nervous
system a4.2 b4.2 system, however, is conditionally specified. The fate map shows that the left and
right sides of the tunicate embryo produce identical cell lineages. Here the muscle-
Anterior Posterior forming yellow cytoplasm is colored red to conform to its association with meso-
derm. (After Reverberi and Minganti 1946.)
Notochord Muscle
A4.1 B4.1
Endoderm Mesenchyme of cytoplasm found in the B4.1 blastomeres. In fact, removal of the B4.1 cells
Vegetal pole (which according to Conklin’s map should produce all the tail musculature)
resulted in a larva with no tail muscles (Reverberi and Minganti 1946). This
result supports the conclusion that only those cells derived from the early B4.1
Ectoderm Separation Ectoderm blastomeres possess the capacity to develop into tail muscle. Further supporting
of cells a mode of autonomous specification, each blastomere will form most of its
respective cell types even when separated from the remainder of the embryo
(FIGURE 2.5). Moreover, if the yellow cytoplasm of the B4.1 cells is placed
into other cells, those cells will form tail muscles (Whittaker 1973; Nishida
a4.2 b4.2 and Sawada 2001). These results taken together suggest that critical factors
that control cell fate are present and differentially segregated in the cytoplasm
Notochord of early blastomeres.
Muscle
A4.1 B4.1
In 1973, J. R. Whittaker provided dramatic biochemical confirmation of
the cytoplasmic segregation of tissue determinants in early tunicate embryos.
When Whittaker removed the pair of B4.1 blastomeres and placed them in
Mesenchyme isolation, they produced muscle tissue; however, no other blastomere was
able to form muscles when separated. Interestingly, contained in the yel-
Endoderm low-pigmented cytoplasm is mRNA for a muscle-specific transcription fac-
tor appropriately called Macho, and only those blastomeres that acquire this
region of yellow cytoplasm (and thus the Macho factor) give rise to muscle
cells (FIGURE 2.6A ; Nishida and Sawada 2001; reviewed by Pourquié 2001).
Functionally, Macho is required for tail muscle development in Styela; loss of
Macho mRNA leads to a loss of muscle differentiation of the B4.1 blastomeres,
whereas microinjection of Macho mRNA into other blastomeres promotes
Developing Questions
Look closely at the localization of Macho mRNA in the
(A) Egg Eight-cell embryo
tunicate embryo (see Figure 2.6A). Is it evenly spread
throughout the cell, or is it localized to only a small
region? Once you have decided on its spatial distribution,
Macho mRNA
(B) Macho added to Figure 2.6 The Macho gene regulates muscle
Control Macho depleted other blastomeres
development in the tunicate. (A) Like the yellow cres-
Marker for muscle actin
ectopic muscle differentiation (FIGURE 2.6B). Thus, the tail muscles of these tunicates
are formed autonomously by acquiring and retaining the Macho mRNA from the egg
cytoplasm with each round of mitosis.
WATCH DEVELOPMENT 2.1 The Four-Dimensional Ascidian Body Atlas use real 3D
data sets collected over time to offer an interactive way to view the Ascidian embryo.
Conditional Specification
We have just learned how most of the cells of an early tunicate embryo are determined
by autonomous specification; however, even the tunicate embryo is not fully specified
this way—its nervous system arises conditionally. Conditional specification is the pro-
cess by which cells achieve their respective fates by interacting with other cells. Here,
what a cell becomes is specified by the array of interactions it has with its neighbors,
which may include cell-to-cell contacts (juxtacrine factors), secreted signals (paracrine
factors), or the physical properties of its local environment (mechanical stress), mecha-
nisms we will explore in detail in Chapter 4. For example, if cells from one region of a
vertebrate blastula (e.g., frog, zebrafish, chick, or mouse) whose fates have been mapped
to give rise to the dorsal region of the embryo are transplanted into the presumptive
ventral region of another embryo, the transplanted “donor” cells will change their fates
and differentiate into ventral cell types (FIGURE 2.7 and Watch Development 2.2).
Moreover, the dorsal region of the donor embryo where cells were extracted also ends
up developing normally.
WATCH DEVELOPMENT 2.2 Watch Dr. Barresi perform a similar gastrula-staged cell
transplantation in zebrafish. The donor cells adopt their new location (see Figure 2.7A).
No Normal
Cells form transplantation Cells form development
back tissue (normal belly tissue
development)
36 Chapter 2
Cleavage
Destroyed
half
8B 2A 8A 7A 6A 5A 4A
8 2 7B 1A 8 7 6 5 4
Top 7 1 8A 7A 1B 2B 8B 7B 6B 5B 4B
view 5 3 5B 3A 4A
6B
6 4 5A 3B 8-Cell 16-Cell
6A 4B
8B 1B
8 1
Animal pole 8A 1A
7 2 7B 2B
7A 2A
7B 3A
7 3 6A 3A
5 7A 3B 6 3 6B 3B
8B 5B 5A 4A 5A 4A
Side 5 4
view 8 4 8A 4B 5B 4B
6B 6A
6
Animal and vegetal cells mixed up
38 Chapter 2
the blastomere’s actual prospective fate (those cell types that it would normally give rise
to over the unaltered course of its development). According to Weismann and Roux, the
prospective potency and the prospective fate of a blastomere should have been identical.
Second, Driesch concluded that the sea urchin embryo is a “harmonious equipotential
system” because all of its potentially independent parts interacted together to form a
single organism. Driesch’s experiment implies that cell interaction is critical for normal
development. Moreover, if each early blastomere can form all the embryonic cells when iso-
lated, it follows that in normal development the community of cells must prevent it from
doing so (Hamburger 1997). Third, Driesch concluded that the fate of a nucleus depended
solely on its location in the embryo. Interactions between cells determined their fates.
We now know (and will see in Chapters 10 and 11) that sea urchins and frogs alike
use both autonomous and conditional specification of their early embryonic cells. More-
over, both animal groups use a similar strategy and even similar molecules during early
development. In the 16-cell sea urchin embryo, a group of cells called the micromeres
inherits a set of transcription factors from the egg cytoplasm. These transcription factors
cause the micromeres to develop autonomously into the larval skeleton, but these same
factors also activate genes for paracrine and juxtacrine signals that are then secreted by
the micromeres and conditionally specify the cells around them.
Embryos (especially vertebrate embryos) in which most of the early blastomeres
are conditionally specified have traditionally been called regulative embryos. But as
we become more cognizant of the manner in which both autonomous and conditional
specification are used in each embryo, the notions of “mosaic” and “regulative” embry-
os appear less and less tenable. Indeed, attempts to get rid of these distinctions were
begun by the embryologist Edmund B. Wilson (1894, 1904) more than a century ago.
Syncytial Specification
In addition to autonomous and conditional specification, there is a third strategy that
uses elements of both. A cytoplasm that contains many nuclei is called a syncytium,4
and the specification of presumptive cells within such a syncytium is called syncytial
specification . A notable example of an embryo that goes through a syncytial stage
is found in insects, as illustrated by the fruit fly Drosophila melanogaster. During its
early cleavage stages, nuclei divide through 13 cycles in the absence of any cytoplasmic
cleavage. This division creates an embryo of many nuclei contained within one shared
cytoplasm surrounded by one common plasma membrane. This embryo is called the
syncytial blastoderm (FIGURE 2.11 and Watch Development 2.3).
WATCH DEVELOPMENT 2.3 Observe the waves of nuclear divisions that occur during
development of the syncytial blastoderm in the Drosophila early embryo.
It is within the syncytial blastoderm that the identity of future cells is established
simultaneously across the entire embryo along the anterior-to-posterior axis of the
blastoderm. Therefore, identity is established without any membranes separating nuclei
into individual cells. Membranes do eventually form around each nucleus through a
process called cellularization, which occurs after mitotic cycle 13 just prior to gastrula-
tion (see Figure 2.11). A fascinating issue is how the cell fates—those cells determined
to become the head, thorax, abdomen, and tail—are specified before cellularization.
Are there determination factors segregated to discrete locations in the blastoderm to
determine identity, as seen in autonomous specification? Or do nuclei in this syncytium
obtain their identity from their position relative to neighboring nuclei, akin to condi-
tional specification? The answer to both these questions is yes.
4
Syncytia can be found in many organisms, from fungi to humans. Examples are the syncy-
tium of the nematode germ cells (connected by cytoplasmic bridges), the multinucleated skel-
etal muscle fiber, and the giant cancer cells derived from fused immune cells.
Specifying Identity 39
(A) Nuclear cycles during Drosophila early (B) Global wave of nuclei division Figure 2.11 The syncytial blasto-
development during cycle 13 derm in Drosophila melanogaster.
(A) Schematic of the progression of
blastoderm cellularization in Droso-
phila (nuclei are red). (B) Still frames
from a time lapse movie of a develop-
ing Drosophila embryo with nuclei
Pre-blastoderm Cycles 4–6 that are premitotic (blue) and actively
cycles 1–9 dividing nuclei in mitosis (purple).
(A after Mazumdar and Mazumdar
2002; B from Tomer et al. 2012.)
Cycles 8–9
Nuclear migration toward cortex
Pole
Cycles 10–13 cells
Syncytial blastoderm cycles
Cellularization interphase 14
Cellular blastoderm
Keeping nuclear position stable during early development allows each nucleus to
be exposed to different amounts of the determination factors distributed in gradients
throughout the shared cytoplasmic environment. A nucleus can interpret its position
(whether to become part of the anterior, midsection, or posterior part of the body)
based on the concentration of cytoplasmic determinants it experiences. Each nucleus
thereby becomes genetically programmed toward a particular identity. The determi-
nants are transcription factors, proteins that bind DNA and regulate gene transcrip-
tion. In Chapter 3, we will go into great detail about the role that transcription factors
play in development.
As we will detail in Chapter 9, the anteriormost portion of the Drosophila embryo
produces a transcription factor called Bicoid, with a concentration of both mRNA and
protein that is highest in the anterior region of the egg and declines toward the pos-
terior (FIGURE 2.12B,C; Gregor et al. 2007; Sample and Shvartsman 2010; Little et al.
2011). The Bicoid concentration gradient across the syncytium is the combined result of
diffusion with a mechanism of protein and mRNA degradation. In addition, the poste-
riormost portion Biology
Developmental of the egg
11e forms a posterior-to-anterior gradient of the transcription
factor Caudal.
Fig. 02.12 Thus, the long axis of the Drosophila egg is spanned by opposing gradi-
ents:Dragonfly
Bicoid from anterior and Caudal from the posterior (FIGURE 2.12D). Bicoid and
theGroup
Media
04/08/16
Caudal are considered morphogens because they occur in a concentration gradient and
Specifying Identity 41
are capable of regulating different genes at different threshold concentrations. We will Developing Questions
discuss morphogens in great detail in Chapter 4, but their repeated use in embryonic
development will merit their inclusion throughout the textbook. If a mechanism of opposing
concentration gradients
As morphogens, Bicoid and Caudal proteins activate different sets of genes in the
of Bicoid and Caudal
syncytial nuclei. Those nuclei in regions containing high amounts of Bicoid and little determine specification of
Caudal are instructed to activate the genes that produce the head. Nuclei in regions the anterior-to-posterior axis
with slightly less Bicoid and a small amount of Caudal are instructed to activate genes in Drosophila melanogaster,
that generate the thorax. In regions with little or no Bicoid but plenty of Caudal, the could this same mechanism
activated genes form abdominal structures (Nüsslein-Volhard et al. 1987). Thus, when work in a fly embryo that
the syncytial nuclei are eventually incorporated into cells, these cells will have their is larger or has different
proportions per body
general fate specified. Afterward, the specific fate of each cell will become determined
segment, or would it
both autonomously (from transcription factors acquired after cellularization) and con- need some modification?
ditionally (from interactions between the cell and its neighbors). How precise is the actual
gradient, and how precise
A Rainbow of Cell Identities does it actually have to be
to set a nucleus/cell upon
Each of the three major strategies of cell specification summarized in TABLE 2.2 offers a lineage-specific path of
maturation?
a different way of providing each embryonic cell with a set of determinants (often
transcription factors) that will activate specific genes and cause the cell to differenti-
ate into a particular cell type. Is the designation of a “cell type” the most precise way
of identifying a cell? To answer this question, we would have to be able to watch and
analyze individual cells in an embryo over time. In Chapter 1, we discussed using fate
mapping techniques, which enable the marking of a single cell with something such
15 17
Total
TE 17
26
Blastocyst TE 15 17
TE
8 17
Blastocyst
ICM
2 Snapshot Summary
Specifying Identity
1. Cell differentiation is the process by which a cell Such cells will mature into their determined cell types
acquires the structural and functional properties unique even when isolated, as best exemplified by cells of the
to a given cell type. tunicate embryo.
2. From an undifferentiated cell to a postmitotic differenti- 7. Conklin first observed the yellow crescent in the tunicate
ated cell type, a cell goes through a process of matura- embryo and showed that cells with this yellow crescent
tion that experiences different levels of commitment gave rise to muscle. The muscle cell fate in tunicates is
toward its end fate. dependent on the transcription factor Macho.
3. A cell is first specified toward a given fate, suggesting 8. Conditional specification is the acquisition of a given cell
that it would develop into this cell type even in isolation. identity based on its position or, more specifically, on the
4. A cell is committed or determined to a given fate if it interactions that cell has with the other cells and mol-
maintains its developmental maturation toward this cell ecules it comes in contact with. An extreme example
type even when placed in a new environment. of conditional specification was demonstrated by the
complete, normal development of sea urchin larvae from
5. There are three different modes of cell specification:
single isolated blastomeres.
autonomous, conditional, and syncytial.
9. Most species have cells that develop via autonomous
6. Autonomous specification refers to cells in an embryo
specification as well as cells that develop via conditional
that possess the necessary cytoplasmic determinants
specification.
that function to commit that cell toward a specific fate.
44 Chapter 2
10. Patterns of cell fate can also be laid out in a syncytium these nuclei by opposing morphogen gradients, name-
of nuclei—called syncytial specification—as in the Dro- ly Bicoid and Caudal.
sophila blastoderm. 12. Genetic techniques like Brainbow enable scientists to
11. Cytoskeletal arrangements maintain positioning of follow the developmental history of individual cells and
nuclei in the syncytium, which enables specification of help further define what cell identity means.
Further Reading
Klein, S. L. and S. A. Moody. 2016. When family history Nishida, H. and K. Sawada. 2001. macho-1 encodes a local-
matters: the importance of lineage analyses and fate maps ized mRNA in ascidian eggs that specifies muscle fate during
for explaining animal development. Curr. Top. Dev. Biol. 117: embryogenesis. Nature 409: 724–729.
93–112. Tabansky, I. and 11 others. 2013. Developmental bias in cleav-
Little, S., G. Tkačik, T. B. Kneeland, E. F. Wieschaus, and T. age-stage mouse blastomeres. Curr. Biol. 23: 21–31.
Gregor. 2011. The formation of the Bicoid morphogen gradient Weissman, T. A. and Pan Y. A. 2015. Brainbow: new resources
requires protein movement from anteriorly localized mRNA. and emerging biological applications for multicolor genetic
PLoS Biol. 3: e1000596. labeling and analysis. Genetics 199: 293–306.
Livet, J. and 7 others. 2007. Transgenic strategies for combinato- Wieschaus, E. 2016. Positional Information and cell fate deter-
rial expression of fluorescent proteins in the nervous system. mination in the early drosophila embryo. Curr. Top. Dev. Biol.
Nature 450: 56–62. 117: 567–579.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
3
From one cell come many, and of many different types. That is the seemingly
miraculous phenomenon of embryonic development. How is it possible that such a diver-
sity of cell types within a multicellular organism can be derived from a single cell, the fer-
tilized egg? Cytological studies done at the start of the twentieth century established that
the chromosomes in each cell of an organism’s body are the mitotic descendants of the
chromosomes established at fertilization (Wilson 1896; Boveri 1904). In other words, each
somatic cell nucleus has the same chromosomes—and therefore the same set of genes—as
all other somatic cell nuclei. This fundamental concept, known as genomic equivalence,
presented a significant conceptual dilemma. If every cell in the body contains the genes
for hemoglobin and insulin, for example, why are hemoglobin proteins made only in red
blood cells and insulin proteins only in certain pancreatic cells? Based on the embryologi-
cal evidence for genomic equivalence (as well as on bacterial models of gene regulation),
a consensus emerged in the 1960s that the answer lies in differential gene expression.
The Punchline
The selective production of different proteins within cells creates cellular diversity.
As the single-celled zygote divides to start the generation of all the cells making up
an organism, differences in the expression of genes in these cells govern maturation
toward distinct cell types. Many regulatory mechanisms targeting DNA access,
RNA production and processing, and protein synthesis and modification lead to this
differential gene expression. They include using a specific repertoire of transcription
factors that bind gene promoters to enhance or repress transcription, modifying
histones to modulate the accessibility of chromatin, and degrading and alternative
splicing of RNA to change the coded message for different protein construction. In
addition, translational controls and posttranslational modifications of proteins as
well as changes in protein transport affect what proteins are created and where they
function. Use of these numerous mechanisms at different times and in different cells
fuels the creation of different cell types as the embryo develops.
46 Chapter 3
different genes, cells can create different proteins that lead to the differentiation of dif-
ferent cell types. There are three postulates of differential gene expression:
1. Every somatic cell nucleus of an organism contains the complete genome estab-
lished in the fertilized egg. In molecular terms, the DNAs of all differentiated cells
are identical.
2. The unused genes in differentiated cells are neither destroyed nor mutated; they
retain the potential for being expressed.
3. Only a small percentage of the genome is expressed in each cell, and a portion of
the RNA synthesized in each cell is specific for that cell type.
By the late 1980s, it was established that gene expression can be regulated at four levels
such that different cell types synthesize different sets of proteins:
1. Differential gene transcription regulates which of the nuclear genes are transcribed
into nuclear RNA.
2. Selective nuclear RNA processing regulates which of the transcribed RNAs (or which
parts of such a nuclear RNA) are able to enter into the cytoplasm and become mes-
senger RNAs.
3. Selective messenger RNA translation regulates which of the mRNAs in the cytoplasm
are translated into proteins.
4. Differential protein modification regulates which proteins are allowed to remain and/
or function in the cell.
Some genes (such as those coding for the globin protein subunits of hemoglobin) are
regulated at all these levels.
WEb Topic 3.1 Does the genome or the cytoplasm direct development?
The geneticists versus the embryologists. Geneticists were certain that genes controlled
development, whereas embryologists generally favored the cytoplasm. Both sides had
excellent evidence for their positions.
WEb Topic 3.2 The origins of developmental genetics The first hypotheses
for differential gene expression came from C. H. Waddington, Salome Gluecksohn-
Waelsch, and other scientists who understood both embryology and genetics.
where it can interact with a ribosome and convey its message for
the synthesis of a specific protein. mRNA unveils the comple-
mentary sequence of DNA three bases at a time, each triplet 4 Translation
being called a codon. Each codon calls for a specific amino acid Amino
that will be covalently attached to its neighboring amino acid acid chain AAAA
denoted by the codon next in line. In this manner, translation Ribosome
leads to the synthesis of a polypeptide chain that will undergo
protein folding and potential modification by the addition of 5 Protein folding
various functional moieties such as carbohydrates, phosphates, and modification
or cholesterol groups. The completed protein is now ready to 6 Carry out
carry out its specific function serving to support the structural function
or functional properties of the cell. Cells that express different
proteins will therefore possess different structural and func-
tional properties, making it a distinct type of cell.
odd-skipped (stage 9)
WEb Topic 3.3 The 2012 Nobel Prize for Physiology or Medicine: Clon-
ing and nuclear equivalence The final “proof” of genomic equivalence was
the demonstration that the nuclei of differentiated somatic cells could generate any cell
type in the body.
Of the 434 sheep oocytes originally used in this experiment, only one survived:
Dolly 1 (FIGURE 3.3B ). DNA analysis confirmed that the nuclei of Dolly’s cells were
Gilbert derived from the strain of sheep from which the donor nucleus was taken (Ashworth et
Developmental Biology 11e, Sinauer Associates
al. 1998; Signer et al. 1998). Cloning of adult mammals has been confirmed in guinea
DevBio11e_03.02 Date 06-02-16
pigs, rabbits, rats, mice, dogs, cats, horses, and cows. In 2003, a cloned mule became
the first sterile animal to be so reproduced (Woods et al. 2003). Thus, it appears that
1
The creation of Dolly was the result of a combination of scientific and social circumstances.
These circumstances involved job security, people with different areas of expertise meeting one
another, children’s school holidays, international politics, and who sits near whom in a pub.
The complex interconnections giving rise to Dolly are told in The Second Creation (Wilmut et
al. 2000), a book that should be read by anyone who wants to know how contemporary science
actually works. As Wilmut acknowledged (p. 36), “The story may seem a bit messy, but that’s
because life is messy, and science is a slice of life.”
Differential Gene Expression 49
Micropipette
Transfer cell
Enucleated into enucleated egg
egg
Figure 3.3 Cloning a mammal using nuclei from adult
somatic cells. (A) Procedure used for cloning sheep. (B)
Dolly, the adult sheep on the left, was derived by fusing a
mammary gland cell nucleus with an enucleated oocyte,
which was then implanted in a surrogate mother (of a dif-
ferent breed of sheep) that gave birth to Dolly. Dolly later
gave birth to a lamb (Bonnie, at right) by normal reproduc-
tion. (A after Wilmut et al. 2000; B photograph by Roddy
Egg and cell Field © Roslin Institute.)
fused with
electric current
Embryo cultured
7 days
Blastocyst
forms
the nuclei of vertebrate adult somatic cells contain all the genes needed to generate an
adult organism. No genes necessary for development have been lost or mutated in the
somatic cells; their nuclei are equivalent.2
2
Although all the organs were properly formed in the cloned animals, many of the clones
developed debilitating diseases as they matured (Humphreys et al. 2001; Jaenisch and Wilmut
2001; Kolata 2001). As we will see shortly, this problem is due in large part to the differences in
methylation between the chromatin of the zygote and the differentiated cell.
Gilbert
50 Chapter 3
SCIENTISTS SPEAK 3.1 Listen to Sir Ian Wilmut discuss cloning and cellular
reprogramming.
(A) Figure 3.4 Nucleosome and chromatin structure. (A) Model of nucleosome struc-
ture as seen by X-ray crystallography at a resolution of 1.9 Å. Histones H2A and H2B
are yellow and red, respectively; H3 is purple; and H4 is green. The DNA helix (gray)
winds around the protein core. The histone “tails” that extend from the core are the
sites of acetylation and methylation, which may disrupt or stabilize, respectively, the
formation of nucleosome assemblages. (B) Histone H1 can draw nucleosomes togeth-
er into compact forms. About 147 base pairs of DNA encircle each histone octamer,
and about 60 to 80 base pairs of DNA link the nucleosomes together. (C) Model for the
arrangement of nucleosomes in the highly compacted solenoidal chromatin structure.
Histone tails protruding from the nucleosome subunits allow for the attachment of
chemical groups. (D) Methyl groups condense nucleosomes more tightly, preventing
access to promoter sites and thus preventing gene transcription. Acetylation loosens
nucleosome packing, exposing the DNA to RNA polymerase II and transcription fac-
tors that will activate the genes. (A after Davey et al. 2002.)
Uncondensed nucleosomes:
Histone tails largely unmethylated H2, H3, H4 tails acetylated
and acetylated
associated with highly repressed chromatin. FIGURE 3.5 depicts a nucleosome with
lysine residues on its H3 tail. Modifications of such residues regulate transcription.
If methyl groups at specific places on histones repress transcription, getting rid of
these methyl moieties should be expected to permit transcription. That has been shown
to be the case in the activation of the Hox genes, a family of genes that are critical in
giving cells their identities along the anterior-posterior body axis. In early development,
Hox genes are repressed by H3K27 trimethylation (the lysine at position 27 on histone
3 has three methyl groups: H3K27me3). In differentiated cells, however, a demethylase
specific for H3K27me3 is recruited to these regions, eliminating the methyl groups and
Gilbert
52 Chapter 3
enabling access to the gene for transcription (Agger et al. 2007; Lan et al. 2007). The
effects of methylation in controlling gene transcription are extensive.
Translation
b-globin a-globin
HEMOGLOBIN
Figure 3.6 Steps in the produc-
tion of β-globin and hemoglobin.
Transcription of the β-globin gene
Heme
creates a nuclear RNA containing
exons and introns as well as the
cap, tail, and 3′ and 5′ untranslated
the regions of DNA that code for parts of a protein3; between exons, however, are inter- regions. Processing the nuclear
vening sequences called introns that have nothing whatsoever to do with the amino RNA into messenger RNA removes
acid sequence of the protein. To help illustrate the structural components of a typical the introns. Translation on ribo-
somes uses the mRNA to encode
eukaryotic gene, we highlight the anatomy of the human β-globin gene (FIGURE 3.6).
a protein. The β-globin protein is
This gene, which encodes part of the hemoglobin protein of the red blood cells, consists inactive until it is modified and com-
of the following elements: plexed with α-globin and heme to
• A promoter region, where RNA polymerase II binds to initiate transcription. become active hemoglobin (bottom).
The promoter region of the human β-globin gene has three distinct units and
extends from 95 to 26 base pairs before (“upstream from”)4 the transcription
initiation site (i.e., from –95 to –26). Some promoters have the DNA sequence
TATA (called the “TATA-box”), which binds the basal or general transcription
factor (TATA-binding protein, TBP) that helps anchor RNA polymerase II to
the promoter.
Gilbert
• The transcription initiation site, which for human β-globin is ACATTTG.
Developmental
This siteBiology 11e, Sinauer Associates
is often called the cap sequence because it is the DNA sequence
DevBio11e_03.06 Date 03-18-16
3
The term exon refers to a nucleotide sequence whose RNA “exits” the nucleus. It has taken on
the functional definition of a protein-encoding nucleotide sequence. Leader sequences and 3′
UTR sequences are also derived from exons, even though they are not translated into protein.
4
By convention, upstream, downstream, 5′, and 3′ directions are specified in relation to the
RNA. Thus, the promoter is upstream of the gene, near to and “before” its 5′ end.
54 Chapter 3
that will code for the addition of a modified nucleotide “cap” at the 5′ end of
the RNA soon after it is transcribed. The specific cap sequence varies among
genes. This cap sequence begins the first exon.
• The 5′ untranslated region (5′ UTR), also called the leader sequence. In the
human β-globin gene, it is the sequence of 50 base pairs intervening between
the initiation points of transcription and translation. The 5′ UTR can deter-
mine the rate at which translation is initiated.
• The translation initiation site, ATG . This codon (which becomes AUG in
mRNA) is located 50 base pairs after the transcription initiation site in the
human β-globin gene (this distance differs greatly among different genes).
The ATG translation start sequence is the same in every gene.
• The protein-encoding portion of the first exon, which contains 90 base pairs
coding for amino acids 1–30 of human β-globin protein.
• An intron containing 130 base pairs with no coding sequences for β-globin.
The structure of this intron, however, is important in enabling the RNA to be
processed into mRNA and exit from the nucleus.
• An exon containing 222 base pairs coding for amino acids 31–104.
• A large intron—850 base pairs—having nothing to do with β-globin protein
structure.
• An exon containing 126 base pairs coding for amino acids 105–146 of the
protein.
• A translation termination codon, TAA . This codon becomes UAA in the
mRNA. When a ribosome encounters this codon, the ribosome dissociates,
and the protein is released. Translation termination can also be represented
by the TAG or TGA codon sequences in other genes.
• A 3′ untranslated region (3′ UTR) that, although transcribed, is not translated
into protein. This region includes the sequence AATAAA, which is needed
for polyadenylation, the insertion of a “tail” of some 200–300 adenylate
residues on the RNA transcript, about 20 bases downstream of the AAUAAA
sequence. This polyA tail (1) confers stability on the mRNA, (2) allows the
mRNA to exit the nucleus, and (3) permits the mRNA to be translated into
protein.
• A transcription termination sequence. Transcription continues beyond the
AATAAA site for about 1000 nucleotides before being terminated.
The original transcription product is called nuclear RNA (nRNA) or, sometimes,
heterogeneous nuclear RNA (hnRNA) or pre-messenger RNA (pre-mRNA). Nuclear RNA
contains the cap sequence, the 5′ UTR, exons, introns, and the 3′ UTR. Both ends of
these transcripts are modified before these RNAs leave the nucleus. A cap consisting
of methylated guanosine is placed on the 5′ end of the RNA in opposite polarity to
the RNA itself, which means that there is no free 5′ phosphate group on the nRNA.
The 5′ cap is necessary for the binding of mRNA to the ribosome and for subsequent
translation (Shatkin 1976). The 3′ terminus is usually modified in the nucleus by the
addition of a polyA tail. The adenylate residues in this tail are added to the transcript
enzymatically; they are not part of the gene sequence. Both the 5′ and 3′ modifications
may protect the mRNA from exonucleases that would otherwise digest it (Sheiness and
Darnell 1973; Gedamu and Dixon 1978). The modifications thus stabilize the message
and its precursor.
Before the nRNA leaves the nucleus, its introns are removed and the remaining
exons spliced together. In this way, the coding regions of the mRNA—that is, the
exons—are brought together to form a single uninterrupted transcript, and this tran-
script is translated into a protein. The protein can be further modified to make it func-
tional (see Figure 3.6).
Differential Gene Expression 55
Cis regulatory elements: The on, off, and dimmer switches of a gene
In addition to the protein-encoding region of the gene, regulatory sequences can be
located on either end of the gene (or even within it). These regulatory sequences—the
promoter, enhancers, and silencers—are necessary for controlling where, when, and how
actively a particular gene is transcribed. When located on the same chromosome as
the gene (and they usually are), they can be referred to as cis-regulatory elements. 5
Promoters are sites where RNA polymerase II binds to the DNA sequence to initiate
transcription. Promoters of genes that synthesize messenger RNAs (i.e., those genes
that encode proteins 6) are typically located immediately upstream from the site where
RNA polymerase II initiates transcription. Most of these promoters contain a stretch
of about 1000 base pairs that is rich in the sequence CG, often referred to as CpG (a C
and a G connected through the normal phosphate bond). These regions are called CpG
islands (Down and Hubbard 2002; Deaton and Bird 2011). The reason transcription is
initiated near CpG islands is thought to involve proteins called basal transcription fac-
tors, which are present in every cell and specifically bind to the CpG-rich sites. These
basal transcription factor proteins form a “saddle” that can recruit RNA polymerase II
and position it appropriately for the polymerase to begin transcription (Kostrewa et al.
2009).
RNA polymerase II does not bind to every promoter in the genome at the same time,
however. Rather, it is recruited to and stabilized on the promoters by DNA sequences
called enhancers that signal where and when a promoter can be used and how much
gene product to make. In other words, enhancers control the efficiency and rate of
transcription from a specific promoter (see Ong and Corces 2011). In contrast, DNA
sequences called silencers can prevent promoter use and inhibit gene transcription.
Transcription factors are proteins that bind DNA with precise sequence recognition
for specific promoters, enhancers, or silencers. Transcription factors that bind enhanc-
ers can activate a gene by (1) recruiting enzymes (such as histone acetyltransferases)
that break up the nucleosomes in the area or (2) stabilizing the transcription initiation
complex as described above. Thus, transcription factors usually work in two nonexclu-
sive ways:
1. Once bound, transcription factors can bind cofactors that recruit nucleosome-
modifying proteins (such as histone methyltransferases and acetyltransferases)
that make that area of the genome accessible for RNA polymerase II to bind and
enable the chromatin in that vicinity to be unwound and transcribed.
2. Transcription factors can form bridges, looping the chromatin such that the tran-
scription factors (and their histone-modifying enzymes) on enhancers can be
brought into the vicinity of the promoter. In the activation of mammalian β-globin
5
Cis- and trans-regulatory elements are so named by analogy with E. coli genetics and organic
chemistry. Therefore, cis-elements are regulatory elements that reside on the same chromo-
some (cis-, “on the same side as”), whereas trans-elements are those that could be supplied
from another chromosome (trans-, “on the other side of”). The term cis-regulatory elements now
refers to those DNA sequences that regulate a gene on the same stretch of DNA (i.e., the pro-
moters and enhancers). Trans-regulatory factors are soluble molecules whose genes are located
elsewhere in the genome and that bind to the cis-regulatory elements. They are usually tran-
scription factors or microRNAs. Some evidence points to the ability of an enhancer to activate
a trans-promoter (i.e., a promoter on another chromosome), but such cases appear to be excep-
tional and rare events (Noordermeer et al. 2011).
6
In the case of protein-encoding genes, RNA polymerase II is used for transcription. There are
several types of RNA that do not encode proteins, including the ribosomal RNAs and transfer
RNAs (which are used in protein synthesis) and the small nuclear RNAs (which are used in
RNA processing). In addition, there are regulatory RNAs (such as the microRNAs and long
noncoding RNAs that we will discuss later in this chapter) that are involved in regulating gene
expression and are not translated into peptides. These regulatory RNAs often are transcribed
by other RNA polymerases.
56 Chapter 3
(A)
Ldb1
Figure 3.7 The bridge between enhancer and promoter can be
made by transcription factors. Certain transcription factors bind to
DNA on the promoter (where RNA polymerase II will initiate transcrip-
tion), whereas other transcription factors bind to the enhancer (which
regulates when and where transcription can occur). Other transcrip-
Enhancer Promoter tion factors do not bind to the DNA; rather, they link the transcription
factors that have bound to the enhancer and promoter sequences. In
GATA1
this way, the chromatin loops to bring the enhancer to the promoter.
No transcription
The example shown here is the mouse β-globin gene. (A) Transcrip-
tion factors assemble on the enhancer, but the promoter is not used
Enhancer until the GATA1 transcription factor binds to the promoter. (B) GATA1
(B) can recruit several other factors, including Ldb1, which forms a link
uniting the enhancer-bound factors to the promoter-bound factors.
GATA1
(After Deng et al. 2012.)
b1
b1 Ld
Ld RNA
polymerase genes, such a bridge uniting the promoter and enhancer is
GATA1
formed by proteins that bind to transcription factors on both
the enhancer and promoter sequences. These proteins recruit
Promoter the nucleosome-modifying enzymes and transcription-
Transcription associated factors (TAFs) that stabilize RNA polymerase II
(FIGURE 3.7; Gurdon 2016; Deng et al. 2012; Noordermeer
and Duboule 2013).
Pausing
Elongation
(E)
PE2
Mediator Mediator TEC
RNA PII
IIA IID NELF RNA PII IIA IID
Nascent
transcript blocked Transcript elongates
with reporter genes into embryos and then monitor the spatial and temporal pattern
of expression displayed by the visible protein product of the reporter gene (such as
green fluorescent protein, GFP; FIGURE 3.9A). If the sequence contains an enhancer, the
reporter gene should become active at particular times and places. For instance, the E.
coli gene for β-galactosidase (the lacZ gene) can be used as a reporter gene and fused to
(A) (B)
(A)
Brain-specific Limb-specific
(i) enhancer enhancer mRNA expressed
in brain and limb
Gene A Gene A
expressed
in brain Brain-expressed transcription factors
and limb Brain-specific enhancer
(ii)
Mediator mRNA expressed
in brain
Gene A RNA PII
expressed
in brain
(iii) Limb-expressed
transcription factors
mRNA expressed
Gene A in limb
expressed RNA PII
in limb
Exons: Promoter 1 2 3 4 5 5a 6 7
(C)
5′…CCCTTTATTGATTGACAGAAGCTGG… 3′ β-galactosidase
Pbx1- Meis-
binding binding
sequence sequence
Figure 3.10 Enhancer region modularity. (A) Model for gene regulation by enhancers. (i)
The top diagram shows the exons, introns, promoter, and enhancers of a hypothetical gene A.
In situ hybridization (left) shows that gene A is expressed in limb and brain cells. (ii) In develop-
ing brain cells, brain-specific transcription factors bind to the brain enhancer, causing it to bind
to the Mediator, stabilize RNA polymerase II at the promoter, and modify the nucleosomes in
the region of the promoter. The gene is transcribed in the brain cells only; the limb enhancer
does not function. (iii) An analogous process allows for transcription of the same gene in the
cells of the limbs. The gene is not transcribed in any cell type whose transcription factors the
enhancers cannot bind. (B) The Pax6 protein is critical in the development of several widely
different tissues. Enhancers direct Pax6 gene expression (yellow exons 1–7) differentially in the
pancreas, the lens and cornea of the eye, the retina, and the neural tube. (C) A portion of the
DNA sequence of the pancreas-specific enhancer element. This sequence has binding sites
forGilbert
the Pbx1 and Meis transcription factors; both must be present to activate Pax6 in the pan-
Developmental
creas. (D) WhenBiology 11e, Sinauer Associates
the β-galactosidase reporter gene is fused to the Pax6 enhancers for expres-
DevBio11e_03.10
sion in the pancreas andDate 05-24-16 the enzyme is seen in those tissues. (A after Visel et al.
lens/cornea,
2009; D from Williams et al. 1998, courtesy of R. A. Lang.)
60 Chapter 3
upstream from the promoter contains the regions necessary for Pax6 expression in the
Developing Questions
pancreas, whereas a second enhancer activates Pax6 expression in surface ectoderm
What are the consequences (lens, cornea, and conjunctiva). A third enhancer resides in the leader sequence; it con-
of enhancer modularity to
tains the sequences that direct Pax6 expression in the neural tube. A fourth enhancer,
a developing individual?
To a species? How might a located in an intron shortly downstream of the translation initiation site, determines
mutation in an enhancer the expression of Pax6 in the retina. The Pax6 gene illustrates the principle of enhancer
affect development? For modularity, wherein genes having multiple, separate enhancers allow a protein to be
instance, what might expressed in several different tissues but not expressed at all in others.
occur in an embryo if there
were a mutation in the combinatorial association Although there is modularity among enhancers, there
enhancer region of the
are codependent units within each enhancer. Enhancers contain regions of DNA that
Pax6 gene? Could such a
mutation have evolutionary bind transcription factors, and it is this combination of transcription factors that activates
importance? Hint: It does, the gene. For instance, the pancreas-specific enhancer of the Pax6 gene has binding
and it’s profound! sites for the Pbx1 and Meis transcription factors (see Figure 3.10C). Both need to be
present for the enhancer to activate Pax6 in the pancreas cells (Zhang et al. 2006).
Moreover, the product of the Pax6 gene encodes a transcription factor that works
in combinatorial partnerships with other transcription factors. Figure 3.11 shows two
gene enhancer regions that bind Pax6. The first is that of the chick δ1 lens crystallin gene
(FIGURE 3.11A ; Cvekl and Piatigorsky 1996; Muta et al. 2002). This gene encodes crys-
tallin, a lens protein that is transparent and allows light to reach the retina. A promoter
in the crystallin gene contains binding sites for TBP and Sp1 (basal transcriptional fac-
tors that recruit RNA polymerase II to the DNA). The gene also has an enhancer in its
third intron that controls the time and place of crystallin expression. This enhancer has
two Pax6-binding sites. The Pax6 protein works with the Sox2 and l-Maf transcription
factors to activate the crystallin gene only in those head cells that are going to become
lens. As we will see in Chapter 16, this means that the cell (1) must be head ectoderm
(which expresses Pax6), (2) must be in the region of the ectoderm capable of forming
eyes (expressing l-Maf), and (3) must be in contact with the future retinal cells (which
induce Sox2 expression; see Kamachi et al. 1998).
Meanwhile, Pax6 also regulates the transcription of the genes encoding insulin,
Figure 3.11 Modular transcriptional glucagon, and somatostatin in the pancreas (FIGURE 3.11B). Here, Pax6 works in coop-
regulatory regions using Pax6 as an
eration with other transcription factors such as Pdx1 (specific for the pancreatic region
activator. (A) Promoter and enhancer of
the chick δ1 lens crystallin gene. Pax6
of the endoderm) and Pbx1 (Andersen et al. 1999; Hussain and Habener 1999). So, in
interacts with two other transcription the absence of Pax6, the eye fails to form, and the endocrine cells of the pancreas do
factors, Sox2 and l-Maf, to activate this not develop properly; these improperly developed endocrine cells produce deficient
gene. The protein δEF3 binds factors that amounts of their hormones (Sander et al. 1997; Zhang et al. 2002).
permit this interaction; δEF1 binds factors Other genes are activated by Pax6 binding, and one of them is the Pax6 gene itself.
that inhibit it. (B) Promoter and enhancer Pax6 protein can bind to a cis-regulatory element of the Pax6 gene (Plaza et al. 1993).
of the rat somatostatin gene. Pax6 acti-
So, once the Pax6 gene is turned on, it will continue to be expressed, even if the signal
vates this gene by cooperating with the
that originally activated it is no longer present.
Pbx1 and Pdx1 transcription factors. (A
after Cvekl and Piatigorsky 1996; B after
Andersen et al. 1999.)
Enhancer DNA
Pax6 +2218
(A) Promoter +1 +1706 L-Maf
Sp1 TBP Sox2 δEF3
δEF1
crystallin gene (lens)
(B)
–450 –45
Pdx1 Pbx1 Pdx1 Pbx1 Pdx1 Pax6 CREB +1
TBP
TATA somatostatin gene (pancreas)
Enhancer
Differential Gene Expression 61
gene regulatory elements: summary Enhancers and silencers enable genes for
specific proteins to use numerous transcription factors in various combinations to con-
trol their expression. Thus, enhancers and silencers are modular such that, for example,
the Pax6 gene is regulated by enhancers that enable it to be expressed in the eye, pan-
creas, and nervous system, as seen in Figure 3.10B; this is the Boolean “OR” func-
tion. But within each cis-regulatory module, transcription factors work in a combinatorial
fashion such that Pax6, l-Maf, and Sox2 proteins are all needed for the transcription
of crystallin in the lens (see Figure 3.11A); that is the Boolean “AND” function. The
combinatorial association of transcription factors on enhancers leads to the spatiotem-
poral output of any particular gene (see Peter and Davidson 2015; Zinzen et al. 2009).
This “AND” function may be extremely important in activating entire groups of genes
simultaneously.
Homeodomain:
Hox Hoxa1, Hoxb2, etc. Axis formation
POU Pit1, Unc-86, Oct-2 Pituitary development; neural fate
Lim Lim1, Forkhead Head development
Pax Pax1, 2, 3, 6, etc. Neural specification; eye development
Basic helix-loop-helix (bHLH) MyoD, MITF, daughterless Muscle and nerve specification; Drosophila sex
determination; pigmentation
Basic leucine zipper (bZip) C/EBP, AP1, MITF Liver differentiation; fat cell specification
Zinc-finger:
Standard WT1, Krüppel, Engrailed Kidney, gonad, and macrophage development;
Drosophila segmentation
Nuclear hormone receptors Glucocorticoid receptor, estrogen Secondary sex determination; craniofacial development;
receptor, testosterone receptor, limb development
retinoic acid receptors
Sry-Sox Sry, SoxD, Sox2 Bend DNA; mammalian primary sex determination;
ectoderm differentiation
8
MITF stands for microphthalmia-associated transcription factor.
Differential Gene Expression 63
9
Pax stands for “paired box,” and “box” refers to its DNA-binding domain. Pax proteins are
homeodomain transcription factors that contain a paired domain for binding to DNA. Studies
on Drosophila have shown that the loss of a homeodomain transcription factor causes dramatic
homeotic transformations in structures, such as the transformation of an antenna into a leg.
10
E-box and M-box refer to “Enhancer” and “Myc” respectively, with “box” meaning DNA-
binding domain.
64 Chapter 3
Gilbert 11
CTCF stands for CCCTC-binding Factor. Although we highlight its role as an insulating fac-
Developmental Biology 11e, Sinauer Associates tor, CTCF can also contribute to chromatin architecture and in some cases activate transcrip-
DevBio11e_03.25 Date 03-02-16 tion by bringing enhancers in contact with promoters. (See Kim and Kaang 2015.)
Differential Gene Expression 65
SCIENTISTS SPEAK 3.3 Enjoy a question and answer session with Dr. Derrick
Rossi on the generation of iPSC with mRNA.
Another example of possible master regulators came from Doug Melton’s lab, which
tested whether select transcription factors could convert pancreatic cells of a diabetic
mouse into insulin-producing β cells. The researchers infected the pancreatic cells with
harmless viruses containing the genes for three transcription factors: Pdx1, Ngn3, and
MafA (FIGURE 3.15 ; Zhou et al. 2008; Cavelti-Weder et al. 2014; Melton 2016). In early
development, Pdx1 protein stimulates the outgrowth of the digestive tube that results
in the pancreatic buds. This transcription factor is found throughout the pancreas and
is critical for specifying that organ’s endocrine (hormone-secreting) cells and activating
genes that encode endocrine proteins. Ngn3 is a transcription factor found in endocrine,
but not exocrine (digestive-enzyme secreting), pancreatic cells. MafA, a transcription
factor regulated by glucose levels, is found only in insulin-secreting β cells and activates
transcription of the insulin gene. During normal development, Pdx1, Ngn3, and MafA
activate other transcription factors that together work to turn a pancreatic endoder-
mal cell into an insulin-secreting β cell. After experimentally inducingDevelopmental Biology
production of 11eC
Fig. 03.14
Dragonfly Media Group
05/24/16
66 Chapter 3
(A)
(B)
self-assembles through (1) the ability of the maternal transcription factors to recognize
Developing Questions
cis-regulatory elements of particular genes that encode other transcription factors (when
How can one actually in doubt . . .) and (2) the ability of this new set of transcription factors to activate paracrine
determine the GRN for a
signaling pathways that activate or inhibit specific transcription factors in neighboring
single cell? Doing so is both
a conceptual and technical cells (see Figure 3.16A). The studies show the regulatory logic by which the genes of the
challenge. The number of sea urchin interact to specify and generate characteristic cell types. This set of intercon-
genes turned on and off nections among genes specifying cell types is referred to as a gene regulatory network
(never mind differences (GRN), a term first coined by Davidson’s group. Therefore, each cell lineage, cell type, and
in rate and amount of likely each individual cell can be defined by the GRN that it possesses at that moment in time.
expression) in a given GRN
is staggeringly immense. Embryonic development is an enormous informational transaction, in which DNA
Obtaining an accurate sequence data generate and guide the system-wide deployment of specific cellular
assessment of expressed functions.
genes is the first hurdle, E. H. Davidson (2010)
techniques for which are
discussed later in this SCIENTISTS SPEAK 3.4 Listen to a question and answer session with
chapter. These genes then Dr. Marianne Bronner-Fraser on neural crest GRNs in lamprey.
have to be organized into
a logic network based on
experimentally determined Mechanisms of Differential Gene Transcription
functions. What can be
learned by comparing the During the twentieth century, we found the actors in the drama of gene transcription,
GRNs of cells from different but not until the twenty-first century were their scripts discovered. How does one locate
regions of an embryo, or the places on the gene where a particular transcription factor binds, or where nucleo-
at different developmental somes with specific modifications are localized? How does one determine the “regula-
stages, or under different tory architecture” of individual genes and of the entire genome? The recent ability to
conditions, or even from
identify protein-specific DNA-binding sequences using ChIP-Seq technology showed
different species? The
answer to these questions that there are different types of promoters and that they use different scripts to transcribe
is, lots, and that represents their genes. ChIP-Seq , for Chromatin Immunoprecipitation-Sequencing, is a technique
the new frontier of that enables a researcher to use known transcription factors as bait to isolate the DNA
developmental genetics. sequences they specifically recognize (Johnson et al. 2007; Jothi et al. 2008). We elaborate
on the ChIP-Seq methodology in the “Tools” section of this chapter (see Figure 3.37) and
describe below the insight that ChIP-Seq has provided on differential gene expression.
(A) High CpG-content promoters (HCPs) (B) Low CpG-content promoters (LCPs)
TF
RNA PII
Poised
(intermediate
state)
Bivalent chromatin modifications H3K4me2 chromatin modifications
Repressed
(inactive)
Figure 3.17 Chromatin regulation in HCPs and LCPs. Promoters histone modification, but not by extensive DNA methylation. (B)
with high and low CpG content have different modes of regulation. Active LCPs, like HCPs, have nucleosomes rich in H3K4me3 and
(A) HCPs are typically in an active state, with unmethylated DNA and low methylation but require stimulation by transcription factors (TF).
nucleosomes rich in H3K4me3. The open chromatin allows RNA Poised LCPs are capable of being activated by transcription factors
polymerase II (RNA PII) to bind. The poised state of HCPs is biva- and have relatively unmethylated DNA and nucleosomes enriched
lent, having both activating (H3K4me3) and repressive (H3K27me3) in H3K4me2. In their usual state, LCPs are repressed by methylated
modifications of the nucleosomes. RNA polymerase II can bind but DNA nucleosomes rich in H3K27me3. (After Zhou et al. 2011.)
not transcribe. The repressed state is characterized by repressive
thaliana has among the highest percentages of methylated cytosines at 14%, the mouse
at 7.6%, and the bacterium E. coli at 2.3% (Capuano et al. 2014). Interestingly, for years
researchers thought that the model organisms Drosophila and C. elegans did not have
methylated cytosines, yet recent studies using more sensitive methods12 have detected
low levels of DNA methylation at cytosines (0.034% in Drosophila and 0.0019–0.0033%
in C. elegans; Capuano et al. 2014; Hu et al. 2015). Currently, using these same high-
resolution methods, no cytosine methylation has been found in yeast. Why such varied
amounts of DNA methylation exist among species remains an open question.
In vertebrates, the presence of methylated cytosines in a gene’s promoter correlates
with the repression of transcription from that gene. In developing human and chick red
blood cells, for example, the DNA of the globin gene promoters is almost completely
unmethylated, whereas the same promoters are highly methylated in cells that do not
produce globins. Moreover, the methylation pattern changes during development (FIG-
URE 3.18B). The cells that produce hemoglobin in the human embryo have unmethyl-
ated promoters in the genes encoding the ε-globins (“embryonic globin chains”) of
embryonic hemoglobin. These promoters become methylated in the fetal tissue as the
genes for fetal-specific γ-globin (rather than the embryonic chains) become activated
(van der Ploeg and Flavell 1980; Groudine and Weintraub 1981; Mavilio et al. 1983).
Similarly, when fetal globin gives way to adult ( β) globin, promoters of the fetal (γ)
globin genes become methylated.
As described in this chapter, methylated DNA is associated with stable DNA silenc-
ing either (1) by interfering with the binding of gene-activating transcription factors or
(2) by recruiting repressor proteins that stabilize nucleosomes in a restrictive manner
along the gene. The presence of a methyl group in the minor groove of DNA can pre-
vent certain transcription factors from binding to the DNA, thereby preventing the gene
from being activated (Watt and Molloy 1988).
For example, during early embryonic development in mice, the Igf2 gene (for insulin-
like growth factor) is transcribed only from the sperm-derived (paternal) chromosome
7. The egg-derived (maternal) Igf2 gene does not function during embryonic develop-
ment because the CTCF protein is an inhibitor that can block the promoter from get-
ting activation signals from enhancers. The CTCF protein binds to a region near the
Igf2 gene in females because this region is not methylated. Once bound, it prevents the
maternally derived Igf2 gene from functioning. In the paternally derived chromosome
7, the region where CTCF would bind is methylated. CTCF cannot bind, and the gene
is not inhibited from functioning (FIGURE 3.22; Bartolomei et al. 1993; Ferguson-Smith
et al. 1993; Bell and Felsenfeld 2000).
In humans, misregulation of IGF2 methylation causes Beckwith-Wiedemann growth
syndrome. Although DNA methylation is the mechanism for imprinting this gene in
both mice and humans, the mechanisms responsible for the differential Igf2 methylation
between sperm and egg appear to be very different in the two species (Ferguson-Smith
et al. 2003; Walter and Paulsen 2003). Differential methylation is one of the most impor-
tant mechanisms of epigenetic changes and is a reminder that an organism cannot be
explained solely by its genes. One needs knowledge of developmental parameters (such
as whether the gene was modified by the gamete transmitting it) as well as genetic ones.
WEb Topic 3.4 Poised chromatin Learn more about the poised state of chroma-
tin, which uses high CpG-content promoters for rapid transcriptional responses to devel-
opmental signals.
WEb Topic 3.6 The nuclear envelope’s role in gene regulation There
is evidence that many genes are regulated by enzymes that are localized to the nuclear
envelope. The inner portion of the nuclear envelope (the nuclear lamina) may be critical in
activating and silencing transcription.
Figure 3.22 Regulation of the imprinted Igf2 gene Enhancer H19 DMR Igf2
in the mouse. This gene is activated by an enhancer Transcription No transcription
element it shares with the H19 gene. The differentially
methylated region (DMR) is a sequence located between (B) Sperm-derived (paternal)
the enhancer and the Igf2 gene and is found on both chromosome
sperm- and egg-derived chromosomes. (A) In the egg-
derived chromosome, the DMR is unmethylated. The
CTCF insulator protein binds to the DMR and blocks the Methyl
enhancer signal. (B) In the sperm-derived chromosome, group
the DMR is methylated. The CTCF insulator protein can-
not bind to the methylated sequence, and the signal from Enhancer H19 DMR Igf2
the enhancer is able to activate Igf2 transcription. No transcription Transcription
Differential Gene Expression 73
15
Mutations can generate species-specific splicing events, and tissue-specific differences in
nRNA splicing among vertebrate species occur 10 to 100 times more frequently than changes in
gene transcription (Barbosa-Morais et al. 2012; Merkin et al. 2012).
74 Chapter 3
(A) Cassette exon: Type II procollagen (B) Mutually exclusive exons: FgfR2
IIA: Precursor chondrocytes FgfR-2IIIb: Limb ectoderm
1 2 3 7 8 10
1 2 3 7 8 9 10
(C) Alternative 5′ splice site: Bcl-x (D) Alternative 3′ splice site: Chordin
Bcl-xL Wild-type
1 2 3 8 9 10
1 2 3 8 9 10
nRNA
4 6 9 17
mRNA 1 2 3 5 7 8 10 11 12 13 14 15 16 18 19 20 21 22 23 24
4 6 17
Protein 9
(C)
Exon 4.1 Exon 4.2 Exon 4.9 Exon 4.12
FIGURE 3.25 The Dscam gene of Drosophila can produce 38,016 different types of proteins
by alternative nRNA splicing. (A) The gene contains 24 exons. Exons 4, 6, 9, and 17 are encoded
by sets of mutually exclusive possible sequences. Each messenger RNA will contain one of the
12 possible exon 4 sequences, one of the 48 possible exon 6 alternatives, one of the 33 possible
Developing Questions
exon 9 alternatives, and one of the 2 possible exon 17 sequences. The Drosophila Dscam gene About 92% of human genes
is homologous to a DNA sequence on human chromosome 21 that is expressed in the nervous are thought to produce
system. Disturbances of this gene in humans may contribute to the neurological defects of Down multiple types of mRNA.
syndrome. (B) Dscam is required for self-avoidance between dendrites that fosters a dispersed Therefore, even though
pattern of dendrites (left). Loss of Dscam in Drosophila, however, causes crossing and fascicu- the human genome
lated growth of dendrites from the same neuron (right; arrows). (C) Expression of alternatively may contain 20,000
spliced forms of Dscam (4.1, 4.2, 4.9, 4.12) in isolated populations of mushroom body neurons genes, its proteome—
(white) in midpupal brains of the fly. The full mushroom body lobes and associated Kenyon cells the number and type of
are seen with antibodies to anti-Fasciclin II and anti-Dachshund, respectively (blue). (A after proteins encoded by the
Yamakawa et al. 1998, Saito et al. 2000; B from Wu et al. 2012; C from Miura et al. 2013.) genome—is far larger and
more complex. “Human
genes are multitaskers,”
isoforms are needed to ensure that each neuron acquires a unique identity ( FIGURE notes Christopher Burge,
one of the scientists who
3.25C; Schmucker 2007; Millard and Zipursky 2008; Miura et al. 2013). Moreover, the
calculated this figure
combination of expressed Dscam1 isoforms can change in a given neuron with each (Ledford 2008). This fact
new round of RNA synthesis! Such timely changes in alternative splicing may be in explains an important
response to neuron-neuron interactions during the process of dendritic arborization. paradox. Homo sapiens
The Drosophila genome is thought to contain only 14,000 genes, but here is a single gene has around 20,000 genes
that encodes three times that number of proteins! in each nucleus; so does
the nematode C. elegans,
Gilbert
WEb Topic 3.7 Control of early development by nuclear RNA selection a tubular creature with
Developmental
In addition Biology 11e, Sinauer
to alternative nRNAAssociates
splicing, the nuclear RNA to mRNA stage can also be only 959 cells. We have
DevBio11e_03.25 Date 03-31-16 more cells and cell types
regulated by RNA “censorship”—selecting which nuclear transcripts are processed into
in the shaft of a hair than
cytoplasmic messages. Different cells select different nuclear transcripts to be pro-
C. elegans has in its entire
cessed and sent to the cytoplasm as messenger RNA.
body. What’s this worm
doing with approximately
WEb Topic 3.8 So you think you know what a gene is? Different scientists
the same number of genes
have different definitions, and nature has given us some problematic examples of DNA as we have?
sequences that may or may not be considered genes.
76 Chapter 3
Muscle cells
stop dividing Muscle hypertrophy
(B)
2001; Strässer and Hurt 2001). The proteins coating the 5′ and 3′ ends of the RNA also
change. The nuclear cap binding protein at the 5′ end is replaced by eukaryotic transla-
tion initiation factor eIF4E, and the polyA tail becomes bound by the cytoplasmic polyA
binding protein. Although both of these changes facilitate the initiation of translation,
there is no guarantee that the RNA will be translated once it reaches the cytoplasm. The
control of gene expression at the level of translation can occur by many means; some of
the most important of them are described below.
Gilbert
DifferentialBiology
Developmental mRNA 11e,longevity
Sinauer Associates
DevBio11e_03.26 Date 04-08-16
The longer an mRNA persists, the more protein can be translated from it. If a message
with a relatively short half-life were selectively stabilized in certain cells at certain times,
it would make large amounts of its particular protein only at those times and places.
The stability of a message often depends on the length of its polyA tail. The length,
in turn, depends largely on sequences in the 3′ untranslated region, certain ones of
which allow longer polyA tails than others. If these 3′ UTRs are experimentally traded,
the half-lives of the resulting mRNAs are altered: long-lived messages will decay rapid-
ly, whereas normally short-lived mRNAs will remain around longer (Shaw and Kamen
1986; Wilson and Treisman 1988; Decker and Parker 1995).
In some instances, mRNAs are selectively stabilized at specific times in specific cells.
The mRNA for casein, the major protein of milk, has a half-life of 1.1 hours in rat mam-
mary gland tissue. During periods of lactation, however, the presence of the hormone
prolactin increases this half-life to 28.5 hours (FIGURE 3.27; Guyette et al. 1979). In the
development of the nervous system, a set of RNA binding proteins called Hu proteins
(HuA, HuB, HuC, and HuD) stabilizes two groups of mRNAs that would otherwise
78 Chapter 3
10
0 3 6 12 18 24 30 36 42 48 perish quickly (Perrone-Bizzozero and Bird 2013). One group
Time after chase (hours) of target mRNAs encodes proteins that stop neuronal pre-
cursor cells from dividing, and the second group of mRNAs
encodes proteins that initiate neuronal differentiation (Okano
and Darnell 1997; Deschênes-Furry et al. 2006, 2007). Thus,
once the Hu proteins are made, the neuronal precursor cells
(A) Wild-type (B) Futile cycle mutant can become neurons.17
Gilbert
Developmental Biology 11e, Sinauer Associates
Differential Gene Expression 79
Most translational regulation in oocytes is negative because the “default state” of the FIGURE 3.29 Translational regulation
maternal mRNA is to be available for translation. Therefore, there must be inhibitors in oocytes. (A) In Xenopus oocytes, the
preventing the translation of these mRNAs in the oocyte, and these inhibitors must 3′ and 5′ ends of the mRNA are brought
together by maskin, a protein that binds
somehow be removed at the appropriate times around fertilization. The 5′ cap and the
CPEB on the 3′ end and eukaryotic ini-
3′ UTR seem especially important in regulating the accessibility of mRNA to ribosomes. tiation factor 4E (eIF4E) on the 5′ end.
If the 5′ cap is not made or if the 3′ UTR lacks a polyA tail, the message probably will not Maskin blocks the initiation of translation
be translated. The oocytes of many species have “used these ends as means” to regulate by preventing eIF4E from binding eIF4G.
the translation of their mRNAs. For instance, the oocyte of the tobacco hornworm moth (B) When stimulated by progesterone
makes some of its mRNAs without their methylated 5′ caps. In this state, they cannot during ovulation, a kinase phosphorylates
be efficiently translated. At fertilization, however, a methyltransferase completes the CPEB, which can then bind CPSF. CPSF
can bind polyA polymerase and initiate
formation of the caps, and these mRNAs can then be translated (Kastern et al. 1982).
growth of the polyA tail. PolyA binding
In amphibian oocytes, the 5′ and 3′ ends of many mRNAs are brought together to protein (PABP) can bind to this tail and
form repressive loop structures by a protein called maskin (Stebbins-Boaz et al. 1999; then bind eIF4G in a stable manner. This
Mendez and Richter 2001). Maskin links the 5′ and 3′ ends into a circle by binding to initiation factor can then bind eIF4E and,
two other proteins, each at opposite ends of the message. First, it binds to the cyto- through its association with eIF3, position
plasmic polyadenylation-element-binding protein (CPEB) attached to the UUUUAU a 40S ribosomal subunit on the mRNA.
sequence in the 3′ UTR; second, maskin also binds to the eIF4E factor that is attached (After Mendez and Richter 2001.)
to the cap sequence. In this configuration, the mRNA cannot be translated (FIGURE
3.29A). The binding of eIF4E to maskin is thought to prevent the binding of eIF4E to
eIF4G, a critically important translation initiation factor that brings the small ribosomal
subunit to the mRNA.
Mendez and Richter (2001) proposed an intricate scenario to explain how mRNAs
bound together by maskin become translated at about the time of fertilization. At ovu-
lation (when the hormone progesterone stimulates the last meiotic divisions of the
oocyte and the oocyte is released for fertilization), a kinase activated by progester-
one phosphorylates the CPEB protein. The phosphorylated CPEB can now bind to the
cleavage and polyadenylation specificity factor, CPSF (Mendez et al. 2000; Hodgman
et al. 2001). The bound CPSF protein sits on the 3′ UTR and complexes with a poly-
merase that elongates the polyA tail of the mRNA. The important aspect of this model
is that the length of the polyA tail is what is being manipulated to control translation.
In oocytes, a message having a short polyA tail is not degraded, yet such messages are
Gilbert
also not translated.
Developmental Once
Biology 11e the tail
, Sinauer is extended, however, molecules of the polyA bind-
Associates
ing protein (PABP)
DevBio11e_03.29 can attach to
Date 03-16-16 the growing tail. PABP stabilizes the eIF4G to eIF4E
interaction (outcompeting maskin) to facilitate ribosomal assembly around the mRNA
and initiate translation (FIGURE 3.29B).
In the Drosophila oocyte, Bicoid protein initiates head and thorax formation. Bicoid
can act both as a transcription factor (activating genes such as hunchback that are nec-
essary for forming the fly anterior) and as a translational inhibitor of those genes such
as caudal that are critical for making the fly posterior (see Chapters 2 and 9). Bicoid
inhibits caudal mRNA translation by binding to a “bicoid recognition element,” a series
of nucleotides in the 3′ UTR of the caudal message. Once there, Bicoid can bind with
and recruit another protein, d4EHP, which can compete with eIF4E protein for the
cap. Without eIF4E, there is no association with eIF4G, and caudal mRNA becomes
untranslatable. As a result, the caudal message is not translated in the anterior of the
embryo (where Bicoid is abundant) but is active in the posterior portion of the embryo.
80 Chapter 3
FIGURE 3.30 Model of ribosomal heterogeneity in mice. (A) (B) Rpl38 mutant
(A) Ribosomes have slightly different proteins depending on
the tissue in which they reside. Ribosomal protein Rpl38 (i.e., Wild-type Rpl38 mutant
protein 38 of the large ribosomal subunit) is concentrated in
those ribosomes found in the somites that give rise to the ver-
tebrae. (B) A wild-type embryo (left) has normal vertebrae and
normal Hox gene translation. Mice deficient in Rpl38 have an
extra pair of vertebrae, tail deformities, and reduced Hox gene
translation. (After Kondrashov et al. 2011.) Rpl38
expression
Figure 3.31 Hypothetical model of the regulation of lin-14 mRNA trans- lin-14 mRNA
lation by lin-4 RNAs. The lin-4 gene does not produce an mRNA. Rather, it
produces small RNAs that are complementary to a repeated sequence in
the 3′ UTR of the lin-14 mRNA, which bind to it and prevent its translation.
(After Wickens and Takayama 1995.) Coding A
A A
sequence 5′ A U 3′
lin-14 C C U C A U G C UCUC A GGA A C
lin-4 U G A G UG U G A G A G U C C U U G
et al. 2003; Lagos-Quintana et al. 2003). The initial RNA tran- 3′
A A
C C
C
5′
UC
script (which may contain several repeats of the miRNA sequence)
forms hairpin loops wherein the RNA finds complementary 5′ A
A A 3′
structures within its strand. Because short double-stranded RNA A C AUUC A CUC A GGAAU
UGUGAGU GAGU C CUUG
molecules can resemble pathogenic viral genomes, the cell has a G A C
3′ U C 5′
mechanism to both recognize these structures and use them as G C
A U
guides for their eradication (Wilson and Doudna 2013). Interest- AC
SCIENTISTS SPEAK 3.5 Listen to a question and answer with Dr. Ken Kempues.
See the follow-up question associated with Question 4 to hear about the first dem-
onstration of double-stranded RNA in C. elegans.
SCIENTISTS SPEAK 3.6 Hear a question and answer with Dr. Craig Mello on his
shared Nobel Prize–winning discovery of RNA interference.
MicroRNAs can be used to “clean up” and fine-tune the level of gene products. We
mentioned those maternal RNAs in the oocyte that allow early development Gilbert to occur.
How does the embryo get rid of maternal RNAs once they have been Developmental the 11e, Sinauer Associates
used and Biology
DevBio11e_03.31 Date 03-31-16
embryonic cells are making their own mRNAs? In zebrafish, this cleanup operation is
assigned to microRNAs such as miR430. That is one of the first genes transcribed by the
fish embryonic cells, and there are about 90 copies of this gene in the zebrafish genome.
82 Chapter 3
FIGURE 3.32 Model for RNA interference from siRNA and miRNA.
Nucleus Cytoplasm Exterior Double-stranded siRNA or miRNA that is added to a cell or produced
1 miRNA production through transcription and processed by the Drosha RNAase (1) will
3′ Drosha microprocessor interact with the RNA-induced silencing complex (RISC) made up
miRNA primarily of Dicer and Argonaute that prepares the RNA to be used
dsRNA
as a guide for targeted mechanisms of interference. Specifically, (1)
transcription of siRNA or miRNA form several hairpin regions where
the RNA finds nearby complementary bases with which to pair. The
5′ pri-miRNA is processed into individual pre-miRNA “hairpins” by the
dsRBP Drosha RNAase (as are the siRNAs), and they are exported from the
nucleus. (2–4) Once in the cytoplasm, these double-stranded RNAs
2 Dicing are recognized by and form the RISC complex with Argonaute and
the RNAase, Dicer. (5) Dicer also acts as a helicase to separate the
strands of the double-stranded RNA. (6) One strand (probably rec-
ognized by placement of Dicer) will be used to bind to the 3′ UTRs of
target mRNAs to block translation or to induce cleavage of the target
Dicer transcript, depending (at least in part) on the strength of the comple-
3 Strand
mentarity between the miRNA and its target. siRNA is best known for
selection
the targeting of transcript degradation. (After He and Hannon 2004;
Argonaute Wilson and Doudna 2013.)
RISC-
loading
complex
4 RISC
loading So, the level of miR430 goes up very rapidly. This microRNA has
hundreds of targets (about 40% of the maternal RNA types),
and when it binds to the 3′ UTR of these target mRNAs, these
mRNAs lose their polyA tails and are degraded (FIGURE 3.33 ;
5 Passenger Giraldez et al. 2006; Giraldez 2010). In addition, miR430 repress-
strand es initiation of translation prior to promoting mRNA decay
ejection RISC (Bazzini et al. 2012).
Maternal Zygotic
(B)
Maternal Zygotic
Transcript levels
miRNA (miR430)
Maternal
miR430
Time
(A) Diffusion and local anchoring Figure 3.34 Localization of mRNAs. (A) Diffusion and local
anchoring. nanos mRNA diffuses through the Drosophila egg and is
Anterior Posterior bound (in part by the Oskar protein) at the posterior end of the oocyte.
Nucleus This anchoring allows the nanos mRNA to be translated. (B) Localized
protection. The mRNA for Drosophila heat shock protein (hsp83) will
be degraded unless it binds to a protector protein (in this case, also
at the posterior end of the oocyte). (C) Active transport on the cyto-
skeleton, causing the accumulation of mRNA at a particular site. Here,
bicoid mRNA is transported to the anterior of the oocyte by dynein
and kinesin motor proteins. Meanwhile, oskar mRNA is brought to the
posterior pole by transport along microtubules by kinesin ATPases.
(After Palacios 2007.)
nanos mRNA being translated Anchor WEb Topic 3.9 Stored mRNA in brain cells One of the
nanos RNA most important areas of local translational regulation may be in the
brain. The storage of long-term memory requires new protein syn-
(B) Localized protection thesis, and the local translation of mRNAs in the dendrites of brain
neurons has been proposed as a control point for increasing the
strength of synaptic connections.
Posttranslational Regulation of
Gene Expression
The story is not over when a protein is synthesized. Once a protein
is made, it becomes part of a larger level of organization. It may
become part of the structural framework of the cell, for instance,
or it may become involved in one of the many enzymatic pathways
for the synthesis or breakdown of cellular metabolites. In any case,
hsp83 mRNA Deadenylase the individual protein is now part of a complex “ecosystem” that
Protector protein complex integrates it into a relationship with numerous other proteins.
complex (degrades hsp83 mRNA) Several changes can still take place that determine whether or
not the protein will be active.
(C) Active transport along cytoskeleton Some newly synthesized proteins remain inactive until certain
inhibitory sections are cleaved away. That is what happens when
insulin is made from its larger protein precursor. Some proteins
must be “addressed” to their specific intracellular destinations
to function. Proteins are often sequestered in certain regions of
the cell, such as membranes, lysosomes, nuclei, or mitochondria.
Some proteins need to assemble with other proteins to form a
functional unit. The hemoglobin protein, the microtubule, and
the ribosome are all examples of multiple proteins joining togeth-
er to form a functional unit. In addition, some proteins are not
Microtubules active unless they bind an ion (such as Ca 2+) or are modified by
the covalent addition of a phosphate or acetate group. The impor-
tance of this type of protein modification will become obvious
oskar mRNA bicoid mRNA in Chapter 4 because many of the critical proteins in embryonic
Dynein Kinesin cells just sit there until some signal activates them. Finally, even
when a protein may be actively translated and ready to function,
the cell can immediately transport this protein to the proteasome
for degradation. Why would a cell expend energy synthesizing
a protein only to degrade it? If a cell needed a protein to func-
tion with rapid response at a precise moment in time, it might
consider the energy expenditure worth it. For instance, a neuron
searching for its synaptic target extends a long axonal process in
search of this target in a process called axon guidance (described
Gilbert
Developmental Biology 11e, Sinauer Associates
Differential Gene Expression 85
in Chapter 15). Pathfinding neurons synthesize certain receptor proteins only to imme-
diately degrade them until the cell has reached an environment where a directional
guidance decision is required. Signals in this location cause the cell to suspend the
receptor degradation, enabling the receptors to be transported to the membrane, and
immediately function to guide the axon onward toward its target.
All the processes we have discussed in this chapter—histone modification, interacting
transcription factors, binding of RNA polymerase II to the promoter, elongation of the
mRNAs, kinetics of RNA splicing, and half-lives of mRNAs—are stochastic events. They
depend on the concentrations of the interacting proteins (Cacace et al. 2012; Murugan
and Kreiman 2012; Costa et al. 2013; Neuert et al. 2013). Thus, each organism is a unique
“performance” coordinated by interactions that tell the individual cells which genes are
to be expressed and which are to remain silent. Chapter 4 will detail the mechanisms by
which cells communicate to orchestrate this differential expression of genes.
NBT/BCIP
Alkaline phosphatase
Anti-DIG antibody
DIG-conjugated probe
3′ 5′
5′ G AAAA 3′
can be converted into a colored product by the enzyme. The enzyme should be present
only where the digoxigenin is present, and the digoxigenin should be present only
where the specific complementary mRNA is found. Thus, in FIGURE 3.35C, the dark
blue precipitate formed by the enzyme indicates the presence of the target mRNA.
Crosslink
and shear
genome. In this way, the DNA sequences bound specifically
by particular transcription factors or nucleosomes contain- 2
ing modified histones can be identified very precisely. As you
will see throughout this text, researchers use these identified
enhancer regions to generate transgenic reporter constructs
and organisms that enable visualization of gene expression in DNA-protein
live cells and organisms. complexes in
solution
Deep sequencing: RNA-Seq As emphasized in this chapter,
Antibody
it is the full repertoire of genes expressed by a cell that estab-
binding
lishes the gene regulatory network controlling cell identity.
3
Major improvements in sequencing technology have enabled
whole genomes to be sequenced, but a genome does not Antibody
equal the cell’s transcriptome. To move closer to the identi-
fication of all the transcripts present in a given embryo, tis-
sue, or even single cell, RNA-Seq was developed. RNA-Seq
takes advantage of the high throughput capabilities of next-
generation sequencing technology to sequence and quantify
the RNA present in a cell (FIGURE 3.37). Specifically, RNA is Precipitation and
isolated from samples and converted to complementary DNA purification
(cDNA) with standard procedures using reverse transcriptase.
G
This cDNA is broken up into smaller fragments, and known G
4 A
adaptor sequences are added to the ends. These adaptors allow G
C
immobilization and PCR-based amplification of these tran- T
Sequence
scripts. Next-generation sequencing can analyze these tran- DNA
scripts for both nucleotide sequence and quantity (Goldman
and Domschke 2014). RNA-seq has been particularly power-
ful for comparing transcriptomes between identical samples
differing only in select experimental parameters. One can
ask, how does the array of transcripts differ between tissues Compare to genome
located in different regions of the embryo, or the same tissue 5
at different times of development, or the same tissue treated or
untreated with a specific compound? These comparisons only
scratch the surface of what is possible and what we can learn GGACG
from differences in transcriptomes. The advent of fluorescence ACGTT CT Localize sequence
activated cell sorting (typically spoken as FACS for short) and GGACGT T C on chromosome
GACGT
microdissection has allowed for the precise isolation of tissues
and individual cells, and recent advances in RNA-seq sensitiv-
ity has permitted transcriptomics of single cells.
A common experimental approach has been to design a
targeted deep-sequencing experiment to arrive at a list of
genes associated with a given condition. Researchers then Gilbert
use bioinformatics and an understanding of developmental Developmental Biology 11e, Sinauer Associates
DevBio11e_03.36 Date 03-01-16
88 Chapter 3
Embryo at 33 hours Embryo at 31/2 days Embryo at 6 days biology to select gene candidates from the list to test the func-
tion of these genes in their system.
(A) (B)
CRE-LOX SYSTEM An important experimental use of enhancers has been the con-
ditional elimination of gene expression in certain cell types. For example, the tran-
scription factor Hnf4 a is expressed in liver cells, but it is also expressed prior to liver
formation in the visceral endoderm of the yolk sac. If this gene is deleted from mouse
embryos, the embryos die before the liver can even form. So, if you wanted to study the
consequence of eliminating this gene’s function in the liver, you would need to create
a mutation that would be conditional; that is, you would need a mutation that would
appear only in the liver and nowhere else. How can that be done? Parviz and colleagues
(2002) accomplished it using a site-specific recombinase technology called Cre-lox.
The Cre-lox technique uses homologous recombination to place two Cre-recom-
binase recognition sites (loxP sequences) within the gene of interest, usually flanking
important exons (see Kwan 2002). Such a gene is said to be “floxed” (“loxP-flanked”).
For example, using cultured mouse embryonic stem (ES) cells, Parviz and colleagues
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_03.39 Date 03-31-16
Differential Gene Expression 91
Enhancer
for albumin Cre-recombinase
Exon 2
“Floxed” allele of Hnf4a Cre-recombinase
Exon 1 Exon 2 Exon 3 Cre-recombinase
Exon 1 Exon 3
loxP binding
sites for Cre-recombinase Mutant
Hnf4a gene Exon 1 Exon 3
3 Snapshot Summary
Differential Gene Expression
1. Evidence from molecular biology, cell biology, and 8. Specific transcription factors can recognize specific
somatic cell nuclear cloning has shown that each cell sequences of DNA in the promoter and enhancer
of the body (with very few exceptions) carries the same regions. These proteins activate or repress transcription
nuclear genome. from the genes to which they have bound.
2. Differential gene expression from genetically identi- 9. Enhancers work in a combinatorial fashion. The bind-
cal nuclei creates different cell types. Differential gene ing of several transcription factors can act to promote
expression can occur at the levels of gene transcription, or inhibit transcription from a certain promoter. In some
nuclear RNA processing, mRNA translation, and protein cases, transcription is activated only if both factor A and
modification. Notice that RNA processing can occur factor B are present; in other cases, transcription is acti-
while the RNA is still being transcribed from the gene. vated if either factor A or factor B is present.
3. Chromatin is made of DNA and proteins. The histone 10. Enhancers work in a modular fashion. A gene can con-
proteins form nucleosomes, and the methylation and tain several enhancers, each directing the gene’s expres-
acetylation of specific histone residues can activate or sion in a particular cell type.
repress gene transcription. 11. A gene encoding a transcription factor can maintain itself
4. Histone methylation is often used to silence gene in the activated state if the transcription factor it encodes
expression. Histones can be methylated by histone also activates its own promoter. Thus, a transcription
methyltransferases and can be demethylated by histone factor gene can have one set of enhancer sequences
demethylases. to initiate its activation and a second set of enhancer
5. Acetylated histones are often associated with active sequences (which bind the encoded transcription factor)
gene expression. Histone acetyltransferases add ace- to maintain its activation.
tyl groups to histones, whereas histone deacetylases 12. Transcription factors act in different ways to regulate
remove them. RNA synthesis. Some transcription factors stabilize RNA
6. Eukaryotic genes contain promoter sequences to which polymerase II binding to the DNA, and some disrupt
RNA polymerase II can bind to initiate transcription. To nucleosomes, increasing the efficiency of transcription.
do so, the eukaryotic RNA polymerases are bound by a 13. The Mediator complex often serves as the bridge
series of proteins called transcription-associated factors, between the enhancer and promoter.
including TFIID and TFIIB. 14. Transcription elongation complexes enable the RNA
7. Eukaryotic genes expressed in specific cell types contain polymerase II to be released from the pre-initiation com-
enhancer sequences that regulate their transcription in plex and continue transcribing the DNA.
time and space. Enhancers activate genes on the same 15. A transcription factor usually has three domains: a
chromosome. Enhancer sequences can be within introns sequence-specific DNA-binding domain, a trans-activat-
or the 3′ UTR; they can even be millions of base pairs ing domain that enables the transcription factor to recruit
away from the gene they activate. Enhancers can also histone remodeling enzymes, and a protein-protein
act as silencers to suppress the transcription of a gene in interaction domain that enables it to interact with other
inappropriate cell types. proteins on the enhancer or promoter.
Differential Gene Expression 93
16. Even differentiated cells can be converted into another 25. Alternative RNA splicing can create several different pro-
cell type by the activation of a different set of transcription teins from the same pre-mRNA transcript. These proteins
factors. (splicing isoforms) can play different roles.
17. In low CpG-content promoters, transcription correlates 26. Alternative pre-mRNA slicing is accomplished by splicing
with a lack of DNA methylation on the promoter and site recognition factors that can be different in different
enhancer regions of genes. cell types. Mutations in splice sites can lead to alternative
18. In high CpG-content promoters, the nucleosomes often phenotypes and disease.
allow transcription to start but do not permit the elonga- 27. Some messages are translated only at certain times. The
tion of the nRNA. oocyte, in particular, uses translational regulation to set
19. Differences in DNA methylation can account for genomic aside certain messages that are transcribed during egg
imprinting, wherein a gene transmitted through the sperm development but used only after the egg is fertilized. This
is expressed differently than the same gene transmitted activation is often accomplished either by the removal
through the egg. Some genes are active only if inherited of inhibitory proteins or by the polyadenylation of the
from the sperm or the egg. The imprinting marks appear message.
to be CpG sites that are methylated on either the mater- 28. MicroRNAs can act as translational inhibitors, binding to
nally inherited or paternally inherited locus. the 3′ UTR of the RNA. The microRNA recruits an RNA-
20. Maintaining active gene expression is often accomplished induced silencing complex that either prevents translation
by Trithorax proteins, whereas active repression is main- or leads to the degradation of the mRNA.
tained by Polycomb protein complexes that contain his- 29. Many mRNAs are localized to particular regions of the
tone methyltransferases. oocyte or other cells. This localization appears to be
21. Insulators are DNA sequences that bind CTCF protein. regulated by the 3′ UTR of the mRNA.
Insulators limit the range over which an enhancer can 30. Ribosomes can differ in different cell types, and ribo-
activate a promoter. somes in one cell may be more efficient at translating
22. DNA methylation can block transcription by preventing certain mRNAs than ribosomes in other cells.
the binding of certain transcription factors or by recruiting 31. Differential gene expression is more like interpreting a
histone methyltransferases or histone deacetylases to the musical score than decoding a code script. It is a sto-
chromatin. chastic phenomenon in which there are numerous events
23. Some chromatin is “poised” to respond quickly to devel- that have to take place, each having numerous interac-
opmental signals. The mRNA of poised chromatin has tions between component parts.
begun to be transcribed, and its histones have both acti- 32. A variety of molecular tools have enabled the study of
vating and repressive marks. differentially expressed genes, such as in situ hybridiza-
24. Differential RNA splicing can create a family of related tion for gene expression, ChIP/Seq to identify regula-
proteins by causing different regions of the nRNA to be tory regions of the DNA that proteins bind to, and gene
read as exons or introns. What is an exon in one set of knockdown (RNA interference) and knockout (CRISPR/
circumstances may be an intron in another. Cas9) to test gene function.
Further Reading
Core, L. J. and J. T. Lis. 2008. Transcriptional regulation Jothi, R., S. Cuddapah, A. Barski, K. Cui and K. Zhao. 2008.
through promoter-proximal pausing of RNA polymerase II. Genome-wide identification of the in vivo protein-DNA bind-
Science 319: 1791–1792. ing sites from ChIP-Seq data. Nucl. Acids. Res. 36: 5221–5231.
Fire, A., S. Q. Xu, M. K. Montgomery, S. A. Kostas, S. E. Driver Melton, D. A. 2016. Applied developmental biology: making
and C. C. Mello. 1998. Potent and specific genetic interference human pancreatic beta cells for diabetics. Curr. Top. Dev. Biol.
by double-stranded RNA in Caenorhabditis elegans. Nature 39: 117: 65–73.
806–811. Miura, S. K., A. Martins, K. X. Zhang, B. R. Graveley and S.
Giraldez, A. J. and 7 others. 2006. Zebrafish MiR-430 promotes L. Zipursky. 2013. Probabilistic splicing of Dscam1 establishes
deadenylation and clearance of maternal mRNAs. Science 312: identity at the level of single neurons. Cell 155: 1166–1177.
75–79. Muse, G. W. and 7 others. 2007. RNA polymerase is poised for
Gurdon, J. B. 2016. Cell fate determination by transcription fac- activation across the genome. Nature Genet. 39: 1507–1511.
tors. Curr. Top. Dev. Biol. 116: 445–454. Nelson, C. E. and 14 others. 2016. In vivo genome editing
Jinek, M., K. Chylinski, I. Fonfara, M. Hauer, J. A. Doudna improves muscle function in a mouse model of Duchenne mus-
and E. Charpentier. 2012. A programmable dual-RNA-guided cular dystrophy. Science 351: 403–407.
DNA endonuclease in adaptive bacterial immunity. Science 337:
816–821.
94 Chapter 3
Nüsslein-Volhard, C. and E. Wieschaus. 1980. Mutations affect- Wilson, R. C. and J. A. Doudna. 2013. Molecular mechanisms
ing segment number and polarity in Drosophila. Nature 287: of RNA interference. Annu. Rev. Biophys. 42: 217–239.
795–801. Yasumoto, K., K. Yokoyama, K. Shibata, Y. Tomita and S. Shiba-
Ong, T.-C. and V. G. Corces. 2011. Enhancer function: New hara. 1994 Microphthalmia-associated transcription factor as
insights into the regulation of tissue-specific gene expression. a regulator for melanocyte-specific transcription of the human
Nature Rev. Genet. 12: 283–293. tyrosinase gene. Mol. Cell Biol. 12: 8058–8070.
Palacios, I. M. 2007. How does an mRNA find its way? Intracel- Zhou, Q., J. Brown, A. Kanarek, J. Rajagopal and D. A. Melton.
lular localization of transcripts. Sem. Cell Dev. Biol. 163–170. 2008. In vivo reprogramming of adult pancreatic exocrine cells
Peter, I. and E. H. Davidson. 2015. Genomic Control Process: to b cells. Nature 455: 627–632.
Development and Evolution. Academic Press, Cambridge. Zhou, V. W., A. Goren and B. E. Bernstein. 2011. Charting his-
Takahashi, K. and S. Yamanaka. 2006. Induction of pluripotent tone modifications and the functional organization of mamma-
stem cells from mouse embryonic and adult fibroblast cultures lian genomes. Nature Rev. Genet. 12: 7–18.
by defined factors. Cell 126: 663–676. Zinzen, R. P., C. Girardot, J. Gagneur, M. Braun and E. E. Fur-
Wilmut, I., K. Campbell and C. Tudge. 2001. The Second Cre- long. 2009. Combinatorial binding predicts spatio-temporal cis-
ation: Dolly and the Age of Biological Control. Harvard University regulatory activity. Nature 462: 65–70.
Press, Cambridge, MA.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
4
Cell-to-Cell Communication
Mechanisms of Morphogenesis
The Punchline
Communication between cells is achieved by informational molecules that are either
secreted or positioned in the cell’s membrane. When these molecules bind to receptors
on neighboring cells, they set off a cascade of intracellular reactions that result in
changes in gene expression, enzymatic activity, and cytoskeletal arrangements,
affecting cell fate, cell behavior, and cell shape. Differential adhesion of cells to one
another can influence the spatial organization of cells within the embryo and organs;
it is often mediated by the homophilic binding of cadherin receptors. Epithelial cells
sometimes transition into migrating mesenchymal cells, an important cell behavior
both for development and for the spread of cancer. Specialized protrusions from cells,
such as nonmotile cilia and long filopodia-like extensions, also play major roles in cell
communication. Secreted signaling proteins like FGFs, Hedgehog, Wnts, and BMPs
function as morphogens that induce changes in gene expression depending on their
concentrations. Morphogen gradients are used to pattern cell fates across whole axes
of an embryo or tissue. Lastly, cell-adjacent juxtacrine signaling can influence polarized
cell patterning across tissues. All these mechanisms together direct cell-fate patterning
and morphogenesis in the embryo.
96 Chapter 4
membrane components that would enable the formation of organs. In the late twentieth
century, these membrane components—the molecules by which embryonic cells are
able to adhere to, migrate over, and induce gene expression in neighboring cells—began
to be discovered and described. Today these pathways and networks are being modeled,
and we are beginning to understand how the cell integrates the information from its
nucleus and from its surroundings to take its place in the community of cells in a way
that fosters unique morphogenetic events.
As we discussed in Chapter 1, the cells of an embryo are either epithelial or mes-
enchymal (see Table 1.1). Epithelial cells adhere to one another and can form sheets
and tubes, whereas mesenchymal cells often migrate individually and form extensive
extracellular matrices that can keep individual cells separate. An organ is formed from
an epithelium and an underlying mesenchyme. There appear to be only a few processes
through which cells create structured organs (Newman and Bhat 2008), and all these
processes involve the cell surface. This chapter will concentrate on three behaviors
requiring cell-to-cell communication via the cell surface: cell adhesion, cell shape, and
FIGURE 4.1 Local and long-range
cell signaling.
modes of cell-to-cell communication.
(A) Local cell signaling is carried out via
membrane receptors that bind to pro- A Primer on Cell-to-Cell Communication
teins in the extracellular matrix (ECM) or
directly to receptors from a neighboring An embryo at any stage is held together, organized, and formed by the interactions
cell in a process called juxtacrine signal-
that occur between cells. The interactions exhibited by cells define their methods of
ing. (B) One mechanism for long-range communication. For communication to occur successfully between humans, there needs
signaling is through paracrine signaling,
to be some initial “voice” or signal from one person that is “heard” or received by the
such that one cell secretes a signaling
protein (ligand) into the environment and other person, which results in a specific response (a change in mood, a hug, or per-
across the distance of many cells. Only haps a sarcastic remark back), much like friends conversing. Molecular communication
those cells expressing this ligand’s cor- between cells is largely carried out through highly diverse and specific protein-protein
responding receptor can respond, either interactions, which have evolved to elicit an array of cellular responses, from changes
rapidly through chemical reactions in the in gene transcription and glucose metabolism to cell migration and cell death. Interac-
cytosol, or more slowly through the pro- tions (or communication) between cells and between cells and their environment begin
cess of gene and protein expression.
at the plasma membrane, with proteins that
are housed within, anchored to, or secreted
(A) Juxtacrine signaling (B) Paracrine signaling
through the membrane.
In an embryo, communication between
Cell
membrane
cells can occur across short distances, such
as between two neighboring cells in direct
contact, called juxtacrine signaling , or
Nucleus
across long distances through the secretion
of proteins into the extracellular matrix,
called paracrine signaling (FIGURE 4.1).
Proteins that are secreted from a cell and
designed to communicate a response in
Homophilic Heterophilic
another cell are generally referred to as sig-
binding binding
naling proteins (generally called ligands),
Signaling while the proteins within a membrane that
proteins function to bind either other membrane-
(ligands)
associated proteins or signaling proteins
are called receptors. A receptor in the mem-
Receptor brane of one cell that binds the same type of
receptor in another cell represents a homo-
philic binding. In contrast, heterophilic
Fast binding occurs between different receptor
types (see Figure 4.1A).
Binding to a receptor of any kind gener-
ECM Slow
ally alters the shape, or conformation, of the
receptor. This conformational change on
Cell-to-Cell Communication 97
the outside of the cell affects the shape of the receptor inside the cell, and this latter
change can give the intracellular portion of the receptor a new property. It now has the
ability to activate the enzymatic reactions that constitute a signal transduction path-
way. Often the “signal” is relayed or “transduced” through successive conformational
changes in the molecules of the pathway, changes orchestrated through the binding of
phosphate groups or other small molecules (cAMP, Ca2+) that eventually lead to cellular
responses. Signal transduction pathways that culminate in activating gene expression
in the nucleus are typically slower than those that enzymatically activate biochemical
pathways or regulate cytoskeletal proteins, thereby affecting physiological functions
or movement, respectively. These signal transduction pathways are fundamental to
animal development.
Spontaneous Segregation
reaggregation of cell types
Dissociation
of cells
Outside
Neural cells
Epidermal cells
Neural plate
cells
Cross section
out into its own region. Thus, when epidermal (ectodermal) and mesodermal cells are
brought together in a mixed aggregate, the epidermal cells move to the periphery of
the aggregate, and the mesodermal cells move to the inside (FIGURE 4.3). Importantly,
the researchers found that the final positions of the reaggregated cells reflect their
respective positions in the embryo. The reaggregated mesoderm migrates centrally with
respect to the epidermis, adhering to the inner epidermal surface (FIGURE 4.4A). The
mesoderm also migrates centrally with respect to the gut or endoderm (FIGURE 4.4B).
When the three germ layers are mixed together, however, the endoderm separates
from the ectoderm and mesoderm and is then enveloped by them (FIGURE 4.4C ). In
the final configuration, the ectoderm is on the periphery, the endoderm is internal, and
the mesoderm lies in the region between them.
Holtfreter interpreted this finding in terms of selective affinity. The inner surface of
the ectoderm has a positive affinity for mesodermal cells and a negative affinity for the
endoderm, whereas the mesoderm has positive affinities for both ectodermal and endo-
dermal cells. Mimicry of normal embryonic structure by cell aggregates is also seen in
the recombination of epidermis and neural plate cells (FIGURE 4.4D). The presumptive
epidermal cells migrate to the periphery as before; the neural plate cells migrate inward,
forming a structure reminiscent of the neural tube. When axial mesoderm (notochord)
cells are added to a suspension of presumptive epidermal and presumptive neural cells,
cell segregation results in an external epidermal layer, a centrally located neural tissue,
and a layer of mesodermal tissue between them (FIGURE 4.4E ). Somehow, the cells are
able to sort out into their proper embryonic positions. Holtfreter and colleagues concluded
that selective affinities change during development. For development to occur, cells
must interact differently with other cell populations at specific times. Such changes in
cell affinity are extremely important in the processes of morphogenesis.
Neural
plate
Neural
plate
Epidermis Endoderm Mesoderm Epidermis Epidermis Mesoderm
Neural Neural
Mesoderm Mesoderm Endoderm plate plate
Epidermis
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_04.04 Date 03-07-16
100 Chapter 4
In vertebrate embryos, several major cadherin types have been Figure 4.6 Simplified scheme of cadherin linkage to the
identified. For example, E-cadherin is expressed on all early mam- cytoskeleton via catenins. (After Takeichi 1991.)
malian embryonic cells, even at the zygote stage. In the zebrafish
Phosphorylation sites
embryo, E-cadherin is needed for the formation and migration of
Actin
the epiblast as a sheet of cells during gastrulation. Loss of E-cad-
herin in the “half-baked” zebrafish mutant results in a failure of Adhesive recognition
deep epiblast cells to move radially into the more superficial epi- site
blast layer, an in vivo cell sorting process known as radial interca- EC2 EC3 EC4 EC5
EC1
lation that helps power epiboly during gastrulation (FIGURE 4.7; β
see also Chapter 11 and Kane et al. 2005). Later in development, α γ
Calcium-
this E-cadherin is restricted to epithelial tissues of embryos and binding site Cell Catenins
adults. membrane
In mammals, P-cadherin is found predominantly on the pla-
centa, where it helps the placenta stick to the uterus (Nose and
Takeichi 1986; Kadokawa et al. 1989). N-cadherin becomes highly
expressed on the cells of the developing central nervous system
(Hatta and Takeichi 1986), and it may play a role in mediating neu-
ral signals. R-cadherin is critical in retina formation (Babb et al.
2005). A class of cadherins called protocadherins (Sano et al. 1993)
lacks the attachment to the actin cytoskeleton through catenins.
Expressing similar protocadherins is an important means of keep-
ing migrating epithelial cells together, and expressing dissimilar
protocadherins is an important way of separating tissues (as when
Cadherin– cadherin
(A) –/– +/– +/+ binding
Cadherin
(B)
EVL YSL
Epiblast HB
Gilbert
102 Chapter 4
the mesoderm forming the notochord separates from the surrounding mesoderm that
will form somites).
Figure 4.8 Importance of the amount Differences in cell surface tension and the tendency of cells to bind together depend
of cadherin for correct morphogenesis. on the strength of cadherin interactions (Duguay et al. 2003). This strength can be
(A) Aggregate surface tension correlates achieved quantitatively (the more cadherins on the apposing cell surfaces, the tighter
with the number of cadherin molecules
the adhesion) or qualitatively (some cadherins will bind to different cadherin types,
on the cell membranes. (B) Sorting
out of two subclones having different whereas other cadherins will not bind to different types).
amounts of cadherin on their cell sur-
faces. The green-stained cells had 2.4 quantity and cohesion The ability of cells to sort themselves based on the amount
times as many N-cadherin molecules in of cadherin expression was first shown when Steinberg and Takeichi (1994) collaborated
their membrane as did the other cells. on an experiment using two cell lines that were identical except that they synthesized
(These cells had no normal cadherin different amounts of P-cadherin. When these two groups of cells, each expressing a dif-
genes being expressed.) At 4 hours of
ferent amount of cadherin, were mixed, the cells that expressed more P-cadherin had a
incubation (left), the cells are randomly
distributed, but after 24 hours of incuba- higher surface cohesion and migrated internally to the lower-expressing group of cells.
tion (right), the red cells (with a surface Foty and Steinberg (2005) demonstrated that this quantitative cadherin-dependent
tension of about 2.4 erg/cm2) have sorting directly correlated with surface tension (FIGURE 4.8A,B). The surface tensions
formed an envelope around the more of these homotypic aggregates (all cells have same type of cadherin) are linearly related
tightly cohering (5.6 erg/cm2) green cells. to the amount of cadherin they express on the cell surface. The cell sorting hierarchy
(C) Sorting can occur based on cadherin is strictly dependent on the amount of cadherin interactions between the cells. This
number even if the two cells express dif-
thermodynamic principle also applies to heterotypic aggregates, in which the relative
ferent cadherin proteins (i.e., are hetero-
typic). Red indicates P-cadherin, green amounts of different cadherin types still predict cell-sorting behavior in vitro (Foty and
E-cadherin. (A,B from Foty and Steinberg Steinberg 2013) (FIGURE 4.8C ).
2005; C from Foty and Steinberg 2013.)
(A) (B)
6
Aggregate surface tension (erg/cm2)
2
Green cells have 2.4 times more Green cells sort to center
N-cadherin
P-cadherin N-cadherin than red cells with red cells at periphery
1
E-cadherin
0
0 50 100 150 200 250
Surface cadherins per cell (thousands)
(A) Figure 4.9 Importance of the types of cadherin for correct morphogenesis. (A) The type of cad-
herin expressed can result in different sorting behaviors, as seen when cells expressing R-cadherin
(red stain) are mixed together with an equal number of cells expressing B-cadherin (green stain).
The cells form two distinct mounds with one common boundary of contact. (B) Cross section of
a mouse embryo showing the domains of E-cadherin expression (left) and N-cadherin expression
(right). N-cadherin is critical for separation of presumptive epidermal and neural tissues during
organogenesis. (C) The neural tube separates cleanly from surface epidermis in wild-type zebrafish
embryos but not in mutant embryos where N-cadherin fails to be made. In these images, the cell
outlines are stained green with antibodies to β-catenin, while the cell interiors are stained blue.
(A from Duguay et al. 2003, photographs courtesy of R. Foty; B photographs by K. Shimamura and
H. Matsunami, courtesy of M. Takeichi; C from Hong and Brewster 2006, courtesy of R. Brewster.)
type, timing, and border formation The quantitative effects of cadherins are
crucial, but qualitative interactions—that is, the type and timing of cadherin expres-
sion—also can be important. The timing of particular developmental events can depend
on cadherin expression. For instance, N-cadherin appears in the mesenchymal cells of
the developing chick leg just before these cells condense and form nodules of cartilage
(which are the precursors of the limb skeleton). N-cadherin is not seen prior to conden-
sation, nor is it seen afterward. If the limbs are injected just prior to condensation with
antibodies that block N-cadherin, the mesenchyme cells fail to condense and cartilage
fails to form (Oberlender and Tuan 1994). It therefore appears that the signal to begin
cartilage formation in the chick limb is the appearance of N-cadherin.
The type of cadherin can matter as well. Duguay and colleagues (2003) showed, for
instance, that R-cadherin and B-cadherin do not bind well to each other. When two
populations of cells expressing either R-cadherin or B-cadherin at equal levels are mixed
Gilbert
together, they sort out into two opposing mounds of cells with a distinct border between
Developmental
them (FIGURE Biology
4.9A11e , Sinauer
). The Associates
formation of boundaries is a critical physical achievement
DevBio11e_04.09 Date 04-07-16
necessary for many morphogenetic events. For instance in the developing ectoderm,
the expression of N-cadherin is important in separating the precursors of the neural
cells from the precursors of the epidermal cells (FIGURE 4.9B). Initially, all early embry-
onic cells contain E-cadherin, but those cells destined to become the neural tube lose
E-cadherin and gain N-cadherin. If epidermal cells are experimentally made to express
N-cadherin or if N-cadherin synthesis is blocked in prospective neural cells, the border
between the skin and the nervous system fails to form properly (FIGURE 4.9C; Kintner
et al. 1992). Thus, through the differential expression of two different cadherin types,
104 Chapter 4
(A)
Filamentous actin
C-cadherin
no
pm
Parax ord
ch
meso al
meso al
Noto
Parax
different tissues can become separated by the formation of a border at the cell
membrane occupying the weaker heterophilic interaction (Fagotto 2014).
Developing Questions
Another example of boundary formation in the embryo occurs within the
The underlying actin cytoskeleton mesoderm to separate the axial (notochordal) mesoderm from the paraxial
appears to be crucial in organizing (somitic) mesoderm. The primary mechanism for forming this boundary rests
cadherins for forming stable
in the reduction of C-cadherins in the apposing membranes of the border cells
linkages between cells. Although
the energetic value of cadherin- (Fagotto et al. 2013). Fagotto and colleagues examined this mechanism in live
cadherin binding is remarkably Xenopus laevis embryos and found that actin-myosin contractile cables line up
strong—about 3400 kcal/mole, parallel to the border interface and are required for both C-cadherin reduction
or some 200 times stronger than and boundary formation (FIGURE 4.10).
most metabolic protein-protein
interactions—actin-myosin WEb Topic 4.1 Shape Change and Epithelial Morphogenesis: “The
contractile forces are also Force Is Strong in You” The ability of epithelial cells to form sheets and
important for establishing the tubes depends on cell shape changes that usually involve cadherins and the actin
tensile forces of a cell. Recently, cytoskeleton.
a “differential interfacial tension
hypothesis” proposed that cell
cortex contractility governs cell
sorting more than cell-to-cell The Extracellular Matrix as a Source
adhesion. As better in vivo tools
are developed to quantitatively of Developmental Signals
measure forces on the cellular
and molecular levels, it will be Cell-to-cell interactions do not happen in the absence of an environment;
exciting to learn how differential rather, they occur in coordination with and often due to the environmental
adhesion and differential conditions surrounding the cells. This environment is called the extracellular
interfacial tension cooperatively matrix, which is an insoluble network consisting of macromolecules secreted
regulate morphogenesis. In the by cells. These macromolecules form a region of noncellular material in the
coming years, keep an eye out for interstices between the cells. Cell adhesion, cell migration, and the formation
a building understanding of the
Developmental Biology 11eproperties play in of epithelial sheets and tubes all depend on the ability of cells to form attach-
role biophysical
Fig. 04.10
mechanisms of morphogenesis. ments to extracellular matrices. In some cases, as in the formation of epithelia,
Dragonfly Media Group these attachments have to be extremely strong. In other instances, as when
04/08/16
Cell-to-Cell Communication 105
cells migrate, attachments have to be made, broken, and made again. In some cases, the
extracellular matrix merely serves as a permissive substrate to which cells can adhere or
on which they can migrate. In other cases, it provides the directions for cell movement
or the signal for a developmental event. Extracellular matrices are made up of the matrix
protein collagen, proteoglycans, and a variety of specialized glycoprotein molecules
such as fibronectin and laminin.
Proteoglycans play critically important roles in the delivery of the paracrine fac-
tors. These large molecules consist of core proteins (such as syndecan) with covalently
attached glycosaminoglycan polysaccharide side chains. Two of the most widespread
proteoglycans are heparan sulfate and chondroitin sulfate. Heparan sulfate can bind
many members of different paracrine families, and it appears to be essential for pre-
senting the paracrine factor in high concentrations to its receptors. In Drosophila, C.
elegans, and mice, mutations that prevent proteoglycan protein or carbohydrate synthe-
sis block normal cell migration, morphogenesis, and differentiation (García-García and
Anderson 2003; Hwang et al. 2003; Kirn-Safran et al. 2004).
The large glycoproteins are responsible for organizing the matrix and the cells into
an ordered structure. Fibronectin is a very large (460-kDa) glycoprotein dimer syn-
thesized by numerous cell types. One function of fibronectin is to serve as a general
adhesive molecule, linking cells to one another and to other substrates such as collagen
and proteoglycans. Fibronectin has several distinct binding sites, and their interaction
with the appropriate molecules results in the proper alignment of cells with their extra-
cellular matrix (FIGURE 4.11A). Fibronectin also has an important role in cell migra-
tion because the “roads” over which certain migrating cells travel are paved with this
protein. Fibronectin paths lead germ cells to the gonads and heart cells to the midline
of the embryo. If chick embryos are injected with antibodies to fibronectin, the heart- Figure 4.11 Extracellular matrices in
forming cells fail to reach the midline, and two separate hearts develop (Heasman et the developing embryo. (A) Fluorescent
al. 1981; Linask and Lash 1988). antibodies to fibronectin show fibronec-
tin deposition as a green band in the
Xenopus embryo during gastrulation.
Scientists Speak 4.1 A question-and-answer session with Dr. Doug DeSimone
The fibronectin will orient the movements
and Dr. Tania Rozario about the role of fibronectin during Xenopus gastrulation.
of the mesoderm cells. (B) Fibronectin
links together migrating cells, collagen,
Laminin (another large glycoprotein) and type IV collagen are major components heparan sulfate, and other extracellular
of a type of extracellular matrix called the basal lamina. The basal lamina is character- matrix proteins. This scanning electron
ized by closely knit sheets that underlie epithelial tissue (FIGURE 4.11B). The adhesion micrograph shows the extracellular
of epithelial cells to laminin (on which they sit) is much greater than the affinity of matrix at the junction of the epithelial cells
(above) and mesenchymal cells (below).
mesenchymal cells for fibronectin (to which they must bind and release if they are to
The epithelial cells synthesize a tight,
migrate). Like fibronectin, laminin plays a role in assembling the extracellular matrix, laminin-based basal lamina, whereas the
promoting cell adhesion and growth, changing cell shape, and permitting cell migra- mesenchymal cells secrete a loose retic-
tion (Hakamori et al. 1984; Morris et al. 2003). ular lamina made primarily of collagen.
(A courtesy of M. Marsden and D. W.
DeSimone; B courtesy of R. L. Trelsted.)
(A) (B)
Epithelium
Basal lamina
Fibronectin
Collagen
106 Chapter 4
Figure 4.13 Basal lamina-directed gene expression in mammary (A) c-myc, cyclin D1 ON
gland tissue. (A) Mouse mammary gland tissue divides when placed
on tissue culture plastic (no basal lamina). The genes encoding cell Lactoferrin,
No basal lamina OFF
division proteins are on, and the genes capable of synthesizing the dif- casein, WAP
ferentiated products of the mammary gland—lactoferrin, casein, and
whey acidic protein (WAP)—are off. (B) When these cells are placed
on a basal lamina, the genes for cell division proteins are turned off, (B)
while the genes encoding inhibitors of cell division (such as p21) and
Lactoferrin, p21 ON
the gene for lactoferrin are turned on. (C,D) The mammary gland cells
wrap the basal lamina around them, forming a secretory epithelium. Casein, WAP,
c-myc, cyclinD1 OFF
The genes for casein and WAP are sequentially activated. (After Bissell
et al. 2003.)
Integrins Basal
lamina
genes become silent. Eventually, all the genes for the develop-
mental products of the mammary gland are expressed, and the
(C)
cell division genes remain turned off. By this time, the mam-
mary gland cells have enveloped themselves in a basal lamina, Lactoferrin, ON
casein, p21
forming a secretory epithelium reminiscent of the mammary
gland tissue. The binding of integrins to laminin is essential for c-myc, cyclinD1,
OFF
transcription of the casein gene, and the integrins act in concert WAP
with prolactin (see Figure 4.27) to activate that gene’s expression
(Roskelley et al. 1994; Muschler et al. 1999). Tight
junctions
Basal Integrin
lamina
Medial cells
(B) (C) undergoing Epithelial cells Mesenchymal cells
Lateral cells EMT
Neural
crest cell
undergoing Epiblast
EMT Mesenchyme
Basal
lamina forming
Neural
mesoderm
tube Hypoblast
Notochord
the blood and exert their effects on cells and tissues far away, paracrine factors are
secreted into the extracellular space and influence their close neighbors. The second
component, the responder, is the cell or tissue being induced. Cells of the respond-
ing tissue must have both a receptor protein for the inducing factor and the ability to
respond to the signal. The ability to respond to a specific inductive signal is called
competence (Waddington 1940).
building the vertebrate eye In the initiation of the vertebrate eyes, paired regions
of the brain bulge out and approach the surface ectoderm of the head. The head ecto-
derm is competent to respond to the paracrine factors made by these brain bulges (the
optic vesicles), and the head ectoderm receiving these paracrine factors is induced to
form the lens of the eye. The genes for lens proteins become induced in the head ecto-
derm cells and are expressed in these cells. The Rho-family GTPases are activated to
control the elongation and curvature of the lens fibers (see Chapter 16; Maddala et al.
2008). Moreover, the prospective lens cells secrete paracrine factors that instruct the
optic vesicle to form the retina. Thus, the two major parts of the eye co-construct each
other, and the eye forms from reciprocal paracrine interactions. The head ectoderm
is the only region capable of responding to the optic vesicle. If an optic vesicle from a
Xenopus laevis embryo is placed underneath head ectoderm in a different part of the
head from where the frog’s optic vesicle normally occurs, the vesicle will induce that
ectoderm to form lens tissue; trunk ectoderm, however, will not respond to the optic
vesicle (FIGURE 4.15; Saha et al. 1989; Grainger 1992). Only head ectoderm is competent
to respond to the signals from the optic vesicle by producing a lens.
Often, one induction will give a tissue the competence to respond to another induc-
er. Studies on amphibians suggest that the first inducers of the lens may be the fore-
gut endoderm and heart-forming mesoderm that underlie the lens-forming ectoderm
during the early and mid gastrula stages (Jacobson 1963, 1966). The anterior neural
plate may produce the next signals, including a signal that promotes the synthesis of
the Paired box 6 (Pax6) transcription factor in the anterior ectoderm which is required
for the competence to respond to the optic vesicle’s signals ( FIGURE 4.16 ; Zygar et
Gilbert
al. 1998). Thus, although the optic vesicle appears to be the lens inducer, the anterior
Developmental Biology 11e, Sinauer Associates
ectoderm has already
DevBio11e_04.15 Datebeen induced by at least two other tissues. The optic vesicle’s
04-21-16
situation is like that of the player who kicks the “winning” goal in a soccer match, yet
many others helped to position that ball for the final kick!
110 Chapter 4
Pharynx Fgf8
BMP4
Mid gastrula stage Late gastrula stage Early neurula stage Late neurula stage
Reciprocal induction
Another feature of induction is the reciprocal nature of many inductive interactions.
To continue the above example, once the lens has formed, it induces other tissues. One
of these responding tissues is the optic vesicle itself; thus, the inducer becomes the
induced. Under the influence of factors secreted by the lens, the optic vesicle becomes
the optic cup, and the wall of the optic cup differentiates into two layers: the pigmented
retina and the neural retina (see Figure 16.8; Cvekl and Piatigorsky 1996; Strickler et al.
2007). Such interactions are called reciprocal inductions.
Another principle can be seen in such reciprocal inductions: a structure does not
need to be fully differentiated to have a function. As we will detail in Chapter 16, the
optic vesicle induces the surface ectoderm to become a lens before the optic vesicle has
become the retina. Similarly, the developing lens reciprocates by inducing the optic
vesicle before the lens forms its characteristic fibers. Thus, before a tissue has its “adult”
functions, it has critically important transient functions in building the organs of the
embryo.
(A) Wild-type Pax6 mutant FIGURE 4.17 The Pax6 gene is similarly required for
eye development in frogs, rats, and humans. (A) Loss
of Pax6 in rats results in the failure to form eyes as
well as significant reductions in nasal structures. (B)
An analysis of lens induction following recombination
experiments of the optic vesicle and surface ectoderm
between wild-type and Pax6 null rat embryos. Pax6 is
required only in the surface ectoderm for proper lens
induction. (C) Mutations in the Pax6 gene in Xenopus
and humans result in similar reductions in the iris
of the eye as compared to wild-type individuals.
(B) This phenotype is characteristic of aniridia. (A from
Optic Surface Lens Lens Fujiwara et al. 1994; B photographs courtesy of M.
vesicles ectoderm induction Fujiwara; C from Yaoita et al. 2015, courtesy of R. M.
Grainger.)
Wild-type Pax6–/Pax6– No
Pax6–/Pax6– Pax6–/Pax6– No
Wild-
type
Iris Iris
Pax6
deficient
iris
reduced
(aniridia)
112 Chapter 4
experimentally placed under a new region of head ectoderm causes that region of the
Developing Questions
ectoderm to form a lens.
Although rebuilding a The second type of inductive interaction is permissive interaction . Here, the
decellularized heart is responding tissue has already been specified and needs only an environment that
clearly an example of
allows the expression of these traits. For instance, many tissues need an extracellular
permissive interactions,
could there be instructive matrix to develop. The extracellular matrix does not alter the type of cell that is pro-
interactions too? Recently, duced, but it enables what has already been determined to be expressed.1 A dramatic
iPSC-derived cardiovascular example of permissive interactions at work comes from the regenerative medicine field,
progenitor cells success- in which an extracellular matrix scaffold can promote the differentiation and rebuilding
fully seeded a decellular- of a beating heart. Doris Taylor’s research group used detergents to remove all the cells
ized mouse heart and from a cadaveric rat heart, which leaves behind the natural extracellular matrix (FIGURE
differentiated into cardio-
4.18A ; Ott et al. 2008). Proteins like fibronectin, collagen, and laminin held together the
myoctyes, smooth muscle
and endothelial cells (Lu rest of the ECM and maintained the intricate shape of the heart. The researchers then
et al. 2013). What could infused this ECM scaffold with cardiomyocytes. Surprisingly, these cells differentiated
the ECM be providing and organized into a functionally contracting “recellularized” heart (FIGURE 4.18B).
to directly influence the Therefore, the environmental conditions of the decellularized ECM were permissive in
differentiation of progenitor allowing the cardiomyocytes to recreate contracting heart muscle. You will be reading
cells into these varied cell more about regenerative medicine in Chapter 5.
types?
Scientists Speak 4.2 Dr. Doris Taylor discusses the use of decellularized organs
for regeneration.
Epithelial-mesenchymal interactions
Some of the best-studied cases of induction involve the interactions of sheets of epithe-
lial cells with adjacent mesenchymal cells. All organs consist of an epithelium and an
associated mesenchyme, so these interactions are among the most important phenom-
ena in nature. Some examples are listed in TABLE 4.1.
1
It is easy to distinguish permissive and instructive interactions using an analogy. This textbook
is made possible by both permissive and instructive interactions. A reviewer can convince us to
change the material in the chapters, which is an instructive interaction because the information
expressed in the book is changed from what it would have been. However, the information in the
book could not be expressed at all without permissive interactions with the publisher and printer.
Ao
RA LA
RV LV
12 h
Cutaneous structures (hair, feathers, sweat glands, Epidermis (ectoderm) Dermis (mesoderm)
mammary glands)
Limb Epidermis (ectoderm) Mesenchyme (mesoderm)
Gut organs (liver, pancreas, salivary glands) Epithelium (endoderm) Mesenchyme (mesoderm)
Foregut and respiratory-associated organs (lungs, Epithelium (endoderm) Mesenchyme (mesoderm
thymus, thyroid)
Kidney Ureteric bud (mesoderm) Mesenchyme epithelium (mesoderm)
Tooth Jaw epithelium (ectoderm) Mesenchyme (neural crest)
Thigh
Thigh
feather
Foot
Scales,
claw
114 Chapter 4
cells can migrate over one another to form a tube while keeping (A) Leader cell
their integrity as an epithelium (Cela and Llimagas 2006). Bnl-secreting (Btl activated)
Another external force is also at work, however. The dor- cells
Bnl
salmost secondary branches of the sacs move along a groove Tracheal protein
that forms between the developing muscles. These tertiary cell epithelium
migrations cause the trachea to become segmented around the cells
musculature (Franch-Marro and Casanova 2000). In this way,
the respiratory tubes are placed close to the larval musculature. Stage 11 Stage 12
(6 h) (8 h)
Morphogen gradients
One of the most important mechanisms governing cell fate specification involves gra-
dients of paracrine factors that regulate gene expression; such signaling molecules are
called morphogens. A morphogen (Greek, “form-giver”) is a diffusable biochemical
molecule that can determine the fate of a cell by its concentration.4 That is, cells exposed
to high levels of a morphogen activate different genes than those cells exposed to lower
levels. Morphogens can be transcription factors produced within a syncytium of nuclei
as in the Drosophila blastoderm (see Chapter 2). They can also be paracrine factors that
are produced in one group of cells and then travel to another population of cells, speci-
Gilbert
fying the target cells to have similar or different fates according to theDevelopmental
concentration of 11e, Sinauer Associates
Biology
the morphogen. Uncommitted cells exposed to high concentrations ofDevBio11e_04.21
the morphogen Date 06-02-16
4
Although there is overlap in the terminology, a morphogen specifies cells in a quantitative
(“more or less”) manner, whereas a morphogenetic determinant specifies cells in a qualitative
(“present or absent”) way. Morphogens are analog; morphogenetic determinants are digital.
116 Chapter 4
High Figure 4.22 Specification of uniform cells into three cell types by a mor-
phogen gradient. A morphogenetic paracrine factor (yellow dots) is secreted
from source cells (yellow) and forms a concentration gradient within the
responsive tissue. Cells exposed to morphogen concentrations above thresh-
Amount of morphogen
Threshold 2 (nearest its source of production) are specified as one cell type. When
the morphogen’s concentration drops below a certain threshold, a dif-
Low ferent cell fate is specified. When the concentration falls even lower, a
cell that initially was of the same uncommitted type is specified in yet a
third distinct manner (FIGURE 4.22).
Distance from source Dev T u torial Morphogen Signaling A lecture and
Morphogen-
secreting cell (source) demonstration by Dr. Michael Barresi of some ways in which
morphogen signaling operates.
(A) Beads, (B) Beads containing (C) Beads containing Figure 4.23 A gradient of the paracrine
no activin 1 nM activin 4 nM activin factor activin, a morphogen, causes con-
(low concentration) (high concentration) centration-dependent expression differenc-
es of two genes in unspecified amphibian
cells. (A) Beads containing no activin did
not elicit expression (i.e., mRNA transcrip-
tion) of either the Xbra or goosecoid gene.
(B) Beads containing 1 nM activin elicited
Xbra expression in nearby cells. (C) Beads
containing 4 nM activin elicited Xbra
Region of expression, but only at a distance of sev-
Xbra expression Region of eral cell diameters from the beads. A region
Unspecified cells goosecoid of goosecoid expression is seen near the
expression source bead, however. Thus, it appears
that Xbra is induced at particular concen-
(D) Activin beads
trations of activin and that goosecoid is
Region of goosecoid gene induced at higher concentrations. (D) Inter-
expression (high concentration) pretation of the Xenopus activin gradient.
High concentrations of activin activate
Region of Xbra gene
expression (low concentration) goosecoid, whereas lower concentrations
activate Xbra. A threshold value appears
Neither gene activated to exist that determines whether a cell will
(minimal or no activin) express goosecoid, Xbra, or neither gene.
In addition, Brachyury (the Xbra protein
product in Xenopus) inhibits the expression
of goosecoid, thereby creating a distinct
boundary. This pattern correlates with the
number of activin receptors occupied on
Activin gradient
individual cells. (After Gurdon et al. 1994;
Number of goosecoid expression threshold Dyson and Gurdon 1998.)
occupied 300
Xbra expression threshold
activin
receptors 100
High Low
Activin concentration
(distance from source)
Gilbert Contact
11e, Sinauer Associates
Developmental Biology(1) with
DevBio11e_04.24 Date 03-08-16 Fgf8
bead
Cell-to-Cell Communication 119
FGF ligand dimer Homodimer of Figure 4.26 The widely used RTK signal
two FGFRs transduction pathway can be activated by
Two bound HSPGs fibroblast growth factor. The receptor tyrosine
Extracellular kinase is dimerized by the ligand (a paracrine
factor, such as FGF) along with heparan
Ligand sulfate proteoglycans (HSPG), which together
Cytoplasm cause the dimerization and autophosphoryla-
RTK tion of the RTKs. The adaptor protein recog-
P
P nizes the phosphorylated tyrosines on the
GEF P RTK and activates an intermediate protein,
P
Adaptor GEF, which activates the Ras G-protein by
P P protein allowing phosphorylation of the GDP-bound
RAS P Ras. At the same time, the GAP protein
(SOS)
P P Nucleus stimulates hydrolysis of this phosphate bond,
RAF GAP returning Ras to its inactive state. The active
GEF Ras activates the Raf protein kinase C, which
in turn phosphorylates a series of kinases
MEK Ras
Active (such as MEK). Eventually, the activated
Inactive transcription kinase ERK alters gene expression in the
ERK transcription factor nucleus of the responding cell by phosphory-
GDP factor lating certain transcription factors (which can
Ras
Transcription then enter the nucleus to change the types
P of genes transcribed) and certain translation
factor
factors (which alter the level of protein synthe-
GTP
sis). In many cases, this pathway is reinforced
Transcription by the release of calcium ions. A simplified
MEK ERK
version of the pathway is shown on the left.
Raf
Expression of ETS-domain
transcription factors
responding cell. These proteins, once activated, can perform new functions. The RTK
pathway was one of the first signal transduction pathways to unite various areas of
developmental biology (FIGURE 4.26). Researchers studying Drosophila eyes, nematode
vulvae, and human cancers found that they were all studying the same genes!
Fibroblast growth factors, epidermal growth factors, platelet-derived growth factors,
and stem cell factor are all paracrine factors that bind to receptor tyrosine kinase (RTK).
Each RTK can bind only one (or one small set) of these ligands, and stable binding
requires an additional element, heparan sulfate proteoglycans, or HSPG (Mohammadi
et al. 2005; Bökel and Brand 2013). When RTK-ligand binding occurs, RTK undergoes
a conformational change that enables it to dimerize with another RTK. This confor-
mational change stimulates the latent kinase activity of each RTK, and these receptors
phosphorylate each other on particular tyrosine residues (see Figure 4.26). Thus, the
binding of the paracrine factor to its RTK causes a cascade of autophosphorylation of
the cytoplasmic domain of the receptor partners. The phosphorylated tyrosine on the
receptor is then recognized by an adaptor protein that serves as a bridge linking the
phosphorylated RTK to a powerful intracellular signaling system.
While binding to the phosphorylated RTK through one of the RTK’s cytoplasmic
domains, the adaptor protein also activates a G protein, such as Ras. Normally, the G
protein is in an inactive, GDP-bound state. The activated receptor stimulates the adap-
tor protein to activate the GTP exchange factor (GEF; also called guanine nucleotide
Gilbert factor, or GNRP). GEF catalyzes the exchange of GDP with GTP. The GTP-
releasing
Developmental
bound Biology
G protein , Sinauer
is an11eactive Associates
form that transmits the signal to the next molecule. After
DevBio11e_04.26 Date 03-23-16
the signal is delivered, the GTP on the G protein is hydrolyzed back into GDP. This catal-
ysis is greatly stimulated by the complexing of the Ras protein with the GTPase-acti-
vating protein (GAP). In this way, the G protein is returned to its inactive state, where
it can await further signaling. Without the GAP protein, Ras protein cannot efficiently
120 Chapter 4
catalyze GTP and so remains in its active configuration for a longer time (Cales et al.
Figure 4.27 A JAK-STAT pathway: 1988; McCormick 1989). Mutations in the RAS gene account for a large proportion of
casein gene activation. The gene for casein
cancerous human tumors (Shih and Weinberg 1982), and the mutations of RAS that
is activated during the final (lactogenic)
phase of mammary gland development, make it oncogenic all inhibit the binding of the GAP protein.
and its activating signal is the secretion The active Ras G protein associates with a kinase called Raf. The G protein
of the hormone prolactin from the ante- recruits the inactive Raf kinase to the cell membrane, where it becomes active (Leev-
rior pituitary gland. Prolactin causes the ers et al. 1994; Stokoe et al. 1994). Raf kinase activates the MEK protein by phos-
dimerization of prolactin receptors in the phorylating it. MEK is itself a kinase, which activates the ERK protein by phosphory-
mammary duct epithelial cells. A particular lation. In turn, ERK is a kinase that enters the nucleus and phosphorylates certain
JAK protein (Jak2) is “hitched” to the cyto-
transcription factors, many of which belong to the Pea3/Etv4-subfamily (Raible and
plasmic domain of these receptors. When
the receptors bind prolactin and dimerize, Brand 2001; Firnberg and Neubüser 2002; Brent and Tabin 2004; Willardsen et al.
the JAK proteins phosphorylate each other 2014). The end point of the RTK-signaling pathway is the regulation of expression
and the dimerized receptors, activating the of a variety of different genes, including but not limited to ones involved in the cell
dormant kinase activity of the receptors. The cycle.
activated receptors add a phosphate group
to a tyrosine residue (Y) of a particular STAT FGFs and the JAK-STAT pathway
protein, which in this case is Stat5. This
Fibroblast growth factors can also activate the JAK-STAT cascade. This pathway is
addition allows Stat5 to dimerize, be translo-
cated into the nucleus, and bind to particular extremely important in the differentiation of blood cells, the growth of limbs, and
regions of DNA. In combination with other the activation of the casein gene during milk production (FIGURE 4.27; Briscoe et
transcription factors (which presumably have al. 1994; Groner and Gouilleux 1995). The cascade starts when a paracrine factor is
been waiting for its arrival), the Stat5 protein bound by the extracellular domain of a receptor that spans the cell membrane, with
activates transcription of the casein gene. the cytoplasmic domain of the receptor being linked to JAK (Janus kinase) proteins.
GR is the glucocorticoid receptor, OCT1 is a The binding of paracrine factor to the receptor activates the JAK kinases and causes
general transcription factor, and TBP is the
them to phosphorylate the STAT (signal transducers and activators of transcription)
major promoter-binding protein that anchors
RNA polymerase II (see Chapter 2) and is family of transcription factors (Ihle 1996, 2001). The phosphorylated STAT is a tran-
responsible for binding RNA polymerase II. scription factor that can now enter into the nucleus and bind to its enhancers.
A simplified diagram is shown on the left.
(For details, see Groner and Gouilleux 1995.)
JAK
Cytoplasm P P
Jak2 Jak2 P Jak2 Jak2 P
STAT
STAT
dimerization Stat5
P Y
Stat5 Stat5
Y Y P
Transcription
Nucleus
Transcription
initiation
P Y P Y TBP +1
GR Stat5 GR Stat5 OCT1 T A TA A
A T AT T
Y P Y P
–85 –24
–1600 Casein gene promoter 0
Cell-to-Cell Communication 121
Premature activation Cartilage growth Thanatophoric Figure 4.28 A mutation in the gene
of FgfR3 kinase stops before birth dysplasia for FgfR3 causes the premature con-
stitutive activation of the STAT pathway
and the production of phosphorylated
FGF Stat1 protein. This transcription factor
receptor 3 activates genes that cause the prema-
(FgfR3)
ture termination of chondrocyte cell
division. The result is thanatophoric
Altered region dysplasia, a condition of failed bone
of protein growth that results in the death of the
newborn infant because the thoracic
Phosphorylated Narrow chest, cage cannot expand to allow breathing.
Stat1 extremely (After Gilbert-Barness and Opitz 1996.)
short limbs
Kinase
domains
Scientists Speak 4.3 Dr. Francesca Mariani talks about the role of FGF signal-
ing during limb bud outgrowth.
WEb Topic 4.2 FGF receptor mutations Mutations of human FGF receptors
have been associated with several skeletal malformation syndromes, including syn-
dromes in which skull, rib, or limb cartilages fail to grow or differentiate.
bone growth (Bitgood and McMahon 1995; Bitgood et al. 1996). Sonic hedgehog6 has the
greatest number of functions of the three vertebrate Hedgehog homologues. Among other
important functions, Sonic hedgehog is responsible for assuring that motor neurons come
only from the ventral portion of the neural tube (see Chapter 13), that a portion of each
somite forms the vertebrae (see Chapter 17), that the feathers of the chick form in their
FIGURE 4.29 Hedgehog processing
proper places (see Figure 4.19), and that our pinkies are always our most posterior digits
and secretion. Translation of the hedge-
hog gene in the endoplasmic reticulum
(see Chapter 19). Hedgehog signaling is capable of regulating these many developmental
produces a Hedgehog protein with events because they function as morphogens; Hedgehog proteins are secreted from a
autoproteolytic activity that cleaves off cellular source, displayed in a spatial gradient, and induce differential gene expression at
the carboxyl terminus (C) to reveal a sig- different threshold concentrations that result in distinct cell identities.
nal sequence that marks the protein for
secretion. The freed C-terminal segment hedgehog secretion Different modes of processing and assembly of Hedgehog
is not involved in signaling and is often
proteins can significantly alter the amount secreted and the gradient that is formed
degraded, whereas the amino-terminal
portion (N) of the molecule becomes
(FIGURE 4.29). By cleaving off its carboxyl terminus and associating with both choles-
the active Hedgehog protein intended terol and palmitic acid moieties, Hedgehog protein can be processed and secreted as
for secretion. Secretion requires the monomers or multimers, packaged as lipoprotein assemblies, or even transported out
addition of cholesterol and palmitic acid of the cell within exovesicles.
to the Hedgehog protein (Briscoe and In the mouse limb bud, it was shown that if Shh lacks the cholesterol modification,
Thérond 2013). Interactions between it diffuses too quickly and dissipates into the surrounding space (Li et al. 2006). These
the cholesterol moiety and a transmem-
lipid modifications are also required for stable concentration gradients of Hedgehog
brane protein called Dispatched enables
Hedgehog to be secreted and diffuse as
and pathway activation. Through these varied protein processing and transport mecha-
monomers; both cholesterol and palmitic nisms, stable gradients of Hedgehog can be established over distances of several hun-
acid are required for multimeric assem- dred microns (about 30 cell diameters in the mouse limb).
bly. In addition, Hedgehog interactions
6
with a class of membrane-associated Yes, it is named after the Sega Genesis character. The vertebrate Hedgehog genes were dis-
heparan sulfate proteoglycans (HSPGs) covered by searching vertebrate gene libraries (chick, rat, zebrafish) with probes that found
foster the congregation and secretion sequences similar to that of the fruit fly hedgehog gene. Riddle and colleagues (1993) discovered
of Hedgehog molecules as lipoprotein three genes homologous to Drosophila hedgehog. Two were named after existing species of
assemblies (Breitling 2007; Guerrero hedgehog, and the third was named after the animated character. Two other hedgehog genes,
found only in fish, were originally named echidna hedgehog (possibly after Sonic’s cartoon
and Chiang 2007). Similar clustering
friend) and tiggywinkle hedgehog (after Beatrix Potter’s fictional hedgehog), but they are now
of Hedgehog can be used to trans-
referred to as ihh-b and shh-b, respectively.
port Hedgehog out of the cell within
exovesicles.
Cytoplasm Secreted
monomers
Secretion
Dispatched
Endoplasmic Secreted
reticulum multimer
Transport
to plasma
membrane
Translation Autoproteolytic Modifications
hedgehog cleavage
Lipoprotein
mRNA N C N assembly
AA
Cholesterol
Palmitic
AA
acid
HSPG
Exovesicle
Cell-to-Cell Communication 123
the hedgehog pathway The cholesterol moiety on Hedgehog is not only important
for modulating its extracellular transport; it is also critical for Hedgehog to anchor to its
receptor on the receiving cell’s plasma membrane (Grover et al. 2011). The Hedgehog
binding receptor is called Patched, which is a large, 12-pass transmembrane protein
(FIGURE 4.30). Patched, however, is not a signal transducer. Rather, the Patched protein
represses the function of another transmembrane receptor called Smoothened. In the
absence of Hedgehog binding to Patched, Smoothened is inactive and degraded, and a
P
Patched
Microtubules
PKA
P
Cos2/
Smoothened Kif7
Drosophila
skin cancer in humans (Harris et al. 2002; Michino et al. 2003). Although mutations that VADE MECUM
inactivate the Hedgehog pathway can cause malformations, mutations that activate the
The segment on zebrafish devel-
pathway ectopically can have mitogenic effects and cause cancers. If the Patched protein
opment demonstrates how alco-
is mutated in somatic tissues such that it can no longer inhibit Smoothened, it can cause
hol can induce cyclopia in these
tumors of the basal cell layer of the epidermis (basal cell carcinomas). Heritable muta-
embryos.
tions of the patched gene cause basal cell nevus syndrome, a rare autosomal dominant
condition characterized by both developmental anomalies (fused fingers; rib and facial
abnormalities) and multiple malignant tumors (Hahn et al. 1996; Johnson et al. 1996).
Interestingly, vismodegib, a compound that inhibits Smoothened function similar to
cyclopamine, is currently in clinical trials as a therapy to combat basal cell carcinomas
(Dreno et al. 2014; Erdem et al. 2015). (What do you think the warnings for pregnancy
should be on this drug?)
Scientists Speak 4.4 Dr. James Briscoe answers questions on the role of Hedge-
hog signaling during neural tube development.
Scientists Speak 4.5 Dr. Marc Tessier-Lavigne speaks on the role of Hedgehog
as a noncanonical axon guidance cue.
Intensity (%)
Wnt3A
cise binding with the palmitoleic acid
60
moiety of Wnt3A (orange). (B) Once
bound, Notum possesses the enzy- 40
matic hydrolase activity to cleave this
lipid off of Wnt3A, rendering it unable 20
to interact with the Frizzled receptor.
The data shown here demonstrate the 0
Wild-type Enzymatically
requirement of this hydrolase function
Notum deficient
for appropriate delipidation of Wnt3A. Wnt3A Notum
Notum lacking its enzymatic activity
is unable to remove the lipid group + Lipidated Wnt3A
from Wnt3A (Delipidated, purple bars) (C) Glypican
as compared to wild-type Notum. (C) Frizzled Wn
LRP5/6 t
Model of extracellular regulation of Wn receptor Wn
t t
Wnt. Lipidated Wnt can bind both its Wnt
Frizzled receptor and glypicans (hepa-
ran sulfate proteoglycans). Active Wnt
signaling leads to the upregulation of
Notum, which is secreted and interacts Palmitoleic acid
with glypicans, where it will also bind to
and cleave off the palmitoleic acid por- Notum
tions of Wnt proteins. In this way, Wnt
signaling leads to a Notum-mediated
negative feedback mechanism. (A cre-
ated by Matthias Zebisch; data from
Kakugawa et al. 2015; courtesy of Notum
Yvonne Jones and Jean-Paul Vincent.)
the canonical wnt pathway ( β -catenin dependent) The first Wnt pathway
to be characterized was the canonical “Wnt/β-catenin pathway,” which represents the
Developmental Biology 11e
Fig.signaling
04.33 events that culminate in the activation of the β-catenin transcription factor
and modulation of specific gene expression (FIGURE 4.34A; Chien et al. 2009; Clevers
Dragonfly Media Group
05/25/16
Cell-to-Cell Communication 127
Wnt
γ
Gα PLC
P β
Plasma P GSK3 Disheveled Ryk Ror Disheveled GTP PIP2 Ryk
membrane Disheveled Axin
Nucleus β-catenin
TCF TCF Cell shape ER
and behavior
OFF ON changes Gene transcription
bone morphogenetic proteins (BMPs), the Vg1 family, and other proteins, BMP FAMILY
including glial-derived neurotrophic factor (GDNF; necessary for kidney
and enteric neuron differentiation) and anti-Müllerian hormone (AMH), GDF10
a paracrine factor involved in mammalian sex determination. Below we BMP3/osteogenin
summarize three of these families most widely used throughout develop- BMP9
ment: TGF-βs, BMPs and Nodal/Activin. Dorsalin 1 (chicken)
BMP10
• Among members of the TGF- β family, TGF-β1, 2, 3, and 5 are
Vgr2/GDF3
important in regulating the formation of the extracellular matrix
between cells and for regulating cell division (both positively and GDF5 (brachypodism)
negatively). TGF-β1 increases the amount of extracellular matrix BMP13/GDF6
that epithelial cells make (both by stimulating collagen and fibro- BMP12/GDF7
nectin synthesis and by inhibiting matrix degradation). TGF-β
BMP5 (short ear)
proteins may be critical in controlling where and when epithelia
BMP6/Vgr1
branch to form the ducts of kidneys, lungs, and salivary glands
BMP7/OP1
(Daniel 1989; Hardman et al. 1994; Ritvos et al. 1995). The effects BMP8a/OP2
of the individual TGF-β family members are difficult to sort out BMP8b (mouse)
because members of the TGF-β family appear to function simi- 60A (Drosophila)
larly and can compensate for losses of the others when expressed
together. BMP2
• The members of the BMP family can be distinguished from BMP4
other members of the TGF-β superfamily by having seven (rather Dpp (Drosophila)
than nine) conserved cysteines in the mature polypeptide.
Vg1 (Xenopus)
Because they were originally discovered by their ability to
Univin (sea urchin)
induce bone formation, they were given the name bone GDF1
morphogenetic proteins. It turns out, though, that bone Screw (Drosophila)
formation is only one of their many functions; the BMPs Nodal
are extremely multifunctional.11 They have been found to
Activin βA
regulate cell division, apoptosis (programmed cell death), ACTIVINS
Activin βB
cell migration, and differentiation (Hogan 1996). They
include proteins such as BMP4 (which in some tissues causes TGF-β1
bone formation, in other tissues specifies epidermis, and in TGF-β5 TGF-β FAMILY
other instances causes cell proliferation or cell death) and TGF-β2
BMP7 (which is important in neural tube polarity, kidney TGF-β3
development, and sperm formation). The BMP4 homologue
in Drosophila is critically involved in forming appendages, AMH
including the limbs, wings, genitalia, and antennae. Indeed, GDF9
the malformations of 15 such structures have given this Inhibin
homologue the name Decapentaplegic (DPP). As it (rather GDNF
oddly) turns out, BMP1 is not a member of the BMP family
Figure 4.35 Relationships among
at all; rather, it is a protease. BMPs are thought to work by
members of the TGF-β superfamily. (After
diffusion from the cells producing them (Ohkawara et al. 2002). Inhibitors such
Hogan 1996.)
as Noggin and Chordin that bind directly to BMP reduce BMP-receptor inter-
actions. We will cover this morphogenetic mechanism more directly when we
discuss dorsoventral axis specification in the gastrula.
• The Nodal and activin proteins are extremely important in specifying the dif-
ferent regions of the mesoderm and for distinguishing the left and right sides
of the vertebrate body axis. The left-right asymmetry of bilateral organisms is
strongly influenced by a gradient of Nodal from right to left across the embryo.
In vertebrates, this Nodal gradient appears to be created by the beating of
motile cilia that promotes the graded flow of Nodal across the midline (Babu
and Roy 2013; Molina et al. 2013; Blum et al. 2014; Su 2014).
11
One of the many reasons humans do not seem to need an enormous genome is that the gene
products—proteins—involved in our construction and development often have many func-
tions. Many of the proteins that we are familiar with in adults (such as hemoglobin, keratins,
Gilbert
and insulin) do have only one function, which led to the erroneous conclusion that this situa-
Developmental Biology 11e, Sinauer Associates
tion is the norm.
DevBio11e_04.35 Date 03-09-16
130 Chapter 4 TGF-β-like Activin, Nodal, BMP ligand
ligands or TGF-β ligand
(A) (B)
Extracellular
TGF-β superfamily
ligand PP PP PP Cytoplasm
Ser/thr GS PP PP PP
kinase box PP PP PP
Receptor II domain
Receptor Receptor Two dimers
type II type I bind ligands
Receptor I Smad2,3 P Smad1,5 P
Smad Smad
activation
Smad4 Smad4
P P
Smad P
dimerization Activated
(phosphorylated) Nucleus
Smad
New P P
transcription
Gilbert
The Cell Biology of Paracrine Signaling
Developmental Biology 11e, Sinauer Associates
DevBio11e_04.36 Date 04-21-16 We have been discussing cell membrane dynamics and cell signaling as if they were
two separate entities, but their functioning is closely related. Paracrine factors can rear-
range the cell surface, and the cell surface is critical in regulating paracrine factor syn-
thesis, flow, and function. The actions of paracrine signals often change the composi-
tion of the cell membrane.
12
Researchers named the Smad proteins by merging the names of the first identified members
of this family: the C. elegans SMA protein and the Drosophila Mad protein.
Cell-to-Cell Communication 131
Wnt
LRP 5/6 Frizzled Cell membrane Figure 4.37 A Wnt pathway: packag-
ing the β-catenin destruction apparatus into
endosomes. A major mechanism for separat-
ing β-catenin from enzymes that would oth-
erwise destroy it is to package the complex in
Disheveled membrane-bound vesicles called endosomes.
Destruction When Wnt binds to Frizzled, Frizzled can bind
1 Early endosome
complex (DC) the destruction complex; the entire complex
forms
(including the bound Wnt and its receptor) is
internalized, allowing β-catenin to accumulate
β-catenin GSK rather than being degraded. (After Taelman et
al. 2010.)
2 Fusion and
internalization
4 DC sequestered
of DC
5 β-catenin
accumulates
and can
enter nucleus
3 Multivesicular
endosome;
destruction
complex
Nucleus internalized
endosome internalization The type and number of receptors that a cell displays
at its cell surface present its potential for response. Endocytosis is one mechanism used
to eliminate a receptor at the membrane. Recent studies are revealing that internaliza-
tion of ligand-receptor complexes into membrane-bound vesicles called endosomes
is a common mechanism in paracrine signaling. When Wnt binds to its receptors, the
β-catenin destruction complex binds to the receptor, and the entire complex (including
the receptor and its bound Wnt) is internalized in endosomes (FIGURE 4.37; Taelman
et al. 2010; Niehrs 2012). This process removes the complex, targets it for degradation,
and enables the survival of β-catenin. The internalization of the signaling complex
appears to be critical for the accumulation of β-catenin, and proteins that aid in this
endocytosis (such as R-spondins; see Figure 4.34) make the Wnt pathway more effi-
cient (Ohkawara et al. 2011). Similarly, Hedgehog-Patched complexes and FGF-FGFR
complexes are also internalized in endosomes and targeted for degradation, a process
that is required for proper limb development (Briscoe and Thérond 2013; Handschuh
et al. 2014; Hsia et al. 2015).
diffusion of paracrine factors Paracrine factors do not flow freely through the
extracellular
Gilbert space. Rather, factors can be bound by cell membranes and extracellular
matrices of the tissues.
Developmental Biology In some
11e, Sinauer cases, such binding can impede the spread of a para-
Associates
DevBio11e_04.37
crine morphogen andDate even04-21-16
target the paracrine factor for degradation (Capurro et al.
2008; Schwank et al. 2011). Wnt proteins, for instance, do not diffuse far from the cells
secreting them unless helped by other proteins. Thus, the range of Wnt factors is signif-
icantly extended when the nearby cells secrete proteins that bind to the paracrine factor
and prevent it from binding prematurely to the target tissue (FIGURE 4.38 ; Mulligan
et al. 2012). Similarly, as we have mentioned above, heparan sulfate proteoglycans
(HSPGs) in the extracellular matrix often modulate the stability, reception, diffusion
rate, and concentration gradient of FGF, BMP, and Wnt proteins (Akiyama et al. 2008;
Yan and Lin 2009; Berendsen et al. 2011; Christian 2011; Müller and Schier 2011; Nah-
mad and Lander 2011).
132 Chapter 4
Figure 4.38 Wnt diffusion is affect- (A) Wingless (Wg) expression (B) Distal-less expression
ed by other proteins. (A) Diffusion of
Wingless (Wg, a Wnt paracrine factor) Wild-type (normal Swim) Wild-type
throughout the developing wing of wild- Ventral
type Drosophila (above) is enhanced by
Swim, a protein that stabilizes Wg and
that is made by some of the wing cells.
When Swim is not present, as in the Midline
mutant below, Wg does not disperse of wing
but is confined to the narrow band
of Wg-expressing cells. (B) Similarly,
Wingless usually activates the Distal-
less gene (green) in much of the wild- Dorsal
type wing (seen above). However, in Swim– mutant Swim– mutant
swim-mutant flies, the range of Distal- Ventral
less expression is confined to those
areas near the band of Wg-expressing
cells. (From Mulligan et al. 2012.)
Midline
of wing
Dorsal
FGF secretion represents a comprehensive example of the ways that HSPGs can
influence paracrine factor diffusion. Cells secrete FGFs into the extracellular matrix,
where the FGFs can interact with a diversity of HSPGs that function to both modulate
the diffusion of FGF and influence FGF-FGFR binding (Balasubramanian and Zhang
2015). Like all proteoglycans, HSPGs possess chains of sugar molecules that vary in
length and type, and different forms of HSPG-FGF interactions can differently shape
the FGF gradient. Specifically, the morphogen gradient of Fgf8 is thought to be estab-
lished through a source-sink model (also known as a “secretion-diffusion-clearance”
mechanism; Yu et al. 2009). In this model, cells secreting Fgf8 are the source of the
morphogen, and the receiving cells provide the sink through mechanisms of bind-
ing, internalization, or protein degradation for clearance of Fgf8 (Balasubramanian
and Zhang 2015). Michael Brand’s lab tested this model in the zebrafish gastrula by
microinjecting a cluster of cells with Fgf8 fused with GFP, quantifying the amount of
Fgf8 in the extracellular space at varying distances from the microinjected cells using
fluorescence correlation spectroscopy (FIGURE 4.39A,B). Remarkably, the researchers
were able to visualize an Fgf8-GFP gradient that differed under different circumstances
(FIGURE 4.39C ): free diffusion of the ligand achieved the greatest distance traveled;
“directed diffusion” along HSPG fibers fostered rapid movement over several cell dis-
tances; “confined clustering” of Fgf8 on dense HSPG matrices significantly restricted
diffusion; and endocytosis internalized the Fgf8-FGFR complex for lysosomal degrada-
tion in receiving cells (Yu et al. 2009; Bökel and Brand 2013). Thus, the target tissue is
not passive. It can promote diffusion, retard diffusion, or degrade the paracrine factor.
cilia as signal reception centers In many cases, the reception of paracrine factors
is not uniform throughout the cell membrane; rather, receptors are often congregated
asymmetrically. For instance, the reception of Hedgehog proteins in vertebrates occurs
on the primary cilium, a focal extension of the cell membrane made by microtubules
(Huangfu et al. 2003; Goetz and Anderson 2010). The primary cilium should not be
confused with motile cilia such as those found lining the trachea or in the node of a
gastrulating embryo. The primary cilium is much shorter than motile cilia and largely
went unnoticed until we realized its direct role in numerous human diseases. In fact,
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_04.38 Date 03-09-16
Cell-to-Cell Communication 133
(A) (B)
mRNA
5
Fgf8
1
mRNA decay
Figure 4.39 The Fgf8 gradient. (A) Zebrafish blastulae were endocytosis with the overexpression of the endosomal protein
injected with DNA encoding Fgf8-GFP (green stain) and mRFP-gly- Rab5c (GOF, gain of function) yields a steeper and shorter Fgf8 gra-
cosyl phosphatidylinositol (GPI; red stain) to visualize, respectively, dient (blue plot). (C) Five primary mechanisms for shaping the Fgf8
Fgf8 expression and the cell membrane. The confocal image is of a gradient. (1) The difference in the rate of fgf8 transcription and fgf8
resulting zebrafish gastrula, showing Fgf8 protein being produced mRNA decay can influence the amount of Fgf8 protein ultimately
by and secreted away from isolated GFP-labeled cells (green). On secreted from a producing cell. Once secreted, Fgf8 can (2) freely
the right is a schematic representation of select cells and the Fgf8 diffuse or (3) travel rapidly along HSPG fibers for directed diffusion.
expression seen in the confocal image (compare a and b identifiers). (4) In contrast, however, dense areas of HSPGs can also confine
Fgf8 is seen in a gradient in the extracellular matrix as well as being and restrict Fgf8 diffusion. (5) The Fgf8-FGFR complex can also be
internalized in receiving cells. (B) Quantification of Fgf8 protein at dif- internalized by endocytosis and targeted for lysosomal degradation.
ferent locations in (A), indicated by “X” marks in schematic. Manipu- Together these different mechanisms result in the displayed gradi-
lation of endocytosis causes predictable changes in the range of ent of Fgf8, and differential responses in cells that experience dif-
Fgf8 secretion. Inhibition of endocytosis with the dominant negative ferent concentrations of Fgf8 signaling (different colored nuclei). (A
GTPase dynamin causes a shallower Fgf8 gradient over a longer courtesy of Michael Brand; B after Yu et al. 2009; C after Bökel and
distance (green plot) (LOF, loss of function), whereas increased Brand 2013; Balasubramanian and Zhang 2015.)
(A)
(B)
Co-localized Shifted overlay
No hedgehog
Hedgehog hyperactivated
FIGURE 4.40 The primary cilium for Hedgehog reception. cilium. Seen here is the primary cilium (arrow; immunofluorescence
(A) Transmission electron micrograph showing a longitudinal section stained for acetylated tubulin, blue) on a fibroblast in culture. The
of the primary cilium (black arrow) of a “B-type cell,” a neural stem ciliary protein Evc (stained green) co-localizes with Smoothened
cell in the adult mammalian brain (see Chapter 5). The centriole at (red) upon hyperactivation of Hedgehog signaling by the drug SAG.
the base of this cilium is visible (arrowhead); the microtubules in Compare the co-localized labeling on the left with the overlays on
this primary cilium form an 8+0 structure (other types of cilia, such the right, which have been shifted to show each individual marker.
as motile cilia, typically form a 9+2 arrangement; seen in upper left Activation of the Evc-Smo complex in the primary cilium leads to
corner in cross-section [red arrows]). (B) Activation of the Hedgehog full-length Gli signaling. (A from Alvarez-Bulla et al. 1998; B from
pathway requires the transport of Smoothened into the primary Caparrós-Martín et al. 2013.)
cilia provide a scaffold for motor proteins to transport Patched and Smoothened as well
as activated Gli proteins, and mutations that knock out cilia formation or their transport
mechanism also prevent Hedgehog signaling (Mukhopadhyay and Rohatgi 2014).
the filopodial cytoneme What if the molecules we thought were diffusible para-
crine factors moving through the extracellular matrix were actually transferred from
one cell to another at synapse-like connections? There is now significant evidence to
support the existence of specialized filopodial projections called cytonemes , which
stretch out remarkable distances (more than 100 μm) from either the target cells or
the signal-producing cells, like long membrane conduits connecting the two types of
cells (Roy and Kornberg 2015). Under this model, ligand-receptor binding would ini-
tially occur at the tips of cytonemes projecting from the target cells when the tips are
positioned in direct apposition to the producing cell’s plasma membrane. The ligand-
receptor complex would then be transported down the cytoneme to the target cell body.
Cytoneme-mediated morphogen signaling was first described by Thomas Korn-
berg’s laboratory studying development of the air sac and wing disc in Drosophila (Roy
et al. 2011). A cluster of cells called the air sac primordium (ASP) develops along the
basal surface of the wing disc in response to DPP (a BMP homologue) and FGF mor-
phogen gradients in the wing disc (FIGURE 4.42A,B ). The Kornberg lab discovered
that the ASP cells extend cytonemes toward the DPP- and FGF-expressing cells, and
that these cytonemes contain receptors for these morphogens—separate receptors in
separate cytonemes. Moreover, DPP bound to its receptor on ASP cells has been docu-
Gilbert
mented traveling
Developmental along
Biology 11e,aSinauer
cytoneme to the cell body. Anterior-posterior patterning of the
Associates
wing disc by a
DevBio11e_04.41 gradient of Hedgehog
Date 03-23-16 (Hh) signaling also appears to be accomplished Developing Questions
through cytonemes (FIGURE 4.42C). Hedgehog coming from posterior cells is delivered
Are all the molecules
through cytonemes that extend from the basolateral surface of anterior cells to the Hh- that we have considered
producing posterior cells (FIGURE 4.42D,E ; Bischoff et al. 2013). to be paracrine factors
Recent investigations have shown that vertebrates use cytonemes as well. Work in distributed solely by
Michael Brand’s lab and recent work by Steffen Scholpp’s lab have shown that the same contact through filopodial
gastrulating cells also transport the morphogen Wnt8a along cytoneme-like extensions. cytoneme processes,
In this case, the signal-producing cells are extending the cytonemes, transporting the as opposed to diffusion
through the extracellular
Wnt8a morphogen to target cells ( FIGURE 4.42F; Luz et al. 2014; Stanganello et al.
matrix? This question
2015). Cytoneme-like interactions are also suspected in one of the classic examples of is increasingly coming
morphogen signaling, that of anterior-posterior specification in the tetrapod limb bud. up in debates among
Here, a posterior-to-anterior gradient of Sonic hedgehog (Shh) in the limb bud leads to developmental biologists.
the correct patterning of digits (see Chapter 19). In the chick limb bud, both the Sonic Where do you stand? Are
hedgehog-expressing cells and the anterior target cells extend filopodial projections you a “diffusionist” or a
toward each other and make contact at points where Sonic hedgehog (Patch) receptors “cytonemist”? Is there room
for both mechanisms,
are localized (FIGURE 4.42G ; Sanders et al. 2013).
or perhaps even a
developmental need for
Scientists Speak 4.6 An iBiology Seminar by Dr. Thomas Kornberg of the Uni- both?
versity of California, San Francisco, discusses cytoneme-directed transport and
direct transfer models.
136 Chapter 4
(A) (C)
Hh protein
Pixel intensities
Hh protein
Cytonemes
Air sac primordium Cytonemes Imaginal disc
(B)
Cytonemes
0 min 250 min 500 min 738 min
(D)
A/P border Longest cytonemes Short array
Hh
Dpp
(E)
Fgf
Filopodial
P extensions
Wnt8a Lrp6
Shh producing cells Shh
FIGURE 4.42 Filopodia-transported morphogens from fly to the morphogens produced and transported along these cytonemes
fish and mouse. (A) Cytonemes from the air sac primordium (ASP) (arrows). (F) Wnt8a (red) and its receptor Lrp6 (green) were micro-
extend toward the epithelium of the wing imaginal disc in Drosophila injected into two different cells of an early-stage zebrafish blastula.
to shuttle the FGF (green) and DPP (red) morphogens. (B) Transport- Live cell imaging of these cells at the gastrula stage revealed Wnt8a
ed DPP receptor binds DPP produced by the wing disc cells, which interactions with the Lrp6 receptor at the tips of filopodial extensions
gets transported back down the cytoneme to the ASP. (C) This sys- from the producer cells (P, yellow arrow). (G) In the chick limb bud,
tem of cytonemes in the Drosophila wing disc is capable of estab- long, thin filopodial protrusions have been documented extending
lishing a gradient of Hedgehog (Hh) protein (green in top panels and both from Sonic hedgehog-producing cells in the posterior region
in plot) over the course of filopodial extension (black processes in (purple cell with green Shh protein in left image) and from the target
lower panels and red plot line). (D) Illustration of the Drosophila wing cells in the anterior limb bud (red cells). These opposing filopodia
imaginal disc during its interactions with tracheal cells, namely the air directly interact (brackets, left image), and at this point of interaction,
Developmental
sac primordium.Biology 11eand Fgf expressing cells are represented
Dpp, Hh, it is proposed that Shh and its receptor Patch can bind (right illustra-
Fig. 04.42red, and green domains. (E) Magnified cross section of the
as blue, tion). (A,B from Roy and Kornberg 2011; C from Bischoff et al. 2013;
Dragonfly
boxed regionMedia Group
in (D). Cytoneme extensions from the air sac primordi- F from Stanganello et al. 2015; G from Sanders et al. 2013.)
05/25/16
um as well as between cells of the wing disc are illustrated along with
Cell-to-Cell Communication 137
(A) (B)
factor tethered to the cell membrane. When the attachment is broken, Notch (or a piece
of it) can detach from the cell membrane and enter the nucleus (Kopan 2002).
Notch proteins are involved in the formation of numerous vertebrate organs—kid-
ney, pancreas, and heart—and they are extremely important receptors in the nervous
system. In both the vertebrate and Drosophila nervous systems, the binding of Delta
to Notch tells the receiving cell not to become neural (Chitnis et al. 1995; Wang et al.
1998). In the vertebrate eye, the interactions between Notch and its ligands regulate
which cells become optic neurons and which become glial cells (Dorsky et al. 1997;
Wang et al. 1998).
WEb Topic 4.3 Notch mutations Humans have genes for more than one Notch
protein and more than one ligand. Their interactions are critical in neural development,
and mutations in Notch genes can cause nervous system abnormalities.
Induction does indeed occur on the cell-to-cell level, and one of the best examples
is the formation of the vulva in the nematode worm C. elegans. Remarkably, the signal
transduction pathways involved turn out to be the same as those used in the formation
of retinal receptors in Drosophila; only the targeted transcription factors are different. In
both cases, an epidermal growth-factor-like inducer activates the RTK pathway, leading
to the differential regulation of Notch-Delta signaling.
notch-delta and lateral inhibition We have discussed the reception of the EGF-
like LIN-3 signal by the cells of the equivalence group that forms the vulva. Before this
induction occurs, however, an earlier interaction has formed the anchor cell. The forma-
tion of the anchor cell is mediated by lin-12, the C. elegans homologue of the Notch gene. In
Cell-to-Cell Communication 139
P5.p Vul on 2˚
Cuticle lin-12 on
3˚ (lateral)
P4.p 3˚
wild-type C. elegans hermaphrodites, two adjacent cells, Z1.ppp and Z4.aaa, have Hypo-
the potential to become the anchor cell. They interact in a manner that causes one P3.p 3˚ dermis
of them to become the anchor cell while the other one becomes the precursor of
the uterine tissue. In loss-of-function lin-12 mutants, both cells become anchor Figure 4.44 C. elegans vulval precursor cells
cells, whereas in gain-of-function mutations, both cells become uterine precur- (VPCs) and their descendants. (A) Location of
sors (Greenwald et al. 1983). Studies using genetic mosaics and cell ablations have the gonad, anchor cell, and VPCs in the second
shown that this decision is made in the second larval stage, and that the lin-12 instar larva. (B,C) Relationship of the anchor cell
gene needs to function only in that cell destined to become the uterine precursor to the six VPCs and their subsequent lineages.
cell. The presumptive anchor cell does not need it. Seydoux and Greenwald (1989) Primary (1°) lineages result in the central vulval
cells, secondary (2°) lineages constitute the lat-
speculate that these two cells originally synthesize both the signal for uterine
eral vulval cells, and tertiary (3°) lineages gener-
differentiation (the LAG-2 protein, homologous to Delta) and the receptor for this ate hypodermal cells. (C) Outline of the vulva in
molecule (the LIN-12 protein, homologous to Notch; Wilkinson et al. 1994). the fourth instar larva. The circles represent the
During a particular time in larval development, the cell that, by chance, is positions of the nuclei. (D) Model for the deter-
secreting more LAG-2 causes its neighbor to cease its production of this differen- mination of vulval cell lineages in C. elegans.
tiation signal and to increase its production of LIN-12. The cell secreting LAG-2 The LIN-3 signal from the anchor cell causes
becomes the gonadal anchor cell, while the cell receiving the signal through the determination of the P6.p cell to generate
the central vulval lineage (dark purple). Lower
its LIN-12 protein becomes the ventral uterine precursor cell ( FIGURE 4.45).
concentrations of LIN-3 cause the P5.p and P7.p
Thus, the two cells are thought to determine each other prior to their respective cells to form the lateral vulval lineages. The P6.p
differentiation events. When LIN-12 is used again during vulva formation, it is (central lineage) cell also secretes a short-range
activated by the primary vulval lineage to stop the lateral vulval cells from form- juxtacrine signal that induces the neighboring
ing the central vulval phenotype (see Figure 4.44). Thus, the anchor cell/ventral cells to activate the LIN-12 (Notch) protein. This
uterine precursor decision illustrates two important aspects of determination in signal prevents the P5.p and P7.p cells from
two originally equivalent cells. First, the initial difference between the two cells generating the primary central vulval cell lineage.
(After Katz and Sternberg 1996.)
is created by chance. Second, this initial difference is reinforced by feedback.
This Notch-Delta mediated mechanism of restricting adjacent cell fates is called
lateral inhibition .
Gilbert
Developmental Biology 11e, Sinauer Associates
Hippo: An integrator
DevBio11e_04.44 Dateof pathways
03-09-16
Most of the signal transduction pathways that we have discussed are named
for the players involved in the initial signaling event at the cell membrane. The
Hippo signal transduction pathway does not have a dedicated ligand or receptor,
however. Hippo stands for one of several important kinases that are critical for
organ size control. It was first identified in Drosophila, where its loss resulted in a
“hippopotamus”-shaped phenotype due to excessive growth (Hansen et al. 2015).
140 Chapter 4
Signal Receptor Figure 4.45 Model for the generation of two cell types (anchor cell and ventral uterine pre-
(A) cursor cell) from two equivalent cells (Z1.ppp and Z4.aaa) in C. elegans. (A) The cells start off
as equivalent, producing fluctuating amounts of signal and receptor. The lag-2 gene is thought
to encode the signal, and the lin-12 gene is thought to encode the receptor. Reception of the
signal turns down LAG-2 (Delta) production and upregulates LIN-12 (Notch). (B) A stochastic
(chance) event causes one cell to produce more LAG-2 than the other cell at some particular
critical time, which stimulates more LIN-12 production in the neighboring cell. (C) This differ-
(B) ence is amplified because the cell producing more LIN-12 produces less LAG-2. Eventually,
just one cell is delivering the LAG-2 signal, and the other cell is receiving it. (D) The signaling
cell becomes the anchor cell, and the receiving cell becomes the ventral uterine precursor cell.
(After Greenwald and Rubin 1992.)
(C)
Loss of Hippo (or overexpression of its main transcriptional effector, Yorkie) causes cells
to divide significantly faster while slowing apoptosis (FIGURE 4.46; Justice et al. 1995;
Xu et al. 1995; Huang et al. 2005).
The essential players in the Hippo signaling cascade begin at the cell membrane
(D) with cell-to-cell interactions involving cell adhesion molecules such as E-cadherin or
Crumbs (see Figure 5.7B). These cell adhesion molecules interact with the F-actin bind-
ing protein angiomotin, which initiates activation of the Hippo kinase cascade (Han-
sen et al. 2015). The main kinase in this cascade is the Large tumor suppressor 1/2
Anchor Ventral uterine (Lats1/2; Warts is the Drosophila homologue), which functions to phosphorylate Yorkie
cell precursor or its mammalian homologue Yap/Taz. When phosphorylated, Yap/Taz will either be
retained in the cytoplasm or degraded, whereas lack of Hippo signaling frees Yap/Taz
to enter the nucleus and function as a transcription co-activator of Tead (Scalloped
homologue). There are a number of ways in which Hippo signaling components can
regulate the pathways of other paracrine factors such as Wnts, EGF, TGF-β, and BMP.
Likewise, these pathways can modulate Hippo signaling, typically operating through
Yap/Taz. Thus, the Hippo pathway is emerging as a major crossroad for the biochemical
pathways of the cell, heightening our attention to the long-unsolved problem of under-
standing how all these conceptually linear pathways are truly integrated.
4 Snapshot Summary
Cell-to-Cell Communication
1. The sorting out of one cell type from another results • Cascades of inductive events are responsible for
from differences in the cell membrane. organ formation.
2. The membrane structures responsible for cell sorting • Regionally specific inductions can generate different
out are often cadherin proteins that change the surface structures from the same responding tissue.
tension properties of the cells. Cadherins can cause 5. Paracrine interactions occur when a cell or tissue
cells to sort by both quantitative (different amounts of secretes proteins that induce changes in neighboring
cadherin) and qualitative (different types of cadherin) dif- cells. Juxtacrine interactions are inductive interactions
ferences. Cadherins appear to be critical during certain that take place between the cell membranes of adjacent
morphological changes. cells or between a cell membrane and an extracellular
3. Cell migration occurs through changes in the actin cyto- matrix secreted by another cell.
skeleton. These changes can be directed by internal 6. Paracrine factors are secreted by inducing cells. These
instructions (from the nucleus) or by external instruc- factors bind to cell membrane receptors in competent
tions (from the extracellular matrix or chemoattractant responding cells. Competence is the ability to bind and
molecules). to respond to inducers, and it is often the result of a
4. Inductive interactions involve inducing and respond- prior induction. Competent cells respond to paracrine
ing tissues. The ability to respond to inductive signals factors through signal transduction pathways.
depends on the competence of the responding cells. 7. Morphogens are secreted signaling molecules
The specific response to an inducer is determined by that affect gene expression differently at different
the genome of the responding tissue. concentrations.
• Reciprocal induction occurs when the two 8. Signal transduction pathways begin with a paracrine
interacting tissues are both inducers and are or juxtacrine factor causing a conformational change in
competent to respond to each other’s signals.
142 Chapter 4
its cell membrane receptor. The new shape can result vertebrae from somitic cells. In adults, EMT is involved in
in enzymatic activity in the cytoplasmic domain of the wound healing and cancer metastasis.
receptor protein. This activity allows the receptor to 12. The cell surface is intimately involved with cell signaling.
phosphorylate other cytoplasmic proteins. Eventually, a Proteoglycans and other membrane components can
cascade of such reactions activates a transcription fac- expand or restrict the diffusion of paracrine factors.
tor (or set of factors) that activates or represses specific
13. Specializations of the cell surface, including cilia and
gene activity.
lamellipodia, may concentrate receptors for paracrine
9. The differentiated state can be maintained by positive and extracellular matrix proteins. Newly discovered
feedback loops involving transcription factors, autocrine filopodia-like extensions called cytonemes can be
factors, or paracrine factors. involved in transferring morphogens between signaling
10. The extracellular matrix is both a source of signals and and responding cells and may be a major component of
serves to modify how such signals may be secreted cell signaling.
across cells to influence differentiation and cell migration. 14. Juxtacrine signaling involves local protein interactions
11. Cells can convert from being epithelial to being mes- between receptors. Examples include Notch-Delta sig-
enchymal and vice versa. The epithelial-mesenchymal naling that patterns cell fates through lateral inhibition
transition (EMT) is a series of transformations involved and Hippo signaling that influences organ size.
in the dispersion of neural crest cells and the creation of
Further Reading
Ananthakrishnan, R. and A. Ehrlicher. 2007. The forces behind Kakugawa, S. and 11 others. 2015. Notum deacylates Wnt pro-
cell movement. Int. J. Biol. Sci. 3: 303–317. teins to suppress signalling activity. Nature 519: 187–192.
Balasubramanian, R. and X. Zhang. 2015. Mechanisms of FGF Molina, M. D., N. de Crozé, E. Haillot and T. Lepage. 2013.
gradient formation during embryogenesis. Semin. Cell Dev. Biol. Nodal: Master and commander of the dorsal-ventral and left-
doi:10.1016/j.semcdb.2015.10.004. right axes in the sea urchin embryo. Curr. Opin. Genet. Dev. 23:
Bischoff, M. and 6 others. 2013. Cytonemes are required for the 445–453.
establishment of a normal Hedgehog morphogen gradient in Müller P. and A. F. Schier. 2011. Extracellular movement of sig-
Drosophila epithelia. Nature Cell Biol. 11: 1269–1281. naling molecules. Dev. Cell 21: 145–158.
Briscoe, J. and P. P. Thérond. 2013. The mechanisms of Hedge- Nahmad, M. and A. D. Lander. 2011. Spatiotemporal mecha-
hog signalling and its roles in development and disease. Nat. nisms of morphogen gradient interpretation. Curr. Opin. Genet.
Rev. Mol. Cell Biol. 7: 416–429. Dev. 21: 726–731.
Fagotto, F., N. Rohani, A. S. Touret and R. Li. 2013. A molecular Roy, S. and T. B. Kornberg. 2015. Paracrine signaling mediated
base for cell sorting at embryonic boundaries: Contact inhibi- at cell-cell contacts. Bioessays 37: 25–33.
tion of cadherin adhesion by ephrin/ Eph-dependent contrac- Saito-Diaz, K. and 6 others. 2013. The way Wnt works: Compo-
tility. Dev. Cell 27: 72–87. nents and mechanism. Growth Factors 31: 1–31.
Foty, R. A. and M. S. Steinberg. 2013. Differential adhesion in Stanganello, E. and 8 others. 2015. Filopodia-based Wnt trans-
model systems. Wiley Interdiscip. Rev. Dev. Biol. 2: 631–645. port during vertebrate tissue patterning. Nature Commun. 6:
Hansen, C. G., T. Moroishi and K. L. Guan. 2015. YAP and 5846.
TAZ: A nexus for Hippo signaling and beyond. Trends Cell Biol. van Amerongen, R. and R. Nusse. 2009. Towards an integrated
25: 499–513. view of Wnt signaling in development. Development 136:
Heldin, C.-H., K. Miyazono and P. ten Dijke. 1997. TGF-β sig- 3205–3214.
naling from cell membrane to nucleus through SMAD proteins. van den Heuvel, M., C. Harryman-Samos, J. Klingensmith, N.
Nature 390: 465–471. Perrimon and R. Nusse. 1993. Mutations in the segment polar-
Huangfu, D., A. Liu, A. S. Rakeman, N. S. Murcia, L. Niswan- ity genes wingless and porcupine impair secretion of the wingless
der and K. V. Anderson. 2003. Hedgehog signalling in the protein. EMBO J. 12: 5293–5302.
mouse requires intraflagellar transport proteins. Nature 426: Yu, S. R. and 7 others. 2009. Fgf8 morphogen gradient forms
83–87. by a source-sink mechanism with freely diffusing molecules.
Nature 461: 533–536.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
5
Stem Cells
Their Potential and Their Niches
The Punchline
Stem cells retain the ability to divide while also generating differentiating progeny. The
differences among stem cell types is based on their potential for cell fate derivation.
Because embryonic stem cells are pluripotent, they can make every cell of the body,
whereas an adult stem cell is multipotent and usually can give rise only to the different
cell types of its residing tissue. Stem cells reside within a “stem cell niche,” which
provides a microenvironment of local and long-range signals that regulate whether the
stem cell is in a state of quiescence, division, or differentiation. A common mechanism
of regulation in the niche involves modulating changes in cell adhesion molecules that
link the stem cell to its niche. Loss of adhesion leads to the movement of the stem
cell or its progeny away from quiescence-promoting signals (often paracrine factors),
thus fostering division and differentiation. Isolation or derivation of human pluripotent
and multipotent stem cells offers opportunities to study the mechanisms of human
development and disease as never before. Precise regulation of stem cells helps build
the embryo, maintain and regenerate tissues, and potentially could provide cell-based
therapies to treat disease.
144 Chapter 5
Dev T u tor i al Stem Cells Dr. Michael Barresi’s lecture covers the
basics of stem cell biology.
Multipotent Embryo,
Multipotent
stem cell adult brain
? ?
Limited Differentiating Regions of
division neuronal the brain
potential precursors
Lymphoid Basophil
B lymphocyte
progenitor cell
Eosinophil
Monocyte/
Hematopoietic Myeloid macrophage
stem cell progenitor cell
(multipotent)
Platelets
Hematopoietic stem cells
Neuro- Endocrine
transmitter signaling
release
evidence that all tissue types possess a unique stem cell niche, and despite many dif-
ferences among the niche architecture of different tissues, several common principles
of stem cell regulation can be applied to all environments. These principles involve
extracellular mechanisms leading to intracellular changes that regulate stem cell behavior
(FIGURE 5.4). Extracellular mechanisms include:
• Physical mechanisms of influence, including structural and adhesion factors
within the extracellular matrix that support the cellular architecture of the
niche. Differences in cell-to-cell and cell-to-matrix adhesions as well as the
cell density within the niche can alter the mechanical forces that influence
stem cell behavior.
• Chemical regulation of stem cells takes the form of secreted proteins from
surrounding cells that influence stem cell states and progenitor differentia-
tion through endocrine, paracrine, or juxtacrine mechanisms (Moore and
Lemischka 2006; Jones and Wagers 2008). In many cases, these signaling fac-
tors maintain the stem cell in an uncommitted state. Once stem cells become
positioned farther from the niche, however, these factors cannot reach them,
and differentiation commences.
Intracellular regulatory mechanisms include:
• Regulation by cytoplasmic determinants, the partitioning of which occurs at
cytokinesis. As a stem cell divides, factors determining cell fate are either
selectively partitioned to one daughter cell (asymmetric differentiating divi-
sion) or shared evenly between daughter cells (symmetrical division).
• Transcriptional regulation occurs through a network of transcription factors
that keep a stem cell in its quiescent or proliferative state, as well as promot-
ing maturation of daughter cells toward a particular fate.
• Epigenetic regulation occurs at the level of chromatin. Different patterns
Developmental Biology
of chromatin 11e
accessibility influence gene expression related to stem cell
Fig. 05.04
behavior.
Dragonfly Media Group
The types of the intracellular mechanisms used by a given stem cell are in part the down-
03/24/16
stream net result of the extracellular stimuli in its niche. Just as important, however, is the
148 Chapter 5
stem cell’s developmental history within its niche. Below are descriptions of some of the
better-known stem cell niches, highlighting their developmental origins and the specific
extracellular and intracellular mechanisms important for regulating stem cell behavior.
Morula Blastocyst
FIGURE 5.5 Establishment of the inner cell mass (the ICM, which
Blastocoel will become the embryo) in the mouse blastocyst. From morula to
blastocyst, the three principal cell types—trophectoderm, ICM, and
primitive endoderm—are illustrated.
Stem Cells 149
(A) FIGURE 5.7 Hippo signaling and ICM development. (A) Immunolo-
Morula Blastocyst calization of the Hippo pathway components Amot (angiomotin; red
stain) and Yap (green stain)—as well as E-cadherin—from morula to
blastocyst. Activated Yap is localized to the trophectoderm nuclei,
while E-cadherin (purple) is restricted to the trophectoderm-ICM
membrane contacts. (B) Hippo signaling in trophectoderm (top) and
ICM (bottom) cells. Hippo signaling is activated through E-cadherin
binding with Amot and, as a result, Yap is degraded in the ICM cell.
Names in parentheses are the Drosophila homologues.
Amot Yap/Taz E-cadherin (A from Hirate et al. 2013.)
(B)
Apical proteins
(PAC, aPKC)
Trophectoderm Stem cells fueling germ cell development
cell in Drosophila
Apical
drosophila testes stem cell niche Stem cell niches in
Amot
the testes of male Drosophila illustrate the importance of local
signals, cell-to-cell adhesion, and asymmetric cell division.
The stem cells for sperm reside in a regulatory microenviron-
Yap/Taz ment called the hub ( FIGURE 5.8). The hub consists of about
TEAD 12 somatic testes cells and is surrounded by 5–9 germ stem
Cdx2 cells (GSCs). The division of a sperm stem cell is asymmetric,
always producing one cell that remains attached to the hub and
E-cadherin
homophilic one unattached cell. The daughter cell attached to the hub is
adherens maintained as a stem cell, whereas the cell that is not touch-
Cell-to-cell junctions ing the hub becomes a gonialblast, a committed progenitor cell
adhesion that will divide to become the precursors of the sperm cells. The
Basal
somatic cells of the hub create this asymmetric proliferation by
secreting the paracrine factor Unpaired onto the cells attached to
ICM cell Amot them. Unpaired protein activates the JAK-STAT pathway in the
adjacent germ stem cells to specify their self-renewal. Cells that
Hippo kinase cascade
are distant from the paracrine factor do not receive this signal
Signals degradation and begin their differentiation into the sperm cell lineage (Kiger
LATS 1/2 (Warts) et al. 2001; Tulina and Matunis 2001).
Physically, this asymmetric division involves the interac-
Wnt Yap/Taz TGF-β/BMP tions between the sperm stem cells and the somatic cells. In
β-catenin Cytoplasmic (Yorkie) Cytoplasmic SMADS the division of the stem cell, one centrosome remains attached
Yap/Taz Yap/Taz to the cortex at the contact site between the stem cell and the
somatic cells. The other centrosome moves to the opposite side,
thus establishing a mitotic spindle that will produce one daugh-
TEAD
(Scalloped) ter cell attached to the hub and one daughter cell away from it
(Yamashita et al. 2003). (We will see a similar positioning of cen-
Cdx2 trosomes in the division of mammalian neural stem cells.) The
cell adhesion molecules linking the hub and stem cells together
Oct4 are probably involved in retaining one of the centrosomes in the
region where the two cells touch. Here we see stem cell produc-
Pluripotency tion using asymmetric cell division.
GRN
drosophila ovarian stem cell niche Similar to sperm,
Retain Lose the Drosophila oocyte is derived from a germ stem cell. These
Oct4 Oct4 GSCs are held within the ovarian stem cell niche, and positional
secretion of paracrine factors influences stem cell self-renewal
Primordial Epiblast and oocyte differentiation in a concentration-dependent man-
germ cells (embryo)
ner. Egg production in the adult fly ovary occurs in more than 12
egg tubes or ovarioles, each one housing identical GSCs (usually
two per ovariole) and several somatic cell types that construct
Developmental Biology 11e
Fig. 05.07
Dragonfly Media Group
04/21/16
Stem Cells 151
Mesenchymal stem cells (MSCs) Bone marrow, adipose tissue, heart, placenta, Probably blood vessel epithelium
umbilical cord
Intestine Base of small intestinal crypts (see Figure 5.13) Paneth cells, MSCs
Hematopoietic (blood-forming) Bone marrow (see Figure 5.15) Macrophages, Treg cells, osteoblasts,
stem cells (HSCs) pericytes, glia, neurons, MSCs
Epidermis (skin) Basal layer of epidermis Dermal fibroblasts
Hair follicle Bulge (see Figure 16.17) Dermal papillae, adipocyte precursors,
subcutaneous fat, keratin
Sperm Testes Sertoli cells (see Figure 6.21)
a
Niches with low rates of cell turnover generate stem cells for repair, slow growth, and (in the case of neurons) learning. Niches with high turnover
are constantly producing new cells for bodily maintenance.
the niche known as the germarium (Lin and Spradling 1993). As a GSC divides, it self-
renews and produces a cystoblast that (like the sperm gonialblast progenitor cell) will
mature as it moves farther out of the stem cell niche—beyond the reach of the niche’s
regulatory signals—and becomes an oocyte surrounded by follicle cells (FIGURE 5.9A ;
Eliazer and Buszczak 2011; Slaidina and Lehmann 2014).
Although the GSCs are within the stem cell niche, they are in contact with Cap cells.
Upon division of the GSC perpendicular to the Cap cells, one daughter cell remains
tethered to the Cap cell by E-cadherin and maintains its self-renewal identity, whereas
Hub
cells Germ
stem cell
Supporting
somatic cells
Gonialblast
FIGURE 5.8 Stem cell niche in Drosophila testes. (A) The apical hub that this protein is transcribed in the somatic hub cells. (C) Cell divi-
consists of about 12 somatic cells, to which are attached 5–9 germ sion pattern of the germline stem cells, wherein one of the two cen-
stem cells. The germ stem cells divide asymmetrically to form another trosomes remains in the cortical cytoplasm near the site of hub cell
germ stem cell (which remains attached to the somatic hub cells), and adhesion while the other migrates to the opposite pole of the germ
a gonialblast that will divide to form the sperm precursors (the sper- stem cell. The result is one cell remaining attached to the hub and the
matogonia and the spermatocyte cysts where meiosis is initiated). (B) other cell detaching from the hub and differentiating. (After Tulina and
Reporter β-galactosidase inserted into the gene for Unpaired reveals Matunis 2001; photograph courtesy of E. Matunis.)
152 Chapter 5
Cap cells
Oocyte
E-cadherin Cystoblast
adherens GSC
junction P
MAD/MED
bam
BMP signal MAD/MED
transduction OFF
P
P
Signal bam
ON
P
P
Oocyte
differentiation
TGF-β
ligands
P
P
the displaced daughter cell begins oocyte differentiation (Song and Xie 2002). Cap cells
affect GSCs by secreting TGF-β family proteins, which activate the BMP signal trans-
duction pathway in the GSCs, and, as a result, prevent GSC differentiation ( FIGURE
5.9B). Extracellular matrix components like collagen and heparan sulfate proteoglycan
restrict the diffusion of the TGF-β family proteins such that only the tethered GSCs
receive significant amounts of these TGF-β signals (Akiyama et al. 2008; Wang et al.
2008; Guo et al. 2009; Hayashi et al. 2009).4 Activation of BMP signal transduction in
Developmental Biology 11e
4 Fig. 05.09
Gain or loss of function of the TGF-β proteins results in tumor-like expansion of the GSC
Dragonfly Media Group
population or loss of the GSCs, respectively (Xie and Spradling 1998).
04/21/16
Stem Cells 153
the GSC prevents differentiation by repressing transcription of genes that promote dif-
ferentiation, primarily that of bag of marbles (bam). When bam is expressed, the cell goes
on to differentiate into an oocyte (see Figure 5.9).
In conclusion, in both the testis and ovary of Drosophila, coordinated cell division
paired with adhesion and paracrine-mediated repression of differentiation controls
GSC renewal and progeny differentiation. New insights into the epigenetic regulation
of GSC development are beginning to emerge, for example the histone methyltrans-
ferase Set1 has been discovered to play an essential role in GSC self-renewal (Yan et
al. 2014; see Scientists Speak 5.2). Moreover, many of the structural and mechanistic
factors at play in the Drosophila germ stem cell niche are similar in other species. For
example, the distal tip cell of the C. elegans gonad is much like the Drosophila Cap cells
in that it provides the niche signals that regulate the nematode’s germ stem cells (see
Chapter 8). C. elegans does not use Unpaired or BMP as in the fly GSC niche; rather,
Notch signaling from the distal tip cell is used to similarly suppress differentiation of
the GSCs. Those cells leaving the range of Notch signaling start differentiating into
germ cells (see the comparative review of GSCs by Spradling et al. 2011).
Scientists Speak 5.2 Dr. Norbert Perrimon answers questions on defining the
gene regulatory network for germ stem cell self-renewal in Drosophila.
5
Most NSCs exhibit astroglial characteristics, although there are exceptions. Self-renewing
neuroepithelial-like cells persist in the zebrafish telencephalon and function as neural progeni-
tors that lack typical astroglial gene expression. Consider the work of Michael Brand’s lab for
further study. (Kaslin et al. 2009; Ganz et al. 2010; Ganz et al. 2012.)
154 Chapter 5
EfnB2 Jag1
GDF11
Induces proliferation
Blood A and neurogenesis Neuroblast
Eph Notch migration
A A
Shh response across lateral ventricle
A A A
Basal
Glia A EGFR A
Shh A
EGFR C
C C Endothelial cell
GABA
C C EGFR C BMP
B1 B3 C
B2 GABA
C C
Shh NUMB Notch antagonist
Apical E E Noggin
E
CSF
NSC maintenance Neuronal fate B1 GFAP+, Constant Notch activity = Quiescent
B2 GFAP+/BLBP+, Oscillating Notch/Ascl1 = Limited proliferation
E B1
B3 BLBP+, Oscillating Notch/Ascl1 = Limited proliferation
B2
C EGFR+, Oscillating Notch/Ascl1 = Fast proliferation
5HT-2C VCAM1
A DCX+, Constant Ascl1 = Proliferation, migration, and
IL1-β differentiation
5HT (Inflammation)
Serotonergic Constant Slow Fast Constant
axon SMO
active oscillating oscillating proneural
Primary Shh Notch/Hes Hes/ Hes/
cilium Ptc proneural proneural
FIGURE 5.10 Schematic of the ventricular-subventricular zone hedgehog (Shh) that influence different neuronal cell differentiation
(V-SVZ) stem cell niche and its regulation. Multiciliated ependymal from the niche. Antagonistic signaling between BMP and Noggin
cells (E; light gray) line the ventricle and contact the apical surface from endothelial cells and ependymal cells, respectively, balance
of V-SVZ NSCs (blue). Typically quiescent B1-type NSCs (dark neurogenesis along this gradient. Serotonergic (5HT) axons lace
blue) give rise to activated B2 and B3 cells (lighter shades of blue) the ventricular surface , and—along with IL1-β and GDF11 from the
that possess limited proliferation. The B3 cells generate the C cells cerebral spinal fluid (CSF) and blood, respectively—play roles as
(green), which, after three rounds of division, give rise to migrating external stimuli to regulate the niche. Non-niche neurons, astro-
neuroblasts (A cells; orange). The niche is penetrated by endothe- cytes, and glia can be found within the niche and influence its regu-
lial cell-built blood vessels that are in part enwrapped by the basal lations. Glial fibrillary acidic protein (GFAP); brain lipid binding protein
endfeet of B cells. Maintenance of the stem cell pool is regulated by (BLBP); double cortin (DCX). (Based on various sources, including
VCAM1 adhesion and Notch signaling (changes in Notch pathway Basak et al. 2012; Giachino et al. 2014; Lim and Alvarez-Buylla 2014;
oscillations are depicted as color changes in the nuclei). Clusters of and Ottone et al. 2014.)
neurons in the ventral region of the lateral ventricle express Sonic
with a dividing B cell, which directly gives rise to a C cell. These type C (A)
progenitor cells proliferate and develop into type A neural precursors
that stream into the olfactory bulb for final neuronal differentiation (see
Figure 5.10). The B cell has been further categorized into three subtypes
(B1, B2, and B3) based on differences in proliferative states that correlate
with distinct radial glial gene expression patterns (Codega et al. 2014;
Giachino et al. 2014). It is important to note that in the NSC niche, type
1 B cells are quiescent or inactive, whereas types 2 and 3 B cells represent
actively proliferating neural stem cells (Basak et al. 2012).6
Developing Questions factor complex typically repressing proneural gene expression (see Figure 5.10 and
Chapter 4). Higher levels of NICD activity support stem cell quiescence, whereas
We know quite a bit about decreasing levels of Notch pathway activity promote progenitor proliferation and
Notch/Delta and Hes
maturation toward neural fates.7 The NICD is more active in the type B1 cell than in
gene oscillations during
embryonic development. the other cells of the V-SVZ niche, and it functions with other transcription factors to
What do oscillations of these repress gene expression associated with both proliferation and differentiation, thereby
genes in the adult neural promoting quiescence and maintaining the number of NSCs (Ables et al. 2011; Pierfe-
stem cell niche actually lice et al. 2011; Giachino and Taylor 2014; Urbán and Guillemot 2014).
look like? How do these Notch1 is actually expressed in all major cell types in the V-SVZ niche (B cells,
oscillations result in the progenitor [transit-amplifying] cells, and type A migrating neuroblasts; Basak et al.
progression from stem cell
2012), which raises the question, how can differentiation begin in the presence of
to neuron?
Notch? An important part of the Notch regulatory mechanism of neurogenesis lies in
the downstream transcriptional targets, namely the Hairy and Enhancer of Split (Hes)-
related genes. Hes genes primarily function to repress proneural gene expression. As
seen in Chapter 17, Notch-Delta signaling and its Hes targets can show temporally
oscillating patterns of gene expression established through negative feedback loops
in which upregulation of Hes by Notch leads to Hes-mediated repression of Notch. A
growing hypothesis is that constant activity of Notch signaling promotes quiescence,
whereas the oscillating expression of Hes genes—and, consequently, the anti-oscilla-
tion periods of proneural genes (such as Ascl1/Mash1)—supports proliferative states
until proneural gene expression is sustained and the cell differentiates (see Figure 5.10;
Imayoshi et al. 2013).
egf represses notch As discussed above, active (and constant) Notch signaling
encourages quiescence and represses differentiation; therefore, one mechanism to pro-
mote neurogenesis is to attenuate (and oscillate) Notch activity. The type C progeni-
tor cells do that by using epidermal growth factor receptor (EGFR) signaling, which
upregulates NUMB, which in turn inhibits NICD (see Figure 5.10; Aguirre et al. 2010).
Therefore, EGF signaling promotes the use of the stem cell pool for neurogenesis by
counterbalancing Notch signaling (McGill and McGlade 2003; Kuo et al. 2006; Aguirre
et al. 2010).
bone morphogenic protein signaling and the nsc niche Further movement
toward differentiation is driven by additional factors, such as BMP signaling, which
promotes gliogenesis in the V-SVZ as well as other regions of the mammalian brain
(Lim et al. 2000; Colak et al. 2008; Gajera et al. 2010; Morell et al. 2015). BMP signaling
from endothelial cells is kept high at the basal side of niche, whereas ependymal cells at
the apical border secrete the BMP inhibitor Noggin, keeping BMP levels in this region
low. Therefore, as B3 cells transition into type C-progenitor cells and then move closer
to the basal border of the niche, they leave the reach of BMP inhibitors and experience
increasing levels of BMP signaling, which promotes neurogenesis with a preference
toward glial cells (see Figure 5.10).
7
Many of the roles that Notch signaling plays in neurogenesis in the adult brain are similar to
its regulation of radial glia in the embryonic brain, but some important differences are begin-
ning to emerge. For a direct comparison of Notch signaling in embryonic versus adult neuro-
genesis and across species, see Pierfelice et al. 2011 and Grandel and Brand 2013.
Stem Cells 157
respond to such changes? The cerebral spinal fluid (CSF), neural networks, and vascula-
ture are in direct contact with the niche, and they can influence NSC behavior through
paracrine release into the CSF, electrophysical activity from the brain, and endocrine
signaling delivered through the circulatory system.
neural activity Intrinsic to the niche, migrating neural precursors secrete the
neurotransmitter GABA to negatively feedback upon progenitor cells and attenuate
their rates of proliferation. In opposition to this action, B cells secrete a competitive
inhibitor to GABA (diazepam-binding inhibitor protein) to increase proliferation in the
niche (Alfonso et al. 2012). Extrinsic inputs have also been discovered from serotonergic
axons densely contacting both the ependymal and type B cells (Tong et al. 2014). Type B
cells express serotonin receptors, and activation or repression of the serotonin pathway
in B1 cells increases or decreases, respectively, proliferation in the V-SVZ (see Figure
5.10). Additional neural activity from dopaminergic axons and a population of choline
acetyltransferase neurons residing in the niche have also been found to promote pro-
liferation and neurogenesis (see the references cited in Lim and Alvarez-Buylla 2014).
sonic hedgehog signaling and the nsc niche Similar to neural tube patterning
in the embryo (which we will describe in Chapter 13), the creation of different neuronal
cell types from the V-SVZ is in part patterned by a gradient of Sonic hedgehog (Shh)
signaling along the apicobasal axis of the niche, with highest levels of Shh in the apical
region8 (Goodrich et al. 1997; Bai et al. 2002; Ihrie et al. 2011). When the Shh gene is
knocked out, the loss of Shh signaling results in specific reductions in apically derived
olfactory neurons (Ihrie et al. 2011). This result implies that cells derived from NSC
clusters in the more apical positions of the niche will adopt different neuronal fates
compared to cells derived from NSCs in more basal positions, based on differences in
Shh signaling (see Figure 5.10).
8
The gradient of Shh in the brain is more accurately described as being oriented along the dor-
sal-to-ventral axis; for simplification, however, we have restricted our discussion to its presence
only along the apical-to-basal axis.
158 Chapter 5
BrdU+/NeuN+ cells
40
vasculature (stained green in the
Number of
photographs) as well as the amount
of proliferative neural progeny in
the old mouse. (B) Administering 20
GDF11 into the circulatory system
of an old mouse was sufficient to
similarly increase both vasculature 0
(green in photographs) and the Isochronic Heterochronic
population of neural progenitors
in the V-SVZ (outined red popula- (B)
Control GDF11+ *
tion in photographs and quantified 80
SOX2+ cells in graph). (After Katsim-
pardi et al. 2014.) 60
Sox2+ cells
Number of
40
20
Villus
Crypt Bmp4
Wnt3a
D114 +4 cell
Differentiation
Differentiation
Proliferation
LRC
PP
(B) Vertical Transit
displacement amplifying CB
CC
cells Active
Base of NICD P
CBC
CBCC
crypt
C
(houses Wnt2b P
ISC)
Bmp4
Stromal pericryptic
cells Wnt2b
Time post-labelling
et al. 2010). After CBCC symmetrical division, one daughter cell will (by chance) be
Developing Questions adjacent to a Paneth cell, while the other daughter cell is pushed away from the base to
progress through the transit-amplifying (progenitor) fate. In this manner, the neutral
Is there a true quiescent
stem cell in the crypt? competition for the Paneth cells’ surfaces dictates which will remain as a stem cell and
This question is hotly which will mature (Klein and Simons 2011).
debated. The employment Why might the longevity of an ISC be left to chance? It seems like a very non-
of transgenic tools to study Darwinian approach of the intestinal crypt to not favor the survival of the fittest stem
discrete cell populations in cell, wouldn’t you agree? Consider what would make an ISC particularly “fit.” It might
the base of the crypt has include high proliferative capability, particularly in a tissue that is designed for rapid
opened the door to defining
turnover like the intestinal epithelium; the paradox, however, is that enhanced pro-
a quiescent stem cell based
on the length of time that liferation is also a precursor for tumorogenesis and cancer. A current idea is that ISC
an induced cell label evolution through “neutral drift” promotes the retention of random CBCCs based more
remains in a cell. Buczacki on location than on genes. Such retention would decrease the probability of fixing
and colleagues) found a “favorable” mutations that may also lead to cancer (Kang and Shibata 2013; Walther
subset of Lrg5-expressing and Graham 2014).
crypt cells retaining the
induced label for weeks Regulatory mechanisms in the crypt
(Buczacki et al. 2013). So,
are these label-retaining The Paneth cell plays an important role in the intestine’s immune response because it is
cells a quiescent, reserve a secretory cell housing many granules for the release of anti-microbial substances. In
population of stem cells? addition, with nearly 80% of the intestinal stem cell’s surface in direct contact with the
Take note of Hans Clevers’ Paneth cell, it is a vital contributor to stem cell regulation. Each niche contains about
comments on this work 15 Paneth cells and an equal number of CBCCs. Deleting the Paneth cells destroys the
(Clevers 2013); consider ability of the stem cells to generate other cells. Paneth cells express several paracrine
also the recent intravital
and juxtacrine factors, including but not limited to Wnt3a and Delta-like4 (Dll4), an
imaging of the crypt
(Ritsma et al. 2014), and activator of Notch (Sato et al. 2009; Barker 2014; Krausova and Korinek 2014). When
debate it yourself. Dll4 binds to Notch receptors on the intestinal stem cells, it is interpreted as a signal for
sustained proliferation and lineage specification toward more secretory over absorptive
cell fates (see Figure 5.13C; Fre et al. 2011; Pellegrinet et al. 2011).
Developmental Biology 11e
Fig. 05.14
Dragonfly Media Group
03/29/16
Stem Cells 161
The stromal cells below the crypt epithelium also help regulate the intestinal stem
cell niche. They secrete Wnt2b with highest levels at the base of the crypt, whereas an
opposing gradient of Bmp4 is most abundant at the top of the crypt (see Figure 5.13C).
CBCCs, expressing both the Frizzled7 and BMPR1a receptors for Wnt2b and Bmp4,
respectively, can be affected by both factors (He et al. 2004; Farin et al. 2012; Flanagan
et al. 2015). The currently accepted model is that Wnt signaling promotes survival and
proliferation of the CBCCs and progenitor cells, whereas the opposing BMP signals
promote differentiation in the crypt with maturation progressing in the direction of the
villus (Carulli et al. 2014; Krausova and Korinek 2014).
There exists another small population of intestinal stem cells called the “+4 cells”
due to their location next to the fourth Paneth cell from the base of the crypt (see Figure
5.13C; Potten et al. 1978; Potten et al. 2002; Clevers 2013). Like CBCCs, +4 cells can
generate all the cell types of the intestine. Some reports indicate that +4 cells divide at a
slower rate than CBCCs, which suggests that they may be the quiescent stem cell of the
crypt. Minimally, it is undisputable that the +4 cells make important contributions to
intestinal homeostasis; significant debate still surrounds the notion that they represent
the niche’s quiescent stem cell, however (Carulli 2014).
Scientists Speak 5.4 There are similarities between the ISC niche with that of
the lung. Dr. Brigid Hogan talks about the role of stem cells in lung development
and disease.
12
The first successful bone marrow transplantation was between two identical twins, one of
whom had leukemia. It was conducted by Dr. E. Donnall Thomas, whose continued research in
stem cell transplantations won him the Nobel Prize in Physiology or Medicine in 1990.
162 Chapter 5
Circadian rhythms
Sympathetic Stress
[ ]
axon
Bone matrix
Long-term Endosteal
Osteoblast Osteoclast quiescent HSC niche
Short-term
active HSC
Mobile HSC/
CAR Short-term progenitor cell
Macrophage cell Mesenchymal quiescent HSC
stem cell Hematopoietic
stem cell niche
[ ]
[ ] Open pore
Endothelial Perivascular
cell Short-term niche
Angiopoietin-1 active HSC
Thrombopoietin
CXCL12/SDF1
Noradrenaline
Oxygen-rich RBCs
Hypoxic
vessels (endothelial cells and stromal cells). With the different physical and cel-
lular properties of these two niches come differential regulation of the HSCs
(Wilson et al. 2007). In addition, there are two subpopulations of HSCs within
these niches: one population can divide rapidly in response to immediate needs,
while a quiescent population is held in reserve and possesses the greatest poten-
tial for self-renewal (Wilson et al. 2008, 2009). Depending on physiological con-
ditions, stem cells from one subpopulation can enter the other subpopulation.
Developing Questions cells are mobilized into the bloodstream; there is greater cell division of HSCs at night
and increased migration of progenitor cells into the bloodstream during the day. This
We discussed two circadian pattern of mobilization is controlled by the release of noradrenaline from
distinct regions in the
sympathetic axons infiltrating the bone marrow (see Figure 5.15; Méndez-Ferrer et
hematopoietic stem cell
niche, but could there al. 2008; Kollet et al. 2012). Receptors on stromal cells respond to this neurotransmit-
be more? It has been ter by downregulating the expression of CXCL12, which temporarily reduces the hold
proposed that the MSCs that these stromal cells have on HSCs and progenitor cells, freeing them to circulate.
in the bone marrow exert Although circadian rhythms stimulate a normal round of HSC proliferation, chronic
unique control over the stress leads to increased release of noradrenaline (Heidt et al. 2014). This release lowers
HSCs and represent their CXCL12 levels, which reduces HSC proliferation and increases their mobilization into
own niche within a niche.
the circulation. So, the next time you wake up, know that your sympathetic nervous
What do you think? How
is cell communication and system is telling your hematopoietic stem cells to wake up, too.
HSC movement among the Additional signaling factors (Wnt, TGF-β, Notch/Jagged1, stem cell factor, and inte-
endosteal, perivascular, grins; reviewed in Al-Drees et al. 2015 and Boulais and Frenette 2015) influence the
and (potentially) MSC production rates of different types of blood cells under different conditions; examples
niches orchestrated? are an increased production of white blood cells during infections and increased red
blood cells when you climb to high altitudes. When the system is misregulated, it can
cause diseases such as the different types of blood cancers. Myeloproliferative disease is
one such cancer that results from a failure of proper signals for blood cell differentiation
(Walkley et al. 2007a,b). It stems from a failure of the osteoblasts to function properly; as
a result, HSCs proliferate rapidly without differentiation (Raaijmakers et al. 2010, 2012).
MSC in culture can self-renew to produce a clonal population of cells that can
go on to form organs in vitro that contain a diversity of cell types (FIGURE 5.17;
Sacchetti et al. 2007; Méndez-Ferrer et al. 2010; reviewed in Bianco 2014). As
seen in bone marrow, MSCs in other tissues may play roles as both progenitor
cells and regulators of the resident niche stem cell, possibly through paracrine
signaling (Gnecchi et al. 2009; Kfoury and Scadden 2015).
stem cell niche while related animals retained the niche. Rodent incisors, for instance,
differ from mammalian incisors, including your own, in that they continue to grow
throughout the lifetime of the animal. In the mouse, each incisor has two stem cell
niches, one on the “inside,” facing into the mouth (lingual), and one on the “outside,”
facing the lips (labial) (FIGURE 5.19). Because most other mammals lack these incisor
stem cell niches, their teeth do not regenerate. We will describe various other stem cell
lineages throughout the rest of the book.
Dentin Ameloblasts
Enamel (making
enamel)
Labial (lips) Lingual Odontoblasts
Dentin (tongue) (making dentin)
Enamel Dental Outer
Dental mesenchyme dental
epithilium epithelium
Pulp
mesenchyme Stellate
FIGURE 5.19 The cervical loop of the mouse reticulum
Fibroblast
incisor is a stem cell niche for the enamel-
mesenchyme
secreting ameloblast cells. These cellsGilbert
migrate
Ameloblast
from the base of the stellate reticulum Developmental
into the Biology 11e, Sinauer Associates
DevBio11e_05.18 Date 04-04-16
Ameloblast stem cell
enamel layer, allowing the teeth to keep growing. Cervical progenitor cells
(After Wang et al. 2007.) loop
Stem Cells 167
Scientists Speak 5.6 Dr. Janet Rossant answers questions about the differences
between mouse and human ESCs.
17
The story of Henrietta Lacks, HeLa cells in science, and social policy are beautifully articu-
lated in Rebecca Skloot’s 2010 book, The Immortal Life of Henrietta Lacks.
Developing Questions years of experimentation with both mouse and human ESCs have demonstrated clear
pluripotency (Martin 1981; Evans and Kaufman 1981; Thomson et al. 1998), they have
What is possible now that also revealed differences in their degrees of self-renewal, the types of cells they can
naïve human ESCs can be
form, and their cellular characteristics (Martello and Smith 2014; Fonseca et al. 2015;
isolated and maintained?
Proof of these cells’ Van der Jeught et al. 2015). It appears that these differences may be based on slight dif-
pluripotency was displayed ferences in the developmental stage of the original ICM cells from which the cultures
when naïve human ESCs were derived, which has led to recognizing two different pluripotent states of an ESC:
were transplanted into naïve and primed .18 The naïve ESC represents the most immature, undifferentiated
the mouse morula and ESC with the greatest potential for pluripotency. In contrast, the primed ESC represents
differentiated into many an ICM cell with some maturation toward the epiblast lineage; hence, it is “primed,” or
cell types of an interspecies
ready for differentiation.
chimeric humanized mouse
embryo (Gafni et al. 2013). Therefore, the growing consensus is that most of the existing mouse ESC lines rep-
Although federal funds resent the naïve state, whereas much of the research conducted with human ESC lines
cannot be used to create captured more of the primed state of pluripotency. Different methods of derivation for
human-mouse chimeras the maintenance of naïve human ESCs from ICM cells or even from primed ESCs are
in the United States, such emerging (Van der Jeught et al. 2015). As an example, leukemia inhibitory factor (LIF)
regulations do not exist has been used in combination with with at least two kinase inhibitors (called 2i) that
in other countries. It is
are associated with the MAPK/ErK pathway inhibitor (MEKi) and glycogen synthase
theoretically plausible to
create a human ICM from kinase 3 inhibitor (GSK3i); as an example, see Theunissen et al. 2014. These factors,
naïve human ESCs that along with additional conditions, serve to prevent differentiation and maintain the
is supported by a mouse ESCs in the naïve, or ground, state.
trophectoderm. Minimally, Researchers are now studying the gene networks, epigenetic modulators, paracrine
doing so could enable the factors, and adhesion molecules required for the differentiation of ESCs. These cells
first direct study of human can respond to specific combinations and sequential application of growth factors to
gastrulation. Should the
coax their differentiation toward specific cell fates associated with the three germ lay-
human gastrula be studied
in this way? What, if any, ers (FIGURE 5.21; Murry and Keller 2008). For instance, applying a chemically defined
ethical concerns could such growth medium to a monolayer of ESCs can push their specification toward a meso-
studies raise? dermal fate; when followed by a period of Wnt activation and then Wnt inhibition, the
cells differentiate into contracting heart muscle cells (Burridge et al. 2012, 2014). In
contrast, ESCs pushed toward an ectodermal fate by inhibiting Bmp4, Wnt, and activin
can be subsequently induced by fibroblast growth factors (FGFs) to become neurons
(see Figure 5.21; Kriks et al. 2011).
Scientists speak 5.7 Watch the 2011 developmental documentary “Stem Cells
and Regenerative Medicine.”
The physical constraints of the environment in which ESCs are cultured can also
profoundly influence their differentiation. Constraining the area of cell growth to small
disc shapes19 can alone initiate a pattern of differential gene expression in the colony of
cells that correlates to that of the early embryo (FIGURE 5.22; Warmflash et al. 2014).
These results demonstrate that an incredible amount of patterning can be initiated
solely by the geometry and size of the growth landscape. These discoveries are enabling
further research into the structure and function of specific human cell types and their
use in medical applications.
18
As you examine past ESCs literature, it will be important to critically consider the pluripotent
state of the ESCs being depicted in each study. Are the ESCs naïve or primed, and what impli-
cations may that have on the authors’ interpretations of their results? Also be aware that naïve
ESCs have also been referred to as being in the “ground state.”
19
Researchers applied a micropattern of adhesive substrate to a glass plate, which restricted cell
growth to a defined size and shape for systematic analysis (Warmflash et al. 2014). In a differ-
ent study, lined grid substrates promoted ESC differentiation into dopamine neurons (Tan et al.
2015).
Stem Cells 169
FLK-1+ mesoderm
Bmp4 Hemangioblast
(not required)
ES cells Epiblast Wnt
Vascular
Fox2+ Endoderm
Bmp4 FGF
Activin Hepatocyte
Ectoderm SHH
FIGURE 5.21 Inducing stem cell differentiation from ESCs. Similar to the steps of differentia-
tion epiblast cells take during their maturation in the mammalian embryo, ESCs in culture can
be coaxed with the same developmental factors (paracrine and transcription factors, among
others) to differentiate into the cell types of each germ layer. With the inhibition of several
growth factors, ESCs can make ectoderm lineages; for mesoderm or endoderm, however,
ESCs are first induced to become primitive streak-like cells (PS) with paracrine factors such as
Wnt, Bmp4, or activin, depending on the desired differentiated cell type. (After Murry and Keller
2008.)
eSCs and regenerative medicine A major hope for human stem cell research is
that it will yield therapies for treating diseases and repairing injuries. In fact, pluripotent
stem cells have opened an entirely new field of therapy called regenerative medicine
(Wu and Hochelinger 2011; Robinton and Daley 2012). The therapeutic possibilities for
ESCs lie in their ability to differentiate into any cell type, especially for treatment of
human conditions in which adult cells degenerate (such as Alzheimer disease, Parkin-
son disease, diabetes, and cirrhosis of the liver). For instance, Kerr and colleagues (2003)
found that human EGCs were able to cure motor neuron injuries in adult rats both by
differentiating into new neurons and by producing paracrine factors (BDNF and TGF-
α) that prevent the death of existing neurons. Similarly, precursor cells for dopamine-
secreting neurons derived from ESCs (Kriks et al. 2011) were able to complete their
differentiation into dopaminergic neurons and cure a Parkinson-like condition when
engrafted into the brains of mice, rats, and even monkeys.
Although great excitement surrounds the potential of therapies using stem cells,
another line of research is aimed at understanding the development of disease and
assessing the effectiveness of pharmaceuticals. Such studies have already advanced
our understanding of rare blood-based diseases such as Fanconi anemia, which causes
bone marrow failure and consequent loss of both red and white blood cells (Zhu et
al. 2011). Often, diseases like Fanconi anemia are caused by hypomorphic muta-
tions —mutations that merely reduce gene function, as opposed to a “null” mutation
that results in the total loss of a protein’s function. Researchers used human ESCs to
create a model of Fanconi anemia by using RNAi to knock down (not knock out) spe-
cific isoforms of the Fanconi anemia genes (Tulpule et al. 2010). The results gave new
insights into the role of the Fanconi anemia genes during the initial steps of embryonic
hematopoiesis.
Scientists Speak 5.8 Dr. George Daley talks about modeling Fanconi anemia
and other blood diseases. A Developmental Documentary also covers the model-
ing of rare blood disorders.
Unfortunately, there are real challenges to expanding the use of ESCs to model
human diseases. One reason is that ESCs are only found at such an early stage of
development; another is that human diseases involve cells that have a long history of
differentiation events and are often multigenic (caused by the interplay of many genes).
Further complicating matters is the risk of immune rejection by the patients receiving
ESCs as part of a treatment. Transplanted cells derived from ESCs are from another
individual and are therefore not the same genotype as the patient, so, just like any
other tissue transplant, they can be rejected by the patient’s immune system.20 Also,
various social and ethical issues are raised by the use of ESCs in therapies because they
are derived from human blastocysts, also known as embryos (Gilbert et al. 2005; Siegel
2008; NSF 2012).21 If we could obtain similarly pluripotent stem cells from individu-
als diagnosed with known diseases, perhaps those cells could be used to study these
diseases and identify new therapies. When hunting for pluripotent cells, finding a way
to induce them could be an answer.
Scientists speak 5.9 Watch a Web conference with Dr. Bernard Siegel on stem
cell and cloning ethics and public policy. A 2011 documentary also covers stem
cell ethics and government policy.
20
One reason diseases of the brain are being targeted is that the brain and the eyes are among
the few places where immune rejection is not a big problem. The blood-brain barrier of the
brain’s endothelial cells keeps the brain and the eyes shielded from the immune system.
21
In 2010, two stem cell scientists filed a lawsuit against the U.S. government to ban federal
funding for human ESC research. This lawsuit halted all human ESC research in the United
States for months. Consider reading Wadman 2011 as well as listening to a Web conference
with one of the plantiffs, Theresa Deisher, recorded in 2011 while the court case Sherley v. Sebe-
lius was ongoing.
Stem Cells 171
Within 6 months of the publication of this work (Takahashi and Yamanaka 2006),
three groups of scientists reported that the same or similar transcription factors could
induce pluripotency in a variety of differentiated human cells (Takahashi et al. 2007; Yu
et al. 2007; Park et al. 2008). Like embryonic stem cells, iPS cell lines can be propagated
indefinitely and, whether in culture or in a teratoma, can form cell types representa-
tive of all three germ layers. By 2012, modifications of the culture techniques made
it possible for the gene expression of mouse iPSCs to become nearly identical to that
of mouse embryonic stem cells (Stadtfeld et al. 2012). Most important was that entire
mouse embryos could be generated from single iPSCs, showing complete pluripotency.
Although iPSCs are functionally pluripotent, they are best at generating the cell types
of the organ from which the parent somatic cell originated (Moad et al. 2013). These
data suggest that, like naïve versus primed ESC, not all iPSCs are the same and that
they may retain an epigenetic memory of their past home.
Scientists speak 5.11 Question and answer sessions with Dr. Rudolf Jaenisch
on iPSCs and Dr. Derrick Rossi on generating iPSCs with mRNA.
Applying iPSCs to human development and disease Using iPSCs provides med-
ical researchers with the ability to experiment on diseased human tissue while avoiding
the complications introduced by using human embryonic stem cells. Currently, there
are four major medical uses for iPSCs: (1) making patient-specific iPSCs for studying
disease pathology, (2) combining gene therapy with patient-specific iPSCs to treat dis-
ease, (3) using patient-specific iPSC-derived progenitor cells in cell transplants without
the complications of immune rejection, and (4) using differentiated cells derived from
patient-derived iPSCs for screening drugs.
Transplanting cells derived from mouse iPSCs back into the same donor mouse does
not elicit immune rejection (Guha et al. 2013), suggesting that iPSC-based cell replace-
ment may, in fact, be a promising therapy in the future.22 So far, the most significant
advances with iPSCs have been in modeling human diseases. Following a major study
(Park et al. 2008) that created iPSCs from patients associated with 10 different diseases,
numerous studies have leveraged iPSC technology to model a diverse array of diseases,
including Down syndrome, diabetes, and more (Singh et al. 2015).
22
At this time, the cost and scalability of iPSC-derived cell types to achieve the cell numbers
required for effective cell replacement therapy are significant obstacles to the progress of this
approach as a medical intervention.
172 Chapter 5
Disease modeling is of particular importance for diseases that are not easily mod-
eled in non-human organisms. Mice, for instance, do not get the same type of cystic
fibrosis—a disease that severely compromises lung function—that humans get. After
discovering what factors caused mouse iPSCs to differentiate into lung tissue (FIGURE
5.23; Mou at al. 2012), researchers made iPSCs from a person with cystic fibrosis and
turned them into lung epithelium that showed the characteristics of human cystic fibro-
sis. Knowing that cystic fibrosis is often caused by mutations within a single gene (the
gene for CF transmembrane conductance regulator, which encodes a chloride channel;
Riordan et al. 1989; Kerem et al. 1989), researchers sought to repair the human mutation
in these iPSCs. Crane and colleagues (2015) accomplished this task in iPSCs derived
from a cystic fibrosis patient that made functional chloride channels in differentiated
epithelium. The next step will be to test this approach in a non-human animal model
to see if it might be used to treat cystic fibrosis in humans.
The benefits of combining the use of iPSCs and gene correction was eloquently
demonstrated by Rudolf Jaenisch’s lab in 2007 to cure a mouse model of sickle-cell
anemia. This disease is caused by a mutation in the gene for hemoglobin. The Jaenisch
lab generated iPSCs from this mouse, corrected the hemoglobin mutation, and then dif-
ferentiated the iPSCs into hematopoietic stem cells that, when implanted in the mouse,
cured its sickle-cell phenotype (FIGURE 5.24; Hanna et al. 2007). Ongoing studies are
Gilbert
attempting to determine
Developmental if similar
Biology therapies
11e, Sinauer could cure human conditions such as dia-
Associates
betes, macular degeneration,
DevBio11e_05.23 spinal cord
Date 03-09-16injury, Parkinson disease, and Alzheimer dis-
ease as well as liver disease and heart disease. Other studies have shown that iPSCs can
be induced to form numerous cell types that are functional when transplanted back into
the organism from which they were derived. Even sperm and oocytes have been gener-
ated from mouse iPSCs. First, skin fibroblasts were induced to form iPSCs, and these
iPSCs were then induced to form primordial germ cells (PGCs). When these induced
PGCs were aggregated with gonadal tissues, the cells proceeded through meiosis and
became functional gametes (Hayashi et al. 2011; Hayashi et al. 2012). This work could
become significant in circumventing many types of infertility as well as in allowing
scientists to study the details of meiosis.
Developing Questions iPSCs harboring a known ALS familial mutation exhibited typical hallmarks of ALS
cellular pathology (Egawa et al. 2012). The researchers used these differentiated motor
We have discussed neurons to screen for drugs that might improve motor neuron health, and they identi-
modeling human disease
fied a histone acetyltransferase inhibitor capable of reducing the ALS cellular pheno-
using stem cells, but can
you study vertebrate types. Thus, experimentation with iPSCs has revealed new insights into how ALS could
evolution in a dish? be epigenetically regulated and possibly treated.
Researchers like Alysson
Muotri are interested in SCIENTISTS SPEAK 5.13 Web conferences with Dr. Carol Marchetto on modeling
how iPSCs generated autism with IPSCs, and with Dr. Alysson Muotri on modeling ALS with iPSCs.
from humans and a
variety of non-human Organoids: Studying human organogenesis in a culture dish
primates compare in
behavior, self-renewal, and We have discussed the many ways in which pluripotent stem cells (ESCs and iPSCs) can
potency. By comparing be used to better understand human development and disease at the level of the cell,
the transcriptomes and but there is a vast difference between cells in culture and cells in the embryo. Human
physiology of the derived blastocysts are routinely used to research early human development and interventions
cell types from different for treating infertility; using human embryos for studying human organogenesis, how-
species, we may gain ever, has been both technically impossible and viewed as unethical by most. Through
new insights into human
recent advances in pluripotent cell culturing techniques, though, researchers have been
evolution. What specific
questions would you ask, able to grow rudimentary organs from pluripotent stem cells. To date, the most complex
and what might your structures that have been created are the optic cup of the eye, mini-guts, kidney tis-
predictions be? sues, liver buds, and even brain regions (FIGURE 5.25A ; Lancaster and Knoblich 2014).
These organoids, as they are called, are generally the size of a pea and can be main-
tained in culture for more than a year. The striking feature of organoids is that they
actually mimic embryonic organogenesis. Pluripotent cells often self-organize into
aggregates based on differential adhesion between cells (much like during gastrulation;
see also Chapter 4), leading to cell sorting and the differentiation of cells with differ-
ent fates that interact to form the tissues of an organ (FIGURE 5.25B). Organoids have
been made from both ESCs and iPSCs derived from healthy and diseased individuals.
Therefore, the same therapeutic approaches that we discussed for ESCs and iPSCs can
also be applied to the organoid system. Although speculative at this point, creating
organoids may prove to be a viable procedure for growing autologous25 structures not
just for patient-specific cell replacement therapy but also for tissue replacement. As an
example, we highlight below some of the remarkable features associated with the devel-
opment of the cerebral organoid and its use in modeling a congenital brain disease.
the cerebral organoid The human cerebral cortex is arguably the most sophisti-
cated tissue in the animal kingdom, so trying to build even parts of this structure may
seem daunting. Ironically, neural differentiation from pluripotent cells seems to be a
sort of “default state,” similar to the presumptive neural forming cells of the gastrula.
Many previous studies characterizing the development of pluripotent stem cells into
neural tissues have paved the way to growing multiregional brain organoids (Eiraku et
al. 2008; Muguruma et al. 2010; Danjo et al. 2011; Eiraku and Sasai 2012; Mariani et al.
2012). In relatively simple growth conditions, pluripotent cells will self-organize into
small spherical clusters of cells called embryoid bodies, and cells within these bodies
will differentiate into a stratified neuroepithelium, similar to the neural epithelium of
an embryo. The “self-organizing” ability of pluripotent cells to form three-dimensional
neuroepithelial structures strongly suggests that robust intrinsic mechanisms exist that
are primed for neural development (Harris et al. 2015). As seen in most adult neural
stem cell niches, this neuroepithelium is polarized along the apical-to-basal axis and is
capable of developing into brain tissue.
25
Autologous means derived from the same individual. In this case, cells from a patient are
reprogrammed into iPSCs that are developed into a specific organoid. Cells and whole tissues
from the organoid can be transplanted back into the same patient without concern of immune
rejection.
Stem Cells 175
(A) (B)
Mesendoderm Ectoderm/neuroectoderm
Cell sorting out Differential adhesion
Wnt3a Bmp4 20% 1.5% through cell surface
Fgf4 Fgf9 KSR KSR adhesion molecules
(CAMs)
Intestinal organoid Kidney organoid Cerebral organoid Optic cup organoid Organoid
FIGURE 5.25 Organoid derivation. (A) Schematic represents the various strategies used to
promote the morphogenesis of specific tissue-type organoids. In most cases, a three-dimen-
sional matrix (Matrigel) is used. KSR is a knockout serum replacement. (B) Early progression of
organoid formation begins with differential gene expression, leading to cells with different cell
adhesion molecules that confer self-organizing properties (see Chapter 4). Once sorted, cells
continue to mature toward distinct lineages that interact to build a functional tissue. (After Lan-
caster and Knoblich 2014.)
In a landmark study, researchers took brain tissue organoids to the next level of com-
plexity (Lancaster et al. 2013). They placed embryoid bodies into droplets of Matrigel
(a matrix made from solubilized basement membrane, the ECM normally at the basal
side of an epithelium) to provide a three-dimensional architecture. They next moved
these neuroepithelial buds into a media-filled spinning bioreactor ( FIGURE 5.26A ;
see also Lancaster and Knoblich 2014). The movement of the organoid in this three-
dimensional matrix served to increase nutrient uptake, which supported the substan-
tial growth required for multiregional cerebral organoid development. The resulting
cerebral organoid showed characteristically layered tissue for a variety of brain regions,
including appropriate neuronal and glial cell markers (FIGURE 5.26B). These cerebral
organoids possessed radial glial cells adjacent to ventricular-like structures, similar to
the developing neural tube and even the adult neural stem niche discussed earlier (FIG-
URE 5.26C ). These human radial glial cells within the cerebral organoid displayed all
patterns of mitotic behaviors: symmetrical division for stem cell expansion and asym-
metrical divisions for self-renewal and differentiation (Lancaster et al. 2013).
Knoblich’s group also generated iPSCs from fibroblast samples of a patient with
severe microcephaly in the hope that they could study the pathologies associated with
this disease (Lancaster et al. 2013). Microcephaly is a congenital disease characterized
Developmental Biology 11e
Fig. 05.25
Dragonfly Media Group
04/21/16
176 Chapter 5
FIGURE 5.26 The cerebral organoid. (A) hES media, Neural Differentiation Differentiation
(A) Schematic showing the process over low bFGF induction media media media + RA
time for the creation of a cerebral organoid Suspension Suspension Matrigel droplet Spinning bioreactor
from initial cell suspension to bioreactor Day 6 Day 11 Day 15
Day 0
spinning. Representative light microscopic
images of the developing organoid are
shown below each step. (B) Section of a
cerebral organoid labeled for neural pro-
genitors (red; Sox2), neurons (green; Tuji),
and nuclei (blue), which reveals the multi-
layered organization characteristic of the
developing cerebral cortex. (C) Radial glial
cell labeled with p-Vimentin (green) under- Embryoid Expanded Cerebral
goes division and shows its characteristic hPSCs bodies Neuroectoderm neuroepithelium tissue
morphology with a long basal process and
its apical membrane at the ventricular-like
lumen (dashed white line). (From Lancaster
and Knoblich 2014a,b.)
26
Cdk5 regulatory subunit-associated protein 2 (CDK5RAP2) encodes a centrosomal protein
that interacts with the mitotic spindle during division.
40%
40 33%
27%
20
0% 0%
0
0–30 30–60 60–90
Patient
5 Snapshot Summary
Stem Cells
1. A stem cell maintains the ability to divide to produce a Notch activity versus proneural gene expression progres-
copy of itself as well as generating progenitor cells capa- sively promote maturation of B cells to transit-amplifying
ble of maturing into different cell types. C cells and then into migrating neural progenitors (A
2. Stem cell potential refers to the range of cell types a cells).
stem cell can produce. A totipotent stem cell can gener- 9. Additional signals—from neural activity and substances
ate all cell types of both the embryonic and extraem- like GDF11 from blood vessels to gradients of Shh,
bryonic lineages. Pluripotent and multipotent stem cells BMP4, and Noggin—all influence cell proliferation and
produce restricted lineages of just the embryo and of differentiation of B cells in the V-SVZ niche.
only select tissues or organs, respectively. 10. The base columnar cells located at the base of the
3. Adult stem cells reside in microenvironments called stem intestinal crypt serve as clonogenic stem cells for the gut
cell niches. Most organs and tissues possess stem cell epithelium, which generates transit-amplifying epithelial
niches, such as the germ cell, hematopoietic, gut epithe- cells that slowly differentiate as they are pushed further
lial, and ventricular-subventricular niches. up the villus.
4. The niche employs a variety of mechanisms of cell-to-cell 11. Wnt signals at the base of the crypt maintain stem cell
communication to regulate the quiescent, proliferative, proliferation, whereas opposing gradients of BMP from
and differentiative states of the resident stem cell. the cells at the top of the crypt induce differentiation.
5. Inner cell mass cells of the mouse blastocyst are main- 12. Adhesion to osteoblasts keeps the hematopoietic stem
tained in a pluripotent state through E-cadherin interac- cell (HSC) quiescent in the endosteal niche. Increased
tions with trophectoderm cells that activate the Hippo exposure to CXC12 signals from CAR cells and mesen-
kinase cascade and repress the function of Yap/Taz as chymal stem cells can transition HSCs into proliferative
transcriptional regulators of Cdx2. behavior, yet downregulation of CXCL12 in the perivas-
6. Cadherin links the germ stem cells of the Drosophila cular niche encourages migration of short-term active
oocyte and testes to the niche keeping them within fields HSCs into the oxygen-rich blood vessels.
of TGF-β and Unpaired signaling, respectively. Asym- 13. Mesenchymal stem cells can be found in a variety of
metric divisions push daughter cells out of this niche to tissues, including connective tissues, muscle, eye, teeth,
promote cell differentiation of germ cells. bone, and more. They play dual roles as supportive
7. The ventricular-subventricular zone (V-SVZ) of the mam- stromal cells as well as being multipotent stem cells.
malian brain represents a complex niche architecture of 14. Embryonic and induced pluripotent stem cells can be
B type stem cells arranged in a “pinwheel” organization maintained in culture indefinitely and, when exposed to
with a primary cilium at the apical surface and long radial certain combinations of factors and/or constrained by
processes that terminate with a basal endfoot. the physical growth substrate, can be coaxed to differen-
8. Constant Notch activity in the V-SVZ niche keeps B cells tiate into potentially any cell type of the body.
in the quiescent state, whereas increasing oscillations of
Stem Cells 179
15. ESCs and iPSCs are being used to study human cell 16. Pluripotent stem cells can also be used in regenerative
development and diseases. The use of stem cells to medicine to rebuild tissues and to make structures called
study patient-specific cell differentiation of the rare blood organoids, which seem to possess many of the multicel-
disorder Fanconia anemia or disorders of the nervous lular hallmarks of human organs. Organoids are being
system like autism and ALS have already started to pro- used to study human organogenesis and patient-specific
vide novel insight into disease mechanisms. disease progression on the tissue level, all in vitro.
Further Reading
Ables, J. L., J. J. Breunig, A. J. Eisch and P. Rakic. 2011. Not(ch) Kim, N. G., E. Koh, X. Chen and B. M. Gumbiner. 2011.
just development: Notch signalling in the adult brain. Nature E-cadherin mediates contact inhibition of proliferation through
Rev. Neurosci. 12: 269–283. Hippo signaling-pathway components. Proc. Natl. Acad. Sci.
Al-Drees, M. A., J. H. Yeo, B. B. Boumelhem, V. I. Antas, K. W. USA 108: 11930–11935.
Brigden, C. K. Colonne and S. T. Fraser. 2015. Making blood: Lancaster, M. A. and J. A. Knoblich. 2014. Organogenesis in a
The haematopoietic niche throughout ontogeny. Stem Cells Int. dish: Modeling development and disease using organoid tech-
doi: 10.1155/2015/571893. nologies. Science. doi: 10.1126/science.1247125.
Barker, N. 2014. Adult intestinal stem cells: Critical drivers of Lancaster, M. A. and 9 others. 2013. Cerebral organoids model
epithelial homeostasis and regeneration. Nature Rev. Mol. Cell human brain development and microcephaly. Nature 501:
Biol. 15: 19–33. 373–379.
Bianco, P. 2014. “Mesenchymal” stem cells. Annu. Rev. Cell Dev. Le Bin, G. C. and 11 others. 2014. Oct4 is required for lineage
Biol. 677–704. priming in the developing inner cell mass of the mouse blasto-
Boulais, P. E. and P. S. Frenette. 2015. Making sense of hemato- cyst. Development 141: 1001–1010.
poietic stem cell niches. Blood 125: 2621–2629. Lim, D. A. and A. Alvarez-Buylla. 2014. Adult neural stem cells
Dimos, J. T. and 12 others. 2008. Induced pluripotent stem cells stake their ground. Trends Neurosci. 37: 563–571.
generated from patients with ALS can be differentiated into Méndez-Ferrer, S. and 10 others. 2010. Mesenchymal and
motor neurons. Science 32: 1218–1221. haematopoietic stem cells form a unique bone marrow niche.
Fonseca, S. A., R. M. Costas and L. V. Pereira. 2015. Searching Nature 466: 829–834.
for naïve human pluripotent stem cells. World J. Stem Cells 7: Ottone, C. and S. Parrinello. 2015. Multifaceted control of
649–656. adult SVZ neurogenesis by the vascular niche. Cell Cycle 14:
Freitas, B. C., C. A. Trujillo, C. Carromeu, M. Yusupova, R. 2222–2225.
H. Herai and A. R. Muotri. 2014. Stem cells and modeling of Spradling, A., M. T. Fuller, R. E. Braun and S. Yoshida. 2011.
autism spectrum disorders. Exp. Neurol. 260: 33–43. Germline stem cells. Cold Spring Harbor Perspect. Biol. doi:
Gafni, O. and 26 others. 2013. Derivation of novel human 10.1101/cshperspect.a002642.
ground state naive pluripotent stem cells. Nature 504: 282–286. Snippert, H. J. and 10 others. 2010. Intestinal crypt homeostasis
Greenbaum A. and 7 others. 2013. CXCL12 in early mesenchy- results from neutral competition between symmetrically divid-
mal progenitors is required for haematopoietic stem-cell main- ing Lgr5 stem cells. Cell 143: 134–144.
tenance. Nature 495: 227–230. Stephenson, R. O., J. Rossant and P. P. Tam. 2012. Intercellular
Harris, J., G. S. Tomassy and P. Arlotta. 2015. Building blocks of interactions, position, and polarity in establishing blastocyst
the cerebral cortex: From development to the dish. Wiley Inter- cell lineages and embryonic axes. Cold Spring Harbor Perspect.
discip. Rev. Dev. Biol. 4: 529–544. Biol. doi: 10.1101/cshperspect.a008235.
Imayoshi, I. and 8 others. 2013. Oscillatory control of factors Xie, T. and A. C. Spradling. 1998. decapentaplegic is essential for
determining multipotency and fate in mouse neural progeni- the maintenance and division of germline stem cells in the Dro-
tors. Science 342: 1203–1208. sophila ovary. Cell 94: 251–260.
Katsimpardi, L. and 9 others. 2014. Vascular and neurogenic Yan, D. and 16 others. 2014. A regulatory network of Drosophila
rejuvenation of the aging mouse brain by young systemic fac- germline stem cell self-renewal. Dev. Cell 28: 459–473.
tors. Science 344: 630–634.
Go to www.devbio.com . ..
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
6
Sex Determination
and Gametogenesis
The Punchline
In vertebrates and arthropods, sex is determined by chromosomes. In mammals, the
Sry gene on the Y chromosome transforms the bipotential gonad into a testis (and
prevents ovary development), while inheritance of two X chromosomes activates
β-catenin, transforming the bipotential gonad into an ovary (and preventing testis
formation). In flies, the number of X chromosomes regulates the Sxl gene, enabling
differential splicing of particular nuclear RNAs into male- or female-specific mRNAs.
In mammals, the testes secrete hormones such as testosterone and anti-Müllerian
hormone. The first builds the male phenotype, the second blocks the female phenotype.
The ovaries synthesize estrogen that builds the female phenotype; they also secrete
progesterone to maintain pregnancy. In all species, the gonads instruct gametogenesis,
the development of the germ cells. Mammalian germ cells entering the ovaries initiate
meiosis while in the embryo and become oocytes. Germ cells entering the mammalian
testes are prevented from entering meiosis and instead divide to produce a stem cell
population that at puberty will generate the sperm. There are also animal species whose
sex is determined by environmental factors such as temperature.
182 Chapter 6
XY XX
Epididymis
Testes
Metanephric
Ovaries
Oviduct The Mammalian Pattern of
kidneys
Sex Determination
Mammalian sex determination is governed by the
gonad-forming genes and by the hormones elabo-
rated by the gonads. Primary sex determination
Ureters is the determination of the gonads—the egg-forming
ovaries or sperm-forming testes. Secondary sex
Degenerated determination is the determination of the male or
Wolffian duct female phenotype by the hormones produced by the
Degenerated
Müllerian duct Urinary Urinary Müllerian gonads. The formation both of ovaries and of testes
bladder bladder duct is an active, gene-directed process. Both the male
Wolffian duct (oviduct) and female gonads diverge from a common pre-
Urethra
(vas deferens) Urethra Uterus cursor, the bipotential gonad (sometimes called
Vagina the indifferent gonad) (Figure 6.1).
MALE FEMALE
GONADS
Gonadal type Testis Ovary
Germ cell location Inside testis cords Inside follicles of ovarian
(in medulla of testis) cortex
(A) Figure 6.2 Sex determination in placental mammals. (A) Mammalian chromosomal
Father
sex determination results in approximately equal numbers of male and female off-
44, spring. (B) Postulated cascades leading to male and female phenotypes in mammals.
XY The conversion of the genital ridge into the bipotential gonad requires, among others,
the Sf1, Wt1, and Lhx9 genes; mice lacking any of these genes lack gonads. The bipo-
Sperm tential gonad appears to be moved into the female pathway (ovary development) by
22, 22, the Foxl2, Wnt4, and Rspo1 genes and into the male pathway (testis development) by
X Y the Sry gene (on the Y chromosome), which triggers the activity of Sox9. (Lower levels
of Wnt4 are also present in the male gonad.) The ovary makes thecal cells and granu-
losa cells, which together are capable of synthesizing estrogen. Under the influence of
22, 44, 44, estrogen (first from the mother, then from the fetal gonads), the Müllerian duct differen-
Mother X XX XY tiates into the female reproductive tract, the internal and external genitalia develop, and
44, the offspring develops the secondary sex characteristics of a female. The testis makes
XX Eggs two major hormones involved in sex determination. The first, anti-Müllerian hormone
(AMH), causes the Müllerian duct to regress. The second, testosterone, causes dif-
22, 44, 44, ferentiation of the Wolffian duct into the male internal genitalia. In the urogenital region,
X XX XY testosterone is converted into dihydrotestosterone (DHT), which causes the morpho-
genesis of the penis and prostate gland. (B after Marx 1995; Birk et al. 2000.)
Female Male
Offspring genotypes Female internal genitalia
(uterus, oviducts,
cervix, upper vagina)
(B)
Granulosa
FOXL2 cells
RSPO1 OVARY Follicles
Thecal Female external genitalia
WNT4 (labia, clitoris, lower vagina)
cells
XX Estrogen
Genital Bipotential
ridge gonad Mullerian
¨
SF1 XY duct
WT1 SF1
SRY Sertoli AMH
LHX9 Regression
SOX9 cells Genital tubercle,
GATA4 TESTIS
urogenital sinus
Leydig SF1 Testosterone DHT
cells
Penis, prostate,
scrotum
Jacobs and Strong 1959). XXY men have functioning testes. Women with a single X
chromosome begin making ovaries, but the ovarian follicles cannot be maintained
without the second X chromosome. Thus, a second X chromosome completes the ova-
ries, whereas the presence of a Y chromosome (even when multiple X chromosomes are
present) initiates the development of testes.
The reason the Y chromosome is able to direct testis formation even when more
than one X chromosome is present may be a matter of timing. It appears there is a
crucial window of opportunity during gonad development during which the testis-
determining factor (now known to be the product of the Sry gene) can function. If the
Sry gene is present, it usually acts during this duration to promote testis formation and
to inhibit ovary formation. If the Sry gene is not present (or if it fails to act at the appro-
priate time), the ovary-forming genes are the ones that will function ( Figure 6.2B ;
Hiramatsu et al. 2009; Kashimada and Koopman 2010).
Once primary (chromosomal) determination has established the gonads, the gonads
begin to produce the hormones and paracrine factors that govern secondary sex determi-
nation—development of the sexual phenotype outside the gonads. This includes the male
or female duct systems and the external genitalia. A male mammal has a penis, scrotum
(testicle sac), seminal vesicles, and prostate gland. A female mammal has a uterus, ovi-
ducts, cervix, vagina, clitoris, labia, and mammary glands.1 In many species, each sex also
has a sex-specific body size, vocal cartilage, and musculature. Secondary sex characteris-
tics are usually determined by hormones and paracrine factors secreted from the gonads.
In the absence of gonads, it appears the female phenotype is generated. When Jost (1947,
1953) removed fetal rabbit gonads before they had differentiated, the resulting rabbits had
a female phenotype, regardless of whether their genotype was XX or XY.
The general scheme of primary sex determination is shown in Figure 6.2B. If the
embryonic cells have two X chromosomes and no Y chromosome, the gonadal pri-
mordia develop into ovaries. The ovaries produce estrogen , a hormone that enables
the development of the Müllerian duct into the uterus, oviducts, cervix, and upper
portion of the vagina (Fisher et al. 1998; Couse et al. 1999; Couse and Korach 2001). If
embryonic cells contain both an X and a Y chromosome, testes form and secrete two
major factors. The first is a TGF-b family paracrine factor called anti-Müllerian hor-
mone (AMH; sometimes called Müllerian-inhibiting factor, MIF). AMH destroys the
Müllerian duct, thus preventing formation of the uterus and oviducts. The second factor
is the steroid hormone testosterone. Testosterone masculinizes the fetus, stimulating
formation of the penis, male duct system, scrotum, and other portions of the male
anatomy, as well as inhibiting development of the breast primordia.
Dev T u tor i al Mammalian sex determination Scott Gilbert outlines
the sex determination schemes of mammals.
1
The naturalist Carolus Linnaeus named the mammals after this female secondary sexual trait
in the seventeenth century. The politics of this decision is discussed in Schiebinger 1993.
Sex Determination and Gametogenesis 185
Müllerian
Proliferating Mixture of somatic
duct
coelomic and germ cells
epithelium
Rete testis
cords Germ cells
Germ cells
Testis cords
Müllerian duct Tunica albuginea Surface
Müllerian duct epithelium
Spermatogonium
Vasculature and
connective tissue
Testis Wolffian
cords Oogonium
duct
(degenerating) Ovarian
Müllerian Wolffian duct follicles
duct (vas deferens) Müllerian
(degenerating) duct
Gilbert
Developmental Biology 11e, Sinauer Associates
Sex Determination and Gametogenesis 187
(Uhlenhaut et al. 2009). When Foxl2 is deleted in adult-stage ovaries, the Sox9 gene
becomes active and the ovary is transformed into a testis.
Scientists speak 6.1 Dr. Robin Lovell-Badge discusses his research showing
how the SRY gene promotes testis formation in humans.
2
These embryos did not form functional sperm—but they were not expected to. The presence
of two X chromosomes prevents sperm formation in XXY mice and men, and the transgenic
mice lacked the rest of the Y chromosome, which contains genes needed for spermatogenesis.
(A) (B)
XY XX XX Figure 6.6 An XX mouse transgenic
ç å ç for Sry is male. (A) Polymerase chain
reaction followed by electrophoresis
shows the presence of the Sry gene in
normal XY males and in a transgenic
XX/Sry mouse. The gene is absent in
Sry a female XX littermate. (B) The external
genitalia of the transgenic mouse are
Control male (right) and are essentially the same
(autosomal) as those in an XY male (left). (From Koop-
gene man et al. 1991; photographs courtesy of
1 2 3 the authors.)
190 Chapter 6
sox9: an autosomal testis-determining gene For all its importance in sex deter-
mination, the Sry gene is probably active for only a few hours during gonadal develop-
ment in mice. During this time, it synthesizes the Sry transcription factor, whose primary
role appears to be to activate the Sox9 gene (Sekido and Lovell-Badge 2008; for other
targets of Sry, see Web Topic 6.2). Sox9 is an autosomal gene involved in several develop-
mental processes, most notably bone formation. In the gonadal rudiments, however, Sox9
induces testis formation. XX humans who have an extra activated copy of SOX9 develop
as males even if they have no SRY gene, and XX mice transgenic for Sox9 develop testes
(Figure 6.7A–D; Huang et al. 1999; Qin and Bishop 2005). Knocking out the Sox9 gene
in the gonads of XY mice causes complete sex reversal (Barrionuevo et al. 2006). Thus,
even if Sry is present, mouse gonads cannot form testes if Sox9 is absent, so it appears that
Sox9 can replace Sry in testis formation. This is not altogether surprising; although the
Sry gene is found specifically in mammals, Sox9 is found throughout the vertebrate phyla.
Indeed, Sox9 appears to be the older and more central sex determination gene in
vertebrates (Pask and Graves 1999). In mammals, it is activated by Sry protein; in
birds, frogs, and fish, it appears to be activated by the dosage of the transcription factor
Dmrt1; and in those vertebrates with temperature-dependent sex
determination, it is often activated (directly or indirectly) by the
(A) XY (B) XX (C) XX male-producing temperature. Expression of the Sox9 gene is spe-
Wild-type Wild-type Sox9 transgenic cifically upregulated by the combined expression of Sry and Sf1
proteins in Sertoli cell precursors (Figure 6.7E–H ; Sekido et al.
11.5 days 2004; Sekido and Lovell-Badge 2008). Thus, Sry may act merely
Sox9
as a “switch” operating during a very short time to activate Sox9, and the Sox9 protein
may initiate the conserved evolutionary pathway to testis formation. So, borrowing Eric
Idle’s phrase, Sekido and Lovell-Badge (2009) propose that Sry initiates testis formation
by “a wink and a nudge.”
The Sox9 protein has several functions. First, it appears to be able to activate its
own promoter, thereby allowing it to be transcribed for long periods of time. Second,
it blocks the ability of β-catenin to induce ovary formation, either directly or indirectly
(Wilhelm et al. 2009). Third, it binds to cis-regulatory regions of numerous genes nec-
essary for testis production (Bradford et al. 2009a). Fourth, Sox9 binds to the promoter
site on the gene for anti-Müllerian hormone, providing a critical link in the pathway
toward a male phenotype (Arango et al. 1999; de Santa Barbara et al. 2000). Fifth, Sox9
promotes the expression of the gene encoding Fgf9, a paracrine factor critical for testis
development. Fgf9 is also essential for maintaining Sox9 gene transcription, thereby
establishing a positive feedback loop driving the male pathway (Kim et al. 2007).
WEb Topic 6.2 Finding the elusive testis-determining factor As one edi-
tor wrote, “The search for TDF has been a long and hard one.”
fibroblast growth factor 9 When the gene for fibroblast growth factor 9 (Fgf9)
is knocked out in mice, the homozygous mutants are almost all female. Fgf9 protein,
whose expression is dependent on Sox9 (Capel et al. 1999; Colvin et al. 2001), plays
several roles in testis formation:
1. Fgf9 causes proliferation of the Sertoli cell precursors and stimulates their differ-
entiation (Schmahl et al. 2004; Willerton et al. 2004).
2. It activates the migration of blood vessel cells from the adjacent kidney duct into
the XY gonad. While this is normally a male-specific process, incubating XX
gonads in Fgf9 leads to the migration of endothelial cells into XX gonads (Fig-
ure 6.8). These blood vessel cells form the major artery of the testis and play an
instructive role in inducing the Sertoli cell precursors to form the testis cords; in
their absence, testis cords do not form (Brennan et al. 2002; Combes et al. 2009).
3. It is required for maintaining Sox9 expression in the presumptive Sertoli cells and
directs their formation into tubules. Moreover, since it can act as both an autocrine
and a paracrine factor, Fgf9 may coordinate Sertoli cell development by reinforcing
Sox9 expression in all the cells of the tissue (Hiramatsu et al. 2009). Such a “com-
munity effect” may be important in achieving the integrated assembly of testis
tubules (Palmer and Burgoyne 1991; Cool and Capel 2009).
4. It represses Wnt4 signaling, which would otherwise direct ovarian development
(Maatouk et al. 2008; Jameson et al. 2012).
5. Finally, Fgf9 appears to help coordinate the sex determination of the gonad with
that of the germ cells. As we will see later in this chapter, those mammalian germ
cells destined to become eggs enter meiosis quickly upon entering the gonad,
whereas germ cells destined to become sperm delay their entry into meiosis until
puberty. Fgf9 is one of the factors that blocks the immediate entry of germ cells
into meiosis, thereby placing them onto the sperm-forming pathway (Barrios et al.
2010; Bowles et al. 2010).
sf1: a critical link between sry and the male developmental pathways
The transcription factor steroidogenic factor 1 (Sf1) is necessary to make the bipotential
gonad. But whereas Sf1 levels decline in the genital ridge of XX mouse embryos, they
remain high in the developing testis. It is thought that Sry either directly or indirectly
maintains Sf1 gene expression. Sf1 protein appears to be active in masculinizing both
the Leydig and the Sertoli cells. In the Sertoli cells, Sf1 works in collaboration with Sry
to activate Sox9 (Sekido and Lovell-Badge 2008) and then, working with Sox9, elevates
levels of anti-Müllerian hormone transcription (Shen et al. 1994; Arango et al. 1999).
In the Leydig cells, Sf1 activates genes encoding the enzymes that make testosterone.
192 Chapter 6
(A) (B)
12-Day
mouse
embryos
XY XX or XY XX XX XX or XY XX
(or XX + Sry) + lacZ (or XY – Sry) + lacZ
Gonad
Remove
urogenital
rudiment
Mesonephros
Separate
gonads from
mesonephros
+
Fgf9
Recombine
and culture
48 hours
(1) (2) (1) (2)
+ Sry: Allows – Sry: No No Fgf9: Allows
migration of mesonephric mesonephric migration of
mesonephric cells cell migration cell migration mesonephric cells
(C) Mesonephros
+
Figure 6.8 Migration of mesonephric endothelial cells into Sry gonadal rudiments. (primitive Wolffian
kidney) duct
In the experiment diagrammed, urogenital ridges (containing both primitive mesonephric
kidneys and bipotential gonadal rudiments) were collected from 12-day embryonic mice.
Some of the mice were marked with a β-galactosidase transgene (lacZ) that is active in
every cell. Thus, every cell of these mice turned blue when stained for β-galactosidase.
The gonad and mesonephros were separated and recombined, using gonadal tissue
Gonad
from unlabeled mice and mesonephros from labeled mice. (A) Migration of mesonephric
cells into the gonad was seen (1) when the gonadal cells were XY or when they were XX
with a Sry transgene. No migration of mesonephric tissue into the gonad was seen (2)
when the gonad contained either XX cells or XY cells in which the Y chromosome had a Metanephric
deletion in the Sry gene. The sex chromosomes of the mesonephros did not affect the kidney
migration. (B) Gonadal rudiments for XX mice could induce mesonephric cell migration if
these rudiments had been incubated with Fgf9. (C) Intimate relation between the Wolffian
duct and the developing gonad in a 16-day male mouse embryo. The mesonephric duct
of the primitive kidney will form the efferent ducts of the testes and the Wolffian duct that
leads to the ureter. The ducts and gonad have been stained for cytokeratin-8. (A,B after
Capel et al. 1999, photographs courtesy of B. Capel; C from Sariola and Saarma 1999,
courtesy of H. Sariola.)
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_06.08 Date 03-17-16
Sex Determination and Gametogenesis 193
Scientists speak 6.2 Dr. Blanche Capel discusses her work on the sex determi-
nation pathways of mammals.
And just as the Foxl2 gene is critical for the maintenance of ovarian gonadal func-
tion throughout life, the Dmrt1 gene is needed for maintaining testicular structure. The
deletion of Dmrt1 in adult mice leads to the transformation of Sertoli cells into ovar-
ian granulosa cells. Moreover, overexpression of Dmrt1 in female mouse ovaries can
reprogram the ovarian tissue into Sertoli-like cells (Lindeman et al. 2015; Zhao et al.
2015). Dmrt1 protein is probably the major male sex inducer across the entire animal
kingdom, having been found in flies, cnidarians, fish, reptiles, and birds (Murphy et al.
2015; Picard et al. 2015). In mammals, SRY has taken over this function. However, these
recent results show that Dmrt1 has retained an important role in male sex determina-
tion, even in mammals.
Scientists speak 6.3 Dr. David Darkower discusses his studies showing Dmrt1
to be a major player in the male sex determination pathway.
Wnt /b-catenin
Androgen activity
(testosterone or Wnt inhibitor Penis,
Male
dihydrotestosterone) (Dickkopf, etc.) scrotum
+ androgen receptor Estrogen +
estrogen receptor
Urogenital swellings
Wnt /β-catenin
Androgen activity
(testosterone or Wnt inhibitor Clitoris,
Female
dihydrotestosterone) (Dickkopf, etc.) labia majora
+ androgen receptor Estrogen +
estrogen receptor
Figure 6.10 Model for the formation of external genitalia. In this schema, the mesen-
chyme in the urogenital swellings secretes inhibitors of Wnt signaling. In the absence of
Wnt signaling, estrogen modifies the genital tubercle into the clitoris and the labioscrotal
folds into the labia majora surrounding the vagina. In males, however, androgens (such as
testosterone and dihydrotestosterone) bind to the androgen receptor in the mesenchymal
cells and prevent the synthesis of the Wnt inhibitors. Wnt signaling is permitted, and it
causes the genital tubercle to become the penis and the labioscrotal folds to become the
scrotum. (After Miyagawa et al. 2009.)
(testosterone) receptor in the mesenchyme and prevent the expression of Wnt inhibi-
tors (thus permitting Wnt expression in the mesenchyme). With the influence of these
Wnts, male urogenital swellings are converted into the penis and the scrotum.
WEb Topic 6.3 The origins of genitalia The cells that give rise to the penis
and clitoris have only recently been identified. Their identity helps explain how male
snakes get two penises and a female hyena develops a clitoris nearly as large as the
male’s penis.
Figure 6.11 Androgen insensitivity syndrome. Despite having the XY karyotype, individu-
als with this syndrome appear female. They cannot respond to testosterone but can respond
to estrogen, so they develop female secondary sex characteristics (i.e., labia and a clitoris
rather than a scrotum and a penis). Internally, they lack the Müllerian duct derivatives and
have undescended testes. (Courtesy of C. B. Hammond.)
196 Chapter 6
Although in most people correlation of the genetic and anatomical sexual phenotypes
is high, about 0.4–1.7% of the population departs from the strictly dimorphic condition
(Blackless et al. 2000; Hull 2003; Hughes et al. 2006). Phenotypes in which male and
female traits are seen in the same individual are called intersex conditions.4 Androgen
insensitivity syndrome is one of several intersex conditions that have traditionally been
labeled pseudohermaphroditism. In pseudohermaphrodites, there is only one type of
gonad (as contrasted with true hermaphroditism, in which individuals have the gonads
of both sexes), but the secondary sex characteristics differ from what would be expected
from the gonadal sex. In humans, male pseudohermaphroditism (male gonadal sex with
female secondary characteristics) can be caused by mutations in the androgen (testos-
terone) receptor or by mutations affecting testosterone synthesis (Geissler et al. 1994).
Female pseudohermaphroditism, in which the gonadal sex is female but the person
is outwardly male, can be the result of overproduction of androgens in the ovary or
adrenal gland. The most common cause of this latter condition is congenital adrenal
hyperplasia , in which there is a genetic deficiency of an enzyme that metabolizes
cortisol steroids in the adrenal gland. In the absence of this enzyme, testosterone-like
steroids accumulate and can bind to the androgen receptor, thus masculinizing the
fetus (Migeon and Wisniewski 2000; Merke et al. 2002).
appears to compensate for the lack of DHT), their external genitalia are able to respond
to the hormone and differentiate. The penis enlarges, the scrotum descends, and the
person originally believed to be a girl is revealed to be a young man. Studies of this con-
dition led to the current perception that the formation of the external genitalia is under
the control of dihydrotestosterone, whereas Wolffian duct differentiation is controlled
by testosterone itself.
WEb Topic 6.4 Descent of the testes The descent of the testes is initiated
around week 10 of human pregnancy by dihydrotestosterone and another hormone from
the Leydig cells, insulin-like hormone.
estrogen The steroid hormone estrogen is needed for complete postnatal develop-
ment of both the Müllerian and the Wolffian ducts, and is necessary for fertility in both
males and females. In females, estrogen induces the differentiation of the Müllerian
duct into the uterus, oviducts, cervix, and upper vagina. In female mice whose genes for
estrogen receptors are knocked out, the germ cells die in the adult, and the granulosa
cells that had enveloped them start developing into Sertoli-like cells (Couse et al. 1999).
Male mice with knockouts of estrogen receptor genes produce few sperm. One of the
functions of the male efferent duct cells (which bring the sperm from the seminiferous
vesicles into the epididymis) is to absorb most of the water from the lumen of the rete
testis. This absorption, which is regulated by estrogen, concentrates the sperm, giving
them a longer life span and providing more sperm per ejaculate. If estrogen or its recep-
tor is absent in male mice, water is not absorbed and the mouse is sterile (Hess et al.
1997). Although blood concentrations of estrogen are in general higher in females than
in males, the concentration of estrogen in the rete testis is higher than in female blood.
In summary, primary sex determination in mammals is regulated by the chromo-
somes, which results in the production of testes in XY individuals and ovaries in XX
individuals. This type of sex determination appears to be a “digital” (either/or) phe-
nomenon. With chromosomal sex established, the gonads then produce the hormones
that coordinate the different parts of the body to have a male or female phenotype. This
secondary sex determination is more “analogue,” where differing levels of hormones
and responses to hormones can create different phenotypes. Secondary sex determina-
tion is thus usually, but not always, coordinated with the primary sex determination.
WEb Topic 6.5 Brain sex and gender In addition to the physical aspects of sec-
ondary sex determination, there are also behavioral attributes. The brain is an organ that
differs between males and females; but does it generate a different pattern of human
behaviors?
Scientists Speak 6.4 Neuroscientist Dr. Daphna Joel discusses her research
showing that male and female brains are remarkably similar.
(A) (B)
XX XO
Figure 6.13 Gynandromorph insects.
(A) D. melanogaster in which the left side seems to be a collection of genes that are active in forming sperm in adults, but not in
is female (XX) and the right side is male sex determination.
(XO). The male side has lost an X chromo- A fruit fly’s sex is determined predominantly by the number of X chromosomes in
some bearing the wild-type alleles of eye each cell. If there is only one X chromosome in a diploid cell, the fly is male. If there are
color and wing shape, thereby allowing two X chromosomes in a diploid cell, the fly is female. Should a fly have two X chro-
expression of the recessive alleles eosin
mosomes and three sets of autosomes, it is a mosaic, where some of the cells are male
eye and miniature wing on the remaining
X chromosome. (B) Birdwing butterfly and some of the cells are female. Thus, while XO mammals are sterile females (no Y
Ornithopera croesus. The smaller male chromosome, thus no Sry gene), XO Drosophila are sterile males (one X chromosome
half is red, black, and yellow, while the per diploid set).
female half is larger and brown. (A, draw- In Drosophila, and in insects in general, one can observe gynandromorphs—animals
ing by Edith Wallace from Morgan and in which certain regions of the body are male and other regions are female (Figure
Bridges 1919; B, Montreal Insectarium, 6.13). Gynandromorph fruit flies result when an X chromosome is lost from one embry-
photograph by the author.)
onic nucleus. The cells descended from that cell, instead of being XX (female), are XO
(male). The XO cells display male characteristics, whereas the XX cells display female
traits, suggesting that, in Drosophila, each cell makes its own sexual “decision.” Indeed,
in their classic discussion of gynandromorphs, Morgan and Bridges (1919) concluded,
“Male and female parts and their sex-linked characters are strictly self-determining,
each developing according to its own aspiration,” and each sexual decision is “not inter-
fered with by the aspirations of its neighbors, nor is it overruled by the action of the
gonads.” Although there are organs that are exceptions to this rule (notably the external
genitalia), it remains a good general principle of Drosophila sexual development.
6
This gene’s gory name is derived from the fact that mutations of this gene can result in aber-
rant dosage compensation of X-linked genes (see Web Topic 6.6). As a result, there is inad-
equate transcription of those genes encoded on the X chromosome, and the embryo dies.
Sex Determination and Gametogenesis 199
XX XY
High concentrations of SisA, Scute, Low concentrations of SisA, Scute,
Runt, and Unpaired Runt, and Unpaired
Sxl gene activated Sxl gene not activated
(Functional
Sxl
Sx1 protein)
Sxl (No functional
Sx1 protein)
dsx dsx
fruitless
(Functional Tra tra (No functional
Tra protein) Tra2 Tra protein)
Syncytial WEb Topic 6.6 Dosage compensation If the cells of female flies, nema-
blastoderm Cellularization todes, and mammals have twice the number of X chromosomes as male cells, how
Sxl Sxl are the genes on the X chromosome regulated? The three groups offer three differ-
(early promoter) (late promoter) ent solutions to the problem.
pre-mRNA pre-mRNA targets of sex-lethal The protein made by the female-specific Sxl tran-
XX script contains regions that are important for binding to RNA. There appear to
() be three major RNA targets to which the female-specific Sxl transcript binds.
mRNA mRNA One of these is the pre-mRNA of Sxl itself. Another target is the msl2 gene that
(exons 1, 2, 4) controls dosage compensation (see below). Indeed, if the Sxl gene is nonfunc-
tional in a cell with two X chromosomes, the dosage compensation system will
Sxl protein Sxl protein not work, and the result is cell death (hence the gene’s name). The third target
is the pre-mRNA of transformer (tra)—the next gene in the cascade (Figure
Sxl Sxl 6.16 ; Nagoshi et al. 1988; Bell et al. 1991).
(early promoter) (late promoter) The pre-mRNA of transformer (so named because loss-of-function mutations
turn females into males) is spliced into a functional mRNA by Sxl protein. The
tra pre-mRNA is made in both male and female cells; however, in the pres-
No pre-mRNA pre-mRNA ence of Sxl, the tra transcript is alternatively spliced to create a female-specific
XY mRNA, as well as a nonspecific mRNA that is found in both females and males.
() Like the male Sxl message, the nonspecific tra mRNA message contains an early
No mRNA mRNA
(exons 1–4) termination codon that renders the protein nonfunctional (Boggs et al. 1987). In
tra, the second exon of the nonspecific mRNA contains the termination codon
and is not utilized in the female-specific message (see Figures 6.14 and 6.16).
No Sxl protein No Sxl protein How is it that females and males make different mRNAs? The female-
specific Sxl protein activates a 3′ splice site that causes tra pre-mRNA to be
processed in a way that splices out the second exon. To do this, Sxl protein
Figure 6.15 Differential RNA splicing and sex-
specific expression of Sex-lethal. In the syncytial blocks the binding of splicing factor U2AF to the nonspecific splice site of the
blastoderm of XX flies, transcription factors from tra message by specifically binding to the polypyrimidine tract adjacent to it
the two X chromosomes are sufficient to activate (Handa et al. 1999). This causes U2AF to bind to the lower-affinity (female-
the early promoter of the Sxl gene. This “early” specific) 3′ splice site and generate a female-specific mRNA (Valcárcel et al.
transcript is spliced into an mRNA lacking exon 1993). The female-specific Tra protein works in concert with the product of the
3 and makes a functional Sxl protein. The early transformer-2 (tra2) gene to help generate the female phenotype by splicing the
promoter of XY flies is not activated, and males
doublesex gene in a female-specific manner.
lack functional Sxl. By the cellularizing blastoderm
stage, the late promoter of Sxl is active in both XX
and XY flies. In XX flies, Sxl already present in the
Doublesex: The switch gene for sex determination
embryo prevents the splicing of exon 3 into mRNA The Drosophila doublesex (dsx) gene is active in both males and females, but its
and functional Sxl protein is made. Sxl then binds primary transcript is processed in a sex-specific manner (Baker et al. 1987). This
to its own promoter to keep it active; it also func- alternative RNA processing is the result of the action of the tra and tra2 gene
tions to splice downstream pre-mRNAs. In XY products on the dsx gene (see Figures 6.14 and 6.16). If the Tra2 and female-spe-
embryos, no Sxl is present and exon 3 is spliced
cific Tra proteins are both present, the dsx transcript is processed in a female-
into the mRNA. Because of the termination codon
in exon 3, males do not make functional Sxl. (After specific manner (Ryner and Baker 1991). The female splicing pattern produces a
Salz 2011.) female-specific protein that activates female-specific genes (such as those of the
yolk proteins) and inhibits male development. If no functional Tra is produced,
a male-specific dsx transcript is made; this transcript encodes a transcription
factor that inhibits female traits and promotes male traits. In the embryonic
gonad, Dsx regulates all known aspects of sexually dimorphic gonad cell fate.
In XX flies, the female Doublesex protein (Dsx F) combines with the product
of the intersex gene (Ix) to make a transcription factor complex that is respon-
sible for promoting female-specific traits. This “Doublesex complex” activates
the Wingless (Wg) gene, whose Wnt-family product promotes growth of the
Gilbert female portions of the genital disc. It also represses the Fgf genes responsible
Developmental Biology 11e, Sinauer Associates for making male accessory organs, activates the genes responsible for making
DevBio11e_06.15 Date 03-17-16
yolk proteins, promotes the growth of the sperm storage duct, and modifies
bricabrac (bab) gene expression to give the female-specific pigmentation profile.
In contrast, the male Doublesex protein (Dsx M) acts directly as a transcription
Sex Determination and Gametogenesis 201
Female-
specific “Default”
Sex-lethal
splicing splicing
1 2 4 5 6 7 8 AAA 1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 8 AAA
Mammalian Gametogenesis
One of the most important events in sex determination is the determination of the germ
cells to undergo gametogenesis, the formation of gametes (sperm and egg). As in the
case of the genital ridges, the mammalian primordial germ cells (PGCs) are bipotential
and can become either sperm or eggs; if they reside in the ovaries they become eggs,
and if they reside in the testes they become sperm. All of these decisions are coordi-
nated by factors produced by the developing gonads.
7
The evolutionary advantages and disadvantages of temperature-dependent sex determination
are discussed in Chapter 26.
Sex Determination and Gametogenesis 203
First and importantly, the cells that generate the sperm or eggs do not originally
form inside the gonads. Rather, they form in the posterior portion of the embryo and
migrate into the gonads (Anderson et al. 2000; Molyneaux et al. 2001; Tanaka et al.
2005). This pattern is common throughout the animal kingdom: the germ cells are “set
aside” from the rest of the embryo and the cells’ transcription and translation are shut
down while they migrate from peripheral sites into the embryo and to the gonad. It is
as if the germ cells were a separate entity, reserved for the next generation, and repress-
ing gene expression makes them insensitive to the intercellular commerce going on all
around them (Richardson and Lehmann 2010; Tarbashevich and Raz 2010).
Although the mechanisms used to specify the germ cells vary enormously across
the animal kingdom, the proteins expressed by germ cells to suppress gene expres-
sion are remarkably conserved. These proteins, which include the Vasa, Nanos, Tudor,
and Piwi family proteins, can be seen in the germ cells of cnidarians, flies, and mam-
mals (Ewen-Campen et al. 2010; Leclére et al. 2012). Vasa proteins are required for
germ cells in nearly all animals studied. They are involved in binding RNA and most
likely activate germ-cell-specific messages. In chickens, experimentally induced Vasa
can direct embryonic stem cells toward a germ cell fate (Lavial et al. 2009). Nanos
proteins bind to their partner, Pumilio, to form a very potent repressive dimer. Nanos
can block RNA translation, and Pumilio binds to the 3′ UTRs of specific mRNAs. In
Drosophila, Nanos and Pumilio repress the translation of numerous mRNAs, and in so
doing they (1) prevent the cell from becoming part of any germ layer; (2) prevent the
cell cycle from continuing; and (3) prevent apoptosis (Kobayashi et al. 1996; Asaoka-
Taguchi et al. 1999; Hayashi et al. 2004). Tudor proteins were discovered in Drosophila,
in which females carrying these genes are sterile8 and do not form pole cells (Boswell
and Mahowald 1985). It appears that Tudor proteins interact with those Piwi proteins
that are involved in transcriptionally silencing portions of the genome, especially active
transposons.
WEb Topic 6.8 Theodor Boveri and the formation of the germ line In
the early 1900s, Boveri’s studies on the development of roundworms demonstrated that
the cytoplasm of the cell destined to be the germ cell precursor was different from the
cytoplasm of other cells.
The newly formed PGCs first enter into the hindgut (Figure 6.18A) and eventually
migrate forward and into the bipotential gonads, multiplying as they migrate. From the
time of their specification until they enter the genital ridges, the PGCs are surrounded
by cells secreting stem cell factor (SCF). SCF is necessary for PGC motility and survival.
Moreover, the cluster of SCF-secreting cells appears to migrate with the PGCs, forming
a “traveling niche” of cells that support the persistence, the division, and movement of
the PGCs (Gu et al. 2009).
The PGCs that migrate to the gonads do not make their own decision to become
either sperm or eggs. That decision is made by the gonad in which they reside; it is sig-
nals from the gonad that create the profound differences between spermatogenesis and
oogenesis (Table 6.1). One of the most fundamental differences involves the timing
of meiosis. In females, meiosis begins in the embryonic gonads. In males, meiosis is not
initiated until puberty. The “gatekeeper” for meiosis appears to be the Stra8 transcrip-
tion factor, which promotes a new round of DNA synthesis and meiotic initiation in the
germ cells. In the developing ovaries, Stra8 is upregulated by two factors—Wnt4 and
retinoic acid—coming from the adjacent kidney (Baltus et al. 2006; Bowles et al. 2006;
Naillat et al. 2010; Chassot et al. 2011). In the developing testes, however, Stra8 is down-
regulated by Fgf9, and the retinoic acid produced by the mesonephros is degraded by
the testes’ secretion of the RA-degrading enzyme Cyp26b1 (Figure 6.19; Bowles et al.
2006; Koubova et al. 2006). During male puberty, however, retinoic acid is synthesized
8
Tudor and Vasa are both named after European royal houses that came to an end with female
monarchs (Elizabeth of England and Christina of Sweden) who had no heirs.
204 Chapter 6
Genital Somite
ridges
Primordial
germ cells
Hindgut
Dorsal
mesentery
(A) Female germ cells (B) Male germ cells Figure 6.19 Retinoic acid (RA)
Before After determines the timing of meiosis and
Normal Nanos2 added day 13.5 day 13.5 sexual differentiation of mammalian
Meso- Meso- germ cells. (A) In female mouse embry-
RA RA RA RA os, RA secreted from the mesonephros
nephros nephros
reaches the gonad and triggers mei-
Somatic Somatic Cyp26b1 Cyp26b1
otic initiation via the induction of Stra8
Germ Germ transcription factor in female germ cells
line line (beige). However, if activated Nanos2
Stra8 Stra8 Nanos2 Stra8 Stra8 Nanos2 genes are added to female germ cells,
they suppress Stra8 expression, lead-
ing the germ cells into a male pathway
(gray). (B) In embryonic testes, Cyp26b1
blocks RA signaling, thereby prevent-
Meiosis Meiosis Meiosis Meiosis ing male germ cells from initiating
Gonad Gonad
meiosis until embryonic day 13.5 (left
Male fate Male fate
panel). After embryonic day 13.5, when
Cyp26b1 expression is decreased,
(C) Male (D) Female Nanos2 is expressed and prevents mei-
otic initiation by blocking Stra8 expres-
sion. This induces male-type differentia-
tion in the germ cells (right panel). (C,D)
Day 12 mouse embryos stained for
mRNAs encoding the RA-synthesizing
enzyme Aldh1a2 (left gonad) and the
RA-degrading enzyme Cyp26b1 (right
gonad). The RA-synthesizing enzyme
is seen in the mesonephros of both
the male (C) and female (D); the RA-
degrading enzyme is seen only in the
male gonad. (A,B from Saga 2008; C,D
from Bowles et al. 2006, courtesy of P.
RA synthesized RA degraded RA synthesized RA degraded Koopman.)
in the Sertoli cells and induces Stra8 in sperm stem cells. Once Stra8 is present, the
sperm stem cells become committed to meiosis (Anderson et al. 2008; Mark et al. 2008).
Thus, the timing of retinoic acid synthesis appears to control Stra8, and Stra8 commits
germ cells to meiosis. Fgf9, which downregulates Stra8, also appears to be critical in
keeping the male germ cells in a stem cell-like condition (Bowles et al. 2010).
The structure of the mammalian gonad plays a critical role as well. The Sertoli cells,
Leydig cells, and blood vessels of the seminiferous tubules constitute a stem cell niche
(Hara et al. 2014; Manku and Culty 2015.) The primordial germ cells that enter the
developing testis will remain in a stem cell-like condition that enables them to mitoti-
cally produce sperm precursors. The follicle cells of the ovary, however, do not con-
stitute a stem cell niche. Rather, each primordial germ cell will be surrounded by the
follicle cells, and usually only one egg will mature from each follicle.
Sexual reproduction, evolutionary variation, and the transmission of traits from one
generation to the next all come down to meiosis. So to understand what germ cells do,
we must first understand meiosis.
Meiosis is the means by which the gametes halve the number of their chromosomes.
In the haploid condition, each chromosome is represented by only one copy, whereas
diploid cells have two copies of each chromosome. Meiotic division differ from mitotic
division in that (1) meiotic cells undergo two cell divisions without an intervening
period of DNA replication, and (2) homologous chromosomes pair together and recom-
bine genetic material.
After the germ cell’s final mitotic division, a period of DNA synthesis occurs, so that
the cell initiating meiosis doubles the amount of DNA in its nucleus. In this state, each
chromosome consists of two sister chromatids attached at a common kinetochore.9 (In
other words, the diploid nucleus contains four copies of each chromosome.) In the first
of the two meiotic divisions (meiosis I), homologous chromosomes (for example, the
two copies of chromosome 3 in the diploid cell) come together and are then separated
into different cells. Hence the first meiotic division splits two homologous chromosomes
between two daughter cells such that each daughter cell has only one copy of each chro-
mosome. But each of the chromosomes has already replicated (i.e., each has two chro-
matids), so the second division (meiosis II) separates the two sister chromatids from each
other. The net result of meiosis is four cells, each of which has a single (haploid) copy of
each chromosome.
The first meiotic division begins with a long prophase, which is subdivided into four
stages (Figure 6.20). During the leptotene (Greek, “thin thread”) stage, the chromatin
of the chromatids is stretched out very thinly, and it is not possible to identify individual
chromosomes. DNA replication has already occurred, however, and each chromosome
consists of two parallel chromatids. At the zygotene (Greek, “yoked threads”) stage,
homologous chromosomes pair side by side. This pairing, called synapsis, is charac-
teristic of meiosis; such pairing does not occur during mitotic divisions. Although the
mechanism whereby each chromosome recognizes its homologue is not known (see
Barzel and Kupiec 2008; Takeo et al. 2011), synapsis seems to require the presence of
Figure 6.20 Meiosis, emphasiz-
ing the synaptonemal complex. Before 9
The terms centromere and kinetochore are often used interchangeably, but in fact the kineto-
meiosis, unpaired homologous chromo- chore is the complex protein structure that assembles on a sequence of DNA known as the
somes are distributed randomly within centromere.
the nucleus. (A) At leptotene, telomeres
have attached along the nuclear enve-
lope. The chromosomes “search” for
homologous chromosomes, and syn- Nucleus
apsis, the association of homologous
chromosomes, begins at zygotene, Chromosomes Sister chromatid cohesion
where the first evidence of the synapto- Synaptonemal complex
nemal complex (SC) can be seen. Dur-
ing pachytene, homologue alignment (A)
is seen along the entire length of the
chromosomes and produces a bivalent
structure. Paired homologs can recom-
bine with each (cross over) other during
zygotene and pachytene. The synapto-
nemal complex dissolves at diplotene,
when recombination is completed. (B) In
Leptotene Zygotene Pachytene Diplotene
diakinesis, chromosomes condense fur-
ther and then form a metaphase plate.
Segregation of the homologous chro- (B) Spindle
mosomes occurs at anaphase I. Only
one pair of sister chromatids is shown
here in meiosis II, where sister chro-
matids align at metaphase II and then
in anaphase II segregate to opposite Diakinesis
poles. (After Tsai and McKee 2011.) Metaphase I Anaphase I Metaphase II Anaphase II
Sex Determination and Gametogenesis 207
the nuclear envelope and the formation of a proteinaceous ribbon called the synaptone-
mal complex. In many species, the nuclear envelope probably serves as an attachment
site for the prophase chromosomes to bind and thereby reduces the complexity of the
search for the other homologous chromosome (Comings 1968; Scherthan 2007; Tsai and
McKee 2011). The synaptonemal complex is a ladderlike structure with a central ele-
ment and two lateral bars (von Wettstein 1984; Yang and Wang 2009). The homologous
chromosomes become associated with the two lateral bars, and the chromosomes are
thus joined together. The configuration formed by the four chromatids and the synap-
tonemal complex is referred to as a tetrad or a bivalent.
During the next stage of meiotic prophase, pachytene (Greek, “thick thread”), the
chromatids thicken and shorten. Individual chromatids can now be distinguished
under the light microscope, and crossing-over may occur. Crossing-over represents an
exchange of genetic material whereby genes from one chromatid are exchanged with
homologous genes from another. Crossing-over may continue into the next stage, dip-
lotene (Greek, “double threads”). During diplotene, the synaptonemal complex breaks
down and the two homologous chromosomes start to separate. Usually, however, they
remain attached at various points called chiasmata , which are thought to represent
regions where crossing-over is occurring. The diplotene stage is characterized by a high
level of gene transcription.
Meiotic metaphase begins with diakinesis (Greek, “moving apart”) of the chro-
mosomes (Figure 6.20B). The nuclear envelope breaks down and the chromosomes
migrate to form a metaphase plate. Anaphase of meiosis I does not commence until
the chromosomes are properly aligned on the mitotic spindle fibers. This alignment is
accomplished by proteins that prevent cyclin B from being degraded until after all the
chromosomes are securely fastened to microtubules.
During anaphase I, the homologous chromosomes separate from each other in
an independent fashion. This stage leads to telophase I, during which two daughter
cells are formed, each cell containing one partner of each homologous chromosome
pair. After a brief interkinesis, the second meiotic division takes place. During meio-
sis II, the kinetochore of each chromosome divides during anaphase so that each of
the new cells gets one of the two chromatids, the final result being the creation of
four haploid cells. Note that meiosis has also reassorted the chromosomes into new
groupings. First, each of the four haploid cells has a different assortment of chromo-
somes. Humans have 23 different chromosome pairs; thus 2 23 (nearly 10 million) dif-
ferent haploid cells can be formed from the genome of a single person. In addition, the
crossing-over that occurs during the pachytene and diplotene stages of first meiotic
metaphase further increases genetic diversity and makes the number of potential dif-
ferent gametes incalculably large.
This organization and movement of meiotic chromosomes is choreographed by
a ring of cohesin proteins that encircles the sister chromatids. Cohesin rings resist
the pulling forces of the spindle microtubules, thereby keeping the sister chromatids
attached during meiosis I (Haering et al. 2008; Brar et al. 2009). The cohesins also
recruit other sets of proteins that help promote pairing between homologous chromo-
somes and allow recombination to occur (Pelttari et al. 2001; Villeneuve and Hillers
2001; Sakuno and Watanabe 2009). At the second meotic division, the cohesin ring is
cleaved and the kinetochores can separate from each other (Schöckel et al. 2011).
WEb Topic 6.9 Modifications of meiosis In many organisms, females can
reproduce themselves without males by modifying meiosis. They can produce diploid
eggs and activate them by some means other than sperm entry.
Type As
Seminiferous spermatogonium
tubule
(A) Primary
spermatocyte
Secondary
spermatocyte
Spermatids
Lumen of tubule
Residual Sperm
body
the BMP8b paracrine factor reach a critical concentration. BMP8b is thought to instruct
the spermatogonia to produce receptors that enable them to respond to proteins such as
stem cell factor (SCF). Indeed, mice lacking BMP8b do not initiate spermatogenesis at
puberty (Zhao et al. 1996; Carlomagno et al. 2010). The transition between mitotically
dividing spermatogonia and the spermatocytes that initiate meiosis appears to be medi-
ated by the opposing influences of GDNF and SCF, both of which are secreted by the
Sertoli cells. SCF promotes the transition to spermatogenesis, while GDNF promotes
the division of spermatogonial stem cells (Rossi and Dolci 2013).
the meiotic phase: haploid spermatids Spermatogonia with high levels of Stra8
and responding to SCF divide to become type B spermatogonia . (Figure 6.22 ; de
Rooij and Russell 2000; Nakagawa 2010; Griswold et al. 2012). Type B spermatogonia
are the precursors of the spermatocytes and are the last cells of the line that undergo
mitosis. They divide once to generate the primary spermatocytes —the cells that enter
meiosis. Each primary spermatocyte undergoes the first meiotic division to yield a pair
of secondary spermatocytes , which complete the second division of meiosis. The
Type B
spermatogonia
Cytoplasmic bridges
Primary spermatocytes
(1st meiotic division)
Secondary spermatocytes
(2nd meiotic division)
Spermatids
Residual bodies
(cytoplasmic
droplet) Figure 6.22 Formation of syncytial clones
of human male germ cells. (After Bloom and
Sperm cells Fawcett 1975.)
210 Chapter 6
haploid cells thus formed are called spermatids , and they are still connected to one
another through their cytoplasmic bridges. The spermatids that are connected in this
manner have haploid nuclei but are functionally diploid, since a gene product made in
one cell can readily diffuse into the cytoplasm of its neighbors (Braun et al. 1989).
During the divisions from undifferentiated spermatogonia to spermatids, the cells
move farther and farther away from the basal lamina of the seminiferous tubule and
closer to its lumen (see Figure 6.21; Siu and Cheng 2004). As the spermatids move
toward border of the lumen, they lose their cytoplasmic connections and differentiate
into spermatozoa. In humans, the progression from spermatogonial stem cell to mature
spermatozoa takes 65 days (Dym 1994).
10
Protamines are relatively small proteins that are over 60% arginine. Transcription of the
genes for protamines is seen in the early haploid spermatids, although translation is delayed
for several days (Peschon et al. 1987). The replacement, however, is not complete, and “activat-
ing” nucleosomes, having trimethylated H3K4, cluster around developmentally significant
loci, including Hox gene promoters, certain microRNAs, and imprinted loci that are paternally
expressed (Hammoud et al. 2009).
Sex Determination and Gametogenesis 211
some 100 million sperm are made in each human testicle, and each
7
ejaculation releases 200 million sperm. Unused sperm are either
resorbed or passed out of the body in urine. During his lifetime, a 6
human male can produce 1012 to 1013 sperm (Reijo et al. 1995).
Birth
population, under the influence of retinoic acid, enter then next step
and initiate the first meiotic division. They become primary oocytes. Months before Years after birth
This first meiotic division does not proceed very far, and the primary conception
oocytes and remain in the diplotene stage of first meiotic prophase Figure 6.23 The number of germ cells in the human
(Pinkerton et al. 1961). This prolonged diplotene stage is sometimes ovary changes over the life span. (After Baker 1970.)
referred to as the dictyate resting stage. This may last from 12 to 40
years. With the onset of puberty, groups of oocytes periodically resume
meiosis. At that time, luteneizing hormone (LH) from the pituitary gland releases this VADE MECUM
block and permits these oocytes to resume meiotic division (Lomniczi et al. 2013). They
A segment on gametogenesis in
complete first meiotic division and proceed to second meiotic metaphase. This LH surge
mammals has movies and photo-
causes the oocyte to mature. The oocyte begins to synthesize the proteins that make it
graphs that illustrate the stream-
competent to fuse with the sperm cell and that enable the first cell divisions of the early
lining of the sperm and remark-
embryo. This maturation involves the cross-talk of paracrine factors between the oocyte
able growth of the egg, taking
and its follicular cells, both of which are maturing during this phase. The follicle cells you deeper into the mammalian
activate the translation of stored oocyte mRNA encoding proteins such as the sperm- gonad with each step.
binding proteins that will be used for fertilization and the cyclins that control embry-
onic cell division (Chen et al. 2013; Cakmak et al. 2016). After the secondary oocyte is
released from the ovary, meiosis will resume only if fertilization occurs. At fertilization,
calcium ions are released in the egg, and these calcium ions release the inhibitory block
and allow the haploid nucleus to form.
WEb Topic 6.10 The biochemistry of oocyte maturation The maturation of
the oocyte is intimately connected to several hormones produced by the brain. The effects
of these hormones are mediated by the follicle cells of the ovary in fascinating ways.
the developmental decision of male versus female does not flow through a single gene
but is instead determined by a ‘parliamentary’ system involving networks of genes that
have simultaneous inputs to several components of the downstream cascade.” We are
finally beginning to understand the mechanisms by which this “masterpiece of nature”
is created.
6 Snapshot Summary
Sex Determination and Gametogenesis
1. In mammals, primary sex determination (the determina- 5. The SOX9 gene product can also initiate testis formation.
tion of gonadal sex) is a function of the sex chromo- Functioning as a transcription factor, it binds to the gene
somes. XX individuals are usually females, XY individuals encoding anti-Müllerian hormone and other genes. Fgf9
are usually males. and Sox9 proteins have a positive feedback loop that
2. The mammalian Y chromosome plays a key role in male activates testicular development and suppresses ovarian
sex determination. XY and XX mammals both have a development.
bipotential gonad. In XY animals, Sertoli cells differentiate 6. Wnt4 and Rspo1 are involved in mammalian ovary
and enclose the germ cells within testis cords. The inter- formation. These proteins upregulate production of
stitial mesenchyme generates other testicular cell types, β-catenin; the functions of β-catenin include promoting
including the testosterone-secreting Leydig cells. the ovarian pathway of development while blocking the
3. In XX mammals, the germ cells become surrounded by testicular pathway of development. The Foxl2 transcrip-
follicle cells in the cortex of the gonadal rudiment. The tion factor is also required and appears to act in parallel
epithelium of the follicles becomes the granulosa cells; with the Wnt4/Rspo1 pathway.
the mesenchyme generates the thecal cells. 7. Secondary sex determination in mammals involves the
4. In humans, the SRY gene encodes the testis-determining factors produced by the developing gonads. In male
factor on the Y chromosome. SRY synthesizes a nucleic mammals, the Müllerian duct is destroyed by the AMH
acid-binding protein that functions as a transcription fac- produced by the Sertoli cells, while testosterone pro-
tor to activate the evolutionarily conserved SOX9 gene. duced by the Leydig cells enables the Wolffian duct to
214 Chapter 6
differentiate into the vas deferens and seminal vesicle. In of gonad determination. Because estrogen is necessary
female mammals, the Wolffian duct degenerates with the for ovary development in these species, it is possible that
lack of testosterone, whereas the Müllerian duct persists differing levels of aromatase (an enzyme that can convert
and is differentiated by estrogen into the oviducts, uterus, testosterone into estrogen) distinguish male from female
cervix, and upper portion of the vagina. Individuals with patterns of gonadal differentiation.
mutations of these hormones or their receptors may have 14. The precursors of the gametes are the primordial germ
a discordance between their primary and secondary sex cells (PGCs). In most species (C. elegans being an
characteristics. exception), the PGCs form outside the gonads and
8. The conversion of testosterone to dihydrotestosterone migrate into the gonads during development.
in the genital rudiment and prostate gland precursor 15. The cytoplasm of the PGCs in many species contains
enables the differentiation of the penis, scrotum, and inhibitors of transcription and translation, such that they
prostate gland. are both translationally and transcriptionally silent.
9. In Drosophila, sex is determined by the number of X 16. In most organisms studied, the coordination of germline
chromosomes in the cell; the Y chromosome does not sex (sperm/egg) is coordinated to somatic sex (male/
play a role in sex determination. There are no sex hor- female) by signals coming from the gonad (testis/ovary).
mones, so each cell makes a sex-determination “deci-
17. In humans and mice, germ cells entering ovaries initiate
sion.” However, paracrine factors play important roles in
meiosis while in the embryo; germ cells entering testes
forming the genital structures.
do not initiate meiosis until puberty.
10. The Drosophila Sex-lethal gene is activated in females (by
18. The first division of meiosis separates the homologous
the accumulation of proteins encoded on the X chromo-
chromosomes. The second division of meiosis splits the
somes), but the protein does not form in males because
kinetochore and separates the chromatids.
of translational termination. Sxl protein acts as an RNA
splicing factor to splice an inhibitory exon from the trans- 19. Spermatogenic meiosis in mammals is characterized by
former (tra) transcript. Therefore, female flies have an the production of four gametes per meiosis and by the
active Tra protein but males do not. absence of meiotic arrest. Oogenic meiosis is character-
ized by the production of one gamete per meiosis and
11. The Tra protein also acts as an RNA splicing factor to
by a prolonged first meiotic prophase to allow the egg to
splice exons from the doublesex (dsx) transcript. The dsx
grow.
gene is transcribed in both XX and XY cells, but its pre-
mRNA is processed to form different mRNAs, depending 20. In male mammals, the PGCs generate stem cells that last
on whether Tra protein is present. The proteins translated for the life of the organism. PGCs do not become stem
from both dsx messages are active, and they activate or cells in female mammals (although in many other animal
inhibit transcription of a set of genes involved in produc- groups, PGCs do become germ stem cells in the ovaries).
ing the sexually dimorphic traits of the fly. 21. In female mammals, germ cells initiate meiosis and are
12. Sex determination of the brain may have different retained in the first meiotic prophase (dictyate stage) until
downstream agents than in other regions of the body. ovulation. In this stage, they synthesize mRNAs and pro-
Drosophila Tra proteins also activate the fruitless gene teins that will be used for gamete recognition and early
in males (but not in females); in mammals, the Sry gene development of the fertilized egg.
may activate brain sexual differentiation independently 22. In some species, meiosis is modified such that a diploid
from the hormonal pathways. egg is formed. Such species can produce a new genera-
13. In turtles and alligators, sex is often determined by the tion parthenogenetically, without fertilization.
temperature experienced by the embryo during the time
Further Reading
Bell, L. R., J. I. Horabin, P. Schedl and T. W. Cline. 1991. Positive Hiramatsu, R. and 9 others. 2009. A critical time window of Sry
autoregulation of Sex-lethal by alternative splicing maintains action in gonadal sex determination in mice. Development 136:
the female determined state in Drosophila. Cell 65: 229–239. 129–138.
Cunha G. R. and 17 others. 2014. Development of the external Imperato-McGinley, J., L. Guerrero, T. Gautier and R. E. Peter-
genitalia: Perspectives from the spotted hyena (Crocuta crocuta). son. 1974. Steroid 5α-reductase deficiency in man: An inherited
Differentiation 87: 4–22. form of male pseudohermaphroditism. Science 186: 1213–1215.
Erickson, J. W. and J. J. Quintero. 2007. Indirect effects of ploidy Jordan-Young, R. M. 2010. Brainstorm: The Flaws in the Science of
suggest X chromosome dose, not the X:A ratio, signals sex in Sex Differences. Harvard University Press, Cambridge, MA.
Drosophila. PLoS Biol. Dec. 5(12):e332. Ikami, K., M. Tokue, R. Sugimoto, C. Noda, S. Kobayashi,
K. Hara and S. Yoshida. 2015. Hierarchical differentiation
Sex Determination and Gametogenesis 215
competence in response to retinoic acid ensures stem cell Miyamoto, Y., H. Taniguchi, F. Hamel, D. W. Silversides and R.
maintenance during mouse spermatogenesis. Development 142: S. Viger. 2008. GATA4/WT1 cooperation regulates transcrip-
1582–1592. tion of genes required for mammalian sex determination and
Joel, D. and 13 others. 2015. Sex beyond the genitalia: differentiation. BMC Mol. Biol. 29: 9–44.
The human brain mosaic. Proc. Natl. Acad. Sci. USA 112: Sekido, R. and R. Lovell-Badge. 2008. Sex determination
15468–15473. involves synergistic action of Sry and Sf1 on a specific Sox9
Koopman, P., J. Gubbay, N. Vivian, P. Goodfellow and R. enhancer. Nature 453: 930–934.
Lovell-Badge. 1991. Male development of chromosomally Sekido, R. and R. Lovell-Badge. 2009. Sex determination and
female mice transgenic for Sry. Nature 351: 117–121. SRY: Down to a wink and a nudge? Trends Genet. 25: 19–29.
Maatouk, D. M., L. DiNapoli, A. Alvers, K. L. Parker, M. M. Severson, A. F., G. von Dassow and B. Bowerman. 2016. Oocyte
Taketo and B. Capel. 2008. Stabilization of β-catenin in XY meiotic spindle assembly and function. Curr. Top. Dev. Biol. 116:
gonads causes male-to-female sex-reversal. Hum. Mol. Genet. 65–98.
17: 2949–2955.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
7
Fertilization
Beginning a New Organism
The Punchline
During fertilization, the egg and sperm must meet, the genetic material of the sperm
must enter the egg, and the fertilized egg must initiate cell division and the other
processes of development. Sperm and egg must travel toward each other, and
chemicals from the eggs can attract the sperm. Gamete recognition occurs when
proteins on the sperm cell membrane meet proteins on the extracellular coating of the
egg. In preparation for this meeting, the sperm cell membrane is altered significantly by
exocytotic events. The sperm activates development by releasing calcium ions (Ca2+)
from within the egg. These ions stimulate the enzymes needed for DNA synthesis,
RNA synthesis, protein synthesis, and cell division. The sperm and egg pronuclei travel
toward one another and the genetic material of the gametes combines to form the
diploid chromosome content carrying the genetic information for the development of a
new organism.
218 Chapter 7
Sperm
Sperm were discovered in the 1670s, but their role in fertilization was not discovered
until the mid-1800s. It was only in the 1840s, after Albert von Kölliker described the
formation of sperm from cells in the adult testes that fertilization research could really
begin. Even so, von Kölliker denied that there was any physical contact between sperm
and egg. He believed that the sperm excited the egg to develop in much the same way
a magnet communicates its presence to iron. The first description of fertilization was
(A) Microtubules
Nucleus
Mitochondria
Golgi
Flagellum Flagellum remnant
Golgi Centriole Acrosomal
apparatus vesicle and
granule
Centriole Centriole
Mitochondria
Nucleus
Cell (haploid) Mitochondria
membrane Centriole Axoneme
Acrosomal
vesicle
(B) (C)
Fertilization 219
published in 1847 by Karl Ernst von Baer, who showed the union of sperm and egg in
sea urchins and tunicates (Raineri and Tammiksaar 2013). He described the fertilization
envelope, the migration of the sperm nucleus to the center of the egg, and the subse-
quent early cell divisions of development. In the 1870s, Oscar Hertwig and Herman Fol
repeated this work and detailed the union of the two cells’ nuclei.
WEb Topic 7.1 The origins of fertilization research Our knowledge of fer-
tilization is relatively recent. Although sperm was discovered in the 1670s, it didn’t have a
known job until 200 years later.
Sperm anatomy Each sperm cell consists of a haploid nucleus, a propulsion system
to move the nucleus, and a sac of enzymes that enable the nucleus to enter the egg. In
most species, almost all of the cell’s cytoplasm is eliminated during sperm matura-
tion, leaving only certain organelles that are modified for spermatic function (Figure
7.1A,B ). During the course of maturation, the sperm’s haploid nucleus becomes very
streamlined and its DNA becomes tightly compressed. In front or to the side of this
compressed haploid nucleus lies the acrosomal vesicle, or acrosome (Figure 7.1C ).
The acrosome is derived from the cell’s Golgi apparatus and contains enzymes that
digest proteins and complex sugars. Enzymes stored in the acrosome can digest a path
through the outer coverings of the egg. In many species, a region of globular actin
proteins lies between the sperm nucleus and the acrosomal vesicle. These proteins
are used to extend a fingerlike acrosomal process from the sperm during the early
stages of fertilization. In sea urchins and numerous other species, recognition between
sperm and egg involves molecules on the acrosomal process. Together, the acrosome
and nucleus constitute the sperm head.
The means by which sperm are propelled vary according to how the species has
adapted to environmental conditions. In most species, an individual sperm is able to
travel by whipping its flagellum. The major motor portion of the flagellum is the axo-
neme, a structure formed by microtubules emanating from the centriole at the base
of the sperm nucleus. The core of the axoneme consists of two central microtubules
surrounded by a row of nine doublet microtubules. These microtubules are made exclu-
sively of the dimeric protein tubulin.
Although tubulin is the basis for the structure of the flagellum, other proteins are
also critical for flagellar function. The force for sperm propulsion is provided by dynein,
a protein attached to the microtubules. Dynein is an ATPase—an enzyme that hydro-
lyzes ATP, converting the released chemical energy into mechanical energy that propels
the sperm.1 This energy allows the active sliding of the outer doublet microtubules,
1
The importance of dynein can be seen in individuals with a genetic syndrome known as the
Kartagener triad. These individuals lack functional dynein in all their ciliated and flagellated
cells, rendering these structures immotile (Afzelius 1976). Thus, males with Kartagener triad
are sterile (immotile sperm). Both men and women affected by this syndrome are susceptible to
bronchial infections (immotile respiratory cilia) and have a 50% chance of having the heart on
the right side of the body (a condition known as situs inversus, the result of immotile cilia in the
center of the embryo).
Figure 7.1 Modification of a germ cell to form a mammalian sperm. (A) The centriole
produces a long flagellum at what will be the posterior end of the sperm. The Golgi apparatus
forms the acrosomal vesicle at the future anterior end. Mitochondria collect around the flagel-
lum near the base of the haploid nucleus and become incorporated into the midpiece (“neck”)
of the sperm. The remaining cytoplasm is jettisoned, and the nucleus condenses. The size of
the mature sperm has been enlarged relative to the other stages. (B) Mature bull sperm. The
DNA is stained blue, mitochondria are stained green, and the tubulin of the flagellum is stained
red. (C) The acrosomal vesicle of this mouse sperm is stained green by the fusion of proacrosin
with green fluorescent protein (GFP). (A after Clermont and Leblond 1955; B from Sutovsky et
al. 1996, courtesy of G. Schatten; C courtesy of K.-S. Kim and G. L. Gerton.)
220 Chapter 7
causing the flagellum to bend (Ogawa et al. 1977; Shinyoji et al. 1998). The ATP needed
to move the flagellum and propel the sperm comes from rings of mitochondria located
in the midpiece of the sperm (see Figure 7.1B). In many species (notably mammals),
a layer of dense fibers has interposed itself between the mitochondrial sheath and the
cell membrane. This fiber layer stiffens the sperm tail. Because the thickness of this
layer decreases toward the tip, the fibers probably prevent the sperm head from being
whipped around too suddenly. Thus, the sperm cell has undergone extensive modifica-
tion for the transport of its nucleus to the egg.
In mammals, the differentiation of sperm is not completed in the testes. Although
they are able to move, the sperm released during ejaculation do not yet have the capac-
ity to bind to and fertilize an egg. The final stages of sperm maturation, cumulatively
referred to as capacitation, do not occur in mammals until the sperm has been inside
the female reproductive tract for a certain period of time.
The egg
cytoplasm and nucleus All the material necessary to begin growth and develop-
ment must be stored in the egg, or ovum.2 Whereas the sperm eliminates most of its
cytoplasm as it matures, the developing egg (called the oocyte before it reaches the
stage of meiosis at which it is fertilized) not only conserves the material it has, but
actively accumulates more. The meiotic divisions that form the oocyte conserve its cyto-
plasm rather than giving half of it away; at the same time, the oocyte either synthesizes
or absorbs proteins such as yolk that act as food reservoirs for the developing embryo.
Birds’ eggs are enormous single cells, swollen with accumulated yolk (see Figure 12.2).
Even eggs with relatively sparse yolk are large compared to sperm. The volume of a sea
urchin egg is about 200 picoliters (2 × 10 –4 mm3), more than 10,000 times the volume
of sea urchin sperm (Figure 7.2). So even though sperm and egg have equal haploid
2
Eggs over easy: the terminology used in describing the female gamete can be confusing. In
general, an egg, or ovum, is a female gamete capable of binding sperm and being fertilized. An
oocyte is a developing egg that cannot yet bind sperm or be fertilized (Wessel 2009). The prob-
lems in terminology come from the fact that the eggs of different species are in different stages
of meiosis (see Figure 7.3). The human egg, for example, is in second meiotic metaphase when
it binds sperm, whereas the sea urchin egg has completed all of its meiotic divisions when it
binds sperm. The contents of the egg also vary greatly from species to species.
Female pronucleus
Egg plasma
membrane
Vitelline envelope
Female
Germinal Polar pronucleus
vesicle bodies
The roundworm Ascaris The nemertean worm The lancelet Branchiostoma Cnidarians
The mesozoan Dicyema Cerebratulus Amphibians (e.g., anemones)
The sponge Grantia The polychaete worm Most mammals Sea urchins
The polychaete worm Chaetopterus Fish
Myzostoma The mollusk Dentalium
The clam worm Nereis The core worm Pectinaria
The clam Spisula Many insects
The echiuroid worm Urechis Starfish
Dogs and foxes
222 Chapter 7
(A) (B)
Plasma membrane
Cell membrane
Microvilli
Vitelline
envelope
Cortical
granule
(A) (B)
Cumulus
Polar body
Ovum
Zona
pellucida
VADE MECUM In addition to simply producing enormous numbers of gametes, two major mechanisms
have evolved to solve these problems: species-specific sperm attraction and species-
The reactions that prevent poly-
specific sperm activation. Here we describe these events as they occur in sea urchins.
spermy in a fertilized sea urchin
egg can be seen in the raising of
Sperm attraction: Action at a distance
the fertilization envelope. See the
segment on sea urchin fertilization Species-specific sperm attraction has been documented in numerous species, includ-
to view these remarkable events. ing cnidarians, mollusks, echinoderms, amphibians, and urochordates (Miller 1985;
Yoshida et al. 1993; Burnett et al. 2008). In many species, sperm are attracted toward
eggs of their species by chemotaxis —that is, by following a gradient of a chemical
secreted by the egg. These oocytes control not only the type of sperm they attract, but
also the time at which they attract them, releasing the chemotactic factor only after they
reach maturation (Miller 1978).
The mechanisms of chemotaxis differ among species (see Metz 1978; Eisenbach
2004), and chemotactic molecules are different even in closely related species. In sea
urchins, sperm motility is acquired only after the sperm are spawned. As long as sperm
cells are in the testes, they cannot move because their internal pH is kept low (about pH
7.2) by the high concentrations of CO2 in the gonad. However, once sperm are spawned
into seawater, their pH is elevated to about 7.6, resulting in the activation of the dynein
ATPase. The splitting of ATP provides the energy for the flagella to wave, and the sperm
begin swimming vigorously (Christen et al. 1982).
But the ability to move does not provide the sperm with a direction. In echinoderms,
direction is provided by small chemotactic peptides called sperm-activating peptides
(SAPs). One such SAP is resact, a 14-amino acid peptide that has been isolated from
the egg jelly of the sea urchin Arbacia punctulata (Ward et al. 1985). Resact diffuses read-
ily from the egg jelly into seawater and has a profound effect at very low concentrations
when added to a suspension of Arbacia sperm. When a drop of seawater containing
Arbacia sperm is placed on a microscope slide, the sperm generally swim in circles about
50 μm in diameter. Within seconds after a small amount of resact is injected, sperm
migrate into the region of the injection and congregate there ( Figure 7.7). As resact
diffuses from the area of injection, more sperm are recruited into the growing cluster.
Resact is specific for A. punctulata and does not attract sperm of other urchin species.
Figure 7.7 Sperm chemotaxis in (An analogous compound, speract, has been isolated from the purple sea urchin, Stron-
the sea urchin Arbacia punctulata. One
gylocentrotus purpuratus.) A. punctulata sperm have receptors in their cell membranes that
nanoliter of a 10-nM solution of resact
bind resact (Ramarao and Garbers 1985; Bentley et al. 1986). When the extracellular side
is injected into a 20-microliter drop
of sperm suspension. (A) A 1-second of the receptor binds resact, it activates latent guanylyl cyclase in the cytoplasmic side of
photographic exposure showing sperm the receptor (Figure 7.8). Active guanylyl cyclase causes the sperm cell to produce more
swimming in tight circles before the cyclic GMP (cGMP), a compound that activates a calcium channel in the cell membrane
addition of resact. The position of the of the sperm tail, allowing the influx of calcium ions (Ca2+) from the seawater into the
injection pipette is shown by the white tail (Nishigaki et al. 2000; Wood et al. 2005). These sperm-specific calcium channels
lines. (B–D) Similar 1-second exposures
are encoded by CatSper genes—the same genes that control the direction of sperm
showing migration of sperm to the center
migration in mice and humans (Seifert et al. 2014). The increases in cGMP and Ca 2+
of the resact gradient 20, 40, and 90
seconds after injection. (From Ward et al. activate both the mitochondrial ATP-generating apparatus and the dynein ATPase that
1985, courtesy of V. D. Vacquier.)
(A) Figure 7.8 Model for chemotactic peptides in sea urchin sperm.
Resact from egg Ca2+ (A) Resact from Arbacia egg jelly binds to its receptor on the sperm.
This activates the receptor’s guanylyl cyclase (RGC) activity, forming
Sperm intracellular cGMP in the sperm. The cGMP opens calcium channels
cell RGC in the sperm cell membrane, allowing Ca2+ to enter the sperm. The
membrane influx of Ca2+ activates sperm motility, and the sperm swims up the
Cytoplasm + resact gradient toward the egg. (B) Ca2+ levels in different regions
cGMP of Strongylocentrotus purpuratus sperm after exposure to 125 nM
Ca2+
GTP speract (the S. purpuratus analog of resact). Red indicates the high-
est level of Ca2+, blue the lowest. The sperm head reaches its peak
Ca2+ levels within 1 second. (A after Kirkman-Brown et al. 2003;
Sperm swims toward egg B from Wood et al. 2003, courtesy of M. Whitaker.)
(B)
0 1 sec
stimulates flagellar movement in the sperm (Shimomura et al. 1986; Cook and Babcock
1993). In addition, the sperm sense the SAP gradient by curving their tails, interspers-
ing straight swimming with a “turn” to sense the environment (Guerrero et al. 2010).
The binding of a single resact molecule may be enough to provide direction for the
sperm, which swim up a concentration gradient of this compound until they reach the
egg (Kaupp et al. 2003; Kirkman-Brown et al. 2003). Thus, resact functions as a sperm-
attracting peptide as well as a sperm-activating peptide. (In some organisms, the func-
tions of sperm attraction and sperm activation are performed by different compounds.)
30
20
10
Sulfated polysaccharides from:
A. lixula
0
Sperm from: A. lixula E. lucunter L. variegatus E. lucunter
L. variegatus
(B)
O3SO O3SO HO HO Figure 7.9 Species-specific induction of the
O O O O acrosome reaction by sulfated polysaccharides
O O O O
characterizing the egg jelly coats of three species
CH3 CH3 CH3 CH3 of sea urchins that co-inhabit the intertidal around
HO HO HO HO Rio de Janeiro. (A) The histograms compare the
A. lixula O3SO ability of each polysaccharide to induce the acro-
O3SO O some reaction in the different species of sperm.
O O3SO O (B) Chemical structures of the acrosome reaction-
HO O HO
O CH3 inducing sulfated polysaccharides reveal their
CH2OH O3SO O species-specificity. (After Vilela-Silva et al. 2008;
O3SO
E. lucunter O CH3 photographs left to right © Interfoto/Alamy; ©
O3SO O FLPA/AGE Fotostock; © Water Frame/Alamy.)
HO
O CH3
O3SO O
CH3
L. variegatus sperm, the receptor activates three sperm membrane proteins: (1) a calcium transport
channel that allows Ca 2+ to enter the sperm head; (2) a sodium-hydrogen exchanger
that pumps sodium ions (Na+) into the sperm as it pumps hydrogen ions (H+) out; and
(3) a phospholipase enzyme that makes another second messenger, the phosopholipid
inositol 1,4,5-trisphosphate (IP3 , of which we will hear much more later in the chapter).
IP3 is able to release Ca 2+ from inside the sperm, probably from within the acrosome
itself (Domino and Garbers 1988; Domino et al. 1989; Hirohashi and Vacquier 2003).
The elevated Ca2+ level in a relatively basic cytoplasm triggers the fusion of the acroso-
mal membrane with the adjacent sperm cell membrane (Figure 7.10A–C ), releasing
enzymes that can lyse a path through the egg jelly to the vitelline envelope.
The second part of the acrosome reaction involves the extension of the acrosomal
Gilbert process by the polymerization of globular actin molecules into actin filaments (Figure
Developmental Biology 11e, Sinauer Associates 7.10D; Tilney et al. 1978). The influx of Ca2+ is thought to activate the protein RhoB in the
DevBio11e_07.09 Date 02-22-16
acrosomal region and midpiece of the sperm (Castellano et al. 1997; de la Sancha et al.
2007). This GTP-binding protein helps organize the actin cytoskeleton in many types of
cells and is thought to be active in polymerizing actin to make the acrosomal process.
Globular
actin Actin
microfilaments
Nucleus
Figure 7.10 Acrosome reaction in sea urchin sperm. (A–C) The portion of the acrosomal
membrane lying directly beneath the sperm cell membrane fuses with the cell membrane to
release the contents of the acrosomal vesicle. (D) The actin molecules assemble to produce
microfilaments, extending the acrosomal process outward. Actual photographs of the acro-
some reaction in sea urchin sperm are shown below the diagrams. (After Summers and
Hylander 1974; photographs courtesy of G. L. Decker and W. J. Lennarz.)
Bindin
particles
Dejellied eggs
Agglutination No agglutination
Eggs
Gilbert
S. franciscanus
S. purpuratus sperm/
S. purpuratus ERB1
30
Pronuclear
fusion
(B) (C)
12 6
54 4
First
cleavage 18 14
Centrosomes
(D) (E) Figure 7.14 Aberrant development in a dispermic sea urchin egg. (A) Fusion of
three haploid nuclei, each containing 18 chromosomes, and the division of the two
12 66
12 sperm centrioles to form four centrosomes (mitotic poles). (B,C) The 54 chromo-
34 24 somes randomly assort on the four spindles. (D) At anaphase of the first division,
4 4
the duplicated chromosomes are pulled to the four poles. (E) Four cells containing
18 14
18 14 32 different numbers and types of chromosomes are formed, thereby causing (F) the
18
Gilbert early death of the embryo. (G) First metaphase of a dispermic sea urchin egg akin
Developmental Biology 11e, Sinauer Associates to (D). The microtubules are stained green; the DNA stain appears orange. The
DevBio11e_07.13 Date 02-22-16 triploid DNA is being split into four chromosomally unbalanced cells instead of the
(F)
normal two cells with equal chromosome complements. (H) Human dispermic egg
at first mitosis. The four centrioles are stained yellow, while the microtubules of the
spindle apparatus (and of the two sperm tails) are stained red. The three sets of
Disintegrating cells; chromosomes divided by these four poles are stained blue. (A–F after Boveri 1907;
death of embryo G courtesy of J. Holy; H from Simerly et al. 1999, courtesy of G. Schatten.)
230 Chapter 7
Figure 7.16 Formation of the fertilization envelope and removal (A) (B)
of excess sperm. To create these photographs, sperm were added
to sea urchin eggs, and the suspension was then fixed in formal-
dehyde to prevent further reactions. (A) At 10 seconds after sperm
addition, sperm surround the egg. (B,C) At 25 and 35 seconds after
insemination, respectively, a fertilization envelope is forming around
the egg, starting at the point of sperm entry. (D) The fertilization
envelope is complete, and excess sperm have been removed.
(From Vacquier and Payne 1973, courtesy of V. D. Vacquier.)
WATCH DEVELOPMENT 7.1 See the fertilization envelope rise from the egg surface.
(A)
Sperm
Microvilli
H2O
Egg cell membrane
Egg Vitelline envelope Ferti
TG lizat
jelly ion
velen
CGSP OV op
OP e
H2O2
Cortical granules
Time
Egg cytoplasm
Udx1
Figure 7.17 Cortical granule exo- (B) Unfertilized (C) Recently fertilized
cytosis and formation of the sea urchin
fertilization envelope. (A) Schematic
diagram of events leading to the forma-
tion of the fertilization envelope. As corti-
cal granules undergo exocytosis, they
release cortical granule serine protease
(CGSP), an enzyme that cleaves the pro-
teins linking the vitelline envelope to the
cell membrane. Mucopolysaccharides
released by the cortical granules form an
osmotic gradient, causing water to enter
and swell the space between the vitelline
envelope and the cell membrane. The In sea urchins and mammals, the rise in Ca 2+ concentration responsible for the cor-
enzyme Udx1 in the former cortical gran-
tical granule reaction is not due to an influx of calcium into the egg, but comes from
ule membrane catalyzes the formation of
hydrogen peroxide (H2O2), the substrate within the egg itself. The release of calcium from intracellular storage can be monitored
for soluble ovoperoxidase (OVOP). OVOP visually using calcium-activated luminescent dyes such as aequorin (a protein that, like
and transglutaminases (TG) harden the GFP, is isolated from luminescent jellyfish) or fluorescent dyes such as fura-2. These
vitelline envelope, now called the fer- dyes emit light when they bind free Ca 2+. When a sea urchin egg is injected with dye
tilization envelope. (B,C) Transmission and then fertilized, a striking wave of calcium release propagates across the egg and
electron micrographs of the cortex of is visualized as a band of light that starts at the point of sperm entry and proceeds
an unfertilized sea urchin egg and the
actively to the other end of the cell (Figure 7.18; Steinhardt et al. 1977; Hafner et al.
same region of a recently fertilized egg.
The raised fertilization envelope and the 1988). The entire release of Ca2+ is complete within roughly 30 seconds, and free Ca2+ is
points at which the cortical granules have re-sequestered shortly after being released.
fused with the egg cell membrane of the
egg (arrows) are visible in (C). (A after WATCH DEVELOPMENT 7.2 This video of sea urchin fertilization shows waves of cal-
Wong et al. 2008; B,C from Chandler and cium ions starting at the point of sperm attachment and traversing the sea urchin egg.
Heuser 1979, courtesy of D. E. Chandler.)
Several experiments have demonstrated that Ca2+ is directly responsible for propa-
gating the cortical granule reaction, and that these ions are stored within the egg itself.
The drug A23187 is a calcium ionophore—a compound that allows the diffusion of ions
such as Ca2+ across lipid membranes, permitting them to travel across otherwise imper-
meable barriers. Placing unfertilized sea urchin eggs into seawater containing A23187
initiates the cortical granule reaction and the elevation of the fertilization envelope.
Moreover, this reaction occurs in the absence of any Ca 2+ in the surrounding water;
thus the A23187 must be stimulating the release of Ca 2+ that is already sequestered in
organelles within the egg (Chambers et al. 1974; Steinhardt and Epel 1974).
Gilbert In sea urchins and vertebrates (but not snails and worms), the Ca 2+ responsible for
the11e
Developmental Biology cortical granule
, Sinauer reaction is stored in the endoplasmic reticulum of the egg (Eisen
Associates
DevBio11e_07.17 and Date 02-22-16
Reynolds 1985; Terasaki and Sardet 1991). In sea urchins and frogs, this reticulum
Fertilization 233
is pronounced in the cortex and surrounds the cortical granules (Figure 7.19; Gardiner
and Grey 1983; Luttmer and Longo 1985). The cortical granules are themselves tethered
to the cell membrane by a series of integral membrane proteins that facilitate calcium-
mediated exocytosis (Conner et al. 1997; Conner and Wessel 1998). Thus, as soon as
Ca2+ is released from the endoplasmic reticulum, the cortical granules fuse with the cell Figure 7.19 Endoplasmic reticulum
membrane above them. Once initiated, the release of calcium is self-propagating. Free surrounding cortical granules in sea
calcium is able to release sequestered calcium from its storage sites, thus causing a wave urchin eggs. (A) The endoplasmic reticu-
of Ca2+ release and cortical granule exocytosis. lum has been stained to allow visualiza-
tion by transmission electron microscopy.
The cortical granule is seen to be sur-
Activation of Egg Metabolism in Sea Urchins rounded by dark-stained endoplasmic
reticulum. (B) An entire egg stained with
Although fertilization is often depicted as nothing more than the means to merge two fluorescent antibodies to calcium-depen-
haploid nuclei, it has an equally important role in initiating the processes that begin dent calcium release channels. The
development. These events happen in the cytoplasm and occur without the involvement antibodies show these channels in the
of the parental nuclei. 3 In addition to initiating the slow block to polyspermy (through cortical endoplasmic reticulum. (A from
cortical granule exocytosis), the release of Ca 2+ that occurs when the sperm enters the Luttmer and Longo 1985, courtesy of S.
Luttmer; B from McPherson et al. 1992,
egg is critical for activating the egg’s metabolism and initiating development. Calcium
courtesy of F. J. Longo.)
ions release the inhibitors from maternally
stored messages, allowing these mRNAs to
(A) (B)
be translated; they also release the inhibi-
tion of nuclear division, thereby allowing
3
In certain salamanders, this function of fer-
tilization (i.e., initiating development of the
embryo) has been totally divorced from the
genetic function. The silver salamander Ambys-
toma platineum is a hybrid subspecies consisting
solely of females. Each female produces an egg
with an unreduced chromosome number. This
Gilbert
egg, however, cannot develop on its own, so
Developmental Biology 11e, Sinauer Associates
the silver salamander mates
DevBio11e_07.18 with a male Jeffer-
Date 02-22-16
son salamander (A. jeffersonianum). The sperm
from the Jefferson salamander merely stimu-
lates the egg’s development; it does not contrib-
ute genetic material (Uzzell 1964). For details
of this complex mechanism of procreation, see
Bogart et al. 1989, 2009. Cortical granule Endoplasmic reticulum
234 Chapter 7
Endoplasmic
Ca2+ reticulum Ca2+
cleavage to occur. Indeed, throughout the animal kingdom, calcium ions are used to
activate development during fertilization.
ip3: the releaser of ca2+ If Ca2+ from the egg’s endoplasmic reticulum is responsible
for the cortical granule reaction and the reactivation of development, what releases
Ca 2+? Throughout the animal kingdom, it has been found that inositol 1,4,5-trisphos-
phate (IP3) is the primary agent for releasing Ca 2+ from intracellular storage.
The IP3 pathway is shown in Figure 7.21. The membrane phospholipid phosphati-
dylinositol 4,5-bisphosphate (PIP2) is split by the enzyme phospholipase C (PLC) to
Gilbert yield two active compounds: IP3 and diacylglycerol (DAG). IP3 is able to release Ca2+ into
theBiology
Developmental cytoplasm by opening
11e, Sinauer the calcium channels of the endoplasmic reticulum. DAG acti-
Associates
DevBio11e_07.20 Date
vates protein 02-22-16
kinase C, which in turn activates a protein that exchanges sodium ions for
hydrogen ions, raising the pH of the egg (Nishizuka 1986; Swann and Whitaker 1986).
This Na+-H+ exchange pump also requires Ca2+. The result of PLC activation is therefore
the liberation of Ca2+ and the alkalinization of the egg, and both of the compounds this
activation creates—IP3 and DAG—are involved in the initiation of development.
Watch Development 7.3 See a movie of fertilization with and without PLC
activation.
In sea urchin eggs, IP 3 is formed initially at the site of sperm entry and can be
detected within seconds of sperm-egg attachment. Inhibiting IP3 synthesis prevents
Ca 2+ release (Lee and Shen 1998; Carroll et al. 2000), whereas injected IP3 can release
sequestered Ca 2+ and lead to cortical granule exocytosis (Whitaker and Irvine 1984;
Busa et al. 1985). Moreover, these IP3-mediated effects can be thwarted by pre-injecting
the egg with calcium-chelating agents (Turner et al. 1986).
Fertilization 235
H+
Na+-H+
exchange pump
Phospholipase
C
OR 1 OR 2 OR1 OR2
+
CH2 CH CH2 CH2 CH CH2 Activation
O OH Na+
DAG
O P O Activation +
O– H
–
O3POH H Alkalinity
HO OPO23– HO HOPO–3 Cortical
H HO H HO
OH H OH H
granule
H H H H exocytosis
H OPO23– H HOPO–3
PIP2 IP3
Stimulation of
IP3 PATHWAY cell division,
DNA synthesis,
Ca2+ RNA translation
IP3
receptor
Egg activation
Cytoplasm Endoplasmic
reticulum Ca2+
Gilbert
phospholipase c: the generator of ip3 If IP 3 is necessary for Ca 2+ release and
Developmental Biology
phospholipase 11e, Sinauer
C is required inAssociates
order to generate IP3, the question then becomes, What
DevBio11e_07.21 Date 02-22-16
activates PLC? This question has not been easy to address since (1) there are numer-
ous types of PLC that (2) can be activated through different pathways, and (3) different
species use different mechanisms to activate PLC. Results from studies of sea urchin
eggs suggest that the active PLC in echinoderms is a member of the γ (gamma) family
of PLCs (Carroll et al. 1997, 1999; Shearer et al. 1999). Inhibitors that specifically block
PLCγ inhibit IP3 production as well as Ca 2+ release. Moreover, these inhibitors can be
circumvented by microinjecting IP3 into the egg. How PLCγ is activated by sperm is still
a matter of controversy, although inhibitor studies have shown that membrane-bound
kinases (Src kinases) and GTP-binding proteins play critical roles (Figure 7.22; Kinsey
and Shen 2000; Giusti et al. 2003; Townley et al. 2009; Voronina and Wessel 2003, 2004).
One possibility is that NAADP brought in by the sperm to initiate electrical depolariza-
tion also activates the enzyme cascade leading to IP3 production and calcium release
(Churchill et al. 2003; Morgan and Galione 2007).
236 Chapter 7
Ca2+ release
early responses As we have seen, contact or fusion of a sea urchin sperm and egg
activates two major blocks to polyspermy: the fast block, mediated by sodium influx
into the cell; and the cortical granule reaction, or slow block, mediated by the intracellu-
lar release of Ca2+. The same release of Ca2+ responsible for the cortical granule reaction
is also responsible for the re-entry of the egg into the cell cycle and the reactivation of
egg protein synthesis. Ca2+ levels in the egg increase from 0.05 to between 1 and 5 μM,
and in almost all species this occurs as a wave or succession of waves that sweep across
the egg beginning at the site of sperm-egg fusion (see Figure 7.18; Jaffe 1983; Terasaki
and Sardet 1991; Stricker 1999).
Calcium release activates a series of metabolic reactions that initiate embryonic
development (Figure 7.23). One of these is the activation of the enzyme NAD+ kinase,
which converts NAD+ to NADP+ (Epel et al. 1981). Since NADP+ (but not NAD+) can
be used as a coenzyme for lipid biosynthesis, such a conversion has important con-
sequences for lipid metabolism and thus may be important in the construction of the
many new cell membranes required during cleavage. Udx1, the enzyme responsible for
Gilbert
the
Developmental of
reduction oxygen
Biology 11e,to crosslink
Sinauer the fertilization envelope, is also NADPH-depen-
Associates
DevBio11e_07.22
dent Date 02-22-16
(Heinecke and Shapiro 1989; Wong et al. 2004). Lastly, NADPH helps regenerate
glutathione and ovothiols, molecules that may be crucial scavengers of free radicals that
could otherwise damage the DNA of the egg and early embryo (Mead and Epel 1995).
Dev T u tor i al Find it/lose it/move it The basic pattern of biological
evidence—find it/lose it/move it—can be followed in the discoveries
involving gamete adhesion and calcium activation of the egg.
Fertilization 237
Membrane Degradation of
potential Fast block to cyclin and inactivation Restoration of
Na+ influx polyspermy mitotic cell cycle
change of MAP kinase
Activation of Conversion of Membrane
NAD+ kinase NAD+ to NADP+ biosynthesis
Sperm binding
and/or fusion to Slow block to
egg cell membrane IP3 Cortical granule polyspermy
Ca2+ release
production exocytosis
Formation of
Kinase Phospholipase C hyaline layer
stimulation activation
Stimulation of
Diacylglycerol Protein kinase C protein synthesis,
production activation DNA replication,
and cytoplasmic
movements of
Na+-H+ Increase in morphogenetic
Figure 7.23 Postulated pathway of egg activation in the
exchange intracellular pH material
sea urchin. (After Epel 1980 and L. A. Jaffe, Pers. Comm.)
238 Chapter 7
WEb Topic 7.4 Rules of evidence The “find it/lose it/move it” pattern for
experimentation fits into a larger system of scientific evidence, as shown by these
examples from fertilization research.
late responses: resumption of protein and dna synthesis The late responses
of fertilization include the activation of a new burst of DNA and protein synthesis. In
sea urchins, the fusion of egg and sperm causes the intracellular pH to increase. This
rise in intracellular pH begins with a second influx of Na+ from seawater, which results
in a 1:1 exchange between these sodium ions and hydrogen ions (H+) from inside the
egg. This loss of H+ causes the pH within the egg to rise (Shen and Steinhardt 1978;
Michael and Walt 1999).
It is thought that pH increase and Ca 2+ elevation act together to stimulate new DNA
and protein synthesis (Winkler et al. 1980; Whitaker and Steinhardt 1982; Rees et al.
1995). If one experimentally elevates the pH of an unfertilized egg to a level similar to
that of a fertilized egg, DNA synthesis and nuclear envelope breakdown ensue, just as
if the egg were fertilized (Miller and Epel 1999). Calcium ions are also critical to new
DNA synthesis. The wave of free Ca2+ inactivates the enzyme MAP kinase, converting
it from a phosphorylated (active) to an unphosphorylated (inactive) form, thus removing
an inhibition on DNA synthesis (Carroll et al. 2000). DNA synthesis can then resume.
In sea urchins, a burst of protein synthesis usually occurs within several minutes
after sperm entry. This protein synthesis does not depend on the synthesis of new mes-
senger RNA, but uses mRNAs already present in the oocyte cytoplasm. These mRNAs
encode proteins such as histones, tubulins, actins, and morphogenetic factors that are
used during early development. Such a burst of protein synthesis can be induced by
artificially raising the pH of the cytoplasm using ammonium ions (Winkler et al. 1980).
One mechanism for this global rise in the translation of messages stored in the
oocyte appears to be the release of inhibitors from the mRNA. In Chapter 2 we dis-
cussed maskin, an inhibitor of translation in the unfertilized amphibian oocyte. In sea
urchins, a similar inhibitor binds translation initiation factor eIF4E at the 5′ end of several
mRNAs and prevents these mRNAs from being translated. Upon fertilization, however,
this inhibitor—the eIF4E-binding protein—becomes phosphorylated and is degraded,
thus allowing eIF4E to complex with other translation factors and permit protein synthe-
sis from the stored sea urchin mRNAs (Cormier et al. 2001; Oulhen et al. 2007). One of
the mRNAs “freed” by the degradation of eIF4E-binding protein is the message encod-
ing cyclin B protein (Salaun et al. 2003, 2004). Cyclin B combines with Cdk1 to create
mitosis-promoting factor (MPF), which is required to initiate cell division.
Figure 7.24 Nuclear events in the fertilization of the sea urchin. (A) Sequen- (A)
tial photographs showing the migration of the egg pronucleus and the sperm
pronucleus toward each other in an egg of Clypeaster japonicus. The sperm
pronucleus is surrounded by its aster of microtubules. (B) The two pronuclei
migrate toward each other on these microtubular processes. (The pronuclear
DNA is stained blue by Hoechst dye.) The microtubules (stained green with fluo-
rescent antibodies to tubulin) radiate from the centrosome associated with the
(smaller) male pronucleus and reach toward the female pronucleus. (C) Fusion
of pronuclei in the sea urchin egg. (A from Hamaguchi and Hiramoto 1980,
courtesy of the authors; B from Holy and Schatten 1991, courtesy of J. Holy;
C courtesy of F. J. Longo.)
2002; Morin et al. 2012). This exchange permits the decondensation of the 0 100 200 400 600 800
sperm chromatin. Once decondensed, the DNA adheres to the nuclear Time (sec)
envelope, where DNA polymerase can initiate replication (Infante et al.
(B)
1973).
But how do the sperm and egg pronuclei find each other? After the sea
urchin sperm enters the egg cytoplasm, the sperm nucleus separates from
the tail and rotates 180º so that the sperm centriole is between the devel-
oping male pronucleus and the egg pronucleus. The sperm centriole then
acts as a microtubule organizing center, extending its own microtubules
and integrating them with egg microtubules to form an aster. Microtu-
bules extend throughout the egg and contact the female pronucleus, at
which point the two pronuclei migrate toward each other. Their fusion
forms the diploid zygote nucleus (Figure 7.24). DNA synthesis can begin
either in the pronuclear stage or after the formation of the zygote nucleus,
and depends on the level of Ca 2+ released earlier in fertilization (Jaffe et
al. 2001).
At this point, the diploid nucleus has formed. DNA synthesis and
protein synthesis have commenced, and the inhibitions to cell division
have been removed. The sea urchin can now begin to form a multicel-
lular organism. We will describe the means by which sea urchins achieve
multicellularity in Chapter 10.
A third reason why it has been difficult to elucidate the details of mammalian fertil-
ization is the recent discovery that there may be multiple mechanisms (discussed later
in the chapter) by which mammalian sperm can undergo the acrosome reaction and
bind to the zona pellucida (see Clark 2011).
WATCH DEVELOPMENT 7.5 A video from the laboratory of Dr. Yasayuki Mio shows
the events of human fertilization and early development in vitro.
capacitation During the trek from the vagina to the ampullary region of the ovi-
duct, the sperm matures such that it has the capacity to fertilize the egg when the two
finally meet. Unlike the sperm of frogs or sea urchins, newly ejaculated mammalian
sperm are immature and cannot fertilize the egg; they are unable to undergo the acro-
some reaction or to sense the cues that will eventually guide them to the egg. To achieve
such competence, the sperm must undergo a suite of sequential physiological changes
called capacitation . These changes are accomplished only after a sperm has resided
for some time in the female reproductive tract (Chang 1951; Austin 1952). Sperm that
are not capacitated are “held up” in the cumulus matrix and are unable to reach the egg
(Austin 1960; Corselli and Talbot 1987).
Dev T u tor i al Capacitation The knowledge that recently ejaculated
mammalian sperm could not fertilize an egg was a critical breakthrough
in the development of successful in vitro fertilization techniques. Figure 7.26 Hypothetical model for
mammalian sperm capacitation. The path-
Contrary to popular belief, the race is not always to the swift. A study by Wilcox and way is modulated by the removal of cho-
colleagues (1995) found that nearly all human pregnancies result from sexual inter- lesterol from the sperm cell membrane,
which allows the influx of bicarbonate ions
course during a 6-day period ending on the day of ovulation. This means that the
(HCO3–) and calcium ions (Ca2+). These
fertilizing sperm could have taken as long as 6 days to make the journey to the oviduct. ions activate adenylate kinase (SACY),
Although some human sperm reach the ampulla of the oviduct within half an hour thereby elevating cAMP concentrations.
of intercourse, “speedy” sperm may have little chance of fertilizing the egg because The high cAMP levels then activate protein
they have not undergone capacitation. Eisenbach (1995) proposed a hypothesis wherein kinase A (PKA). Active PKA phosphory-
capacitation is a transient event, and sperm are given a relatively brief window of com- lates several tyrosine kinases, which in
petence during which they can successfully fertilize the egg. As the sperm reach the turn phosphorylate several sperm pro-
teins, leading to capacitation. Increased
ampulla, they acquire competence—but they lose it if they stay around too long.
intracellular Ca2+ also activates the phos-
The molecular processes of capacita-
phorylation of these proteins, as well as
tion prepare the sperm for the acrosome contributing to the hyperactivation of the
reaction and enable the sperm to become Serum albumin protein sperm. (After Visconti et al. 2011.)
hyperactive ( Figure 7.26 ). Although (cholesterol acceptor)
the details of these processes still await + +
HCO3– K+ Ca2+
description (they are notoriously difficult
to study), two sets of molecular changes
are considered to be important: Sperm cell
+
membrane
1. Lipid changes. The sperm cell mem-
brane is altered by the removal of SACY
Cholesterol efflux K+
cholesterol by albumin proteins in the from sperm
female reproductive tract (Cross 1998). membrane + +
HCO3– ATP Ca2+
The cholesterol efflux from the sperm
cell membrane is thought to change cAMP +
the location of its “lipid rafts,” isolated
+
regions that often contain receptor pro-
teins that can bind the zona pellucida
Increased dynein
and participate in the acrosome reac- PKA
activity?
tion (Bou Khalil et al. 2006; Gadella et
al. 2008). Originally located throughout
the sperm cell membrane, after cho- Phosphorylation Hyperactivation
of tyrosine kinases (sperm swim with
lesterol efflux lipid rafts are clustered
increased speed
over the anterior sperm head. The and force)
outer acrosomal membrane changes
and comes into contact with the sperm Phosphorylation of sperm proteins
cell membrane in a way that prepares it
for the acrosome reaction (Tulsiani and
Abou-Haila 2004). Sperm
capacitation
2. Protein changes. Particular proteins or
carbohydrates on the sperm surface
242 Chapter 7
are lost during capacitation (Lopez et al. 1985; Wilson and Oliphant
1987). It is possible that these compounds block the recognition sites
for the sperm proteins that bind to the zona pellucida. It has been
suggested that the unmasking of these sites might be one of the
effects of cholesterol depletion (Benoff 1993). The membrane poten-
tial of the sperm cell becomes more negative as potassium ions leave
the sperm. This change in membrane potential may allow calcium
channels to be opened and permit calcium to enter the sperm. Cal-
cium and bicarbonate ions are critical in activating cAMP production
and in facilitating the membrane fusion events of the acrosome reac-
tion (Visconti et al. 1995; Arnoult et al. 1999). The influx of bicar-
bonate ions (and possibly other ions) alkalinizes the sperm, raising
its pH. This will be critical in the subsequent activation of calcium
channels (Navarro et al. 2007). As a result of cAMP formation, pro-
tein phosphorylation occurs (Galantino-Homer et al. 1997; Arcelay
et al. 2008). Once they are phosphorylated, some proteins migrate to
the surface of the sperm head. One of these proteins is Izumo, which
is critical in sperm-egg fusion (see Figure 7.30; Baker et al. 2010).
There may be an important connection between sperm translocation
and capacitation. Smith (1998) and Suarez (1998) have documented that
before entering the ampulla of the oviduct, the uncapacitated sperm bind
Figure 7.27 Scanning electron micrograph (artificially
actively to the membranes of the oviduct cells in the narrow passage (the
colored) showing bull sperm as it adheres to the mem-
branes of epithelial cells in the oviduct of a cow prior to
isthmus) preceding it (Figure 7.27; see also Figure 12.11). This binding
entering the ampulla. (From Lefebvre et al. 1995, courtesy is temporary and appears to be broken when the sperm become capaci-
of S. Suarez.) tated. Moreover, the life span of the sperm is significantly lengthened
by this binding. This restriction of sperm entry into the ampulla during
capacitation, and the expansion of sperm life span may have important
consequences (Töpfer-Petersen et al. 2002; Gwathmey et al. 2003). The
binding action may function as a block to polyspermy by preventing
many sperm from reaching the egg at the same time (if the oviduct isth-
mus is excised in cows, a much higher rate of polyspermy results). In
addition, slowing the rate of sperm capacitation and extending the active
life of sperm may maximize the probability that sperm will still be avail-
Gilbert able to meet the egg in the ampulla.
Developmental Biology 11e, Sinauer Associates
DevBio11e_07.27 Date 02-22-16
In the vicinity of the oocyte: Hyperactivation,
thermotaxis, and chemotaxis
Toward the end of capacitation, sperm become hyperactivated—they swim at higher
velocities and generate greater force. Hyperactivation appears to be mediated by the
opening of a sperm-specific calcium channel in the sperm tail (see Figure 7.26; Ren et
al. 2001; Quill et al. 2003). The symmetric beating of the flagellum is changed into a
rapid asynchronous beat with a higher degree of bending. The power of the beat and
the direction of sperm head movement are thought to release the sperm from their
binding with the oviduct epithelial cells. Indeed, only hyperactivated sperm are seen
to detach and continue their journey to the egg (Suarez 2008a,b). Hyperactivation may
enable sperm to respond differently to the fluid current. Uncapacitated sperm move
in a planar direction, allowing more time for the sperm head to attach to the oviduct
epithelial cells. Capacitated sperm rotate around their long axis, probably enhancing the
detachment of the sperm from the epithelia (Miki and Clapham 2013). Hyperactivation,
along with a hyaluronidase enzyme on the outside of the sperm cell membrane, enables
the sperm to digest a path through the extracellular matrix of the cumulus cells (Lin et
al. 1994; Kimura et al. 2009).
An old joke claims that the reason a man has to release so many sperm at each
ejaculation is that no male gamete is willing to ask for directions. So what does provide
Fertilization 243
the sperm with directions? Heat is one cue: there is a thermal gradient of 2ºC between
the isthmus of the oviduct and the warmer ampullary region (Bahat et al. 2003, 2006).
Capacitated mammalian sperm can sense thermal differences as small as 0.014ºC over
a millimeter and tend to migrate toward the higher temperature (Bahat et al. 2012). This
ability to sense temperature difference and preferentially swim from cooler to warmer
sites (thermotaxis) is found only in capacitated sperm.
By the time the sperm are in the ampullary region, most of them have undergone
the acrosome reaction (La Spina et al. 2016; Muro et al. 2016). Now, a second sensing
mechanism, chemotaxis, may come into play. It appears that the oocyte and its accom-
panying cumulus cells secrete molecules that attract capacitated (and only capacitated)
sperm toward the egg during the last stages of sperm migration (Ralt et al. 1991; Cohen-
Dayag et al. 1995; Eisenbach and Tur-Kaspa 1999; Wang et al. 2001). The identity of
these chemotactic compounds is being investigated, but one of them appears to be the
hormone progesterone, which is made by the cumulus cells. Guidobaldi and colleagues
(2008) have shown that rabbit sperm binds progesterone secreted from the cumulus
cells surrounding the oocyte and uses the hormone as a directional cue. In humans,
progesterone has been shown to bind to a receptor that activates Ca2+ channels in the cell
membrane of the sperm tail, leading to sperm hyperactivity (Lishko et al. 2011; Strünker
et al. 2011). Mouse cumulus cells also secrete a substance, CRISP1, that attracts sperm
and hyperactivates them through CatSper channels (Ernesto et al. 2015). The human
cumulus also appears to make a substance (or substances) that attracts sperm, and it
appears to form a gradient permitting the sperm to move through the cumulus toward
the egg (Sun et al. 2005; Williams et al. 2015). Whether these are the same chemoat-
tractants or different ones has yet to be resolved. This activation takes place only after
the sperm’s intracellular pH has increased, which may help explain why capacitation is Developing Questions
needed in order for sperm to reach and fertilize the egg (Navarro et al. 2007). Sometimes the egg and
Thus it appears that, just as in the case of sperm-activating peptides in sea urchins, sperm fail to meet and
progesterone both provides direction and activates sperm motility. Moreover, as in cer- conception does not
tain invertebrate eggs, it appears that the human egg secretes a chemotactic factor only take place. What are the
when it is capable of being fertilized, and that sperm are attracted to such a compound leading causes of infertility
in humans, and what
only when they are capable of fertilizing the egg.
procedures are being used
In summary, three calcium-mediated sensing processes get the mammalian sperm to circumvent these blocks?
to the egg: rheotaxis (long-range), thermotaxis (moderate range), and finally chemo-
taxis, which works within millimeters of the egg.
(A) Figure 7.28 Acrosome-reacted mouse sperm bind to the zona and are
successful at fertilizing the egg. (A) The acrosomes of mouse sperm were
labeled with GFP such that intact acrosomes fluoresced green; sperm tails
were labeled with red fluorescent markers. When the labeled sperm were
allowed to interact with a mouse egg and cumulus, the resulting video
0.00 4.30 5.37 6.50 revealed that the fertilizing sperm (arrowhead at 4.30 seconds) showed
Seconds no green fluorescence when it reached the surface of the zona pellucida
at 6.20 seconds—indicating that it had undergone the acrosome reaction
(B) before that time. An adjacent sperm did fluoresce green, meaning its acro-
some remained intact. Such acrosome-intact sperm remain bound to the
zona without undergoing the acrosome reaction or progressing to the egg
cell membrane. (B) Gain-of-function experiment demonstrating that human
sperm bind to ZP2. Of the four human zona pellucida proteins, only ZP4
is not found in mouse zona. Transgenic mouse oocytes were constructed
that expressed the three normal mouse zona proteins and also one of the
four human zona proteins. When human sperm were added to the mouse
oocytes, they bound only to those transgenic oocytes that expressed human
ZP2. Human sperm did not bind to cells expressing human ZP1, ZP3, or ZP4.
ZP1 ZP2
(A from Jin et al. 2011, courtesy of N. Hirohashi; B from Baibakov et al. 2012.)
binding. Human sperm does not bind to the zona of mouse eggs, so
Baibakov and colleagues (2012) added the different human zona pro-
teins separately to the zona of mouse eggs. Only those mouse eggs
with human ZP2 bound human sperm (Figure 7.28B). Using mutant
forms of ZP2, Avella and colleagues (2014) demonstrated that there is
a particular region of the mouse ZP2 protein (between amino acids 51
ZP3 ZP4 and 149) that bound the sperm. This region is seen in human ZP2 and
may be responsible for sperm-zona binding in humans as well. ZP3
was the other candidate for binding sperm; however, Gahlay and col-
leagues (2010) provided evidence that mouse eggs with mutations in
ZP3 were still fertilized.
In mice, there is also evidence that acrosome-intact sperm can bind
(A) to ZP3, and that ZP3 can cause the acrosome reaction directly on the
zona (Bleil and Wassarman 1980, 1983). And in humans, there is evi-
dence that the reaction can also be induced by the zona proteins, per-
haps by all of them acting in concert (Gupta 2015). Indeed, there may
be several means to initiate the acrosome reaction and to bind to and
penetrate the zona pellucida. These mechanisms may act simultane-
ously, or perhaps one mechanism is used for acrosome-intact sperm
and another for acrosome-reacted sperm. Given that the zona’s bio-
chemical composition differs in different species, the mechanisms
that predominate in one species need not be the same in another. The
Gilbert sperm receptor that binds to the zona proteins has not yet been identi-
Developmental Biology 11e, Sinauer Associates fied. It is probably a complex containing several proteins that bind to
DevBio11e_07.28 Date 02-22-16
both the protein and carbohydrate portions of the zona glycoproteins
(Chiu et al. 2014).
(B)
Figure 7.29 Entry of sperm into a golden hamster egg. (A) Scan-
ning electron micrograph of sperm fusing with egg. The “bald” spot
(without microvilli) is where the polar body has budded off. Sperm do
not bind there. (B) Transmission electron micrograph of the sperm
fusing parallel to the egg cell membrane. (From Yanagimachi and
Noda 1970 and Yanagimachi 1994, courtesy of R. Yanagimachi.)
Fertilization 245
Figure 7.31 Cleaved ZP2 is necessary for ZP2Mut egg Normal 2-cell ZP2Mut 2-cell
the block to polyspermy in mammals. Eggs and
embryos were visualized by fluorescence micros-
copy (to see sperm nuclei; top row) and brightfield
microscopy (differential interference contrast, to
see sperm tails; bottom row). Sperm bound nor- Sperm nuclei
mally to eggs containing a mutant ZP2 that could
not be cleaved. However, the egg with normal
(i.e., cleavable) ZP2 got rid of sperm by the 2-cell
stage, whereas the egg with the mutant (uncleav-
able) ZP2 retained sperm. (From Gahlay et al.
2010, photograph courtesy of J. Dean.)
Sperm tails
thereby preventing the sperm from seeing any Juno protein that may still reside on the
Developing Questions
oocyte membrane.
One of the goals of modern
pharmacology is to create Fusion of genetic material
a male contraceptive.
Reviewing the steps of
As in sea urchins, the single mammalian sperm that finally enters the egg carries its
fertilization, what steps genetic contribution in a haploid pronucleus. In mammals, however, the process of
do you think it might pronuclear migration takes about 12 hours, compared with less than 1 hour in the sea
be possible to block urchin. The DNA of the sperm pronucleus is bound by protamines—basic proteins
pharmacologically in that are tightly compacted through disulfide bonds. Glutathione in the egg cytoplasm
order to produce such a reduces these disulfide bonds and allows the sperm chromatin to uncoil (Calvin and
contraceptive for males?
Bedford 1971; Kvist et al. 1980; Sutovsky and Schatten 1997).
The mammalian sperm enters the oocyte while the oocyte nucleus is “arrested”
in metaphase of its second meiotic division (Figure 7.32A,B ; see also Figure 7.3). As
described for the sea urchin, the calcium oscillations brought about by sperm entry
inactivate MAP kinase and allow DNA synthesis. But unlike the sea urchin egg, which
is already in a haploid state, the chromosomes of the mammalian oocyte are still in
the middle of meiotic metaphase. Oscillations in the level of Ca 2+ activate another
kinase that leads to the proteolysis of cyclin (thus allowing the cell cycle to continue)
and securin (the protein that holds the metaphase chromosomes together), eventually
resulting in a haploid female pronucleus (Watanabe et al. 1991; Johnson et al. 1998).
DNA synthesis occurs separately in the male and female pronuclei. The centro-
some produced by the male pronucleus generates asters (largely from microtubule
proteins stored in the oocyte). The microtubules join the two pronuclei and enable
them to Gilbert
migrate toward one another. Upon meeting, the two nuclear envelopes break
Developmental
down. However, Biology
instead 11e, SinaueraAssociates
of producing common zygote nucleus (as in sea urchins), the
DevBio11e_07.31 Date 02-22-16
chromatin condenses into chromosomes that orient themselves on a common mitotic
spindle (Figure 7.32C,D). Thus, in mammals a true diploid nucleus is seen for the first
time not in the zygote, but at the 2-cell stage.
Each sperm brings into the egg not only its nucleus but also its mitochondria, its
centriole, and a tiny amount of cytoplasm. The sperm mitochondria and their DNA are
degraded in the egg cytoplasm, so all of the new individual’s mitochondria are derived
from its mother. The egg and embryo appear to get rid of the paternal mitochondria
both by dilution and by actively targeting them for destruction (Cummins et al. 1998;
Shitara et al. 1998; Schwartz and Vissing 2002). In most mammals, however, the sperm
centriole not only survives but appears to serve as the organizing agent for making the
new mitotic spindle. Moreover, the sperm cytoplasm has recently been found to contain
enzymes that activate egg metabolism, as well as RNA fragments that may alter gene
expression (Sharma et al. 2016).
Fertilization 247
Figure 7.32 Pronuclear movements during human fertilization. Microtubules are stained
green, DNA is dyed blue. Arrows point to the sperm tail. (A) The mature unfertilized oocyte (D)
completes the first meiotic division, budding off a polar body. (B) As the sperm enters the
oocyte (left side), microtubules condense around it as the oocyte completes its second
meiotic division at the periphery. (C) By 15 hours after fertilization, the two pronuclei have
come together, and the centrosome splits to organize a bipolar microtubule array. The
sperm tail is still seen (arrow). (D) At prometaphase, chromosomes from the sperm and egg
intermix on the metaphase equator and a mitotic spindle initiates the first mitotic division.
The sperm tail can still be seen. (From Simerly et al. 1995, courtesy of G. Schatten.)
Whereas sea urchin eggs usually are activated as a single wave of Ca2+ crosses from
the point of sperm entry, the mammalian egg is traversed by numerous waves of cal-
cium ions (Miyazaki et al. 1992; Ajduk et al. 2008; Ducibella and Fissore 2008). The
extent (amplitude, duration, and number) of these Ca2+ oscillations appears to regulate
the timing of mammalian egg activation events (Ducibella et al. 2002; Ozil et al. 2005;
Toth et al. 2006). In this way, cortical granule exocytosis occurs just before resumes
meiosis and much before the translation of maternal mRNAs.
In mammals, the Ca2+ released by IP3 binds to a series of proteins including calmod-
ulin-activated protein kinase (which will be important in eliminating the inhibitors of
mRNA translation), MAP kinase (which allows the resumption of meiosis), and syn-
aptotagmin (which helps initiate cortical granule fusion). Unused Ca 2+ is pumped back
into the endoplasmic reticulum, and additional Ca 2+ is acquired from outside the cell.
This recruitment of extracellular Ca 2+ appears to be necessary for the egg to complete
meiosis. If Ca 2+ influx is blocked, the second polar body does not form; instead, the
result is two nonviable (triploid) egg pronuclei (Maio et al. 2012; Wakai et al. 2013).
Dev T u tor i al Legends of the sperm The stories people tell about
fertilization are often at odds with the actual data of biology.
Coda
Fertilization is not a moment or an event, but a process of carefully orchestrated and
coordinated events including the contact and fusion of gametes, the fusion of nuclei, and
the activation of development. It is a process whereby two cells, each at the verge of death,
unite to create a new organism that will have numerous cell types and organs. It is just
the beginning of a series of cell-cell interactions that characterize animal development.
7 Snapshot Summary
Fertilization
1. Fertilization accomplishes two separate activities: sex the sperm and egg cell membranes. In sea urchins, bin-
(the combining of genes derived from two parents) and din may mediate gamete recognition and fusion.
reproduction (the creation of a new organism). 11. Polyspermy results when two or more sperm fertilize an
2. The events of fertilization usually include (1) contact and egg. It is usually lethal, since it results in blastomeres with
recognition between sperm and egg; (2) regulation of different numbers and types of chromosomes.
sperm entry into the egg; (3) fusion of genetic material 12. Many species have two blocks to polyspermy. The fast
from the two gametes; and (4) activation of egg metabo- block is immediate and causes the egg membrane
lism to start development. resting potential to rise. Sperm can no longer fuse with
3. The sperm head consists of a haploid nucleus and an the egg. In sea urchins this is mediated by the influx of
acrosome. The acrosome is derived from the Golgi sodium ions. The slow block, or cortical granule reaction,
apparatus and contains enzymes needed to digest is physical and is mediated by calcium ions. A wave of
extracellular coats surrounding the egg. The midpiece of Ca2+ propagates from the point of sperm entry, causing
the sperm contain mitochondria and the centriole that the cortical granules to fuse with the egg cell membrane.
generates the microtubules of the flagellum. Energy for The released contents of these granules cause the vitel-
flagellar motion comes from mitochondrial ATP and a line envelope to rise and harden into the fertilization
dynein ATPase in the flagellum. envelope.
4. The female gamete can be an egg (with a haploid nucle- 13. The fusion of sperm and egg results in the activation of
us, as in sea urchins) or an oocyte (in an earlier stage of crucial metabolic reactions in the egg. These reactions
development, as in mammals). The egg (or oocyte) has a include re-initiation of the egg’s cell cycle and subse-
large mass of cytoplasm storing ribosomes and nutritive quent mitotic division, and the resumption of DNA and
proteins. Some mRNAs and proteins that will be used as protein synthesis.
morphogenetic factors are also stored in the egg. Many 14. In all species studied, free Ca2+, supported by the alka-
eggs also contain protective agents needed for survival linization of the egg, activates egg metabolism, protein
in their particular environment. synthesis, and DNA synthesis. Inositol trisphosphate
5. Surrounding the egg cell membrane is an extracellular (IP3 ) is responsible for releasing Ca2+ from storage in the
layer often used in sperm recognition. In most animals, endoplasmic reticulum. DAG (diacylglycerol) is thought to
this extracellular layer is the vitelline envelope. In mam- initiate the rise in egg pH.
mals, it is the much thicker zona pellucida. Cortical gran- 15. IP3 is generated by phospholipases. Different spe-
ules lie beneath the egg’s cell membrane. cies may use different mechanisms to activate the
6. Neither the egg nor the sperm is the “active” or “passive” phospholipases.
partner; the sperm is activated by the egg, and the egg 16. Genetic material is carried in a male and a female pronu-
is activated by the sperm. Both activations involve cal- cleus, which migrate toward each other. In sea urchins,
cium ions and membrane fusions. the male and female pronuclei merge and a diploid
7. In many organisms, eggs secrete diffusible molecules zygote nucleus is formed. DNA replication occurs after
that attract and activate the sperm. pronuclear fusion.
8. Species-specific chemotactic molecules secreted by 17. Mammalian fertilization takes place internally, within the
the egg can attract sperm that are capable of fertilizing female reproductive tract. The cells and tissues of the
it. In sea urchins, the chemotactic peptides resact and female reproductive tract actively regulate the transport
speract have been shown to increase sperm motility and and maturity of both the male and female gametes.
provide direction toward an egg of the correct species. 18. The translocation of sperm from the vagina to the egg
9. The acrosome reaction releases enzymes exocytotically. is regulated by the muscular activity of the uterus, by
These proteolytic enzymes digest the egg’s protective the binding of sperm in the isthmus of the oviduct, and
coating, allowing the sperm to reach and fuse with the by directional cues from the oocyte and/or the cumulus
egg cell membrane. In sea urchins, this reaction in the cells surrounding it.
sperm is initiated by compounds in the egg jelly. Globular 19. Mammalian sperm must be capacitated in the female
actin polymerizes to extend the acrosomal process. Bin- reproductive tract before they are capable of fertilizing
din on the acrosomal process is recognized by a protein the egg. Capacitation is the result of biochemical chang-
complex on the sea urchin egg surface. es in the sperm cell membrane and the alkalinization of
10. Fusion between sperm and egg is probably mediated by its cytoplasm. Capacitated mammalian sperm can pen-
protein molecules whose hydrophobic groups can merge etrate the cumulus and bind the zona pellucida.
250 Chapter 7
20. In one model of sperm-zona binding, the acrosome- 22. The rise in intracellular free Ca2+ at fertilization in amphib-
intact sperm bind to ZP3 on the zona, and ZP3 induces ians and mammals causes the degradation of cyclin
the sperm to undergo the acrosome reaction on the and the inactivation of MAP kinase, allowing the second
zona pellucida. In a more recent model, the acrosome meiotic metaphase to be completed and the formation
reaction is induced in the cumulus, and the acrosome- of the haploid female pronucleus.
reacted sperm bind to ZP2. 23. In mammals, DNA replication takes place as the pro-
21. In mammals, blocks to polyspermy include modification nuclei are traveling toward each other. The pronuclear
of the zona proteins by the contents of the cortical gran- membranes disintegrate as the pronuclei approach each
ules so that sperm can no longer bind to the zona. other, and their chromosomes gather around a common
metaphase plate.
Further Reading
Bartolomei, M. S. and A. C. Ferguson-Smith. 2011. Mammalian Jin, M. and 7 others. 2011. Most fertilizing mouse spermatozoa
genomic imprinting. Cold Spring Harbor Persp. Biol. doi: 10.1101/ begin their acrosome reaction before contact with the zona
chsperspect.a002592. pellucida during in vitro fertilization. Proc. Natl. Acad. Sci. USA
Boveri, T. 1902. On multipolar mitosis as a means of analysis of 108: 4892–4896.
the cell nucleus. [Translated by S. Gluecksohn-Waelsch.] In B. Just, E. E. 1919. The fertilization reaction in Echinarachinus
H. Willier and J. M. Oppenheimer (eds.), Foundations of Experi- parma. Biol. Bull. 36: 1–10.
mental Embryology. Hafner, New York, 1974. Knott, J. G., M. Kurokawa, R. A. Fissore, R. M. Schultz and C.
Briggs, E. and G. M. Wessel. 2006. In the beginning: Animal J. Williams. 2005. Transgenic RNA interference reveals role for
fertilization and sea urchin development. Dev. Biol. 300: 15–26. mouse sperm phospholipase Cζ in triggering Ca2+ oscillations
Gahlay, G., L. Gauthier, B. Baibakov, O. Epifano and J. Dean. during fertilization. Biol Reprod. 72: 992–996.
2010. Gamete recognition in mice depends on the cleavage sta- Parrington, J., L. C. Davis, A. Galione and G. Wessel. 2007.
tus of an egg’s zona pellucida protein. Science 329: 216–219. Flipping the switch: How a sperm activates the egg at fertiliza-
Glabe, C. G. and V. D. Vacquier. 1978. Egg surface glycoprotein tion. Dev. Dyn. 236: 2027–2038.
receptor for sea urchin sperm bindin. Proc. Natl. Acad. Sci. USA Vacquier, V. D. and G. W. Moy. 1977. Isolation of bindin: The
75: 881–885. protein responsible for adhesion of sperm to sea urchin eggs.
Jaffe, L. A. 1976. Fast block to polyspermy in sea urchins is elec- Proc. Natl. Acad. Sci. USA 74: 2456–2460.
trically mediated. Nature 261: 68–71. Wasserman, P. M. and E. S. Litscher. 2016. A bespoke coat for
eggs: Getting ready for fertilization. Curr. Top. Dev. Biol. 117:
539–552.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
8
Rapid Specification in
Snails and Nematodes
fertilization gives the organism a new genome and rearranges its cytoplasm.
Once this is accomplished, the resulting zygote begins the production of a multicellular
organism. During cleavage, rapid cell divisions divide the zygote cytoplasm into numer-
ous cells. These cells undergo dramatic displacements during gastrulation , a process
whereby the cells move to different parts of the embryo and acquire new neighbors. The
different patterns of cleavage and gastrulation were described in Chapter 1 (see pp. 11–14).
During cleavage and gastrulation, the major body axes of most animals are determined
and the embryonic cells begin to acquire their respective fates. Three axes must be speci-
fied: the anterior-posterior (head-tail) axis; the dorsal-ventral (back-belly) axis; and the
left-right axis (see Figure 1.6). Different species specify these axes at different times, using
different mechanisms. Cleavage always precedes gastrulation, but in some species body
axis formation begins as early as oocyte formation (as in Drosophila). In other species, the
axes begin forming during cleavage (as in tunicates), while in still others axis formation
extends all the way through gastrulation (as in Xenopus).
The chapters in this unit will look at how representative species in several groups
undergo cleavage, gastrulation, axis specification, and cell fate determination. With the
exception of the human examples in Chapter 12, virtually all of the species and groups
described (including snails, nematodes, fruit flies, sea urchins, frogs, zebrafish, chicks,
How are snail and mice) have been important model organisms for developmental biologists. In other
embryos determined words, these species are easily maintained in the laboratory and have special properties
to coil either to the that allow their mechanisms of development to be readily observed. These properties
right or to the left?
The Punchline
Mode of development plays a major role in classifying animal groups. One major
taxonomical criterion is whether the anterior end (mouth) or posterior end (anus) of the
body develops first. The snails (gastropod mollusks) and nematodes (roundworms)
form their mouths first and have evolved rapid specification of their body axes and
cell fates, often by placing transcription factors into specific blastomeres during early
cleavage. These transcription factors can determine cells autonomously, or they can
initiate paracrine factor pathways that induce the determination of neighboring cells. In
particular, the D-quadrant blastomeres of snails can work as “organizers” that structure
the morphogenesis of the entire embryo. Its transparent cuticle, small cell number, and
minute genome allow the study of C. elegans development as a model of how genes
can act to control axis formation and cell specification.
252 Chapter 8
include quick generation time, large litters, amenability to genetic and surgical manip-
ulation, and the ability to develop under laboratory conditions. (This very ability to
develop in the laboratory, however, sometimes precludes our asking certain questions
concerning the relationship of development to an organism’s natural habitat, as we will
discuss in Chapter 25.)
This chapter will detail the early development of two groups of protostome inverte-
brates, the gastropod mollusks (represented by snails) and the nematodes (represented
by Caenorhabditis elegans). We begin, however, by taking a brief look at animal evolution
and classification as seen through the lens of development.
Basal phyla
Animals that have two germ layers—ectoderm and endoderm but little or no meso-
derm—are referred to as diploblasts. The diploblasts have traditionally included the
cnidarians (jellyfish and hydras) and the ctenophores (comb jellies). Recent genomic
studies have shown that the ctenophore clade—not the sponges, as had long been
thought—is the sister group to all other animals (Ryan et al. 2013; Moroz et al. 2014).
The sponges apparently have the genes to produce a nervous system, although no mod-
ern sponge group has one. This finding indicates that the nervous system has been lost
in the sponge lineage, rather than never having evolved among these animals. The
hypothesis that cnidarians rather than sponges are the most ancient extant metazoan
lineage remains controversial, despite increasing evidence for this position (Borowiec
et al. 2015; Chang et al. 2015; Pisani et al. 2015).
Moreover, it has long been thought that the diploblast cnidarians and ctenophores
have radial symmetry and no mesoderm, whereas the triploblast phyla (all other ani-
mals) have bilateral symmetry and a third germ layer, the mesoderm. However, this
clear-cut demarcation is now being questioned in regard to the cnidarians. Although
certain cnidarians (such as Hydra) have no true mesoderm, others seem to have some
mesoderm, and some display bilateral symmetry only at certain stages of their life
cycle (Martindale et al. 2004; Martindale 2005). However, the mesoderm of cnidar-
ians may have evolved independently of the mesoderm found in the protostomes and
deuterostomes. We now are aware that jellyfish possess striated muscle (necessary for
their propulsion movement), but their muscles do not seem related either molecularly or
developmentally to the mesodermally derived muscles of vertebrates or insects (Stein-
metz et al. 2012). This independent generation of contractile cells appears to represent
a remarkable case of evolutionary convergence.
Ctenophores
Common
ancestor of Sponges
metazoans Basal phyla
Placozoans
Lophotrochozoans Mollusks
Annelids
Hemichordates
Lancelets
Chordates
Urochordates
DEUTEROSTOMES Vertebrates
common type of cleavage (spiral) and a common larval form (the trochophore). The
trochophore (Greek trochos, “wheel”) is a planktonic (free-swimming) larval form with
characteristic bands of locomotive cilia. Adults of some lophotrochozoan species have a
distinctive feeding apparatus, the lophophore. Lophotrochozoans include 14 of the 36
metazoan phyla, including the flatworms, annelids, and mollusks. The spiral cleavage
program is so characteristic of this group that the term “spiralia” has become another
way of describing this clade (Henry 2014).
deuterostomes The major deuterostome lineages are the chordates (including the
vertebrates) and the echinoderms. Although it may seem strange to classify humans,
fish, and frogs in the same broad group as starfish and sea urchins, certain embryologi-
cal features stress this kinship. First, in deuterostomes (“mouth second”), the oral open-
ing is formed after the anal opening. Also, whereas protostomes generally form their
body cavity by hollowing out a solid block of mesoderm (schizocoely, as mentioned
earlier), most deuterostomes form their body cavity by extending mesodermal pouches
from the gut (enterocoely). (There are many exceptions to this generalization, however;
see Martín-Durán et al. 2012.)
The lancelets (Cephalochordata; amphioxus) and the tunicates (Urochordata; sea
squirts) are invertebrates—they have no backbone. However, the larvae of these organ-
isms have a notochord and pharyngeal arches (head structures), indicating that they
are chordates. (The “chord” in “chordates” refers to the notochord, which induces the
formation of the vertebrate spinal cord.) This discovery, made by Alexander Kowa-
levsky (1867, 1868), was a milestone in biology. The developmental stages of these
organisms united the invertebrates and vertebrates into a single “animal kingdom.”
Darwin (1874) rejoiced, noting that vertebrates probably arose from a group of animals
that resembled larval tunicates. Indeed, Urochordata is now considered to be the group
most closely related to the vertebrates. This relationship has been demonstrated both
by developmental affinities and by molecular analysis (Bourlat et al. 2006; Delsuc et
al. 2006), reversing a previous view that cephalochordates were the sister group to
vertebrates.
We turn now to a detailed description of early development in two protostome
groups: the snails (shelled gastropod mollusks) and C. elegans (an extremely well-studied
species of nematode worm). Despite their differences, the early development of both of
these invertebrate groups has evolved for rapid development to a larval stage, followed
by subsequent growth into an adult (Davidson 2001). Their common factors include:
• Immediate activation of the zygotic genes
• Rapid specification of the products of cleavage (the blastomeres) by the prod-
ucts of the zygotic genes and by maternally active genes
• A relatively small number of cells (several hundred or fewer) present at the
start of gastrulation
3B
(A) View from animal pole
2b1
1B
2B 2b2
2b 3a 3b
B 1b22
AB 1b2 1a21 1b
12
1b21
1a 1b 2c
A 1a2 2a1 1b11
1b1 1a22
1A 1 1 1a11 1c12 2c2
1c 1C 2A 1a 1c 2C
C 1d 2 3A
1a12 1c11
CD 2a 1c 1d11 3C
1d1 2a2
1d2 1c21
D 2d 1d 21 1
1d12 2c
1D 1d22 1c22
2D 3d 2d1 3c
2d2
3D
1b11 1d11
1d12
21 1a11
1b 2d1
1b1 1a1 21
(B) Side view 1b12 1a21 1a12 1d
1b22 1a22
Polar body B 2b1 2a1 1c
22
1b 1a 1d 1a2
2b 2a 3a
3b 2a2 3d
2b2
AB A C
CD 1B 2B 2D
1A 3B
2A 3A
D
256 Chapter 8
(A) Figure 8.3 Spiral cleavage in mollusks. (A) The spiral nature of third cleavage can
be seen in the confocal fluorescence micrograph of the 4-cell embryo of the clam
Acila castrenis. Microtubules stain red, RNA stains green, and DNA stains yellow. Two
cells and a portion of a third cell are visible; a polar body can be seen at the top of the
micrograph. (B–D) Cleavage in the mud snail Ilyanassa obsoleta. The D blastomere is
larger than the others, allowing the identification of each cell. Cleavage is dextral. (B)
8-cell stage. PB, polar body (a remnant of meiosis). (C) Mid-fourth cleavage (12-cell
embryo). The macromeres have already divided into large and small spirally oriented
cells; 1a–d have not divided yet. (D) 32-cell embryo. (A courtesy of G. von Dassow
and the Center for Cell Dynamics; B–D from Craig and Morrill 1986, courtesy of the
authors.)
the animal pole, the upper ends of the mitotic spindles appear to alternate clockwise
and counterclockwise (Figure 8.3). This arrangement causes alternate micromeres to
form obliquely to the left and to the right of their macromeres.
WATCH DEVELOPMENT 8.1 Video from the laboratory of Dr. Deirdre Lyons shows the
first two micromere quartets forming in the snail Crepidula fornicata.
At the third cleavage, the A macromere gives rise to two daughter cells, macromere
1A and micromere 1a. The B, C, and D cells behave similarly, producing the first quartet
of micromeres. In most species, these micromeres are clockwise (to the right) of their
macromeres (looking down on the animal pole). At the fourth cleavage, macromere
1A divides to form macromere 2A and micromere 2a, and micromere 1a divides to
form two more micromeres, 1a1 and 1a2 (see Figure 8.2). The micromeres of this second
quartet are to the left of the macromeres. Further cleavage yields blastomeres 3A and
Gilbert Developmental Biology 11/e 3a from macromere 2A, and micromere 1a 2 divides to produce cells 1a 21 and 1a 22. In
Gil_DevBio11e_08.03 01-08-15 normal development, the first-quartet micromeres form the head structures, while the
second-quartet micromeres form the statocyst (balance organ) and shell. These fates
are specified both by cytoplasmic localization and by induction (Cather 1967; Clement
1967; Render 1991; Sweet 1998).
coils that open on the left). Crampton (1894) analyzed the embryos (A) Left-handed coiling (B) Right-handed coiling
of aberrant snails and found that their early cleavage differed from
AB AB
the norm (Figure 8.4). The orientation of the cells after the second
cleavage was different in the sinistrally coiling snails as a result of a
different orientation of the mitotic apparatus. You can see in Figure
8.4 that the position of the 4d blastomere is different in the right-
coiling and left-coiling snail embryos. This 4d blastomere is rather
special. It is often called the mesentoblast, since its progeny include CD CD
most of the mesodermal organs (heart, muscles, primordial germ
cells) and endodermal organs (gut tube).
B B
In snails such as Lymnaea, the direction of snail shell coiling is
controlled by a single pair of genes (Sturtevant 1923; Boycott et
al. 1930; Shibazaki 2004). In Lymnaea peregra, mutants exhibiting C A A C
sinistral coiling were found and mated with wild-type, dextrally
coiling snails. These matings showed that the right-coiling allele, D
D
D, is dominant to the left-coiling allele, d. However, the direction of
cleavage is determined not by the genotype of the developing snail
1B 1B
but by the genotype of the snail’s mother. This is called a maternal
effect. (We’ll see other important maternal effect genes when we 1a 1a
1b 1b
discuss Drosophila development.) A dd female snail can produce 1c 1A 1A 1c
1C 1d 1d 1C
only sinistrally coiling offspring, even if the offspring’s genotype
is Dd. A Dd individual will coil either left or right, depending on
the genotype of its mother. Such matings produce a chart like this: 1D 1D
Genotype Phenotype
DD female × dd male → Dd All right-coiling 4B 4A 4A 4B
DD male × dd female → Dd All left-coiling
Dd × Dd → 1DD:2Dd:1dd All right-coiling
Thus it is the genotype of the ovary in which the oocyte develops 4C 4C
that determines which orientation cleavage will take. The genetic
4D 4D
factors involved in coiling are brought to the embryo in the oocyte
cytoplasm. When Freeman and Lundelius (1982) injected a small 4d 4d
amount of cytoplasm from dextrally coiling snails into the eggs of
dd mothers, the resulting embryos coiled to the right. Cytoplasm
from sinistrally coiling snails, however, did not affect right-coiling
embryos. These findings confirmed that the wild-type mothers
were placing a factor into their eggs that was absent or defective
in the dd mothers. Working with similar populations, Davison and
colleagues have identified and mapped a gene encoding a formin
protein that is active in the eggs of mothers who carry the D allele,
Figure 8.4 Dextral and sinistral snail coiling. Looking down
but not in the eggs of dd mothers (Liu et al. 2013; Davison et al. on the animal pole of left-coiling (A) and right-coiling (B) snails.
2016). Thus, DD and Dd mothers produce active formin proteins. The origin of sinistral and dextral coiling can be traced to the
In dd females, however, the formin gene has a frameshift muta- orientation of the mitotic spindle at the third cleavage. Left- and
tion in the coding region that renders its mRNA nonfunctional, so right-coiling snails develop as mirror images of each other.
its message is rapidly degraded. When the egg contains functional (After Morgan 1927.)
formin mRNA from the mother’s D allele, this message becomes
asymmetrically positioned in the embryo as early as the two-cell
stage. The formin protein encoded by the mRNA message binds to actin and helps align
the cytoskeleton. These findings are upheld by studies showing that drugs that inhibit
formins cause eggs from DD mothers to develop into left-coiling embryos.
The first indication that the cells will divide sinistrally rather than dextrally is a helical
deformation of the cell membranes at the dorsal tip of the macromeres (Figure 8.5A).
Once the third cleavage takes place, the Nodal protein (a TGF-β family paracrine fac-
tor) activates genes on the right side of dextrally coiling embryos and on the left side of
sinistrally coiling embryos (Figure 8.5B). Using glass needles to change Gilbert Developmental Biology 11/e
the direction
Gil_DevBio11e_08.04
01/08/15
258 Chapter 8
po po
go go
Developing Questions
Does being a righty or a
lefty matter? Being right-
of cleavage at the 8-cell stage changes the location of Nodal gene expression (Grande
handed or left-handed
may play a relatively
and Patel 2009; Kuroda et al. 2009; Abe et al. 2014). Nodal appears to be expressed in the
minor role in one’s life as a C-quadrant micromere lineages (which give rise to the ectoderm) and induces asymmet-
human; but if one is a snail, ric expression of the gene for the Pitx1 transcription factor (a target of Nodal in vertebrate
it has crucial implications axis formation as well) in the neighboring D-quadrant blastomeres (Figure 8.5C).
both for individuals and
for the evolution of snail WEb Topic 8.2 A classic paper links genes and development In a master-
populations. Among snails, ful thought experiment from 1923, Alfred Sturtevant applied Mendelian genetics to the
lefties mate more readily process of snail coiling. His were some of the first studies to link the power of genetics
with lefties and righties and the study of embryology.
mate more readily with
righties—it’s strictly a matter WATCH DEVELOPMENT 8.2 See dextral and sinistral snail coiling in video from the
of genital position and laboratory of Dr. Reiko Kuroda.
physically hooking up.
Moreover, certain snake
species feed on shelled The snail fate map
snails, and the jaws of these
snakes have evolved to
Detailed fate maps (see Chapters 1 and 2) have greatly advanced our knowledge of spi-
eat right-coilers more easily ralian development. The fate maps of the gastropods Ilyanassa obsoleta and Crepidula for-
than lefties. How might this nicata were constructed by injecting large polymers conjugated to fluorescent dyes into
evolutionaryBiology
Gilbert Developmental adaptation
11/e specific micromeres (Render 1997; Hejnol et al. 2007). The fluorescence is maintained over
among snakes
Gil_DevBio11e_08.05 have the period of embryogenesis and can be seen in larval tissues derived from the inject-
01/29/15affected the evolution of ed cells. More specific results, showing divergences between snail species, have been
snails in regions where the
obtained using live imaging (Figure 8.6; Chan and Lambert 2014; Lyons et al. 2015).
species coexist? (See Hoso
et al. 2010 for an interesting
In general, the first quartet micromeres (1a–1d), supplemented by some cells from
set of experiments.) the second and third quartets, generate the head ectoderm, while the nervous system
comes largely from the first- and second-quartet cells (see Figure 8.6A). Fate maps
Rapid Specification in Snails and Nematodes 259
(A)
1B 1C 2B 2C 3B 3b 3C 4B 4C Ectoderm
B C 2c
1b 1b 1c
1c 1b1 1c1 3c 1b 1c
1 1
Ectomesoderm
2b
1a 1a 1d 2d 3a 1a1 1d1 1a1 1d
1
1d Endomesoderm
A D 4d
1A 1D 2A 2D 3A 3d 3D 4A Endoderm
4D
4-cell 8-cell 12-cell 20-cell 25-cell
(B) 1b Blastomere
2-day-old 3-day-old 4-day-old Veliger larva
Dorsal Dorsal Dorsal Anterior
(C) 4d Blastomere
2-day-old 3-day-old 4-day-old Veliger larva
Posterior/dorsal Ventral Ventral Dorsal
the polar lobe E. B. Wilson and his student H. E. Crampton observed that cer-
tain spirally cleaving embryos (mostly in mollusks and annelids) extrude a bulb of
cytoplasm—the polar lobe —immediately before first cleavage. In some species of
snails, the region uniting the polar lobe to the rest of the egg becomes a fine tube.
Figure 8.8 Importance of the 3′ UTR The first cleavage splits the zygote asymmetrically, so that the polar lobe is connected
for association of mRNAs with specific only to the CD blastomere (Figure 8.9A). In several species, nearly one-third of the
centrosomes. In Ilyanassa, the R5LE
total cytoplasmic volume is contained in this anucleate lobe, giving it the appearance
message is usually segregated into the
of another cell (Figure 8.9B). The resulting three-lobed structure is often referred to
first tier of micromeres. The message
binds to one side of the centrosome as the trefoil stage embryo (Figure 8.9C ).
complex (the side that will be in the small Crampton (1896) showed that if one removes the polar lobe at the trefoil stage, the
micromere.) (A) Normal R5LE mRNA remaining cells divide normally. However, the resulting larva is incomplete (Figure
distribution from the 2-cell through the 8.10), wholly lacking its intestinal endoderm and mesodermal kidney and heart), as
24-cell stage. The mRNA (green) associ- well as some ectodermal organs (such as eyes). Moreover, Crampton demonstrated
ates with the centrosomic region (blue)
that the same type of abnormal larva can be produced by removing the D blastomere
that will generate the micromere tier and
from the 4-cell embryo. Crampton thus concluded that the polar lobe cytoplasm con-
becomes localized to particular blasto-
meres by the 24-cell stage. (B) Hairpin tains the heart and intestinal-forming determinants and that these determinants (as
loop of the 3′ UTR of the R5LE message.
(After Rabinowitz and Lambert 2010.)
(B) G C G A A
C A G A A T T T T
T A T
GA CTCAC GTTCTCT AG CAGCATAGGTT TCCA TTAA ATTCGC A
T
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
–
– –
(B) (C)
Polar lobe
Polar lobe
(A) (B)
V VC
E
Y
ES
ES
well as its inducing ability) is transferred to the D blastomere.1 Crampton also showed
that the localization of these endomesodermal determinants is established shortly
after fertilization.
WATCH DEVELOPMENT 8.3 You can watch the polar lobe develop in this video of a
non-molluscan lophotrochozoan, the annelid worm Chaetopterus.
1
Although this looks like a great case for autonomous specification, it is possible that signal-
ing from the micromeres is needed to activate the cytoplasmic determinants brought to the D
blastomere by the polar lobe (Gharbiah et al. 2014; Henry 2014). In addition to these roles in
cell differentiation, the material in the polar lobe is responsible for specifying the dorsal-ventral
polarity of the embryo. When polar lobe material is forced to pass into the AB blastomere as
well as into the CD blastomere, twin larvae form that are joined at their ventral surfaces (Guer-
rier et al. 1978; Henry and Martindale 1987).
Rapid Specification in Snails and Nematodes 263
(A) (B)
1b1.2.2
1a1.2.2 1c1.2.2
4D
ML MR
4d 4dL 4dR
1D 2D 2c
2D 2C
4b
4A
4B
4a 4D
4c
24c
4D 4D
4C
Posterior
Blastopore lip 3b2 mesenchyme
Figure 8.14 Gastrulation in the snail
Crepidula. (A) Scanning electron micro-
Gastrulation in Snails graphs focusing on the blastopore region
show internalization of the endoderm,
The snail stereoblastula is relatively small, and its cell fates have already been deter- which is derived from the macromeres
mined by the D series of macromeres. Gastrulation is accomplished by a combination plus the fourth tier of micromeres. The
4d cell has divided into 1mR and 1mL
of processes, including the invagination of the endoderm to form the primitive gut, and
(the right and left mesendoderm cells,
the epiboly of the animal cap micromeres that multiply and “overgrow” the vegetal
respectively). The ectoderm undergoes
macromeres (Collier 1997; van den Biggelaar and Dictus 2004; Lyons and Henry 2014). epiboly from the animal pole and envel-
Eventually, the micromeres cover the entire embryo, leaving a small blastopore slit at ops the other cells of the embryo.
the vegetal pole (Figure 8.14A). The first through third quartet micromeres form an (B) Live cell labeling of Crepidula
epithelial animal cap that expands to cover vegetal endomesodermal precursors. As the embryos shows gastrulation occurring by
blastopore narrows, cells derived from 3a2 and 3b2 undergo epithelial-to-mesenchymal epiboly. Cells derived from the 3b micro-
mere are stained red. (A from Van den
transition and move into the archenteron. Posteriorly, cells derived from 3c 2 and 3d 2
Biggelaar and Dictus 2004; B from Lyons
undergo convergence and extension that involves zippering of cells and their intercala-
et al. 2015, courtesy of D. Lyons.)
tion across the ventral midline (Figure 8.14B ; Lyons et al. 2015).
During snail gastrulation, the mouth forms from cells all around the circumference
of the blastopore, and the anus arises from the 2d 2 cells, which are only very briefly
part of the
Gilbert blastopore Biology
Developmental lip. The11/e
anus forms at 12 days postfertilization, as a separate hole,
and not related to
Gil_DevBio11e_08.14 the blastopore. Thus, these animals are protostomes, forming their
02/12/15in the area where the blastopore is first seen.
mouths
WATCH DEVELOPMENT 8.4 The epiboly of the snail micromeres and the internaliza-
tion of macromeres is shown in two videos from the laboratory of Dr. Deirdre Lyons.
EMS cell
ABp
PO ABpr Hypodermis, neurons
Zygote
MS Muscle, pharynx, gonads (80 cells)
EMS
E Intestine (20 cells)
P1
C Muscle,
Figure 8.15 Development in the hypodermis, 2 neurons (47 cells)
nematode Caenorhabditis elegans is
rapid and results in an adult with exactly D Muscle (20 cells)
P2
959 somatic cells. Individual cell lineages P3
Z2
have been traced through the course of Germ line
P4
the animal’s development. (A) Differential (2 cells)
interference micrographs of the cleaving Z3
embryo. (1) The AB cell (left) and the P1
cell (right) are the result of the first asym-
metric division. Each will give rise to a dif-
ferent cell lineage. (2) The 4-cell embryo his students sought an organism wherein it might be possible to identify each gene
shows ABa, ABp, P2, and EMS cells. (3) involved in development as well as to trace the lineage of each and every cell (Brenner
Gastrulation is initiated by the movement 1974). Nematode roundworms seemed like a good group to start with because embry-
of E-derived cells toward the center of
ologists such as Richard Goldschmidt and Theodor Boveri had already shown that
the embryo. (B) Abbreviated cell lineage
chart. The germ line segregates into the
several nematode species have a relatively small number of chromosomes and a small
posterior portion of the most posterior (P) number of cells with invariant cell lineages.
cell. The first three cell divisions produce Brenner and his colleagues eventually settled on C. elegans, a small (1 mm long),
the AB, C, MS, and E lineages. The num- free-living (i.e., nonparasitic) soil nematode with relatively few cell types. C. elegans has
ber of derived cells (in parentheses) refers a rapid period of embryogenesis—about 16 hours—that it can accomplish in a petri dish
to the 558 cells present in the newly
Gilbert (Figure 8.15A). Moreover, its predominant adult form is hermaphroditic, with each
hatched larva.Developmental
Some of these continue
Biology to
11e, Sinauer Associates producing both eggs and sperm. These roundworms can reproduce either by
individual
divide to produce the 959 somatic cells Date 01-08-15
Gil_DevBio11e_08.15
of the adult. (A courtesy of D. G. Morton
self-fertilization or by cross-fertilization with the infrequently occurring males.
and K. Kemphues; B after Pines 1992, The body of an adult C. elegans hermaphrodite contains exactly 959 somatic cells, and
based on Sulston and Horvitz 1977 and the entire cell lineage has been traced through its transparent cuticle (Figure 8.15B;
Sulston et al. 1983.) Sulston and Horvitz 1977; Kimble and Hirsh 1979). It has what is called an invariant
cell lineage, which means that each cell gives rise to the same number and type of
cells in every embryo. This allows one to know which cells have the same precursor
cells. Thus, for each cell in the embryo, we can say where it came from (i.e., which cells
in earlier embryonic stages were its progenitors) and which tissues it will contribute to
forming. Furthermore, unlike vertebrate cell lineages, the C. elegans lineage is almost
entirely invariant from one individual to the next; there is little room for randomness
(Sulston et al. 1983). It also has a very compact genome. The C. elegans genome was the
Rapid Specification in Snails and Nematodes 267
first complete sequence ever obtained for a multicellular organism (C. elegans Sequenc- Developing Questions
ing Consortium 1999). Although it has about the same number of genes as humans
(18,000–20,000 genes, whereas Homo sapiens has 20,000–25,000), the nematode has only Humans have trillions of
cells, a regionalized brain,
about 3% the number of nucleotides in its genome (Hodgkin 1998, 2001).
and intricate limbs. The
C. elegans displays the rudiments of nearly all the major bodily systems (feeding, nematode has 959 cells and
nervous, reproductive, etc., although it has no skeleton), and it exhibits an aging phe- can fit under a fingernail.
notype before it dies. Neurobiologists celebrate its minimal nervous system (302 neu- However, humans and
rons), and each one of its 7,600 synapses (neuronal connections) has been identified C. elegans have nearly
(White et al. 1986; Seifert et al. 2006). In addition, C. elegans is particularly friendly the same number of
to molecular biologists. DNA injected into C. elegans cells is readily incorporated into genes, leaving Jonathan
Hodgkins, curator of the
their nuclei, and C. elegans can take up antisense RNA from its culture medium.
C. elegans gene map, to
ask “What does a worm
Cleavage and Axis Formation in C. elegans want with 20,000 genes?”
Any suggestions?
Fertilization in C. elegans is a not your typical sperm-meets-egg story. Most C. elegans
individuals are hermaphrodites, producing both sperm and eggs, and fertilization
occurs within a single adult individual. The egg becomes fertilized by rolling through
a region of the embryo (the spermatheca) containing mature sperm (Figure 8.16A,B).
The sperm are not the typical long-tailed, streamlined cells, but are small, round,
unflagellated cells that travel slowly by amoeboid motion. When a sperm fuses with
the egg cell membrane, polyspermy is prevented by the rapid synthesis of chitin (the
protein comprising the cuticle) by the newly fertilized egg (Johnston et al. 2010). The
fertilized egg undergoes early divisions and is extruded through the vulva.
(A)
Anus Actual size
Rectum (~1 mm)
Pharynx
Ovary Intestine Vulva
(B)
Vulva Spermatheca
Oviduct
Spermatheca Uterus
(sperm storage region)
Figure 8.16 Fertilization and
Ovary
Distal tip cell early cleavages in C. elegans.
Meiotic zone Mitotic zone
(A) Side view of adult hermaphro-
Sperm in spermatheca dite. Sperm are stored such that
a mature egg must pass through
the sperm on its way to the vulva.
(B) The germ cells undergo mitosis
near the distal tip of the gonad.
Oocytes As they move farther from the
Embryos distal tip, they enter meiosis. Early
meioses form sperm, which are
(C) stored in the spermatheca. Later
meioses form eggs, which are
Anterior Posterior fertilized as they roll through the
spermatheca. (C) Early develop-
ABp ABpr ment occurs as the egg is fertilized
ABar
C and moves toward the vulva. The
AB P1 ABa P2 ABal ABpl P lineage consists of stem cells
P3 that will eventually form the germ
EMS MS E cells. (After Pines 1992, based
Chorion on Sulston and Horvitz 1977 and
Sulston et al. 1983.)
268 Chapter 8
Figure 8.17 PAR proteins and the establishment of polarity. (A) When sperm enters the
egg, the egg nucleus is undergoing meiosis (left). The cortical cytoplasm (orange) contains
PAR-3, PAR-6, and PKC-3, and the internal cytoplasm contains PAR-2 and PAR-1 (purple
dots). (B,C) Microtubules of the sperm centrosome initiate contraction of the actin-based
cytoskeleton toward the future anterior side of the embryo. These sperm microtubules also
protect PAR-2 protein from phosphorylation, allowing it to enter the cortex along with its bind-
(G) ing partner, PAR-1. PAR-1 phosphorylates PAR-3, causing PAR-3 and its binding partners
PAR-6 and PKC-3 to leave the cortex. (D) The posterior of the cell becomes defined by PAR-2
and PAR-1, while the anterior of the cell becomes defined by PAR-6 and PAR-3. The meta-
phase plate is asymmetric, as the microtubules are closer to the posterior pole. (E) The meta-
phase plate separates the zygote into two cells, one having the anterior PARs and one the
posterior PARs. (F) In this dividing C. elegans zygote, PAR-2 protein is stained green; DNA is
stained blue. (G) In second division, the AB cell and the P1 cell divide perpendicularly (90° dif-
ferently from each other). (A–E after Bastock and St. Johnston 2011; F, photograph courtesy
of J. Ahrenger; G, photograph courtesy of J. White.)
Gilbert
Rapid Specification in Snails and Nematodes 269
partitioning), are uniformly distributed in the cortical cytoplasm. PKC-3 restricts PAR-1
and PAR-2 to the internal cytoplasm by phosphorylating them. The sperm centrosome
(microtubule-organizing center) contacts the cortical cytoplasm through its micro-
tubules and initiates cytoplasmic movements that push the male pronucleus to the
nearest end of the oblong oocyte. That end becomes the posterior pole (Goldstein and
Hird 1996). Moreover, these microtubules locally protect PAR-2 from phosphorylation,
thereby allowing PAR-2 (and its binding partner, PAR-1) into the cortex nearest the
centrosome. Once PAR-1 is in the cortical cytoplasm, it phosphorylates PAR-3, caus-
ing PAR-3 (and its binding partner, PKC-3) to leave the cortex. At the same time, the
sperm microtubules induce the contraction of the actin-myosin cytoskeleton toward
the anterior, thereby clearing PAR-3, PAR-6, and PKC-3 from the posterior of the 1-cell
embryo. During first cleavage, the metaphase plate is closer to the posterior, and the
fertilized egg is divided into two cells, one having the anterior PARs (PAR-6 and PAR-3)
and one having the posterior PARs (PAR-2 and PAR-1) (Goehring et al. 2011; Motegi et
al. 2011; Rose and Gönczy 2014).
SCIENTISTS SPEAK 8.1 Michael Barresi interviews Dr. Kenneth Kemphues, who
talks about his work on the PAR genes and RNAi.
interactions with neighboring cells (see Maduro 2006). The SKN-1, PAL-1, and PIE-1
proteins encode transcription factors that act intrinsically to determine the fates of cells
derived from the four P1-derived somatic founder cells (MS, E, C, and D).
The SKN-1 protein is a maternally expressed transcription factor that controls the fate
of the EMS blastomere, the cell that generates the posterior pharynx. After first cleav-
age, only the posterior blastomere—P1—has the ability to produce pharyngeal cells
when isolated. After P1 divides, only EMS is able to generate pharyngeal muscle cells in
isolation (Priess and Thomson 1987). Similarly, when the EMS cell divides, only one of
its progeny, MS, has the intrinsic ability to generate pharyngeal tissue. These findings
suggest that pharyngeal cell fate may be determined autonomously, by maternal factors
residing in the cytoplasm that are parceled out to these particular cells.
Bowerman and co-workers (1992a,b, 1993) found maternal effect mutants lacking
pharyngeal cells and were able to isolate a mutation in the skn-1 (skin excess) gene.
Embryos from homozygous skn-1-deficient mothers lack both pharyngeal mesoderm
and endoderm derivatives of EMS (Figure 8.18). Instead of making the normal intes-
tinal and pharyngeal structures, these embryos seem to make extra hypodermal (skin)
and body wall tissue where their intestine and pharynx should be. In other words,
the EMS blastomere appears to be respecified as C. Only those cells destined to form
pharynx or intestine are affected by this mutation. The SKN-1 protein is a transcription
factor that initiates the activation of those genes responsible for forming the pharynx
and intestine (Blackwell et al. 1994; Maduro et al. 2001).
Another transcription factor, PAL-1, is also required for the differentiation of the P1
lineage. PAL-1 activity is needed for the normal development of the somatic (but not
the germline) descendants of the P2 blastomere, where it specifies muscle production.
Embryos lacking PAL-1 have no somatic cell types derived from the C and D stem
cells (Hunter and Kenyon 1996). PAL-1 is regulated by the MEX-3 protein, an RNA-
binding protein that appears to inhibit the translation of pal-1 mRNA. Wherever MEX-3
is expressed, PAL-1 is absent. Thus, in mex-3-deficient mutants, PAL-1 is seen in every
blastomere. SKN-1 also inhibits PAL-1 (thereby preventing it from becoming active
in the EMS cell). But what keeps pal-1 from functioning in the prospective germ cells
and turning them into muscles? In the germ line, PAL-1 synthesis is prevented by the
Sperm embryos, both EMS daughter cells become E cells (Lin et al. 1995; Park et al. 2004).
Thus, the Wnt pathway is seen to be critical in establishing the anterior-posterior axis
of C. elegans. Remarkably, as we will see, Wnt signaling appears to specify the A-P axis
throughout the animal kingdom.
The P2 cell is also critical in giving the signal that distinguishes ABp from its sister,
AB ? P1 ABa (see Figure 8.21). ABa gives rise to neurons, hypodermis, and the anterior pharynx
cells, while ABp makes only neurons and hypodermal cells. However, if one experi-
ABp P2 mentally reverses the positions of these two cells, their fates are similarly reversed and a
APX-1
GLP-1 MOM-2 normal embryo forms. In other words, ABa and ABp are equivalent cells whose fates are
determined by their positions in the embryo (Priess and Thomson 1987). Transplanta-
MOM-5 tion and genetic studies have shown that ABp becomes different from ABa through its
ABa EMS
interaction with the P2 cell. In an unperturbed embryo, both ABa and ABp contact the
EMS blastomere, but only ABp contacts the P2 cell. If the P2 cell is killed at the early
Dorsal fate
4-cell stage, the ABp cell does not generate its normal complement of cells (Bowerman
et al. 1992a,b). Contact between ABp and P2 is essential for the specification of ABp
cell fates, and the ABa cell can be made into an ABp-type cell if it is forced into contact
Ventral fate with P2 (Hutter and Schnabel 1994; Mello et al. 1994).
This interaction is mediated by the GLP-1 protein on the ABp cell and the APX-1
MS E (anterior pharynx excess) protein on the P2 blastomere. In embryos whose mothers have
Mesoderm Endoderm mutant glp-1, ABp is transformed into an ABa cell (Hutter and Schnabel 1994; Mello et
al. 1994). The GLP-1 protein is a member of a widely conserved family called the Notch
Figure 8.21 Cell-cell signaling in the proteins, which serve as cell membrane receptors in many cell-cell interactions; it is seen
4-cell embryo of C. elegans. The P2 cell on both the ABa and ABp cells (Evans et al. 1994).3 One of the most important ligands for
produces two signals: (1) the juxtacrine
Notch proteins such as GLP-1 is the cell surface protein Delta. In C. elegans, the Delta-
protein APX-1 (a Delta homologue), which
is bound by GLP-1 (Notch) on the ABp like protein is APX-1, and it is found on the P2 cell (Mango et al. 1994a; Mello et al. 1994).
cell, and (2) the paracrine protein MOM-2 This APX-1 signal breaks the symmetry between ABa and ABp, since it stimulates the
(Wnt), which is bound by the MOM-5 GLP-1 protein solely on the AB descendant that it touches—namely, the ABp blastomere.
(Frizzled) protein on the EMS cell. (After In doing this, the P2 cell establishes the dorsal-ventral axis of C. elegans and confers on
Han 1998.) the ABp blastomere a fate different from that of its sister cell.
Gastrulation in C. elegans
Gastrulation in C. elegans starts extremely early, just after the generation of the P4 cell
in the 26-cell embryo (Figure 8.22 ; Skiba and Schierenberg 1992). At this time, the
two daughters of the E cell (Ea and Ep) migrate from the ventral side into the center of
the embryo. There they divide to form a gut consisting of 20 cells. There is a very small
3
GLP-1 protein is localized in the ABa and ABp blastomeres, but the maternally encoded glp-1
mRNA is found throughout the embryo. Evans and colleagues (1994) have postulated that
there might be some translational determinant in the AB blastomere that enables the glp-1
message to be translated in its descendants. The glp-1 gene is also active in regulating post-
embryonic cell-cell interactions. It is used later by the distal tip cell of the gonad to control the
number of germ cells entering meiosis; hence the name GLP, for “germ line proliferation.”
Rapid Specification in Snails and Nematodes 273
and transient blastocoel prior to the movement of the Ea and (A) (B)
Ep cells, and their inward migration creates a tiny blastopore.
The next cell to migrate through this blastopore is the P4 cell, C AB
the precursor of the germ cells. It migrates to a position beneath AB E
D C
the gut primordium. The mesodermal cells move in next: the
MS E P4 D D
descendants of the MS cell migrate inward from the anterior MS
side of the blastopore, and the C- and D-derived muscle precur-
sors enter from the posterior side. These cells flank the gut tube
P4
on the left and right sides (Schierenberg 1997). Finally, about 6 (C) (D)
hours after fertilization, the AB-derived cells that contribute to
the pharynx are brought inside, while the hypoblast cells (pre- MS D C
cursors of the hypodermal skin cells) move ventrally by epiboly,
eventually closing the blastopore. The two sides of the hypoder- AB AB/MS E C
mis are sealed by E-cadherin on the tips of the leading cells that MS C
meet at the ventral midline (Raich et al. 1999). D
During the next 6 hours, the cells move and develop into P4
organs, while the ball-shaped embryo stretches out to become
a worm with 556 somatic cells and 2 germline stem cells (see Figure 8.22 Gastrulation in C. elegans. (A) Positions of founder
Priess and Hirsh 1986; Schierenberg 1997). There is evidence cells and their descendants at the 26-cell stage, at the start of gas-
(Schnabel et al. 2006) that, although these gastrulation move- trulation. (B) 102-cell stage, after the migration of the E, P4, and D
ments provide a good first approximation of the final form, an descendants. (C) Positions of the cells near the end of gastrulation.
additional “cell focusing” is used to move cells into functional The dotted and dashed lines represent regions of the hypodermis
arrangements. Here cells of the same fate sort out along the contributed by AB and C, respectively. (D) Early gastrulation, as the
two E cells start moving inward. (After Schierenberg 1997; photo-
anterior-posterior axis. Other modeling takes place as well; an
graph courtesy of E. Schierenberg.)
additional 115 cells undergo apoptosis (programmed cell death).
After four molts, the worm is a sexually mature, hermaphroditic
adult, containing exactly 959 somatic cells as well as numerous
sperm and eggs.
WATCH DEVELOPMENT 8.6 Video from the Goldstein laboratory at the University of
North Carolina beautifully depicts C. elegans gastrulation.
One characteristic that distinguishes C. elegans development from that of most other
well-studied organisms is the prevalence of cell fusion. During C. elegans gastrulation,
about one-third of all the cells fuse together to form syncytial cells containing many
nuclei. The 186 cells that comprise the hypodermis (skin) of the nematode fuse into
8 syncytial cells, and cell fusion is also seen in the vulva, uterus, and pharynx. The
functions of these fusion events can be determined by observing mutations that pre-
vent syncytia from forming (Shemer and Podbilewicz 2000, 2003). It seems that fusion
prevents individual cells from migrating beyond their normal borders. In the vulva (see
Chapter 2), fusion prevents hypodermis cells from adopting a vulval fate and making
an ectopic (and nonfunctional) vulva.
The C. elegans research program integrates genetics, cell biology,Gilbert
embryology, and
even ecology to provide an understanding of the networks that govern Developmental Biology 11e, Sinauer Associates
cell differen-
tiation and morphogenesis. In addition to providing some remarkable Gil_DevBio11e_08.22
insights into Date 01-08-15
how gene expression can change during development, studies of C. elegans have also
humbled us by demonstrating how complex these networks are. Even in an organism
as “simple” as C. elegans, with only a few genes and cell types, the right side of the body
is made in a different manner from the left. The identification of the genes mentioned
above is just the beginning of our effort to understand the complex interacting systems
of development.
WEb Topic 8.3 Heterochronic genes and the control of larval stages
C. elegans undergoes four larval stages before becoming an adult. These stages are
regulated by microRNAs that control the translation of particular messages.
274 Chapter 8
8 Snapshot Summary
Early Development in Snails and Nematodes
1. Body axes are established in different ways in different 5. The polar lobe of certain mollusks contains the mor-
species. In some species the axes are established at phogenetic determinants for mesoderm and endoderm.
fertilization through determinants in the egg cytoplasm. These determinants enter the D blastomere.
In others, such as nematodes and snails, the axes are 6. The soil nematode Caenorhabditis elegans was chosen
established by cell interactions later in development. as a model organism because it has a small number
2. Both snails and nematodes have holoblastic cleavage. In of cells, has a small genome, is easily bred and main-
snails, cleavage is spiral; in nematodes, it is rotational. tained, has a short life span, can be genetically manipu-
3. In snails and C. elegans, gastrulation begins when there lated, and has a cuticle through which one can see cell
are relatively few cells. The blastopore becomes the movements.
mouth (the protostome mode of gastrulation). 7. In the early divisions of the C. elegans zygote, one
4. Spiral cleavage in snails results in stereoblastulae (i.e., daughter cell becomes a founder cell (producing differen-
blastulae with no blastocoels). The direction of the cleav- tiated descendants) and the other becomes a stem cell
age spirals is regulated by a factor encoded by the (producing other founder cells and the germ line).
mother and placed in the oocyte. Spiral cleavage can be 8. Blastomere identity in C. elegans is regulated by both
modified by evolution, and adaptations of spiral cleav- autonomous and conditional specification.
age have allowed some mollusks to survive in otherwise
harsh environments.
Rapid Specification in Snails and Nematodes 275
Further Reading
Crampton, H. E. and E. B. Wilson. 1896. Experimental studies Resnick T. D., K. A. McCulloch and A. E. Rougvie. 2010.
on gastropod development. Arch. Entw. Mech. 3: 1–18. miRNAs give worms the time of their lives: Small RNAs
Davison, A. and 15 others. 2016. Formin is associated with and temporal control in Caenorhabditis elegans. Dev. Dyn.
left-right asymmetry in the pond snail and frog. Curr. Biol. 26: 239:1477–1489.
654–660. Shibazaki, Y., M. Shimizu and R. Kuroda. 2004. Body hand-
Henry, J. Q. 2014. Spiralian model systems. Int. J. Dev. Biol. 58: edness is directed by genetically determined cytoskeletal
389-401. dynamics in the early embryo. Curr. Biol. 14: 1462–1467.
Hoso, M., Y. Kameda, S.-P. Wu, T. Asami, M. Kato and M. Sturtevant, A. H. 1923. Inheritance of direction of coiling in
Hori. 2010. A speciation gene for left–right reversal in snails Limnaea. Science, New Series, 58: 269-270.
results in anti-predator adaptation. Nature Communications 1: Sulston, J. E., J. Schierenberg, J. White and N. Thomson. 1983.
133. doi:10.1038/ncomms1133. The embryonic cell lineage of the nematode Caenorhabditis
Lambert, J. D. 2010. Developmental patterns in spiralian elegans. Dev. Biol. 100: 64–119.
embryos. Curr. Biol. 20: 272–277. Wilson, E. B. 1898. Cell lineage and ancestral reminiscence. In
Biological Lectures from the Marine Biological Laboratories, Woods
Hole, Massachusetts, pp. 21–42. Ginn, Boston.
Go to www.devbio.com . ..
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
9
The Punchline
The development of the fruit fly is extremely rapid, and its body axes are specified
by factors in the maternal cytoplasm even before the sperm enters the egg. The
anterior-posterior axis is specified by proteins and mRNAs made in maternal nurse
cells and transported into the oocyte, such that each region of the egg contains
different ratios of anterior- and posterior-promoting proteins. Eventually, gradients
of these proteins control a set of transcription factors—the homeotic proteins—that
specify the structures to be formed by each segment of the adult fly. The dorsal-
ventral axis is also initiated in the egg, which sends a signal to its surrounding
follicle cells. The follicle cells respond by initiating a molecular cascade that leads
both to cell-type specification and to gastrulation. Specific organs form at the
intersection of the anterior-posterior axis and the dorsal-ventral axis.
278 Chapter 9
(A)
enough to observe microscopically. It was not until the techniques of molecular biol-
ogy allowed researchers to identify and manipulate the insect’s genes and RNA that
its genetics could be related to its development. And when that happened, a revolution
occurred in the field of biology. This revolution is continuing, in large part because of
the availability of the complete Drosophila genome sequence and our ability to generate
transgenic flies at high frequency (Pfeiffer et al. 2009; del Valle Rodríguez et al. 2011).
Researchers are now able to identify developmental interactions taking place in very
small regions of the embryo, to identify enhancers and their transcription factors, and
to mathematically model the interactions to a remarkable degree of precision (Henge-
Gilbert Developmental Biology 11/e
Gil_DevBio11e_09.01 nius et al. 2014).
01/19/15
Early Drosophila Development
We have already discussed the specification of early embryonic cells by cytoplasmic
determinants stored in the oocyte. The cell membranes that form during cleavage
establish the region of cytoplasm incorporated into each new blastomere, and the mor-
phogenetic determinants in the incorporated cytoplasm then direct differential gene
expression in each cell. But in Drosophila development, cell membranes do not form
until after the thirteenth nuclear division. Prior to this time, the dividing nuclei all
VADE MECUM share a common cytoplasm and material can diffuse throughout the whole embryo.
The specification of cell types along the anterior-posterior and dorsal-ventral axes is
The fruit fly segment has remark-
accomplished by the interactions of components within the single multinucleated cell.
able time-lapse sequences,
Moreover, these axial differences are initiated at an earlier developmental stage by the
including footage of cleavage
position of the egg within the mother’s egg chamber. Whereas the sperm entry site may
and gastrulation. This segment
fix the axes in nematodes and tunicates, the fly’s anterior-posterior and dorsal-ventral
also provides access to the fly
life cycle.
axes are specified by interactions between the egg and its surrounding follicle cells
prior to fertilization.
Watch Development 9.1 The website “The Interactive Fly” features movies illustrat-
ing all aspects of Drosophila development.
The Genetics of Axis Specification in Drosophila 279
Fertilization
Drosophila fertilization is a remarkable series of events and is quite different from fer-
tilizations we’ve described previously.
• The sperm enters an egg that is already activated. Egg activation in Drosophila is
accomplished at ovulation, a few minutes before fertilization begins. As the Dro-
sophila oocyte squeezes through a narrow orifice, calcium channels open and
Ca2+ flows in. The oocyte nucleus then resumes its meiotic divisions and the
cytoplasmic mRNAs become translated without fertilization (Mahowald et al.
1983; Fitch and Wakimoto 1998; Heifetz et al. 2001; Horner and Wolfner 2008).
• There is only one site where the sperm can enter the egg. This is the micropyle, a
tunnel in the chorion (eggshell) located at the future dorsal anterior region of
the embryo. The micropyle allows sperm to pass through it one at a time and
probably prevents polyspermy in Drosophila. There are no cortical granules to
block polyspermy, although cortical changes are seen.
• By the time the sperm enters the egg, the egg already has begun to specify
the body axes; thus the sperm enters an egg that is already organizing itself as
an embryo.
• The sperm and egg cell membranes do not fuse. Rather, the sperm enters into the egg
intact. The DNA of the male and female pronuclei replicate before the pronuclei
have fused, and after the pronuclei fuse, the maternal and paternal chromo-
somes remain separate until the end of the first mitosis (Loppin et al. 2015).
Cleavage
Most insect eggs undergo superficial cleavage, wherein a large mass of centrally
located yolk confines cleavage to the cytoplasmic rim of the egg (see Figure 1.5). One
of the fascinating features of this cleavage pattern is that cells do not form until after
the nuclei have divided several times. In the Drosophila egg, karyokinesis (nuclear divi-
sion) occurs without cytokinesis (cell division) so as to create a syncytium, a single cell
with many nuclei residing in a common cytoplasm (Figure 9.2). The zygote nucleus
undergoes several nuclear divisions within the central portion of the egg; 256 nuclei
are produced by a series of eight nuclear divisions averaging 8 minutes each (Figure
9.3A,B). This rapid rate of division is accomplished by repeated rounds of alternating S
(DNA replication) and M (mitosis) phases in the absence of the gap (G) phases of the
cell cycle. During the ninth division cycle, approximately five nuclei reach the surface
of the posterior pole of the embryo. These nuclei become enclosed by cell membranes
and generate the pole cells that give rise to the gametes of the adult. At cycle 10, the
other nuclei migrate to the cortex (periphery) of the egg and the mitoses continue, albeit
at a progressively slower rate (Figure 9.3C,D; Foe et al. 2000). During these stages of
nuclear division, the embryo is called a syncytial blastoderm, since no cell membranes
exist other than that of the egg itself.
Although Developmental
Gilbertthe Biology
nuclei divide within11/e
a common cytoplasm, the cytoplasm itself is far
Gil_DevBio11e_09.03
from uniform.
01/08/15 Karr and Alberts (1986) have shown that each nucleus within the syn-
cytial blastoderm is contained within its own little territory of cytoskeletal proteins.
When the nuclei reach the periphery of the egg during the tenth cleavage cycle, each
nucleus becomes surrounded by microtubules and microfilaments. The nuclei and their
associated cytoplasmic islands are called energids. Following division cycle 13, the
cell membrane (which had covered the egg) folds inward between the nuclei, eventu-
ally partitioning off each energid into a single cell. This process creates the cellular
blastoderm , in which all the cells are arranged in a single-layered jacket around the
yolky core of the egg (Turner and Mahowald 1977; Foe and Alberts 1983; Mavrakis et
al. 2009).
As with all cell formation, the formation of the cellular blastoderm involves a deli-
cate interplay between microtubules and microfilaments (Figure 9.4). The membrane
movements, nuclear elongation, and actin polymerization all appear to be coordinated
by the microtubules (Riparbelli et al. 2007). The first phase of blastoderm cellulariza-
tion is characterized by the invagination of cell membranes between the nuclei to form
furrow canals. This process can be inhibited by drugs that block microtubules. After
the furrow canals have passed the level of the nuclei, the second phase of cellular-
ization occurs. The rate of invagination increases and the actin-membrane complex
The Genetics of Axis Specification in Drosophila 281
(A) (B)
(C)
Centrosomes Figure 9.4 Formation of the cellular blastoderm in Drosophila. Nucle-
ar shape change and cellularization are coordinated through the cyto-
Actin skeleton. (A) Cellularization and nuclear shape change shown by staining
the embryo for microtubules (green), microfilaments (blue), and nuclei
(red). The red stain in the nuclei is due to the presence of the Kugelk-
ern protein, one of the earliest proteins made from the zygotic nuclei.
Nucleus
It is essential for nuclear elongation. (B) This embryo was treated with
Microtubules
nocadozole to disrupt microtubules. The nuclei fail to elongate, and cellu-
larization is prevented. (C) Diagrammatic representation of cell formation
and nuclear elongation. (After Brandt et al. 2006; photographs courtesy
of J. Grosshans and A. Brandt.)
Actin
10 min 55 min
Cellularization
begins to constrict at what will be the basal end of the cell (Foe et al. 1993; Schejter and
Wieschaus 1993; Mazumdar and Mazumdar 2002). In Drosophila, the cellular blasto-
derm consists of approximately 6000 cells and is formed within 4 hours of fertilization.
Ventral Ventral
furrow furrow
Pole cells in
posterior
midgut
invagination
Pole cells
T3
A5
A1
A4
Amnioserosa Abdomen A8
A2
A3
Germ band
Anterior segment
Figure 9.5 Gastrulation in Drosophila. The anterior of each gastrulating embryo (G)
points upward in this series of scanning electron micrographs. (A) Ventral furrow begin-
ning to form as cells flanking the ventral midline invaginate. (B) Closing of ventral fur-
row, with mesodermal cells placed internally and surface ectoderm flanking the ventral
midline. (C) Dorsal view of a slightly older embryo, showing the pole cells and posterior
endoderm sinking into the embryo. (D) Schematic representation showing dorsolat-
eral view of an embryo at fullest germ band extension, just prior to segmentation. The
cephalic furrow separates the future head region (procephalon) from the germ band,
which will form the thorax and abdomen. (E) Lateral view, showing fullest extension of
the germ band and the beginnings of segmentation. Subtle indentations mark the incipi-
ent segments along the germ band. Ma, Mx, and Lb correspond to the mandibular,
maxillary, and labial head segments; T1–T3 are the thoracic segments; and A1–A8 are
the abdominal segments. (F) Germ band reversing direction. The true segments are
now visible, as well as the other territories of the dorsal head, such as the clypeolabrum,
procephalic region, optic ridge, and dorsal ridge. (G) Newly hatched first instar larva.
(Photographs courtesy of F. R. Turner; D after Campos-Ortega and Hartenstein 1985.)
Gastrulation
The general body plan of Drosophila is the same in the embryo, the larva, and the adult,
each of which has a distinct head end and a distinct tail end, between which are repeat-
ing segmental units. Three of these segments form the thorax, while another eight
segments form the abdomen. Each segment of the adult fly has its own identity. The
first thoracic segment, for example, has only legs; the second thoracic segment has legs
and wings; and the third thoracic segment has legs and halteres (balancing organs).
Gastrulation begins shortly after the mid-blastula transition. The first movements
of Drosophila gastrulation segregate the presumptive mesoderm, endoderm, and ecto-
derm. The prospective mesoderm—about 1000 cells constituting the ventral midline of
the embryo—folds inward to produce the ventral furrow (Figure 9.5A). This furrow
eventually pinches off from the surface to become a ventral tube within the embryo.
The prospective endoderm invaginates to form two pockets at the anterior and posterior
ends of the ventral furrow. The pole cells are internalized along with the endoderm
(Figure 9.5B,C ). At this time, the embryo bends to form the cephalic furrow.
The ectodermal cells on the surface and the mesoderm undergo convergence and exten-
sion, migrating toward the ventral midline to form the germ band, a collection of cells
along the ventral midline that includes all the cells that will form the trunk of the embryo.
The germ band extends posteriorly and, perhaps because of the egg case, wraps around the
top (dorsal) surface of the embryo (Figure 9.5D). Thus, at the end of germ band forma-
tion, the cells destined to form the most posterior larval structures are located immediately
behind the future head region (Figure 9.5E). At this time,
the body segments begin to appear, dividing the ectoderm
(A) Anterior
and mesoderm. The germ band then retracts, placing the
presumptive posterior segments at the posterior tip of the
embryo (Figure 9.5F). At the dorsal surface, the two sides Head
of the epidermis are brought together in a process called
dorsal closure. The amnioserosa (the extraembryonic layer
Prothorax T1
that surrounds the embryo), which had been the most dorsal T2
structure, interacts with the epidermal cells to stimulate their T1 Mesothorax
T3
migration (reviewed in Panfilio 2008; Heisenberg 2009). T2
Metathorax A1
While the germ band is in its extended position, sev- T3 A2
A1
eral key morphogenetic processes occur: organogenesis,
Dorsal A2
Ventral A3
segmentation ( Figure 9.6A ), and segregation of the A4
A3
imaginal discs.1 The nervous system forms from two A5 A6
A4
regions of ventral ectoderm. Neuroblasts (i.e., the neural Abdominal
A5
segments A7 A8
A6
1
Imaginal discs are cells set aside to produce the adult struc- A7 A8
tures. Imaginal disc differentiation will be discussed as a part
of metamorphosis in Chapter 21.
Posterior
(B)
Figure 9.6 Axis formation in Drosophila. (A) Comparison of larval
(left) and adult (right) segmentation. In the adult, the three thoracic seg-
ments can be distinguished by their appendages: T1 (prothorax) has
legs only; T2 (mesothorax) has wings and legs; T3 (metathorax) has
halteres (not visible) and legs. (B) During gastrulation, the mesodermal
cells in the most ventral region enter the embryo, and the neurogenic
cells expressing Short gastrulation (Sog) become the ventralmost cells
of the embryo. Sog, blue; ventral nervous system defective, green;
intermediate neuroblast defective, red. (B courtesy of E. Bier.)
284 Chapter 9
progenitor cells) differentiate from this neurogenic ectoderm and migrate inward
within each segment (and also from the nonsegmented region of the head ectoderm).
Therefore, in insects such as Drosophila, the nervous system is located ventrally rather
than being derived from a dorsal neural tube as it is in vertebrates (Figure 9.6B; see
also Figure 9.29).
WATCH DEVELOPMENT 9.3 Watch a video showing external and internal develop-
ment in Drosophila.
(A) (B)
Cytoplasmic polarity
(maternal effect)
Gap genes
(C)
Pair-rule genes
broad (about three segments wide), partially overlapping domains. Gap genes encode
transcription factors, and differing combinations and concentrations of gap gene proteins
regulate the transcription of pair-rule genes, which divide the embryo into periodic units.
The transcription of the different pair-rule genes results in a striped pattern of seven
transverse bands perpendicular to the anterior-posterior axis. The transcription factors
encoded by the pair-rule genes activate the segment polarity genes, whose mRNA and
protein products divide the embryo into 14-segment-wide units, establishing the peri-
odicity of the embryo. At the same time, the protein products of the gap, pair-rule, and
segment polarity genes interact to regulate another class of genes, the homeotic selector
genes, whose transcription determines the developmental fate of each segment.
same gene, gurken . The gurken message appears to be synthesized in the nurse cells,
but it is transported into the oocyte. Here it becomes localized between the oocyte
nucleus and the cell membrane, and it is translated into Gurken protein (Cáceres and
Nilson 2005). At this time the oocyte nucleus is very near what will become the poste-
rior tip of the egg chamber, and the Gurken signal is received by the follicle cells at that
position through a receptor protein encoded by the torpedo gene2 (Figure 9.8A). This
signal results in the “posteriorization” of these follicle cells (Figure 9.8B). The poste-
rior follicle cells send a signal back into the oocyte. This signal, a lipid kinase, recruits
the Par-1 protein to the posterior edge of the oocyte cytoplasm (Figure 9.8C; Doer-
flinger et al. 2006; Gervais et al. 2008). Par-1 protein organizes microtubules specifically
with their minus (cap) and plus (growing) ends at the anterior and posterior ends of the
oocyte, respectively (Gonzalez-Reyes et al. 1995; Roth et al. 1995; Januschke et al. 2006).
The orientation of the microtubules is critical, because different microtubule motor
proteins will transport their mRNA or protein cargoes in different directions. The motor
protein kinesin, for instance, is an ATPase that will use the energy of ATP to trans-
port material to the plus end of the microtubule. Dynein, however, is a “minus-directed”
motor protein that transports its cargo in the opposite direction. One of the messages
transported by kinesin along the microtubules to the posterior end of the oocyte is oskar
mRNA (Zimyanin et al. 2008). The oskar mRNA is not able to be translated until it reaches
the posterior cortex, at which time it generates the Oskar protein. Oskar recruits more
Par-1 protein, thereby stabilizing the microtubule orientation and allowing more material
to be recruited to the posterior pole of the oocyte (Doerflinger et al. 2006; Zimyanin et
al. 2007). The posterior pole will thereby have its own distinctive cytoplasm, called pole
plasm, which contains the determinants for producing the abdomen and the germ cells.
This cytoskeletal rearrangement in the oocyte is accompanied by an increase in
oocyte volume, owing to transfer of cytoplasmic components from the nurse cells.
These components include maternal messengers such as the bicoid and nanos mRNAs.
These mRNAs are carried by motor proteins along the microtubules to the anterior and
posterior ends of the oocyte, respectively (Figure 9.8D–F ). As we will soon see, the
protein products encoded by bicoid and nanos are critical for establishing the anterior-
posterior polarity of the embryo.
2
Gurken protein is a member of the EGF (epidermal growth factor) family, and torpedo encodes
a homologue of the vertebrate EGF receptor (Price et al. 1989; Neuman-Silberberg and Schüp-
bach 1993).
The Genetics of Axis Specification in Drosophila 287
(A)
Nucleus
Anterior Posterior Torpedo
Nurse cells (Gurken
Oocyte receptor)
Terminal
follicle
cells
Uncommitted Gurken
polar follicle cells protein
(B) (C)
Protein kinase A
Anterior
follicle cells
Posterior
follicle cells
(D)
Anterior border cells bicoid mRNA
Polarized
microtubules
_
_ +
+
_ +
+
_ +
Figure 9.8 The anterior-posterior axis is specified during
_ oogenesis. (A) The oocyte moves into the posterior region of the
oskar mRNA in egg chamber, while nurse cells fill the anterior portion. The oocyte
association with nucleus moves toward the terminal follicle cells and synthesizes
kinesin I Gurken protein (green). The terminal follicle cells express Torpedo,
the receptor for Gurken. (B) When Gurken binds to Torpedo, the
terminal follicle cells differentiate into posterior follicle cells and
(E) Nucleus Gurken
synthesize a molecule that activates protein kinase A in the egg.
Dorsal Protein kinase A orients the microtubules such that the growing
(plus) ends are at the posterior (depicted in panel D). (C) Par-1
protein (green) localizes to the cortical cytoplasm of nurse cells
and to the posterior pole of the oocyte. (The Staufen protein
marking the posterior pole is labeled red; the red and green
nanos mRNA in signals combine to fluoresce yellow.) (D) bicoid mRNA binds to
association with dynein, a “minus-directed” motor protein associated with the non-
Oskar protein
growing end of microtubules; dynein moves the bicoid mRNA to
Ventral
the anterior end of the egg. oskar mRNA becomes complexed to
bicoid mRNA kinesin I, a “plus-directed” motor protein that moves it toward the
growing end of the microtubules at the posterior region, where
(F) Oskar protein can bind nanos mRNA. (E) The nucleus (with its
associated Gurken protein) migrates along the microtubules to the
dorsal anterior region of the oocyte and induces the adjacent fol-
licle cells to become the dorsal follicle cells. (F) Photomicrograph
of bicoid mRNA (stained black) passing from the nurse cells and
localizing to the anterior end of the oocyte during oogenesis. (C
courtesy of H. Doerflinger; F from Stephanson et al. 1988, cour-
Anterior Posterior tesy of the authors.)
Table 9.1 Maternal effect genes that establish the anterior-posterior polarity of the Drosophila
embryo
Gene Mutant phenotype Proposed function
anterior group
bicoid (bcd) Head and thorax deleted, replaced by inverted Graded anterior morphogen; contains homeodomain;
telson represses caudal mRNA
exuperantia (exu) Anterior head structures deleted Anchors bicoid mRNA
swallow (swa) Anterior head structures deleted Anchors bicoid mRNA
posterior group
nanos (nos) No abdomen Posterior morphogen; represses hunchback mRNA
tudor (tud) No abdomen, no pole cells Localization of nanos mRNA
oskar (osk) No abdomen, no pole cells Localization of nanos mRNA
vasa (vas) No abdomen, no pole cells; oogenesis defective Localization of nanos mRNA
valois (val) No abdomen, no pole cells; cellularization Stabilizes Nanos localization complex
defective
pumilio (pum) No abdomen Helps Nanos protein bind hunchback message
caudal (cad) No abdomen Activates posterior terminal genes
terminal group
torsolike No termini Possible morphogen for termini
trunk (trk) No termini Transmits Torsolike signal to Torso
fs(1)Nasrat[fs(1)N] No termini; collapsed eggs Transmits Torsolike signal to Torso
fs(1)polehole[fs(1)ph] No termini; collapsed eggs Transmits Torsolike signal to Torso
bicoid
mRNA
A H T Ab Te Te Ab Te A H T Ab Te Te T H T Ab Te A H T Ab T H A
Head Tail Tail Tail Head Tail Tail Head Tail Head Tail Head
Wild-type bicoid-deficient Normal “Head” in Two “heads”
phenotype phenotype: two tails development middle
bicoid mrna localization in the anterior pole of the oocyte The 3′ untrans-
lated region (3′UTR) of bicoid mRNA contains sequences that are critical for its localiza-
tion at the anterior pole (Figure 9.11; Ferrandon et al. 1997; Macdonald and Kerr 1998;
Spirov et al. 2009). These sequences interact with the Exuperantia and Swallow proteins
while the messages are still in the nurse cells of the egg chamber (Schnorrer et al. 2000).
Experiments in whichBiology
Gilbert Developmental fluorescently
11/e labeled bicoid mRNA was microinjected into living
egg chambers of
Gil_DevBio11e_09.11wild-type or mutant flies indicate that Exuperantia must be present in
01/08/15
the nurse cells for anterior localization. But Exuperantia alone is not sufficient to bring
the bicoid message into the oocyte (Cha et al. 2001; Reichmann and Ephrussi 2005). The
bicoid-Exuperantia complex is transported out of the nurse cells and into the oocyte via
microtubules, seeming to ride on a kinesin ATPase (Arn et al. 2003). Once inside the
oocyte, bicoid mRNA attaches to dynein proteins that are maintained at the microtubule
organizing center (the slower growing “minus end”) at the anterior of the oocyte (see
Figure 9.8; Cha et al. 2001). About 90% of the bicoid mRNA is localized to the anterior
20% of the embryo, with its concentration peaking at 7% egg length (Little et al. 2011).
290 Chapter 9
transported to the oocyte, where they are distributed ubiquitously throughout the syn-
cytial blastoderm. But if they are not localized, how do they mediate their localized
patterning activities? It turns out that translation of the hb and cad mRNAs is repressed
by the diffusion gradients of Nanos and Bicoid proteins, respectively.
In the anterior region, Bicoid protein prevents translation of the caudal message.
Bicoid binds to a specific region of caudal’s 3′UTR. Here, it binds Bin3, a protein that
stabilizes an inhibitory complex that prevents the binding of the mRNA 5′ cap to the
ribosome. By recruiting this translational inhibitor, Bicoid prevents translation of cau- Anterior Posterior
dal in the anterior of the embryo (Figure 9.12 ; Rivera-Pomar et al. 1996; Cho et al.
Figure 9.12 Caudal protein gradient
2006; Signh et al. 2011). This suppression is necessary; if Caudal protein is made in of a wild-type Drosophila embryo at the
the embryo’s anterior, the head and thorax do not form properly. Caudal activates the syncytial blastoderm stage. Anterior is
genes responsible for the invagination of the hindgut and thus is critical in specifying to the left. The protein (stained darkly)
the posterior domains of the embryo. enters the nuclei and helps specify pos-
In the posterior region, Nanos protein prevents translation of the hunchback message. terior fates. Compare with the comple-
mentary gradient of Bicoid protein in
Nanos in the posterior of the embryo forms a complex with several other ubiquitous
Figure 9.22. (From Macdonald and Struhl
proteins, including Pumilio and Brat. This complex binds to the 3′ UTR of the hunchback
1986, courtesy of G. Struhl.)
message, where it recruits d4EHP and prevents the hunchback message from attaching
to ribosomes (Tautz 1988; Cho et al. 2006).
The result of these interactions is the creation of four maternal protein gradients in
the early embryo (Figure 9.13):
• An anterior-to-posterior gradient of Bicoid protein
• An anterior-to-posterior gradient of Hunchback protein
• A posterior-to-anterior gradient of Nanos protein
• A posterior-to-anterior gradient of Caudal protein
The stage is now set for the activation of zygotic genes in the insect’s nuclei, which
were busy dividing while these four protein gradients were being established.
Scientists Speak 9.1 Dr. Eric Wieschaus discusses the patterning of anterior- Gilbert Developmental Biology 11/e
posterior development in Drosophila. Gil_DevBio11e_09.13
01/08/15
Figure 9.13 Model of anterior-pos-
(A)–Oocyte mRNAs (C) terior pattern generation by Drosophila
Anterior maternal effect genes. (A) The bicoid,
hunchback mRNA
nanos, hunchback, and caudal mRNAs
bicoid mRNA are deposited in the oocyte by the ovar-
Concentration
(A) (D) fk
ap
Head T1 T2 A8
T3 A1
Wild-type
(B)
fk fk
ap ap
A8 A7 A6 A7 A8
bicoid-deficient mutant
(C)
150 Figure 9.14 Bicoid protein gradient in the early Drosophila embryo. (A)
Localization of bicoid mRNA to the anterior tip of the embryo in a steep gradi-
Concentration of Bicoid protein
ent. (B) Bicoid protein gradient shortly after fertilization. Note that the concen-
tration is greatest anteriorly and trails off posteriorly. Notice also that Bicoid
(intensity of stain)
100 is concentrated in the nuclei. (C) Densitometric scan of the Bicoid protein
gradient. The upper curve (black) represents the Bicoid gradient in wild-type
embryos. The lower curve (red) represents Bicoid in embryos of bicoid mutant
Wild-type mothers. (D) Phenotype of cuticle from a strongly affected embryo produced
50
bicoid mutant by a female fly deficient in the bicoid gene compared with the wild-type cuticle
pattern. The head and thorax of the bicoid mutant have been replaced by a
second set of posterior telson structures, abbreviated fk (filzkörper) and ap
0 (anal plates). (A from Kaufman et al. 1990; B,C from Driever and Nüsslein-
Anterior Posterior Volhard 1988b; D from Driever et al. 1990, courtesy of the authors.)
The Genetics of Axis Specification in Drosophila 293
SCIENTISTS SPEAK 9.2 In two separate videos, Dr. Eric Wieschaus discusses the
stability of the Bicoid gradient and its role throughout fly evolution.
In the posterior half of the embryo, the Caudal protein gradient also activates a
number of zygotic genes, including the gap genes knirps (kni) and giant (gt), which are
critical for abdominal development (Rivera-Pomar et al. 1995; Schulz and Tautz 1995).
Since a second function of Bicoid protein is to inhibit the translation of caudal mRNA,
Caudal protein is absent from the anterior portion of the embryo. Thus, the posterior-
forming genes are not activated in this region.
WEb Topic 9.4 The terminal gene group Further details about these genes are
provided, including how the two ends are specified differently from the central trunk seg-
ments, and how Bicoid helps determine which terminal becomes anterior.
The next step in development will be to use these gradients of transcription factors
to activate specific genes along the anterior-posterior axis.
294 Chapter 9
Segmentation Genes
Cell fate commitment in Drosophila appears to have two steps: specification and deter-
mination (Slack 1983). Early in fly development, the fate of a cell depends on cues
provided by protein gradients. This specification of cell fate is flexible and can still be
altered in response to signals from other cells. Eventually, however, the cells undergo a
transition from this loose type of commitment to an irreversible determination. At this
point, the fate of a cell becomes cell-intrinsic. 5
The transition from specification to determination in Drosophila is mediated by seg-
mentation genes that divide the early embryo into a repeating series of segmental pri-
mordia along the anterior-posterior axis. Segmentation genes were originally defined
by zygotic mutations that disrupted the body plan, and these genes were divided into
three groups based on their mutant phenotypes (Table 9.2 ; Nüsslein-Volhard and
Wieschaus 1980):
• Gap mutants lack large regions of the body (several con-
tiguous segments; Figure 9.15A).
• Pair-rule mutants lack portions of every other segment
(Figure 9.15B).
(A) Gap: Krüppel (as an example) • Segment polarity mutants show defects (deletions, dupli-
Early embryo Later embryo Larva Larva cations, polarity reversals) in every segment (Figure
(normal) (normal) (normal) (lethal 9.15C ).
mutant)
Area of Area of
gene action gene action Segments and parasegments
Mutations in segmentation genes result in Drosophila embry-
os that lack certain segments or parts of segments. However,
early researchers found a surprising aspect of these mutations:
many of them did not affect actual adult segments. Rather,
they affected the posterior compartment of one segment and
the anterior compartment of the immediately posterior segment
(Figure 9.16). These “transegmental” units were named para-
segments (Martinez-Arias and Lawrence 1985).
Once the means to detect gene expression patterns were
(B) Pair-rule: fushi tarazu (as an example) available, it was discovered that the expression patterns in the
early embryo are delineated by parasegmental boundaries, not
by the boundaries of the segments. Thus, the parasegment
appears to be the fundamental unit of embryonic gene expres-
sion. Although parasegmental organization is also seen in the
nerve cord of adult Drosophila, it is not seen in the adult epider-
mis (the most obvious manifestation of segmentation), nor is it
5
Aficionados of information theory will recognize that the process by
which the anterior-posterior information in morphogenetic gradients
is transferred to discrete and different parasegments represents a
transition from analog to digital specification. Specification is ana-
(C) Segment polarity: engrailed (as an example) log, determination digital. This process enables the transient infor-
mation of the gradients in the syncytial blastoderm to be stabilized
so that it can be used much later in development (Baumgartner and
Noll 1990).
6
The two modes of segmentation may be required for the coordination of
movement in the adult fly. In arthropods, the ganglia of the ventral nerve
cord are organized by parasegments, but the cuticle grooves and muscula-
ture are segmental. This shift in frame by one compartment allows the mus-
cles on both sides of any particular epidermal segment to be coordinated by
the same ganglion. This, in turn, allows rapid and coordinated muscle con-
tractions for locomotion (Deutsch 2004). A similar situation occurs in verte-
brates, where the posterior portion of the anterior somite combines with the
anterior portion of the next somite.
the entire embryo that become consolidated into discrete regions of high activity as
nuclear divisions continue (Jäckle et al. 1986). The Hunchback gradient is particular-
ly important in establishing the initial gap gene expression patterns. By the end of
nuclear division cycle 12, Hunchback is found at high levels across the anterior part of
the embryo. Hunchback then forms a steep gradient through about 15 nuclei near the
middle of the embryo (see Figures 9.7C and 9.13B). The posterior third of the embryo
has undetectable Hunchback levels at this time.
The transcription patterns of the anterior gap genes are initiated by the differ-
ent concentrations of the Hunchback and Bicoid proteins. High levels of Bicoid and
Hunchback induce the expression of giant, while the Krüppel transcript appears over
the region where Hunchback begins to decline. High levels of Hunchback (in the
(A) absence of Bicoid) also prevent the transcription of the posterior gap genes (such
Bcd Cad
as knirps and giant) in the embryo’s anterior (Struhl et al. 1992). It is thought that a
gradient of the Caudal protein, highest at the posterior pole, is responsible for acti-
vating the abdominal gap genes knirps and giant in the posterior part of the embryo.
Kni Hb Kr Gt The giant gene thus has two methods of activation (Rivera-Pomar 1995; Schulz and
Tautz 1995): one for its anterior expression band (through Bicoid and Hunchback),
and one for its posterior expression band (by Caudal).
After the initial gap gene expression patterns have been
Tll established by the maternal effect gradients and Hunchback,
(B) they are stabilized and maintained by repressive interac-
Kni Hb
tions between the different gap gene products themselves.
1
(These interactions are facilitated by the fact that they occur
within a syncytium, in which the cell membranes have not yet
formed.) These boundary-forming inhibitions are thought to
0 be directly mediated by the gap gene products, because all four
(C) major gap genes (hunchback, giant, Krüppel, and knirps) encode
Hb
DNA-binding proteins (Knipple et al. 1985; Gaul and Jäckle
Hb Kr 1990; Capovilla et al. 1992). One such model, established by
1 genetic experiments, biochemical analyses, and mathemati-
Concentration
Into wild-type embryo Into wild-type embryo Into wild-type embryo Into giant-deficient embryo
(B) (C) (D) (E)
298 Chapter 9
B5 B4 C1H3 B1 H2 C2
B3 B2 H7 C3 C4 C5 C6
K6 N1 N2 G2 T3 K4 T4 N3K2 N4K1 N5 N6
K5 G3 T4 T5 G1 K3 T7 T8
–1,600 –1,400 –1,200 –1,000 –800 –600 –400
Figure 9.20 Model for formation of the second stripe of tran- to a repressor site, suggesting competitive interactions at these
scription from the even-skipped gene. The enhancer element for positions. (Moreover, a protein that is a repressor for stripe 2 may be
stripe 2 regulation contains binding sequences for several maternal an activator for stripe 5; it depends on which proteins bind next to
and gap gene proteins. Activators (e.g., Bicoid and Hunchback) them.) B, Bicoid; C, Caudal; G, Giant; H, Hunchback; K, Krüppel; N,
are noted above the line; repressors (e.g., Krüppel and Giant) are Knirps; T, Tailless. (After Janssens et al. 2006.)
shown below. Note that nearly every activator site is closely linked
regulates a separate stripe or a pair of stripes. For instance, even-skipped stripe 2 is con-
trolled by a 500-bp region that is activated by Bicoid and Hunchback and repressed by
both Giant and Krüppel proteins (Figure 9.20; Small et al. 1991, 1992; Stanojevíc et al.
1991; Janssens et al. 2006). The anterior border is maintained by repressive influences
from Giant, while the posterior border is maintained by Krüppel. DNase I footprinting
showed that the minimal enhancer region for this stripe contains five binding sites for
Bicoid, one for Hunchback, three for Krüppel, and three for Giant. Thus, this region is
thought to act as a switch that can directly sense the concentrations of these proteins
and make on/off transcriptional decisions.
The importance of these enhancer elements can be shown by both genetic and
biochemical means. First, a mutation in a particular enhancer can delete its par-
ticular stripe and no other. Second, if a reporter gene (such as lacZ, which encodes
β-galactosidase) is fused to one of the enhancers, the reporter gene is expressed only
in that particular stripe (see Figure 9.19; Fujioka et al. 1999). Third, placement of the
stripes can be altered by deleting the gap genes that regulate them. Thus, stripe place-
ment is a result of (1) the modular cis-regulatory enhancer elements of the pair-rule
genes and (2) the trans-regulatory gap gene and maternal gene proteins that bind to
these enhancer sites.
Once initiated by the gap gene proteins, the transcription pattern of the primary
pair-rule genes becomes stabilized by interactions among their products (Levine and
Harding 1989). The primary pair-rule genes also form the context that allows or inhib-
its expression of the later-acting secondary pair-rule genes, such as fushi tarazu ( ftz;
Figure 9.21). The eight known pair-rule genes are all expressed in striped patterns,
but the patterns are not coincident with each other. Rather, each row of nuclei within
a parasegment has its own array of pair-rule products that distinguishes it from any
other row. These products activate the next level of segmentation genes, the segment
polarity genes.
A8
T1 T A7
A
2 T A A 6
3 A1 A 2 A3 4 5
Clypeolabrum Labial
(B) Mandibulum
(D)
Diffusion of
Patched (receptors) Hedgehog protein
Wingless protein
Frizzled
(receptor)
Zw3
Dsh (GSK3)
Transcription
of wingless Armadillo
(β-catenin)
Transcription
Cubitus interruptus of engrailed,
Patched
hedgehog
(receptor)
Hedgehog
Smoothened
protein
After the segmental boundaries are set, the pair-rule and gap genes wg hh hh wg wg hh hh
(A) (B)
A8 A7 A6
A1
A2 A5
A4
A3
T1 T2 T3
A4
A5 A3
A6
A7
Cl
A8
An
A2
Md A1
Mx Lb T1
T2 T3
Gilbert Developmental Biology 11/e
Antennapedia complex Bithorax
bithorax complex Gil_DevBio11e_09.23
01/19/16
Figure 9.24 Homeotic gene expression in Drosophila. (A)
lab dfd scr Antp Ubx abdA AbdB
Expression map of the homeotic genes. In the center are the
genes of the Antennapedia and bithorax complexes and their
functional domains. Below and above the gene map, the regions
of homeotic gene expression (both mRNA and protein) in the
blastoderm of the Drosophila embryo and the regions that form
from them in the adult fly are shown. (B) In situ hybridization for
four genes at a slightly later stage (the extended germ band). The
engrailed (blue) expression pattern separates the body into seg-
ments; Antennapedia (green) and Ultrabithorax (purple) separate
the thoracic and abdominal regions; Distal-less (red) shows the
Head Thorax Abdomen placement of jaws and the beginnings of limbs. (A after Kaufman
et al. 1990 and Dessain et al. 1992; B courtesy of D. Kosman.)
302 Chapter 9
Antennapedia complex, contains the homeotic genes labial (lab), Antennapedia (Antp),
sex combs reduced (scr), deformed (dfd), and proboscipedia (pb). The labial and deformed
genes specify the head segments, while sex combs reduced and Antennapedia contribute
to giving the thoracic segments their identities. The proboscipedia gene appears to act
only in adults, but in its absence, the labial palps of the mouth are transformed into legs
(Wakimoto et al. 1984; Kaufman et al. 1990; Maeda and Karch 2009).
The second region of homeotic genes is the bithorax complex (Lewis 1978; Maeda
and Karch 2009). Three protein-coding genes are found in this complex: Ultrabithorax
(Ubx), which is required for the identity of the third thoracic segment; and the abdominal
A (abdA) and Abdominal B (AbdB) genes, which are responsible for the segmental identi-
ties of the abdominal segments (Sánchez-Herrero et al. 1985). The chromosome region
containing both the Antennapedia complex and the bithorax complex is often referred
to as the homeotic complex, or Hom-C.
Because the homeotic selector genes are responsible for the specification of fly body
parts, mutations in them lead to bizarre phenotypes. In 1894, William Bateson called
these organisms homeotic mutants, and they have fascinated developmental biolo-
gists for decades.7 For example, the body of the normal adult fly contains three thoracic
segments, each of which produces a pair of legs. The first thoracic segment does not
produce any other appendages, but the second thoracic segment produces a pair of
wings in addition to its legs. The third thoracic segment produces a pair of legs and a
pair of balancers known as halteres. In homeotic mutants, these specific segmental
identities can be changed. When the Ultrabithorax gene is deleted, the third thoracic
segment (characterized by halteres) is transformed into another second thoracic seg-
ment. The result is a fly with four wings (Figure 9.25)—an embarrassing situation for
a classic dipteran.8
(A) Similarly, Antennapedia protein usually specifies the second thoracic segment of
the fly. But when flies have a mutation wherein the Antennapedia gene is expressed
in the head (as well as in the thorax), legs rather than antennae grow out of the head
sockets (Figure 9.26). This is partly because, in addition to promoting the formation
of thoracic structures, the Antennapedia protein binds to and represses the enhancers
of at least two genes, homothorax and eyeless, which encode transcription factors that are
critical for antenna and eye formation, respectively (Casares and Mann 1998; Plaza et
al. 2001). Therefore, one of Antennapedia’s functions is to repress the genes that would
trigger antenna and eye development. In the recessive mutant of Antennapedia, the gene
fails to be expressed in the second thoracic segment, and antennae sprout in the leg
positions (Struhl 1981; Frischer et al. 1986; Schneuwly et al. 1987).
The major homeotic selector genes have been cloned and their expression analyzed
by in situ hybridization (Harding et al. 1985; Akam 1987). Transcripts from each gene
Second thoracic segment 7
Homeo, from the Greek, means “similar.” Homeotic mutants are mutants in which one structure
(B) is replaced by another (as where an antenna is replaced by a leg). Homeotic genes are those genes
whose mutation can cause such transformations; thus, homeotic genes are genes that specify
the identity of a particular body segment. The homeobox is a conserved DNA sequence of about
180 base pairs that is shared by many homeotic genes. This sequence encodes the 60-amino
acid homeodomain, which recognizes specific DNA sequences. The homeodomain is an impor-
tant region of the transcription factors encoded by homeotic genes. However, not all genes con-
taining homeoboxes are homeotic genes.
8
Dipterans—two-winged insects such as flies—are thought to have evolved from four-winged
insects, and it is possible that this change arose via alterations in the bithorax complex. Chapter
26 includes further speculation on the relationship between the homeotic complex and evolution.
Figure 9.25 (A) Wings of the wild-type fruit fly emerge from the second thoracic segment.
(B) A four-winged fruit fly constructed by putting together three mutations in cis-regulators of
the Ultrabithorax gene. These mutations effectively transform the third thoracic segment into
Second thoracic Third thoracic another second thoracic segment (i.e., transform halteres into wings). (Courtesy of Nipam
segment segment Patel.)
The Genetics of Axis Specification in Drosophila 303
can be detected in specific regions of the embryo (see Figure 9.24B) and are especially Developing Questions
prominent in the central nervous system.
Homeobox genes specify
the anterior-posterior body
SCIENTISTS SPEAK 9.3 Listen to this interview with Dr. Walter Gehring, who
axis in both Drosophila and
spearheaded investigations that unified genetics, development, and evolution, humans. How come we do
leading to the discovery of the homeobox and its ubiquity throughout the animal not see homeotic mutations
kingdom. that result in extra sets of
limbs in humans, as can
WEb Topic 9.5 Initiation and maintenance of homeotic gene expres- happen in flies?
sion Homeotic genes make specific boundaries in the Drosophila embryo. Moreover,
the protein products of the homeotic genes activate batteries of other genes, specifying
the segment.
Figure 9.27 Expression of Gurken between the oocyte nucleus and the
dorsal anterior cell membrane. (A) The gurken mRNA is localized between the
oocyte nucleus and the dorsal follicle cells of the ovary. Anterior is to the left;
dorsal faces upward. (B) A more mature oocyte shows Gurken protein (yellow)
across the dorsal region. Actin is stained red, showing cell boundaries. As the
oocyte grows, follicle cells migrate across the top of the oocyte, where they
become exposed to Gurken. (A from Ray and Schüpbach 1996, courtesy of
T. Schüpbach; B courtesy of C. van Buskirk and T. Schüpbach.)
304 Chapter 9
(Schüpbach 1987). The Gurken-Torpedo signal that specifies dorsalized follicle cells ini-
tiates a cascade of gene activity that creates the dorsal-ventral axis of the embryo. The
activated Torpedo receptor protein activates Mirror, a transcription factor that represses
expression of the pipe gene (Andreu et al. 2012; Fuchs et al. 2012). As a result, Pipe is
made only in the ventral follicle cells (Figure 9.28A; Sen et al. 1998; Amiri and Stein
2002). Pipe protein modifies the ventral vitelline envelope by sulfating its proteins. This
Ventralized
vitelline
membrane
1 Oocyte nucleus travels to anterior
dorsal side of oocyte where it localizes
gurken mRNA. Torpedo Nucleus Ventralized
Dorsal embryo cell
2 Translated Gurken is received by
Torpedo proteins. Dorsal cell fa Cactus
te
3a Torpedo signal causes follicle cells to 10
differentiate to a dorsal morphology.
3a Dorsal Cactus
3b Pipe synthesis is inhibited in dorsal 3b
follicle cells. + +
+
4 Gurken does not diffuse to ventral
follicle cells. Pelle
Gurken Tube
5a Ventral follicle cells synthesize Pipe. Inhibition of
2 Toll 9
5b Pipe signal sulfates ventral vitelline Pipe synthesis
proteins. gurken
mRNA Spätzle
6 Sulfated vitelline membrane proteins 8
bind Gastrulation-defective (GD). Nucleus
1
7a GD cleaves Snake to its active form and
No Gurken signal
forms a complex with Snake and
to ventral side 4
uncleaved Easter proteins.
7b Sulfated
7b Easter protein is cleaved into its Easter
vitelline
active form. 7a membrane
8 Cleaved Easter binds to and cleaves Snake proteins
Spätzle; activated Spätzle binds to Toll + 5b GD
receptor protein. + +
+
9 Toll activation activates Tube and Pelle, 6
which phosphorylate the Cactus
protein. Cactus is degraded, releasing it cell fate
from Dorsal. Ventral
5a Pipe Ventralized vitelline membrane
10 Dorsal protein enters the nucleus and synthesis
ventralizes the cell.
Figure 9.28 Generating dorsal-ventral polarity in Drosophila. (A) follicle cells to take on a characteristic dorsal follicle morphology
The nucleus of the oocyte travels to what will become the dorsal and inhibits the synthesis of Pipe protein. Therefore, Pipe protein
side of the embryo. The gurken genes of the oocyte synthesize is made only by the ventral follicle cells. (B) The ventral region, at a
mRNA that becomes localized between the oocyte nucleus and slightly later stage of development. Sulfated proteins on the ventral
the cell membrane, where it is translated into Gurken protein. The region of the vitelline envelope recruit Gastrulation-defective (GD),
Gurken signal is received by the Torpedo receptor protein made by which in turn complexes with other proteins, initiating a cascade
the follicle cells (see Figure 9.8). Given the short diffusibility of the that results in the cleaved Spätzle protein binding to the Toll recep-
signal, only the follicle cells closest to the oocyte nucleus (i.e., the tor. The resulting cascade ventralizes the cell. (After van Eeden and
dorsal follicle cells) receive the Gurken signal, which causes the St. Johnston 1999; Cho et al. 2010.)
allows the Gastrulation-defective protein to bind to the vitelline envelope (only in the
ventral region) and to recruit other proteins to make a complex that will cleave the Easter
protein into its active protease form (Figure 9.28B; Cho et al. 2010, 2012). Easter then
cleaves the Spätzle protein (Chasan et al. 1992; Hong and Hashimoto 1995; LeMosy et
al. 2001), and the cleaved Spätzle protein is the ligand that binds to and activates the
Toll receptor. It is important that the cleavage of Spätzle be limited to the most ventral
portion of the embryo. This is accomplished by the secretion of a protease inhibitor from
the follicle cells of the ovary. This can inhibit any small amounts of proteases that might
be expected on the margins (Hashimoto et al. 2003; Ligoxygakis et al. 2003).
Toll protein is a maternal product that is evenly distributed throughout the cell mem-
Developing Questions
brane of the egg (Hashimoto et al. 1988, 1991), but it becomes activated only by binding
Spätzle, which is produced only on the ventral side of the egg. The ventral Toll receptors According to the model
bind the mature Spätzle protein, and the membrane containing activated Toll protein discussed here, the Gurken
protein from the egg is
undergoes endocytosis. Signaling from the Toll receptor is believed to occur in these
signaling dorsal-ventral
cytoplasmic endosomes rather than on the cell surface (Lund et al. 2010). Therefore, patterning information to
the Toll receptors on the ventral side of the egg are transducing a signal into the egg, the follicle cells. How can
whereas the Toll receptors on the dorsal side are not. This localized activation estab- we know this? Hint: Consult
lishes the dorsal-ventral polarity of the oocyte. Dr. Trudi Schüpbach’s 1987
paper in the journal Cell
SCIENTISTS SPEAK 9.4 Two videos featuring Dr. Trudi Schüpbach show how the (see Further Readings at
anchoring and regulation of the Gurken protein are accomplished in the Drosophi- the end of the chapter) and
la embryo. watch her videos (cited in
“Scientists Speak,” at left).
(A) (C)
(B) Dorsal
Amnioserosa
Dorsal ectoderm
Lateral ectoderm
Neurogenic
ectoderm
the ventral activation of the Toll receptor. When Spätzle binds
Mesoderm
to and activates the Toll protein, Toll activates a protein kinase
Ventral called Pelle. Another protein, Tube, is probably necessary for
Lateral section Transverse section bringing Pelle to the cell membrane, where it can be activated
(Galindo et al. 1995). The activated Pelle protein kinase (prob-
Figure 9.29 Specification of cell fate ably through an intermediate) can phosphorylate Cactus. Once
by the Dorsal protein. (A) Transverse sec- phosphorylated, Cactus is degraded and Dorsal can enter the nucleus (Kidd 1992; Shel-
tions of embryos stained with antibody
ton and Wasserman 1993; Whalen and Steward 1993; Reach et al. 1996). Since Toll is
to show the presence of Dorsal protein
(dark area). The wild-type embryo (left) activated by a gradient of Spätzle protein that is highest in the most ventral region,
has Dorsal protein only in the ventralmost there is a corresponding gradient of Dorsal translocation in the ventral cells of the
nuclei. A dorsalized mutant (center) has embryo, with the highest concentrations of Dorsal in the most ventral cell nuclei, which
no localization of Dorsal protein in any become the mesoderm (Figure 9.29B).
nucleus. In the ventralized mutant (right), The Dorsal protein signals the first morphogenetic event of Drosophila gastrulation.
Dorsal protein has entered the nucleus The 16 ventralmost cells of the embryo—those cells containing the highest amount
of every cell (B) Fate maps of cross sec-
of Dorsal in their nuclei—invaginate into the body and form the mesoderm (Figure
tions through the Drosophila embryo at
division cycle 14. The most ventral part 9.30). All of the body muscles, fat bodies, and gonads derive from these mesodermal
becomes the mesoderm; the next higher cells (Foe 1989). The cells that will take their place at the ventral midline will become
portion becomes the neurogenic (ventral) the nerves and glia.
ectoderm. The lateral and dorsal ecto-
derm can be distinguished in the cuticle, WEb Topic 9.6 Effects of the Dorsal protein gradient Dorsal works as a
and the dorsalmost region becomes the transcription factor initiating a cascade that sets up the conditions for the specification of
amnioserosa, the extraembryonic layer the mesoderm, endoderm, and ectoderm.
that surrounds the embryo. The translo-
cation of Dorsal protein into ventral, but
not lateral or dorsal, nuclei produces a Axes and Organ Primordia:
gradient whereby the ventral cells with the The Cartesian Coordinate Model
most Dorsal protein become mesoderm
precursors. (C) Dorsal-ventral patterning The anterior-posterior and dorsal-ventral axes of Drosophila embryos form a coordinate
in Drosophila. The readout of the Dorsal system that can be used to specify positions within the embryo (Figure 9.31A). Theo-
gradient can be seen in the trunk region
retically, cells that are initially equivalent in developmental potential can respond to
of a whole-mount stained embryo. The
expression of the most ventral gene, their position by expressing different sets of genes. This type of specification has been
ventral nervous system defective (blue), is demonstrated in the formation of the salivary gland rudiments (Panzer et al. 1992;
from the neurogenic ectoderm. The inter- Bradley et al. 2001; Zhou et al. 2001).
mediate neuroblast defective gene (green) Drosophila salivary glands form only in the strip of cells defined by the activity of the
is expressed in lateral ectoderm. Red sex combs reduced (scr) gene along the anterior-posterior axis (parasegment 2). No sali-
represents the muscle-specific homeo- vary glands form in scr-deficient mutants. Moreover, if scr is experimentally expressed
Gilbert Developmental Biology 11/e
box gene, expressed in the mesoderm
Gil_DevBio11e_09.29 throughout the embryo, salivary gland primordia form in a ventrolateral stripe along
above the intermediate neuroblasts. The
01/19/16
dorsalmost tissue expresses decapen- most of the length of the embryo. The formation of salivary glands along the dorsal-
taplegic (yellow). (A from Roth et al. 1989, ventral axis is repressed by both Decapentaplegic and Dorsal proteins, which inhibit
courtesy of the authors; B after Rushlow salivary gland formation both dorsally and ventrally. Thus, the salivary glands form at
et al. 1989; C from Kosman et al. 2004, the intersection of the vertical scr expression band (parasegment 2) and the horizontal
courtesy of D. Kosman and E. Bier.) region in the middle of the embryo’s circumference that has neither Decapentaplegic
The Genetics of Axis Specification in Drosophila 307
nor Dorsal ( Figure 9.31B ). The cells that form the salivary
glands are directed to do so by the intersecting gene activities
along the anterior-posterior and dorsal-ventral axes.
A similar situation is seen in neural precursor cells found
in every segment of the fly. Neuroblasts arise from 10 clusters
of 4 to 6 cells each that form on each side in every segment
in the strip of neural ectoderm at the midline of the embryo
(Skeath and Carroll 1992). The cells in each cluster interact (via
the Notch pathway discussed in Chapter 4) to generate a single
neural cell from each cluster. Skeath and colleagues (1993) have
shown that the pattern of neural gene transcription is imposed
by a coordinate system. Their expression is repressed along
the dorsal-ventral axis by the Decapentaplegic and Snail pro-
teins, while positive enhancement by pair-rule genes along the
anterior-posterior axis causes neural gene repetition in each
half-segment. It is very likely, then, that the positions of organ
primordia in the fly are specified via a two-dimensional coordi-
nate system based on the intersection of the anterior-posterior
and dorsal-ventral axes.
WEb Topic 9.7 The right-left axes Drosophila has a
right-left axis extending from the center of the embryo to its
sides. Each set of limbs develops on the right and left sides, but Figure 9.30 Gastrulation in Drosophila. In this cross section,
the embryo is not entirely symmetrical. the mesodermal cells at the ventral portion of the embryo buckle
inward, forming the ventral furrow (see Figure 9.5A,B). This furrow
becomes a tube that invaginates into the embryo and then flattens
Coda and generates the mesodermal organs. The nuclei are stained with
antibody to the Twist protein, a marker for the mesoderm. (From
Genetic studies of the Drosophila embryo have uncovered numer- Leptin 1991a, courtesy of M. Leptin.)
ous genes that are responsible for specification of the anterior-
posterior and dorsal-ventral axes. Mutations of Drosophila genes
have given us our first glimpses of the multiple levels of pattern
regulation in a complex organism and have enabled us to isolate
these genes and their products. Most importantly, however, as
we will see in forthcoming chapters, the insights arising from
work on Drosophila genes have been pivotal in helping us under-
stand the general mechanism of pattern formation used not only
by insects but throughout the animal kingdom.
WEb Topic 9.8 Early development of other insects Figure 9.31 Cartesian coordinate system
Drosophila melanogaster and its relatives are highly derived mapped out by gene expression patterns. (A)
species. Other insect species develop very differently from the A grid (ventral view, looking “up” at the embryo)
“standard” fruit fly. formed by the expression of short-gastrulation
(red), intermediate neuroblast defective (green),
and muscle
Gilbert Developmental 11/e homeobox (magenta) along
segment
Biology
the dorsal-ventral axis, and by the expression of
Gil_DevBio11e_09.30
(A) (B) scr activates
01/19/16 wingless (yellow) and engrailed (purple) transcripts
dpp along the anterior-posterior axis. (B) Coordinates
inhibits for the expression of genes giving rise to Dro-
sophila salivary glands. These genes are activated
by the protein product of the sex combs reduced
(scr) homeotic gene in a narrow band along the
Salivary anterior-posterior axis, and they are inhibited in
gland the regions marked by decapentaplegic (dpp) and
dorsal gene products along the dorsal-ventral
axis. This pattern allows salivary glands to form in
dorsal the midline of the embryo in the second paraseg-
inhibits ment. (A courtesy of D. Kosman; B after Panzer et
al. 1992.)
308 Chapter 9
9 Snapshot Summary
Drosophila Development and Axis Specification
1. Drosophila cleavage is superficial. The nuclei divide 13 • Boundaries of gene expression can be created by
times before forming cells. Before cell formation, the the interaction between transcription factors and
nuclei reside in a syncytial blastoderm. Each nucleus is their gene targets. Here, the transcription factors
surrounded by actin-filled cytoplasm. transcribed earlier regulate the expression of the next
2. When the cells form, the Drosophila embryo undergoes set of genes.
a mid-blastula transition, wherein the cleavages become • Translational control is extremely important in the
asynchronous and new mRNA is made. At this time, early embryo, and localized mRNAs are critical in
there is a transfer from maternal to zygotic control of patterning the embryo.
development. • Individual cell fates are not defined immediately.
3. Gastrulation begins with the invagination of the most Rather, there is a stepwise specification wherein
ventral region (the presumptive mesoderm), which a given field is divided and subdivided, eventually
causes the formation of a ventral furrow. The germ band regulating individual cell fates.
expands such that the future posterior segments curl just 5. There is a temporal order wherein different classes of
behind the presumptive head. genes are transcribed, and the products of one gene
4. The genes regulating pattern formation in Drosophila often regulate the expression of another gene.
operate according to certain principles: 6. Maternal effect genes are responsible for the initiation
• There are morphogens—such as Bicoid and of anterior-posterior polarity. bicoid mRNA is bound by
Dorsal—whose gradients determine the specification its 3′ UTR to the cytoskeleton in the future anterior pole;
of different cell types. In syncytial embryos, these nanos mRNA is sequestered by its 3′ UTR in the future
morphogens can be transcription factors. posterior pole. hunchback and caudal messages are
seen throughout the embryo.
The Genetics of Axis Specification in Drosophila 309
7. Dorsal-ventral polarity is regulated by the entry of Dorsal such that they become activated in seven “stripes.” Their
protein into the nucleus. Dorsal-ventral polarity is initiated boundaries of transcription are defined by the gap genes.
when the nucleus moves to the dorsal-anterior of the The pair-rule genes form seven bands of transcription
oocyte and sequesters the gurken message, enabling it along the anterior-posterior axis, each one comprising
to synthesize proteins in the dorsal side of the egg. two parasegments.
8. Dorsal protein forms a gradient as it enters the various 13. The pair-rule gene products activate engrailed and
nuclei. Those nuclei at the most ventral surface incor- wingless expression in adjacent cells. The engrailed-
porate the most Dorsal protein and become mesoderm; expressing cells form the anterior boundary of each
those more lateral become neurogenic ectoderm. parasegment. These cells form a signaling center that
9. Bicoid and Hunchback proteins activate the genes organizes the cuticle formation and segmental structure
responsible for the anterior portion of the fly; Caudal acti- of the embryo.
vates genes responsible for posterior development. 14. Homeotic selector genes are found in two complexes on
10. The unsegmented anterior and posterior extremities are chromosome III of Drosophila. Together, these regions are
regulated by the activation of Torso protein at the anterior called Hom-C, the homeotic gene complex. The genes
and posterior poles of the egg. are arranged in the same order as their transcriptional
expression. Genes of the Hom-C specify the individual
11. The gap genes respond to concentrations of the mater-
segments, and mutations in these genes are capable of
nal effect gene proteins. Their protein products interact
transforming one segment into another.
with each other such that each gap gene protein defines
specific regions of the embryo. 15. Organs form at the intersection of dorsal-ventral and
anterior-posterior regions of gene expression.
12. The gap gene proteins activate and repress the pair-rule
genes. The pair-rule genes have modular enhancers
Further Reading
Driever, W., V. Siegel, and C. Nüsslein-Volhard. 1990. Autono- Nüsslein-Volhard, C. and E. Wieschaus. 1980. Mutations affect-
mous determination of anterior structures in the early Drosoph- ing segment number and polarity in Drosophila. Nature 287:
ila embryo by the Bicoid morphogen. Development 109: 811–820. 795–801.
Dubuis, J. O., G. Tkacik, E. F. Wieschaus, T. Gregor and W. Pankratz, M. J., E. Seifert, N. Gerwin, B. Billi, U. Nauber and
Bialek. 2013. Positional information, in bits. Proc. Natl. Acad. H. Jäckle. 1990. Gradients of Krüppel and knirps gene products
Sci. USA 110: 16301-–16308. direct pair-rule gene stripe patterning in the posterior region of
Ingham, P. W. 2016. Drosophila segment polarity mutants and the Drosophila embryo. Cell 61: 309–317.
the rediscovery of the Hedgehog pathway genes. Curr. Top. Dev. Roth, S., D. Stein and C. Nüsslein-Volhard. 1989. A gradient of
Biol. 116: 477–488. nuclear localization of the dorsal protein determines dorsoven-
Lehmann, R. and C. Nüsslein-Volhard. 1991. The maternal tral pattern in the Drosophila embryo. Cell 59: 1189–1202.
gene nanos has a central role in posterior pattern formation of Schultz, J. 1935. Aspects of the relation between genes and
the Drosophila embryo. Development 112: 679–691. development in Drosophila. American Naturalist 69: 30–54.
Lewis, E. B. 1978. A gene complex controlling segmentation in Schüpbach, T. 1987. Germline and soma cooperate during
Drosophila. Nature 276: 565–570. oogenesis to establish the dorsoventral pattern of egg shell and
Maeda, R. K. and F. Karch. 2009. The Bithorax complex of Dro- embryo in Drosophila melanogaster. Cell 49: 699–707.
sophila. Curr. Top. Dev. Biol. 88: 1–33. Struhl, G. 1981. A homeotic mutation transforming leg to
Martinez-Arias, A. and P. A. Lawrence. 1985. Parasegments antenna in Drosophila. Nature 292: 635–638.
and compartments in the Drosophila embryo. Nature 313: Wang, C. and R. Lehman. 1991. Nanos is the localized poste-
639–642. rior determinate in Drosophila. Cell 66: 637–647.
McGinnis, W., R. L. Garber, J. Wirz, A. Kuroiwa and W. J. Geh- Wieschaus, E. 2016. Positional information and cell fate deter-
ring. 1984. A homologous protein-coding sequence in Drosophi- mination in the early Drosophila embryo. Curr. Top. Dev. Biol.
la homeotic genes and its conservation in other metazoans. Cell 117: 567–580.
37: 403–408.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
10
The Punchline
Sea urchins and tunicates are deuterostome invertebrates. They have no backbone,
although tunicates have a notochord. Both groups use both conditional and
autonomous specification schemes. Sea urchins are known for integrating these
types of specification. The micromeres are specified autonomously through a gene
regulatory network with a double-negative circuit that inhibits the inhibitor of skeleton
development. Part of the resulting “micromere phenotype” is the ability to induce
neighboring cells to become endoderm and secondary mesenchyme. Tunicates,
on the other hand, are better known for their autonomous mode of development,
wherein determinants such as the muscle cell transcription factor Macho are placed
into specific blastomeres during oogenesis and early cleavage. Tunicates also display
conditional specification; this mode is used to create organs such as the notochord,
which links this group of invertebrates to the vertebrates.
312 Chapter 10
regulatory mode, since a single blastomere isolated from the four-cell stage could form
an entire sea urchin pluteus larva (Driesch 1891; also see Chapter 2). However, cells
isolated from later stages could not become all the cells of the larval body.
Sea urchin embryos also provided the first evidence that chromosomes were needed
for development, that DNA and RNA were present in every animal cell, that messenger
RNAs directed protein synthesis, that stored messenger RNA provided the proteins for
early embryonic development, that cyclins controlled cell division, and that enhancers
were modular
Gilbert (Ernst
Developmental 2011;11eMcClay 2011). The first cloned eukaryotic gene encoded
Biology
a sea urchin histone
Sinauer Associates protein (Kedes et al. 1975), and the first evidence for chromatin
GIL10e_10.01 Date 02-10-15
remodeling concerned histone alterations during sea urchin development (Newrock
et al. 1978). With the advent of new genetic techniques, sea urchin embryos continue
to be critically important organisms for delineating the mechanisms by which genetic
interactions specify different cell fates.
Early cleavage
VADE MECUM Sea urchins exhibit radial holoblastic cleavage (Figures 10.2 and 10.3). Recall from
Chapter 1 that this type of cleavage occurs in eggs with sparse yolk, and that holoblas-
The segment on sea urchin
tic cleavage furrows extend through the entire egg (see Figure 1.5). In sea urchins, the
development provides an excel-
first seven cleavage divisions are stereotypic in that the same pattern is followed in
lent review of this organism’s
early development, as well as
every individual of the same species. The first and second cleavages are both meridi-
more general questions concern- onal and are perpendicular to each other (that is to say, the cleavage furrows pass
ing the fundamentals of echino- through the animal and vegetal poles). The third cleavage is equatorial, perpendicular
derm cleavage and gastrulation. to the first two cleavage planes, and separates the animal and vegetal hemispheres
from each other (see Figure 10.2A, top row, and Figure 10.3A–C). The fourth cleavage,
however, is very different. The four cells of the animal tier divide meridionally into
eight blastomeres, each with the same volume. These eight cells are called mesomeres.
The vegetal tier, however, undergoes an unequal equatorial cleavage (see Figure 10.2B)
to produce four large cells—the macromeres —and four smaller micromeres at the
vegetal pole. In Lytechinus variegatus, a species often used for experimentation, the
ratio of cytoplasm retained in the macromeres and micromeres is 95:5. As the 16-cell
embryo cleaves, the eight “animal” mesomeres divide equatorially to produce two
tiers—an1 and an 2—one staggered above the other. The macromeres divide meridio-
nally, forming a tier of eight cells below an2 (see Figure 10.2A, bottom row). Somewhat
later, the micromeres divide unequally, producing a cluster of four small micromeres at
Sea Urchins and Tunicates 313
Vegetal pole
Fertilization envelope
(A) (B) (C)
Blastula formation
By the blastula stage, all the cells of the developing sea urchin are the same size, the
micromeres having slowed down their cell divisions. Every cell is in contact with the
proteinaceous fluid of the blastocoel on the inside and with the hyaline layer on the
outside. Tight junctions unite the once loosely connected blastomeres into a seamless
epithelial sheet that completely encircles the blastocoel. As the cells continue to divide,
the blastula remains one cell layer thick, thinning out as it expands. This is accom-
plished by the adhesion of the blastomeres to the hyaline layer and by an influx of
water that expands the blastocoel (Dan 1960; Wolpert and Gustafson 1961; Ettensohn
and Ingersoll 1992).
These rapid and invariant cell cleavages last through the ninth or tenth division,
depending on the species. By this time, the fates of the cells have become specified
(discussed in the next section), and each cell becomes ciliated on the region of the
cell membrane farthest from the blastocoel. Thus, there is apical-basal (outside-inside)
polarity in each embryonic cell, and there is evidence that PAR proteins (like those
of the nematode) are involved in distinguishing the basal cell membranes (Alford et
al. 2009). The ciliated blastula begins to rotate within the fertilization envelope. Soon
afterward, differences are seen in the cells. The cells at the vegetal pole of the blastula
begin to thicken, forming a vegetal plate (see Figure 10.3F). The cells of the animal
hemisphere synthesize and secrete a hatching enzyme that digests the fertilization
envelope (Lepage et al. 1992). The embryo is now a free-swimming hatched blastula.
WEb Topic 10.1 Urchins in the lab Stanford University hosts a valuable and freely
accessible site called VirtualUrchin that describes and outlines numerous ways of study-
ing sea urchin development in the laboratory. The Swarthmore College Developmental
Biology site also provides useful laboratory protocols.
Animal pole
an1
Ectoderm
an2
Oral ectoderm
Oral Aboral veg1
Hindgut
Figure 10.4 Fate map and cell lineage of the Midgut, foregut,
veg2
sea urchin Strongylocentrotus purpuratus. The non-skeletogenic mesoderm
60-cell embryo is shown, with the left side fac-
ing the viewer. Blastomere fates are segregated
Large micromeres Primary mesenchyme cells
along the animal-vegetal axis of the egg. Vegetal pole Small micromeres Prmordial germ cells
Sea Urchins and Tunicates 315
the endodermal organs. The veg2 layer gives rise to cells that (A) Normal development
can populate three different structures—the endoderm, the
Animal Blastula
coelom (internal mesodermal body wall), and the non-skel- an1
etogenic mesenchyme (sometimes called secondary mes-
hemi-
an2 sphere
enchyme), which generates pigment cells, immunocytes, and veg1
muscle cells. The upper tier of micromeres (the large micro- veg2
meres) produces the skeletogenic mesenchyme (also called Micromeres
primary mesenchyme), which forms the larval skeleton. The Pluteus larva
lower-tier micromeres (i.e., the small micromeres) play no role (B) Animal hemisphere
in embryonic development. Rather, they contribute cells to the alone Dauerblastula
larval coelom, from which the tissues of the adult are derived
during metamorphosis (Logan and McClay 1997, 1999; Wray
1999). These small micromeres also contribute to producing
the germline cells (Yajima and Wessel 2011.)
The fates of the different cell layers are determined in a
Complete
two-step process: animalization
(C) Animal hemisphere
1. The large micromeres are autonomously specified. They and micromeres
inherit maternal determinants that were deposited at
the vegetal pole of the egg; these become incorporated
into the large micromeres at fourth cleavage. These four
micromeres are thus determined to become skeletogenic
mesenchyme cells that will leave the blastula epithelium,
enter the blastocoel, migrate to particular positions along Recognizable larva;
the blastocoel wall, and then differentiate into the larval endoderm from
skeleton. animal layers
2. The autonomously specified large micromeres are now Figure 10.5 Ability of micromeres to induce presumptive ecto-
able to produce paracrine and juxtacrine factors that con- dermal cells to acquire other fates. (A) Normal development of the
ditionally specify the fates of their neighbors. The micro- 60-cell sea urchin embryo, showing the fates of the different layers.
meres produce signals that tell the cells above them to (B) An isolated animal hemisphere becomes a ciliated ball of undif-
become endomesoderm (the endoderm and the secondary ferentiated ectodermal cells called a Dauerblastula (permanent
mesenchyme cells) and induces them to invaginate into blastula). (C) When an isolated animal hemisphere is combined with
the embryo. isolated micromeres, a recognizable pluteus larva is formed, with all
the endoderm derived from the animal hemisphere. (After Hörsta-
The ability of the micromeres to produce signals that change dius 1939.)
the fates of neighboring cells is so pronounced that if micro-
meres are removed from the embryo and placed below an iso-
lated animal cap —that is, below the top two animal tiers that
usually become ectoderm—the animal cap cells will generate
endoderm and a more or less normal larva will develop (Fig-
ure 10.5 ; Hörstadius 1939).
These skeletogenic micromeres are the first cells whose fates are determined autono-
mously. If micromeres are isolated from the 16-cell embryo and placed in petri dishes,
they will divide the appropriate number of times and produce the skeletal spicules
(Okazaki 1975). Thus, the isolated micromeres do not need any other signals to gener-
ate their skeletal fates. Moreover, if skeletogenic micromeres are transplanted into the
animal region of the blastula, not only will their descendants form skeletal spicules, but
the transplanted micromeres will alter the fates of nearby cells by inducing a secondary
site for gastrulation. Cells that would normally have produced ectodermal skin cells will
be respecified as endoderm and will produce a secondary gut (Figure 10.6; Hörstadius
1973; Ransick and Davidson 1993). Therefore, the inducing ability of the micromeres is
also established autonomously. Gilbert Developmental Biology 11e
Sinauer Associates
GIL10e_10.05 Date 01-29-15
WATCH DEVELOPMENT 10.1 “A Sea-Biscuit Life” is a beautifully photographed and
subtitled video that chronicles the development of the sand dollar (another echinoderm,
basically a flattened sea urchin).
316 Chapter 10
(A) Figure 10.6 Ability of micromeres to induce a secondary axis in sea urchin embryos.
Transplanted (A) Micromeres are transplanted from the vegetal pole of a 16-cell embryo into the animal pole
micromeres
of a host 16-cell embryo. (B) The transplanted micromeres invaginate into the blastocoel to cre-
Mesomeres ate a new set of skeletogenic mesenchyme cells, and they induce the animal cells next to them
to become vegetal plate endoderm cells. (C) The transplanted micromeres differentiate into
Macromeres skeletal rods while the induced animal cap cells form a secondary archenteron. Meanwhile,
gastrulation proceeds normally from the original vegetal plate of the host. (After Ransick and
Micromeres Davidson 1993.)
16-Cell stage
Here we will focus on the earliest part of one such GRN: the reactions by which the
skeletogenic mesenchyme cells of the sea urchin embryo receive their developmental
fate and inductive properties. Descended from the micromeres, skeletogenic mesen-
chyme cells are those cells that are autonomously specified to ingress into the blasto-
coel and become the larval skeleton. And, as we have seen, they are also the cells that
conditionally induce their neighbors to become endoderm (gut) and non-skeletogenic
mesenchyme (pigment; coelom) cells (see Figure 10.6).
Ettensohn 2007), where it prevents the degradation of β-catenin in the micromere and
veg 2-tier macromere cells. The β-catenin then enters the nucleus, where it combines
with the TCF transcription factor to activate gene expression from specific promoters. Figure 10.7 Role of the Disheveled
Several pieces of evidence suggest that β-catenin specifies the micromeres. First, and β-catenin proteins in specifying the
during normal sea urchin development, β-catenin accumulates in the nuclei of those vegetal cells of the sea urchin embryo.
cells fated to become endoderm and mesoderm (Figure 10.7B). This accumulation is (A) Localization of Disheveled (arrows)
autonomous and can occur even if the micromere precursors are separated from the in the vegetal cortex of the sea urchin
oocyte before fertilization (left) and in
rest of the embryo. Second, this nuclear accumulation appears to be responsible for
the region of a 16-cell embryo about to
specifying the vegetal half of the embryo. It is possible that levels of nuclear β-catenin become the micromeres (right). (B) Dur-
accumulation help determine the mesodermal and endodermal fates of the vegetal cells ing normal development, β-catenin accu-
(Kenny et al. 2003). Treating sea urchin embryos with lithium chloride allows β-catenin mulates predominantly in the micromeres
to accumulate in every cell and transforms presumptive ectoderm into endoderm (Fig- and somewhat less in the veg2 tier cells.
ure 10.7C ). Conversely, experimental procedures that inhibit β-catenin accumulation (C) In embryos treated with lithium chlo-
ride, β-catenin accumulates in the nuclei
of all blastula cells (probably by LiCl’s
blocking the GSK3 enzyme of the Wnt
(A) pathway), and the animal cells become
specified as endoderm and mesoderm.
(D) When β-catenin is prevented from
entering the nuclei (i.e., it remains in the
cytoplasm), the vegetal cell fates are
not specified, and the entire embryo
develops as a ciliated ectodermal ball.
(From Weitzel et al. 2004, courtesy of C.
Ettensohn, and from Logan et al. 1998,
courtesy of D. McClay.)
(B) Mesomeres
veg1
veg2
Large
micromeres
Small
micromeres
(C)
veg2
veg1
(D)
Small
micromeres
318 Chapter 10
in the vegetal cell nuclei prevent the formation of endoderm and mesoderm (Figure
10.7D; Logan et al. 1998; Wikramanayake et al. 1998).
pmar1 and hesc: a double-negative gate The next micromere regulatory input
comes from the Otx transcription factor, which is also enriched in the micromere cyto-
plasm. Otx interacts with the β-catenin/TCF complex at the enhancer of the Pmar1 gene
to activate Pmar1 transcription in the micromeres shortly after their formation (Figure
10.8A ; Oliveri et al. 2008). Pmar1 protein is a repressor of HesC, a gene that encodes
another repressive transcription factor. HesC is expressed in every nucleus of the sea
urchin embryo except those of the micromeres.2
In the micromeres, where Pmar1 is activated, the HesC gene is repressed. This
mechanism, whereby a repressor locks the genes of specification and these genes can
be unlocked by the repressor of that repressor (in other words, when activation occurs
by the repression of a repressor), is called a double-negative gate (Figures 10.8B
and 10.9A). Such a gate allows for tight regulation of fate specification: it promotes the
expression of these genes where the input occurs, and it represses the same genes in
every other cell type (Oliveri et al. 2008).
The genes repressed by HesC are those involved in micromere specification and dif-
ferentiation: Alx1, Ets1, Tbr, Tel, and SoxC. Each of these genes can be activated by ubiq-
uitous transcription factors, but these positive transcription factors cannot work while
HesC repressor protein binds to their respective enhancers. When the Pmar1 protein is
present, it represses HesC, and all these genes become active (Revilla-i-Domingo et al.
2007). The newly activated genes synthesize transcription factors that activate another
2
This is an oversimplification of the skeletogenic gene regulatory network. In the pathway to
micromere specification, other transcription factors must be expressed, and the maternal tran-
scription factor SoxB1 has to be eliminated from the micromeres or it will inhibit the activation
of Pmar1. In addition, the cytoskeletal processes partitioning the cells and anchoring certain
factors are not considered here. For complete details of the model, see the continually updated
website cited in Web Topic 10.2.
(A) Figure 10.8 Simplified illustration of the double-negative gated “circuit” for micromere
specification. (A) In situ hybridization reveals the accumulation of Pmar1 mRNA (dark purple) in
the micromeres. (B) OTX is a general transcription factor, and β-catenin from the maternal cyto-
plasm is concentrated at the vegetal pole of the egg. These transcriptional regulators are inher-
ited by the micromeres and activate the Pmar1 gene. Pmar1 encodes a repressor of HesC,
which in turn encodes a repressor (hence the “double-negative”) of several genes involved
in micromere specification (e.g., Alx1, Tbr, and Ets). Genes encoding signaling proteins (e.g.,
Delta) are also under the control of HesC. In the micromeres, where activated Pmar1 protein
represses the HesC repressor, the micromere specification and signaling genes are active. In
the veg2 cells, Pmar1 is not activated and the HesC gene product shuts down the skeletogenic
genes; however, those cells containing Notch can respond to the Delta signal from the skeleto-
genic mesenchyme. The gene expression patterns are seen below. U represents ubiquitous
activating transcription factors. (After Oliveri et al. 2008; photograph courtesy of P. Oliveri.)
(B)
Maternal Micromere Veg2 macromere
factors
Otx/β-catenin
U U
Pmar1 Pmar1
HesC HesC
U U U U U U U U
(A) (B)
If A active:
B not active; Regulatory
Gene A
C, D, E active gene A Regulatory
Gene B
gene B
If A not active:
B active; Figure 10.9 “Logic circuits” for gene
Gene C Gene D Gene E C, D, E inactive Differentiation expression. (A) In a double-negative gate,
gene C a single gene encodes a repressor of an
entire battery of genes. When this repres-
sor gene is repressed, the battery of
set of genes, most of which are genes that activate skeletal determinants. Some of these genes is expressed. (B) In a feedforward
transcription factors also activate each other’s genes, so that once one factor is activated, circuit, gene product A activates both
gene B and gene C, and gene B also
it maintains the activity of the other skeletogenic genes. This stabilizes the regulatory
activates gene C. Feedforward circuits
state of the skeletogenic mesenchyme cells (see Peter and Davidson 2016).
provide an efficient way to amplify a sig-
Another way micromeres retain their specification is to secrete an autocrine fac- nal in one direction.
tor, Wnt8 (Angerer and Angerer 2000; Wikramanayake et al. 2004). As soon as the
micromeres form, maternal β-catenin and Otx activate the Blimp1 gene, whose product
(in conjunction with more β-catenin) activates the Wnt8 gene. Wnt8 protein is then
received by the same micromeres that made it (i.e., autocrine regulation), activating the
micromeres’ own genes for β-catenin. Because β-catenin activates Blimp1, this autocrine
regulation sets up a positive feedback loop between Blimp1 and Wnt8 that establishes a
source of β-catenin for the micromere nuclei. Equally important, this cross-regulatory
loop serves to lock both genes “on” and can amplify their expression levels.
In contrast to the double-negative gate that specifies the micromeres, control of the
genes that differentiate the cells of the sea urchin skeleton operates on a feedforward
process (Figure 10.9B). Here, regulatory gene A produces a transcription factor that
is needed for the differentiation of gene C and also activates regulatory gene B, which
produces a transcription factor also needed for differentiation of gene C. This feedfor-
ward process stabilizes gene expression and makes the resulting cell type irreversible.
do not become endoderm 3 (Ransick and Davidson 1995; Sherwood and McClay 1999;
Sweet et al. 1999).
Another cell-specifying signal from the micromeres is the juxtacrine protein Delta,
also a factor that is controlled by the double-negative gate. Delta functions by activating
Notch proteins on the adjacent veg2 cells and later will act on the adjacent small micro-
meres. Delta causes the veg 2 cells to become the non-skeletogenic mesenchyme cells
by activating the Gcm transcription factor and repressing the FoxA transcription factor
(which activates the endoderm-specific genes). The upper veg2 cells, since they do not
receive the Delta signal, retain FoxA expression, and this pushes them in the direction
of becoming endodermal cells (Croce and McClay 2010).
In sum, the genes of the sea urchin micromeres specify their cell fates autonomously
and also specify the fates of their neighbors conditionally. The original inputs come
from the maternal cytoplasm and activate genes that unlock repressors of a specific
cell fate. Once the maternal cytoplasmic factors accomplish their functions, the nuclear
genome takes over.
SCIENTISTS SPEAK 10.1 Dr. Jeff Hardin offers a brief tutorial on sea urchin
gastrulation.
3
Recall the experiments in Figure 10.6, which demonstrated that the micromeres are able
to induce a second embryonic axis when transplanted to the animal hemisphere. However,
micromeres in which β-catenin is prevented from entering the nucleus are unable to induce
the animal cells to form endoderm, and no second axis forms (Logan et al. 1998). β-Catenin
also accumulates in macromeres, but by a different means, and the Pmar1 gene is not activated
in macromeres (possibly due to the presence of SoxB1; see Kenny et al. 2003 and Lhomond et
al. 2012).
Sea Urchins and Tunicates 321
9 hr 9.5 hr 10 hr
Skeletal
rods
12 hr 13 hr 13.5 hr Syncytial cables Anus
Mouth
15 hr 17 hr 18 hr Blastopore
Syncytial cables 24 hr
had formerly been part of an epithelium lose their attachments and become individual,
migrating cells (Figure 10.11A ; see also Chapter 4).
EMTs are important events throughout animal development, and the pathways to
EMT are revisited in cancer cells, where the EMT is often necessary for the formation
of secondary tumor sites. There appear to be five distinct processes in this EMT, and
all of these events are regulated by the same micromere GRN that specifies and forms
the skeletogenic mesenchyme. However, each of these processes is controlled by a dif-
ferent subset of transcription factors. Even more surprisingly, none of the transcription
factors was the “master regulator” of the EMT (Saunders and McClay 2014). These five
events are:
1. Apical-basal polarity. The vegetal cells of the blastula elongate to form a thickened
“vegetal plate” epithelium (Figure 10.10, 9 hours).
2. Apical constriction of the micromeres. The cells alter their shape, wherein the apical
end (away from the blastocoel) becomes constricted. Apical constriction is seen
during gastrulation and neurulation in both vertebrates and invertebrates, and it
is one of the most important cell shape changes associated with morphogenesis
(Sawyer et al. 2010).
(A)
Extracellular
matrix fibril Basal lamina Skeletogenic
Blastocoel mesenchyme cell
3. Basement membrane remodeling. The cells must pass through the laminin-contain-
ing basement membrane. Originally, this membrane is uniform around the blasto-
coel. However, the micromere cells secrete proteases (protein-digesting enzymes)
that digest a hole in this membrane, shortly before the first mesenchymal cells are
seen inside the blastocoel (Figure 10.11B–D).
4. De-adhesion. The cadherins that couple epithelial cells together are degraded,
thereby allowing the cells to become free from their neighbors. Downregulation
of cadherins is controlled by the transcription factor Snail. The gene for snail is Figure 10.12 Positioning of skel-
activated by the Alx1 transcription factor, which in turn is regulated by the double- etogenic mesenchyme cells in the sea
urchin. (A) Positioning of the micromeres
negative gate of the gene regulatory network (Wu et al. 2007). The Snail transcrip-
to form the calcium carbonate skeleton is
tion factor is involved in de-adhesion throughout the animal kingdom (including
determined by the ectodermal cells. Skel-
cancers). etogenic mesenchyme cells are stained
5. Cell motility. The transcription factors of the GRN activate those proteins caus- green; β-catenin is red; skeletogenic
ing the active migration of the cells out of the epithelium and into the blastocoel. mesenchyme cells appear to accumulate
One of the most critical ones is Foxn2/3. This transcription factor is also seen in in those regions characterized by high
regulation of the motility of neural crest cells after their EMT (to form the face in β-catenin concentrations. (B) Nomarski
vertebrates). The cells bind to and travel on extracellular matrix proteins within the videomicrograph showing a long, thin
blastocoel (Figure 10.11E,F ). filopodium extending from a skeletogenic
mesenchyme cell to the ectodermal
The proteins necessary for selective migration, cell fusion, and skeleton formation wall of the gastrula, as well as a shorter
(e.g., biomineralization proteins) are also regulated by the transcription factors (such as filopodium extending inward from the
Alx1, Ets1, and Tbr) activated by the double-negative gate (Rafiq et al. 2014). At two sites ectoderm. Mesenchymal filopodia extend
near the future ventral side of the larva, many skeletogenic mesenchyme cells cluster through the extracellular matrix and
directly contact the cell membrane of the
together, fuse with one another, and initiate spicule formation (Hodor and Ettensohn
ectodermal cells. (C) Seen in cross sec-
1998; Lyons et al. 2015). If a labeled micromere from another embryo is injected into tion through the archenteron (top), the
the blastocoel of a gastrulating sea urchin embryo, it migrates to the correct location surface ectoderm expresses FGF in the
and contributes to the formation of the embryonic spicules (Ettensohn 1990; Peterson particular locations where skeletogenic
and McClay 2003). It is thought that the necessary positional information is provided micromeres congregate. Moreover, the
by the prospective ectodermal cells and their basal laminae (Figure 10.12A ; Harkey ingressing skeletal micromeres (bot-
and Whiteley 1980; Armstrong et al. 1993; Malinda and Ettensohn 1994). Only the tom; longitudinal section) express the
FGF receptor. When FGF signaling is
skeletogenic mesenchyme cells (and not other cell types or latex beads) are capable of
suppressed, the skeleton does not form
responding to these patterning cues (Ettensohn and McClay 1986). The extremely fine properly. (B from Miller et al. 1995, pho-
filopodia on the skeletogenic mesenchyme cells explore and sense the blastocoel wall tographs courtesy of J. R. Miller and D.
and appear to be sensing dorsal-ventral and animal-vegetal patterning cues from the McClay; C from Röttinger et al. 2008,
ectoderm (Figure 10.12B ; Malinda et al. 1995; Miller et al. 1995). photographs courtesy of T. Lepage.)
Two signals secreted by the blastula wall appear to be critical for this migration.
VEGF paracrine factors are emitted from two small regions of the ectoderm where the (C)
skeletogenic mesenchyme cells will congregate (Duloquin et al. 2007), and a fibroblast
growth factor (FGF) paracrine factor is made in the equatorial belt between endoderm
(A) (B)
324 Chapter 10
and ectoderm, becoming defined into the lateral domains where the skeletogenic mes-
enchyme cells collect (Figure 10.12C; Röttinger et al. 2008; McIntyre et al. 2014). The
skeletogenic mesenchyme cells migrate to these points of VEGF and FGF synthesis
and arrange themselves in a ring along the animal-vegetal axis (Figure 10.13). The
receptors for these paracrine factors appear to be specified by the double-negative gate
(Peterson and McClay 2003).
WEb Topic 10.3 Axis specification in sea urchin embryos The Nodal
Figure 10.14 Invagination of the protein determines the oral-aboral axis of the sea urchin pluteus larva during early
vegetal plate. (A) Vegetal plate invagina- gastrulation. During late gastrulation and the early larval period, Nodal specifies the
tion in Lytechinus variegatus, seen by
right half of the larva.
scanning electron microscopy of the
external surface of the early gastrula.
The blastopore is clearly visible. (B) Fate Invagination of the archenteron
map of the vegetal plate of the sea urchin
embryo, looking “upward” at the vegetal first stage of archenteron invagination As the skeletogenic mesenchyme cells
surface. The central portion becomes leave the vegetal region of the spherical embryo, important changes are occurring in the
the non-skeletogenic mesenchyme cells. cells that remain there. These cells thicken and flatten to form a vegetal plate, changing
The concentric layers around it become the shape of the blastula (see Figure 10.10, 9 hours). The vegetal plate cells remain bound
the foregut, midgut, and hindgut, respec- to one another and to the hyaline layer of the egg, and they move to fill the gaps caused
tively. The boundary where the endoderm by the ingression of the skeletogenic mesenchyme. The vegetal plate involutes inward
meets the ectoderm marks the anus. The
by altering its cell shape, then invaginates about one-fourth to one-half of the way into
non-skeletogenic mesenchyme and fore-
gut come from the veg2 layer; the midgut the blastocoel before invagination suddenly ceases. The invaginated region is called the
comes from veg1 and veg2 cells; the archenteron (primitive gut), and the opening of the archenteron at the vegetal pole is
hindgut and the ectoderm surrounding it the blastopore (Figure 10.14A; see also Figure 10.10, 10.5–11.5 hours).
come from the veg1 layer. (A from Morrill
and Santos 1985, courtesy of J. B. Mor-
rill; B after Logan and McClay 1999.)
(A) (B)
Ectoderm
Hindgut
veg1 Mesoderm
Midgut
veg2
Foregut
Gilbert Developmental Biology 11e
Small Associates
Sinauer Non-skeletogenic
micromeres
GIL10e_10.13 Date 01-29-15 mesenchyme Ectoderm
(skeletogenic Large
mesenchyme) micromeres
Sea Urchins and Tunicates 325
The movement of the vegetal plate into the blastocoel appears to be initiated by shape
changes in the vegetal plate cells and in the extracellular matrix underlying them (see
Kominami and Takata 2004). Actin microfilaments collect in the apical ends of the veg-
etal cells, causing these ends to constrict, forming bottle-shaped vegetal cells that pucker
inward (Kimberly and Hardin 1998; Beane et al. 2006). Destroying these cells with lasers
retards gastrulation. In addition, the hyaline layer at the vegetal plate buckles inward
due to changes in its composition, directed by the vegetal plate cells (Lane et al. 1993).
At the stage when the skeletogenic mesenchyme cells begin ingressing into the
blastocoel, the fates of the vegetal plate cells have already been specified (Ruffins and
Ettensohn 1996). The non-skeletogenic mesenchyme is the first group of cells to invagi-
nate, forming the tip of the archenteron and leading the way into the blastocoel. The
non-skeletogenic mesenchyme will form the pigment cells, the musculature around
the gut, and contribute to the coelomic pouches. The endodermal cells adjacent to the
macromere-derived secondary mesenchyme become foregut, migrating the farthest
into the blastocoel. The next layer of endodermal cells becomes midgut, and the last
circumferential row to invaginate forms the hindgut and anus (Figure 10.14B).
(A)
Early Later
gastrulation Archenteron gastrulation
1
2
3
2 1 4
4 5 3 5
76 6
7
Blastopore
the extension of a telescope. And lastly, the cells rearrange themselves by intercalating
between one another, like lanes of traffic merging (Ettensohn 1985; Hardin and Cheng
1986; Martins et al. 1998; Martik et al. 2012). This phenomenon, where cells intercalate
to narrow the tissue and at the same time lengthen it, is called convergent extension.
The final phase of archenteron elongation is initiated by the tension provided by
non-skeletogenic mesenchyme cells, which form at the tip of the archenteron and
remain there. These cells extend filopodia through the blastocoel fluid to contact the
inner surface of the blastocoel wall (Dan and Okazaki 1956; Schroeder 1981). The filo-
podia attach to the wall at the junctions between the blastomeres and then shorten,
pulling up the archenteron (Figure 10.15 B,C; see also Figure 10.12, 12 and 13 hours).
Hardin (1988) ablated non-skeletogenic mesenchyme cells of Lytechinus pictus gastrulae
with a laser, with the result that the archenteron could elongate only to about two-
thirds of the normal length. If a few non-skeletogenic mesenchyme cells were left,
elongation continued, although at a slower rate. Thus, in this species the non-skeleto-
genic mesenchyme cells play an essential role in pulling the archenteron upward to the
blastocoel wall during the last phase of invagination.
But can the filopodia of non-skeletogenic mesenchyme cells attach to any part of
the blastocoel wall, or is there a specific target in the animal hemisphere that must
be present for attachment to take place? Is there a region of the blastocoel wall that
is already committed to becoming the ventral side of the larva? Studies by Hardin
and McClay (1990) show that there is indeed a specific target site for filopodia that
differs from other regions of the animal hemisphere. The filopodia extend, touch the
blastocoel wall at random sites, and then retract. However, when filopodia contact a
particular region of the wall, they remain attached and flatten out against this region,
pulling the archenteron toward it. When Hardin and McClay poked in the other side of
the blastocoel wall so that contacts were made most readily with that region, the filo-
podia continued to extend and retract after touching it. Only when the filopodia found
their target tissue did they cease these movements. If the gastrula was constricted so
that the filopodia never reached the target area, the non-skeletogenic mesenchyme
cells continued to explore until they eventually moved off the archenteron and found
the target as freely migrating cells. There appears, then, to be a target region on what
is to become the ventral side of the larva that is recognized by the non-skeletogenic
mesenchyme cells, and which positions the archenteron near the region where the
mouth will form. Thus, as is characteristic of deuterostomes, the blastopore marks the
position of the anus.
As the top of the archenteron meets the blastocoel wall in the target region, many
of the non-skeletogenic mesenchyme cells disperse into the blastocoel, where they
proliferate to form the mesodermal organs (see Figure 10.10, 13.5 hours). Where the
archenteron contacts the wall, a mouth eventually forms. The mouth fuses with the
archenteron to create the continuous digestive tube of the pluteus larva. The remarkable
metamorphosis from pluteus larva to adult sea urchin will be described in Chapter 21.
Chorion
Yellow Sperm Yellow Sperm Yolk Yellow
Vegetal pole cytoplasm pronucleus cytoplasm pronucleus material crescent
6
Chabry and Driesch each seem to have gotten the results the other desired (see Fisher 1991).
Driesch, who saw the embryo as a machine, expected autonomous specification but showed
conditional specification (regulative development). Chabry, a Socialist who believed everyone
starts off equally endowed, expected to find conditional specification but instead discovered
autonomous specification (mosaic development). Recent research on gene regulatory networks
has begun to provide a molecular basis for this regulation (Peter et al. 2012).
Sea Urchins and Tunicates 329
7
We will see the importance of Brachyury in vertebrate notochord formation as well. Indeed,
the notochord is the “cord” that links the tunicates with the vertebrates, and Brachyury appears
to be the gene that specifies the notochord (Satoh et al. 2012). As we will also see, Tbx6 (which
is closely related to Brachyury) is important in forming vertebrate musculature.
330 Chapter 10
activate cascades that block muscle formation (a role for these factors that is conserved
in vertebrates). As seen in Figure 10.21, the presence of Macho-1 changes the responses
to endodermal FGFs, causing the anterior cells to form notochord while the posterior
cells become mesenchyme.
WEb Topic 10.6 Gastrulation in tunicates Tunicate embryos follow the deu-
terostome pattern of gastrulation, but do so very differently than sea urchins.
10 Snapshot Summary
Early Development in Sea Urchins and Tunicates
1. In both sea urchins and tunicates, the blastopore 3. Sea urchin cell fates are determined both by autono-
becomes the anus and the mouth is formed elsewhere; mous and conditional modes of specification. The
this deuterostome mode of gastrulation is also charac- micromeres are specified autonomously and become
teristic of chordates (including vertebrates). a major signaling center for conditional specification of
2. Sea urchin cleavage is radial and holoblastic. At fourth other lineages. Maternal β-catenin is important for the
cleavage, however, the vegetal tier divides into large autonomous specification of the micromeres.
macromeres and small micromeres. The animal pole 4. Differential cell adhesion is important in regulating sea
divides to form the mesomeres. urchin gastrulation. The micromeres detach first from
332 Chapter 10
the vegetal plate and move into the blastocoel. They 9. The ingression of the skeletogenic mesenchyme is
form the skeletogenic mesenchyme, which becomes accomplished through an epithelial-mesenchymal transi-
the skeletal rods of the pluteus larva. The vegetal plate tion in which these cells lose cadherins and gain affinity
invaginates to form the endodermal archenteron, with a to adhere to the matrix within the blastocoel.
tip of non-skeletogenic mesenchyme cells. The archen- 10. Archenteron invagination and growth are coordinated
teron elongates by convergent extension and is guided by cell shape changes, cell proliferation, and convergent
to the future mouth region by the non-skeletogenic extension. In the final stage in invagination, the tip of the
mesenchyme. archenteron is actively pulled to the blastocoel roof by
5. The large micromeres become the skeleton of the larva; the non-skeletogenic mesenchyme cells.
the small micromeres contribute to the coelomic pouch- 11. The adult sea urchin rudiment, called the imaginal rudi-
es and the germ cells of the adult. ment, forms from the left coelomic pouch under the
6. The micromeres regulate the fates of their neighboring influence of BMPs.
cells through juxtacrine and paracrine pathways. They 12. The tunicate embryo divides holoblastically and
can convert animal cells into endoderm. bilaterally.
7. Gene regulatory networks are modules that work by 13. The yellow cytoplasm contains muscle-forming deter-
logic circuits to integrate inputs into coherent cellular minants that act autonomously. The heart and nervous
outputs. The micromeres integrate maternal compo- system are formed conditionally by signaling interactions
nents such that the placement of Disheveled at the between blastomeres.
vegetal pole enables the formation of β-catenin to help
14. Macho-1 is the tunicate muscle determinant (a tran-
activate the Pmar1 gene, whose products inhibit the
scription factor that is sufficient to activate muscle-spec-
HesC gene. The product of HesC inhibits skeletogenic
ifying genes). The notochord and mesenchyme are gen-
genes. Thus, by locally inhibiting the inhibitor, the most
erated conditionally by paracrine factors such as FGFs.
vegetal cells become committed to skeleton production.
This is called a double-negative gate. 15. FGFs induce expression of Brachyury in neighboring
cells, inducing these cells to become the notochord.
8. The Nodal protein determines the oral-aboral axis of the
sea urchin pluteus larva during early gastrulation. During 16. The transcription factor Nodal appears to specify the
late gastrulation and the early larval period, it specifies left-right axis in tunicates, in which it is expressed solely
the right half of the larva. on the left side of the body (which is also the case in
snails and vertebrates).
Further Reading
Lemaire, P. 2009. Unfolding a chordate developmental pro- Revilla-i-Domingo, R., P. Oliveri and E. H. Davidson. 2010.
gram, one cell at a time. Dev. Biol. 332: 48–60. A missing link in the sea urchin embryo gene regulatory
Lyons, D. C., M. L. Martik, L. R. Saunders and D. R. McClay. network: hesC and the double-negative specification of micro-
2014. Specification to biomineralization: Following a single cell meres. Proc. Natl. Acad. Sci. USA 104: 12383–12388.
type as it constructs a skeleton. Integr. Comp. Biol. 54: 723–733. Saunders, L. R. and D. R. McClay. 2014. Sub-circuits of a gene
McClay, D. R. 2016. Sea urchin morphogenesis. Curr. Top. Dev. regulatory network control a developmental epithelial-mesen-
Biol. 117: 15–30. chymal transition. Development 141: 1503–1513.
Nishida, H. and K. Sawada. 2001. Macho-1 encodes a local- Wu, S. Y., M. Ferkowicz and D. R. McClay. 2010. Ingression of
ized mRNA in ascidian eggs that specifies muscle fate during primary mesenchyme cells of the sea urchin embryo: A pre-
embryogenesis. Nature 409: 724–729. cisely timed epithelial-mesenchymal transition. Birth Def. Res.
C Embryol. Today 81: 241–252.
Peter, I. S. and E. H. Davidson. 2016. Implications of develop-
mental gene regulatory networks inside and outside develop-
mental biology. Curr. Top. Dev. Biol. 117: 237–252.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
11
The Punchline
Amphibians have played major roles in experimental embryology since the earliest
days of the field. In the frog, fertilization induces protein movements in the egg
cytoplasm, leading to the accumulation of β-catenin in the egg’s future dorsal region.
In this future dorsal portion of the embryo, β-catenin activates genes that establish a
crucial embryonic structure dubbed “the organizer.” The organizer secretes proteins
that block the activities of paracrine factors (mainly BMPs) that would ventralize the
mesoderm and turn ectoderm into epidermis. As a result, the ectoderm adjacent to
the organizer become specified as neural tissue. Inhibition of Wnt signaling is critical
to successful formation of the head, and Wnt protein inhibitors are produced in the
anterior portion of the organizer tissues. Although the cleavage and gastrulation
patterns of fish are very different from those of frogs, the same pattern of axis-
specifying gene activity appears to be working in both groups of vertebrates.
334 Chapter 11 (B) Danio rerio (zebrafish)
(A)
Tunicates (see Ch. 7)
Fish
Notochord
(C) Xenopus laevis
Amphibians
Vertebrae
Jointed
limbs Reptiles and birds
(tetrapods)
Amniote egg
Mammals
VERTEBRATES
Figure 11.1 (A) Phylogenetic tree of the chordates showing the relationship of the verte-
brate groups. The embryonic development of fish and amphibians must be carried out in moist
environments. The evolution of the shelled amniote egg permitted development to proceed on
dry land for the reptiles and their descendants, as we will see in Chapter 12. (B) The zebrafish
(Danio rerio) has become a popular model organism for the study of development. It is the first
vertebrate species to be subjected to mutagenesis studies similar to those that have been car-
ried out on Drosophila. (C) Xenopus laevis, the African clawed frog, is one of the most studied
amphibians because it has the rare property of not having a breeding season and thus can gen-
erate embryos year-round. (B courtesy of D. McIntyre; C © Michael Redmer/Visuals Unlimited.)
VADE MECUM
bodies are patterned and structured. As Jean Rostand wrote in 1960, “Theories come
and theories go. The frog remains.”
The Vade Mecum segment
“Amphibians” has video of the
WATCH DEVELOPMENT 11.1 A two-minute video provides a speedy overview of frog
events of frog development from
development from fertilization to larvae.
fertilization through the meta-
morphosed adult, using three-
dimensional models as well as
living Xenopus. Fertilization, Cortical Rotation, and Cleavage
Most frogs have external fertilization, with the male fertilizing the eggs as the female is
laying them. Even before fertilization, the frog egg has polarity, in that the dense yolk
is at the vegetal (bottom) end, whereas the animal part of the egg (the upper half) has
very little yolk. As we will also see, certain proteins and mRNAs are already localized
in specific regions of the unfertilized egg.
Fertilization can occur anywhere in the animal hemisphere of the amphibian egg.
The point of sperm entry is important because it determines dorsal-ventral polarity. The
point of sperm entry marks the ventral (belly) side of the embryo, while the site 180º
opposite the point of sperm entry will mark the dorsal (spinal) side. The sperm cen-
triole, which enters the egg with the sperm nucleus, organizes the microtubules of the
egg into parallel tracks in the vegetal cytoplasm, separating the outer cortical cytoplasm
from the yolky internal cytoplasm (Figure 11.2A,B). These microtubular tracks allow
the cortical cytoplasm to rotate with respect to the inner cytoplasm. Indeed, these par-
allel arrays are first seen immediately before rotation starts, and they disappear when
rotation ceases (Elinson and Rowning 1988; Houliston and Elinson 1991).
Gilbert In the zygote, the cortical cytoplasm rotates about 30º with respect to the internal
Developmental Biology 10e
cytoplasm , Sinauer11.2C
(Figure Associates
). In some cases, this exposes a region of gray-colored inner
DevBio11e_11.011 Date 01-25-16
cytoplasm directly opposite the sperm entry point (Figure 11.2D; Roux 1887; Ancel and
Vintenberger 1948). This region, the gray crescent, is where gastrulation will begin.
Even in Xenopus eggs, which do not expose a gray crescent, cortical rotation occurs and
Amphibians and Fish 335
Vegetal region
cytoplasmic movements can be seen (Manes and Elinson 1980; Vincent et al. 1986). Gas-
trulation begins at the part of the egg opposite the point of sperm entry, and this region
will become the dorsal portion of the embryo. The microtubular arrays organized by the
sperm centriole at fertilization plays a large role in initiating these movements. There-
fore, the dorsal-ventral axis of the larva can be traced back to the point of sperm entry.
WATCH DEVELOPMENT 11.2 See the microtubular arrays cortical rotation during the
first cleavage of Xenopus eggs.
(A) (B)
Animal Blastocoel
1 2 1 2 3
1
Vegetal
(C) Figure 11.3 Cleavage of a Xenopus egg. (A) The first three cleavage furrows,
Epidermal numbered in order of appearance. Because the vegetal yolk impedes cleavage, the
ectoderm second division begins in the animal region of the egg before the first division has
Neural plate divided the vegetal cytoplasm completely. The third division is displaced toward
ectoderm the animal pole. (B) As cleavage progresses, the vegetal hemisphere ultimately
contains larger and fewer blastomeres than the animal hemisphere. The final draw-
Lateral plate Somites and
ing shows a cross section through a mid-blastula stage embryo. (C) Fate map of
mesoderm notochord
the Xenopus embryo superimposed on the mid-blastula stage. (D) SEMs of the
Blastopore first, second, and fourth cleavages. Note the size discrepancies of the animal and
vegetal cells after third cleavage. (A,B after Carlson 1981; C after Lane and Smith
Somites
Heart 1999 and Newman and Kreig 1999; D from Beams and Kessel 1976, courtesy of
Endoderm
the authors and L. Biedler.)
(D)
While the first cleavage furrow is still cleaving the yolky cytoplasm of the vegetal
hemisphere, the second cleavage has already started near the animal pole. This cleavage
Cleavage is at right angles to the first one and is also meridional. The third cleavage is equato-
furrow rial. However, because of the vegetally placed yolk, the third cleavage furrow is not at
the equator but is displaced toward the animal pole (Valles et al. 2002). It divides the
amphibian embryo into four small animal blastomeres (micromeres) and four large
blastomeres (macromeres) in the vegetal region. Despite their unequal sizes, the blas-
tomeres continue to divide at the same rate until the twelfth cell cycle (with only a small
delay of the vegetal cleavages). As cleavage progresses, the animal region becomes
packed with numerous small cells, while the vegetal region contains a relatively small
number of large, yolk-laden macromeres. An amphibian embryo containing 16 to 64
cells is commonly called a morula (plural morulae; Latin, “mulberry,” whose shape it
vaguely resembles). At the 128-cell stage, the blastocoel becomes apparent, and the
embryo is considered a blastula (Figure 11.3B).
Numerous cell adhesion molecules keep the cleaving blastomeres together. One
of the most important of these is EP-cadherin. The mRNA for this protein is supplied
in the oocyte cytoplasm. If this message is destroyed by antisense oligonucleotides so
that no EP-cadherin protein is made, the adhesion between blastomeres is dramati-
cally reduced, resulting in the obliteration of the blastocoel (Heasman et al. 1994a,b).
Membrane adhesions may have a further role; it is probable that the coordination of cell
division is mediated through waves of membrane contractions (Chang and Ferrell 2013).
Although amphibian development differs from species to species (see Hurtado and
De Robertis 2007), in general the animal hemisphere cells will give rise to the ectoderm,
the vegetal cells will give rise to the endoderm, and the cells beneath the blastocoel
cavity will become mesoderm (Figure 11.3C ). The cells opposite the point of sperm
entry will become the neural ectoderm, the notochord mesoderm, and the pharyngeal
(head) endoderm (Keller 1975, 1976; Landstrom and Løvtrup 1979).
The amphibian blastocoel serves two major functions. First, it can change its shape
such that cell migration can occur during gastrulation; and second, it prevents the cells
beneath it from interacting prematurely with the cells above it. When Nieuwkoop (1973)
took embryonic newt cells from the roof of the blastocoel in the animal hemisphere (a
region often called the animal cap) and placed them next to the yolky vegetal cells
from the base of the blastocoel, the animal cap cells differentiated into mesodermal
tissue instead of ectoderm. Thus, the blastocoel prevents the premature contact of the
vegetal cells with the animal cap cells, and keeps the animal cap cells undifferentiated.
Amphibians and Fish 337
Amphibian Gastrulation
The study of amphibian gastrulation is both one of the oldest and one of the newest
areas of experimental embryology (see Beetschen 2001; Braukmann and Gilbert 2005).
Even though amphibian gastrulation has been studied extensively since the 1870s, new
live-imaging techniques have emerged that are giving us a new appreciation of the
intricacies of these cell movements (Papan et al. 2007; Moosmann et al. 2013). More-
over, most of our theories concerning the mechanisms of gastrulation and axis specifi-
cation have been revised over the past two decades. The study of these developmental
movements has also been complicated by the fact that there is no single way amphib-
ians gastrulate; different species employ different means to achieve the same goal. In
recent years, the most intensive investigations have focused on Xenopus laevis, so we
will concentrate on the mechanisms of gastrulation in that species.
WATCH DEVELOPMENT 11.3 See Xenopus gastrulation from the outside, looking at
the blastopore lip.
entry; see Figure 11.2C). Here the cells invaginate to form the slitlike blastopore. These
bottle cells change their shape dramatically. The main body of each cell is displaced
toward the inside of the embryo while maintaining contact with the outside surface
by way of a slender neck. As in sea urchins, the bottle cells will initiate the formation
(F)
(D) (E) Mesenchyme
Ectoderm Ectoderm
Dorsal
mesoderm Archenteron Notochord
Dorsal
Notochord
blastopore Dorsal
AP lip Lip blastopore lip
Lateral
AP Endoderm
blastopore
Anterior lip internalized
endomesoderm AP
Ventral Endoderm Yolk plug Ventral
Ectoderm blastopore lip mesoderm
Figure 11.4 Cell movements during frog gastrulation. The draw- will change as gastrulation continues. (C,D) Mid-gastrulation. The
ings show meridional sections cut through the middle of the embryo archenteron forms and displaces the blastocoel, and cells migrate
and positioned so that the vegetal pole is tilted toward the observer from the lateral and ventral lips of the blastopore into the embryo.
and slightly to the left. The major cell movements are indicated by The cells of the animal hemisphere migrate down toward the vegetal
arrows, and the superficial animal hemisphere cells are colored region, moving the blastopore to the region near the vegetal pole.
so that their movements can be followed. Below the drawings (E,F) Toward the end of gastrulation, the blastocoel is obliterated,
are corresponding micrographs imaged with a surface imaging the embryo becomes surrounded by ectoderm, the endoderm has
microscope (see Ewald et al. 2002). (A,B) Early gastrulation. The been internalized, and the mesodermal cells have been positioned
bottle cells of the margin move inward to form the dorsal lip of the between the ectoderm and endoderm. (Drawings after Keller 1986;
blastopore, and the mesodermal precursors involute under the roof micrographs courtesy of Andrew Ewald and Scott Fraser.)
of the blastocoel. AP marks the position of the animal pole, which
Gilbert
Developmental Biology 10e, Sinauer Associates
Amphibians and Fish 339
of the archenteron (primitive gut).1 However, unlike sea urchins, gastrulation in the
frog begins not in the most vegetal region but in the marginal zone —the region sur-
rounding the equator of the blastula, where the animal and vegetal hemispheres meet
(Figure 11.4A,B). Here the endodermal cells are not as large or as yolky as the most
vegetal blastomeres.
But cell involution is not a passive event. At least 2 hours before the bottle cells form,
internal cell rearrangements propel the cells of the dorsal floor of the blastocoel toward
the animal cap. This vegetal rotation places the prospective pharyngeal endoderm
cells adjacent to the blastocoel and immediately above the involuting mesoderm (see
Figure 11.5D). These cells then migrate along the basal surface of the blastocoel roof,
traveling toward the future anterior of the embryo (Figure 11.4C–E ; Nieuwkoop and
Florschütz 1950; Winklbauer and Schürfeld 1999; Ibrahim and Winklbauer 2001). The
superficial layer of marginal cells is pulled inward to form the endodermal lining of the
archenteron, merely because it is attached to the actively migrating deep cells. Although
experimentally removing the bottle cells does not affect the involution of the deep or
superficial marginal zone cells into the embryo, removal of the deep involuting mar-
ginal zone (IMZ) cells stops archenteron formation.
involution at the blastopore lip After the bottle cells have brought the invo-
luting marginal zone into contact with the blastocoel wall, the IMZ cells involute into
the embryo. As the migrating marginal cells reach the lip of the blastopore, they turn
inward and travel along the inner surface of the outer animal hemisphere cells (i.e., the
blastocoel roof; Figure 11.4D–F ). The order of the march into the embryo is deter-
mined by the vegetal rotation that abuts the prospective pharyngeal endoderm against
the inside of the animal cap tissue (Winklebauer and Damm 2011). Meanwhile, the
animals cells undergo epiboly, producing a stream of cells that converge at and become
the dorsal blastopore lip.
The first cells to compose the dorsal blastopore lip and enter into the embryo are
the cells of the prospective pharyngeal endoderm of the foregut (Figure 11.5). These
cells migrate anteriorly beneath the surface ectoderm of the blastocoel.2 These anterior
endoderm cells transcribe the hhex gene, which encodes a transcription factor that is
critical for forming the head and heart (Rankin et al. 2011). As these first cells pass
into the interior of the embryo, the dorsal blastopore lip becomes composed of cells
that involute into the embryo to become the prechordal plate, the precursor of the
head mesoderm. Prechordal plate cells transcribe the goosecoid gene, whose product
is a transcription factor that activates numerous genes controlling head formation.
It achieves this activation indirectly, by repressing those genes (e.g., Wnt8) that repress
head development. This phenomenon—the activation of genes by repressing their
repressors—is a major feature of animal development, as we saw in the double-negative
gate that specifies sea urchin micromeres.
1
Ray Keller and his students showed that the peculiar shape change of the bottle cells is needed
to initiate gastrulation in Xenopus. It is the constriction of these cells that forms the blastopore,
and it brings subsurface marginal cells into contact with the basal region of the surface blas-
tomeres. Once this contact is made, the marginal cells begin to migrate along the extracellular
matrix on the basal region of these surface cells. When such involution movements are under-
way, the bottle cells are no longer essential. At this point, they have done their job and can be
removed without stopping gastrulation (Keller 1981; Hardin and Keller 1988). Thus, in Xenopus,
the major factor in the movement of cells into the embryo appears to be the involution of the
subsurface cells rather than the invagination of superficial marginal bottle cells.
2
The pharyngeal endoderm and head mesoderm cannot be separated experimentally at this
stage, so they are sometimes referred to collectively as the head endomesoderm. The notochord
is the basic unit of the dorsal mesoderm, but it is thought that the dorsal portion of the somites
may have similar properties to the notochord. X-ray phase-contrast and in vitro microtomogra-
phy have shown new details of gastrulation that have yet to be integrated into molecular mod-
els (Moosmann et al. 2013).
340 Chapter 11
Site of
blastopore
formation
Vegetal
endoderm
Bottle cells Blastopore Bottle cells
Figure 11.5 Early movements of
Xenopus gastrulation. (A) At the begin-
ning of gastrulation, the involuting mar- Next to involute through the dorsal blastopore lip are the cells of the chordameso-
ginal zone (IMZ) forms. Pink represents derm. These cells will form the notochord, the transient mesodermal rod that plays an
the prospective head mesoderm (goo- important role in inducing and patterning the nervous system. Chordamesoderm cells
secoid expression). Chordamesoderm express the Xbra (Brachyury) gene, whose product (as we saw in the previous chapter)
(Xbra expression) is red. (B) Vegetal is a transcription factor critical for notochord formation. Thus, the cells constituting
rotation (arrows) pushes the prospective
the dorsal blastopore lip are constantly changing as the original cells migrate into the
pharyngeal endoderm (orange; speci-
fied by hhex and cerberus expression)
embryo and are replaced by cells migrating downward, inward, and upward.
to the side of the blastocoel. (C,D) The As the new cells enter the embryo, the blastocoel is displaced to the side opposite
vegetal endoderm (yellow) movements the dorsal lip. Meanwhile, the lip expands laterally and ventrally as bottle cell formation
push the pharyngeal endoderm forward, and involution continue around the blastopore. The widening blastopore “crescent”
driving the mesoderm passively into the develops lateral lips and, finally, a ventral lip over which additional mesodermal and
embryo and toward the animal pole. The endodermal precursor cells pass (Figure 11.6). These cells include the precursors of
ectoderm (blue) begins epiboly. (After
the heart and kidney. With the formation of the ventral lip, the blastopore has formed
Winklbauer and Schürfeld 1999.)
a ring around the large endodermal cells that remain exposed on the vegetal surface.
Yolk
plug
Blastopore lip
Bilateral lips Yolk plug Ventral lip
Amphibians and Fish 341
This remaining patch of endoderm is called the yolk plug; it, too, is eventually inter-
nalized (at the site of the anus). At that point, all the endodermal precursors have been
brought into the interior of the embryo, the ectoderm has encircled the surface, and the
mesoderm has been brought between them. The first cells into the blastopore become
the most anterior.
Watch Development 11.4 Watch the video by Dr. Christopher Watters from which
the photographs in Figure 11.6 were taken.
convergent extension of the dorsal mesoderm Figure 11.7 depicts the behav-
ior of the involuting marginal zone cells at successive stages of Xenopus gastrulation
(Keller and Schoenwolf 1977; Hardin and Keller 1988). The IMZ is originally several
layers thick. Shortly before their involution through the blastopore lip, the several layers
of deep IMZ cells intercalate radially to form one thin, broad layer. This intercalation
further extends the IMZ vegetally (Figure 11.7A). At the same time, the superficial
cells spread out by dividing and flattening. When the deep cells reach the blastopore lip,
they involute into the embryo and initiate a second type of intercalation. This intercala-
tion causes a convergent extension along the mediolateral axis that integrates several
mesodermal streams to form a long, narrow band (Figure 11.7B). The anterior part of
this band migrates toward the animal cap. Thus, the mesodermal stream continues to
migrate toward the animal pole, and the overlying layer of superficial cells (including
Figure 11.7 Xenopus gastrulation
the bottle cells) is passively pulled toward the animal pole, thereby forming the endo-
continues. (A) The deep marginal cells
dermal roof of the archenteron (see Figures 11.4 and 11.7). The radial and mediolateral flatten, and the formerly superficial cells
intercalations of the deep layer of cells appear to be responsible for the continued move- form the wall of the archenteron. (B)
ment of mesoderm into the embryo. Radial intercalation, looking down at the
Several forces appear to drive convergent extension. The first force is a polarized cell dorsal blastopore lip from the dorsal sur-
cohesion, wherein the involuted mesodermal cells send out protrusions to contact one face. In the noninvoluting marginal zone
another. These “reachings out” are not random, but occur toward the midline of the (NIMZ) and the upper portion of the IMZ,
deep (mesodermal) cells are intercalating
embryo and require an extracellular fibronectin matrix (Goto et al. 2005; Davidson et al.
radially to make a thin band of flattened
2008). These intercalations, both mediolaterally and radially, are stabilized by the planar cells. This thinning of several layers into a
cell polarity (PCP) pathway that is initiated by Wnts (Jessen et al. 2000; Shindo and few causes convergent extension (white
Wallingford 2014; Ossipova et al. 2015). The second force is differential cell cohesion. arrows) toward the blastopore lip. Just
During gastrulation, the genes encoding the adhesion proteins paraxial protocad- above the lip, mediolateral intercalation of
herin and axial protocadherin become expressed specifically in the paraxial (somite- the cells produces stresses that pull the
forming; see Chapter 17) mesoderm and the notochord, respectively. An experimental IMZ over the lip. After involuting over the
lip, mediolateral intercalation continues,
dominant-negative form of axial protocadherin prevents the presumptive notochord
elongating and narrowing the axial meso-
cells from sorting out from the paraxial mesoderm and blocks normal axis formation. derm. (After Wilson and Keller 1991 and
Winklbauer and Schürfeld 1999.)
(A) (B)
Bottle cells Precursors of
Precursors of Ectoderm pharyngeal endoderm
head mesoderm Archenteron and head mesoderm
Animal pole
Re-spread
bottle cells NIMZ Blastocoel
Superficial IMZ Archenteron
cells move toward IMZ
animal pole Endoderm
Notochord
precursors
Mediolateral
intercalation
IMZ extends Blastopore Blastopore
vegetally lip lip
342 Chapter 11
Nodal Vg1
Nodal Vg1 Nodal
VegT (dorsal) Vg1 Endoderm
m
g1
VegT V
mRNA
Vegetal
Figure 11.10 Model for the specifica-
tion of the mesoderm. The vegetal region
of the oocyte has accumulated mRNA for is critical in sustaining the mesoderm (Figure 11.10). In the absence of such induction,
the transcription factor VegT and (in the cells become ectoderm (Fukuda et al. 2010).
future dorsal region) mRNA for the Nodal In addition, the Vg1 mRNA that has been stored in the vegetal cytoplasm is also
paracrine factor Vg1. At the late blastula translated. The production of Vg1 (another Nodal-like protein) is needed to activate
stage, the Vg1 mRNA is translated and
other genes in the dorsal mesoderm. If either Nodal or Vg1 signaling is blocked, there is
Vg1 induces the future dorsal mesoderm
to transcribe the genes for several Wnt little or no mesoderm induction (Kofron et al. 1999; Agius et al. 2000; Birsoy et al. 2006).
antagonists (such as Dickkopf). The Thus, by the late blastula stage, the fundamental germ layers are becoming specified.
VegT message is also translated, and The vegetal cells are specified as endoderm through transcription factors such as Sox17.
VegT activates nuclear genes encod- The equatorial cells are specified as mesoderm by transcription factors such as Eome-
ing Nodal proteins. These TGF-β family sodermin. And the animal cap—which has not begun receiving signals yet—becomes
members activate the expression of the specified as ectoderm (see Figure 11.10).
transcription factor Eomesodermin in the
presumptive mesoderm. Eomesodermin,
The dorsal-ventral and anterior-posterior axes
with the help of activated Smad2 from
the Nodal proteins, activates nuclear Although animal-vegetal polarity initiates specification of the germ layers, the anterior-
genes encoding VegT. In this way, VegT posterior, dorsal-ventral, and left-right axes are specified by events triggered at fertil-
expression has gone from maternal ization but not realized until gastrulation. In Xenopus (and in other amphibians), the
mRNAs in the presumptive endoderm to formation of the anterior-posterior axis is inextricably linked to the formation of the
nuclear expression in the presumptive dorsal-ventral axis. This, as we will see, is predicated on fertilization events that will
mesoderm. (After Fukuda et al. 2010.)
place the transcription factor β-catenin in the region of the egg opposite the point of
Gilbert sperm entry and will specify that region of the egg to be the dorsal region of the embryo.
Developmental Biology 10e, Sinauer Associates Once β-catenin is localized in this region of the egg, the cells containing β-catenin
DevBio11e_11.10 Date 02-09-16 will induce expression of certain genes and thus initiate the movement of the involuting
mesoderm. This movement will establish the anterior-posterior axis of the embryo. The
first mesodermal cells to migrate over the dorsal blastopore lip will induce the ectoderm
above them to produce anterior structures such as the forebrain; mesoderm that involutes
later will signal the ectoderm to form more posterior structures, such as the hindbrain
and spinal cord. This process, whereby the central nervous system forms through interac-
tions with the underlying mesoderm, has been called primary embryonic induction and is
one of the principal ways in which the vertebrate embryo become organized. Indeed, its
discoverers called the dorsal blastopore lip and its descendants “the organizer,” and found
that this region is different from all the other parts of the embryo. In the early twentieth
century, experiments by Hans Spemann and his students at the University of Freiburg,
Germany, framed the questions that experimental embryologists would continue to ask
for most of the rest of the century and resulted in a Nobel Prize for Spemann in 1935 (see
Hamburger 1988; De Robertis and Aréchaga 2001; Sander and Fässler 2001).
(A) 8-Cell stage (B) 16-Cell stage (C) 14 Days Figure 11.11 Spemann’s demonstra-
tion of nuclear equivalence in newt cleav-
Ligature
age. (A) When the fertilized egg of the
newt Triturus taeniatus was constricted
by a ligature, the nucleus was restricted
to one half of the embryo. The cleav-
age on that side of the embryo reached
the 8-cell stage, while the other side
remained undivided. (B) At the 16-cell
Nuclei Nucleus stage, a single nucleus entered the as-yet
migrates undivided half, and the ligature was fur-
ther constricted to complete the separa-
tion of the two halves. (C) After 14 days,
after fertilizing a newt egg, Spemann used a baby’s hair (taken from his infant daugh- each side had developed into a normal
ter) to “lasso” the zygote in the plane of the first cleavage. He then partially constricted embryo. (After Spemann 1931.)
the egg, causing all the nuclear divisions to remain on one side of the constriction.
Eventually—often as late as the 16-cell stage—a nucleus would escape across the con-
striction into the non-nucleated side. Cleavage then began on this side too, whereupon
Spemann tightened the lasso until the two halves were completely separated. Twin
larvae developed, one slightly more advanced than the other (Figure 11.11). Spemann
concluded from this experiment that early amphibian nuclei were genetically identical
and that each cell was capable of giving rise to an entire organism.
However, when Spemann performed a similar experiment
with the constriction still longitudinal but perpendicular to the (A) (B)
plane of the first cleavage (i.e., separating the future dorsal and
ventral regions rather than the right and left sides), he obtained
a different result altogether. The nuclei continued to divide on
both sides of the constriction, but only one side—the future dorsal
side of the embryo—gave rise to a normal larva. The other side
produced an unorganized tissue mass of ventral cells, which Spe- First cleavage
mann called the Bauchstück (“belly piece”). This tissue mass was
a ball of epidermal cells (ectoderm) containing blood cells and
mesenchyme (mesoderm) and gut cells (endoderm), but it con- Gray crescent
tained no dorsal structures such as nervous system, notochord,
or somites.
Why did these two experiments have such different results? Separation of
blastomeres and
One possibility was that when the egg was divided perpendicular
development
to the first cleavage plane, some cytoplasmic substance was not
equally distributed into the two halves. Fortunately, the salaman-
der egg was a good organism to test that hypothesis. As we saw
earlier in this chapter (see Figure 11.2), there are dramatic move-
ments in the cytoplasm following the fertilization of amphibian
eggs, and in some amphibians these movements expose a gray,
crescent-shaped area of cytoplasm in the region directly opposite
the point of sperm entry. The first cleavage plane normally splits
this gray crescent equally between the two blastomeres (see Fig- “Belly
ure 11.2D). If these cells are then separated, two complete larvae piece”
develop (Figure 11.12A). However, should this cleavage plane Normal Normal Normal
be aberrant
Gilbert (either in the rare natural event or in an experiment), development development development
Developmental Biology
the gray crescent 10e, Sinauer
material Associates
passes into only one of the two blasto-
DevBio11e_11.11 Date 01-25-16 Figure 11.12 Asymmetry in the amphibian egg. (A) When the
meres. Spemann’s work revealed that when two blastomeres are
separated such that only one of the two cells contains the cres- egg is divided along the plane of first cleavage into two blasto-
meres, each of which gets half of the gray crescent, each experi-
cent, only the blastomere containing the gray crescent develops
mentally separated cell develops into a normal embryo. (B) When
normally (Figure 11.12B). only one of the two blastomeres receives the entire gray crescent,
It appeared, then, that something in the region of the gray cres- it alone forms a normal embryo. The other blastomere produces
cent was essential for proper embryonic development. But how did it a mass of unorganized tissue lacking dorsal structures. (After
function? What role did it play in normal development? The most Spemann 1931.)
346 Chapter 11
important clue came from fate maps, which showed that the gray crescent region gives
rise to those cells that form the dorsal lip of the blastopore. These dorsal lip cells are com-
mitted to invaginate into the blastula, initiating gastrulation and the formation of the
head endomesoderm and notochord. Because all future amphibian development depends
on the interaction of cells that are rearranged during gastrulation, Spemann speculated
that the importance of the gray crescent material lies in its ability to initiate gastrulation,
and that crucial changes in cell potency occur during gastrulation. In 1918, he performed
experiments that showed both statements to be true. He found that the cells of the early
gastrula were uncommitted, but that the fates of late gastrula cells were determined.
Spemann’s demonstration involved exchanging tissues between the gastrulae of two
species of newts whose embryos were differently pigmented—the darkly pigmented
Triturus taeniatus and the nonpigmented T. cristatus. When a region of prospective epi-
dermal cells from an early gastrula of one species was transplanted into an area in an
early gastrula of the other species and placed in a region where neural tissue normally
formed, the transplanted cells gave rise to neural tissue. When prospective neural tis-
sue from early gastrulae was transplanted to the region fated to become belly skin, the
(A) Transplantation in early gastrula neural tissue became epidermal (Figure 11.13A ; Table 11.1). Thus, cells of the early
Presumptive newt gastrula exhibit conditional (induction-dependent) specification: their ultimate
neural ectoderm Presumptive fate depends on their location in the embryo.
epidermis However, when the same interspecies transplantation
Neural plate experiments were performed on late gastrulae, Spemann
obtained completely different results. Rather than differentiat-
ing in accordance with their new location, the transplanted cells
exhibited autonomous (mosaic, independent) development. Their
prospective fate was determined, and the cells developed inde-
pendently of their new embryonic location. Specifically, pro-
Epidermis spective neural cells now developed into brain tissue even when
forms placed in the region of prospective epidermis (Figure 11.13B),
(B) Transplantation in late gastrula and prospective epidermis formed skin even in the region of
the prospective neural tube. Within the time separating early
Presumptive
neural ectoderm Presumptive
epidermis
Neural plate Figure 11.13 Determination of ectoderm during newt gastrulation.
Presumptive neural ectoderm from one newt embryo is transplanted
into a region in another embryo that normally becomes epidermis.
(A) When the tissues are transferred between early gastrulae, the
presumptive neural tissue develops into epidermis, and only one neu-
ral plate is seen. (B) When the same experiment is performed using
late-gastrula tissues, the presumptive neural cells form neural tissue,
Neural plate thereby causing two neural plates to form on the host. (After Saxén
tissue forms and Toivonen 1962.)
Amphibians and Fish 347
and late gastrulation, the potencies of these groups of cells had become restricted to
their eventual paths of differentiation. Something caused them to become committed
to epidermal and neural fates. What was happening?
In these experiments, Spemann and Mangold once again used the differently pig-
mented embryos of Triturus taeniatus and T. cristatus so they could identify host and
donor tissues on the basis of color. When the dorsal lip of an early T. taeniatus gastrula
was removed and implanted into the region of an early T. cristatus gastrula fated to
become ventral epidermis (belly skin), the dorsal lip tissue invaginated just as it would
normally have done (showing self-determination) and disappeared beneath the vegetal
cells (Figure 11.14A). The pigmented donor tissue then continued to self-differentiate
into the chordamesoderm (notochord) and other mesodermal structures that normal-
ly form from the dorsal lip (Figure 11.14B). As the donor-derived mesodermal cells
moved forward, host cells began to participate in the production of a new embryo,
becoming organs that normally they never would have formed. In this secondary
embryo, a somite could be seen containing both pigmented (donor) and nonpigmented
(host) tissue. Even more spectacularly, the dorsal lip cells were able to interact with the
host tissues to form a complete neural plate from host ectoderm. Eventually, a second-
ary embryo formed, conjoined face to face with its host (Figure 11.14C). The results of
these technically difficult experiments have been confirmed many times and in many
amphibian species, including Xenopus (Figure 11.14D,E ; Capuron 1968; Smith and
Slack 1983; Recanzone and Harris 1985).
Spemann referred to the dorsal lip cells and their derivatives (notochord and head
endomesoderm) as the organizer because (1) they induced the host’s ventral tissues to
change their fates to form a neural tube and dorsal mesodermal tissue (such as somites),
and (2) they organized host and donor tissues into a secondary embryo with clear
anterior-posterior and dorsal-ventral axes. He proposed that during normal develop-
ment, these cells “organize” the dorsal ectoderm into a neural tube and transform the
flanking mesoderm into the anterior-posterior body axis (Spemann 1938). It is now
known (thanks largely to Spemann and his students) that the interaction of the chor-
damesoderm and ectoderm is not sufficient to organize the entire embryo. Rather, it
initiates a series of sequential inductive events. Because there are numerous inductions
during embryonic development, this key induction—in which the progeny of dorsal
lip cells induce the dorsal axis and the neural tube—is traditionally called the primary
embryonic induction . This classical term has been a source of confusion, however,
because the induction of the neural tube by the notochord is no longer considered the
4
Hilde Proescholdt Mangold died in a tragic accident in 1924, when her kitchen’s gasoline heat-
er exploded. She was 26 years old, and her paper was just about to be published. Hers is one of
the very few doctoral theses in biology that have directly resulted in the awarding of a Nobel
Prize. For more information about Hilde Mangold, her times, and the experiments that identi-
fied the organizer, see Hamburger 1984, 1988, and Fässler and Sander 1996.
348 Chapter 11
Notochord Somite
Endoderm
Lumen of gut
Secondary Primary
invagination invagination Neural tube
first inductive process in the embryo. We will soon discuss inductive events that pre-
cede this “primary” induction.
WEb Topic 11.2 Spemann, Mangold, and the organizer Spemann did not
see the importance of this work the first time he and Mangold did it. This web topic pro-
vides a more detailed account of why Spemann and Mangold performed this particular
experiment.
• How did the organizer get its properties? What caused the dorsal blastopore
lip to differ from any other region of the embryo?
• What factors were being secreted from the organizer to cause the formation of
the neural tube and to create the anterior-posterior, dorsal-ventral, and left-
right axes?
• How did the different parts of the neural tube become established, with the
most anterior becoming the sensory organs and forebrain and the most pos-
terior becoming spinal cord?
Spemann and Mangold’s description of the organizer was the starting point for one of
the first truly international scientific research programs (see Gilbert and Saxén 1993;
Armon 2012). Researchers from Britain, Germany, France, the United States, Belgium,
Finland, Japan, and the Soviet Union all joined in the search for the remarkable sub-
stances responsible for the organizer’s ability. R. G. Harrison referred to the amphibian
gastrula as the “new Yukon to which eager miners were now rushing to dig for gold
around the blastopore” (see Twitty 1966, p. 39). Unfortunately, their early picks and
shovels proved too blunt to uncover the molecules involved. The proteins responsible
for induction were present in concentrations too small for biochemical analyses, and the
large quantity of yolk and lipids in the amphibian egg further interfered with protein
purification (Grunz 1997). The analysis of organizer molecules had to wait until recom-
binant DNA technologies enabled investigators to make cDNA clones from blastopore
lip mRNA, thus allowing them to see which of these clones encoded factors that could
dorsalize the embryo (Carron and Shi 2016). We are now able to take up each of the
above questions in turn.
Animal
pole
5 45 50
3
Tier D
4 1
3 2 16 42 42
Vegetal 4
New gastrulation pole
site and body
axis form
If β-catenin is originally found throughout the embryo, how does it become local-
ized specifically to the side opposite sperm entry? The answer appears to reside in the
localizations of three proteins in the egg cortical cytoplasm. The proteins Wnt11, GSK3-
binding protein (GBP), and Disheveled (Dsh) all are translocated from the vegetal pole
of the egg to the future dorsal side of the embryo during fertilization. From research on
the Wnt pathway, we have learned that β-catenin is targeted for destruction by glycogen
synthase kinase 3 (GSK3; see Chapter 4). Indeed, activated GSK3 stimulates degrada-
tion of β-catenin and blocks axis formation when added to the egg, and if endogenous
GSK3 is knocked out by a dominant-negative form of GSK3 in the ventral cells of the
early embryo, a second axis forms (see Figure 11.17F; He et al. 1995; Pierce and Kimel-
man 1995; Yost et al. 1996).
GSK3 can be inactivated by GBP and Disheveled. These two proteins release GSK3
from the degradation complex and prevent it from binding β-catenin and targeting it for
destruction. During the first cell cycle, when the microtubules form parallel tracts in the
vegetal portion of the egg, GBP travels along the microtubules by binding to kinesin,
an ATPase motor protein that travels on microtubules. Kinesin always migrates toward
the growing end of the microtubules, and in this case, that means moving to the point
opposite sperm entry, i.e., the future dorsal side (Figure 11.17A–C). Disheveled, which
is originally found in the vegetal pole cortex, grabs onto the GPB, and it too becomes
Gilbert
translocated along the
Developmental Biology 10e, microtubular monorail (Miller et al. 1999; Weaver et al. 2003).
Sinauer Associates
The cortical rotation is
DevBio11e_11.16 probably
Date 01-25-16important in orienting and straightening the microtu-
bular array and in maintaining the direction of transport when the kinesin complexes
occasionally jump the track (Weaver and Kimelman 2004). Once at the site opposite
the point of sperm entry, GBP and Dsh are released from the microtubles. Here, on the
future dorsal side of the embryo, they inactivate GSK3, allowing β-catenin to accumu-
late on the dorsal side while ventral β-catenin is degraded (Figure 11.17D,E ).
But the mere translocation of these proteins to the dorsal side of the embryo does
not seem to be sufficient for protecting β-catenin. It appears that a Wnt paracrine factor
352 Chapter 11
Sperm
GBP Dsh
Wnt 11
Kinesin
mRNA
Microtubules
(C) Dorsal enrichment Figure 11.17 Model of the mechanism by which the Disheveled protein stabi-
(C)–of Dsh and GBP lizes β-catenin in the dorsal portion of the amphibian egg. (A) Disheveled (Dsh) and
GBP associate with kinesin at the vegetal pole of the unfertilized egg. Wnt11 is
Wnt 11
V Dsh D also in vesicles at the vegetal portion of the egg. (B) After fertilization, these vege-
GBP tal vesicles are translocated dorsally along subcortical microtubule tracks. Cortical
rotation adds a “slow” form of transportation to the fast-track microtubule ride. (C)
Wnt11, Dsh, and GBP are then released from the microtubules and are distributed
in the future dorsal third of the 1-cell embryo. (D) Dsh and GBP bind to and block
the action of GSK3, thereby preventing the degradation of β-catenin on the dorsal
side of the embryo. Wnt11 probably is needed to stabilize this reaction, keeping an
active source of Dsh. (E) The nuclei of the blastomeres in the dorsal region of the
embryo receive β-catenin, whereas the nuclei of those in the ventral region do not.
(F) Formation of a second dorsal axis caused by the injection of both blastomeres
(D) Dorsal inhibition
of a 2-cell Xenopus embryo with dominant-inactive GSK3. Dorsal fate is actively
(A)–of GSK3 Wnt 11 suppressed by wild-type GSK3. (A–E after Weaver and Kimelman 2004; F from
GSK3 Dsh, GBP
Pierce and Kimelman 1995, courtesy of D. Kimelman.)
V D
GSK3
Gilbert
Developmental Biology 10e, Sinauer Associates
DevBio11e_11.17 Date 01-25-16
Amphibians and Fish 353
β-catenin β-catenin Figure 11.18 Summary of events hypothesized to bring about induc-
degraded stabilized tion of the organizer in the dorsal mesoderm. Microtubules allow the trans-
location of Disheveled and Wnt11 proteins to the dorsal side of the embryo.
Ventral Dorsal Dsh (from the vegetal cortex and newly made by Wnt11) binds GSK3,
thereby allowing β-catenin to accumulate in the future dorsal portion of
the embryo. During cleavage, β-catenin enters the nuclei and binds with
Tcf3 to form a transcription factor that activates genes encoding proteins
such as Siamois and Twin. Siamois and Twin interact in the organizer with
the Smad2 transcription factor activated by vegetal TGF-β family members
(Nodal-related proteins, Vg1, activin, etc.). Together, these three transcrip-
Tcf3 siamois, twin β-catenin siamois, twin tion factors activate the “organizer” genes such as chordin, noggin, and
proteins gene proteins gene goosecoid. The presence of the VegT transcription factor in the endoderm
prevents the organizer genes from being expressed outside the organizer
area. (After Moon and Kimelman 1998.)
Siamois and
Repressed Activated Twin proteins
Transcription
Smad2 from
TGF-β family
paracrine factors
Organizer genes (e.g., chordin,
noggin, goosecoid)
Organizer proteins
(e.g., Chordin, Noggin,
Transcription Goosecoid)
known as Tcf3, converting the Tcf3 repressor into an activator of transcription. Expres-
sion of a mutant form of Tcf3 that lacks the β-catenin binding domain results in embry-
os without dorsal structures (Molenaar et al. 1996).
The β-catenin /Tcf3 complex binds to the promoters of several genes whose activity
is critical for axis formation. Two of these genes, twin and siamois, encode homeodomain
transcription factors and are expressed in the organizer region immediately follow-
ing the mid-blastula transition. If these genes are ectopically expressed in the ventral
cells, a secondary axis emerges on the former ventral side of the embryo; and if cortical
microtubular polymerization is prevented, siamois expression is eliminated (Lemaire
et al. 1995; Brannon and Kimelman 1996). The Tcf3 protein is thought to inhibit sia-
mois and twin transcription when it binds to those genes’ promoters in the absence of
β-catenin. However, when β-catenin binds to Tcf3, the repressor is converted into an
activator, and twin and siamois are transcibed (Figure 11.18).
The proteins Siamois and Twin bind to the enhancers of several genes involved in
organizer function (Fan and Sokol 1997; Bae et al. 2011). These include genes encod-
ing the transcription factors Goosecoid and Xlim1 (which are critical in specifying the
dorsal mesoderm) and the paracrine factor antagonists Noggin, Chordin, Frzb, and Cer-
berus (which specify the ectoderm to become neural; Laurent et al. 1997; Engleka and
Kessler 2001). In the vegetal cells, Siamois and Twin appear to combine with vegetal
transcription factors to help activate endodermal genes (Lemaire et al. 1998). Thus, one
could expect that if the dorsal side of the embryo contained β-catenin, this β-catenin
would allow the region to express Twin and Siamois, which in turn would initiate for-
mation of the organizer.
Gilbert
Developmental Biology 10e, Sinauer Associates
the vegetal nodal-related signal Yet another factor appears to be critical in acti-
DevBio11e_11.18 Date 01-29-16
vating the genes that characterize the organizer cells. This other factor is the phosphory-
lated Smad2 transcription factor (discussed earlier), which is essential in forming the
354 Chapter 11
V D
Organizer
VegT, Vg1 β-catenin Xnr Gradient of BMP4,
Xwnt8 (ventral and
lateral mesoderm)
VegT, Vg1
Nodal- Ventral
related low mesoderm
SCIENTISTS SPEAK 11.1 Hear Daniel Kessler discuss the molecular mechanisms
of primary embryonic induction in amphibians.
Amphibians and Fish 355
Neural Figure 11.21 Model for the action of the organizer. (A) BMP4 (along
Animal
ectoderm with certain other molecules) is a powerful ventralizing factor. Orga-
Epidermal nizer proteins such as Chordin, Noggin, and Follistatin block the action
ectoderm of BMP4; their inhibitory effects can be seen in all three germ layers.
Ventral Dorsal (After Dosch et al. 1997.)
Organizer molecules:
BMP4 Chordin, Noggin,
Mesoderm Follistatin
expressed throughout the ectodermal and mesodermal regions of the late blastula.
Dorsal However, during gastrulation, transcription factors (such as Goosecoid) induced by
Vegetal Siamois and Twin prevent the transcription of bmp4 in the dorsal region of the embryo,
endoderm
restricting their expression to the ventrolateral marginal zone (Blitz and Cho 1995;
Yao and Kessler 2001; Hemmati-Brivanlou and Thomsen 1995; Northrop et al. 1995;
Steinbeisser et al. 1995). In the ectoderm, BMPs repress the genes (such as Foxd4 and
neurogenin) involved in forming neural tissue, while activating other genes involved
in epidermal specification (Lee et al. 1995). In the mesoderm, it appears that graded
levels of BMP4 activate different sets of mesodermal genes: an absence of BMP4 speci-
fies the dorsal mesoderm; a low amount specifies the intermediate mesoderm; and a
high amount specifies the ventral mesoderm ( Figure 11.21; Gawantka et al. 1995;
Hemmati-Brivanlou and Thomsen 1995; Dosch et al. 1997).
The organizer acts by blocking the BMPs. Three of the major BMP inhibitors secreted
by the organizer are Noggin, Chordin, and Follistatin. The genes encoding these pro-
teins are some of the most critical genes activated by Smad2 and Siamois/Twin (Carnac
et al. 1996; Fan and Sokol 1997; Kessler 1997). A fourth BMP inhibitor, Norrin, appears
to be stored in the animal pole of the oocyte and functions to block BMPs in the dorsal
ectoderm (Xu et al. 2015).
noggin In 1992, Smith and Harland constructed a cDNA plasmid library from dor-
salized (lithium chloride-treated) gastrulae. Messenger RNAs synthesized from sets
of these plasmids were injected into ventralized embryos (having no neural tube) pro-
duced by irradiating early embryos with ultraviolet light. Those plasmid sets whose
mRNAs rescued dorsal structures in these embryos were split into smaller sets, and so
on, until single-plasmid clones were isolated whose mRNAs were able to restore the
dorsal tissue in such embryos. One of these clones contained the gene for the protein
Noggin (Figure 11.22A). Injection of noggin mRNA into 1-cell, UV-irradiated embry-
os completely rescued dorsal development and allowed the formation of a complete
embryo.
Noggin is a secreted protein that is able to accomplish two of the major functions
of the organizer: it induces dorsal ectoderm to form neural tissue, and it dorsalizes
mesoderm cells that would otherwise contribute to the ventral mesoderm (Smith et al.
1993). Smith and Harland showed that newly transcribed noggin mRNA is first localized
in the dorsal blastopore lip region and then becomes expressed in the notochord (Fig-
ure 11.22B). Noggin binds to BMP4 and BMP2 and inhibits their binding to receptors
(Zimmerman et al. 1996).
chordin Chordin protein was isolated from clones of cDNA whose mRNAs were pres-
ent in dorsalized, but not in ventralized, embryos (Sasai et al. 1994). These cDNA clones
were tested by injecting them into ventral blastomeres and seeing whether they induced
Gilbert secondary axes. One of the clones capable of inducing a secondary neural tube contained
Developmental Biology 11e, Sinauer Associates the chordin gene; chordin mRNA was found to be localized in the dorsal blastopore lip
DevBio11e_11.21 Date 02-09-16 and later in the notochord (Figure 11.23). Morpholino antisense oligomers directed
against the chordin message blocked the ability of an organizer graft to induce a second-
ary central nervous system (Oelgeschläger et al. 2003). Of all organizer genes observed,
chordin is the one most acutely activated by β-catenin (Wessely et al. 2004). Like Noggin,
Amphibians and Fish 357
(A) (B)
(i) (ii)
(iii) (iv)
Figure 11.22 The soluble protein Noggin dorsalizes the amphibian embryo. (A) Rescue of
dorsal structures by Noggin protein. When Xenopus eggs are exposed to ultraviolet radiation,
cortical rotation fails to occur, and the embryos lack dorsal structures (top). If such an embryo
is injected with noggin mRNA, it develops dorsal structures in a dosage-related fashion (top to
bottom). If too much noggin message is injected, the embryo produces dorsal anterior tissue
at the expense of ventral and posterior tissue, becoming little more than a head (bottom). (B)
Localization of noggin mRNA in the organizer tissue, shown by in situ hybridization. At gastrula-
tion (i), noggin mRNA (dark areas) accumulates in the dorsal marginal zone. When cells involute
(ii), noggin mRNA is seen in the dorsal blastopore lip. During convergent extension (iii), noggin
is expressed in the precursors of the notochord, prechordal plate, and pharyngeal endoderm,
which (iv) extend beneath the ectoderm in the center of the embryo. (Courtesy of R. M. Harland.)
Gilbert
Developmental
Figure 11.23 Biology 11e, Sinauer
Localization Associates
of chordin mRNA. (A) Whole-mount in situ hybridization shows
DevBio11e_11.22
that Date 01-29-16
just prior to gastrulation, chordin mRNA (dark area) is expressed in the region that will
become the dorsal blastopore lip. (B) As gastrulation begins, chordin is expressed at the dorsal
blastopore lip. (C) In later stages of gastrulation, the chordin message is seen in the organizer
tissues. (From Sasai et al. 1994, courtesy of E. De Robertis.)
358 Chapter 11
Blastula Gastrula Chordin binds directly to BMP4 and BMP2 and prevents their
complexing with their receptors (Piccolo et al. 1996).
(C) (D)
the BMP homologue Decapentaplegic (Dpp) specifies the hypo-
dermis (skin), while the BMP antagonist Short gastrulation (Sog)
blocks the actions of Dpp and specifies the neural system. Sog
protein is a homologue of Chordin. These insect homologues
not only appear to be similar to their vertebrate counterparts,
they can actually substitute for each other. When sog mRNA
is injected into ventral regions of Xenopus embryos, it induces
the amphibian notochord and neural tube. Injecting chordin
mRNA into Drosophila embryos produces ventral nervous tissue.
Although Chordin dorsalizes the Xenopus embryo, it ventraliz-
es Drosophila. In Drosophila, Dpp is made dorsally; in Xenopus,
BMP4 is made ventrally. In both cases, Sog/Chordin helps spec-
ify neural tissue by blocking the effects of Dpp/BMP4 (Hawley et al. 1995; Holley et al. Developing Questions
1995; De Robertis et al. 2000; Bier and De Robertis 2015). Thus, arthropods appear to be
Chordin and BMPs seem to
upside-down vertebrates—a fact the French anatomist Geoffroy Saint-Hilaire pointed
be homologous between
out in his attempts to convince other anatomists of the unity of the animal kingdom in flies and vertebrates—
the 1840s (see Appel 1987; Genikhovich et al. 2015; De Robertis and Moriyama 2016). but are the processing
pathways of Chordin and
SCIENTISTS SPEAK 11.2 Dr. Richard Harland discusses gastrulation and neural BMP homologous as well?
induction in Xenopus. How might the Chordin-BMP
axis allow the regulation of
the embryonic axes such
the same pattern always
Regional Specificity of Neural Induction occurs, even if the embryo
along the Anterior-Posterior Axis is much smaller or larger?
Just as the dorsal-ventral axis across the animal kingdom is predicated on BMP and its
inhibitors (the neural region being the area of lowest BMPs), the specification of the
anterior-posterior axis is predicated on a gradient of Wnt proteins, with the head being
characterized by the lowest concentrations of Wnts (Petersen and Reddien 2009). There
are a few exceptions (such as Drosophila) where the Wnt gradient does not provide
major patterning cues; but even in these cases, vestigial patterns of Wnt are still seen
(Vorwald-Denholtz and De Robertis 2011). Gilbert
In vertebrates, one of the most important phenomena along the anterior-posterior
Developmental Biology 11e, Sinauer Associates
axis is the regional specificity of the neural structures that are produced. Forebrain, Date 01-29-16
DevBio11e_11.25
hindbrain, and spinocaudal regions of the neural tube must be properly organized in
an anterior-to-posterior direction. The organizer tissue not only induces the neural
tube, it also specifies the regions of the neural tube. This region-specific induction was
demonstrated by Hilde Mangold’s husband, Otto Mangold, in 1933. He transplanted
four successive regions of the archenteron roof of late-gastrula newt embryos into the
blastocoels of early-gastrula embryos. The most anterior portion of the archenteron roof
(containing head mesoderm) induced balancers and portions of the oral apparatus; the
360 Chapter 11
next most anterior section induced the formation of various head structures, includ-
ing nose, eyes, balancers, and otic vesicles; the third section (including the notochord)
induced the hindbrain structures; and the most posterior section induced the formation
of dorsal trunk and tail mesoderm5 (Figure 11.26A–D).
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_11.26
5 Date 01-29-16
The induction of dorsal mesoderm—rather than the dorsal ectoderm of the nervous system—
by the posterior end of the notochord was confirmed by Bïjtel (1931) and Spofford (1945), who
showed that the posterior fifth of the neural plate gives rise to tail somites and the posterior
portions of the pronephric kidney duct.
Amphibians and Fish 361
(B) Ectoderm
the BMP signal and the Wnt signal must be blocked. This Wnt blockade comes from
the endomesoderm, the most anterior portion of the organizer (Glinka et al. 1997). In
1996, Bouwmeester and colleagues showed that the induction of the most anterior head
structures could be accomplished by a secreted protein called Cerberus (named after
the three-headed dog that guarded the entrance to Hades in Greek mythology). When
cerberus mRNA was injected into a vegetal ventral Xenopus blastomere at the 32-cell
stage, ectopic head structures were formed (Figure 11.28A). These head structures
arose from the injected cell as well as from neighboring cells.
The cerberus gene is expressed in the pharyngeal endomesoderm cells that arise
from the deep cells of the early dorsal lip. Cerberus protein can bind BMPs, Nodal-
related proteins, and Xwnt8 (see Figure 11.27A and 11.30; Piccolo et al. 1999). When
Cerberus synthesis is blocked, the levels of BMP, Nodal-related proteins, and Wnts
all rise in the anterior of the embryo, and the ability of the anterior endomesoderm to
induce a head is severely diminished (Silva et al. 2003).
frzb, dickkopf, notum, and tiki: more ways to block wnts Shortly after the
attributes of Cerberus were demonstrated, two other proteins, Frzb and Dickkopf, were
(A) (B)
Frzb
Xwnt8
Wnt receptor
(Frizzled protein)
Dsh
(C) Animal
Ventral Dorsal
Figure 11.28 Inhibiting Wnt signaling enables head formation. Xwnt8 Frzb, Dickkopf, Tiki
(A) Injecting cerberus mRNA into a single D4 (ventral vegetal) blasto-
mere of a 32-cell Xenopus embryo induces head structures as well
as a duplicated heart and liver. The secondary eye (a single cyclopic
eye) and olfactory placode can be readily seen. Xwnt8 is capable of
ventralizing the mesoderm and preventing anterior head formation
Vegetal
in the ectoderm. (B) Frzb protein is secreted by the anterior region
of the organizer. It must bind to Xwnt8 before that inducer can bind
(D)
to its receptor. Frzb resembles the Wnt-binding domain of the Wnt
receptor (the Frizzled protein), but Frzb is a soluble molecule. (C)
Xwnt8 is made throughout the marginal zone. (D) Double in situ
hybridization localizing Frzb (dark stain) and Chordin (reddish stain)
messages. The frzb mRNA is transcribed in the head endomeso-
derm of the organizer, but not in the notochord (where chordin is
expressed). (A from Bouwmeester et al. 1996; D from Leyns et al.
1997; photographs courtesy of E. M. De Robertis.)
Amphibians and Fish 363
3
Figure 11.30 Model of organizer function and axis Wnt, FGF,
specification in the Xenopus gastrula. (1) BMP inhibitors and RA gradients
from organizer tissue (dorsal mesoderm and pharyngeal
mesendoderm) block the formation of epidermis, ventro- Dorsal
lateral mesoderm, and ventrolateral endoderm. (2) Wnt mesoderm
inhibitors in the anterior of the organizer (pharyngeal endo- 1
mesoderm) allow the induction of head structures. (3) A BMP inhibitors: Planar
Dorsal
gradient of caudalizing factors (Wnts, FGFs, and retinoic Chordin, Noggin, signal
mesoderm
acid) results in the regional expression of Hox genes, which Follistatin
specify the regions of the neural tube. Dorsal
2 blastopore
Wnt inhibitors: lip
Cerberus, Frzb,
Dickkopf, IGF
Endoderm
Ectoderm
Nodal-like TGF-β paracrine factors and β-catenin across the vegetal cells. The basic
model of neural induction, then, looks like the diagram in Figure 11.30.
SCIENTISTS SPEAK 11.3 Dr. Lauri Saxén discusses the early investigation of the
primary organizer and the formulation of the double-gradient hypothesis.
While the Wnt proteins play a major role in specifying the anterior-posterior axis,
they are probably not the only agents involved. Fibroblast growth factors appear to be
critical in allowing the cells to respond to the Wnt signal (Holowacz and Sokol 1999;
Domingos et al. 2001). Retinoic acid (RA) also is seen to have a gradient highest at
the posterior end of the neural plate, and RA can also posteriorize the neural tube in
a concentration-dependent manner (Cho and De Robertis 1990; Sive and Cheng 1991;
Chen et al. 1994; Pera et al. 2013). RA signaling appears to be especially important in
patterning the hindbrain, as it appears to interact with FGF signals to activate the pos-
terior Hox genes (Kolm et al. 1997; Dupé and Lumsden 2001; Shiotsugu et al. 2004). RA
is also critical in allowing the growth of the most posterior part of the tadpole, the tail.
The receptors for RA are transcription factors, and when they are not bound to retinoic
acid, they bind co-repressors that inhibit the activity of certain genes. However, when
RA binds to the receptors, the co-repressors are exchanged for co-activators, and the-
segenes become actively transcribed (Chakravarti et al. 1996). The unbound RA recep-
tors in the tailbud of the developing tadpole maintain a pool of undifferentiated caudal
mesoderm cells. As the wavefront of RA synthesis extends posteriorly, the retinoic acid
binds to these receptors, after which these cells express posterior Hox genes and dif-
ferentiate into somatic tissue and allow the outgrowth of the tail (Janesick et al. 2014).
Together, the posterior-to-anterior Wnt, FGF, and RA gradients function to determine
the boundaries of the Hox genes along the anterior-posterior axis (Wacker et al. 2004;
Durston et al. 2010a,b).
WEb Topic 11.4 Gradients and Hox gene expression The mechanisms by
which the gradients of Wnt, RA, and FGFs specify the Hox genes in neural ectoderm are
still not agreedGilbert
upon.
Developmental Biology 11e, Sinauer Associates
DevBio11e_11.30 Date 01-29-16
Specifying the Left-Right Axis
Although the developing tadpole outwardly appears symmetrical, several internal
organs, such as the heart and the gut tube, are not evenly balanced on the right and
left sides. In other words, in addition to its dorsal-ventral and anterior-posterior axes,
the embryo has a left-right axis. In all vertebrates studied so far, the crucial event in
Amphibians and Fish 365
Yolk Yolk
cell syncytial
layer
Vegetal pole
(ix) (x) Otic vesicle (xi) (xii)
Eye (ear) Midbrain Hindbrain
Forebrain
Notochord
×
ç å
+/m +/+
F2 generation
å
× +/m
ç å
+/+ +/+
F3 generation
+/m × +/+ +/+ × +/+ +/+ × +/m +/m × +/m
m/m
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_11.33 Date 01-29-16
368 Chapter 11
(A) The similarity of developmental mechanisms among all vertebrates and the abil-
ity of Danio rerio to be genetically manipulated has given this small fish an important
role in investigating the genes that operate during human development (Mudbhary
and Sadler 2011). When developmental biologists screened zebrafish mutants for cystic
kidney disease, they found 12 different genes. Two of these genes were already known
to cause human cystic kidney disease, but the other 10 were as-yet unknown genes that
were found to interact with the first two in a common pathway. Moreover, that path-
way, which involves the synthesis of cilia, was not what had been expected. Thus, the
zebrafish studies disclosed an important and previously unknown pathway to explore
human birth defects (Sun et al. 2004).
Zebrafish embryos are also permeable to small molecules placed in the water—a
property that allows us to test drugs that may be deleterious to vertebrate develop-
ment. For instance, zebrafish development can be altered by the addition of ethanol or
(B)
retinoic acid, both of which produce malformations in the fish that resemble human
developmental syndromes known to be caused by these molecules (Blader and Strähle
1998). As one zebrafish researcher joked, “Fish really are just little people with fins”
(Bradbury 2004).
Cleavage
The eggs of most bony fish are telolecithal , meaning that most of the cytoplasm is
occupied by yolk. Cleavage can take place only in the blastodisc, a thin region of yolk-
free cytoplasm at the animal pole. The cell divisions do not completely divide the egg,
so this type of cleavage is called meroblastic (Greek meros, “part”). Since only the blas-
todisc becomes the embryo, this type of meroblastic cleavage is referred to as discoidal.
Scanning electron micrographs show beautifully the incomplete nature of discoi-
Figure 11.34 The gene for green dal meroblastic cleavage in fish eggs (Figure 11.35). The calcium waves initiated at
fluorescent protein (GFP) was fused to
fertilization stimulate the contraction of the actin cytoskeleton to squeeze non-yolky
the regulatory region of a zebrafish sonic
hedgehog gene. As a result, GFP was cytoplasm into the animal pole of the egg. This process converts the spherical egg into a
synthesized wherever Hedgehog protein pear-shaped structure with an apical blastodisc (Leung et al. 1998, 2000). In fish, there
is normally expressed in the fish embryo. are many waves of calcium release, and they orchestrate the processes of cell division.
(A) In the head, GFP is seen in the devel- The calcium ions are critical for coordinating mitosis. They integrate the movements of
oping retina and nasal placodes. (B) the mitotic spindle with those of the actin cytoskeleton, deepen the cleavage furrow,
Because GFP is expressed by individual and heal the membrane after the separation of the blastomeres (Lee et al. 2003).
cells, scientists can see precisely which
The first cell divisions follow a highly reproducible pattern of meridional and equa-
cells make GFP, and thus which cells
Gilbert
normally transcribe the gene of interest
torial cleavages. These divisions are rapid, taking only about 15 minutes each. The first
Developmental Biology 11e, Sinauer Associates10 divisions occur synchronously, forming a mound of cells that sits at the animal pole
(in this case, sonic hedgehog in the reti-
DevBio11e_11.34 Date 01-29-16
na). (Photographs courtesy of U. Strahle of a large yolk cell . This mound of cells constitutes the blastoderm . Initially, all the
and C. Neumann.) cells maintain some open connection with one another and with the underlying yolk
cell, so that moderately sized (17 kDa) molecules can pass freely from one blastomere to
the next (Kane and Kimmel 1993; Kimmel and Law 1985). Remarkably, as the daughter
cells migrate away from one another, they often retain these bridges through long tun-
nels connecting the cells (Caneparo et al. 2011).
Maternal effect mutations have shown the importance of oocyte proteins and
mRNAs in embryonic polarity, cell division, and axis formation (Dosch et al. 2004;
Langdon and Mullins 2011). As in frogs, the microtubules are important roads along
which morphogenetic determinants travel, and maternal mutants affecting the forma-
tion of the microtubule cytoskeleton prevent the normal positioning of the cleavage
furrow and of mRNAs in the early embryo (Kishimoto et al. 2004).
Fish embryos, like many other embryos, undergo a mid-blastula transition (seen
around the tenth cell division in zebrafish) when zygotic gene transcription begins,
cell divisions slow, and cell movements become evident (Kane and Kimmel 1993). At
this time, three distinct cell populations can be distinguished. The first of these is the
yolk syncytial layer, or YSL (Agassiz and Whitman 1884; Carvalho and Heisenberg
Amphibians and Fish 369
(A) (B)
Enveloping
layer (EVL)
Blastoderm
Deep cells
Microtubules
Yolk cell Figure 11.36 Fish blastula. (A) Prior to gastrulation, the deep
cells are surrounded by the enveloping layer (EVL). The animal
surface of the yolk cell is flat and contains the nuclei of the yolk
syncytial layer (YSL). Microtubules extend through the yolky cyto-
plasm and the external YSL. (B) Late-blastula-stage embryo of the
(C) Animal pole minnow Fundulus, showing the external YSL. The nuclei of these
cells were derived from cells at the margin of the blastoderm, which
released their nuclei into the yolky cytoplasm. (C) Fate map of the
deep cells after cell mixing has stopped. This is a lateral view; for
Ectoderm the sake of clarity, not all organ fates are labeled. (A,C after Lange-
land and Kimmel 1997; B from Trinkaus 1993, courtesy of J. P.
Mesoderm Trinkaus.)
Ventral Dorsal
Endoderm
Vegetal pole
Posterior
is accomplished by physical forces rather than by chemicals. When the cortical cyto-
skeleton is disrupted by drugs, the cells fail to turn and the mesodermal genes are not
activated. However, if the cells are injected with magnetic particles before being hit
with the drugs, they can be mechanically towed around the embryo. The cells don’t
involute, but the mesodermal genes do turn on. Thus, during normal development,
epiboly and cell specification may be coordinated by the mechanical stress of involu-
tion (Figure 11.38; Brunet et al. 2013).
the embryonic shield and the neural keel Once the hypoblast has formed,
cells of the epiblast and hypoblast intercalate on the future dorsal side of the embryo to
form a localized thickening, the embryonic shield (Schmitz and Campos-Ortega 1994).
Here, the cells converge and extend anteriorly, eventually narrowing along the dorsal
midline (Figure 11.39A). This convergent extension in the hypoblast forms the chor-
damesoderm, the precursor of the notochord (Trinkaus 1992; Figure 11.39B,C). This
convergent extension is similar to that discussed in Xenopus, and is similarly accom-
plished by the Wnt-mediated planar cell polarity pathway (see Vervenne et al. 2008).
As we will see, the embryonic shield is functionally equivalent to the dorsal blasto-
pore lip of amphibians, since it can organize a secondary embryonic axis when trans-
planted to a host embryo (Oppenheimer 1936; Ho 1992). The cells adjacent to the chor-
damesoderm—the paraxial mesoderm cells—are the precursors of the mesodermal
Developmental
somitesBiology 11e 17). Concomitant convergence and extension in the epiblast bring
(see Chapter
Fig. 11.38
presumptive neural cells from the epiblast into the dorsal midline, where they form the
Dragonfly Media Group
neural keel . The neural keel, a band of neural precursors that extends over the axial
01/19/16
Amphibians and Fish 373
Extension Shield
Embryonic shield
Convergence
Involution
Hypoblast
Epiboly
Yolk cell 10 hours
Vegetal pole
(C)
Chordamesoderm
12.5 hours
Figure 11.39 Convergence and extension in the zebrafish gastrula. (A) Dorsal view of con-
vergence and extension movements during zebrafish gastrulation. Epiboly spreads the blasto-
derm over the yolk; involution and ingression generate the hypoblast; convergence and exten-
sion bring the hypoblast and epiblast cells to the dorsal side to form the embryonic shield.
Within the shield, intercalation extends the chordamesoderm toward the animal pole. (B) Model
of mesendoderm (hypoblast) formation. Numbers indicate hours after fertilization. On the future Ventral
dorsal side, the internalized cells undergo convergent extension to form the chordamesoderm
(notochord) and the paraxial (somitic) mesoderm adjacent to it. On the ventral side, the hypo-
blast cells migrate with the epibolizing epiblast toward the vegetal pole, eventually converging
there. (C) Convergent extension of the chordamesoderm of the hypoblast cells. These cells are
marked by their expression of the no-tail gene (dark areas) encoding a T-box transcription fac-
tor. (A,C from Langeland and Kimmel 1997, courtesy of the authors; B after Keller et al. 2001.)
and paraxial mesoderm, eventually develops a slitlike lumen to become the neural
tube and to enter into the embryo.7 Those cells remaining in the epiblast become the
epidermis. On the ventral side (see Figure 11.39B), the hypoblast ring moves toward the
vegetal pole, migrating directly beneath the epiblast that is epibolizing itself over the
yolk cell. Eventually, the ring closes at the vegetal pole, completing the internalization
of those cells that will become mesoderm and endoderm (Keller et al. 2008).
7
This is different from the formation of the neural tube in frog embryos and is probably
equivalent to “secondary” neural tube formation in the posterior of mammalian embryos
(see Chapter 13).
374 Chapter 11
(A) Animal Embryonic Embryonic positioned their germ layers such that the ectoderm is on the
shield shield outside, the endoderm is on the inside, and the mesoderm lies
between them. We will now see that zebrafish form their body
Ventral Dorsal axes in ways very similar to those of Xenopus, and using very
similar molecules.
Donor Host
8
Another similarity between the amphibian and fish organizers is that they can be duplicated
by rotating the egg and changing the orientation of the microtubules (Fluck et al. 1998). One
difference in the axial development of these groups is that in amphibians, the prechordal plate
is necessary for inducing the anterior brain to form. In zebrafish, although the prechordal plate
appears to be necessary for forming ventral neural structures, the anterior regions of the brain
can form in its absence (Schier et al. 1997; Schier and Talbot 1998).
Amphibians and Fish 375
tissue when placed onto the animal cap of a blastula, which contains thoroughly undif-
ferentiated cells. When a graft from the ventral blastopore lip is placed on animal cap
cells, a well-organized tail structure is formed, having epidermis, somites, neural tube,
but no dorsal mesoderm (Agathon et al. 2003). Much of this structure is induced from
the host tissue. So the ventral blastopore lip in zebrafish is a “tail organizer.” Cells
from the lateral blastopore lips will induce trunk and posterior head structures, having
notochord tissue. Moreover, these transplanted tissues do not express BMPs, Wnts, or Figure 11.41 Correlation between
their antagonists. the relative position of BMP- and Nodal-
So it appears that, in addition to the classical shield organizer, the entire blastopore secreting clones and the orientation of
lip appears involved in forming posterior head, trunk and tail, through another means. the secondary embryonic axis induced
at the animal cap. (A,B) When the Nodal-
This second set of axis-determining factors appears to be a dual gradient of Nodal and
BMP vector (yellow arrow in A) is paral-
BMP proteins (Fauny et al. 2009; Thisse and Thisse 2015). Along the blastopore lip, lel to the D-V axis (white arrow) of the
from the ventral to the dorsal margin, there forms a continuous gradation in the ratio embryonic margin (where Nodal is strong
of BMP to Nodal activity. BMP is highest at the ventral margin, low dorsolaterally, and dorsally and BMP strong ventrally), the
approaches 0 in the dorsalmost domain, where only Nodal is active. Thus, each region original axis (blue arrow in B) and the
of the blastopore lip is characterized by a specific BMP/Nodal ratio of activity. Remark- secondary axis (red arrow) axes are par-
ably, an entire ectopic axis can be made by injecting one of the animal cap blastomeres allel. (C,D) When the Nodal-BMP vector
is perpendicular to the original dorsal-
with Nodal mRNA and another animal cap cell with BMP mRNA (Xu et al., 2014). A
ventral axis, the secondary embryonic
gradient is formed between them, and the neighboring cells respond by constructing axis grows perpendicular to the primary
a new axis (Figure 11.41). axis. (E,F) When the Nodal-BMP vector
Moreover, by injecting different amounts of BMP and Nodal mRNAs into a single is against that of the original dorsal-
blastula animal cap cells, one can mimic the effect of the blastopore lip. Injections of ventral axis, the primary and secondary
mRNAs with a high BMP to Nodal ratio induce the formation of new tails growing axes grow in opposite directions. sh,
from the animal pole of the embryo. Wnt8, a posterior morphogen, is produced in these embryonic shield. A, C, and E are animal
pole views at the shield stage; B, D, and
cells. Injection of mRNAs with decreasing BMP to Nodal ratios induces the formation
F are lateral views at 30 hours after fertil-
of secondary trunks from these animal pole cells. When Nodal and BMP are injected ization. (From Xu et al. 2014, courtesy
in the same amounts, a posterior head of C. Thisse.)
is induced (Thisse et al. 2000). As men-
tioned in Xenopus, Nodal proteins are
critical for the formation of the Orga- (A) V D (B)
nizer; and in zebrafish, ectopic expres-
sion of Nodal in the ventral blastopore
margin will convert the ventral blas- sh i
topore lip into a shield, inducing an
entire secondary axis. The shield in
BMP Nodal
zebrafish may be the “head organizer,” ii
while the cells 180º away become the
“tail organizer.” V D
(C) (D)
T he eng ine for integ rating the
BMP-Chordin and BMP-Nodal axes
Nodal
appears to be β-catenin. As in Xenopus, i
β-catenin activates the Nodal genes. In sh
addition, β-catenin activates the genes
BMP
encoding FGFs and other factors that
repress BMP and Wnt expression on
ii
the dorsal side of the embryo while
activating the genes for goosecoid, nog- (E) V D (F)
gin, and dickkopf there (Solnica-Krezel
and Driever 2001; Sampath et al. 1998;
Gritsman et al. 2000; Schier and Tal-
bot 2001; Fürthauer et al. 2004; Tsang sh
et al. 2004). As in Xenopus, β-catenin i
accumulates specifically in the nuclei Nodal BMP
destined to become the dorsal cells ii
(Langdon and Mullins 2011). And, as
376 Chapter 11
in Xenopus, this appears to be regulated by a maternal Wnt protein, in this case Wnt8a
(Lu et al. 2011). The presence of β-catenin distinguishes dorsal YSL from the lateral and
ventral YSL regions9 (Figure 11.42 ; Schneider et al. 1996), and inducing β-catenin
accumulation on the ventral side of the egg results in its dorsalization and a second
embryonic axis (Kelly et al. 1995).
SCIENTISTS SPEAK 11.4 Dr. Bernard Thisse discusses experiments leading to the
notion that the dorsal-ventral axis of the zebrafish is specified by a gradient of
Nodal and BMP. Dr. Christine Thisse discusses the evidence that an entire embryo
can be generated from pluripotent cells having two opposite gradient activities.
9
Some of the endodermal cells that accumulate β-catenin will become the precursors of the
ciliated cells of Kupffer’s vesicle (Cooper and D’Amico 1996). As we will discuss in the final sec-
tion of this chapter, these cells are critical in determining the left-right axis of the embryo.
Amphibians and Fish 377
WATCH DEVELOPMENT 11.8 See the rotary motion of cilia in the Kupffer’s vesicle
of zebrafish.
11 Snapshot Summary
Early Development in Amphibians and Fish
1. Amphibian cleavage is holoblastic, but it is unequal tissues. The organizer functions by secreting proteins
because of the presence of yolk in the vegetal (Noggin, Chordin, and Follistatin) that block the BMP
hemisphere. signal that would otherwise ventralize the mesoderm
2. Amphibian gastrulation begins with the invagination of and activate the epidermal genes in the ectoderm.
the bottle cells, followed by the coordinated involution of 6. Dorsal-ventral specification begins with maternal mes-
the mesoderm and the epiboly of the ectoderm. Vegetal sages and proteins stored in the vegetal cytoplasm.
rotation plays a significant role in directing the involution. These include Nodal-like paracrine factors, transcrip-
3. The driving forces for ectodermal epiboly and the con- tion factors (such as VegT), and agents that protect
vergent extension of the mesoderm are the intercalation β-catenin from degradation.
events in which several tissue layers merge. Fibronectin 7. The organizer is itself induced by the Nieuwkoop center,
plays a critical role in enabling the mesodermal cells to located in the dorsalmost vegetal cells. This center is
migrate into the embryo. formed by the translocation of the Disheveled protein
4. The dorsal lip of the blastopore forms the organizer tis- and Wnt11 to the dorsal side of the egg to stabilize
sue of the amphibian gastrula. This tissue dorsalizes β-catenin in the dorsal cells of the embryo.
the ectoderm, transforming it into neural tissue, and 8. The Nieuwkoop center is formed by the accumulation of
it transforms ventral mesoderm into lateral and dorsal β-catenin, which can complex with Tcf3 to form a tran-
mesoderm. scription factor complex that can activate the transcrip-
5. The organizer consists of pharyngeal endoderm, head tion of the siamois and twin genes on the dorsal side of
mesoderm, notochord, and dorsal blastopore lip the embryo.
378 Chapter 11
9. The Siamois and Twin proteins collaborate with activat- embryo. In Xenopus, as in other vertebrates, Nodal
ed Smad2 transcription factors generated by the TGF-β protein activates expression of pitx2, which is critical in
pathway (Nodal, Vg1) to activate genes encoding BMP distinguishing left-sidedness from right-sidedness.
inhibitors. These inhibitors include the secreted factors 15. Cleavage in fish is meroblastic. The deep cells of the
Noggin, Chordin, and Follistatin, as well as the transcrip- blastoderm form between the yolk syncytial layer and
tion factor Goosecoid. the enveloping layer. These deep cells migrate over the
10. In the presence of BMP inhibitors, ectodermal cells form top of the yolk, forming the hypoblast and epiblast.
neural tissue. The action of BMP on ectodermal cells 16. On the future dorsal side, the hypoblast and epiblast
causes them to become epidermis. intercalate to form the embryonic shield, a structure
11. In the head region, an additional set of proteins (Cer- homologous to the amphibian organizer. Transplantation
berus, Frzb, Dickkopf, Tiki) blocks the Wnt signal from of the embryonic shield into the ventral side of another
the ventral and lateral mesoderm. embryo will cause a second embryonic axis to form.
12. Wnt signaling causes a gradient of β-catenin along the 17. In both amphibians and fish, neural ectoderm is per-
anterior-posterior axis of the neural plate that appears to mitted to form where the BMP-mediated induction of
specify the regionalization of the neural tube. epidermal tissue is prevented. The fish embryonic shield,
13. Insulin-like growth factors (IGFs) help transform the neu- like the amphibian dorsal blastopore lip, secretes the
ral tube into anterior (forebrain) tissue. BMP antagonists. Like the amphibian organizer, the
shield receives its abilities by being induced by β-catenin
14. The left-right axis appears to be initiated by the acti-
and by underlying endodermal cells expressing Nodal-
vation of a Nodal protein solely on the left side of the
related paracrine factors.
Further Reading
Carron, C. and D. L. Shi. 2016. Specification of anterioposterior asymmetries in β-catenin which are modulated by the Wnt
axis by combinatorial signaling during Xenopus development. signaling pathway. J. Cell Biol. 136: 1123–1136.
Wiley Interdiscip. Rev. Dev. Biol. 5: 150–168. Lepage, E. S. and A. E. Bruce. 2010. Zebrafish epiboly:
Cho, K. W. Y., B. Blumberg, H. Steinbeisser and E. De Robertis. Mechanics and mechanisms. Int. J. Dev. Biol. 54: 1213–12211.
1991. Molecular nature of Spemann’s organizer: The role of the Niehrs, C. 2004. Regionally specific induction by the Spemann-
Xenopus homeobox gene goosecoid. Cell 67: 1111–1120. Mangold organizer. Nature Rev. Genet. 5: 425–434.
De Robertis, E. M. 2006. Spemann’s organizer and self- Piccolo, S. and 6 others. 1999. The head inducer Cerberus is a
regulation in amphibian embryos. Nature Rev. Mol. Cell Biol. 7: multifunctional antagonist of Nodal, BMP, and Wnt signals.
296–302. Nature 397: 707–710.
Essner, J. J., J. D. Amack, M. K. Nyholm, E. B. Harris and H. J. Reversade, B., H. Kuroda, H. Lee, A. Mays, and E. M. De
Yost. 2005. Kupffer’s vesicle is a ciliated organ of asymmetry in Robertis. 2005. Deletion of BMP2, BMP4, and BMP7 and
the zebrafish embryo that initiates left-right development of the Spemann organizer signals induces massive brain formation in
brain, heart and gut. Development 132: 1247–1260. Xenopus embryos. Development 132: 3381–3392.
Hontelez, S. and 6 others. 2015. Embryonic transcription Spemann, H. and H. Mangold. 1924. Induction of embryonic
is controlled by maternally defined chromatin state Nature primordia by implantation of organizers from a different
Commun. 6: 10148. species. (Trans. V. Hamburger.) In B. H. Willier and J. M.
Khokha, M. K., J. Yeh, T. C. Grammer and R. M. Harland. 2005. Oppenheimer (eds.), Foundations of Experimental Embryology.
Depletion of three BMP antagonists from Spemann’s organizer Hafner, New York, pp. 144–184. Reprinted in Int. J. Dev. Biol. 45:
leads to catastrophic loss of dorsal structures. Dev. Cell 8: 13–311.
401–411. Winklbauer, R. and E. W. Damm. 2011. Internalizing the
Langdon, Y. G. and M. C. Mullins. 2011. Maternal and zygotic vegetal cell mass before and during amphibian gastrulation:
control of zebrafish dorsoventral axial patterning. Annu. Rev. Vegetal rotation and related movements. WIREs Dev Biol.
Genet. 45: 357–377. Doi:10.1002/wdev.26.
Larabell, C. A. and 7 others. 1997. Establishment of the Xu, P. F., N. Houssin, K. F. Ferri-Lagneau, B. Thisse and C.
dorsal-ventral axis in Xenopus embryos is presaged by early Thisse. 2014. Construction of a vertebrate embryo from two
opposing morphogen gradients. Science 344: 87–89.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
12
The Punchline
Birds and mammals begin development differently. Birds have a meroblastic cleavage,
where mammalian cleavage is holoblastic. The chick forms a layer of cells over a large
body of yolk, whereas the relatively yolk-free eggs of mammals form a blastocyst
containing an outer layer (that becomes part of the placenta) and an inner cell
mass composed of embryonic stem cells (that will form all the cells of the embryo).
Gastrulation is initiated at the node, a site that is most likely determined by physical as
well as chemical cues. Nodal and Wnt proteins are especially important in determining
where this takes place as well as specifying the anterior-posterior polarity of the
embryo. The node extends into the primitive streak, and the cells of the upper layer
travel to and through this structure. The cells migrating into and through the streak
become the mesoderm and the endoderm. Those remaining on the surface become
the ectoderm. The node is very similar to the dorsal blastopore lip of amphibians, and
similar molecules are involved in its formation.
380 Chapter 12
(A) Gallus gallus Figure 12.1 The membranes of the amniote egg characterize
reptiles, birds, and mammals. (A) Phylogenetic relationships of the
AMNIOTE amniotes. Note that birds are considered reptiles by most modern
VERTEBRATES Reptiles taxonomists, but for physiological studies they are often treated
as separate taxa. (Other flying and feathered reptile groups have
not survived to the present day.) The domestic chicken (Gallus gal-
lus) is the most widely studied bird species. Among mammals, the
Birds development of the laboratory mouse Mus musculus is the most
Feathers, flight
widely studied. Both avian and mouse studies contribute to our
Amniote understanding of human development. (B) The shelled amniote egg
egg (as exemplified by the chicken egg on the left) permitted animals to
Monotremes
develop away from bodies of water. The amnion provides a “water
(egg-laying mammals:
platypus, echidna) sac” in which the embryo develops; the allantois stores wastes; and
Mammary
the blood vessels of the chorion exchange gases and nutrients from
glands
Placental mammals the yolk sac. In mammals (right), this arrangement is modified such
Placenta that the blood vessels acquire nutrients and exchange gases via a
placenta joined to the mother’s uterus rather than from the yolk sac.
Mus musculus (Chick photograph courtesy of D. McIntyre; mouse photograph ©
(B) Antagain/iStock.)
Extraembryonic
Maternal
membranes:
portion
of placenta
Yolk sac
mother. Gas exchange, nutrient uptake, and waste elimination take place through the
placenta, enabling the embryo to develop inside another organism.
WEb Topic 12.1 The extraembryonic membranes The amniote embryo is sup-
ported by a variety of membranes that provide it with nourishment, protection, and waste
disposal services.
Ever since Aristotle first observed and recorded the details of its 3-week-long devel-
opment, the domestic chicken (Gallus gallus) has been a favorite organism for embryo-
logical studies. It is accessible year-round and is easily maintained. Moreover, at any
particular temperature, its developmental stage can be accurately predicted, so large
numbers of same-stage embryos can be obtained and manipulated. Chick organ forma-
tion is accomplished by genes and cell movements similar to those of mammalian organ
formation, and the chick is one of the few organisms whose embryos are amenable to
both surgical and genetic manipulations (Stern 2005a). Thus, the chick embryo has
often served as a model for human embryos, as has the ubiquitous laboratory mouse.
Gilbert The mouse is the mammalian model organism of choice and is the subject of many
Developmental Biology 11e, Sinauer Associates studies involving genetic and surgical manipulation. In addition, the mouse was the first
DevBio11e_12.01 Date 04-08-16 mammalian genome to be sequenced, and when it was first published many scientists
felt it was more valuable than knowing the human genome sequence. Their reasoning
was that “working on mouse models allows the manipulation of each and every gene to
determine their functions” (Gunter and Dhand 2002). We cannot do that with humans.
Human development is a subject of medical as well as general scientific interest, how-
ever, and the latter sections of this chapter will cover early human development, illus-
trating the application of many of the principles we have described in model organisms.
Birds and Mammals 381
Blastodisc 1
0 0
Vitelline
membrane
Yolk
1 2 1
0 0
Inner shell membrane
Subgerminal
(B) 4 cavity
2 3 3 2
1 1
Hypoblast Epiblast
Yolk
382 Chapter 12
bases. Thereafter, equatorial and vertical cleavages divide the blastoderm into a tissue
about 4 cell layers thick, with the cells linked together by tight junctions (see Figure
12.2C; Bellairs et al. 1978; Eyal-Giladi 1991; Nagai et al. 2015). The switch from mater-
nal to zygotic gene expression occurs at about the seventh or eighth division, when
there are around 128 cells (Nagai et al. 2015).
Between the blastoderm and the yolk of avian eggs is a space called the subgermi-
nal cavity, which is created when the blastoderm cells absorb water from the albumin
(“egg white”) and secrete the fluid between themselves and the yolk (New 1956). At
VADE MECUM this stage, the deep cells in the center of the blastoderm appear to be shed and die,
leaving behind a 1-cell-thick area pellucida; this part of the blastoderm forms most
Viewing the movies of 3-D mod-
of the actual embryo. The peripheral ring of blastoderm cells that have not shed their
els of chick cleavage and gas-
trulation in the segment on chick
deep cells constitutes the area opaca. Between the area pellucida and the area opaca
development will help you under- is a thin layer of cells called the marginal zone (Eyal-Giladi 1997; Arendt and Nübler-
stand these phenomena. Jung 1999). Some marginal zone cells become very important in determining cell fate
during early chick development.
Dorsal
Ventral
Area opaca Posterior
Hypoblast Precursors of endoderm
islands secondary hypoblast Koller’s sickle
Primary
hypoblast cells
Secondary
hypoblast cells
(D) Stage 2
Primitive streak
(middle layer)
(E) Stage 3
Primitive streak
Epiblast
Hypoblast
Figure 12.3 Formation of the chick blastoderm. The left column is a diagrammatic midsagit-
tal section through part of the blastoderm. The middle column depicts the entire embryo viewed
from the ventral side, showing the migration of the primary hypoblast and the secondary hypoblast
(endoblast) cells. The right column shows the entire embryo seen from the dorsal side. (A–C)
Events prior to laying of the shelled egg. (A) Stage X embryo, where islands of hypoblast cells can
be seen, as well as a congregation of hypoblast cells around Koller’s sickle. (B) By stage XII, a
sheet of cells that grows anteriorly from Koller’s sickle combines with the hypoblast islands to form
the complete hypoblast layer. (C) By stage XIII, just prior to primitive streak formation, the formation
of the hypoblast just been completed. (D) By stage 2 (12–14 hours after the egg is laid), the primi-
tive streak cells form a third layer that lies between the hypoblast and epiblast cells. (E) By stage 3
(15–17 hours post laying), the primitive streak has become a definitive region of the epiblast, with
cells migrating through it to become the mesoderm and endoderm. (After Stern 2004.)
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_12.03 Date 02-11-16
384 Chapter 12
(A) Anterior Figure 12.4 Cell movements of the primitive streak and fate map of the chick embryo.
Area opaca (A–C) Dorsal view of the formation and elongation of the primitive streak. The blastoderm is
seen at (A) 12–14 hours, (B) 15–17 hours, and (C) 18–20 hours after the egg is laid. (D–F) For-
Area Margin mation of notochord and mesodermal somites as the primitive streak regresses, shown at
pellucida (D) 20–22 hours, (E) 23–25 hours, and (F) the four-somite stage. Fate maps of the chick epi-
Koller’s blast are shown for two stages, the definitive primitive streak stage (C) and neurulation (F).
sickle In (F), the endoderm has ingressed beneath the epiblast, and convergent extension is seen
Posterior in the midline. The movements of the mesodermal precursors through the primitive streak at
(B) (C) are shown. (Adapted from several sources, especially Spratt 1946; Smith and Schoenwolf
1998; Stern 2005a,b.)
Area opaca
Area streak, a depression called the primitive groove forms within
pellucida
the streak. Most migrating cells pass through the primitive
Primitive groove, which serves as a gateway into the deep layers of
streak the embryo (Figure 12.4; Voiculescu et al. 2014). Thus, the
taking shape primitive groove is homologous to the amphibian blastopore,
Fate map Anterior and the primitive streak is homologous to the blastopore lip.
(C) Notochord At the anterior end of the primitive streak is a regional
Epidermal
Hensen’s ectoderm thickening of cells called Hensen’s node (also known as the
node primitive knot; see Figure 12.4C). The center of Hensen’s
Neural
ectoderm
node contains a funnel-shaped depression (sometimes called
Area
pellucida the primitive pit) through which cells can enter the embryo
Paraxial to form the notochord and prechordal plate. Hensen’s node
Area mesoderm
(somites) is the functional equivalent of the dorsal lip of the amphib-
opaca ian blastopore (i.e., the organizer)1 and the fish embryonic
Lateral plate
Primitive shield (Boettger et al. 2001).
mesoderm
groove The primitive streak defines the major body axes of the
Extraembryonic avian embryo. It extends from posterior to anterior; migrat-
mesoderm Primitive
(D) ing cells enter through its dorsal side and move to its ventral
streak side; and it separates the left portion of the embryo from
Head Prechordal
the right. The axis of the streak is equivalent to the dorsal-
process mesoderm,
notochord
ventral axis of amphibians. The anterior end of the streak—
Hensen’s Hensen’s node—gives rise to the prechordal mesoderm,
Medial somite notochord, and medial part of the somites. Cells that ingress
node
Lateral somite through the middle of the streak give rise to the lateral part
Kidney, etc. of the somites and to the heart and kidneys. Cells in the pos-
(E) terior portion of the streak make the lateral plate and extra-
Lateral plate
embryonic mesoderm (Psychoyos and Stern 1996). After the
Ectoderm of mesoderm
head fold
ingression of the mesoderm cells, epiblast cells remaining
Extraembryonic outside of but close to the streak will form medial (dorsal)
Anterior mesoderm
structures such as the neural plate, while those epiblast cells
border of
farther from the streak will become epidermis (see Figure
mesoderm Neural fold
12.4, right-hand panels).
Somite Notochord
WEb Topic 12.2 Organizing the chick node FGFs
Hensen’s Segmental plate
and BMPs have major roles in determining the place where
node Primitive streak gastrulation is initiated.
the embryo. Convergent extension is responsible for the progression of the streak—a
doubling in streak length is accompanied by a concomitant halving of its width (see
Figure 12.4B). Cell division adds to the length produced by convergent extension, and
some of the cells from the anterior portion of the epiblast contribute to the formation of
Hensen’s node (Streit et al. 2000; Lawson and Schoenwolf 2001b).
At the same time, the secondary hypoblast (endoblast) cells continue to migrate
anteriorly from the posterior marginal zone of the blastoderm (see Figure 12.3E). The
elongation of the primitive streak appears to be coextensive with the anterior migra-
tion of these secondary hypoblast cells, and the hypoblast directs the movement of the
primitive streak (Waddington 1933; Foley et al. 2000). The streak eventually extends to
60–75% of the length of the area pellucida.
Hypoblast
Rostral The first cells to migrate through Hensen’s node are those destined
Neural tube to become the pharyngeal endoderm of the foregut. Once deep within
Neurons
Somites 1,5 the embryo, these endodermal cells migrate anteriorly and eventually
displace the hypoblast cells, causing the hypoblast cells to be confined
Presomitic RA to a region in the anterior portion of the area pellucida. This anterior
mesoderm region, the germinal crescent, does not form any embryonic structures,
3
Floor plate Raldh2 but it does contain the precursors of the germ cells, which later migrate
1 Shh through the blood vessels to the gonads.
Paraxial RARβ 3,4 The next cells entering through Hensen’s node also move anteri-
mesoderm 1,4 Wnt8c orly, but they do not travel as far ventrally as the presumptive foregut
Notochord 4 endodermal cells. Rather, they remain between the endoderm and the
Delta1 epiblast to form the prechordal plate mesoderm (Psychoyos and Stern
Caudal lateral
2 Fgf8 1996). Thus, the head of the avian embryo forms anterior (rostral) to
epiblast 1 Hensen’s node.
Primitive The next cells passing through Hensen’s node become the chor-
streak damesoderm . The chordamesoderm has two components: the head
Caudal
process and the notochord. The most anterior part, the head process,
Raldh2/RARβ
is formed by central mesoderm cells migrating anteriorly, behind the
Fgf8 Shh prechordal plate mesoderm and toward the rostral tip of the embryo
(see Figures 12.4 and 12.5). The head process underlies those cells that
Figure 12.6 Signals that regulate axis extension in will form the forebrain and midbrain. As the primitive streak regresses,
chick embryos. In the stage 10 chick embryo, Fgf8 inhibits the cells deposited by the regressing Hensen’s node will become the
expression of the retinoic acid (RA) synthesizing enzyme notochord. In the ectoderm, most of the initial neural plate corresponds
Raldh2 in the presomitic mesoderm (1) and the expression to the future head region (from forebrain to the level of the future ear
of the RA receptor RARβ in the neural ectoderm (4), thus vesicle, which lies adjacent to Hensen’s node at full primitive streak
preventing RA from triggering differentiation in the caudal- stage). A small region of neural ectoderm just lateral and posterior to
lateral epiblast cells (those cells adjacent to the node/
the node (sometimes called the caudal lateral epiblast) will give rise
streak border and which give rise to lateral and dorsal
neural tube) and the caudalmost paraxial mesoderm (1,5). to the rest of the nervous system, including the posterior hindbrain
In addition, Fgf8 inhibits Sonic hedgehog (Shh) expression and all of the spinal cord. As the primitive streak regresses, this latter
in the neural tube floorplate, controlling the onset of ven- region regresses with Hensen’s node and adds cells to the caudal end of
tral patterning genes (1). FGF signaling is also required for the elongating neural plate. It appears that FGF signaling in the streak
expression of Delta1 in the medial portion of the caudal- and paraxial (future somite) mesoderm keeps this region “young” and
lateral epiblast cells (2) and promotes expression of Wnt8c undifferentiated as it regresses, and that this is antagonized by retinoic
(4). As Fgf8 decays in the caudal paraxial mesoderm, Wnt
acid (RA) activity as cells leave this zone (Figure 12.6 ; Diez del Corral
signaling, most likely provided by Wnt8c, now acts to pro-
mote Raldh2 in the adjacent paraxial mesoderm (4). RA et al. 2003).
produced by Raldh2 activity represses Fgf8 (1) and Wnt8c
(3,4). (After Wilson et al. 2009.) Scientists speak 12.1 Dr. Steven Oppenheimer lectures on the
development of the chick embryo.
formation of the primitive streak The migration of chick epiblast cells to form
the primitive streak was first analyzed by Ludwig Gräper, who in 1926 made time-lapse
movies of labeled cells under the microscope. He wrote that these movements reminded
him of the Polonaise, a courtly dance in which men and women move in parallel rows
along the sides of the room, and the man and woman at the “posterior end” leave their
respective lines to dance forward through the center. The mechanism for the cellular
“dance” was revealed by Voiculescu and colleagues (2007), who used a modern version
of cinemicrography (specifically, multiphoton time-lapse microscopy) that identified
individual moving cells. They found that cells came down the sides of the epiblast to
undergo a medially directed intercalation of cells in the posterior margin where the
primitive streak was forming (Figure 12.7). And although the movement may look like
a dance from far away, “at high power, it looks like a rush hour” (Stern 2007).
This rush to the center is mediated by the activation of the Wnt planar cell polar-
ity pathway (see Chapter 4) in the epiblast next to Koller’s sickle, at the posterior edge
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_12.06 Date 02-12-16
Birds and Mammals 387
of the embryo. If this pathway is blocked, the mesoderm and (A) (B)
endoderm form peripherally instead of centrally. The Wnt path-
way in turn appears to be activated by fibroblast growth factors
(FGFs) produced by the hypoblast. If the hypoblast is rotated,
the orientation of the primitive streak follows it. Moreover, if
FGF signaling is activated in the margin of the epiblast, Wnt
signaling will occur there and the orientation of the primitive
streak will change, as if the hypoblast had been placed there.
The cell migrations that form the primitive streak thus appear
to be regulated by FGFs coming from the hypoblast, which acti-
vates the Wnt planar cell polarity pathway in the epiblast.
5 5
16 10 4 5 11 17 10 4 17 4
migration through the primitive streak Cells migrate 16 3 11 12 10 11
15 9 3 1 6 12 18
to the primitive streak, and as they enter the embryo, the cells 14 8 2 7 13 19 15 9 1 6 18 3 17
separate into two layers. The deep layer joins the hypoblast 14 7 13 19 16 12
8 2 15 1 18
along its midline, displacing the hypoblast cells to the sides. 9 6
7 19
These deep-moving cells give rise to the endodermal organs of 14 13
Time 8
the embryo, as well as to most of the extraembryonic membranes 2
(the hypoblast and peripheral cells of the area opaca form the
rest). The second migrating layer spreads to form a loose layer of Figure 12.7 Mediolateral intercalation in the formation of the
primitive streak. Chick embryos at (A) stage 13 (immediately prior
cells between the endoderm and the epiblast. This middle layer
to primitive streak formation) and (B) stage 2 (shortly after primi-
of cells generates the mesodermal portions of the embryo and
tive streak formation). Arrows show cell displacement toward the
the mesoderm lining the extraembryonic membranes. streak and in front of it. The red area represents the streak-forming
The migration of mesodermal cells through the anterior region; in (A), the original location of this region is shown in green.
primitive streak and their condensation to form the chordame- The circled areas are represented in the lower row. Each colored
soderm also appear to be controlled by FGF and Wnt signaling. disc represents an individual cell, and the cells become mediolat-
Fgf8 is expressed in the primitive streak and repels migrating erally intercalated as the primitive streak forms. (After Voiculescu
et al. 2007.)
cells away from the streak. Yang and colleagues (2002) were able
to follow the trajectories of cells as they migrated through the
primitive streak (see Figure 12.5) and were able to deflect these
normal trajectories by using beads that released Fgf8.
Once cells migrate away from the streak, further movement of the mesodermal pre-
cursors appears to be regulated by Wnt proteins. In the more posterior regions, Wnt5a is
unopposed and directs the cells to migrate broadly and become lateral plate mesoderm
(see Chapter 18). In the more anterior regions of the streak, however, Wnt5a is opposed
by Wnt3a, which inhibits migration and causes the cells to form paraxial mesoderm (see
Chapter 17). Indeed, the addition of Wnt3a-secreting pellets to the posterior primitive
streak suppresses lateral migration and prevents the formation of lateral plate meso-
derm (Sweetman et al. 2008). By 22 hours of incubation, most of the presumptive endo-
dermal cells are in the interior of the embryo, although presumptive mesodermal cells
continue to migrate inward for a longer time.
Primitive streak
Area pellucida
Primitive
Area opaca streak
(D) (E)
Lengthening of notochord
d
d'
b' Reg
res
of p sion
c rimi
c' strea tive
k
Posterior border of pellucida area
0.0 10.5 20.5
Hours
WEb Topic 12.3 Epiblast cell heterogeneity Although the early epiblast
appears uniform, different cells have different molecules on their cell surfaces. This vari-
ability allows some of them to remain in the epiblast while others migrate into the embryo.
(A) Surface view of egg (B) Cross section through egg (C) Surface view of yolk
Blastoderm Primitive
streak
P
A
X Y X Yolk Y X P A Y
and Stern 2002). Thus, the pattern appears similar to that of amphibian embryos.
Recent studies suggest that Nodal activity is needed to initiate the primitive
streak, and that it is the secretion of Cerberus—an antagonist of Nodal—by the
primary hypoblast cells that prevents primitive streak formation (Bertocchini
et al. 2004; Voiculescu et al. 2014). As the primary hypoblast cells move away
from the PMZ, Cerberus protein is no longer present, allowing Nodal activity
(and therefore formation of the primitive streak) in the posterior epiblast. Once
Figure 12.10 Model for generating left-right
formed, however, the streak secretes its own Nodal antagonist—the Lefty pro-
asymmetry in the chick embryo. (A) On the left
side of Hensen’s node, Sonic hedgehog (Shh) tein—thereby preventing any further primitive streaks from forming. Eventu-
activates Cerberus, which stimulates BMPs to ally, the Cerberus-secreting hypoblast cells are pushed to the future anterior of
induce the expression of Nodal. In the presence the embryo, where they contribute to ensuring that neural cells in this region
of Nodal, the Pitx2 gene is activated. Pitx2 pro- become forebrain rather than more posterior structures of the nervous system.2
tein is active in the various organ primordia and
specifies which side will be the left. On the right Left-right axis formation
side of the embryo, activin is expressed, along
The vertebrate body has distinct right and left sides. The heart and spleen, for
with activin receptor IIa. This activates Fgf8, a
protein that blocks expression of the gene for instance, are generally on the left side of the body, whereas the liver is usually
Cerberus. In the absence of Cerberus, Nodal is on the right. The distinction between the sides is primarily regulated by the left-
not activated and thus Pitx2 is not expressed. sided expression of two proteins: the paracrine factor Nodal and the transcrip-
(B) Whole-mount in situ hybridization of Cer- tion factor Pitx2. However, the mechanism by which Nodal gene expression is
berus mRNA. This view is from the ventral sur- activated in the left side of the body differs among the vertebrate classes. The
face (“from below,” so the expression seems to ease with which chick embryos can be manipulated has allowed scientists to
be on the right). Dorsally, the expression pattern
elucidate the pathways of left-right axis determination in birds more readily than
would be on the left. (C) Whole-mount in situ
hybridization using probes for the chick Nodal in other vertebrates.
message (stained purple) shows its expression in As the primitive streak reaches its maximum length, transcription of the
the lateral plate mesoderm only on the left side Sonic hedgehog gene (Shh) becomes restricted to the left side of the embryo, con-
of the embryo. This view is from the dorsal side. trolled by activin and its receptor (Figure 12.10A). Activin signaling, along with
(D) Similar in situ hybridization, using the probe BMP4, appears to block the expression of Sonic hedgehog protein and to activate
for Pitx2 at a later stage of development. The expression of Fgf8 protein on the right side of the embryo. Fgf8 blocks expres-
embryo is seen from its ventral surface. At this
sion of the paracrine factor Cerberus on the right-hand side; it may also activate
stage, the heart is forming, and Pitx2 expression
can be seen on the left side of the heart tube a signaling cascade that instructs the mesoderm to have right-sided capacities
(as well as symmetrically in more anterior tis- (Schlueter and Brand 2009).
sues). (A after Raya and Izpisua-Belmonte 2004;
2
B from Rodriguez-Esteban et al. 1999, courtesy Conjoined twins may be formed by having by having two sources of Nodal expression
of J. Izpisúa-Belmonte; C courtesy of C. Stern; within the same blastodisc. Experimentation with chick embryos can produce two axes
D from Logan et al. 1998, courtesy of C. Tabin.) in the same blastodisc by circumventing the usual inhibition of Nodal by the Vg1-secret-
ing posterior cells (Bertocchini et al. 2004). In mammals, multiple axes can also form if
Nodal antagonists are blocked (Perea Gomez et al. 2002).
LEFT RIGHT
Hensen’s
node Shh Activin
Shh Fgf8 BMP4
Cerberus Cerberus
Lefty
BMPs
Nodal
Snail
Pitx2
Midline
Birds and Mammals 391
Meanwhile, on the left side of the body, Shh protein activates Cerberus (Figure
12.10B ), which in this case acts with BMP to stimulate the synthesis of Nodal pro-
tein (Yu et al. 2008). Nodal activates the Pitx2 gene while repressing Snail. In addition,
Lefty1 in the ventral midline prevents the Cerberus signal from passing to the right
side of the embryo (Figure 12.10C,D). As in Xenopus, Pitx2 is crucial in directing the
asymmetry of the embryonic structures. Experimentally induced expression of either
Nodal or Pitx2 on the right side of the chick embryo reverses the asymmetry or causes
randomization of asymmetry on the right or left sides 3 (Levin et al. 1995; Logan et al.
1998; Ryan et al. 1998).
The real mystery is, What processes create the original asymmetry of Shh and Fgf8?
One important observation is that the first asymmetry seen during the formation of
Hensen’s node in chicks involves Fgf8- and Shh-expressing cells rearranging them-
selves to converge on the right-hand side of the node (Cui et al. 2009; Gros et al. 2009).
Therefore, the differences in gene expression can be traced back to differences in cell
migration to the right and left sides of the embryo. What establishes this initial asym-
metry is still unknown, but it may be a physical displacement of cells around the node
(Tsikolia et al. 2012; Otto et al. 2014).
Fertilization
Blastocyst Infundibulum
Ovary
Early stage of
Fimbriae
implantation Ovulation
in the second cleavage, one of the two blastomeres divides meridionally and the other
divides equatorially (Figure 12.12). This is called rotational cleavage (Gulyas 1975).
Another major difference between mammalian cleavage and that of most other
embryos is the marked asynchrony of early cell division. Mammalian blastomeres do
not all divide at the same time. Thus, mammalian embryos do not increase exponen-
tially from 2 to 4 to 8 cells, but frequently contain odd numbers of cells. Furthermore,
the mammalian genome, unlike the genomes of rapidly developing animals, is activated
during early cleavage and zygotically transcribed proteins are necessary for cleavage
and development. Maternally encoded proteins can persist through most of the cleavage
stages and play important roles in early development. In the mouse and goat, the activa-
tion of zygotic (i.e., nuclear) genes begins in the late zygote and continues through the
2-cell stage (Zeng and Schultz 2005; Rother et al. 2011). In humans, the zygotic genes
are activated slightly later, around the 8-cell stage (Piko and Clegg 1982; Braude et al.
1988; Dobson et al. 2004).
In order for the zygotic genes to be activated, the parental chromatin undergoes
many changes. New histones are placed on the DNA during the early cell divisions, and
the gamete-specific DNA methyl groups are removed (except for those on imprinted
genes; see Chapter 3). In both mice and human embryos, the DNA methylation of
sperm and egg chromatin is almost entirely removed. While some “imprinted
gene” methylation remains, that concerned with cell differentiation appears
(A) Echinoderm and (B) Mammal to be removed. This allows an almost “clean slate” for the newly forming
(A)–amphibian blastocyst cells. New DNA methylation patterns characteristic of totipotent
Cleavage Cleavage Cleavage Cleavage and pluripotent cells are established (Abdalla et al. 2009; Guo et al. 2014;
Gilbert
plane II plane I plane IIA plane I Smith et al. 2014). Thus, by the 16-cell stage, the genome of each cell is hypo-
Developmental Biology 11e, Sinauer Associates
methylated Date
DevBio11e_12.11 and each of these 16 cells appears to be pluripotent (Tarkowski et
02-03-16
al. 2010). The stage is now set for cell differentiation to take place.
Blastocoel Trophoblast
Figure 12.14 Core transcriptional circuitry for the pluripotency of (A) (B)
ES cells (A) Feedforward circuit in which Oct4/Sox2 dimers activate
Nanog genes. Nanog protein then activates its own gene as well as Oct4
Nanog
genes promoting pluripotency. (B) The interconnected regulatory cir- Sox2 Oct4 Oct4
cuit whereby Oct4, Sox2, and Nanog each activate themselves and Sox2 Sox2
each other’s synthesis. (After Boyer et al. 2005.)
Nanog Nanog Nanog
ES cell
genes
Developing Questions Trophoblast or ICM? The first decision of the rest of your life
We have been discussing The philosopher and theologian Søren Kierkegaard wrote that we define ourselves
eutherian mammals, by the choices we make. It seems that the embryo already knows this. The decision
those organisms such as to become either trophoblast or inner cell mass is the first binary decision in mam-
mice and humans that malian life. Later in development, embryonic cells must lose their pluripotency and
retain the fetus during decide on what they are going to grow up to be. In the first decision, Oct4 mutually
its development. But represses Cdx2 expression, enabling some cells to be trophoblast and other cells to
what about monotreme
become the pluripotent cells of the ICM. In the second decision, each of the cells of
mammals (such as the
platypus) that lay eggs, the ICM expresses either Nanog or Gata6, thereby retaining its pluripotency (Nanog)
or marsupial mammals or becoming primitive endoderm (Gata6) (Ralston and Rossant 2005; Rossant 2016).
(such as kangaroos) that Prior to blastocyst formation, each embryonic blastomere expresses both the Cdx2
have extremely short and Oct4 transcription factors (Niwa et al. 2005; Dietrch and Hiiragi 2007; Ralston and
pregnancies? Do their Rossant 2008) and appears to be capable of becoming either ICM or trophoblast (Hiiragi
embryos have blastocysts? and Solter 2004; Motosugi et al. 2005; Kurotaki et al. 2007). However, once the decision
to become either trophoblast or ICM is made, the cell expresses a set of genes specific to
each region. The pluripotency of the ICM is maintained by a core of three transcription
factors, Oct4, Sox2, and Nanog. These proteins bind to the enhancers of their own genes
to maintain their expression while at the same time activating one another’s enhancers
(Figure 12.14). Thus, when one of these genes is activated, the other ones are too. Act-
ing in concert, Sox2 and Oct4 form a dimer and often reside on enhancers adjacent to
Nanog, activating those genes required to maintain pluripotency in embryonic stem (ES)
cells and repressing those genes whose products would lead to differentiation (Marson
et al. 2008; Young 2011). These transcription factors appear to work by recruiting RNA
polymerase II to the promoters of those genes being activated while recruiting histone
methyltransferases to those genes being repressed (Kagey et al. 2010; Adamo et al. 2011).
Only trophoblast cells synthesize the transcription factor Cdx2, which downregu-
lates Oct4 and Nanog (Strumpf et al. 2005). The activation of the Cdx2 gene in the
trophoblast cells appears Gilbert
to be regulated by the Yap protein, which in turn is a co-
factor for the transcriptionDevelopmental (Figure
factor Tead4Biology 11e,12.15A
Sinauer).Associates
Tead4 is found in the nuclei
of both the inner and outerDevBio11e_12.14 Datebut
cells of the blastocyst, 02-17-16
it is activated by Yap only in the
outer compartment. That is because Yap can enter the nucleus in the outer cells and
thereby allow Tead4 to transcribe trophoblast-specifying genes such as Cdx2 and eome-
sodermin (Eomes). In contrast, the inner cells, with each of their surfaces surrounded by
other cells, activate the gene for Lats, a protein kinase that phosphorylates Yap (Figure
12.15B). Phosphorylated Yap cannot enter the nucleus and is degraded (Nishioka et al.
2009). Therefore, in the inner cells, Tead4 cannot function and Cdx2 remains untran-
scribed (see Wu and Scholer 2016). Cdx2 blocks the expression of Oct4, and Oct4 blocks
the expression of Cdx2. In this way, the two lineages become separated.
(B)
Hippo
Hippo
P
Hippo Lats
Yap Lats P
Yap
ICM
Endometrium
of uterus
Mammalian Gastrulation
Birds and mammals are both descendants of reptilian species (albeit different reptilian
species). It is not surprising, therefore, that mammalian development parallels that of
Gilbert reptiles and birds. What is surprising is that the gastrulation movements of reptilian
Developmental Biology 11e, Sinauer Associates and avian embryos, which evolved as an adaptation to yolky eggs, are retained in the
DevBio11e_12.16 Date 02-03-16 mammalian embryo even in the absence of large amounts of yolk. The mammalian
inner cell mass can be envisioned as sitting atop an imaginary ball of yolk, following
instructions that seem more appropriate to its reptilian ancestors.
Figure 12.17 Tissue and germ layer formation in the early human embryo. Days 5–9:
Implantation of the blastocyst. The inner cell mass delaminates hypoblast cells that line the
blastocoel, forming the extraembryonic endoderm of the primitive yolk sac and a bilayered
(epiblast and hypoblast) blastodisc. Days 10–12: The trophoblast divides into the cytotropho-
blast, which will form the villi, and the syncytiotrophoblast, which will ingress into the uterine
tissue to form the chorion. Days 12–15: Gastrulation and formation of primitive streak. Mean-
while, the epiblast splits into the amniotic ectoderm (which encircles the amniotic cavity) and
the embryonic epiblast. The adult mammal (ectoderm, endoderm, mesoderm, and germ cells)
forms from the cells of the embryonic epiblast. The extraembryonic endoderm forms the yolk
sac. The actual size of the embryo at this stage is about that of the period at the end of this
sentence.
Day 5 Blastocyst
Blastocyst
Epiblast
Trophoblast
Day 8–9
Embyronic
epiblast Syncytio-
trophoblast
Day 10–12
Extraembryonic Extraembryonic
mesoderm endoderm Extraembryonic Embryonic Embryonic Embryonic
mesoderm mesoderm endoderm ectoderm
Day 15
Primitive
streak
Embryonic
ectoderm
Embryonic
Embryonic endoderm Extraembryonic tissues Embryonic tissues
mesoderm
398 Chapter 12
stages, eventually becoming the chorion, the embryonically derived portion of the
placenta. Trophoblast cells also induce the mother’s uterine cells to form the mater-
nal portion of the placenta, the decidua . The decidua becomes rich in the blood
vessels that will provide oxygen and nutrients to the embryo. The inner cell mass
gives rise to the epiblast and the hypoblast (primitive endoderm). The hypoblast will
generate yolk sac cells, while the epiblast will generate the embryo, the amnion, and
the allantois.
Primitive Node
groove
Hypoblast Endoderm
Bilaminar Day 16
Amnionic cavity germ disc Node
Yolk sac
Primitive groove
contain all the cells that will generate the actual embryo and is similar in many ways
to the avian epiblast.
By labeling individual cells of the epiblast with horseradish peroxidase, Kirstie Law-
son and her colleagues (1991) were able to construct a detailed fate map of the mouse
epiblast (see Figure 1.11). Gastrulation begins at the posterior end of the embryo, and
this is where the cells of the node5 arise (Figure 12,19B,C). Like the chick epiblast cells,
mammalian mesoderm and endoderm cells originate in the epiblast, undergo epithelial-
mesenchymal transition, lose E-cadherin, and migrate through a primitive streak as
individual mesenchymal cells (Burdsal et al. 1993). Those cells arising from the node
give rise to the notochord. However, in contrast to notochord formation in the chick, the
cells that form the mouse notochord are thought to become integrated into the endo-
derm of the primitive gut (Jurand 1974; Sulik et al. 1994). These cells can be seen as a
band of small, ciliated cells extending rostrally from the node. They form the notochord
by converging medially and “budding” off in a dorsal direction from the roof of the gut.
The timing of these developmental events varies enormously in mammals. In humans,
the migration of cells forming the mesoderm doesn’t start until day 16—around the
time that a mouse embryo is almost ready to be born (see Figure 12.19C; Larsen 1993).
Cell migration and specification are coordinated by fibroblast growth factors. The
cells of the primitive streak appear to be capable of both synthesizing and responding
to FGFs (Sun et al. 1999; Ciruna and Rossant 2001). In embryos that are homozygous for
the loss of the Fgf8 gene or its receptor, cells fail to emigrate from the primitive streak,
and neither mesoderm nor endoderm are formed. Fgf8 (and perhaps other FGFs) prob-
ably control cell movement into the primitive streak by downregulating the E-cadherin
that holds the epiblast cells together. Fgf8 may also control cell specification by regulat-
ing snail, Brachyury, and Tbx6, three genes that are essential (as they are in the chick
embryo) for mesodermal migration, specification, and patterning.
The ectodermal precursors are located anterior and lateral to the fully extended
primitive streak, as in the chick epiblast and (as in the chick embryo), a single cell can
give rise to descendants in more than one germ layer. Thus, at the epiblast stage these
lineages have not yet become fully separate from one another. Indeed, in mice, some of
the visceral endoderm, which had been extraembryonic, is able to intercalate with the
definitive endoderm and become part of the gut (Kwon et al. 2008).
Scientists speak 12.2 In two videos, Dr. Janet Rossant discusses her research
on embryonic cell lineages in the mouse embryo.
It is, indeed, wonderful, and we are just beginning to find out how really amazing it is.
5
In mouse development, Hensen’s node is usually just called “the node,” despite the fact that
Hensen discovered this structure in rabbit and guinea pig embryos.
400 Chapter 12
Figure 12.21 Formation of the AVE precursor cells by mechani- (A) Day 5 (B) Day 5.5
cal stress. (A) At day 5 of embryogenesis, growth is not restricted by
the shape of the uterus and the embryo grows in several directions.
(B) About 12 hours later, embryonic growth becomes restricted and
the embryo grows only in the proximal-distal direction. The base-
ment membrane at the distal region breaks, and epiblast cells enter Mechanical
the visceral endoderm layer (blue arrows), forming the precursors of forces from
Growth Growth maternal
the AVE. (After Hiramatsu et al. 2013.)
tissues
Breach in
Basement basement
membrane membrane
AVE precursor
cell formation
force generated by the uterus is critical in instructing normal (A-P polarization)
development.
Hox genes
Anterior Primitive
streak
Ectoderm Organizer
Mesoderm Axial Anterior-posterior
mesendoderm Developmental Biology 11e patterning
Endoderm Fig. 12.21
Dragonfly Media Group
02/17/16
402 Chapter 12
The Cdx genes, in turn, integrate the various posteriorization signals and activate par-
ticular Hox genes.
Drosophila embryo
(10 hours)
mouse complex (such as Hoxa4, b4, c4, and d4) are paralogues —that is, it is thought
that the four mammalian Hox complexes were formed by chromosome duplications.
Because the correspondence between the Drosophila Hom-C genes and mouse Hox
genes is not one-to-one, it is likely that independent gene duplications and deletions
have occurred since these two animal groups diverged (Hunt and Krumlauf 1992).
Indeed, the most posterior mouse Hox gene (equivalent to Drosophila AbdB) underwent
its own set of duplications in some mammalian chromosomes.
Hox gene expression can be seen along the mammalian body axis (in the neural
tube, neural crest, paraxial mesoderm, and surface ectoderm) from the anterior bound-
ary of the hindbrain through the tail. The regions of expression are not in register,
but the 3′ Hox genes (homologous to labial, proboscopedia, and deformed of the fly) are
expressed more anteriorly than the 5′ Hox genes (homologous to Ubx, abdA, and AbdB).
Thus, one generally finds the genes of paralogous group 4 expressed anteriorly to those
of paralogous group 5, and so forth (see Figure 12.23; Wilkinson et al. 1989; Keynes and
Lumsden 1990). Mutations in the Hox genes suggest that the regional identity along
the anterior-posterior axis is determined primarily by the most posterior Hox gene
expressed in that region.
experimental analysis of the hox code The expression patterns of mouse Hox
genes suggest a code whereby certain combinations of Hox genes specify a particu-
lar region of the anterior-posterior axis (Hunt and Krumlauf 1991). Particular sets of
paralogous genes provide segmental identity along the anterior-posterior axis of the
body. Evidence for such a code comes from two main sources: (1) comparative anatomy,
in which the types of vertebrae in different vertebrate species are correlated with the
constellation of Hox gene expression; and (2) gene targeting (“knockout”) experiments,
in which mice are constructed that lack both copies of one or more Hox genes.
12.25A). This was demonstrated when all six copies of the Hox10
paralogous group (i.e., Hoxa10, c10, and d10 in Figure 12.23) were
knocked out and no lumbar vertebrae developed. Instead, the pre-
sumptive lumbar vertebrae formed ribs and other characteristics
Lumbar similar to those of thoracic vertebrae (Figure 12.25B). This was
a homeotic transformation comparable to those seen in insects;
however, the redundancy of genes in the mouse made it much
more difficult to produce, because the existence of even one copy
of the Hox10 group genes prevented the transformation (Wellik
and Capecchi 2003; Wellik 2009). Similarly, when all six copies of the Hox11 group were
knocked out, the thoracic and lumbar vertebrae were normal, but the sacral vertebrae
failed to form and were replaced by lumbar vertebrae (Figure 12.25C). More recently, a
Hoxb6 gene was placed on a Delta enhancer, causing it to be expressed in every somite.
The result was a “snakelike” mouse in which each somite had formed a rib-bearing
thoracic vertebra (see Figure 17.7C; Guerreiro et al. 2013).
(A) 5-Week
human
embryo (B) (C)
Gut Liver Heart Lungs
rudiment
Foregut
4 weeks
Stomach
5 Weeks rudiment 4 weeks
4.5 weeks
Trachea
7 Weeks 6 weeks Bronchi
(D)
Figure 12.26 Left-right asymmetry in the developing human.
(A) Abdominal cross sections show that the originally symmetrical organ
rudiments acquire asymmetric positions by week 11. The liver moves to
the right and the spleen moves to the left. (B) Not only does the heart
move to the left side of the body, but the originally symmetrical veins of
the heart regress differentially to form the superior and inferior venae
cavae, which connect only to the right side of the heart. (C) The right lung
branches into three lobes, while the left lung (near the heart) forms only
two lobes. In human males, the scrotum also forms asymmetrically. (D)
Ciliated cells of the mouse node, each with a cilium extending from the
posterior ventral region of the cell. (A–C After Kosaki and Casey 1998; D
courtesy of K. Sulik and G. C. Schoenwolf.)
or right side of the body; see Afzelius 1976). Moreover, when Nonaka and colleagues
(2002) cultured early mouse embryos under an artificial flow of medium from left to
right, they obtained a reversal of the left-right axis.
The mechanism for this rotation appears to be the placement of the basal body of
the cilium on each of the 200 or so monociliated node cells. The basal body giving rise
to each cilium is at the posterior side of each cell and extends out the ventral surface.
Thus, the placement of cilia integrates information concerning the anterior-posterior and
Gilbert
dorsal-ventral
Developmental axes11e
Biology to ,construct the right-left axis (Guirao et al. 2010; Hashimoto et al.
Sinauer Associates
2010). The placement
DevBio11e_12.26 Date 02-12-16 is governed by the planar cell polarity (PCP) pathway,
of the cilia
406 Chapter 12
possibly directed by a Wnt. Mutations in PCP pathway signaling molecules can random-
ize localization of cilia in these cells, also causing randomization of the left-right axis.
But how does rotation generate a body axis? It appears that the cells neighboring the
node, the crown cells, are responsible for sensing the flow. Crown cells have immo-
bile cilia, and these cilia are affected by the movement of fluids. The fluid movement
activates the Pkd2 protein on their cilia. A cascade initiated by Pdk2 (in a manner
still unknown) appears to suppress the synthesis of Cerberus and thereby activate the
expression of Nodal (Kawasumi et al. 2011; Yoshiba et al. 2012). Nodal is thought to
bind in an autocrine manner to crown cells to maintain its own transcription; so Cer-
berus (which is made by the crown cells on the right side) would inhibit the mainte-
nance of Nodal expression. In this way, Nodal expression is maintained on the left side,
where it can activate Pitx, which determines the left- and right-sidedness of the tissue.
Watch development 12.2 View video on the several sites that focus on the week-
by-week changes of human development, as well as sites detailing the molecular biology
of mouse development, comparing it with that of humans.
Twins
The early cells of the mammalian embryo can replace each other and compensate
for a missing cell. This regulative ability was first demonstrated in 1952, when Seidel
destroyed one cell of a 2-cell rabbit embryo and the remaining cell produced an entire
embryo. The regulative capacity of the early embryo is also seen in humans. Human
twins are classified into two major groups: monozygotic (one-egg; identical) twins and
dizygotic (two-egg; fraternal) twins. Fraternal twins are the result of two separate fer-
tilization events, whereas identical twins are formed from a single embryo whose cells
somehow become dissociated from one another.
Identical twins, which occur in roughly 1 in 400 human births, may be produced by
the separation of early blastomeres, or even by the separation of the inner cell mass into
two regions within the same blastocyst. About 33% of identical twins have two com-
plete and separate chorions, indicating that separation occurred before the formation of
the trophoblast tissue at day 5 (Figure 12.27A). Other identical twins share a common
chorion, suggesting that the split occurred within the inner cell mass after the tropho-
blast formed. By day 9, the human embryo has completed the construction of another
extraembryonic layer, the lining of the amnion. If separation of the embryo comes
after the formation of the chorion on day 5 but before the formation of the amnion on
day 9, then the resulting embryos should have one chorion and two amnions (Figure
12.27B). This happens in about two-thirds of human identical twins. A small percent-
age of identical twins are born within a single chorion and amnion (Figure 12.27C ),
meaning the division of the embryo came after day 12.
According to these studies of twins, each cell of the inner cell mass should be able to
produce any cell of the body. This hypothesis has been confirmed, and it has important
consequences for the study of mammalian development. When ICM cells are isolated
and grown under certain conditions, they remain undifferentiated and continue to
divide in culture (Evans and Kaufman 1981; Martin 1981). Such cells are embryonic
stem cells (ES cells). When ES cells are injected into a mouse blastocyst, they can inte-
grate into the host inner cell mass. The resulting embryo has cells from both the host
and the donor tissue. This technique has become extremely important in determining
the function of genes during mammalian development.
WEb Topic 12.6 Chimerism The opposite of twins, chimeras occur when two distinct
embryos are fused together to create a single individual.
Whereas fraternal twins are created during fertilization (two separate eggs meet-
ing two separate sperm) and identical twins are formed during cleavage, conjoined
Birds and Mammals 407
2 Chorions
Embryo Yolk sac
Amnion
(A)
2 Amnions
Trophoblast Chorion
Inner cell mass 1 Chorion
(B)
2 Amnions
2-Cell
embryo
Blastocoel 1 Chorion
(C)
1 Amnion
Figure 12.27 The timing of human monozygotic twinning with relation to extraembryonic
membranes. (A) Splitting occurs before formation of the trophoblast, so each twin has its own
chorion and amnion. (B) Splitting occurs after trophoblast formation but before amnion forma-
tion, resulting in twins having individual amniotic sacs but sharing one chorion. (C) Splitting after
amnion formation leads to twins in one amniotic sac and a single chorion. (After Langman 1981.)
twins are probably created during gastrulation. Conjoined twins are identical (there
Developing Questions
has never been a documented case of conjoined twins being different sexes) and occur
approximately once in every 200,000 live births. Spratt and Haas (1960) showed that In an episode of the U.S.
television series CSI: Crime
if the chick epiblast is divided into four parts, each forms a primitive streak (Figure
Scene Investigation,
12.28A). Moreover, if a second Hensen’s node from a chick is placed into an epiblast, the DNA of the obvious
the two primitive streaks can fuse together. It appears that if there is a tear in the mar- perpetrator did not match
ginal zone (allowing a new center of Nodal expression to form), or if a second region of the DNA of the cells at the
the marginal zone should express Nodal, then a second axis can form (Figure 12.28B ; crime scene. The episode
Gilbert
Bertocchini and Stern 2002; Perea Gomez et al. 2002; Torlopp et al. 2014). Since humans was based on actual rare
Developmental
are thought toBiology the, Sinauer
have 11e Associates pathway to making the primitive streak as
same molecular instances where a mammal
DevBio11e_12.27 Date 02-04-16 has been found to have
chicks do, it seems possible that conjoined twins could be the result of two areas of the
two different sets of DNA.
margin producing Nodal. Levin (1999) has shown that this would explain the differ- How do you think such
ent type of conjoined twins (Figure 12.28C ). We do not know how conjoined twins a situation might come
form, but the generation of multiple axes during gastrulation might begin to explain about?
this phenomenon.
WEb Topic 12.7 Conjoined twins Although conjoined twins are a rare occurrence,
the medical and social issues raised by conjoined twins provide a fascinating look at
what people throughout history have considered “individuality.”
408 Chapter 12
Node
2° neural Primitive
tube streak
2° head Secondary
Right Left forming streak
Craniopagus
Host
head
forming
Thoracopagus
Parapagus
Host
Posterior neural
tube
Figure 12.28 (A) Spratt and Haas
(1960) showed that if the chick epiblast
were divided into four parts, each
would form a primitive streak. (B) If a
Pygopagus
second Hensen’s node from a chick
were placed into an epiblast, the two
primitive streaks could fuse together.
It appears that if there is a tear or in
a second region of the marginal zone
expresses Nodal, then a second
axis can form. (C) Since humans are
thought to have the same molecular
pathway to making the primitive streak,
it would seem possible that conjoined
Dev T utorial Twinning In this brief lecture, Scott Gilbert describes
twins could be made by having two
some of the recent theories of twin formation.
areas of the margin produce Nodal.
This would explain the different type of
conjoined twins (Levin 1999).
Coda
Variations on the important themes of development have evolved in the different ver-
tebrate groups (Figure 12.29). The major themes of vertebrate gastrulation include:
• Internalization of the endoderm and mesoderm
• Epiboly of the ectoderm around the entire embryo
• Convergence of the internal cells to the midline
• Extension of the body along the anterior-posterior axis
Although fish, amphibian, avian, and mammalian embryos have different patterns of
cleavage and gastrulation, they use many of the same molecules to accomplish the same
goals. Each group uses gradients of Nodal and Wnt proteins to establish polarity along the
anterior-posterior axis. In Xenopus and zebrafish, maternal factors induce Nodal proteins
in the vegetal hemisphere or marginal zone. In the chick, Nodal expression is induced by
Wnt and Vg1 emanating from the posterior marginal zone, while elsewhere Nodal activ-
ity is suppressed by the hypoblast. In the mouse, the hypoblast similarly restricts Nodal
activity, using Cerberus in the chick embryo and Cerberus and Lefty1 in mammals.
Each of these vertebrate groups uses BMP inhibitors to specify the dorsal axis. Sim-
ilarly, Wnt inhibition and Otx2 expression are important in specifying the anterior
Gilbert regions of the embryo, but different groups of cells may express these proteins. In all
Developmental Biology 11e, Sinauer Associates
cases, the region of the body from the hindbrain to the tail is specified by Hox genes.
DevBio11e_12.28 Date 02-04-16
Finally, the left-right axis is established through the expression of Nodal on the left-
hand side of the embryo. Nodal activates Pitx2, leading to the differences between
the left and right sides of the embryo. How Nodal becomes expressed on the left side
appears to differ among the vertebrate groups. But overall, despite their initial differ-
ences in cleavage and gastrulation, the different vertebrate groups have maintained
very similar ways of establishing the three body axes.
Zebrafish Frog Chicken Birds and Mammals
Mouse 409
STAGE Danio rerio Xenopus laevis Gallus gallus Mus musculus
Early
cleavage
Epiblast
Primary Secondary
Yolk cell hypoblast hypoblast Hypoblast
SMO Blastopore
Blastopore Hypoblast SMO
SMO
Pharyngula
Figure 12.29 Early development in four vertebrates. Cleavage of the blastopore is indicated by the red arrows extending from the
differs greatly among the four groups. Zebrafish and chicks have organizer. By the late gastrula stage, the endoderm (yellow) is inside
meroblastic discoidal cleavage; frogs have unequal holoblastic the embryo, the ectoderm (blue, purple) surrounds the embryo, and
cleavage; and mammals have equal holoblastic cleavage. These the mesoderm (red) is between the endoderm and ectoderm. The
cleavage patterns form different structures, but there are many con- regionalization of the mesoderm has also begun. The bottom row
served features, such as the Nieuwkoop center (NC; green circles). shows the pharyngula stage that immediately follows gastrulation.
Gilbert
As gastrulation begins, each of the groups has cells equivalent This stage, with a pharynx, a central neural tube and notochord
Developmental Biology 11e, Sinauer Associates
to the Spemann-Mangold
DevBio11e_12.29 Dateorganizer
02-12-16 (SMO; red circles). The SMO flanked by somites, and a sensory cephalic (head) region, charac-
marks the beginning of the blastopore region, and the remainder terizes the vertebrates. (After Solnica-Krezel 2005.)
410 Chapter 12
12 Snapshot Summary
Early Development in Birds and Mammals
1. Reptiles and birds, like fish, undergo discoidal mero- signals Pitx2 expression on the left side of developing
blastic cleavage, wherein the early cell divisions do not organs.
cut through the yolk of the egg. These early cells form a 6. The hypoblast helps determine the body axes of the
blastoderm. embryo, and its migration determines the cell move-
2. In chick embryos, early cleavage forms an area opaca ments that accompany formation of the primitive streak
and an area pellucida. The region between them is the and thus its orientation.
marginal zone. Gastrulation begins in the area pellucida 7. Mammals undergo a variation of holoblastic rotational
next to the posterior marginal zone, as the hypoblast and cleavage that is characterized by a slow rate of cell divi-
primitive streak both start there. sion, a unique cleavage orientation, lack of divisional
3. The primitive streak is derived from epiblast cells and synchrony, and formation of a blastocyst.
the central cells of Koller’s sickle. As the primitive streak 8. The blastocyst forms after the blastomeres undergo
extends rostrally, Hensen’s node is formed. Cells migrat- compaction. It contains outer cells—the trophoblast
ing out of Hensen’s node become prechordal mesendo- cells—that become the chorion, and an inner cell mass
derm and are followed by the head process and noto- that becomes the amnion and the embryo.
chord cells.
9. The inner cell mass cells are pluripotent and can be
4. The prechordal plate helps induce formation of the cultured as embryonic stem cells. They give rise to the
forebrain; the chordamesoderm induces formation of epiblast and to the visceral endoderm (hypoblast).
the midbrain, hindbrain, and spinal cord. The first cells
10. The chorion forms the fetal portion of the placenta, which
migrating laterally through the primitive streak become
functions to provide oxygen and nutrition to the embryo,
endoderm, displacing the hypoblast. The mesoderm cells
to provide hormones for the maintenance of pregnancy,
then migrate through the primitive streak. Meanwhile, the
and to block the potential immune response of the moth-
surface ectoderm undergoes epiboly around the yolk.
er to the developing fetus.
5. In birds, gravity helps determine the position of the primi-
11. Mammalian gastrulation is not unlike that of birds. There
tive streak, which points in a posterior-to-anterior direc-
appear to be two signaling centers, one in the node and
tion and whose differentiation establishes the dorsal-ven-
one in the anterior visceral endoderm. The latter center is
tral axis. The left-right axis is formed by the expression
critical for establishing the body axes, while the former is
of Nodal protein on the left side of the embryo, which
Birds and Mammals 411
critical in inducing the nervous system and in patterning migrate through the primitive streak), and the precursors
axial structures caudally from the midbrain. of the ectoderm, which remain on the surface. By the end
12. Hox genes pattern the anterior-posterior axis and help of gastrulation, the head and anterior trunk structures
specify positions along that axis. If Hox genes are are formed. Elongation of the embryo continues through
knocked out, segment-specific malformations can arise. precursor cells in the caudal epiblast surrounding the
Similarly, causing the ectopic expression of Hox genes posteriorized Hensen’s node.
can alter the body axis. 16. In each class of vertebrates, neural ectoderm is permitted
13. The homology of gene structure and the similarity of to form where the BMP-mediated induction of epidermal
expression patterns between Drosophila and mammalian tissue is prevented.
Hox genes suggest that this patterning mechanism is 17. Fraternal twins arise from two separate fertilization
extremely ancient. events. Identical twins result from the splitting of the
14. The mammalian left-right axis is specified similarly to that embryo into two cellular groups during stages where
of the chick, but with some significant differences in the there are still pluripotent cells in the embryo. Experimen-
roles of certain genes. tal evidence suggests that conjoined twins may occur
through the formation of two organizers within a common
15. In amniote gastrulation, the pluripotent epithelium, or
blastodisc.
epiblast, produces the mesoderm and endoderm (which
Further Reading
Beddington, R. S. P. and E. J. Robertson. 1999. Axis develop- Rossant, J. 2016. Making the mouse blastocyst: Past, present,
ment and early asymmetry in mammals. Cell 96: 195–2012. and future. Curr. Top. Dev. Biol. 116: 275–288.
Bertocchini, F. and C. D. Stern. 2002. The hypoblast of the chick Stern, C. D. and K. M. Downs. 2012. The hypoblast (vis-
embryo positions the primitive streak by antagonizing Nodal ceral endoderm): An evo-devo perspective. Development 139:
signaling. Dev. Cell 3: 735–744. 1059–10612.
Boyer, L. A. and 13 others. 2005. Core transcriptional regula- Strumpf, D., C.-A. Mao, Y. Yamanaka, A. Ralston, K. Chaweng-
tory circuitry in human embryonic stem cells. Cell 122: 947–956. saksophak, F. Beck and J. Rossant. 2005. Cdx2 is required for
Burke, A. C., A. C. Nelson, B. A. Morgan and C. Tabin. 1995. correct cell fate specification and differentiation of trophecto-
Hox genes and the evolution of vertebrate axial morphology. derm in the mouse blastocyst. Development 132: 2093–2102.
Development 121: 333–346. Vanderberg, L. N. and M. Levin. 2013. A unified model for
Hiramatsu, R., T. Matsuoka, C. Kimura-Yoshida, S. W. Han, left-right asymmetry? Comparison and synthesis of molecular
K. Mochida, T. Adachi, S. Takayama and I. Matsuo. 2013. Exter- models of embryonic laterality. Dev. Biol. 379: 1–15.
nal mechanical cues trigger the establishment of the anterior-
posterior axis in early mouse embryos. Dev. Cell 27: 131–144.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
13
The Punchline
The vertebrate brain and spinal cord start their development as a flat plate of
neuroepithelial cells that folds up along most of its length to form a tube. The process
of forming this neural tube is called neurulation. Folding occurs at specific locations
in the plate through asymmetric changes in the shapes of cells such that their apical
sides contract, establishing hinge points of tissue bending. The folding brings the
sides of the plate upward and toward each other until they fuse along the midline, as
if the tube were being zipped up. The tube separates from the surface ectoderm via
differential adhesion, and the central nervous system is born. The cells of the new
neural tube become specialized as precursors of neurons and glial cells, and the
different regions of the tube become specified along its dorsoventral axis. Morphogen
gradients emanating from the dorsal surface ectoderm and ventral notochord establish
positional cues for the induction of key regulatory transcription factors that initiate
cell type-specific gene regulatory networks. TGF-β and Sonic hedgehog signals play
important roles in both neurulation and cell fate patterning of the neural tube.
Option 1
414 Chapter 13
NT
A How is a
Figure 13.1 The major questions to be addressed in Chapters
tube formed?
13, 14, and 15. Questions of neurulation and cell fate specification
(A,B) will be answered in this chapter. How the neural tube (NT) is
NCC
expanded into the elaborate structures of the brain (C) will be covered
in Chapter 14. The peripheral nervous system (D) is largely derived
from neural crest cells (NCC) migrating out of the dorsal neural tube. B How are D How is the
In addition, newly born neurons must extend long processes to find different peripheral
their synaptic partners (E) and thus connect up the nervous system. cell types nervous system
patterned? made?
Topics (D) and (E) will be covered in Chapter 15.
E How are
neural
connections
C How is the made?
brain built
from a
tube?
Transverse
section
Blastopore
Blastopore Posterior
Endoderm Endoderm
Mesoderm Epidermis Endoderm Epidermis
Epidermis
Notochord
Notochord
Rostral Caudal
Extracellular matrix
Neural plate/tube
Epidermis
Paraxial mesoderm
neurulation evolved much like limbs—that is, as a vertebrate novelty associated with
Developing Questions
tail elongation (Handrigan 2003).
Why is there the need for The neural tube is finally complete when these two separately formed tubes join
two separate mechanisms to
together (Harrington et al. 2009). The size of the transition zone between the primary
complete the neural tube?
and secondary neural tubes varies among species, from relatively abrupt in the mouse,
What were the evolutionary
pressures that forced the to a region spanning the thoracic vertebrae in the chick, to the thoracolumbar region in
adoption of secondary humans (Dady et al. 2014). Formation of the neural tube in this transition zone has been
neurulation as opposed named junctional neurulation (Dady et al. 2014) because it involves a combination of
to a posterior extension of mechanisms involved in both primary and secondary neurulation (see Figure 13.4).
primary neurulation? As
you ponder these questions, Dev T u tor i al Neurulation Dr. Michael Barresi describes the cellular
consider the embryo’s first events and molecular mechanisms behind neural tube formation.
morphogenetic mechanism,
that of gastrulation. How
might the timing of the Primary neurulation
end of gastrulation and its Although some species differences exist, the process of primary neurulation is relatively
capacity for axis elongation similar in all vertebrates.1 To explore the mechanisms of neural plate folding, we will
(or lack thereof) influence largely focus on the process of primary neurulation in amniotes. Shortly after the neural
your ideas? It is surprising
plate has formed in the chick, its edges thicken and move upward to form the neural
that we still do not fully
understand the evolutionary
history of the nervous 1
In teleost (bony) fish such as zebrafish, the neural plate does not fold; rather, convergence at
system.Developmental Biology 11e the midline generates the neural keel, and the lumen of the neural tube is formed through a
Fig. 13.04 process of cavitation (Lowery and Sive 2004; see also Harrington et al. 2009).
Dragonfly Media Group
05/25/16
Neural Tube Formation and Patterning 417
folds , and a U-shaped neural groove appears in the center of the plate, dividing the
future right and left sides of the embryo (FIGURE 13.5). The neural folds on the lateral
sides of the neural plate migrate toward the midline of the embryo, eventually fusing
to form the neural tube beneath the overlying ectoderm.
Primary neurulation can be divided into four distinct but spatially and temporally
overlapping stages:
1. Elongation and folding of the neural plate. Cell divisions within the neural plate are
preferentially in the anterior-posterior direction (often referred to as the rostral-
caudal, or beak-to-tail, direction), which fuels continued axial elongation associ-
ated with gastrulation. These events occur even if the neural plate tissue is isolated
from the rest of the embryo. To roll into a neural tube, however, the presumptive
Anterior neuropore
Anterior
Epidermal
Neural crest
ectoderm
mesenchyme
Neural fold
Notochord Neural groove
Foregut
Extraembryonic Extraembryonic
coelom mesoderm
Lateral body
fold Neural fold
Pericardial
coelom Neural plate
Endoderm
Neural Somite
groove Intermediate
Neural fold mesoderm
Somitic
Neural plate mesoderm
Coelom
Endoderm
Primitive groove
Somite
Hensen’s node
Mesoderm
Blood island
Posterior
neuropore
Primitive
streak
epidermis is also needed (FIGURE 13.6A,B ; Jacobson and Moury 1995; Moury and
Schoenwolf 1995; Sausedo et al. 1997).
2. Bending of the neural plate. The bending of the neural plate involves the formation
of hinge regions where the neural plate contacts surrounding tissues. In birds
and mammals, the cells at the midline of the neural plate form the medial hinge
point, or MHP (Schoenwolf 1991a,b; Catala et al. 1996). MHP cells are reported
to be firmly anchored to the notochord beneath them and form a hinge, which
(A)
1a Elongation
Neural plate Presumptive
neural crest
Epidermis
(surface)
ectoderm
(B)
1b Folding
MHP
Notochord
enables the creation of a furrow, or neural groove, at the dorsal midline (FIGURE
13.6C ).
3. Convergence of the neural folds. Shortly thereafter, two dorsolateral hinge points
(DLHPs) are induced by and anchored to the surface (epidermal) ectoderm. After
the initial furrowing of the neural plate, the plate bends around the hinge regions.
Each hinge acts as a pivot that directs the rotation of the cells around it (Smith and
Schoenwolf 1991). Continued convergence of the surface ectoderm pushes toward
the midline of the embryo, providing another motive force for bending the neural
plate, causing the neural folds to converge (FIGURE 13.6D; Alvarez and Schoen-
wolf 1992; Lawson et al. 2001). This movement of the presumptive epidermis and
the anchoring of the neural plate to the underlying mesoderm may also be impor-
tant for ensuring that the neural tube invaginates inward, or into the embryo, and
not outward (Schoenwolf 1991a).
4. Closure of the neural tube. The neural tube closes as the paired neural folds are
brought in contact together at the dorsal midline. The folds adhere to each other,
and the neural and surface ectoderm cells from one side fuse with their respective
counterparts from the other side. During this fusion event, cells at the apex of the
neural folds delaminate and become neural crest cells (FIGURE 13.6E ).
regulation of hinge points To fold the neural plate means to bend a sheet of
epithelial cells. How can a row of attached boxes be bent? While in the shape of a
rectangular box (i.e., epithelial), they cannot; however, if the surface area of one side
of each box in a region were reduced relative to its apposing side (creating the shape of
a truncated pyramid), each of these cells should introduce a displacing angle with its
neighboring cells and cause the row of boxes to bend. The MHP and two DLHPs are
three regions of the neural plate where such cell shape changes occur (see Figure 13.6B–
D). The epithelial cells in these locations adopt a “wedge-shaped” morphology along
the apicobasal axis, one that is wider basally than apically (Schoenwolf and Franks
1984; Schoenwolf and Smith 1990). Similar to the bottle cells that initiate invagination
during gastrulation (see Figure 11.4), localized contraction of actinomyosin complexes
at the apical border reduces the size of the apical half of the cell relative to the basal
compartment, a process known as apical constriction . This apical constriction pairs
with the basal retention of nuclei to yield the wedge-shaped hinge point cells (see Fig-
ure 13.6C,D; Smith and Schoenwolf 1987, 1988). In addition, recent findings suggest
that the division rates in the dorsolateral domains of the neural plate are significantly
faster than in ventral regions; this increases the cell density in the neural folds and
adds a force that is hypothesized to promote buckling at the DLHP (McShane et al.
2015). The physical forces exerted by different regions of the neural plate have yet to be
quantified, but at the cellular level hinge points are formed by (1) apical constriction,
(2) basal thickening with retention of the nucleus within the basal portion of cells, and
(3) cell packing in the neural folds. What regulates these cellular changes in the correct
locations of the neural plate?
It is known that the notochord induces the MHP cells to become wedge-shaped (see
Figure 13.6B–D; van Straaten et al. 1988; Smith and Schoenwolf 1989). The morphogen
Sonic hedgehog (Shh) is expressed in the notochord and is required for the induction
of floor plate cells in the neural plate (Chiang et al. 1996), which in turn form the MHP.
The persistence of the MHP in Shh knockout mice suggests that other notochord-
derived signals may be required for its morphogenesis (Ybot-Gonzalez et al. 2002).
In the DLHP, Noggin appears to be critical for proper hinge formation. In mice, loss
of Noggin results in a severe failure of neural tube closure (FIGURE 13.7; Stottman et al.
2006). Noggin is expressed in the neural folds, and this expression is sufficient to induce
the DLHP to form; Noggin is also expressed transiently in the notochord (Ybot-Gonzalez
et al. 2002, 2007). It is important to note that Noggin binds to and inhibits bone mor-
phogenic proteins (BMPs). Could it be the inhibition of BMPs that results in cell shape
changes in the DLHP? Several experiments indicate it is more complicated than that.
420 Chapter 13
Figure 13.7 Activated BMP signaling leads to neural tube (A) Wild-type (B) Noggin–/–
defects. (A) In the wild-type mouse, Noggin—a direct antagonist
of BMP ligands—is expressed in the notochord and neural folds.
The darkly stained region marks the dorsal neural folds and tube.
(B) Loss of Noggin results in failure of neural tube closure (arrows),
perhaps due in part to a lack of BMP inhibition. (From Stottman et
al. 2006.)
(A)
Constitutively active Control (normal Dominant negative Figure 13.8 BMP prevents MHP
BMP receptor 1 BMP signaling) BMP receptor 1 formation by regulating apical-basal
polarity. This experiment demonstrates
that high levels of BMP signaling inhibit
MHP formation while low levels promote
excessive folding at the midline. (A)
Electroporation of a constitutively active
BMP receptor (left) or a dominant nega-
tive form of BMP receptor (right) into the
chick neural plate prior to folding. The
normal (control) condition is seen in the
Relative level of BMP signaling (SMAD activation) center. Electroporated cells are visible
through GFP expression (green); nuclei
are visible (blue), as are apical cell mem-
branes marked by Par3 in the middle
(B) and right sections (red). (B) Schematic
representation of the results in A. (C)
Illustrations of the cell shape and nuclear
positions in the non-hinge region of the
neural plate (left) and at the MHP (right).
Preferential positioning of nuclei (blue)
to the basal cell compartment paired
Hinge point Exaggerated with apical actin-myosin contraction pro-
failure point motes apical constriction. (D) Illustrations
of a single cell in non-hinge (C, left) and
Developmental Biology 11e hinge (D, right) regions of this epithelium,
Fig. 13.07 demonstrating the effect of BMP sig-
(C) Non-hinge region MHP
Dragonfly Media Group naling on apical to basal polarity. BMP
Apical 05/25/16 Par complex signaling on the apical surface leads to
(Par3, Par6, an apically stabilized Par complex that
aPKC) segregates basal defining components
Basal Lethal-giant- such as LGL, all of which promotes an
larvae (LGL) equal epithelial morphology. Attenuation
(D) BMP of BMP signaling by Noggin can disrupt
receptor the division of these the compartments,
BMP ligand leading to an expansion of typical basal
components and a loosening of junc-
Noggin tional complexes, all of which enables
SMADS apical constriction. (After Eom et al. 2011,
2012, 2013.)
Neural Tube Formation and Patterning 421
BMP BMP
Noggin
Figure 13.9 Morphogen regulation of hinge point formation.
DLHP DLHP BMPs are expressed by the surface ectoderm (green), Noggin
is expressed in the dorsal neural folds (blue), and Shh is ex-
pressed ventrally in the notochord and floor plate. The regula-
tion of hinge points revolves around BMP as an antagonist to
both DLHP and MHP formation. Shh is required for the specifi-
cation of floor plate, while additional signals from the notochord
Shh
induce MHP morphology. Noggin directly inhibits BMP ligands,
thus alleviating BMP repression of the hinge points. The DLHPs,
MHP however, only form at the correct size and dorsal-ventral posi-
tion, which is based on Noggin’s distance from inhibitory Shh
gradients ascending from the floor plate. Therefore, apical
Notochord constriction occurs only in those cells experiencing low enough
signals concentrations of both BMP (MHP and DLHP) and Shh (DLHP)
morphogens.
422 Chapter 13
Closure 1
Closure 3 Closure 3 (cranio-
Posterior rachischisis)
neuropore
Posterior
neuropore
Figure 13.10 Neural tube closure in the mamma- (C) (D) (E)
lian embryo. (A,B) Initiation sites for neural tube clo- Neural fold Anterior
sure of mouse (A) and human (B) embryos. In addition neuropore
Pericardial
to the three initiation sites found in mice, neural tube bulge (heart)
closure in humans also initiates at the posterior end Pericardial
of the hindbrain and in the lumbar region. (C) Dorsal Otic placode bulge
view of a 22-day (8-somite) human embryo initiating
neurulation. Both anterior and posterior neuropores Somites
Somite
are open to the amniotic fluid. (D) A 10-somite human
embryo showing some of the major sites of neural
tube closure (arrows). (E) Dorsal view of a 23-day neu-
rulating human embryo with only its neuropores open. Cut edge
(F) Midbrain exencephaly and open spina bifida are of amnion Posterior
neuropore
seen in the mouse curly tail mutation, a hypomorphic
mutation in the grainhead-like3 gene. (G) Vitoria de 22 days 23 days
Cristo, who lived with anencephaly for two and a half
years. Anencephaly results when a failure to close (F) (G)
the neural tube at sites 2 and 3 allows the forebrain to
remain in contact with amniotic fluid and subsequently
degenerate. (A,B after Bassuk and Kibar 2009; C
from Nakatsu et al. 2000; F from Copp et al. 2003; G
courtesy of Joana Schmitz Croxato; see also http://
belovedvitoria.blogspot.com.)
conducted on mouse embryos in culture (Pyrgaki et al. 2010; Massarwa and Niswan-
der 2013). During DLHP bending, dynamic cell processes extend from the juxtaposed
tips of the neural folds (FIGURE 13.11; also see Watch Development 13.1). This cellular
behavior is being displayed by non-neural surface ectoderm cells, which ultimately
extend long filopodial processes toward the apposing fold. These filopodial extensions
establish temporary “cellular bridges” whose functions are currently unknown.
Scientists Speak 13.1 Listen to a web conference in which Dr. Lee Niswander
discusses neural tube closure.
Visualizing neural tube zipping in the mouse revealed potentially important cell
behaviors at the time of fusion, but what are the forces driving this attachment of
the apposing neural folds? To better quantify the mechanisms of neural tube zipping,
we will examine a simpler vertebrate system, that of Ciona intestinalis. Tunicates (also
called
Gilbertascidians) such as Ciona form neural tubes through primary neurulation, which
includes a very
Developmental similar
Biology 11e,zipper-like fusion event that proceeds in a posterior-to-anterior
Sinauer Associates
direction (FIGURE 13.12A
DevBio11e_13.11 Date 05-25-16
; Nicol and Meinertzhagen 1988a,b; Hashimoto et al. 2015).
Live-cell imaging of the membrane junction points between epidermal and neural cells
during neural tube closure revealed a mechanism of sequential exchange of junctions at
apical membrane junctions (FIGURE 13.12B). The driving force for zipper advancement
424 Chapter 13
Figure 13.12 Neural tube zipper (A) Early neurula Early tailbud
advance in Ciona. (A) Ciona embryos
stained with phalloidin to label cell mem-
branes at the early neurula and early
tailbud stages. Corresponding transverse
sections showing the neural (blue) and
non-neural (gray) ectoderm are shown to
the sides of these embryos (teal arrows).
Closure of the neural tube progresses in
a posterior to anterior direction, which is
represented by the yellow progression
points and yellow arrow. (B) Time-lapse
imaging of an embryo expressing GFP
in the membranes of cells of the left
hemisphere. The schematic on the left
illustrates the region being imaged. Cell
membranes are outlined in color to indi-
cate important cell junctions. Epidermal- (B) 00:00 11:25 17:55 25:50 34:10
to-epidermal cell junctions are white;
epithelial-to-neural cell junctions are in
color. Arrow positions denote the location 4
of the advancing rostral closure point.
The critical observation is the correlation 3
between zipper point advancement and 2
the exchange of an epithelial-to-neural 1
junction (solid colored lines) with a newly 0
formed epithelial-to-epithelial junction
(dashed colored lines). (C) Model for zip- ZO-1 :: GFP No GFP
per advancement. Myosin contraction
(red) pulls the zipper point anteriorly to (C) Zipper advance builds posterior
the next cell junction (green), an event resistance behind the zipper
that occurs when the posterior attach-
ments are finally released. (After Hashi- Primary
moto et al. 2015.) contraction
Anterior
tissue
resistance
Posterior
tissue
resistance
Cell detachment and shape relaxation
relieves posterior resistance
in Ciona may be the localized activation of actomyosin contraction (i.e., myosin moving
on filamentous actin) in the apical membranes of epidermal cells lying immediately
ahead of the zipper point (FIGURE 13.12C ). Junctional tension is highest between the
apical membrane of these epidermal cells and their adjacent neural ectodermal neigh-
bors. Moreover, inhibition of myosin prevents zipper advancement. These data suggest
that a stepwise exchange of cell junctions is initiated by the apical activation of acto-
myosin contraction, which is then followed by a release in the attachments of posterior
junctions to the zipper point and consequently a reduction in posterior resistance. As
a result of these junctional exchanges, epidermal-to-neural attachments are replaced
with epidermal-to-epidermal adhesion, and neural tube closure advances (Hashimoto
et al. 2015).
fusion and separation The neural tube eventually forms a closed cylinder that
separates from the surface ectoderm. This separation appears to be mediated by the
expression of different cell adhesion molecules. Although the cells that will become
the neural tube originally express E-cadherin, they stop producing this protein as the
Figure 13.13 Expression of N- and E-cadherin adhesion proteins during neurulation in Xen-
opus. (A) Normal development. In the neural plate stage, N-cadherin is seen in the neural plate,
whereas E-cadherin is seen on the presumptive epidermis. Eventually, the N-cadherin-bearing
neural cells separate from the E-cadherin-containing epidermal cells. (Neural crest cells
express neither N- nor E-cadherin, and they disperse.) (B) No separation of the neural tube
occurs when one side of the frog embryo is injected with N-cadherin mRNA so that N-cadherin
is expressed in the epidermal cells as well as in the presumptive neural tube.
neural tube forms and instead synthesize N-cadherin (FIGURE 13.13A). As a result,
Developing Questions
the surface ectoderm and neural tube tissues no longer adhere to each other. If the sur-
face ectoderm is experimentally made to express N-cadherin (by injecting N-cadherin What initiates the
directionality of neural tube
mRNA into one cell of a two-cell Xenopus embryo), the separation of the neural tube
closure? Zipping proceeds
from the presumptive epidermis is dramatically impeded (FIGURE 13.13B ; Detrick et in a posterior to anterior
al. 1990; Fujimori et al. 1990). Loss of the gene for N-cadherin in zebrafish also results direction in Ciona, as
in failure to form a neural tube (Lele et al. 2002). The Grainyhead transcription factors well as in certain closure
are especially important in this process (Rifat et al. 2010; Werth et al. 2010; Pyrgaki et points in mammals, yet
al. 2011). Grainyhead-like2, for instance, controls a battery of cell adhesion molecules it proceeds in opposite
and downregulates E-cadherin synthesis in the neural folds. Mice with mutations in directions to close other
regions of the mammalian
Grainyhead-like2 or Grainyhead-like3 genes have severe neural tube defects that include
brain. Moreover, are the cell
a split face, exencephaly, and spina bifida (see Figure 13.10F and Scientists Speak 13.1; forces that seem to advance
Copp et al. 2003; Pyrgaki et al. 2011). the zipper in the primitive
chordate Ciona conserved
neural tube closure defects In humans, neural tube closure defects occur in throughout vertebrates?
about 1 in every 1000 live births. Failure to close the posterior neuropore (closure site
5) around day 27 of development results in a condition called spina bifida, the severity
of which depends on how much of the spinal cord remains exposed. Failure to close VADE MECUM
site 2 or site 3 in the rostral neural tube keeps the anterior neuropore open, resulting Whole mounts and a complete
in a usually lethal condition called anencephaly, in which the forebrain remains in set of serial cross sections of
contact with the amniotic fluid and subsequently degenerates. The fetal forebrain ceases chick neurulation are included
development and the vault of the skull fails to form (see Figure 13.11G). The failure of in the “Chick-Mid” segment and
the entire neural tube to close over the body axis is called craniorachischisis. can be viewed in several formats,
Failure to close the neural tube can result from both genetic and environmental including as movies.
Gilbert (Fournier-Thibault et al. 2009; Harris and Juriloff 2010; Wilde et al. 2014). Muta-
causes
Developmental Biology 11e, Sinauer Associates
tions (first found in mice)
DevBio11e_13.13 in genes such as Pax3, Sonic hedgehog, Grainyhead, Tfap2, and
Date 03-11-16
Openbrain show that these genes are essential for the formation of the mammalian
neural tube; in fact, more than 300 genes appear to be involved. Environmental factors
including drugs, maternal dietary factors (such as cholesterol and folate, also known
as folic acid or vitamin B9), diabetes, obesity, and toxins can all influence human neu-
ral tube closure. How these factors lead to neural tube disorders is largely unknown.
An emerging idea posits that a major outcome of environmental perturbations is the
modification of the embryo’s epigenome, which in turn causes transcription variability
leading to neural tube defects (FIGURE 13.14A ; Feil et al. 2012; Shyamasundar et al.
2013; Wilde et al. 2014). This idea is most associated with the potential downstream
consequences of folic acid metabolism.
426 Chapter 13
(A) (B) O OH
O
O COO–
N
Gene expression Causative H
variability NTD genes O CH3 HN COO–
N
HN
+
H2N N N
H H
NTD
Although the exact role of folate remains unknown, the early use of folic acid antag-
onists led to fetuses with neural tube defects. Since then, many large-scale human trials
have demonstrated clear correlations of neural tube disorders with folic acid deficiency,
which is the reason folic acid is not only recommended for pregnant women but also
systematically fortified in foods (reviewed in Wilde et al. 2014). How folic acid deficiency
leads to neural tube disorders is currently an active area of research. Folic acid is an
important nutrient used for regulating DNA synthesis during cell division in the brain
(Anderson et al. 2012) and is also critical in regulating DNA methylation ( FIGURE
13.14B). Further evidence that epigenetic mechanisms are essential for proper neural
tube development are the findings that functional manipulation of histone modifying
enzymes (acetyltransferases, deacetylases, demethyltransferases) cause neural tube
defects (Artama et al. 2005; Bu et al. 2007; Shpargel et al. 2012; Welstead et al. 2012;
Murko et al. 2013). Whatever the mechanisms, it has been estimated that 25–30% of
human neural tube birth defects can be prevented if pregnant women take supple-
mental folate. Therefore, the U.S. Public Health Service recommends that women of
childbearing age take 0.4 milligram of folate daily (Milunsky et al. 1989; Centers for
Disease Control 1992; Czeizel and Dudas 1992).
Secondary neurulation
Secondary neurulation, which takes place in the most posterior region of the embryo
during tailbud elongation, produces a neural tube through a very different process than
primary neurulation (see Figure 13.4). Secondary neurulation involves the production
of mesenchyme cells from the prospective ectoderm and mesoderm, followed by the
condensation of these cells into a medullary cord beneath the surface ectoderm (FIG-
URE 13.15A,B). After this mesenchymal-epithelial transition, the central portion of this
cord undergoes cavitation to form several hollow spaces, or lumens (FIGURE 13.15C);
the lumens then coalesce into a single central cavity (FIGURE 13.15D; Schoenwolf and
Delongo 1980).
We have seen that after Hensen’s node has migrated to the posterior end of the
embryo, the caudal region of the epiblast contains a precursor cell population that gives
rise to both neural ectoderm and paraxial (somite) mesoderm as the embryo’s trunk
elongates (Tzouanacou et al. 2009). The ectodermal cells that will form the posterior
(secondary) neural tube express the Sox2 gene, whereas the ingressing mesodermal
cells (which no longer encounter high levels of BMPs as they migrate beneath the epi-
blast) do not express Sox2. Rather, the ingressing mesodermal cells express Tbx6 and
Condensing
(A) Surface ectoderm mesenchymal cells (C) Neural tube
form somites (see Chapter 17; Shimokita and Takahashi 2010; Takemoto et al. 2011).
The ability of the Tbx6 transcription factor to repress neural-inducing Sox2 expression
explains the bizarre phenotype of homozygous Tbx6 mouse mutants, which have three
neural tubes, posteriorly (see Figure 17.4; Chapman and Papaioannou 1998; Takemoto
et al. 2011). In these mutants, the two rods of paraxial mesoderm have become neural
tubes that even express regionally appropriate genes (such as Pax6). Thus, the epiblast
surrounding the rostral primitive streak (the caudal lateral epiblast; see Chapter 12)
contains a common precursor pool for paraxial mesoderm and for the neural plate
that forms the caudal hindbrain and spinal cord (Cambray and Wilson 2007; Wilson
et al. 2009). This distinction also emphasizes another fundamental difference between
primary and secondary neurulation. During primary neurulation, the surface ecto-
derm and neural ectoderm are intimately connected through the process of neural
tube closure and fusion, whereas during secondary neurulation, these two tissues are
essentially uncoupled and develop independently of one another.2
In human and chick embryos, there appears to be a transitional region at the junc-
tion of the anterior (primary) and posterior (secondary) neural tubes. As mentioned
earlier, neural tube formation in this transition zone is referred to as junctional neurula-
tion (see Figure 13.4). In human embryos, coalescing cavities are seen in the transitional
region, but the neural tube also forms by the bending of neural plate cells. The junc-
tional neural tube in the chick is a mosaic of both ventral mesenchyme cells and dorsal
neural ectodermal cells. In addition to directly providing dorsal epithelial cells to the
junctional neural tube, neural plate cells also undergo an epithelial-to-mesenchymal
transition and ingress into the underlying mesenchyme pool (FIGURE 13.15E ; Dady
et al. 2014). Some posterior neural tube anomalies result when the two regions of the
neural tube fail to coalesce (Saitsu et al. 2007). Given the prevalence of human posterior
spinal cord malformations, further understanding of the mechanisms of secondary
neurulation may have important clinical implications.
2
Failure to form the nerve (medullary) cord in zebrafish does not prevent surface ectoderm
from spanning the dorsal midline (Harrington et al. 2009).
3
Our species name comes from the Latin sapio, meaning “to be capable of discerning.”
Neural Tube Formation and Patterning 429
Pharynx Forebrain
Neural
plate
Neural Midbrain
folds
Notochord Hindbrain
Spinal cord
Adult derivatives
Figure 13.17 Rhombomeres of the chick hindbrain. (A) Hind- The dorsal-ventral axis
brain of a 3-day chick embryo. The roof plate has been removed The neural tube is polarized along its dorsal-ventral axis. In the
so that the segmented morphology of the neural epithelium can
spinal cord, for instance, the dorsal region is the place where the
be seen. The r1/r2 boundary is at the upper arrow, and the r6/r7
spinal neurons receive input from sensory neurons, whereas the
boundary is at the lower arrow. (B) A chick hindbrain at a similar
stage stained with antibody to a neurofilament subunit. The rhom- ventral region is where the motor neurons reside. In the middle
bomere boundaries are emphasized because they serve as chan- are numerous interneurons that relay information between the
nels for neurons crossing from one side of the brain to the other. sensory and motor neurons (FIGURE 13.18). These differenti-
(From Lumsden 2004, courtesy of A. Lumsden.) ated cell types organized along the dorsoventral axis arose from
progenitor cell populations located adjacent to the cavities (ven-
tricles) of the brain that run along the anterior-to-posterior axis
(i.e., in the ventricular zone). Each progenitor domain can be
defined by its expression of specific transcription factors (such as
the products of Hox genes), which specify progeny to differenti-
ate into the specific classes of neuronal and glial cells that make
up the CNS (Catela et al. 2015). This presents a logical question:
Figure 13.18 Differential expression of transcription factors factors creates further subdomains (yellow and light blue). (B) As the
define progenitor domains and derived cell types along the dorso- neural tube develops, these progenitor zones expand and continue
ventral axis. (A) The early neural tube is made up of neuroepithelial to diversify with their maturing gene regulatory networks until the full
progenitor cells that can be divided into discrete domains based on differentiative program is adopted and derived cell types emerge
their unique repertoire of transcription factor expression. Pax3 and (such as the different neuronal cell types illustrated). (C) Immunola-
Pax7 define the most dorsal domain (dark blue), Nkx6.1 is expressed beling for the Isl1 (blue), Foxp1 (red), and Lhx3 (green) transcription
ventrally (red), and Pax6 is located in the central region of the neural factors in an embryonic (day 12.5) mouse spinal cord at the cervical
tube (green). Overlap in expression of these different transcription level. (A,B after Catela et al. 2015; C courtesy of Jeremy Dasen.)
Neural Tube Formation and Patterning 431
How does a cell sense its position within the neural tube such that it develops into the
progenitor cell population that generates the precise type and properly positioned neu-
rons and glia? Said another way, how is pattern created in the neural tube?
Opposing morphogens
The dorsal-ventral polarity of the neural tube is induced by morphogenetic signals com-
ing from its immediate environment. The ventral pattern is imposed by the notochord,
whereas the dorsal pattern is induced by the overlying epidermis (FIGURE 13.19A–D).
Specification of the axis is initiated by two major paracrine factors: Sonic hedgehog
TGF-β family:
(A) (B) (C) (D)
BMP4, 7 in BMP4 in BMP4, BMP7,
epidermis roof plate BMP5, dorsalin,
activin
BMP7, dorsalin, activin
Dorsalin, activin
Roof plate
Neural Gradient D1 interneurons
tube of TGF-β D2 interneurons
family V0 interneurons
V1 interneurons
Gradient V2 interneurons
of Shh Motor neurons
Shh in Shh V3 neurons
Shh in floor Floor plate
notochord plate
V1
V2
Motor
V3
FP
V
0 0.5 1 2 3 4 ∞
[Shh], nM
Figure 13.19 Dorsal-ventral specification of the neural tube. depending on their position in the neural tube. (E) Chick neural tube
(A) The newly formed neural tube is influenced by two signaling showing areas of Shh (green) and the expression domain of the
centers. The roof of the neural tube is exposed to BMP4 and BMP7 protein dorsalin (blue; dorsalin is a member of the TGF-β superfam-
from the epidermis, while the floor of the neural tube is exposed to ily). Motor neurons induced by a particular concentration of Shh are
Sonic hedgehog (Shh) from the notochord. (B) Secondary signaling stained orange/yellow. (F) Relationship between Sonic hedgehog
centers are established in the neural tube. BMP4 is expressed and concentrations, the generation of particular neuronal types in vitro,
secreted from the roof plate cells; Shh is expressed and secreted and distance from the notochord. Cells closest to the notochord
from the floor plate cells. (C) BMP4 establishes a nested cascade become the floor plate neurons; motor neurons and V3 interneurons
of TGF-β factors spreading ventrally into the neural tube from the emerge on the ventrolateral sides. (G) In situ hybridization for three
roof plate. Sonic hedgehog diffuses dorsally as a gradient from the other transcription factors: Pax7 (blue; characteristic of the dorsal
floor plate cells. (D) The neurons of the spinal cord are given their neural tube cells), Pax6 (green), and Nkx6.1 (red). Where Nkx6.1 and
identities by their exposure to these gradients of paracrine factors. Pax6 overlap (yellow), motor neurons become specified. (E from
The amounts and types of paracrine factors present cause differ- Jessell 2000, courtesy of T. M. Jessell; F,G after Briscoe et al. 1999,
ent transcription factors to be activated in the nuclei of these cells, photograph courtesy of J. Briscoe.)
432 Chapter 13
protein (Shh) originating from the notochord, and TGF-β proteins originating from the
dorsal ectoderm (FIGURE 13.19E). In both cases, these factors induce a second signaling
center within the neural tube itself.
Sonic hedgehog secreted from the notochord induces the medial hinge point cells
to become the floor plate of the neural tube. The floor plate cells also secrete Sonic
hedgehog, which forms a gradient that is highest at the most ventral portion of the
neural tube (FIGURE 13.19B,C,E). Cells experiencing the highest concentrations of Shh
develop into the progenitor cells for motor neurons and a class of interneurons called
V3 neurons, whereas moderate and lower levels of Shh induce increasingly more dorsal
progenitor populations (FIGURE 13.19D,F,G ; Roelink et al. 1995; Briscoe et al. 1999).
The importance of Sonic hedgehog in patterning the ventral portion of the neural
tube has been confirmed by experiments that again demonstrate the principles of “find
it, lose it, move it” (see Web Topic 7.4 and the associated Dev Tutorial). If a piece of noto-
chord is removed from an embryo, the neural tube adjacent to the deleted region will
have no floor plate cells (Placzek et al. 1990). Moreover, if notochord fragments are taken
from one embryo and transplanted to the lateral side of a host neural tube, the result will
be to induce another set of floor plate cells in the adjacent host neural tube and bilaterally
positioned sets of ectopic motor neurons around the induced floor plate (FIGURE 13.20).
The same results can be obtained if the notochord fragments are replaced by pellets of
cultured cells secreting Sonic hedgehog, demonstrating that Shh alone is sufficient for
the induction of floor plate and affiliated motor neurons (Echelard et al. 1993).
The dorsal fates of the neural tube are established by proteins of the TGF-β super-
family, especially BMPs 4 and 7, dorsalin, and activin (Liem et al. 1995, 1997, 2000).
Initially, BMP4 and BMP7 are found in the epidermis. Just as the notochord establishes
a secondary signaling center—the floor plate cells—on the ventral side of the neural
tube, the epidermis establishes a secondary signaling center by inducing BMP4 expres-
sion in the roof plate cells of the neural tube. The BMP4 protein from the roof plate
induces a cascade of TGF-β proteins in adjacent cells (see Figure 13.19). Dorsal sets of
cells are thus exposed to higher concentrations of TGF-β proteins, and at earlier times,
when compared with the more ventral neural cells. The importance of the TGF-β super-
family factors in patterning the dorsal portion of the neural tube was demonstrated by
the phenotypes of zebrafish mutants. Those mutants deficient in certain BMPs lacked
dorsal and intermediate types of neurons (Nguyen et al. 2000).
how much and how long? How do these morphogens ultimately confer positional
information to cells in the neural tube? Recall that progenitor identity is determined
by the unique gene regulatory network it expresses. The sys- (A) (B)
tem of differential gene expression a cell exhibits is depen- Chick Intermediate
dent on the combination of its distance from, and duration neural tube neural tube 6h 12 h
of, exposure to the morphogenetic signaling centers. Cells
adjacent to the floor plate that receive high concentrations of
Sonic hedgehog synthesize the transcription factors Nkx6.1
Shh 4 nM
Shh 0 nM
and Nkx2.2 and become the ventral (V3) interneurons. The
cells dorsal to them, exposed to slightly less Sonic hedge- 18 h 24 h
hog (and slightly more TGF-β), produce Pax6 and Olig2 and
become motor neurons. The next two groups of cells, receiv- Pax7 Shh 0.5 nM
ing progressively less Sonic hedgehog, express Pax6 alone
Shh Olig2
and become the V2 and V1 interneurons. Finally, the cells at
the dorsalmost segment of the neural tube express Pax7 and Nkx2.2
Shh 2 nM Pax7 Olig2 Nkx2.2
become dorsal progenitors (see Figure 13.18; Lee and Pfaff
2001; Muhr et al. 2001). (C)
It had been thought that the intersecting gradients of Shh Shh 1 nM Shh 4 nM
200
and TGF-β signals would be sufficient to instruct the syn-
WEb Topic 13.3 Gli activation Explore how Sonic hedgehog signaling establishes
gradients of the Gli transcription factor along the dorsal-ventral axis.
Scientists Speak 13.2 Listen to a web conference with Dr. Andy McMahon on
Gli activator targets.
Nxk2.2 - Olig2
expressing cells. (B) Loss of Olig2 leads to
expansion of the Nkx2.2 domain (compare
the brackets in A and B). (C) Gain of Olig2
function by ectopically expressing the gene
through electroporation represses Nkx2.2
expression (arrow, yellow outline). (D) Loss of
80 hph 80 hph 24 hpe 80 hph the Pax6 gene leads to a marked expansion
Nxk2.2 - Olig2
Nxk2.2 - Olig2
Scientists Speak 13.3 Listen to a web conference with Dr. James Briscoe on
neural tube patterning and Sonic hedgehog.
Neural tube
Gli Gli Gli Gli
Dorsal activity activity activity activity
m
o d al
Dorsal
es xi
er
m ara
P
RA
Fgf/Wnt
RP Anterior Posterior
Paraxial mesoderm
TGF-β
er al
od xi
m
Ventral
es ra
m Pa
Pax7
Proneural
Anterior Pax6
progenitors
Nkx6.1 Preneural NMPs
Tail bud
progenitors
elongation
Shh
Figure 13.24 Model for converging signals for maturation of retinoic acid (RA) and Fgf/Wnt establish inverse gradients along
and specification of neural progenitors in the developing caudal the rostral-caudal axis, and setting up graded positional instruc-
region of the spinal cord. During spinal cord development, the tail tions along this axis. High Fgf/Wnt maintains the NMP pool. Moder-
is undergoing elongation, in part fueled by the caudal lateral epi- ate Fgf/Wnt and low RA promote early preneural progenitors to be
blast, which houses proliferative and the motile neuromesodermal competent to respond to TGF-β and Shh dorsoventral signals and
progenitors (NMPs). NMPs leave the tailbud and either progress develop into the roof plate (RP) and floor plate (FP), respectively. As
into the neural mesenchyme or the mesenchyme of the paraxial the tailbud continues to elongate, preneural progenitors will experi-
mesoderm, where they will give rise to the neural tube or somites ence low Fgf/Wnt and moderate RA, which broadens their com-
respectively. (Dashed arrows indicate that those cells will contribute petency to initiate gene regulatory programs specific for proneural
to those regions of the neural tube, but the cells are not actively progenitor populations. In this way, morphogens along all axes pat-
migrating into those regions.) Opposing antagonistic morphogens tern the cell fates in the neural tube.
436 Chapter 13
13 Snapshot Summary
Neural Tube Formation and Patterning
1. The neural tube forms from the shaping and folding 5. The neural crest cells arise at the borders of the neu-
of the neural plate. In primary neurulation, the surface ral tube and surface ectoderm. They become located
ectoderm folds into a tube that separates from the sur- between the neural tube and surface ectoderm, and they
face ectoderm. In secondary neurulation, ectoderm and migrate away from this region to become peripheral neu-
mesoderm cells coalesce as a mesenchyme to form first ral, glial, and pigment cells.
a cord and then a cavity (lumen) within the cord. 6. There is a gradient of maturity in many embryos (espe-
2. Primary neurulation is regulated both by intrinsic and cially those of amniotes) such that the anterior develops
extrinsic forces. Intrinsic wedging occurs within cells of earlier than the posterior.
the hinge regions, bending the neural plate. Extrinsic 7. The brain forms three primary vesicles, the prosencepha-
forces include the movement of the surface ectoderm lon (forebrain), mesencephalon (midbrain), and rhomben-
toward the center of the embryo. cephalon (hindbrain). The prosencephalon and rhomben-
3. Neural tube closure is also the result of extrinsic and cephalon become further subdivided.
intrinsic forces. In humans, congenital anomalies can 8. Dorsal-ventral patterning of the neural tube is accom-
result if the neural tube fails to close. Folate is important plished by proteins of the TGF-β superfamily secreted
in mediating neural tube closure. from the surface ectoderm and roof plate of the neural
4. After the node has reached the posterior of the epiblast, tube, and by Sonic hedgehog protein secreted from
certain cells contribute to both the paraxial mesoderm the notochord and floor plate cells. Temporal and spa-
and the neural tube. tial gradients of Shh trigger the synthesis of particular
Neural Tube Formation and Patterning 437
transcription factors that specify the neuroepithelium. progenitor cells (NMPs) that can become either neural or
Some of these transcription factors show cross-repres- somitic cells. Exposure of the preneural progenitors to
sion, allowing discrete borders to form between regions opposing gradients of Fgf/Wnt and retinoic acid leads to
along the dorsal-ventral axis. the patterning of the caudal neural tube along its dorsal-
9. Secondary neurulation in the caudal end of the neu- ventral axis.
ral plate gives rise to bipotential neuromesodermal
Further Reading
Balaskas, N. and 7 others. 2012. Gene regulatory logic for read- Jessell, T. M. 2000. Neuronal specification in the spinal cord:
ing the Sonic hedgehog signaling gradient in the vertebrate Inductive signals and transcriptional codes. Nature Rev. Genet.
neural tube. Cell 14: 273–284. 1: 20–29.
Chiang, C., Y. Litingtung, E. Lee, K. E. Yong, J. L. Corden, H. Lawson, A., H. Anderson and G. C. Schoenwolf. 2001. Cellular
Westphal and P. A. Beachy. 1996. Cyclopia and defective axial mechanisms of neural fold formation and morphogenesis in
patterning in mice lacking Sonic hedgehog gene function. the chick embryo. Anat. Rec. 262: 153–168.
Nature 383: 407–413. Massarwa, R. and L. Niswander. 2013. In toto live imaging of
Cohen, M., A. Kicheva, A. Ribeiro, R. Blassberg, K. M. Page, mouse morphogenesis and new insights into neural tube clo-
C. P. Barnes, and J. Briscoe. 2015. Ptch1 and Gli regulate Shh sure. Development 140: 226–236.
signalling dynamics via multiple mechanisms. Nature Commun. McShane, S. G., M. A. Molè, D. Savery, N. D. Greene, P. P. Tam
6: 6709. and A. J. Copp. 2015. Cellular basis of neuroepithelial bend-
Dady, A., E. Havis, V. Escriou, M. Catala, and J. L. Duband. ing during mouse spinal neural tube closure. Dev. Biol. 404:
2014. Junctional neurulation: A unique developmental program 113–124.
shaping a discrete region of the spinal cord highly susceptible Milunsky, A., H. Jick, S. S. Jick, C. L. Bruell, D. S. Maclaughlen,
to neural tube defects. J. Neurosci. 34: 13208–13221. K. J. Rothman and W. Willett. 1989. Multivitamin folic acid
Gouti, M., V. Metzis and J. Briscoe. 2015. The route to spinal supplementation in early pregnancy reduces the prevalence of
cord cell types: A tale of signals and switches. Trends Genet. 31: neural tube defects. J. Am. Med. Assoc. 262: 2847–2852.
282–289. Sasai, N., E. Kutejova and J. Briscoe. 2014. Integration of signals
Hashimoto, H., F. B. Robin, K. M. Sherrard and E. M. Munro. along orthogonal axes of the vertebrate neural tube controls
2015. Sequential contraction and exchange of apical junctions progenitor competence and increases cell diversity. PLoS Biol.
drives zippering and neural tube closure in a simple chordate. 12(7):e1001907.
Dev. Cell 32: 241–255. Wilde, J. J., J. R. Petersen and L. Niswander. 2014. Genetic,
epigenetic, and environmental contributions to neural tube
closure. Annu. Rev. Genet. 48: 583–611.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
14
Brain Growth
“What is perhaps the most intriguing question of all is whether the brain
is powerful enough to solve the problem of its own creation,” declared Gregor Eichele in
1992. Determining how the brain—an organ that perceives, thinks, loves, hates, remem-
bers, changes, deceives itself, and coordinates all our conscious and unconscious bodily
processes—is constructed is undoubtedly the most challenging of all developmental enig-
mas. A combination of genetic, cellular, and systems level approaches is now giving us a
very preliminary understanding of how the basic anatomy of the brain becomes ordered.
Differentiation of the neural tube into the various regions of the brain and spinal cord
occurs simultaneously in three different ways. On the gross anatomical level, the neural
tube and its lumen bulge and constrict to form the vesicles of the brain and spinal cord. At
the tissue level, the cell populations in the wall of the neural tube arrange themselves into
the different functional regions of the brain and spinal cord. Finally, on the cellular level,
the neuroepithelial cells differentiate into the numerous types of nerve cells (neurons)
and associated cells (glia) present in the body. In this chapter, we will concentrate on the
development of the mammalian brain in general, as well as the human brain in particular,
The complexities of
as we consider what makes us human.
being human: How
deep do they fold?
The Punchline
Brain growth begins with expansion of the newly formed neural tube along the
apicobasal axis within three regions: the ventricular zone, the mantle or intermediate
zone, and the marginal zone. Stem cells called radial glia span this neuroepithelium
and proliferate, giving rise to progenitor cells and neurons. Newly born neurons use
the radially oriented fibers of radial glia to migrate toward the marginal zone. In the
cerebral cortex, a basally concentrated gradient of Reelin regulates the ordered
“inside-to-outside” layering of migrating neurons. Bergmann glia act similarly to radial
glia, but function in the cerebellum to generate Purkinje neurons. The self-renewal
and neurogenic potential of these stem cells is influenced by numerous factors,
including the orientation of the mitotic spindle, inheritance of the parental centriole and
cilium, partitioning of Notch signaling, and mitogenic factors from the cerebral spinal
fluid. The large and complex human brain has evolved through modification of the
mechanisms controlling cerebellar neurogenesis, namely, the expansion of radial glial
progenitor populations and the differential expression of unique neurogenesis genes.
Neurogenesis does not end at birth but remains active in different ways throughout life.
440 Chapter 14
Neuroepithelial cells are only present in the early embryo and eventually transform
into ventricular (ependymal) cells and radial glial cells, or radial glia. Ependymal
cells remain an integral component of the neural tube lining and secrete the cerebro-
spinal fluid. Radial glia1 maintain a polarized morphology spanning the apicobasal
axis of the central nervous system (CNS) and carry out two primary functions. First,
they serve as the major neural stem cell throughout embryonic and fetal development,
demonstrating self-renewal and the multipotent generation of both neurons and glial
cells (Doetsch et al. 1999; Kriegstein and Alvarez-Buylla 2009); and second, they serve
as a scaffold for the migration of other progenitor cells and newborn neurons (Bentivo-
glio and Mazzarello 1999). These two functions provide the foundational mechanism
driving brain growth.
neurons and nerves Neurons are cells that conduct electric potentials and
transform these electric impulses into signals that coordinate our bodily functions,
thoughts, sensations, and perceptions of the world. The fine, branching extensions of
the neuron used to pick up electric impulses from other cells are called dendrites (FIG-
URE 14.2A). Some neurons develop only a few dendrites, whereas others (such as the
Purkinje neurons; FIGURE 14.1B) develop extensive, branching dendritic arbors. Very
few dendrites are found on cortical neurons at birth, and one of the amazing events
of the first year of human life is the increase in the number of these receptive cellular
processes. During this year, each cortical neuron develops enough dendritic surface
to accommodate as many as 100,000 connections, or synapses, with other neurons.
The average neuron in the highly developed cortex of the human cerebrum connects
with 10,000 other neural cells, enabling the human cortex to function as the center for
learning and reasoning.
Another important feature of a developing neuron is its axon . Whereas dendrites
are often numerous and do not extend far from the neuronal cell body, or soma, axons
may extend 2–3 feet (see Figure 14.2A). The pain receptors on your big toe, for example,
must transmit messages all the way to your spinal cord. One of the fundamental con-
cepts of neurobiology is that the axon is a continuous extension of the nerve cell body.
The process by which neuronal connections between cell bodies are established from
soma to soma through axons has been one of the most investigated events in neural
development. As we will describe in Chapter 15, to “wire up” the embryonic brain,
axons extend from the cell body, led by a motile growth cone at their tip that uses the
cue-laden environment to navigate to its target for synaptic connection.
glial cells There are three categories of glial cells: oligodendrocytes, astroglia, and
microglia. Neurons transmit information via electric impulses that travel from one
region of the body to another along the axons. To prevent dispersal of the electric signal
and to facilitate conduction to its target cell, axons in the CNS are insulated by oligo-
dendrocytes (FIGURE 14.1C ). The oligodendrocyte wraps itself around the developing
1
Increasing evidence suggests that radial glia represent a heterogeneous population of neural
stem cells and progenitor cells.
442 Chapter 14
axon and then produces a specialized cell membrane called the myelin sheath (FIGURE
14.2B). In the peripheral nervous system (i.e., all the nerves and neurons outside of the
central nervous system), myelination is accomplished by a similar type of glial cell,
the Schwann cell (FIGURE 14.2C ). Transplantation experiments have shown that the
axon, and not the glial cell, controls the thickness of the myelin sheath by the amount
of neuregulin-1 the axon secretes (Michailov et al. 2004).
The myelin sheath is essential for proper nerve function and also helps keep axons
alive for decades. Loss of this sheath (demyelination) is associated with convulsions,
paralysis, and certain debilitating afflictions such as multiple sclerosis (Emery 2010;
Nave 2010). There are mouse mutants in which subsets of neurons are poorly myelin-
ated. In the trembler mutant, the Schwann cells are unable to produce a particular pro-
(A) Input via axons from tein component such that myelination is deficient in the peripheral nervous system but
other neurons normal in the CNS. Conversely, in the mouse
Dendrites mutant jimpy, the CNS is deficient in myelin but
the peripheral nerves are unaffected (Sidman et
al. 1964; Henry and Sidman 1988).
Astroglial cells represent a diverse class of
glial cells that include radial glia and a variety
Soma (cell body)
of differentiated subtypes of astrocytes (e.g.,
Axon hillock
type I, type II, and reactive astrocytes) ( FIG-
URE 14.1D). Astrocytes were originally named
Axon Growth cone after their star (astral) shape appearance in a
of axon culture dish, and, historically astrocytes were
presumed to function as the connective tissue of
the nervous system, that is, its “glue.” However,
modern studies have revealed that astrocytes
Receptor carry out an array of functions critical to the
MYELINATION IN
CENTRAL NERVOUS adult nervous system. These functions include
SYSTEM establishing the blood-brain barrier, responding
(B) Oligodendrocyte to inflammation in the CNS, and (most impor-
tantly) supporting synapse homeostasis and
neural transmission.
A major marker for astroglia is an intermedi-
ate filament protein called glial fibrillary acidic
Axon
protein (Gfap). Protein-misfolding mutations in
Node of Ranvier
FIGURE 14.2 Neural transmission and myelina-
tion. (A) A motor neuron. Electric impulses (red
arrows) are received by the dendrites, and the stim-
Axon
ulated neuron transmits impulses through its axon
to its target tissue. The axon (which may be 2–3
feet long) is a cellular extension, or process, through
which the neuron sends its signals. The axon’s
growth cone is both a locomotor and a sensory
(C) MYELINATION IN apparatus that actively explores the environment,
PERIPHERAL NERVOUS picking up directional cues that tell it where to go.
SYSTEM Eventually, the growth cone will form a connection,
or synapse, with the axon’s target tissue. (B,C) In
Schwann cell the peripheral nervous system, Schwann cells wrap
themselves around the axon; in the central nervous
system, myelination is accomplished by the pro-
cesses of oligodendrocytes. The micrograph shows
an axon enveloped by the myelin membrane of a
Axon Schwann cell. (Micrograph courtesy of C. S. Raine.)
Brain Growth 443
the human gfap gene can lead to Alexander disease, a neurodegenerative disease caused Developing Questions
by fibrous protein aggregates that impair multiple functions of the nervous system
(Brenner et al. 2001; Hagemann et al. 2006). Glia—are they more than
glue? The recent spotlight
Microglia are often considered the “immune cells” of the central nervous system,
on glial cell function has
since they function to engulf dying and dysfunctional neurons and glia. As their name revealed numerous ways in
implies, microglia are small relative to the other cell types of the nervous system. They which these cells influence
are also very motile, with behaviors reminiscent of macrophages. In fact, microglia are nervous system physiology,
not born in the nervous system, but are first generated by macrophage progenitor cells but how these roles mani-
derived from the yolk sac (Wieghofer et al. 2015). These circulating microglial progeni- fest during CNS develop-
tors take root in the CNS prior to formation of the blood-brain barrier. ment remains unknown.
Consider some of these
questions: Is oligodendro-
WATCH DEVELOPMENT 14.1 To learn more about glia, watch this introductory video, cyte wrapping required
which describes the different glial cell types. for neuronal survival? Do
astroglial cells regulate
the targeting of synaptic
Tissues of the developing central nervous system partners? Do microglia help
The neurons of the brain are organized into layers (laminae) and clusters (nuclei2), “sculpt” the brain during
development?
each having different functions and connections. The original neural tube is composed
of a germinal neuroepithelium , a layer of rapidly dividing neural stem cells one cell
layer thick. Sauer and colleagues (1935) showed that the cells of the germinal neu-
roepithelium span the full width of the epithelium, from the luminal surface of the
neural tube to the outside surface. Over the course of evolution, adaptations have led to
the germinal neuroepithelium producing a diversity of highly complex regions within
the CNS. All of these regions, however, are elaborations of the same basic three-zone
pattern of layers: ventricular (next to the lumen), mantle (intermediate), and marginal
(outer) (FIGURE 14.3).
As the stem cells in the ventricular zone continue to divide, the migrating cells
form a second layer around the original neural tube. This layer becomes progressively
thicker as more cells are added to it from the germinal neuroepithelium. This new layer
is the mantle, or intermediate, zone. The mantle zone cells differentiate into both neu-
rons and glia. The neurons make connections among themselves and send forth axons
away from the lumen, thereby creating a marginal zone poor in neuronal cell bodies.
Eventually, oligodendrocytes cover many of the axons in the marginal zone in myelin
sheaths, giving them a whitish appearance. Hence, the axonal marginal layer is often
called white matter, while the mantle zone, containing the neuronal cell bodies, is
referred to as gray matter (see Figure 14.3). The germinal epithelium of the ventricular
zone will later shrink to become the ependyma that lines the brain cavity.
Here we will focus our investigation of CNS structure on the architecture associated
with the spinal cord and medulla, cerebellum, and cerebrum.
spinal cord and medulla organization The basic three-zone pattern of ven-
tricular (ependymal), mantle, and marginal layers is retained throughout development
of the spinal cord and the medulla (the posterior region of the hindbrain). When viewed
in cross section, the mantle gradually becomes a butterfly-shaped structure surrounded
by the marginal zone or white matter, and both become encased in connective tissue.
As the neural tube matures, a longitudinal groove—the sulcus limitans —divides it
into dorsal and ventral halves. The dorsal portion receives input from sensory neurons,
whereas the ventral portion is involved in effecting various motor functions (FIGURE
14.4 ). This developmental anatomy generates the basis of medullary and spinal cord
physiology (such as the reflex arch).
2
In neuroanatomy, the term nucleus refers to an anatomically discrete collection of neurons
within the brain that typically serves a specific function. Note that it is a distinct structure from
the cell nucleus.
444 Chapter 14 Spinal cord or medulla Radial glial cell
Central
canal
Ventricle
Sulcus
Presumptive limitans
ventral region
(E)
Spinal
nerve
Association
FIGURE 14.4 Development of the human spinal cord. (A–D) neuron
The neural tube is functionally divided into dorsal and ventral Sensory
regions, separated by the sulcus limitans. As cells from the Dorsal neuron
adjacent somites form the spinal vertebrae, the neural tube dif- root
ferentiates into the ventricular (ependymal), mantle, and marginal
zones as well as the roof and floor plates. The sulcus limitans Spinal Motor
separates the dorsal (“alar;” yellow) part of the spinal cord that nerve neuron
receives information from the ventral (“basal;” green) part of the
spinalDevelopmental
cord, which projects
Biologymotor
11e neurons. (E) A segment of the
spinalFig.
cord14.03
with its sensory (dorsal) and motor (ventral) roots. Ventral Marginal Mantle Ventricular
(After Dragonfly
Larsen 1993.)
Media Group root layer layer layer
05/04/16
Brain Growth 445
cerebellum. Here they form a new germinal zone—the external granular layer—near
the outer boundary of the neural tube.
At the outer boundary of the external granular layer, which is 1–2 cell bodies thick,
neural progenitor cells proliferate and come into contact with cells that secrete bone mor-
phogenetic proteins (BMPs). The BMPs specify the postmitotic cells derived from neural
progenitor divisions to become a type of neuron called granule cells (Alder et al. 1999).
Granule cells migrate back toward the ventricular (ependymal) zone, where they form a
region called the internal granular layer (see Figure 14.3). Meanwhile, the original ven-
tricular zone of the cerebellum generates a wide variety of neurons and glial cells, includ-
ing the distinctive and large Purkinje neurons, the major cell
type of the cerebellum (FIGURE 14.5). Purkinje neurons secrete
Sonic hedgehog, which sustains the division of granule cell (A)
precursors in the external granular layer (Wallace 1999). Each
Purkinje neuron has an enormous dendritic arbor that spreads
like a tree above a bulb-like cell body (see Figure 14.1B). A typi-
cal Purkinje neuron may form as many as 100,000 synapses
with other neurons—more connections than any other type of
neuron studied. Each Purkinje neuron also sends out a slender
axon, which connects to neurons in the deep cerebellar nuclei.
Purkinje neurons are critical in the electrical pathway of
the cerebellum. All electric impulses eventually regulate their
activity because Purkinje neurons are the only output neurons
of the cerebellar cortex. Such regulation requires the proper
cells to differentiate at the appropriate places and times. How
is this complicated series of events accomplished? Contemplate a
few ideas about what mechanisms might control the pattern
of neuronal differentiation, as we will return to this overarch-
ing question later in the chapter.
FIGURE 14.6 Lhx2 is required for neocortex devel- Olfactory bulb Neocortex
opment. Whole mount and coronal sections of brains
of wild-type and Lhx2 conditional knockout mice, in DM
which early stem cells experience the loss of Lhx2. The
neocortex marker Satb2 (brown) shows high expression
in both dorsomedial (DM) and lateral (L) regions of the
neocortex in the wild-type mouse, whereas in Lhx2-
Wild-type
knockout mice, significant levels of expression of the L
Satb2 marker are found only in the dorsomedial neocor-
tex. (From Chou et al. 2009.)
DM
to the lateral geniculate nucleus of the thalamus, which is involved in vision, whereas
neurons of the auditory cortex of layer 6 (located more anteriorly than the visual cor-
tex) project axons to the medial geniculate nucleus of the thalamus, which functions
in hearing.
One of the major questions in developmental neurobiology is whether the differ-
ent functional regions of the cerebral cortex are already specified in the ventricular
region, or if specification is accomplished much later by synaptic connections between
the regions. Evidence that specification is early (and that there might be some “proto-
map” of the cerebral cortex) is suggested by certain human mutations that destroy the
layering and functional abilities in only one part of the cortex, Septal Cortical Striatal
leaving the other regions intact (Piao et al. 2004). More direct neuron neuron neuron
evidence for the existence of a protomap in the embryonic cor-
tex recently emerged when Fuentealba and colleagues (2015)
followed ventricular radial glial cells from different regions of
the embryonic mouse brain using retroviral barcoding until
the cells’ direct clonal descendants could be identified in the
adult cortex (FIGURE 14.8). They discovered that the differenti-
ated neurons of the cortex were descended from stem cells that Embryo
resided in comparable areas in the embryo (which were them-
selves derived from radial glia from comparable ventricular zone
areas). These results support a model in which ventricular zone
radial glia are regionally specified in the embryo and give rise
to similarly specified adult stem cells that propagate regionally
restricted progeny.
Radial
Dev T u tor i al Neurogenesis in the cerebral glia
cortex Dr. Michael J. F. Barresi describes the cellular
and molecular processes governing the inside-out
development of the cerebral cortex.
B-cell
adult neural
Developmental Mechanisms stem cell
0 h, 00 min 0 h, 07 min 0 h, 24 min 0 h, 59 min 1 h, 17 min 1 h, 24 min 1 h, 41 min 2 h, 55 min 5 h, 15 min 7 h, 00 min
Apical surface
FIGURE 14.9 Live imaging of neuroepithelial cell interkinetic nuclear symmetrical division, giving rise to two progenitor cells. The asterisk
migration and division of neural stem cells in the zebrafish embry- at 1 h 24 min indicates the point at which the neuronal daughter cell
onic hindbrain. Two nearly adjacent progenitor cells in the germinal detached from the apical surface (white dotted double lines). Notice
epithelium were recorded over 7 hours. Cells are labeled to show the translocation of the nucleus in a progenitor cell as it proceeds
cell membranes (green) and nuclei (red). A reporter gene specifically through the cell cycle. The cell is undergoing DNA synthesis (S phase)
marks neurons (yellow). The progenitor cell on the left underwent an when its nucleus is toward the basal end of the cell (away from the
asymmetrical division, generating a neuron (arrow at 7 h) and another dotted white lines) and is in mitosis (M phase) when its nucleus is near
progenitor (below the neuron). The cell on the right underwent the apical end of the cell. (From Alexandre et al. 2010.)
nuclear migration but fail to progress through mitosis, and the somas of these radial glia
Developing Questions accumulate at the luminal (apical) surface over time (Johnson et al. 2016).
It has been said that a pic-
ture is worth a thousand Watch Development 14.2 Watch the cell behaviors associated with the inter-
words, in which case, a kinetic nuclear migration of radial glial cells during division in the developing brains of
movie must be worth a mil- zebrafish and chick.
lion. Watching movies of
interkinetic nuclear migra-
tion (see Watch Develop-
ment 14.2), we challenge symmetry of division When neuroepithelial cells or radial glial cells divide, what
you to avoid seeing some- options do they have? Recall from Chapter 5 our descriptions of division in other stem
thing new each time. Hid- cells (see Figure 5.1). A stem cell can divide symmetrically to produce two copies of
den in those movies are itself, thus increasing the pool of stem cells. Alternatively, symmetrical division can
answers to many questions,
produce two differentiating daughter cells, which depletes the stem cell pool. A stem
including: Why does cyto-
kinesis need to happen at cell can also divide asymmetrically to self-renew and yield a differentiating daughter
the apical surface in the cell. How might you investigate which of these divisions occurs in the neuroepithe-
neuroepithelium? Do these lium? Labeling the cells with a tracer such as radioactive thymidine that is incorpo-
cells maintain their basal rated only into dividing cells would allow you to trace cell lineages. When mammalian
process? What role do cen- neuroepithelial cells are labeled in this way during early development, 100% of them
trosomes—key organizing incorporate the radioactive thymidine into their DNA, indicating they are all undergo-
structures for microtubules
ing some form of division (Fujita 1964). Shortly thereafter, however, certain cells stop
and mitosis—play in this
nuclear migration? incorporating this thymidine analog, indicating that they are no longer dividing. These
cells can then be seen to migrate away from the lumen of the neural tube and differ-
entiate into neuronal and glial cells (Fujita 1966; Jacobson 1968). When a cell of the
Gilbert germinal neuroepithelium is ready to generate neurons (instead of more neural stem
Developmental Biology 11e, Sinauer Associates cells), the division plane often shifts to create an asymmetrical division (the arrow in
DevBio11e_14.09 Date 04-25-16 Figure 14.9). Instead of both daughter cells remaining attached to the luminal surface,
one of them becomes detached (the asterisk in Figure 14.9). The cell remaining con-
nected to the luminal surface usually remains a stem cell, while the other cell migrates
and differentiates into a neuron or other type of progenitor (Chenn and McConnell
1995; Hollyday 2001).
Neurogenesis: Building from the bottom up (or from the inside out)
In a 2008 paper, Nicholas Gaiano summarized neurogenesis:
The construction of the mammalian neocortex is perhaps the most complex
biological process that occurs in nature. A pool of seemingly homogeneous stem cells
first undergoes proliferative expansion and diversification and then initiates the
Brain Growth 449
production of successive waves of neurons. As these neurons are generated, they take
up residence in the nascent cortical plate where they integrate into the developing
neocortical circuitry. The spatial and temporal coordination of neuronal generation,
migration, and differentiation is tightly regulated and of paramount importance to
the creation of a mature brain capable of processing and reacting to sensory input
from the environment and of conscious thought.
As the neural tube matures, the progeny of the neuroepithelial stem cells become
radial glial cells. Only recently have cell lineage studies demonstrated that radial glia
are neural stem cells that undergo symmetrical and asymmetrical divisions (Malatesta
et al. 2000, 2003; Miyata et al. 2001; Noctor et al. 2001; Anthony et al. 2004; Casper
and McCarthy 2006; Johnson et al. 2016). The divisions of the radial glia take place
in the ventricular zone (the zone lining the ventricle and therefore in contact with
the cerebrospinal fluid). In the cerebrum, as the progenitor cells delaminate from the
ventricular zone, they form a subventricular zone basal to it. Together, these zones
form the germinal strata that generate the neurons that migrate into the cortical plate
and form the layers of neurons of the neocortex (FIGURE 14.10A,B ; Frantz et al. 1994;
for reviews, see Kriegstein and Alvarez-Buylla 2009; Lui et al. 2011; Kwan et al. 2012;
Paridaen and Huttner 2014).
A single stem cell in the ventricular layer can give rise to both neurons and glial cells
in any of the cortical layers (Walsh and Cepko 1988). There are three major progenitor
cell types in the germinal strata: ventricular radial glia (vRG), outer radial glia (oRG),
and intermediate progenitor (IP) cells. During the early stages of CNS development,
neuroepithelial cells transform into ventricular radial glia that, as their name suggests,
maintain contact with the luminal surface. The vRG serve as the parental stem cell FIGURE 14.10 Summary model of
type and, in addition to directly generating neurons, will give rise to both the oRG and neurogenesis in the cerebral cortex.
IP cells (FIGURE 14.10C,D). Self-renewing, symmetrical divisions dominate early in (SVZ, subventricular zone; VZ, ventricular
zone.) (Model based on Kriegstein and
Alvarez-Buylla 2009; Kwan et al. 2012;
Paridaen and Huttner 2014.)
Progenitor cell types Differentiated cell types
Neuroepithelial cell (NEC) Deep layer neuron Symmetrical differentiation
Ventricular radial glial cell (vRG) Upper layer neuron vRG
oRG vRG
Intermediate progenitor (IP) Macroglia
(oligodendrocyte/ 2 macroglia
Outer radial glial cell (oRG) 1 oRG 2 neurons L1
astrocyte) vRG
(any RG lacking apical
attachment) + L2 Upper
1 oRG 1 IP layers
Order of birthdate
IP L3
+ Cortical
Asymmetrical vRG
1 IP L4 plate
neurogenic
2 neurons (neo-
1 vRG L5
vRG cortex)
+ Deeper
Symmetrical 1 vRG 1 IP L6 layers
proliferative +
NEC 1 neuron Intermediate
NEC – vRG zone
transition
2 NEC Outer
subventricular
zone
Ventricular
zone
(A) NEC build VZ and SVZ (B) VZ radial glia (C) Intermediate progenitors (D) Outer radial glia (E) Transitions
Pre-neurogenesis Neurogenesis Late neurogenesis
and gliogenesis
Time
450 Chapter 14
neurogenesis to expand the progenitor pool, and then more asymmetrical divisions
govern progenitor differentiation.
The oRG cells always maintain contact between their basal process and the pial
surface; however, they are no longer tethered to the apical surface, and their soma
reside in the subventricular zone and are therefore “outer” relative to vRG (Lui et al.
2011; Wang et al. 2011). Both vRG and oRG can divide to produce IP cells (see Figure
14.10C,D). IP cells have limited proliferative capacity, normally being able to undergo
only a single round of division, yet during neurogenesis they play a pivotal role as a pro-
genitor cell population for the specific expansion of particular lineages. It is generally
thought that cell type potency (i.e., the cell types a progenitor can give rise to) becomes
more restricted from vRG to oRG, with IP cells showing the most lineage restriction
(Noctor et al. 2004; Lui et al. 2011).
Scientists Speak 14.1 See a web conference with Dr. Arnold Kriegstein on oRG
cells and the development of the neocortex.
Process of
glial cell
radial glia in the neocortex In the developing cerebrum, most of the neurons
generated in the ventricular zone migrate outward along radial glial processes to form
the cortical plate near the outer surface of the brain, where they set up the six layers
of the neocortex. As in the rest of the brain, those neurons with the earliest birthdays
form the layer closest to the ventricle (FIGURE 14.12A,B). Subsequent neurons travel
greater distances to form the more superficial layers of the cortex. This process forms an
“inside-out” gradient of development (Rakic 1974). McConnell and Kaznowski (1991)
have shown that the determination of laminar identity (i.e., which layer a cell migrates
to) is made during the final cell division. Newly generated neuronal precursors trans-
planted after this last division from young brains (where they would form layer 6) into
older brains, whose migratory neurons are forming layer 2, are committed to their fate
and migrate only to layer 6. However, if these cells are transplanted prior to their final
division (i.e., during mid-S phase), they are uncommitted and can migrate to layer 2
(FIGURE 14.12C,D). The fates of neuronal precursors from older brains are more fixed.
The neuronal precursor cells formed early in development have the potential to become
any neuron (at layer 2 or 6, for instance); later precursor cells give rise only to upper
level (layer 2) neurons (Frantz and McConnell 1996). Once the cells arrive at their final
destination, it is thought that they express specific adhesion molecules that organize
them
Gilbertinto brain nuclei (Matsunami and Takeichi 1995).
Developmental Biology 11e, Sinauer Associates
DevBio11e_14.11 Date 03-22-16
Signaling mechanisms regulating development of the neocortex
cajal-retzius cells: “moving targets” in the neocortex How do migrat-
ing neural progenitors become segregated to the correct layer? As mentioned above,
earlier-born neurons establish the deeper layers and later-born neurons form the more
superficial layers. Think about this. It means that the cerebrum is growing from inside
to outside. One outcome of such growth is that with each new expanding layer, the
outer pial surface moves farther away from the ventricular surface. Therefore, the pial
surface is an ever-expanding outer limit, and the neurons embarking on their outward
trek have farther to travel than their predecessors. This important dynamic ultimately
influences the layering of the brain (see Frotscher 2010).
When the luminal and pial surfaces are relatively close during early development
of the neocortex, a newly born neuron extends basal filopodia toward the pial surface,
establishes adhesive contact, and then simply displaces its nucleus and associated cyto-
plasm toward the pial surface, translocating the cell body from the apical to the basal
452 Chapter 14
(A) [3H]-thymidine administered FIGURE 14.12 Determination of cortical laminar identity in the ferret cerebrum. (A)
on embryonic day 29 “Early” neuronal precursors (birthdays on embryonic day 29) migrate to layer 6. (B) “Late”
100 neuronal precursors (birthdays on postnatal day 1) migrate farther, into layers 2 and 3. (C)
When early neuronal precursors (dark blue) are transplanted into older ventricular zones
80 after their last mitotic S phase, the neurons they form migrate to layer 6. (D) If these pre-
cursors are transplanted before or during their last S phase, they migrate with the host
neurons to layer 2. (After McConnell and Kaznowski 1991.)
60
Percent of [3H]-thymidine-labeled neurons
40
(C) (D)
Host neurons
20 1
Subventricular
80 zone (white
matter)
60
40 S G2 M
Ventricular
20 zone Radial glial cell
0
1 2/3 4 5 6 White Cell-autonomous fate when Host (conditional) fate when
matter transplanted after last S phase transplanted in S phase
Cortical layers
region of the cell. The basal attachment provides the required physical resistance and
tension that enables this translocation (Miyata and Ogawa 2007). Thus, no actual cell
migration is necessary. During later development, however, each progenitor cell needs
to actively migrate along the radial glial cell’s basal process until its own basal mem-
brane makes contact with the outermost region of the cortical plate, at which point a
similar translocation can complete the journey (FIGURE 14.13A).
The cells influencing this outward migration of progenitor cells are the Cajal-Retzius
cells, which lie under the pial surface and secrete the extracellular protein Reelin—the
same protein mentioned earlier as regulating layering in the cerebellum (D’Arcangelo
et al. 1995, 1997). Translocating progenitor cells express transmembrane receptors for
Reelin (Trommsdorff et al. 1999), and when these receptors bind to Reelin, they set off a
series of signal transduction pathways mediated by the enzyme Disabled-1 (see Figure
14.13A, cell 1). As a result, the cells increase their expression of N-cadherin, allowing
them to attach to other cells that also express N-cadherins. Cadherins are expressed
with increasing intensity from the ventricular zone to highest levels in the marginal
zone, overlapping Cajal-Retzius cells; thus, newly born neurons expressing N-cadherin
become oriented toward regions of increasing adhesion (Franco et al. 2011; Jossin and
Cooper 2011). The neurons also extend filopodia toward the fibronectin-rich extracel-
lular matrix at the pial surface (Chai et al. 2009) and use transmembrane proteins called
Gilbert integrins to attach the filopodia to this extracellular matrix (Sekine et al. 2012). Once the
Developmental Biology 11e, Sinauer Associates filopodia are attached, Disabled-1-mediated regulation of the actin cytoskeleton powers
DevBio11e_14.12 Date 05-04-16
contraction of the filopodia in a spring-like motion, pulling the cell body forward as the
cell’s apical end detaches (see Figure 14.13A, cell 2; Miyata and Ogawa 2007).
Brain Growth 453
FIGURE 14.13 Model of Reelin regulation of directed neuro- in newly born neurons and migrating progenitor cells. Two types of
nal migration. (A) Secreted from Cajal-Retzius cells, Reelin (red mice were used, wild type and a strain carrying a conditional Dab1
circles) is distributed in a gradient in the extracellular matrix. mutation that is activated only when combined with a second gene
Reelin instructs the newly born migrating neurons (labeled 1 and (CRE). CRE has no affect on wild-type mice. A plasmid carrying
2) to extend filopodia from their basal membrane toward the pial CRE and GFP was introduced into progenitor cells of the two mouse
surface. Disabled-1 (Dab1) is activated by Reelin. The product strains. Cells that received the plasmid could be identified by their
of the Dab1 gene stabilizes filamentous actin (F-actin) as well as GFP expression (green). (B) The wild-type control shows that the
upregulating N-cadherin expression. N-cadherin is also localized treated progenitor cells successfully reached the layer of the corti-
to the membranes of radial glial fibers and other cells throughout cal plate. (C) In the Dab1 conditional mutant, Dab1 is knocked out in
the epithelium, increasing to highest concentrations closest to the green (CRE-containing, GFP-expressing) cells. These cells were
the marginal zone. Initial Reelin-Dab1 signaling results in marginal retained in the intermediate zone. Time-lapse imaging of a single
zone-directed extension of the filopodium and translocation of neu- cell demonstrates that a typical progenitor cell will initiate migratory
ron 1. In a migrating neuron approaching the marginal zone (cell cell elongation (red), then extend its basal process to the marginal
2), Dab1 upregulates integrin expression in the tip of the filopo- zone (green), and finally translocate the apical compartment to
dium to anchor this cell to the fibronectin-rich extracellular matrix. the outer layers (blue) (B, drawing on right). Similar imaging shows
However, at highest Reelin concentrations, a negative feedback migration is initiated in Dab1 knockout cells, but they fail to advance
mechanism is triggered that inhibits Dab1 by protein degradation productive basal extensions, nor do they show translocation (C,
(cell 2), ending migration and enabling cell differentiation within drawing on right). (B,C from Franco et al. 2011.)
the specified cortical layer. (B,C) Conditional inactivation of Dab1
The same Reelin signal that initiates this migration also triggers a negative feedback
such that at the highest levels of Reelin (near the marginal zone), the neurons lose their
cell adhesion molecules and integrate into the layers of the cortical plate in a progressive
inside-out manner (see Figure 14.13A, cell 2; Feng et al. 2007). Loss of Reelin, its recep-
tors, or Disabled-1 results in an inversion of cortical layering; neurons typically found
within the inner layers (layers 4 and 5) are positioned near the marginal zone (layer 1),
Developmental Biology 11e
Fig. 14.13
Dragonfly Media Group
05/26/16
454 Chapter 14
and cells of the external layers (layers 2 and 3) are found near the subplate when these
Developing Questions
genes are lost (FIGURE 14.13B,C; Olson et al. 2006; Franco et al. 2011; Sekine et al. 2011).
N-cadherin was shown to
be important for neural
Watch Development 14.3 Observe the morphology of late-migrating neuroblasts
progenitor migration in
as they translocate to the Cajal-Retzius cells.
the neocortex, but how?
Cells along the apicobasal
axis have increasing lev- WEb Topic 14.1 Neuronal versus glial differentiation Explore the role of
els of cadherin expression neurotrophic factors in regulating the differentiation of cortical progenitor cells into neu-
that appear to provide a rons versus glia, a mechanism that maps to the stats you need to know.
road to the next layer, but
cadherins are typically WEb Topic 14.2 Horizontal and vertical specification of the cerebrum
thought of as playing a
Neither the vertical nor the horizontal organization of the cerebral cortex is clonally speci-
role in differential adhesion
fied. Cell migration is critical, and paracrine factors from neighboring cells play major
and cell sorting. Could the
properties of cell sorting be roles in migration and specification.
driving the movement of
neural progenitors toward to be or not to be … a stem, a progenitor, or a neuron? Whether a radial
the marginal zone, much glial cell undergoes symmetrical versus asymmetrical division depends on the plane
like E-cadherin functions in
of division (which in turn depends on the orientation of the mitotic spindle) and is cor-
the zebrafish gastrula (see
Chapter 4)? In one inter- related with the type of progeny generated. Cytokinesis that separates the radial glial
esting study, whole-tran- cell perfectly perpendicular (planar) to the luminal surface (i.e., the mitotic spindle is
scriptome analysis of the parallel to the lumen) can result in two radial glial stem cells (Xie et al. 2013). Although
different proliferative zones such perpendicular cleavages can sometimes yield different progeny—a radial glial cell
of the mouse and human and a neuron—more often it is oblique division planes that give rise to these two dis-
neocortex revealed a high tinct progeny. When the mitotic spindle is altered in such a way that cytokinesis occurs
level of expression of cell
along random axes, it increases early asymmetrical divisions and triggers premature
adhesion and extracellular
matrix genes (Fietz et al. neurogenesis (Xie et al. 2013).
2012), which suggests that The fate of a daughter cell following cytokinesis has been linked to the centriole it
the use of cell adhesion is inherits. The two centrioles in a dividing cell are not the same in regard to their age: the
likely both a complex and parental centriole is “older” than the daughter centriole it creates when it replicates. At
foundational mechanism for each division, the cell receiving the “old” centriole will stay in the ventricular zone as a
layering the cortex. stem cell, while the cell receiving the “young” centriole leaves and differentiates (Wang
et al. 2009). These two centrioles are bound to different proteins and structures, which
results in an asymmetrical localization of those factors that influence gene expression and
cell fate. Of particular significance is the primary cilium, which is connected to the older
centriole and remains with it during cell division. The daughter cell that inherits this older
centriole along with the primary cilium can quickly present the primary cilium to the
lumen and, consequently, to the cerebrospinal fluid. Cerebrospinal fluid contains factors
Developing Questions such as insulin-like growth factors, FGFs, and Sonic hedgehog, which induce proliferation
It has been shown that and signal the cell to maintain its radial glial stem cell fate (Lehtinen et al. 2011; Paridaen
the Hes family of Notch- et al. 2013). The daughter cell that inherits the younger centriole will eventually form a
transcriptional effectors new primary cilium. This cilium, however, will extend from the cell’s basal process rather
exhibit oscillating periods than its apical surface and will experience a different array of signals that will influence its
of gene expression in vRG development into a progenitor cell or a neuron (Wilsch-Brauninger et al. 2012).
due to a negative feedback Another mechanism involved in determining the fate of cells derived from an asym-
mechanism (see Chapters
metrical division of a radial glial stem cell is how the apical protein Par-3 is distrib-
4 and 17; Shimojo et al.
2008). It is intriguing to uted (FIGURE 14.14A). In general, Par-3 maintains the apical-basal polarity of cells.
speculate about a model in In the developing brain, Par-3 recruits a complex in the apical portion of the cell that
which the number of Notch- can segregate cell-fate-inducing factors such as Notch signaling proteins. In an asym-
Hes oscillations a vRG cell metrical division, one daughter cell receives more Par-3 protein than the other (FIGURE
experiences might regulate 14.14B). The daughter cell receiving more Par-3 develops high Notch signaling activity
its development between and remains a stem cell. The other daughter cell expresses high amounts of the Delta
renewal, progenitor deri-
protein (recall that Delta is the Notch receptor) and becomes primed for neuronal dif-
vation, and differentiation
(Paridaen and Huttner ferentiation (Bultje et al. 2009).
2014). This separation of high and low Notch is directly due to the co-transport of the
Notch-inhibitor Numb with Par-3. It may seem counterintuitive to recruit this inhibitor
Brain Growth 455
se /
ha se
(A) ap pha hase
et a p FIGURE 14.14 Asymmetrical division of
G2 M An telo /G
0
radial glia mediated by Par3 and Notch. (A)
S G1
Schematic section of a chick embryo neural
N-cadherin tube, showing the position of the nucleus and
Par-3 Par-3 protein in a radial glial cell as a function
Ventricular
of the cell cycle. Mitotic cells are found near
zone High Notch
the inner surface of the neural tube, adja-
Low Notch cent to the lumen. The dynamic distribution
of Par-3 protein in these luminal stem cells
Progeny from
regulates the synthesis of Notch signaling
an asymmetrical
pathway components in the cell membrane of
cell division
the daughter cells. At mitosis, Par-3 becomes
localized primarily to one of the two daughter
cells. That daughter cell will express high lev-
Lumen of els of Notch and remain a stem cell; the cell
neural tube (B) receiving less Par-3 will express less Notch
and become a neural progenitor cell. (B) Fus-
ing the Par3 gene with GFP enables visualiza-
tion of Par3 protein movement during division,
as seen here in the zebrafish embryonic hind-
brain. Par3 (bright green) is isolated primarily
to the daughter cell on the left (arrowhead)
after an asymmetrical division. As illustrated
in (A), this cell will remain a stem cell. (A after
Bultje et al. 2009, Lui et al. 2011; B from Alex-
andre et al. 2010.)
into the stem cell that requires high Notch, but Par-3 actually sequesters and deac-
tivates Numb function. Daughter cells lacking Par3 exhibit freely active Numb, which
functions to reduce Notch and thus enable an alternative (Delta-mediated) cell fate
(Gaiano et al. 2000; Rasin et al. 2007; Bultje et al. 2009).
600 Gorilla
dy Chimpanzee
n / bo Newborn Adult 400
ai h Orangutan
Br rowt chimpanzee chimpanzee
200
g
3
This criterion is not exact; dolphins and whales, for example, have a greater amount of folding
in the cortex than do humans.
Brain Growth 457
100
21.1
Percent proliferative cells
80
28.9
63.9 Gilbert
in each zone
20
0
Mouse Ferret Sheep Human Future Future
gyrus sulcus
Lissencephalic Gyrencephalic
FIGURE 14.17 Characterization of radial glial fanning during corti- gyrencephalic species. Brains that are more gyrencephalic show
cal folding in the ferret neocortex. (A) Retrograde tracing of radial higher percentages of proliferative cells in the outer subventricular
glial cells in the ferret neocortex over the course of neurogenesis zone (oSVZ), which is the same region that houses more outer radial
and gyrification. Note the triangle-shaped distribution of the dye- glial cells compared to lissencephalic species. (C) The orientation
filled cells, indicating a progressive fanning out of the radial fibers of ventricular (orange) and outer radial glial (brown) fibers in regions
along the apicobasal axis. (Arrowheads at the lower left show tight that will form a gyrus and sulcus. Outer radial glia are depicted
clusters at the luminal surface compared to the extreme width of to show more obliquely oriented fibers—a structural organization
each dye fill at the pial surface.) (B) Quantification of mitotic cells proposed to support gyrus formation. (A,B after Reillo et al. 2011;
in the different regions of the cerebrum of lissencephalic and C from Lewitus et al. 2013.)
458 Chapter 14
Denisovan
Neandertal
Bonobo
Chimpanzee
FIGURE 14.18 ARHGAP11B is an
evolutionarily novel human gene that can Orangutan
induce the formation of gyri in mouse
neocortex. (A) Phylogenetic tree of pri-
mates showing the point in the human (C) Satb2 DAPI ARHGAP11B and
lineage where the ARHGAP11B gene GFP expressing cells
arose through a partial duplication of the
ARHGAP11A gene. (B) Transverse sec-
tion through the mouse brain showing
the expression of GFP (green) in cells
that were electroporated in utero with
a construct encoding both GFP and
ARHGAP11B. (C) Immunolabeling using
a marker for the neocortex (Satb2; red)
in a mouse electroporated with ARH-
GAP11B (green). Nuclei are stained with
DAPI (blue). The dashed lines in (B) and
(C) denote induced gyri; the arrowheads
denote sulci. (From Florio et al. 2015.)
Brain Growth 459
WEb Topic 14.4 Speech, language, and the FOXP2 gene In humans, individu-
als with mutations of the FOXP2 gene display severe problems with language. Scientists
are studying the possible roles of this gene in the language acquisition abilities of humans
versus other primates.
Scientists Speak 14.2 See a web conference with Dr. Sofie Salama on the
HAR1 gene and human brain development.
of chimpanzees and mice, but not humans. When a reporter gene is joined to a chim-
panzee GADD45G enhancer and inserted into a mouse embryo, GADD45G is expressed
in the mouse brain. However, when joined to a human GADD45G enhancer, it is not
expressed in the human brain, evidence that the human GADD45G enhancer does act
to suppress a suppressor (the GADD45G gene).
Primary Anterior
motor cortex
Sensory
Age cortex Posterior
(years) 5 8 12 16 20
In tests using functional MRI to scan subjects’ brains while emotion-charged pic-
tures flashed on a computer screen, the brains of young teenagers showed activity in
the amygdala, which mediates fear and strong emotions. When older teens were shown
the same pictures, most of their brain activity was centered in the frontal lobe, an
area involved in more reasoned perceptions (Baird et al. 1999; Luna et al. 2001). These
data come primarily from studies comparing different groups of individuals. Improving
technology, however, is beginning to allow assessment of brain maturation of a single
individual over time (Dosenbach et al. 2010). The teenage brain is a complicated and
dynamic entity that is not easily understood (as any parent knows). Once through the
teen years, however, the resulting adult brain is usually capable of making reasoned
decisions, even in the onslaught of emotional situations.
14 Snapshot Summary
Brain Growth
1. Dendrites receive signals from other neurons, and axons neurons throughout life, although at nowhere near the
transmit signals to other neurons. The gap between cells fetal rate.
where signals are transferred from one neuron to another 4. The neurons of the brain are organized into laminae (lay-
(through the release of neurotransmitters) is called a syn- ers) and nuclei (clusters).
apse. There is an enormous array of different neuronal
5. New neurons are formed by the division of neural stem
morphologies throughout the CNS.
cells (neuroepithelial cells, radial glial cells) in the wall of
2. Macroglial cell types in the CNS are the astroglia (astro- the neural tube (called the ventricular zone). The resulting
cytes), oligodendrocytes (myelinating cells), and microglia newborn neurons can migrate away from the ventricular
(immune cells of the nervous system). zone and form a new layer, called the mantle zone (gray
3. Radial glial cells serve as the neural stem cells in the matter). Neurons forming later have to migrate through
embryonic and fetal brain. Humans continue making the existing layers. This process forms the cortical layers.
462 Chapter 14
6. Newborn neurons and progenitor cells migrate out of the 11. Asymmetrical partitioning of Par-3 during radial glial
ventricular zone on the processes of radial glial cells. cell division restricts active Notch signaling within ven-
7. In the cerebellum, migrating neurons form a second ger- tricular radial glia to promote stemness in one daughter
minal zone, called the external granular layer. cell, while Delta activity in the other daughter supports
differentiation.
8. The cerebral cortex in mammals, called the neocortex,
has six layers. Each layer differs in function and in the 12. The number and complexity of gyri and sulci (folds) of
type of neurons located there. the neocortex are correlated with level of intelligence.
Humans have a highly folded (gyrencephalic) neocor-
9. Ventricular radial glia can give rise to outer radial glial
tex. Radial glial cells are likely to play a major role in the
cells that populate the subventricular zone. Both stem
development of these folds.
cells can also generate intermediate progenitors that are
themselves capable of further symmetrical and asym- 13. Human brains appear to differ from those of other pri-
metrical divisions. mates by their retention of the fetal neuronal growth rate
during early childhood, high transcriptional activity of
10. In both the cerebellum and cerebrum, secreted Reelin
certain genes, the presence of human-specific alleles of
guides migrating neurons to the correct superficial layer
developmental regulatory genes, and the loss of tran-
in an “inside-out” growth progression; it does so through
scriptional regulators.
the regulation of N-cadherin and integrin expression.
Further Reading
Alexandre, P., A. M. Reugels, D. Barker, E. Blanc and J. D. Lewitus, E., I. Kelava and W. B. Huttner. 2013. Conical expan-
Clarke. 2010. Neurons derive from the more apical daughter in sion of the outer subventricular zone and the role of neocortical
asymmetric divisions in the zebrafish neural tube. Nature Neu- folding in evolution and development. Front. Hum. Neurosci. 7:
rosci. 13: 673–679. 424.
Azevedo, F. A. and 8 others. 2009. Equal numbers of neuronal Mota, B. and S. Herculano-Houzel. 2015. Cortical folding scales
and nonneuronal cells make the human brain an isometrically universally with surface area and thickness, not number of
scaled-up primate brain. J. Comp. Neurol. 513: 532–541. neurons. Science 349: 74–77.
Bentivoglio, M. and P. Mazzarello. 1999. The history of radial McLean, C. Y. and 12 others. 2011. Human-specific loss of
glia. Brain Res. Bull. 49: 305–315. regulatory DNA and the evolution of human-specific traits.
Bultje, R. S., D. R. Castaneda-Castellanos, L. Y. Jan, Y. N. Jan, Nature 471: 216–219.
A. R. Kriegstein and S. H. Shi. 2009. Mammalian Par3 regu- Paridaen, J. T., M. Wilsch-Brauninger and W. B. Huttner. 2013.
lates progenitor cell asymmetric division via Notch signaling in Asymmetric inheritance of centrosome-associated primary
the developing neocortex. Neuron 63: 189–202. cilium membrane directs ciliogenesis after cell division. Cell
Casper, K. B. and K. D. McCarthy. 2006. GFAP-positive pro- 155: 333–344.
genitor cells produce neurons and oligodendrocytes through- Paridaen, J. T. and W. B. Huttner. 2014. Neurogenesis during
out the CNS. Mol. Cell. Neurosci. 31: 676–684. development of the vertebrate central nervous system. EMBO
Erikksson, P. S., E. Perfiliea, T. Björn-Erikksson, A.-M. Alborn, Rep. 15: 351–364.
C. Nordberg, D. A. Peterson and F. H. Gage. 1998. Neurogene- Pollen, A. A. and 13 others. 2015. Molecular identity of human
sis in the adult human hippocampus. Nature Med. 4: 1313–1317. outer radial glia during cortical development. Cell 163: 55–67.
Fuentealba, L. C., S. B. Rompani, J. I. Parraguez, K. Obernier, R. Sekine, K. and 7 others. 2012. Reelin controls neuronal posi-
Romero, C. L. Cepko and A. Alvarez-Buylla. 2015. Embryonic tioning by promoting cell-matrix adhesion via inside-out acti-
origin of postnatal neural stem cells. Cell 161: 1644–1655. vation of integrin α5β1. Neuron 76: 353–369.
Hatten, M. E. 1990. Riding the glial monorail: A common Trommsdorff, M. and 8 others. 1999. Reeler/Disabled-like dis-
mechanism for glial-guided neuronal migration in different ruption of neuronal migration in knockout mice lacking the
regions of the mammalian brain. Trends Neurosci. 13: 179–184. VLDL receptor and ApoE receptor 2. Cell 97: 689–701.
Kwan, K. Y., N. Sestan and E. S. Anton. 2012. Transcriptional Varki, A., D. H. Geschwind and E. E. Eichler. 2008. Explaining
co-regulation of neuronal migration and laminar identity in the human uniqueness: Genome interactions with environment,
neocortex. Development 139: 1535–1546. behaviour, and culture. Nature Rev. Genet. 9: 749–763.
Go to www.devbio.com . ..
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
15
The Punchline
Neural crest cells and axon growth cones both migrate far from their source of origin
to specific places in the embryo. In the process, they must recognize and respond to
signals that guide them along specific routes to their final destination. Neural crest
cells arise from the crest of the neural tube, leaving this position either as a community
or as individual cells. These multipotent stem cells navigate through pathways in the
trunk and head, differentiating into such diverse cell types as neurons, smooth muscle,
pigment, and cartilage. Newly born neurons extend a growing axonal process led by
a motile growth cone tip, which navigates through the embryonic environment to form
a synapse with its target cell. Both neural crest cells and axonal growth cones use
transmembrane receptors to interpret short- and long-range guidance cues. These
cues produce cytoskeletal changes that result in the attraction or repulsion of the
cell as it travels. Such guidance molecules include members of the stromal-derived
factor, ephrin, Slit, and semaphorin families. Equally important are the noncanonical
repurposing of common morphogens as guidance cues, and the use of neurotrophins
for neuronal survival.
464 Chapter 15
FIGURE 15.1 Neural crest cell migra- (A) (C) Neural plate Neural plate
tion. (A) The neural crest is a transient border
structure dorsal to the neural tube. Nonneural
Neural crest cells (stained blue in this ectoderm
1
micrograph) undergo an epithelial-to-
mesenchymal transition from the dor- Notochord
salmost portion of the neural tube (the Premigratory
top of this micrograph). (B) When the neural crest
skin has been removed from the dorsal
surface of a vertebrate embryo, the Neural fold
2
neural crest cells (here computer-col-
ored gold against the purple somites)
can be seen as a collection of mesen-
chymal cells above the neural tube. (C)
Illustration of the sequential steps of
neural crest development, starting with Epidermis
their specification at the border of the
neural plate (1) and subsequent loca- Delaminating
tion at the apex of neural folds (2), fol-
(B) 3 neural crest
lowed by their delamination at the point cells
of neural tube closure (3), and final
migration out of ectodermal tissues (4). Neural tube
(A courtesy of J. Briscoe; B courtesy of
D. Raible.)
Migratory
neural crest
cells
mesenchymal transition from the dorsal neural tube, after which they migrate exten-
sively along the anterior-posterior axis and generate a prodigious number of differenti-
ated cell types (FIGURE 15.1; TABLE 15.1).
ary, lying opposite chick somites 1–7, while the sacral neu-
ral crest lies posterior to somite 28. Failure of neural crest Dorsal
S7 root
cell migration from these regions to the colon results in
ganglia
Trunk
ings of the head and neck region into which cranial neural crest
crest
cartilage nor cornea (Noden 1978; Nakamura and Ayer-Le Lievre 1982; Lwigale et al.
2004). However, both cranial and trunk neural crest cells can generate neurons, mela-
nocytes, and glia. The cranial neural crest cells that normally migrate into the eye
region to become cartilage cells can form sensory ganglion neurons, adrenomedullary
cells, glia, and Schwann cells if the cranial region is transplanted into the trunk region
(Noden 1978; Schweizer et al. 1983).
The inability of the trunk neural crest to form skeleton is most likely due to the
expression of Hox genes in the trunk neural crest. If Hox genes are expressed in the
cranial neural crest, these cells fail to make skeletal tissue; if trunk crest cells lose
Hox gene expression, they can form skeleton. Moreover, if transplanted into the trunk
region, cranial crest cells participate in forming trunk cartilage that normally does not
arise from neural crest components. This ability to form bone may have been a primi-
tive property of the neural crest and may have been critical for forming the bony armor
found in several extinct fish species (Smith and Hall 1993). In other words, rather than
the cranial crest acquiring the ability to form bone, the trunk crest has apparently lost
this ability. McGonnell and Graham (2002) showed that bone-forming capacity may
still be latent in the trunk neural crest: if cultured with certain hormones and vitamins,
trunk crest cells become capable of forming bone and cartilage when placed into the
head region. Moreover, Abzhanov and colleagues (2003) have shown that the trunk
crest cells can act like cranial crest cells (and make skeletal tissue) if the trunk cells are
cultured in conditions that cause them to lose the ability to express their Hox genes.
So even though the cells of the cranial neural crest and trunk neural crest are multi-
potent (a cranial crest cell can form neurons, cartilage, bone, and muscles; a trunk neu-
ral crest cell can form glia, pigment cells, and neurons), they have different repertoires
of cell types that they can generate under normal conditions. 3
Dev T u tor i al Neural crest cell development Dr. Michael J.F. Barresi
describes the remarkable journey that neural crest cells undertake to find
their destined tissues outside the CNS and differentiate into a variety of
distinct cell types.
3
To learn the role that neural crest plays in tooth, hair, and cranial nerve development, seek out
Chapter 16.
4
We introduced Brainbow-based fate mapping in Chapter 2 and described the utility of the
“confetti” mouse model for lineage tracing in Chapter 5.
Neural Crest Cells and Axonal Specificity 467
Dorsal root
ganglia (neurons) DRG
Ventral root
Premigratory Migratory (Schwann cells,
neural crest cells neural crest cells Sympathetic other glia)
ganglia (neurons)
FIGURE 15.3 Lineage tracing of trunk neural crest cells in mouse
proves they are multipotent stem cells. (A) Premigratory and early
migratory neural crest cells were marked by Cre-mediated recom-
bination in a “confetti” mouse. As many as 10 different colors could
be induced (see also Figure 2.13). (B) Researchers followed individual
colored clones to their fated structures later in development. Fluores-
SG VR
cent cells were seen in the dorsolateral pathway where melanocytes
differentiate; in the dorsal root ganglia (DRG), as part of the Schwann
cell population on the ventral root, and in the sympathetic ganglia
(SG). Micrographs show the tracing of premigratory cells labeled by
the Wnt1-CreERT driver, which shows a unique YFP/RFP fluorescent
combination in three different peripheral structures visualized with
cell type-specific markers. (After Baggliolini et al. 2015.)
75% of them proliferated, and their progeny showed multiple types of Developing Questions
lineages that differentiated into different cell types: dorsal root ganglia,
sympathetic ganglia, Schwann cells wrapping the ventral nerve root, It seems we now can be confident that
trunk neural crest cells are multipotent
and melanocytes (FIGURE 15.3). Although a small population of these
stem cells. Is it possible that some small
mapped neural crest cells appeared to be unipotent, the large majority population of these cells, dispersed widely
displayed multipotency throughout their migration—a finding strongly like novel developmental seeds, could
suggesting that mouse embryonic trunk neural crest cells are multipo- be retained as adult stem cells in each
tent stem cells, an important step forward in the field of neural crest of their final destinations? The ontogeny
research. of adult stem cells is unknown for many
The next logical question is whether cephalic neural crest cells are tissues. The migratory and multipotent
nature of neural crest cells suggests the
equally multipotent. It appears that a majority of early migrating cranial
hypothesis that they may be capable of
neural crest cells from the chick can generate multiple cell types (Calloni seeding these adult tissues.
et al. 2009), but it is not yet certain whether they are in fact multipotent
stem cells.
Nicole Le Douarin and others proposed a model of neural crest devel-
opment that likely still holds true, even in light of the new information
about multipotency. In this model, an original multipotent neural crest VADE MECUM
cell divides and progressively refines its developmental potentials (FIG-
The segment on Dr. Nicole Le Douarin’s work
URE 15.4; see Creuzet et al. 2004; Martinez-Morales et al. 2007; Le Doua- shows original footage of the experimental tech-
rin et al. 2008). To test this model directly, an individual neural crest cell niques and results of her work on neural crest cell
would need to be exposed to different environments to determine the reorganization, migration, and differentiation.
Developmental
array of different Biology
cell types 11e generate.
it could
Fig. 15.03
Dragonfly Media Group
05/27/16
468 Chapter 15
Neural crest specifiers FIGURE 15.4 Model for neural crest lineage segregation and the heterogeneity
of neural crest cells. The committed precursors of cartilage/bone (C), glia (G), neu-
rons (N), and melanocytes (M) are derived from intermediate progenitor cells, some
Neural crest of which could act as stem cells. The paracrine factors regulating these steps are
C M shown in colored type. NTs, neurotropin(s). (After Martinez-Morales et al. 2007.)
progenitors G N
C G G M
Specification of Neural Crest Cells
Neural crest
lineage N N Although neural crest cells are not identifiable until they
precursors emigrate from the neural tube, induction of these cells first
occurs during early gastrulation, at the border between
the presumptive epidermis and the presumptive neural
C G G N G M
plate (the region that will form the central nervous sys-
Edn1 Neuregulin NTs Edn3 Steel tem). Specification of the neural crest at the neural plate-
Edn3
epidermis boundary is a multistep process (see Huang and
Saint-Jeannet 2004; Meulemans and Bronner-Fraser 2004).
C G N M The first step appears to be the specification of the neural
plate border. The cells in this border between the neu-
Edn1 Neuregulin Neurturin Edn3 ral plate and the epidermis will become the neural crest
Nppc Edn3 GDNF a-MSH
NTs Steel and (in the anterior region) the placodes —thickenings
in the surface ectoderm that will generate the eye lens,
inner ear, olfactory epithelium, and other sensory struc-
tures (see Chapter 16). In amphibians, the border appears
to be specified by the interplay between a number of
neural plate inductive signals , including BMPs, Wnts,
and FGFs. Indeed, in the 1940s, Raven and Kloos (1945)
Cartilage/bone Schwann cells; Melanocytes
glia showed that although the presumptive notochord could
induce both the amphibian neural plate and neural crest
tissue (presumably blocking nearly all BMPs), the somite
Neurons and lateral plate mesoderm could induce only the neural
crest. In chick embryos, neural crest specification occurs
during gastrulation, when the borders between the neural
and nonneural ectoderm are still forming (Basch et al. 2006; Schmidt et al. 2007; Ezin et
al. 2009). Here, the neural plate inductive signals (especially BMPs and Wnts) secreted
from the ventral ectoderm and paraxial mesoderm interact to specify the boundaries.
In the anterior region, the timing of BMP and Wnt expression is critical for dis-
criminating between neural plate, epidermis, placode, and neural crest tissues (FIGURE
15.5). As we saw in Chapters 11 and 12, if both BMP and Wnt signaling are continuous,
the fate of the ectoderm is epidermal; but if BMP antagonists (e.g., Noggin or FGFs)
block BMP signaling, the ectoderm becomes neural. Studies by Patthey and colleagues
(2008, 2009) have shown that if Wnts induce BMPs and then Wnt signaling is turned
off, the cells become committed to be anterior placodes, whereas if the Wnt signaling
induces BMPs but stays on, the cells become capable of becoming neural crest.
The last few decades of research on neural crest specification has helped to assemble
the gene regulatory network (GRN) involved in the maturation of neural crest cells
(FIGURE 15.6). This GRN begins with Wnt and BMP inducing the expression of a set
Gilbert
Developmental Biology 11e, Sinauer Associates of transcription factors in the ectoderm (including Gbx2, Zic1, Msx1, and Tfap2), which
DevBio11e_15.04 Date 03-15-16 in turn regulate the neural plate border specifiers. These specifiers, including Pax3/7
and dlx5/6, collectively confer upon the border region the ability to form neural crest as
well as dorsal neural tube cell types. The border-specifying transcription factors then
induce a second set of more specific transcription factors, the neural crest specifiers,
in those cells that are to become the neural crest. These neural crest specifiers include
genes encoding the transcription factors FoxD3, Sox9, Snail (premigratory), and Sox10
(migratory) (Simões-Costa and Bronner 2015).
Neural Crest Cells and Axonal Specificity 469
Neural plate
Gbx2 Neural plate border
cMyb
Six1
cMyc
Sox9 –– Sox10
Snail1/2 FoxD3
Sox9 Ets1
Sox2 Pax3/7 Id Eya1/2
TGF-β
Wnt Sympathetic
Chondrocytes Tcf/βcat Melanocytes Sox10 neurons
BMPs
Smad3 Smad4
Insml TGF-β Wnt BMP
Sox10
Pax3/7 Mef2c
Sox9
Ascl1 Phox2b
Sox5/6 Mitf Hand2 Gata3
Tfap2
Col2a1 Agc1 Dct Tyr Si Th Dbh
FIGURE 15.6 The gene regulatory network for neural crest devel- the derived cells types (bottom). This circuit is replicated in a simpler
opment. This GRN is a compilation of data from a variety of verte- linear flow chart to the right. (Note: Not all derived cell types are
brate organisms. One of the most significant circuits (highlighted in illustrated.) (After Simões-Costa and Bronner 2015.)
yellow) shows gene expression in cells from early ectoderm (top) to
470 Chapter 15
When Foxd3, Snail, Sox9, and Sox10 are experimentally expressed in the lateral neu-
ral tube, the lateral neuroepithelial cells become neural crest-like, undergo epithelial-
to-mesenchymal transition (EMT) and delaminate from the neuroepithelium:
• Sox9 and Snail together are sufficient to induce EMT in neuroepithelial cells.
Sox9 is also required for the survival of trunk neural crest cells after delami-
nation (in the absence of Sox9, neural crest cells undergo apoptosis as soon as
they delaminate).
• Foxd3 may play many roles. It is needed for the expression of the cell surface
proteins needed for cell migration, and it also appears to be critical for the
specification of ectodermal cells as neural crest. Inhibiting expression of the
Foxd3 gene inhibits neural crest differentiation. Conversely, when Foxd3 is
expressed ectopically by electroporating the active gene into neural plate
cells, those neural plate cells express proteins characteristic of the neural crest
(Nieto et al. 1994; Taneyhill et al. 2007; Teng et al. 2008).
• The Sox10 gene appears to be one of the most critical regulators of neural crest
specification. It is crucial not only for the delamination of neural crest cells
from the neural tube, but also for the differentiation of the numerous neural
crest lineages (Kelsh 2006; Betancur et al. 2010). Sox10 protein binds to the
enhancers of numerous target genes that encode the neural crest effectors;
these include the genes for some small G proteins, such as Rho GTPases, that
allow cells to change shape and migrate; cell surface receptors, such as recep-
tor tyrosine kinases and endothelin receptor (e.g., ENDRB2), that allow the
neural crest cells to respond to patterning and chemotactic proteins in their
environments; and transcription factors, such as MITF in the melanocyte
lineage that forms pigment cells (see Figure 15.6; Simões-Costa and Bronner
2015).
WEb Topic 15.1 Induced neural crest cells Understanding the gene regula-
tory network controlling neural crest development has allowed researchers to reprogram
human fibroblasts into induced neural crest cells (iNCCs) to study their development and
role in disease.
Scientists Speak 15.1 Dr. Marianne Bronner talks about the gene regulatory
network of neural crest development in regard to evolution.
Pathfinding axon
Growth substrate
Individually
migrating
neural crest cell
Collective
migration of
neural crest cells Growth substrate
FIGURE 15.7 Analogy of neural crest and axonal migration to the guidance and movement
of traffic. See text for narrative. (Photo © Alexis Corpuz.)
Delamination
After cell specification, the first visible indication of neural crest cells is their epithelial-
to-mesenchyme transition (EMT) in preparation for leaving the neural tube. Neural
crest cells lose their adhesive junctions and separate from the epithelium in a process
known as delamination (FIGURE 15.8). The timing of neural crest delamination is
controlled by the neural tube’s environment. The trigger for the EMT appears to be the
activation of the Wnt genes by BMPs. The BMPs (which can be produced by the dorsal
region of the neural tube; see Chapters 13 and 14) are held in check by Noggin produced
by the notochord and somites. When Noggin expression is reduced, BMPs can function
and activate EMT in the neural crest cells (Burstyn-Cohen et al. 2004).
Prior to delamination, the different regions of ectoderm in the area of the neural crest
can be identified by their expression of different cell-cell adhesion molecules: surface
Developmental Biology 11e
Fig. 15.07
FIGURE 15.8 Migrating neural crest cells are stained red by HNK-1 antibody, which recog-
05/27/16
nizes a cell surface carbohydrate involved in neural crest cell migration. RhoB protein (green
stain) is expressed in cells as they delaminate. Cells expressing both HNK-1 and RhoB appear
yellow. (From Liu and Jessell 1998, courtesy of T. M. Jessell.)
472 Chapter 15
FIGURE 15.9 Neural crest delamination and migration by contact Surface ectoderm cells
inhibition. The process of neural crest delamination is shown here fuse into one layer E-cadherin BMP/Wnt
at the time when the neural and surface ectoderms have separated
and are both in the process of fusing at the midline into the neural
tube and epidermis respectively. BMP and Wnt signals specify the
three major regions of the neuroepithelium, which are distinguished
by their expression of unique adhesion proteins: surface ectoderm
(E-cadherin), neural tube (N-cadherin), and the premigratory neural
Differential
Contact inhibition
Snail 2
crest (cadherin-6B). In the premigratory domain, BMP levels are the
expression along
highest, with Wnt at intermediate amounts; this situation supports Premigratory
D/V axis
the upregulation of Snail-2 (and Zeb-2) in these cells. Snail-2 proteins neural crest
repress N-cadherin and E-cadherin in this domain. Cadherin-6B is
upregulated only in the apical half of premigratory neural crest cells, Delamination
and functions to activate RhoA and actomyosin contractile fibers for Snail
apical constriction and the initiation of delamination. Noncanonical
Wnt signaling (not shown) establishes the polar activity of RhoA (red)
and Rac1 (yellow) along the migratory axis of migrating neural crest
cells. When neural crest cells contact one another, they experience
herin
contact inhibition, during which they will stop, turn, and migrate away
Cad
-6B
in the opposite direction.
Snail2
Migratory
neural crest
N-cadherin
N-cadherin
Sox2
ectoderm expresses E-cadherin, premigratory neural crest expresses cadherin 6B, and the
neural tube expresses N-cadherin (FIGURE 15.9). The Wnt and BMP signals lead to the
expression of the “core EMT regulatory factors” (e.g., Snail-2, Zeb-2, Foxd3, and Twist) in
the delaminating premigratory neural crest. Sox2 is expressed by the cells of the neural
ectoderm (plate/fold/tube) and functions in part to transcriptionally repress Snail-2 expres-
sion, whereas the more dorsally expressed Snail-2 in the premigratory neural crest region
cross-represses Sox2 expression (reviewed in Duband et al. 2015). As seen in the pattern-
ing of the ventral neural tube (see Chapter 14), this cross-transcriptional repression helps
to refine the boundaries between the neural tube epithelium (N-cadherin), premigratory
neural crest (cadherin 6B), and surface ectoderm (E-cadherin); see Figure 15.9.
Noncanonical Wnt signaling is critical for activating the small Rho GTPases in premi-
gratory neural crest cells. These Rho GTPases function to (1) facilitate the expression of
Foxd3 and the Snail family genes and (2) establish the cytoskeletal conditions for migra-
tion by promoting actin polymerization into microfilaments and the attachment of these
microfilaments to focal adhesions in the cell membrane (Hall 1998; De Calisto et al. 2005).
The crest cells cannot leave the neural tube as long as they are tightly connected
to one another. Snail has been shown to directly downregulate the expression of cad-
herin-6B and the tight junction proteins that bind epithelial cells together (see Figure
15.9). In zebrafish, cadherin-6 is transiently maintained only at the apical end of the
delaminating cell, which allows RhoA to construct the actomyosin contractile fibers
for apical constriction and the commencement of delamination and migration (Clay
and Halloran 2014). After migration, neural crest cells re-express cadherins, as demon-
strated where they aggregate to form the dorsal root and sympathetic ganglia (Takeichi
1988; Akitaya and Bronner-Fraser 1992; Coles et al. 2007).
Developmental Biology 11e
Fig. 15.09
Dragonfly Media Group
05/26/16
Neural Crest Cells and Axonal Specificity 473
chemotaxis are not required for collective migration, but that properties intrinsic to the
Developing Questions
cells are sufficient to maintain cluster integrity and directional movement. Simulations
Several different embryonic modeling collective migration predict that both contact inhibition of locomotion and co-
progenitor cells, such attraction between cells are necessary for efficient collective migration, which matches
as border cells in the
what is seen in vivo and in vitro (Carmona-Fontaine et al. 2011; Woods et al. 2014).
Drosophila ovary and the
lateral line primordia in Indeed, cranial neural crest cells in Xenopus show not only a Wnt/PCP-mediated RhoA
zebrafish, display collective mechanism of contact inhibition of locomotion but also secretion of Complement 3a
migration, but do any cell (C3a), which attracts neural crest cells expressing the C3a receptor. These same cranial
types in the adult exhibit neural crest cells also express low levels of N-cadherin (see Figure 15.11). Experimen-
similar collective migratory tally increasing N-cadherin results in a more tightly adherent population of neural crest
behaviors that result in unable to invade spaces with the same migratory speed, suggesting that optimal levels
“invasion” of tissues? If they
of N-cadherin may be necessary for normal collective migration of these cells and for
did, would the cells go
through an epithelial-to- their invasion of tissues (Theveneau et al. 2010; Kuriyama et al. 2014).
mesenchymal transition as
the neural crest cells do? WATCH DEVELOPMENT 15.1 This time-lapse movie demonstrates the changes in
collective migration following manipulation of N-cadherin in neural crest cells.
Following early specification and delamination, neural crest cells migrate along
different paths to their specific locations for final differentiation. How do these cells
“know” where to go? Does the substrate for travel differ along different paths? What are
the “traffic signs” in the environment that provide guidance cues for neural crest cells to
FIGURE 15.12 Neural crest cell migra- colonize their target tissues? Next we will highlight mechanisms behind the guidance
tion in the trunk of the chick embryo. of neural crest cell migration into the trunk, head, and cardiac regions of the embryo.
Schematic diagram of trunk neural crest
cell migration. Cells taking the ventral
pathway (1) travel through the anterior
Migration Pathways of Trunk Neural Crest Cells
of the sclerotome (that portion of the
Neural crest cells migrating from the neural tube at the axial level of the trunk follow
somite that generates vertebral cartilage).
Those cells initially opposite the posterior
one of two major pathways (FIGURE 15.12). Many cells that leave early follow a ven-
portion of a sclerotome migrate along tral pathway away from the neural tube. Fate-mapping experiments show that these
the neural tube until they come to an cells become sensory (dorsal root) and autonomic neurons, adrenomedullary cells, and
anterior region. These cells contribute Schwann cells and other glial cells (Weston 1963; Le Douarin and Teillet 1974). In birds
to the sympathetic and parasympathetic and mammals (but not in fish and amphibians), these cells migrate ventrally through
ganglia as well as to the adrenomedullary
cells and dorsal root ganglia. Somewhat
later, other trunk neural crest cells enter
the dorsolateral pathway (2) at all axial
positions of the somite. These cells travel
beneath the ectoderm and become pig-
ment-producing melanocytes. (Migration
pathways are shown on only one side of
2
the embryo.)
Epidermis
Dermomyotome
Sclerotome
Notochord Dorsolateral
Post. pathway
Cells travel between
Aorta
Ant. Somite the epidermis and
the dermis
Post.
Rostral
Ventral pathway
Cells travel ventrally through
the anterior sclerotome
Neural Crest Cells and Axonal Specificity 475
the anterior, but not the posterior, section of the sclerotomes 5 (Rickmann et al. 1985;
Bronner-Fraser 1986; Loring and Erickson 1987; Teillet et al. 1987).
Trunk crest cells that emigrate via the second pathway—the dorsolateral path-
way —become melanocytes, the melanin-forming pigment cells. These cells travel
between the epidermis and the dermis, entering the ectoderm through minute holes
in the basal lamina (which they themselves may create). Once in the ectoderm, they
colonize the skin and hair follicles (Mayer 1973; Erickson et al. 1992). The dorsolateral
pathway was demonstrated in a series of classic experiments by Mary Rawles (1948),
who transplanted the neural tube and neural crest from a pigmented strain of chickens
into the neural tube of an albino chick embryo and saw pigmented feathers on other-
wise white wings (see Figure 1.15C).
By transplanting quail neural tubes or neural folds into chick embryos, Teillet and
colleagues (1987) were able to mark neural crest cells both genetically and immuno-
logically. The antibody marker recognized and labeled neural crest cells of both spe-
cies; the genetic marker enabled the investigators to distinguish between quail and
chick cells (see Figure 1.15A,B). These studies showed that neural crest cells initially
located opposite the posterior region of a somite migrate anteriorly or posteriorly along
the neural tube, and then enter the anterior region of their own or an adjacent somite.
These cells join with the neural crest cells that initially were opposite the anterior por-
tion of the somite, and they form the same structures. Thus, each dorsal root ganglion
comprises neural crest cell populations forming adjacent to three somites: one from
the neural crest opposite the anterior portion of the somite, and one each from the
two neural crest regions opposite the posterior portions of its own and the neighbor-
ing somites.
5
Recall that the sclerotome is the portion of the somite that gives rise to the cartilage of the spine.
In the migration of fish neural crest cells, the sclerotome is less important; rather, the myotome
appears to guide the migration of the crest cells ventrally (Morin-Kensicki and Eisen 1997).
476 Chapter 15
Posterior: no migration
P
(C) + – + – + – + – + (D)
Anterior Posterior
Motor
axons
going for the gut Which neural crest cells colonize the gut and which do not?
This distinction involves both extracellular matrix components and soluble paracrine
factors. Neural crest cells from the vagal and sacral regions form the enteric ganglia
478 Chapter 15
of the gut tube and control intestinal peristalsis. Cells from the vagal neural crest, once
past the somites, enter into the foregut and spread to most of the digestive tube, while
the sacral neural crest cells colonize the hindgut (see Figure 15.14B). Various inhibi-
tory extracellular matrix proteins (including the Slit proteins) block the more ventral
migration of trunk neural crest cells into the gut, but these inhibitory proteins are
absent around the vagal and sacral crest, allowing these neural crest cells to reach the
gut tissue. Once in the vicinity of the developing gut, these crest cells are attracted to
the digestive tube by glial-derived neurotrophic factor (GDNF ), a paracrine factor
produced by the gut mesenchyme (Young et al. 2001; Natarajan et al. 2002). GDNF
from the gut mesenchyme binds to its receptor, Ret, on the neural crest cells. The vagal
neural crest cells have more Ret in their cell membranes than do the sacral cells, which
makes the vagal cells more invasive (Delalande et al. 2008).
GDNF activates cell division, directs cell migration into the gut mesoderm, and
induces neural differentiation (Mwizerwa et al. 2011). If either GDNF or Ret is deficient
in mice or humans, the pup or child suffers from Hirschsprung disease, a syndrome
wherein the intestine cannot properly void solid wastes. In humans, this condition is
most often due to the failure of the vagal neural crest cells to complete their coloniza-
tion of the hindgut, thus leaving a section of the lower intestine without the ability to
undergo peristalsis. By combining experimental analysis of crest cell migration with
mathematical modeling, Landman and colleagues (2007) modeled the migration of
the vagal crest cells and explained the genetic deficiencies that cause Hirschsprung
disease. In their model, the vagal crest cells normally do not migrate in a directed
manner once they are in the anterior portion of the gut. Rather, they proliferate until
all the niches in that region of the intestine are saturated, after which the migrating
front moves posteriorly (Simpson et al. 2007). Meanwhile, the gut itself continues to
elongate. Whether or not the colonization is complete depends on the initial num-
ber of vagal crest cells entering the anterior gut and the ratio of cell motility to gut
growth. These results were not intuitively obvious just from physical observation, and
the study shows the power of combining experimental and mathematical approaches
to development.
The enteric neural crest cells perform one of the longest migratory journeys because
they are chasing a moving target—the caudalmost, or distal extent, of the growing gut.
This caudal migration of enteric neural crest cells has been likened to a wave that has
a leading (caudal) “crest” of cells (Druckenbrod and Epstein 2007). As the wave pro-
Developing Questions gresses down the developing gut, neural crest cells must spread evenly throughout the
Enteric neural crest cells tissue to ensure complete innervation and function. The process by which enteric neural
are positioned at the crest cells are deposited in the gut has been called “directional dispersal” (Theveneau
right time and place to
and Mayor 2012), but little has been discovered about the cell behaviors mediating this
influence the trajectory
process. Enteric neural crest do not migrate collectively as clusters but rather in long
of pathfinding enteric
neurons. Does that in fact chains (Corpening et al. 2011; Zhang et al. 2012). Moreover, as the wave progresses,
occur? Are these leading enteric neural crest cells migrate in seemingly random directions and explore domains
neural crest cells expressing along all axes; overall dispersal, however, preferentially occurs in the posterior direc-
membrane receptors or tion (FIGURE 15.15A ; Young et al. 2014). Enteric neural crest cells are differentiating
secreting diffusible proteins into neurons along this journey, with both the soma (cell body) and projecting axon still
that instruct the growing
quite mobile during gut development. It is interesting that enteric neural crest cells can
neuron to extend its axon
in the direction of the
be found migrating all along the growing axon as well as just ahead of the leading tip of
neural crest cell? If the the growing axon (FIGURE 15.15B). These findings suggest a mutualistic relationship
enteric neural crest cells between migrating enteric neural crest cells and pathfinding enteric neurons such that
are leading the way for the the neural crest cells use the nerve axons as a substrate for migration and the neurons’
axons, what is guiding the axons follow “trail-blazing” neural crest cells (Young et al. 2014).
neural crest cells toward
the caudal end of the gut
while also establishing a WATCH DEVELOPMENT 15.2 The first of two movies features the dispersal of enteric
homogeneously dispersed neural crest cells. The second shows a close-up of individual enteric neural crest cells
array of neurons? migrating along actively growing axons in the developing gut.
Neural Crest Cells and Axonal Specificity 479
(A) Dispersal of ENCC in the gut over time (B) ENCC lead and migrate on growing neurites
Caudal
0h 0 min
Caudal
* *
2h * 30 min
*
*
4h * 50 min
*
FIGURE 15.15 Following the movement of individual enteric neural spread throughout the gut (green, 0 h). Photoconverted cells actively
crest cells (ENCCs) in the developing gut. Transgenic Ednrb-hKikGR migrate and disperse with a caudal preference over time (2 h, 4 h;
mice were used to fluorescently label enteric neural crest (green). width of bar at top). (B) ENCCs (green) can be seen at the growth tip
KikGR is a photoconvertable protein that changes its emission when of differentiating neurites (red, arrows). ENCCs are also seen to use
exposed to ultraviolet light from green to red. (A) Four separate foci neurites as a substrate for migration (note movement of asterisks
were photoconverted in the developing gut (red; bars at top). The over time; different colored asterisks denote different cells). (Data
caudalmost tip of the moving ENCC wave is located to the far right of adapted from Young et al. 2014.)
the 0-hour time point. Early chains of ENCCs can be seen sparsely
7
MITF stands for microphthalmia-associated transcription factor, so named because one
result of mutations of the gene, as described in mice, is small eyes (i.e., microphthalmia).
The effects of MITF are widespread, however, as we will see in this chapter.
(B)
FIGURE 15.16 Neural crest cell migration in the dorsolateral pathway through
the skin. (A) Whole mount in situ hybridization of day 11 mouse embryo stained
for neural crest-derived melanoblasts (purple). (B) Stage 18 chick embryo seen
in cross section through the trunk. Melanoblasts (arrows) can be seen moving
through the dermis, from the neural crest region toward the periphery. (A from
Baxter and Pavan 2003; B from Santiago and Erickson 2002, courtesy of C.
Erickson.)
480 Chapter 15
environment (such as the adrenal cortex inducing adjacent neural crest cells into adre-
nomedullary cells), or (3) a combination of the two (as when cells migrating through
the sclerotome respond to Wnt signals depending on their types of receptors). The fate
of an individual neural crest cell is determined both by its starting position (anterior-
posterior along the neural tube) and by its migratory path.
Scientists Speak 15.2 Dr. Melissa Harris and Dr. Carol Erickson talk about
EphB2/EDNRB2 and migration along the dorsolateral pathway.
1 Incus and malleus (from neural Maxillary branch of the Jaw muscles; floor of Maxillary and mandi-
crest); mandible, maxilla, and carotid artery (to the ear, mouth; muscles of the bular divisions of tri-
temporal bone regions (from nose, and jaw) ear and soft palate geminal nerve (V)
neural crest)
2 Stapes bone of the middle ear; Arteries to the ear region: Muscles of facial Facial nerve (VII)
styloid process of temporal bone; corticotympanic artery expression; jaw and
part of hyoid bone of neck (all (adult); stapedial artery upper neck muscles
from neural crest cartilage) (embryo)
3 Lower rim and greater horns of Common carotid artery; Stylopharyngeus (to Glossopharyngeal
hyoid bone (from neural crest) root of internal carotid elevate the pharynx) nerve (IX)
4 Laryngeal cartilages (from lateral Arch of aorta; right sub- Constrictors of pharynx Superior laryngeal
plate mesoderm) clavian artery; original and vocal cords branch of vagus
spouts of pulmonary nerve (X)
arteries
6a Laryngeal cartilages (from lateral Ductus arteriosus; roots Intrinsic muscles Recurrent laryngeal
plate mesoderm) of definitive pulmonary of larynx branch of vagus
arteries nerve (X)
(A) (B)
Anterior Frontonasal
midbrain process
Posterior
midbrain
r1
r2
r3
Hindbrain r4 p1
r5 p2
r6
p3
r7
p4
r8
Incus
Stapes
Maxillomandibular Styloid
process process
Meckel’s cartilage
FIGURE 15.18 Cranial neural crest Hyoid cartilage
cell migration in the mammalian head. Laryngeal cartilage
(A) Migration of GFP-labeled neural
crest cells in a day 9.5 mouse embryo, Tracheal rings
emphasizing the colonization of the pha-
ryngeal arches and frontonasal process.
(B) Migrational pathways from the cranial The cranial crest cells follow one of three major streams:
neural crest into the pharyngeal arches
(p1–p4) and frontonasal process. (C) Con- 1. Neural crest cells from the midbrain and rhombomeres 1 and 2 of the hindbrain
tinued migration of the cranial neural crest migrate to the first pharyngeal arch (the mandibular arch), forming the jawbones
to produce the human face. The frontona- as well as the incus and malleus bones of the middle ear. These cells will also
sal process contributes to the forehead, differentiate into neurons of the trigeminal ganglion—the cranial nerve that
nose, philtrum of the upper lip (the area innervates the teeth and jaw—and will contribute to the ciliary ganglion that
between the lip and nose), and primary innervates the ciliary muscle of the eye. These neural crest cells are also pulled by
palate. The lateral nasal process gener- the expanding epidermis to generate the frontonasal process, the bone-forming
ates the sides of the nose. The maxillo- region that becomes the forehead, the middle of the nose, and the primary palate.
mandibular process gives rise to the lower
Thus, the cranial neural crest cells generate much of the facial skeleton (see Figure
jaw, much of the upper jaw, and the sides
Gilbert
15.18B,C; Le Douarin and Kalcheim 1999; Wada et al. 2011).
of the middle and
Developmental lower
Biology 11eregions ofAssociates
, Sinauer the
DevBio11e_15.18 Datein05-05-16
face. (D) Structures formed the human 2. Neural crest cells from rhombomere 4 populate the second pharyngeal arch, form-
face by the mesenchymal cells of the ing the upper portion of the hyoid cartilage of the neck as well as the stapes bone
neural crest. The cartilaginous elements of the middle ear (see Figure 15.18B,D). These cells will also contribute neurons of
of the pharyngeal arches are indicated the facial nerve. The hyoid cartilage eventually ossifies to provide the bone in the
by colors, and the darker pink region neck that attaches the muscles of the larynx and tongue.
indicates the facial skeleton produced by
anterior regions of the cranial neural crest. 3. Neural crest cells from rhombomeres 6–8 migrate into the third and fourth pha-
(A courtesy of P. Trainor and A. Barlow; B ryngeal arches and pouches to form the lower portion of the hyoid cartilage as well
after Le Douarin 2004; C after Helms et al. as contributing cells to the thymus, parathyroid, and thyroid glands (see Figure
2005; D after Carlson 1999.) 15.18B; Serbedzija et al. 1992; Creuzet et al. 2005). These neural crest cells also go
Neural Crest Cells and Axonal Specificity 483
to the region of the developing heart, where they help construct the outflow tracts
(i.e., the aorta and pulmonary artery). If the neural crest is removed from those
regions, these structures fail to form (Bockman and Kirby 1984). Some of these
cells migrate caudally to the clavicle (collarbone), where they settle at the sites that
will be used for the attachment of certain neck muscles (McGonnell et al. 2001).
WATCH DEVELOPMENT 15.3 Watch cranial neural crest cells chase the placode in
the frog embryo. In a second movie, cranial neural crest cells chase placodal cells even
in isolated of culture conditions.
It was found that placodal cells secrete the chemoattractant stromal-derived fac-
tor-1 (SDF1), thereby setting up a gradient of the factor that is highest at the placode.
The cranial neural crest cells express the receptor for this ligand, CXCR4, which allows
them to sense the attraction of the SDF1 gradient and directs the migration of neural
crest cells up the gradient toward the placode (the “chase”). Once the neural crest cells
reach the placode, however, contact inhibition of locomotion between the neural crest
and placode cells causes the placode cells to migrate away from the site of contact (the
“run”). The chemoattractive force of SDF1, however, will start the chase again in the
8
We have seen similar phenomena before, as in the cells of the chick neural folds (some of
which probably become neural crest cells) and limb buds, early zebrafish blastomeres, and the
extensions of sea urchin micromeres.
484 Chapter 15
Rac1
Rac1
Rac1 Placode
migration
Rac1
Placode
Chemorepellents: semaphorins/ephrins FIGURE 15.19 “Chase and run” model for chemotactic cell migration. (A)
The micrograph is a lateral view of streams of cranial neural crest cells in the
Xenopus head, visualized by in situ hybridization for FoxD3 and Dlx2 for both
(B) premigratory and migratory cranial neural crest populations (dark purple). The
SDF1 CXCR4 SDF1 illustration depicts the collective migration of cranial neural crest cells using
N-cadherin the autonomous mechanisms described in Figure 15.11. Here, a ventrally posi-
tioned placode (blue cells) attracts the leading edge of the cranial neural crest
stream via SDF1-CXCR4 signaling (the “chase”). The cranial neural crest con-
NC Rac1 PL PL
tacts the placode, triggering contact inhibition that pushes the placode forward
(the “run”). Chemorepellents restrict crest cells from lateral wandering outside
Focal adhesion of the cluster. (B) Internal molecular events and resulting cellular behaviors that
Collapse yield forward migratory movement of both placodal (blue) and cranial neural
crest (red/yellow) cells. (After Theveneau et al. 2013; Scarpa and Mayor 2016.
Photograph from Kuriyama et al. 2014.)
Rac1 Rac1
No focal adhesion ventral direction toward the “running” placode (FIGURE 15.19B ; Theve-
neau et al. 2013; Scarpa and Mayor 2016).
(A) Wnt1-Cre: Neural crest-derived bone (B) Mesp-Cre: Mesoderm-derived bone FIGURE 15.20 Cranial neural crest cells in
embryonic mice, stained for β-galactosidase
expression. (A) In the Wnt1-Cre strain, β-galacto-
sidase is expressed wherever Wnt1 (a neural
crest marker) would be expressed. This dorsal
view of a 17.5-day embryonic mouse shows
staining in the frontal bone (f) and interparietal
* * bone (asterisk) but not in the parietal bone (p).
f f (B) The Mesp-Cre strain of mice expresses
p p β-galactosidease in those cells derived from the
mesoderm. Here, a reciprocal pattern of stain-
ing is seen, and the parietal bone is blue. (C)
Summary diagram of results from mapping with
Sox9 and Wnt1 markers (Als, alisphenoid; Bs,
(C) basisphenoid; Ex, exoccipital; Max, maxilla; Nc,
Nasal
nasal capsule; Os, orbitosphenoid; So, supra-
Parietal Frontal occipital; Sq, squamosal). (A,B from Yoshida
Inter- 2008, courtesy of G. Morriss-Kay; C from several
Pre- Nc
parietal maxilla sources, including Noden and Schneider 2006
Als Max and Lee and Saint-Jeannet 2011.)
So Temporal Sq Os
Otic Bs Jugal
Palatine
Mandible
Ex
Incus Paraxial
Stapes mesoderm
Malleus Meckel’s
Tympanic cartilage Neural
crest
bone and mesoderm-derived head bone is between the frontal and parietal bones (FIG-
URE 15.20C; Yoshida et al. 2008). Although the specifics may vary among the vertebrate
groups, in general the front of the head is derived from the neural crest while the back
of the skull is derived from a combination of neural crest-derived and mesodermal
bones. The neural crest contribution to facial muscle mixes with the cells of the cranial
mesoderm such that facial muscles probably also have dual origins (Grenier et al. 2009).
Given that the neural crest forms our facial skeleton, it follows that even small varia-
tions in the rate and direction of cranial neural crest cell divisions will determine what
we look like. Moreover, because we look more like our biological parents than our
friends do (at least, we hope this is true), such small variations must be hereditary. The
regulation of our facial features is probably coordinated in large part by numerous para-
crine growth factors. BMPs (especially BMP3) and Wnt signaling cause the protrusion
of the frontonasal and maxillary processes, giving shape to the face (Brugmann et al.
2006; Schoenebeck et al. 2012). FGFs from the pharyngeal endoderm are responsible for
the attraction of the cranial neural crest cells into the arches as well as for patterning the
skeletal elements within the arches. Fgf8 is both a survival factor for the cranial crest
cells and is critical for the proliferation of cells forming the facial skeleton (Trocovic et
al. 2003, 2005; Creuzet et al. 2004, 2005). The FGFs work in concert with BMPs, some-
times activating them and sometimes repressing them (Lee et al. 2001; Holleville et al.
2003; Das and Crump 2012).
r1
r2
r3
r4
r5
r6
r7
r8
WEb Topic 15.3 Why birds don’t have teeth The formation of the face and jaw
is coordinated by a series of cranial neural crest cell migrations and by the interactions of
these neural crest cells with surrounding tissues.
Neural S1
S2
tube
S3
Neural
crest cells Pulmonary
(C) in septum artery
Aortic arch
arteries
3
Aortic- Aorta 4
pulmonary
septum 6
Pulmonary
artery
Growth cone
Axon
Dir
ectional turn
CLASP
APC
Dynamic
MT Lamellipodium
Attractive
Filopodium signals
FIGURE 15.24 Axon growth cones. (A) Growth cone of the hawkmoth Manduca sexta Protrusion
during axon extension and pathfinding. The actin in the filopodia is stained green with
fluorescent phalloidin, and the microtubules are stained red with a fluorescent antibody
Filopodium and
Lamellipodium
to tubulin. (B) Actin microspikes in an axon growth cone, seen by transmission electron
extend forward
microscopy. (C) The periphery of the growth cone contains lamellipodia and filopodia. The
lamellipodia are the major motile apparatus and are seen in the regions that are turning
toward a stimulus. The filopodia are sensory. Both structures contain actin microfilaments.
There is also a central region of microtubules, some of which extend outward into the filopo-
dia. The microtubules entering the peripheral area can be lengthened or shortened by pro-
teins activated by attractive or repulsive stimuli. During attraction, regulatory proteins bind
to the plus ends of the microtubules, stabilizing and lengthening them. On the side opposite
the attractive cue, microtubules are removed from the periphery. (A courtesy of R. B. Levin
and R. Luedemanan; B from Letourneau 1979; C after Lowery and Van Vactor 2009; Bearce
et al. 2015; Cammarata et al. 2016.)
Engorgement
C-domain
moves forward
of pointed filopodia called microspikes (FIGURE 15.24B). These microspikes con-
tain microfilaments, which are oriented parallel to the long axis of the axon. (This
mechanism is similar to that seen in the filopodial microfilaments of secondary mes-
enchyme cells in echinoderms; see Chapter 10). Within the axon itself, structural sup-
port is provided by microtubules. If the neuron is placed in a solution of colchicine (an
inhibitor of microtubule polymerization), microspikes will be destroyed, and axons
retract (Yamada et al. 1971; Forscher and Smith 1988).
As in most migrating cells, the exploratory microspikes of the growth cone attach
to the substrate and exert a force that pulls the rest of the cell forward. Axons will
not grow if the growth cone fails to advance (Lamoureux et al. 1989). In addition to
their structural role in axonal migration, microspikes also have a sensory function. Consolidation
Fanning out in front of the growth cone, each microspike samples the microenviron-
ment and sends signals back to the cell body (Davenport et al. 1993). The navigation New axon
of axons to their appropriate targets depends on guidance molecules in the extracel- shaft forms
lular environment, and it is the growth cone that turns or does not turn in response
to guidance cues as the axon seeks to make appropriate synaptic connections. Such
differential responsiveness is due to disparities in the expression of receptors on the
growth cone cell membrane. Growth cones have the ability to sense the environment
and translate the extracellular signals into a directed movement (FIGURE 15.24C ).
This use of directional cues to facilitate specific migration is accomplished by altering
the cytoskeleton, changing membrane growth, and coordinating cell adhesion and
cell movement (Vitriol and Zheng 2012).
FIGURE 15.25 APC localizes tubulin mRNA at the plus end of microtubules for spatially
targeted translation to fuel growth cone expansion. (A) Schematic showing the localized
Tubb2b transcript and targeted translation for immediate microtubule elongation at the plus
end. (B) Growth cone of a neuronal cell line (white outline) expressing b2B-tubulin mRNA
(green) as seen by fluorescence in situ hybridization. (C) APC and β2B tubulin (Tubb2b) immu-
nolocalization in the peripheral domain of a neuron from a dissociated rat dorsal root ganglion.
APC is co-localized to the tips of Tubb2b-containing microtubules (arrows), seen close up in
the inset. (A after Coles and Bradke 2014; B,C from Preitner et al. 2014.)
The growth cone was found to have two major compartments. The central domain
of the growth cone contains microtubules that extend the axon shaft and support mito-
chondria and other organelles (see Figure 15.24C). The peripheral domain contains two
types of actin-associated membrane protrusions: the lamellipodia, broad membranous
sheets containing short, branched actin networks, that act as the migratory network of
the growth cone; and the filopodia, membranes extended by long bundles of filamen-
tous actin, that act as the sensory network. A transition zone between the central and
peripheral regions may coordinate actin and tubulin growth (Rodriguez et al. 2003;
Lowery and Van Vactor 2009). Lone “pioneer” microtubules from the central zone’s
core of microtubule bundles protrude through the actin arc that defines the transition
zone and extend into the periphery of the growth cone. These pioneer microtubules
dynamically associate with the actin microfilaments, and together the microtubules and
microfilaments grow and contract to perform the fingerlike movements characteristic of
filopodia (Mitchison and Kirschner 1988; Sabry et al. 1991; Tanaka and Kirschner 1991,
1995; Schaefer et al. 2002). The microtubule- and actin-based membrane protrusions,
coupled with selective adhesion and membrane recycling, provide the force that drives
axon movement and directionality.
(A)
EB1 Actin
APC
3´
3′
Local
αβ-tubulin translational 5′
heterodimer machinery + Microtubule
plus end
Tubb2B
3′
5′
3′ b2B-tubulin
5′ 3′ 5′ mRNA
Growth cone
Axon shaft
Tubb2b
APC
Rho, Rho, Rho your actin filaments down the signaling stream
The regulation of actin polymerization drives growth cone movement and thus is the
target of many molecular guidance pathways. Rho GTPases regulate the growth of
actin microfilaments. These GTPases can be activated or repressed by receptors bind-
ing ephrins, netrins, Slit proteins, or semaphorins ( FIGURE 15.26A ). Similarly, the
regulation of tubulin polymerization into microtubules is important because tubulin is
encouraged to polymerize on the side of the growth cone receiving attractant stimuli,
and it is inhibited from polymerizing (indeed, the tubulin is depolymerized and recy-
cled) on the side opposite the attractive stimuli (Vitriol and Zheng 2012).
Adhesion is thought to provide the “clutch” for directional movement. Visualize
actin as being linked to the cell membrane. Now contemplate that the dynamics of
Developmental Biology 11e
Fig. 15.25
Dragonfly Media Group
05/18/16
492 Chapter 15
ROCK
Myosin II Cofilin
adhesion, and membrane turnover, the growth cone mechanically transports the axon
toward its appropriate target.
Axon Guidance
How does the growth cone “know” to traverse numerous potential target cells and
make a specific connection? Harrison (1910) first suggested that the specificity of axonal
growth is due to pioneer nerve fibers, axons that go ahead of other axons and serve
as guides for them.10 This observation simplified but did not solve the problem of how
neurons form appropriate patterns of interconnection. Harrison also noted, however,
that axons must grow on a solid substrate, and he speculated that differences among
embryonic surfaces might allow axons to travel in certain specified directions. The final
connections would occur by complementary interactions on the target cell surface:
That it must be a sort of a surface reaction between each kind of nerve fiber and the
particular structure to be innervated seems clear from the fact that sensory and motor
fibers, though running close together in the same bundle, nevertheless form proper
peripheral connections, the one with the epidermis and the other with the muscle. . . .
The foregoing facts suggest that there may be a certain analogy here with the union of
egg and sperm cell.
Research on the specificity of neuronal connections has focused on three major sys-
tems: (1) motor neurons, whose axons travel from the spinal cord to a specific muscle; (2)
commissural neurons, whose axons must cross the midline plane of the embryo to inner-
vate targets on the opposite side of the central nervous system; and (3) the optic system,
where axons originating in the retina must find their way back into the brain. In all cases,
the specificity of axonal connections unfolds in three steps (Goodman and Shatz 1993):
1. Pathway selection. The axons travel along a route that leads them to a particular
region of the embryo.
2. Target selection. The axons, once they reach the correct area, recognize and bind to
a set of cells with which they may form stable connections.
3. Address selection. The initial patterns are refined such that each axon binds to a
small subset (sometimes only one) of its possible targets.
The first two processes are independent of neuronal activity. The third process involves
interactions between several active neurons and converts the overlapping projections
into a fine-tuned pattern of connections.
We have known since the 1930s that the axons of motor neurons can find their
appropriate muscles even when the neural activity of the axons is blocked. Twitty (who
was Harrison’s student) and his colleagues found that embryos of the newt Taricha
torosa secrete tetrodotoxin (TTX), a toxin that blocks neural transmission in other spe-
cies. By grafting pieces of T. torosa embryos onto embryos of other salamander species,
they were able to paralyze the host embryos for days while development occurred.
Normal neuronal connections were made even though no neural activity could occur.
At about the time that the larvae were ready to feed, the neurotoxin wore off, and the
young salamanders swam and fed normally (Twitty and Johnson 1934; Twitty 1937).
More recent experiments using zebrafish mutants with nonfunctional neurotransmitter
receptors similarly demonstrated that motor neurons can establish their normal pat-
terns of innervation in the absence of neuronal activity (Westerfield et al. 1990). But the
question remains: How are the neurons’ axons instructed where to go?
10
The growth cones of pioneer neurons migrate to their target tissue while embryonic distances
are still short and the intervening embryonic tissue is still relatively uncomplicated. Later in
development, other neurons bind to pioneer neurons and thereby enter the target tissue. Klose
and Bentley (1989) have shown that in some cases, pioneer neurons die after the “follow-up”
neurons reach their destination. Yet if the pioneer neurons are prevented from differentiating,
the other axons do not reach their target tissue.
494 Chapter 15
T7–LS3
Crural Crural
plexus plexus
Axial
Axial
Sartorius Sartorius
Neural Crest Cells and Axonal Specificity 495
VENTRAL
that contains muscle precursor cells). This process is an example of a classic morphogen Limb
(FGFs) also functioning to directly guide axons in a manner that is classically attributed bud
to guidance molecules. We will revisit this point again later in this chapter. In summary,
motor neurons seek their targets through intrinsic “programs” that assign different
motor neurons different cell surface molecules that determine the responsiveness of the
axon growth cones to guidance cues in their path and on their targets.
thus causing them to turn (FIGURE 15.30; Kolodkin et al. 1992, 1993). In Drosophila,
semaphorin-2 is secreted by a single large thoracic muscle. In this way, the thoracic mus- Ventral nerve cord
cle prevents itself from being innervated by inappropriate axons (Matthes et al. 1995).
The proteins of the semaphorin-3 family, also known as collapsins, are found in
mammals and birds. These secreted proteins collapse the growth cones of axons origi-
nating in the dorsal root ganglia (Luo et al. 1993). There are several types of neurons in
the dorsal root ganglia whose axons enter the dorsal spinal cord. Most of these axons
are prevented from traveling farther and entering the ventral spinal cord; however, a
subset of them does travel ventrally through the other neural cells ( FIGURE 15.31).
These particular axons are not inhibited by semaphorin-3, whereas those of the other
neurons are (Messersmith et al. 1995). This finding suggests that semaphorin-3 pat-
terns sensory projections from the dorsal root ganglia by selectively repelling certain
axons so that they terminate dorsally. A similar scheme is seen in the brain, where
semaphorin made in one region of the brain prevents the entry of neurons that origi-
nated in another region (Marín et al. 2001).
(A)
Dorsal root FIGURE 15.31 Semaphorin-3 as a selective inhibitor of axonal pro-
ganglion jections into the ventral spinal cord. (A) Trajectory of axons in relation
Gilbert
to semaphorin-3 expression in the spinal cord of a 14-day embryonic
Developmental
rat. Neurons Biology
that are 11e, Sinauer
responsive Associates 3 (NT3) can travel
to neurotrophin
DevBio11e_15.30 Date 05-06-16
to the ventral region of the spinal cord, but the afferent axons for the
NT3-responsive mechanoreceptors and for temperature and pain receptor neurons
neurons terminate dorsally. (B) Transgenic chick fibroblast cells that secrete
Afferent to low- semaphorin-3 inhibit the outgrowth of mechanoreceptor axons.
threshold These axons are growing in medium treated with nerve growth factor
mechanoreceptors (NGF), which stimulates their growth, but they are still inhibited from
growing toward the source of semaphorin-3. (C) Neurons that are
Temperature and responsive to NT3 for growth are not inhibited from extending toward
pain receptors
the source of semaphorin-3 when grown with NT3. (A after Marx
1995; B,C from Messersmith et al. 1995, courtesy of A. Kolodkin.)
(B) (C)
Semaphorin-3-
secreting cells
Semaphorin-3-
secreting cells
Mechanoreceptor NT3-responsive
neurons neurons
498 Chapter 15
netrin In 1994, Serafini and colleagues developed an assay that allowed them to screen
for the presence of a presumptive diffusible molecule that might be guiding the commis-
sural neurons. When dorsal spinal cord explants from chick embryos were explanted onto
collagen gels, the presence of floor plate cells near them promoted the outgrowth of com-
missural axons. Serafini and colleagues took fractions of embryonic chick brain homog-
enate and tested them to see if any of the proteins therein mimicked explant activity. This
FIGURE 15.32 Trajectory of commis- research resulted in the identification of two proteins, netrin-1 and netrin-2. Like Shh,
sural axons in the rat spinal cord. (A)
Schematic drawing of a model wherein
commissural neurons first experience a
gradient of Sonic hedgehog and netrin-2 (A) (B)
and then a steeper gradient of netrin-1.
The commissural axons are chemotacti-
cally guided ventrally down the lateral Netrin-2 gradient;
margin of the spinal cord toward the floor Shh gradient Neural
plate. Upon reaching the floor plate, con- tube
tact guidance from the floor plate cells
causes the axons to change direction. (B)
Commissural
Autoradiographic localization of netrin-1 neuron
mRNA by in situ hybridization of anti-
sense RNA to the hindbrain of a young
rat embryo. netrin-1 mRNA (dark area) is
concentrated in the floor plate neurons. Netrin-1 gradient Floor plate
(B from Kennedy et al. 1994, courtesy of
M. Tessier-Lavigne.) Floor plate
Neural Crest Cells and Axonal Specificity 499
netrin-1 is made by and secreted from the floor plate cells, whereas C. elegans
netrin-2 is synthesized in the lower region of the spinal cord but not
in the floor plate (see Figure 15.32B). It is possible that the commis-
sural neurons first encounter a gradient of netrin-2 and Shh, which
brings them into the domain of the steeper netrin-1 gradient. The
netrins are recognized by the receptors DCC and DSCAM, which are
(A) (B)
found in commissural axon growth cones (Liu et al. 2009).
Although they are soluble molecules, both netrins become asso- Wild-
ciated with the extracellular matrix.11 Such associations can play type unc-6 –
Sensory
important roles and may change the effect of netrin from attrac- neuron
tive to repulsive, as seen in Xenopus retinal neurons (Höpker et al.
1999). The structures of the netrin proteins have numerous regions
of homology with UNC-6, a protein implicated in directing the
Ventral body wall Motor
migration of axons around the body wall of C. elegans. In the wild- epidermoblasts neuron
type nematode, UNC-6 induces axons from certain centrally located
sensory neurons to move ventrally while inducing ventrally placed (C) (D)
motor neurons to extend axons dorsally. In unc-6 loss-of-function
mutations, neither of these migrations occurs (Hedgecock et al.
unc-5 – unc-40 –
1990; Ishii et al. 1992; Hamelin et al. 1993). Mutations of the unc-
40 gene disrupt ventral (but not dorsal) axon migration, whereas
mutations of the unc-5 gene prevent only dorsal migration (FIGURE
15.33). Genetic and biochemical evidence suggests that UNC-5
and UNC-40 are portions of the UNC-6 receptor complex, and that
UNC-5 can convert a UNC-40-mediated attraction into a repulsion
FIGURE 15.33 UNC expression and function in axonal guid-
(Leonardo et al. 1997; Hong et al. 1999; Chang et al. 2004).
ance. (A) In the body of the wild-type C. elegans embryo, sen-
There is reciprocity in science. Just as research on vertebrate sory neurons project ventrally, and motor neurons project dor-
netrin genes led to the discovery of their C. elegans homologues, sally. The ventral body wall epidermoblasts expressing UNC-6
research on the nematode unc-5 gene led to the discovery of the are darkly shaded. (B) In the unc-6 mutant embryo, neither of
gene encoding the mammalian netrin receptor. This gene turns these migrations occurs. (C) The unc-5 loss-of-function muta-
out to be one whose mutation in mice causes a disease called ros- tion affects only the dorsal movements of the motor neurons.
(D) The unc-40 loss-of-function mutation affects only the ventral
tral cerebellar malformation (Ackerman et al. 1997; Leonardo et al.
migration of the sensory growth cones. (After Goodman 1994.)
1997). Similarly, the “netrin DCC” receptor received its name from
analysis of mutated genes associated with cancer and garnered its
acronym from “deleted in colorectal cancer.”
Recently, Vegf has been identified as a third midline attractant Gilbert
that cooperates with Shh and Netrin to guide commissural axons Developmental Biology 11e, Sinauer Associates
ventromedially to the floor plate. Moreover, in vitro studies indicate that DevBio11e_15.33
all three of Date 05-06-16
Developing Questions
these attractants may be involved in signaling Src family kinases (SFKs) to mediate
You have learned that
growth cone responses (Li et al. 2004; Meriane et al. 2004; Yam et al. 2009; Ruiz de
Shh is in part responsible
Almodovar et al. 2011). It will be exciting to see if future in vivo studies reveal possible for attracting commissural
spatiotemporal roles for SFKs in the midline crossing of commissural axons. axons to the floor plate.
What about other classical
slit and robo It seems that to cross the midline and grow away from it on the morphogen signals? Can
contralateral side (opposite to the side of the CNS in which the soma is residing), repul- BMPs from the dorsal neural
sive cues are needed as a driving force. One important chemorepulsive group of mol- tube affect dorsoventral
pathfinding, or can Wnts
ecules is the Slit proteins, which are expressed and secreted by midline cells (recently
expressed in an anterior-
to-posterior gradient in the
11
Nature does not necessarily conform to the categories we humans create. The binding of a neural tube influence longi-
soluble factor to the extracellular matrix makes for an interesting ambiguity between chemotaxis tudinal axon guidance?
(movement toward a specific chemical substance) and haptotaxis (migration along a preferred
substrate). There is also some confusion between the terms neurotropic and neurotrophic. Neu-
rotropic (Latin, tropicus, “a turning movement”) means that something attracts the neuron.
Neurotrophic (Greek, trophikos, “nursing” or “nourishing”) refers to a factor’s ability to keep the
neuron alive, usually by supplying growth factors. Because many agents have both properties,
they are alternatively called neurotropins and neurotrophins. In the recent literature, neurotrophin
appears to be more widely used.
500 Chapter 15
(A) Slit protein (B) Robo protein reviewed in Neuhaus-Follini and Bashaw 2015; Martinez and Tran
2015). In Drosophila, Slit is secreted by the glial cells at the midline
of the nerve cord, and it acts to prevent most axons from crossing
the midline from either side. Roundabout (Robo) proteins (Robo112 ,
Robo2, and Robo3) are the receptors for Slit (Rothberg et al. 1990;
Kidd et al. 1998; Kidd et al. 1999). In Drosophila, Robo receptors in
the growth cones of pathfinding neurons function to prevent migra-
tion across the midline and, depending on the different combina-
tions of expressed Robo receptors, instruct the lateral positioning
of longitudinal tracts13 relative to the midline (Rajagopalan et al.
2000; Simpson et al. 2000; Bhat 2005; Spitzweck et al. 2010). Loss of
Slit or the combined loss of Robo1 and Robo2 results in a failure of
proper axon crossing of the midline such that the axons grow to the
midline and then cross, re-cross, and continue to extend in parallel
(C) Wild-type (D) Slit –/– along the midline ( FIGURE 15.34 ). These and other results have
led to a model in which the commissural neurons that cross from
one side of the midline to the other temporarily avoid this repulsion
by downregulating Robo1/2 proteins as they approach the midline.
Once the growth cone is across the middle of the embryo, the neu-
rons re-express Robos at the growth cone and once again become
sensitive to the midline inhibitory actions of Slit (Brose et al. 1999;
Kidd et al. 1999; Orgogozo et al. 2004).
In Drosophila, this mechanistic change in responsiveness is con-
trolled by an endosomal protein called Commissureless (Comm),
which is expressed only in precrossing axons and functions to
misroute Robo proteins to the lysosome instead of permitting their
expression at the membrane. In Drosophila, this endosomal traffick-
ing mechanism for protein enables a faster change in the respon-
FIGURE 15.34 Robo/Slit regulation of midline crossing by siveness of midline-crossing commissural axons than would be pos-
neurons. Robo and Slit in the Drosophila central nervous sys-
sible through regulation of robo gene expression ( FIGURE 15.35 ;
tem. (A) Antibody staining reveals Slit protein in the midline glial
cells. (B) Robo protein appears along the neurons of the lon- Keleman et al. 2002; 2005; Yang et al. 2009).
gitudinal tracts of the CNS axon scaffold. (C) Wild-type CNS Vertebrates also use Slit and Robo signaling for midline repul-
axon scaffold shows the ladderlike arrangement of neurons sion, but the switch in growth cone responsiveness between pre-
crossing the midline. (D) Staining of the CNS axon scaffold and postcrossing axons is somewhat different. In vertebrates there
with antibodies to all CNS neurons in a Slit loss-of-function are several Slit (1–3) and Robo (1–4) proteins with Robo3 having
mutant shows axons entering but failing to leave the midline two isoforms, Robo3.1 and Robo3.2, which are expressed in pre- and
(instead of running alongside it). (From Kidd et al. 1999, cour-
postcrossing commissural axons, respectively (Mambetisaeva et al.
tesy of C. S. Goodman.)
2005). As neurons extend axons toward the midline, those axons
destined to remain ipsilateral (i.e., same side of the CNS on which
the soma resides) are expressing Robo1 and Robo2, so they are repelled from crossing
the midline by Slit (see Figure 15.38). Axons expressing Robo3.1, however, are able to
cross the midline. Although the precise mechanism is unclear, Robo3.1 is suggested to
actively promote midline crossing, since knockdown of Robo3.1 results in the failure of
commissural axons to cross the midline. Once the commissural neuron’s growth cone
has crossed the midline, it downregulates Robo3.1 and upregulates Robo1, 2, and 3.2,
Gilbert
Developmental Biology 11e, Sinauer Associates which prevents the growth cone from re-crossing the midline and allows the full force of
DevBio11e_15.34 Date 05-06-16 Slit to act as a chemorepellent, thus forcing the growth cone away from the midline (see
Figure 15.35, mouse; Long et al. 2004; Sabatier et al. 2004; Woods 2004; Chen et al. 2008).
In addition to the downregulation of Robo3.1, the change in growth cone respon-
siveness at the midline is reinforced by altering how the neuron interprets gradients
12
Although historically Roundabout1 in Drosophila has been referred to simply as Robo
(without the number 1), to avoid confusion we call it Robo1 throughout this text.
13
Axon pathways in the central nervous system are called tracts, while axon pathways in the
peripheral nervous system are called nerves.
Midline
Drosophila
Precrossing Comm Net movement
Netrin away from midline
Robo 1/2
Secretory vesicle
Comm
Mouse
Shh
Precrossing Ptc
Boc
Smo Net movement
away from midline
14-3-3 Net movement
Attraction SFK DCC Netrin to midline
robo3
Repulsion R1/2 Netrin Shh
Slit
R3.1 Ptc Smo
Sequesterd
slit R3.1
Boc
Slit PKA
Shh Robo 1/2/3.2
Postcrossing
Ptc
Boc Repulsion
Smo
PKA
14-3-3
14-3-3 DCC Netrin
robo3 Repulsion
R3.2 R1/2 Slit
R3.2
R3.2
Slit
FIGURE 15.35 Model of axon guidance of commissural neurons signaling through the Netrin receptor Frazzled triggers the downregu-
crossing the midline in the fly and the mouse. Illustration shows a lation of Comm. Robo is then returned to the growth cone, and Slit-
single commissural neuron residing in the left hemisphere of the fly mediated repulsion ensues so that the axon will not recross. In verte-
ventral nerve cord (top) or mouse neural tube (bottom). Slit-Robo sig- brates, Robo1/2 (R1/2) receptors are capable of inhibiting Netrin-DCC
naling mediates repulsion. Netrin and Shh elicit attraction to the mid- binding; therefore, in precrossing axons, this repression and Slit-Robo
line in precrossing commissural axons through their Frazzled/DCC repulsion in general needs to be attenuated. The Robo3.1 (R3.1) iso-
and the Ptc-Boc-Smo receptor complex, respectively. In postcrossing form may function to inhibit Robo1/2, thus permitting Netrin-mediated
axons, 14-3-3 protein becomes upregulated, which shifts the respon- attraction. Moreover, Robo3.1 may also competitively sequester Slit,
siveness to Shh by influencing PKA downstream of Shh signaling. In with no direct downstream guidance outcome, which would serve to
Developmental
flies, precrossingBiology
axons11e
are essentially blind to Slit repulsive cues due reduce available Slit to bind Robo1/2. In postcrossing axons, however,
Fig. 15.35
to the redirecting of Robo receptors to the lysosome by Commissure- the Robo3.2 (R3.2) isoform is upregulated, and the 3.1 isoform is lost.
Dragonfly
less (Comm) Media Group
for degradation. Once at the midline, however, increased Robo3.2 seems to function similarly as a canonical Slit repellent.
05/27/16
502 Chapter 15
Developing Questions of Shh. Postcrossing axons upregulate 14-3-3 proteins that function through protein
kinase A (PKA) to alter the growth cone’s interpretation of the Shh from attractive to
How is the alternative repulsive (see Figure 15.35; Yam et al. 2012). Therefore, the precise spatial and temporal
splicing of Robo3
regulation of Slit-Robo and Shh signaling in pre- and postcrossing axons enables com-
temporally regulated
during midline crossing? missure formation. Mutations in the human ROBO3 gene disrupt the normal crossing
Moreover, how are Robo3.1 of axons from one side of the brain’s medulla to the other (Jen et al. 2004). Among other
and Robo3.2 functioning to problems, people with this mutation are unable to coordinate their eye movements.
mediate midline attraction
and then repulsion? Scientists Speak 15.4 Dr. Marc Tessier-Lavigne talks about the original identifi-
cation of Sonic hedgehog as a midline attractant in the mouse spinal cord.
WEb Topic 15.5 The early evidence for chemotaxis Before molecular tech-
niques, investigators used transplantation experiments and ingenuity to reveal evidence
that chemotactic molecules were being released by target tissues.
intraretinal guidance The adhesion and growth of retinal ganglion axons along
the inner surface of the retina may be governed by the retina’s laminin-containing basal
lamina. The embryonic lens and the periphery of the retina secrete inhibitory factors
(probably chondroitin sulfate proteoglycans) that repel the RGC axons, preventing them
from traveling in the wrong direction (FIGURE 15.36; Hynes and Lander 1992; Ohta et
al. 1999). NCAM may also be especially important here because the directional migra-
tion of the retinal ganglion growth cones depends on the N-CAM-expressing glial
endfeet at the inner retinal surface (Stier and Schlosshauer 1995). In the mouse retina,
RGCs express Robo1 and Robo2 receptors, and Slits are expressed in both the gan-
glion layer and lens epithelium. Functional analysis of Slit and Robo during intraretinal
pathfinding of RGC axons suggests that Slits and Robo2 play a role in repelling RGC
Neural Crest Cells and Axonal Specificity 503
Eph B1 Optic
Retinal disc
Lens ganglion
cell
Sema-3A Chiasm Chondroitin sulfate
Slit
Retina DCC, Robo2
Optic Zic2, Eph B1
Ephrin-B2 tract
Optic Netrin
Chiasm nerve Semaphorins
Netrin Optic nerve Ephrin B2
(NCAM/L1 Slit1/2 (Slit2/3 in fish)
fasciculated)
Developing Questions in the retina, Robo2 appears to be the major mediator of RGC guidance at the ventral
forebrain where the optic chiasm is forming (see Figure 15.36B).
It appears that RGC In fish, all RGC axons cross at the optic chiasm to the contralateral side, but in mam-
axons contact astroglia
mals, some portion of RGC axons remain on the ipsilateral side. It appears that those
throughout much of their
journey. What is the axons not destined to cross to the opposite side of the brain are repulsed from doing
significance of this neuron- so when they enter the optic chiasm (Godement et al. 1990). This repulsion appears to
glial interaction, and what be influenced by the synthesis of ephrin and Shh in the cells occupying the chiasm.
specific molecules are These midline cues are interpreted by the receptors Eph and Boc that are uniquely
important in facilitating this expressed on ipsilaterally projecting RGCs (Cheng et al. 1995; Marcus et al. 2000; Fabre
interaction? et al. 2010).
In the mouse eye, the Eph B1 receptor is expressed on those temporal axons that
are repelled by the optic chiasm’s ephrin B2, and those axons project to the side of the
tectum on the same side as their eye; Eph B1 is nearly absent on axons that are allowed
to cross over. Mice lacking the Eph B1 gene show hardly any ipsilateral projections. This
pattern of Eph B1 expression appears to be regulated by the Zic2 transcription factor
found in those retinal axons that do form ipsilateral projections (Herrera et al. 2003;
Williams et al. 2003; Pak et al. 2004). In addition, loss of the alternative Shh receptor
Boc results in the aberrant contralateral pathfinding of specific temporal RGCs that
typically remain on the ipsilateral side. Furthermore, ectopic expression of Boc in typi-
cally contralateral axons will cause them to now project ipsilaterally (Fabre et al. 2010).
These results suggest that both Eph B1/ephrin B2 and Boc/Shh are the major regulators
of the decision to cross or not to cross the forebrain midline.
Ephrin appears to play a similar role in the retinotectal mapping in the frog. In the
developing frog, the ventral axons express the Eph B receptor, whereas the dorsal axons
do not. Before metamorphosis, both axons cross the optic chiasm. When the frog’s ner-
vous system is being remodeled during metamorphosis, however, the chiasm expresses
ephrin B, which causes a subpopulation of ventral cells to be repulsed and project to
the same side rather than cross the chiasm (Mann et al. 2002). This arrangement allows
the frog to have binocular vision, which is very good if one is trying to catch flies with
one’s tongue.
Chemotactic proteins
endothelins Some neurons in the superior cervical ganglia (the largest ganglia in
the neck) go toward the carotid artery, whereas other neurons from these same ganglia
do not. It appears that those axons extending from the superior cervical ganglia to the
carotid artery follow blood vessels that also lead there. These blood vessels secrete small
peptides called endothelins. In addition to their adult roles constricting blood vessels,
14
As is seen throughout developmental biology, the metaphor of a “target” is problematic. Here,
the target is not a passive entity, but an importantly active one.
Neural Crest Cells and Axonal Specificity 505
endothelins appear to have an embryonic role, as they are able to direct the migration
of certain neural crest cells (such as those entering the gut) and of certain sympathetic
axons that have endothelin receptors on their membranes (Makita et al. 2008).
WEb Topic 15.6 BMP4 and trigeminal ganglion neurons Axon bundles from
neurons in the trigeminal ganglion innervate the eye regions and the upper and lower
jaws. BMP4 from their target organs guides these axons.
Medial
C C
Tecta
M M
Lateral L
L
ds
Rostral an
(anterior) R R lig
rin
Eph
Optic tract
rs
M. Wilson; B after Holt 2002, courtesy of C. Holt.) ept
Eph rec
Visual image
the retina stimulates cells on the lateral surface of the tectum. Similarly, light focused
on the temporal (posterior) part of the retina stimulates cells in the caudal portion of
the tectum. These studies demonstrate a point-for-point correspondence between the
cells of the retina and the cells of the tectum. When a group of retinal cells is activated, a
very small and specific group of tectal cells is stimulated. Furthermore, the points form a
continuum; in other words, adjacent points on the retina project onto adjacent points on
the tectum. This arrangement enables the frog to see an unbroken image. This intricate
specificity caused Sperry (1965) to put forward the chemoaffinity hypothesis:
The complicated nerve fiber circuits of the brain grow, assemble, and organize
themselves through the use of intricate chemical codes under genetic control. Early in
development, the nerve cells, numbering in the millions, acquire and retain thereafter,
individual identification tags, chemical in nature, by which they can be distinguished
and recognized from one another.
Current theories do not propose a point-for-point specificity between each axon and the
neuron that it contacts. Rather, evidence now demonstrates that gradients of adhesiv-
ity (especially those involving repulsion) play a role in defining the territories that the
axons enter, and that activity-driven competition between these neurons determines
the final connection of each axon.
Gilbert
Developmental Biology 11e, Sinauer
AdhesiveAssociates
specificities in different regions of the optic tectum:
DevBio11e_15.38 Date 05-06-16
Ephrins and Ephs
There is good evidence that retinal ganglion cells can distinguish between regions of
the optic tectum. Cells taken from the ventral half of the chick neural retina preferen-
tially adhere to dorsal (medial) halves of the tectum and vice versa (Gottlieb et al. 1976;
Roth and Marchase 1976; Halfter et al. 1981). Retinal ganglion cells are specified along
Neural Crest Cells and Axonal Specificity 507
the dorsal-ventral axis by a gradient of transcription factors. Dorsal retinal cells are
characterized by high concentrations of Tbx5 transcription factor, whereas ventral cells
have high levels of Pax2. These transcription factors are induced by paracrine factors
(BMP4 and retinoic acid, respectively) from nearby tissues (Koshiba-Takeuchi et al.
2000). Misexpression of Tbx5 in the early chick retina results in marked abnormalities
of the retinotectal projection. Therefore, the retinal ganglion cells are specified accord-
ing to their location.
One gradient that has been identified and functionally characterized is a gradient of
repulsion, which is highest in the posterior tectum and weakest in the anterior tectum.
Bonhoeffer and colleagues (Walter et al. 1987; Baier and Bonhoeffer 1992) prepared a
“carpet” of tectal membranes with alternating “stripes” of membrane derived from the
posterior and the anterior tecta. They then let cells from the nasal (anterior) or temporal
(posterior) regions of the retina extend axons into the carpet. The nasal ganglion cells
extended axons equally well on both the anterior and posterior tectal membranes. The
neurons from the temporal side of the retina, however, extended axons only on the
anterior tectal membranes. When the growth cone of a temporal retinal ganglion axon
contacted a posterior tectal cell membrane, the growth cone’s filopodia withdrew, and FIGURE 15.39 Differential retino-
the cone collapsed and retracted (Cox et al. 1990). tectal adhesion is guided by gradients
The basis for this specificity appears to be two sets of gradients along the tectum and of Eph receptors and their ligands. (A)
retina. The first gradient set consists of ephrin proteins and their receptors. In the optic Representation of the dual gradients
of Eph receptor tyrosine kinase in
tectum, ephrin proteins (especially ephrins
the retina and its ligands (ephrin A2
A2 and A5) are found in gradients that are
and A5) in the tectum. (B) Experiment
highest in the posterior (caudal) tectum and (A) Nasal showing that temporal, but not nasal,
decline anteriorly (rostrally) (FIGURE 15.39A). retinal ganglion axons respond to
Eye
Moreover, cloned ephrin proteins have the a gradient of ephrin ligand in tectal
ability to repulse axons, and ectopically membranes by turning away or slow-
expressed ephrin will prohibit axons from Brain ing down. An equilibrium of attractive
and repulsive forces inherent in the
the temporal (but not from the nasal) regions
gradient may lead specific axons to
of the retina from projecting to where it is
their targets. (After Barinaga 1995;
expressed (Drescher et al. 1995; Nakamoto et Temporal Temporal Hansen et al. 2004.)
al. 1996). The complementary Eph receptors Tectum
have been found on chick retinal ganglion
cells, expressed in a temporal-to-nasal gradi- Eph (receptor Ephrins
ent along the retinal ganglion axons (Cheng tyrosine kinase) (ligands)
et al. 1995). This gradient appears to be due to
a spatially and temporally regulated expres-
sion of retinoic acid (Sen et al. 2005).
Retina
Ephrins appear to be remarkably pli-
able molecules. Concentration differences Nasal Temporal
in ephrin A in the tectum can account for
the smooth topographic map (wherein the Anterior Posterior
position of neurons in the retina maps con- Tectum
tinuously onto the targets). Hansen and col- (B) Gradient of ephrin
leagues (2004) have shown that ephrin A can in tectal membranes
be an attractive as well as a repulsive signal Temporal retina Nasal retina
for retinal axons. Moreover, their quantita-
tive assay for axon growth showed that the
origin of the axon determined whether it
was attracted or repulsed by ephrins. Axon
growth is promoted by low ephrin A con-
centrations that are anterior to the proper
target and is inhibited by higher concentra- Attraction Repulsion Attraction Repulsion
tions posterior to the correct target (FIGURE Equilibrium Equilibrium
15.39B). Each axon is thus led to the appro- (target) (target)
priate place and then told to go no farther. At
508 Chapter 15
that equilibrium point, there would be no growth and no inhibition, and the synapses
with the target tectal neurons could be made.
The second set of gradients parallels the ephrins and Ephs. The tectum has a gradi-
ent of Wnt3 that is highest at the medial region and lowest laterally (like the ephrin
gradient). In the retina, a gradient of Wnt receptor is highest ventrally (like the Eph
proteins). The two sets of gradients are both required to specify the coordinates of axon-
to-tectum targets (Schmitt et al. 2006).
Synapse Formation
When an axon contacts its target (usually either a muscle cell or another neuron), it
forms a specialized junction called a synapse. The axon terminal of the presynaptic
neuron (i.e., the neuron transmitting the signal) releases chemical neurotransmitters
that depolarize or hyperpolarize the membrane of the target cell (the postsynaptic
cell). The neurotransmitters are released into the synaptic cleft between the two cells,
where they bind to receptors in the target cell.
The construction of a synapse involves several steps (Burden 1998). When motor
neurons in the spinal cord extend axons to muscles, the growth cones that contact newly
formed muscle cells migrate over their surfaces. When a growth cone first adheres to
(A) Growth cone contacts myotube (B) Neural agrin induces ACh (C) Synaptic basal lamina forms
receptors to cluster
Extracellular Neurotransmitter
Myotube matrix vesicles
Agrin β2
laminin
ACh
receptors
(F)
(D) (E) Sheathing by
Schwann cells
Axons
In maturity
Myotube
Muscle Neuromuscular
fiber junction
AT
Schwann cells
Neural Crest Cells and Axonal Specificity 509
the cell membrane of a muscle fiber, no specializations can be seen in either membrane. Developing Questions
However, the axon terminal soon begins to accumulate neurotransmitter-containing
synaptic vesicles, the membranes of both cells thicken at the region of contact, and the There is significant synaptic
plasticity in the brain over
synaptic cleft between the cells fills with an extracellular matrix that includes a specific
one’s life, and problems
form of laminin (FIGURE 15.40A–C ). This muscle-derived laminin specifically binds with forming new synapses
the growth cones of motor neurons and may act as a “stop signal” for axonal growth may underlie many dis-
(Martin et al. 1995; Noakes et al. 1995). In at least some neuron-to-neuron synapses, orders such as autism
the synapse is stabilized by N-cadherin. The activity of the synapse releases N-cadherin spectrum disorder. What
from storage vesicles in the growth cone (Tanaka et al. 2000). role do the guidance and
In muscles, after the first axon makes contact, growth cones from other axons con- target-specifying cues play
in synapse remodeling
verge at the site to form additional synapses. During mammalian development, all
later in life?
muscles that have been studied are innervated by at least two axons. This polyneuronal
innervation is transient, however; soon after birth, all but one of the axon branches
are retracted (FIGURE 15.40D–F ). This “address selection” is based on competition
between the axons (Purves and Lichtman 1980; Thompson 1983; Colman et al. 1997).
When one of the motor neurons is active, it suppresses the synapses of the other neu-
rons, possibly through a nitric oxide-dependent mechanism (Dan and Poo 1992; Wang
et al. 1995). Eventually, the less active synapses are eliminated. The remaining axon
terminal expands and is ensheathed by a Schwann cell (see Figure 15.40E).
FIGURE 15.40 Differentiation of a motor neuron synapse with a muscle in mammals. (A) A
growth cone approaches a developing muscle cell. (B) The axon stops and forms an unspe-
cialized contact on the muscle surface. Agrin, a protein released by the neuron, causes acetyl-
choline (ACh) receptors to cluster near the axon. (C) Neurotransmitter vesicles enter the axon
terminal (AT), and an extracellular matrix connects the axon terminal to the muscle cell as the
synapse widens. This matrix contains a nerve-specific laminin. (D) Other axons converge on
the same synaptic site. The wider view (below) shows muscle innervation by several axons
(seen in mammals at birth). (E) All but one of the axons are eliminated. The remaining axon can
branch to form a complex neuromuscular junction with the muscle fiber. Each axon terminal
is sheathed by a Schwann cell process, and folds form in the muscle cell membrane. The
overview shows muscle innervation several weeks after birth. (F) Whole mount view of mature
neuromuscular junction in a mouse. (A–E after Hall and Sanes 1993, Purves 1994, Hall 1995, F
courtesy of M. A. Ruegg.)
510 Chapter 15
(Indeed, the mass of cells we lose each year through normal cell death is close to our
entire body weight!) During embryonic development, we were constantly making and
destroying cells, and we generated about three times as many neurons as we eventually
ended up with when we were born. Lewis Thomas (1992) wisely noted:
By the time I was born, more of me had died than survived. It was no wonder I cannot
remember; during that time I went through brain after brain for nine months, finally
contriving the one model that could be human, equipped for language.
Apoptosis is necessary not only for the proper spacing and orientation of neurons,
but also for generating the middle ear space, the vaginal opening in females, and the
spaces between our fingers and toes (Saunders and Fallon 1966; Rodriguez et al. 1997;
Roberts and Miller 1998). Apoptosis prunes unneeded structures (e.g., frog tails, male
mammary tissue), controls the number of cells in particular tissues (neurons in verte-
brates and flies), and sculpts complex organs (palate, retina, digits, heart).
The pathways for apoptosis were delineated primarily through
(A) C. elegans (B) Mammalian neurons genetic studies of C. elegans. Indeed, the importance of these
pathways was recognized by awarding a Nobel Prize in Physi-
ology or Medicine to Sydney Brenner, H. Robert Horvitz, and
John E. Sulston in 2002. Through these studies, it was found that
the proteins encoded by the ced-3 and ced-4 genes were essential
for apoptosis and that, in the cells that did not undergo apopto-
EGL–1 Bcl-2
Bik sis, those genes were turned off by the product of the ced-9 gene
Intracellular (FIGURE 15.41A ; Hengartner et al. 1992). The CED-4 protein is
Bax
membrane a protease-activating factor that activates the gene for CED-3,
CED–9 a protease that initiates destruction of the cell. CED-9 can bind
to and inactivate CED-4. Mutations that inactivate the gene for
CED-9 cause numerous cells that would normally survive to acti-
vate their ced-3 and ced-4 genes and die, leading to the death of
CED–4 Apaf1 the entire embryo. Conversely, gain-of-function mutations in the
ced-9 gene cause its protein to be made in cells that would nor-
mally die, resulting in those cells surviving. Thus, the ced-9 gene
CED–3 Caspase–9 appears to be a binary switch that regulates the choice between
life and death on the cellular level. It is possible that every cell in
the nematode embryo is poised to die, with those cells that sur-
Caspase–3 vive being rescued by the activation of the ced-9 gene.
Apoptosis Apoptosis FIGURE 15.41 The loss of apoptosis can disrupt normal brain
development. (A) In C. elegans, the CED-4 protein is a protease-
(C) caspase-9 +/+ (wild-type) (D) caspase-9 –/– (knockout) activating factor that can activate CED-3. The CED-3 protease initiates
the cell destruction events. CED-9 can inhibit CED-4 (and CED-9 can
be inhibited upstream by EGL-1). (B) A similar pathway exists in mam-
mals and appears to function in a similar manner. In this hypothetical
scheme for the regulation of apoptosis in mammalian neurons, Bcl-XL
(a member of the Bcl-2 family) binds Apaf1 and prevents it from acti-
vating the precursor of caspase-9. The signal for apoptosis allows
another protein (here, Bik) to inhibit the binding of Apaf1 to Bcl-XL.
Apaf1 is now able to bind to the caspase-9 precursor and cleave it.
Caspase-9 dimerizes and activates caspase-3, initiating apoptosis.
The same colors are used to represent homologous proteins. (C,D) In
mice in which the genes for caspase-9 have been knocked out, nor-
mal neural apoptosis fails to occur, and the overproliferation of brain
neurons is obvious. (C) A 6-day embryonic wild-type mouse.
(D) A caspase-9 knockout mouse of the same age. The enlarged brain
protrudes above the face, and the limbs are still webbed. (A,B after
Adams and Cory 1998; C,D from Kuida et al. 1998.)
Neural Crest Cells and Axonal Specificity 511
The CED-3 and CED-4 proteins are at the center of the apoptosis pathway that is
common to all animals studied. The trigger for apoptosis can be a developmental cue
such as a particular molecule (e.g., BMP4 or glucocorticoids), the loss of adhesion to a
matrix, or the lack of sufficient neurotrophic signals. Either type of cue can activate
CED-3 or CED-4 proteins or inactivate CED-9 molecules. In mammals, the homo-
logues of the CED-9 protein are members of the Bcl-2 family (which includes Bcl-2,
Bcl-X, and similar proteins; FIGURE 15.41B). The functional similarities are so strong
that if an active human BCL-2 gene is placed in C. elegans embryos, it prevents normally
occurring cell death (Vaux et al. 1992).
The mammalian homologue of CED-4 is Apaf1 (apoptotic protease activating fac-
tor 1). Apaf1 participates in the cytochrome c-dependent activation of the mammalian
CED-3 homologues, the proteases caspase-9 and caspase-3 (see Figure 15.41; Shaham
and Horvitz 1996; Cecconi et al. 1998; Yoshida et al. 1998). Activation of the caspase
proteins results in a cascade of autodigestion—caspases are strong proteases that digest
the cell from within, cleaving cellular proteins and fragmenting DNA.
Although apoptosis-deficient nematodes (i.e., worms deficient for CED-4) are viable
despite having 15% more cells than wild-type worms, mice with loss-of-function muta-
tions for either caspase-3 or caspase-9 die around the time of birth from massive cell
overgrowth in the nervous system (FIGURE 15.41C,D ; Jacobson et al. 1997; Kuida et
al. 1996, 1998). Similarly, mice homozygous for targeted deletions of Apaf1 have severe
craniofacial abnormalities, brain overgrowth, and webbing between their toes.
WEb Topic 15.7 The uses of apoptosis Apoptosis is used for numerous processes
throughout development. This website explores the role of apoptosis in such phenomena
as Drosophila germ cell development and the eyes of blind cave fish.
NF
Proximal
Dorsal nerve
D
V
FIGURE 15.42 Analysis of motor neuron axon stalling and cell death in
Frizzled-3 knockout mice. (A) Whole mount immunocytochemistry for the
protein Neurofilament, which labels all axons in the embryo. A similar whole
mount image in full color is seen on the front cover of this book. (B) Close
Fz3–/–
examination of the axonal projections into the hindlimb are visualized with
the neurofilament antibody (NF), and axons at different depths along the
dorsal to ventral axis of this limb have been pseudocolored differently. Fz3
heterozygous mice show normal dorsal nerve projections, whereas Fz3
homozygous knockout mice exhibit varying degrees of dorsal nerve loss
(two examples shown here). The axon trajectories of the LMCL motor neu-
rons (dorsal nerve) are extracted and shown below each image to empha-
size the reduction of axonal projections distal to the plexus. (C) Transverse
sections of the spinal cord labeled for discrete populations of motor neurons
and any cells undergoing apoptosis, as indicated by Caspase 3 labeling
(green, in right hand photos). Frizzled-3 knockout mice (lower images) show
reductions in the motor neuron specification markers Islet1/2 (red) and Foxp1
(green, in left hand photos), along with increased cell death specifically in the
motor columns. (D) Schematics describe the phenotypes associated with
a loss of Frizzled-3/PCP signaling. First, a stalling defect in motor neurons
destined for the dorsal limb is followed by cell death. ([A–C] from Hua et al.
2013; D from Yung and Goodrich 2013.)
Davies 1990). In contrast, another neurotrophin, BDNF, does not affect sympathetic or
sensory neurons, but it can rescue fetal motor neurons in vivo from normally occurring
cell death and from induced cell death following the removal of their target tissue. The
Developmental Biology 11e results of these in vitro studies have been corroborated by gene knockout experiments
Fig. 15.42
Dragonfly Media Group
05/27/16
Neural Crest Cells and Axonal Specificity 513
(A) Sympathetic (B) Dorsal root (C) Nodose (taste) FIGURE 15.43 Effects of nerve
growth factor (NGF; top row) and brain-
derived neurotrophic factor (BDNF;
bottom row) on axonal outgrowths from
NGF (A) sympathetic ganglia, (B) dorsal root
ganglia, and (C) nodose (taste percep-
tion) ganglia. Although both NGF and
BDNF had a mild stimulatory effect on
dorsal root ganglia axonal outgrowth,
the sympathetic ganglia responded
dramatically to NGF and hardly at all
BDNF to BDNF; the converse was true of the
nodose ganglia. (From Ibáñez et al.
1991.)
in which the deletion of particular neurotrophic factors results in the loss of only certain
subsets of neurons (Crowley et al. 1994; Jones et al. 1994).
Neurotrophic factors are produced continuously in adults, and their loss may pro-
duce debilitating diseases. BDNF is required for the survival of a particular subset of
neurons in the striatum (a region of the brain involved in modulating the intensity of
coordinated muscle activity such as movement, balance, and walking), and enables
these neurons to differentiate and synthesize the receptor for dopamine. BDNF in this
region of the brain is upregulated by huntingtin, a protein that is mutated in Hunting-
ton disease. Patients with Huntington disease have decreased production of BDNF,
which leads to the death of striatal neurons (Guillin et al. 2001; Zuccato et al. 2001). The
result is a series of cognitive abnormalities, involuntary muscle movements, and even-
tual death. Two other neurotrophins—glial-derived neurotrophic factor (GDNF, dis-
cussed earlier in terms of neural crest migration) and conserved dopamine neurotrophic
factor (CDNF)—enhance the survival of the midbrain dopaminergic neurons, whose
destruction characterizes Parkinson disease (Lin et al. 1993; Lindholm et al. 2007).
The midbrain dopaminergic neurons send axons to the cells of the striatum, whose
ability to respond to dopamine signals is dependent on BDNF. Drugs that activate the
neurotrophic factors are being tested for the ability to cure Parkinson and Alzheimer
diseases
Gilbert
(Youdim 2013).
Developmental Biology 11e, Sinauer Associates
DevBio11e_15.43 Date 05-06-16
Next Step Investigation
The field of neurodevelopment has made great strides in axon from one intermediate target to another and then on
identifying many of the essential factors that establish to the final destination. It is currently rare for us to know
neural connectivity. From the key transcription factors the full sequence of guidance mechanisms underlying the
specifying neural cell fates and the axon guidance recep- entire journey of a particular neuron, never mind linking
tors required for target specificity, to the mechanical multiple connections together. With recent advances of live
machinery housed in the growth cone and the secreted cell imaging in vivo, however, studies in this new frontier
guidance cues and survival factors, we are beginning to of visualizing cell-cell dynamics during axon pathfinding
truly understand how a circuit is formed. Scientists are just are poised to solve some of the mysteries of connectivity.
starting to piece circuits together for a systems-level view Go to Eyewire to help connect up a brain (http://eyewire.
of neural development, however. Each neuron sends its org/explore).
514 Chapter 15
15 Snapshot Summary
Neural Crest Cells and Axonal Specificity
1. The neural crest is a transitory structure. Its cells migrate 5. Some neural crest cells appear to be capable of form-
to become numerous different cell types. The path a ing a large repertoire of cell types. Other neural crest
neural crest cell takes depends on the extracellular envi- cells may be restricted even before they migrate. The
ronment it meets. final destination of the neural crest cell can sometimes
• Trunk neural crest cells can migrate dorsolaterally change its specification.
to become melanocytes and dorsal root ganglia 6. The fates of the cranial neural crest cells are influenced
cells. They can also migrate ventrally to become by Hox genes. They can acquire their Hox gene expres-
sympathetic and parasympathetic neurons and sion pattern through interaction with neighboring cells.
adrenomedullary cells.
7. Motor neurons are specified according to their position
• Cranial neural crest cells enter the pharyngeal arches in the neural tube. The Lim family of transcription factors
to become the cartilage of the jaw and the bones plays an important role in this specification before their
of the middle ear. They also form the bones of the axons have even extended into the periphery.
frontonasal process, the papillae of the teeth, and
8. The growth cone is the locomotory organelle of the
cranial nerves.
neuron and rearranges its cytoskeletal architecture in
• Cardiac neural crest cells enter the heart and form
response to environmental cues. Axons can find their
the septum (separating wall) between the pulmonary
targets without neuronal activity.
artery and aorta.
9. Some proteins are generally permissive to neuron adhe-
2. The formation of the neural crest depends on interac-
sion and provide substrates on which axons can migrate.
tions between the prospective epidermis and the neural
Other substances prohibit migration.
plate. Paracrine factors from these regions induce the
formation of transcription factors that enable neural crest 10. Some growth cones recognize molecules that are pres-
cells to emigrate. ent in very specific areas and are guided by these mol-
ecules to their respective targets.
3. Collective migration of neural crest cells is powered by
contact inhibition of locomotion and a co-attraction to 11. Some neurons are “kept in line” by repulsive molecules.
leading cells, which are cellular behaviors mediated by If the neurons wander off the path to their target, these
a combination of low N-cadherin, bipolar Rho-GTPase molecules send them back. Some molecules, such as
activity, and attraction to Sdf1 secretion. the semaphorins and Slits, are selectively repulsive to
particular sets of neurons.
4. Trunk neural crest cells will migrate through the anterior
portion of each sclerotome, but not through the posterior 12. Some neurons sense gradients of a protein and are
portion of a sclerotome. Semaphorin and ephrin proteins brought to their target by following these gradients. The
expressed in the posterior portion of each sclerotome netrins and Shh may work in this fashion.
can prevent neural crest cell migration.
Neural Crest Cells and Axonal Specificity 515
13. Changes in growth cone responsiveness to the secreted 15. Retinal ganglion cells in frogs and chicks send axons
attractive and repulsive cues secreted from the midline that bind to specific regions of the optic tectum. This
enable commissural axons to cross the midline and con- process is mediated by numerous interactions, and tar-
nect to two sides of the central nervous system. get selection appears to be mediated through ephrins.
14. Target selection can be brought about by neurotroph- 16. Synapse formation has an activity-dependent compo-
ins, proteins that are made by the target tissue and that nent. An active neuron can suppress synapse formation
stimulate the particular set of axons able to innervate it. by other neurons on the same target.
In some cases, the target makes only enough of these 17. Lack of synapse formation and neuronal activity can lead
factors to support a single axon. Neurotrophins also play to the induction of programmed cell death or apoptosis,
a role in the apoptosis of many neurons. which unleashes a cascade of caspase enzymes that
result in cell death.
Further Reading
Baggiolini, A. and 10 others. 2015. Premigratory and migra- Sánchez-Arrones, L., F. Nieto-Lopez, C. Sánchez-Camacho, M.
tory neural crest cells are multipotent in vivo. Cell Stem Cell 16: I. Carreres, E. Herrera, A. Okada and P. Bovolenta. 2013. Shh/
314–322. Boc signaling is required for sustained generation of ipsilateral
Bard, L., C. Boscher, M. Lambert, R. M. Mège, D. Choquet and projecting ganglion cells in the mouse retina. J. Neurosci. 33:
O. Thoumine. 2008. A molecular clutch between the actin flow 8596–8607.
and N-cadherin adhesions drives growth cone migration. J. Scarpa, E. and R. Mayor. 2016. Collective cell migration in
Neurosci. 28: 5879–5890. development. J. Cell Biol 212: 143–155.
Cammarata, G. M., E. A. Bearce and L. A. Lowery. 2016. Cyto- Scarpa, E., A. Szabó, A. Bibonne, E. Theveneau, M. Parsons and
skeletal social networking in the growth cone: How +TIPs R. Mayor. 2015. Cadherin switch during EMT in neural crest
mediate microtubule-actin cross-linking to drive axon out- cells leads to contact inhibition of locomotion via repolarization
growth and guidance. Cytoskeleton doi: 10.1002/cm.21272. of forces. Dev. Cell 34: 421–434.
Clay, M. R. and M. C. Halloran. 2014. Cadherin 6 promotes Simões-Costa, M. and M. E. Bronner. 2015. Establishing neu-
neural crest cell detachment via F-actin regulation and influ- ral crest identity: A gene regulatory recipe. Development 142:
ences active Rho distribution during epithelial-to-mesenchy- 242–257.
mal transition. Development 141: 2506–2515. Simpson, J. H., K. S. Bland, R. D. Fetter and C. S. Goodman.
Duband, J. L., A. Dady and V. Fleury. 2015. Resolving time and 2000. Short-range and long-range guidance by Slit and its Robo
space constraints during neural crest formation and delamina- receptors: A combinatorial code of Robo receptors controls lat-
tion. Curr. Top. Dev. Biol. 111: 27–67. eral position. Cell 103: 1019–1032.
Harada, T., C. Harada and L. F. Parada. 2007. Molecular regula- Teillet, M.-A., C. Kalcheim and N. M. Le Douarin. 1987. Forma-
tion of visual system development: More than meets the eye. tion of the dorsal root ganglia in the avian embryo: Segmental
Genes Dev. 21: 367–378. origin and migratory behavior of neural crest progenitor cells.
Keleman, K. and 7 others. 2002. Comm sorts Robo to control Dev. Biol. 120: 329–347.
axon guidance at the Drosophila midline. Cell 110: 415–427. Theveneau E., B. Steventon, E. Scarpa, S. Garcia, X. Trepat, A.
Kolodkin, A. L. and M. Tessier-Lavigne. 2011. Mechanisms Streit and R. Mayor. 2013. Chase-and-run between adjacent
and molecules of neuronal wiring: A primer. Cold Spring Harbor cell populations promotes directional collective migration.
Persp. Biol. 3(6): pii: a001727. Nature Cell Biol. 15: 763–772.
Martinez, E. and T. S. Tran. 2015. Vertebrate spinal commissur- Tosney, K. W. 2004. Long-distance cue from emerging dermis
al neurons: a model system for studying axon guidance beyond stimulates neural crest melanoblast migration. Dev. Dynam.
the midline. Wiley Interdiscip. Rev. Dev. Biol. 4: 283–297. 229: 99–108.
Okada, A. and 7 others. 2006. Boc is a receptor for Sonic hedge- Waldo, K., S. Miyagawa-Tomita, D. Kumiski and M. L. Kirby.
hog in the guidance of commissural axons. Nature 444: 369–373. 1998. Cardiac neural crest cells provide new insight into septa-
tion of the cardiac outflow tract: Aortic sac to ventricular septal
Preitner, N. and 7 others. 2014. APC is an RNA-binding pro- closure. Dev. Biol. 196: 129–144.
tein, and its interactome provides a link to neural development
and microtubule assembly. Cell 158: 368–382. Walter, J., S. Henke-Fahle and F. Bonhoeffer. 1987. Avoidance of
posterior tectal membranes by temporal retinal axons. Develop-
Sabatier, C. and 7 others. 2004. The divergent Robo family protein ment 101: 909–913.
rig-1/Robo3 is a negative regulator of slit responsiveness required
for midline crossing by commissural axons. Cell 117: 157–169. Yoshida, T., P. Vivatbutsiri, G. Morriss-Kay, Y. Saga and S. Iseki.
2008. Cell lineage in mammalian craniofacial mesenchyme.
Mech. Dev. 125: 797–808.
Go to www.devbio.com . ..
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
16
Ectodermal Placodes
and the Epidermis
The Punchline
Placodes are thickenings of the surface ectoderm. Cranial placodes form the sensory
neurons of our face, becoming the auditory, nasal, gustatory, and optical organs. The
lens placode is induced by a bulge from the brain. As the lens placode becomes the
lens, it instructs the brain bulge to become the retina. Pax6 appears to be important
in the ability of the anterior ectoderm to respond to signals from the presumptive
retina. The more posterior ectodermal placodes generate the cutaneous appendages,
including hair, feathers, scales, sweat glands, mammary glands, and teeth. These
inductions involve the interactions of several paracrine pathways. The epidermis
retains epidermal stem cells that allow it to be regenerated constantly, and the Notch
pathway is critical in this maintenance. Interactions between the epidermis and the
underlying mesenchyme enable the production and shaping of the placodes for these
ectodermal appendages. The ability of these cutaneous tissues to grow and regenerate
depends on the ability to maintain an epidermal stem cell niche, and different species
have different abilities in this respect.
518 Chapter 16
tube and epidermis (Figure 16.1). With some contributions from the cranial neural crest,
the cranial placodes generate most of the peripheral neurons of the head associated with
hearing, balance, smell, and taste; the cranial neural crest contributes all of the glia. The
olfactory placode gives rise to the sensory neurons involved in smell, as well as to migra-
tory neurons that will travel into the brain and secrete gonadotropin-releasing hormone.
The otic placode gives rise to the sensory epithelium of the ear and to neurons that
help form the cochlear-vestibular ganglion (see Steit 2008). In the case of the trigeminal
ganglion, the proximal neurons are formed from neural crest cells (Baker and Bronner-
Fraser 2001) and the distal ones from the trigeminal placode (Hamburger 1961). The lens
placode is the only cranial sensory placode that does not form neurons.
TheGilbert
specification of the entire placodal domain and of each region of the specific plac-
Developmental Biology 11e, Sinauer Associates
odes isDevBio11e_16.01
defined by the placement and timing of paracrine factor expression by neighboring
Date 05-31-16
cells. Both the paracrine factors and their antagonists (such as Noggin and Dickkopf) are
critically important (Figure 16.2). Interestingly, the entire pre-placodal region is origi-
nally specified as lens tissue. This propensity has to be suppressed locally by FGFs and by
neural crest cells in order for the other cell types to arise (Bailey et al. 2006; Streit 2008).
In addition to these anterior placodes that give rise to specific senses, other placodes
provide sensory neurons for the face. These are the epibranchial placodes, and they
form dorsally to the point at which the pharyngeal pouches contact the epidermis. The
epibranchial placodes give rise to the sensory neurons of the facial, glossopharyngeal,
and vagal nerves (which relay sensory information about the organs to the brain). The
connections made by these placodal neurons are critical in that they enable taste and
other facial sensations to be appreciated. But how do these neurons find their way into
the hindbrain? Late-migrating cranial neural crest cells do not travel ventrally to enter
the pharyngeal arches; rather, they migrate dorsally to generate glial cells (Weston and
Butler 1966; Baker et al. 1997). These glial cells form tracks that guide neurons from
the epibranchial placodes to the hindbrain (Begbie and Graham 2001). Thus, glial cells
from the late-migrating cranial neural crest cells are critical in organizing the innerva-
tion of the hindbrain.
The placodes are induced by their neighboring tissues, and there is evidence that
the different placodes are each a small portion of what had earlier been a common
pan-placodal field that is competent to form the placodes if induced (see Figure 16.2B;
Streit 2004; Schlosser 2005). The cranial placodes may be induced from a common set
of inductive signals arising from the pharyngeal endoderm and head mesoderm (Platt
1896; Jacobson 1966). Jacobson (1963) also showed that the presumptive placodal cells
adjacent to the anterior neural tube are competent to give rise to any placode. The
anterior-posterior and lateral boundaries of the pan-placodal field are set by retinoic
acid, working through Fgf8 (Janesick et al. 2012). Detailed fate mapping studies have
Ectodermal Placodes and the Epidermis 519
(A) (B)
Placodal FGFs
ectoderm Wnt
Epidermis
BMP Pre-neural
Neural crest
Pre-neural Pan-placodal field
Figure 16.2 Specification of neural crest cells. (A) The neural plate is bordered FGFs
Wnt
by neural crest anteriorly and caudally, and by placodal ectoderm anteriorly. If Fgf2,3,8,19 Fgf3,8 Wnt
PDGF
the ectodermal cells receive both BMP and Wnt for an extended period of time, Notch
they become epidermis. If Wnt induces BMP and is then downregulated, the
cells become placodal cells (expressing the placode specifier genes Six1, Six4,
Olfactory Trigeminal Epibranchial Otic
and Eya2). If Wnt induces BMP but remains active, these border cells between
the neural plate and epidermis become neural crest (expressing the neural crest-
specifier genes Pax7, Snail2, and Sox9). If they receive Wnt only (because the
BMP signal is blocked by Noggin or FGFs), the ectodermal cells become neural
cells. (B) Diagrammatic summary of some of the signaling pathways involved in
the specification of the pan-placodal field and the induction of cranial placodes
from this region. (A after Patthey et al. 2009; B after Steit 2008.)
confirmed that during the neurula stages, all the placodal precursors are located in a
horseshoe-shaped domain that surrounds the anterior neural plate and cranial neural
folds (Pieper et al. 2011). This columnar pan-placodal epithelium contains the transcrip-
tion factors Six1, Six4, and Eya2. These proteins are maintained in all the placodes and
are downregulated in the interplacodal regions (Bhattacharyya et al. 2004; Schlosser
and Ahrens 2004). Later, the pan-placodal field is separated into discrete placodes; the
mechanism for this separation is not known (Breau and Schneider-Maunoury 2014).
Different sets of paracrine factors now induce each discrete placode toward its respec-
tive fate, such that each placode expresses its own unique set of transcription factors
(Groves and LaBonne 2014; Moody and LaMantia 2015). For instance, the chick otic
placode, which develops into the sensory cells of the inner ear, is induced by a combi-
nation of FGF and Wnt signaling (Ladher et al. 2000, 2005). Fgf19 from the underlying
cranial paraxial mesoderm is received by both the presumptive otic vesicle and the
adjacent neural plate. Fgf19 induces the neural plate to secrete Wnt8c and Fgf3, which in
turn act synergistically to induce formation of the otic placode. The localization of Fgf19
to the specific region of the mesoderm is controlled by Fgf8 secreted in the endodermal
region beneath it (Figure 16.3).
Throughout the head, the neural crest and the sensory placodes—those structures
between the epidermis
Developmental and neural plate—provide the sensory neurons of our ears,
Biology 11e
Fig.tongue,
nose, 16.02 facial skin, and balance system.
Dragonfly Media Group
05/31/16
WEb Topic 16.1 Kallmann syndrome Some infertile men have no sense of smell.
The relationship between these two conditions was elusive until the gene for Kallmann
syndrome was identified.
WEb Topic 16.2 The human cranial nerves The 12 cranial nerves mediate
much of our perception of the outside world.
520 Chapter 16
(B)
Six3
Otx2
Lhx2
Optx2
Normal Rx knockout
(C)
Stage 12.5 Stage 15
(E) Xrx1 in eye field Pineal gland
Six3 Lhx2
Rx1 Pax6
Pax6 tll
Rx1 Optx2
ET
Lhx2
Retina Ventral
ET Six3 hypothalamus
522 Chapter 16
Olf Opt
Olf Opt
Opt L
Mx Mx
Mx
Mn Mn
Mn
Figure 16.6 Sonic hedgehog separates the eye field into bilateral fields. Jervine,
(D)
Diencephalon an alkaloid found in certain plants, inhibits endogenous Shh signaling. (A) Scanning
Telencephalon electron micrograph showing the external facial features of a normal mouse embryo.
Mesencephalon (B) Mouse embryos exposed to 10 μM jervine had variable loss of midline tissue and
resulting fusion of the paired, lateral olfactory processes (Olf), optic vesicles (Opt),
and maxillary (Mx) and mandibular (Mn) processes of the jaw. (C) Complete fusion of
the mouse optic vesicles and lenses (L) resulted in cyclopia. (D) Drawing showing the
Metencephalon location of the prechordal plate (the source of Shh) in the 12-day mouse embryo. (A–C
Prechordal from Cooper et al. 1998, courtesy of P. A. Beachy.)
plate
Hypothalamus Myelencephalon
Notochord factors (such as Six3, Rx, and Sox2) with overlapping functions. These fac-
tors mutually activate one another to generate a single eye-forming field
in the center of the ventral forebrain (Figure 16.5E; Tétreault et al. 2009;
Fuhrmann 2010). The final result, however, is two eyes that are more lateral
in the head. The main player in separating the single vertebrate eye field
(A) Surface-dwelling (B) Cave-dwelling
populations
into two bilateral fields is our old friend Sonic hedgehog (Shh).
populations
Shh from the prechordal plate suppresses Pax6 expression in the center
of the neural tube, dividing the field in two (Figure 16.6). If the mouse
Shh gene is mutated, or if the processing of this protein is inhibited, the
single median eye field does not split. The result is cyclopia —a single eye
in the center of the face, usually below the nose (see Figure 16.6C; Chiang
et al. 1996; Kelley et al. 1996; Roessler et al. 1996). Conversely, if too much
Shh is synthesized by the prechordal plate, the Pax6 gene is suppressed
in too large an area and the eyes fail to form at all. This phenomenon
may explain why cave-dwelling fish are blind. Yamamoto and colleagues
(2004) demonstrated that the difference between surface populations of
the Mexican tetra fish (Astyanax mexicanus) and eyeless cave-dwelling
populations of the same species is the amount of Shh secreted from the
prechordal plate. Elevated Shh was probably selected in cave-dwelling
Gilbert
Developmental Biology species because it resulted in heightened oral sensing and larger jaws
Ptc2 11e, Sinauer Associates
DevBio11e_16.06 Date 03-04-16 (Yamamoto et al. 2009). However, Shh also downregulates Pax6, resulting
in the disruption of optic cup development, apoptosis of lens cells, and
arrested eye development (Figure 16.7).
Pax2
Pax2
Figure 16.7 Surface-dwelling (A) and cave-dwelling (B) Mexican tetras (Asty-
anax mexicanus). The eye fails to form in the population that has lived in caves for
more than 10,000 years (top right). Two genes, Ptc2 and Pax2, respond to Shh
and are expressed in broader domains in the cavefish embryos than in those of
surface dwellers (center). The embryonic optic vesicles (bottom) of surface-dwell-
ing fish are normal size and have small domains of Pax2 expression (specifying
the optic stalk). The optic vesicles of the cave-dwelling fishes’ embryos (where
Pax6 is usually expressed) are much smaller, and the Pax2-expressing region
has grown at the expense of the Pax6 region. (From Yamamoto et al. 2004; pho-
Pax6 Pax2 tographs courtesy of W. Jeffery.)
Ectodermal Placodes and the Epidermis 523
(A)
Gastrulation and neural plate formation Neural tube closure Lens morphogenesis
PPE PR PLE OC
PLE OV PLE LV LF
OV
LE
NP PR NR
ME LP
(B)
Retina lineage Pigment
epithelium
Neural plate
Anterior
mesoderm Presumptive Optic Optic Neural
and endoderm retina vesicle cup retina
Primary
BMPs BMP7 lens fiber
Figure 16.8 Reciprocal embryonic interactions between the of the optic cup into the neural retina, and causes the lens placode
developing lens placode and the optic vesicle from the brain. (A) to involute and form the lens vesicle. The expanded inset (upper
Diagrammatic rendering of the major anatomical changes from gas- right) shows the critical interactions between the optic vesicle and
trulation through lens morphogenesis. These interactions start with the presumptive lens cells of the lens placode. (B) Some of the
the presumptive lens ectoderm being influenced by the neural plate, paracrine factors involved in lens development. At different stages
cardiac mesoderm, and pharyngeal mesoderm. Later, the optic and in different tissues, the FGFs and their receptors may be differ-
vesicle—a bulge from the diencephalon—touches the presump- ent The three arrows below show some of the genes that become
tive lens ectoderm, triggering a series of interactions that turns the expressed in the presumptive lens during the indicated timeframes.
optic vesicle into a two-layered optic cup, converts the inner layer (After Ogino et al. 2012.)
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_16.08 Date 05-19-16
Ectodermal Placodes and the Epidermis 525
Sox2 Pax6
Corneal AAATATTCATTGTTGTTGCTCACCTACCATG
epithelium
Anterior
chamber d-Crystallin enhancer sequence
Equator
d-Crystallin, etc.
Corneal Stroma
epithelium of iris
Lens
Corneal Ciliary
endothelium body
526 Chapter 16
(A) (B)
Intermediate
layers
Ganglion cells
Retinal fiber
layers
Figure 16.10 Retinal neurons sort out into functional layers during
development. (A) Fluorescent labeled confocal micrograph of chick retina,
showing the three layers of neurons and the synapses between them. (B)
The mammalian retina as drawn and labeled by Santiago Ramón y Cajal
in 1900. Numerical labels: 1, photoreceptor layer; 2, external limiting mem-
brane; 3, outer granular layer; 4, outer plexiform layer; 5, inner granular
layer; 6, inner plexiform layer; 7, ganglion cell layer; 8, optic nerve fiber layer;
9, internal limiting membrane. Alphabetical labels: A, pigmented cells; B,
epithelial cells; a, rods; b, cones; c, rod nucleus; d, cone nucleus; e, large
horizontal cell; f, cone-associated bipolar cell; g, rod-associated bipolar cell;
h, amacrine cell; i, giant ganglion cell; j, small ganglion cell. (A courtesy of
A. J. Fischer; B courtesy of the Instituto Cajal, CSIC, Madrid.)
Müller glial cells that maintain its integrity, amacrine neurons (which lack large axons),
and horizontal neurons that transmit electric impulses in the plane of the retina.
The neuroblasts of the retina appear to be competent to generate all of the retinal
cell types (Turner and Cepko 1987; Yang 2004). In amphibians, the type of neuron
produced from a multipotent retinal stem cell appears to depend on the timing of gene
translation. Photoreceptor neurons, for instance, are specified through expression of
the Xotx5b gene, while Xotx2 and Xvsx1 expression is critical for specifying the bipolar
neurons. Interestingly, these three genes are transcribed in all retinal cells, but they
are translated differently. Those neurons whose birthday is at stage 30 translate Xotx5b
mRNA and become photoreceptors, while those neurons forming later (birthdays at
stage 35) translate the Xotx2 and Xvsx1 messages and become bipolar interneurons
(Decembrini et al. 2006, 2009). This time-dependent regulation of translation is medi-
ated by microRNAs.
Not all the cells of the optic cup become neural tissue. The tips of the optic cup on
either side of the lens develop into a pigmented ring of muscular tissue called the iris.
The iris muscles control the size of the pupil (and give an individual his or her charac-
teristic eye color). At the junction between the neural retina and the iris, the optic cup
forms the ciliary body. This tissue secretes the aqueous humor, a fluid needed for the
nutrition of the lens and for forming the pressure needed to stabilize the curvature of
the eye and the constant distance between the lens and the cornea.
WEb Topic 16.3 Why babies don’t see well The retinal photoreceptors are not
Gilbert
fully developed at birth but increase in density and discriminatory ability as a child grows.
Developmental Biology 11e, Sinauer Associates
DevBio11e_16.10 Date 03-07-16
528 Chapter 16
also possible that both asymmetrical and symmetrical division play important roles in
forming and sustaining the epidermis (Hsu et al. 2014; Yang et al. 2015). Moreover, it is
still not determined whether there is a discrete population of long-lived stem cells in the
basal layer (Mascré et al. 2012), or whether all basal cells have stem cell-like properties
(Clevers et al. 2015).
Cell division from the basal layer produces younger cells and pushes the older cells
to the surface of the skin. This is unlike the “inside-out” patterning of the neural tube,
where newly generated neurons migrate through layers of older cells on their way to the
periphery. (Neural cells, however, don’t form anew each day like the epidermal cells.)
After the synthesis of the differentiated products, the cells cease transcriptional and
metabolic activities. These differentiated epidermal cells, the keratinocytes, are bound
tightly together and produce a water-impermeable seal of lipid and protein.
As they reach the surface, keratinocytes are dead, flattened sacs of keratin protein,
and their nuclei are pushed to one edge of the cell. These cells constitute the cornified
layer, or stratum corneum . Throughout life, the dead keratinocytes of the cornified
layer are shed3 and are replaced by new cells. In mice, the journey from the basal layer to
the sloughed cell takes about two weeks. Human epidermis turns over a bit more slowly;
the proliferative ability of the basal layer is remarkable in that it can supply the cellular
material to continuously replace 1–2 m2 of skin for several decades throughout adult life.
Several factors stimulate development of the epidermis (see Figure 16.11). Dermal
fibroblasts activate epidermal stem cell division through the production of FGFs, insu-
lin-like growth factor, and the appropriately named epidermal growth factor (Hsu et
al. 2014). BMPs help initiate epidermal production by inducing the p63 transcription
factor in the basal layer. This transcription factor’s multiple roles may depend in part
on different splicing isoforms of p63 that are expressed in the epidermis. The p63 pro-
tein is required for keratinocyte proliferation and differentiation (Truong and Khavari
2007); it also appears to stimulate the production of the Notch ligand Jagged. Jagged
is a juxtracrine protein in the basal cells that activates the Notch protein on the cells
above them, activating the keratinocyte differentiation pathway and preventing further
cell divisions (see Mack et al. 2005; Blanpain and Fuchs 2009). Thus, Notch signaling is
necessary for the transition from the basal layer to the spinous layer.
3
Humans lose about 1.5 grams of these cells every day. Most of this skin becomes “house dust.”
Deficient Notch signaling has been implicated in psoriasis (Kim et al. 2016).
530 Chapter 16
Figure 16.12 Ectodermal appendages arise through shared Placode Bud Morphogenesis
placode and bud stages prior to diversification and epithelial mor-
phogenesis. The developmental schema of hair (top row), tooth Hair
(center), and mammary gland (bottom row) are shown for the three
stages. (After Biggs and Mikkola 2014.)
Hair
shaft
Tooth
Epithelium
Mesenchyme Enamel knot
Condensed mesenchyme Nipple sheath
Mammary
gland
Day 10.5 Day 10.5 Tooth development zone Figure 16.13 Division of the dental lamina
into incisor and molar fields. (A) Schematic
diagram showing the mandible of a 10.5-day
mouse embryo. A mutually antagonistic inter-
Forebrain action between Bmp4 and Fgf8 is thought
to define the tooth field in the oral ectoderm.
Nasal process Each tooth fields is continuous until day 11,
but subsequently divides into the incisor and
Maxillary Day 11.5 molar fields in the distal and proximal areas of
process the jaw, respectively. The two fields are sepa-
Mandibular rated by a toothless region called diastema.
process (After Ahn 2015.)
Diastema
in certain skin mesenchymes, namely, those mesenchyme associated with palms, soles,
and external genitalia. In these locations, HoxA13 gene expression appears to promote
the synthesis of paracrine factors that induce the ectodermal epithelium to express spe-
cific keratin proteins rather than hair (Rinn et al. 2008; Johansson and Headon 2014).
Recombination experiments with mouse mammary glands have revealed remarkable
sex-related differences in development. In female mice, the mammary gland completes
the first part of its development in the embryo. Like the human mammary gland, it com-
pletes the second part of its development in response to estrogenic hormones made at
puberty. Final development, including ductal growth and the differentiation of the milk-
producing cells on the branches and tips, is accomplished during pregnancy. In male
mice, however, mammary development is literally nipped in the bud. Shortly after placode
epidermis has ingressed, the mesenchyme cells condense around it. The mesenchymal
cells appear to stretch the epithelial rudiment and separate the male mammary epithe-
lium from the epidermis. The epithelial portion of the male mammary gland then dies.
The condensation of the mesenchyme around the stalk of the male mammary bud is
due to testosterone. The addition of testosterone to female cultured mammary likewise
arrested their development. Moreover, recombination experiments with mice lacking
the testosterone receptor show that testosterone acts only on the mesenchyme cells,
instructing them to destroy the male mammary rudiment (Figure 16.14 ; Kratochwil
and Schwartz 1976; Dürnberger et al. 1978). In humans, however, the duct in males is
not severed, and male mammary development follows the female pattern until puberty.
At that time, increased estrogen levels permit expanded breast development in women,
while male estrogens remain at prepubertal levels. If men are exposed to estrogenic
compounds (such as some endocrine disruptors; see Chapter 24), their breasts will
enlarge, a condition called gynecomastia. However, since males do not secrete prolac-
tin, gynecomastic breasts do not usually produce milk.
Signaling pathways
Developmental Biology 11e
Fig. 16.13
Just about all of the major signaling pathways are involved in the formation of the
Dragonfly Media Group
ectodermal appendages (Biggs and Mikkola 2014; Ahn et al. 2015). In some instanc-
02/10/16
es, such as the enamel knot of mammalian teeth, the same signaling center sends
out paracrine factors belonging to nearly every family (Figure 16.15). The canonical
532 Chapter 16
(A) (B)
Enamel knot
Figure 16.15 Tooth generation in mammals. The enamel knot knot. (B–D) In situ hybridization reveals that the enamel knot tran-
is the signaling center directing tooth morphogenesis. These pho- scribes the genes for paracrine factors initiating several signaling
tographs show the cap stage of development where the epithelium cascades. These genes include Sonic hedgehog (B), Bmp7 (C), and
Gilbert
is growing into the mesenchyme. (A) Staining for cell division with Fgf4 (D). (From Vaahtokari et al 1996, courtesy of I. Thesleff.)
Developmental Biology
radioactive BrdU 11e, Sinauer
indicates Associates
a region of non-dividing cells, the enamel
DevBio11e_16.14 Date 05-19-16
Ectodermal Placodes and the Epidermis 533
Wnt/β-catenin pathway was implicated by the loss of properly formed hair, teeth, and
mammary glands in mice deficient in components of this pathway (van Genderen et
al. 1994). Manipulating embryos to have β-catenin expression throughout the epider-
mis eventually transforms the entire epidermis to a hair follicle fate (Närhi et al. 2008;
Zhang et al. 2008), and it creates supernumerary teeth in the jaw (Järvinen et al. 2006;
Liu et al. 2008). Indeed, Wnt signaling may help induce the enamel knot to form and
may be critical in the ability (lost in mammals) to regenerate teeth (Järvinen et al. 2006).
Mouse mutants lacking negative regulators of the Wnt pathway display more and larger
mammary placodes (Närhi et al. 2012; Ahn et al. 2013).
FGFs probably play multiple roles in ectodermal appendage development. One of
these roles is to regulate the migration of mesenchymal cells to become the condensates
beneath the placode. In teeth, Fgf8 from the placode appears to attract and sustain mes-
enchyme cells to the tooth placode (Trumpp et al. 1999; Mammoto et al. 2011). In hair,
the placodal Wnt activates the secretion of Fgf20, which may stimulate mesenchymal
cell migration to the placode (Huh et al. 2014). In the mammary gland, Fgf10 from the
somites (and possibly the limb buds) is thought to induce the placode formation (Mail-
leux et al. 2002; Veltmaat et al. 2006). Mice lacking the genes for Fgf10 or its receptor
lack mammary placodes 1,2, 3, and 5. (For some unknown reason, mammary placode
4 survives).
TGF-β family members, especially the BMPs, also play important roles in ectoder-
mal appendage formation. Indeed, the shifting expression pattern of BMP4 from the
epithelium to the mesenchyme coordinates the shifting of tooth-generating potential
and is critical for the bud-to-cap transition. BMPs are known to induce several genes Developing Questions
involved in tooth development (Vainio et al. 1993; Jussila and Thesleff 2012) and BMPs
Turtle scutes (the keratinous
and Wnts most likely regulate each other to control tooth shape (Munne et al. 2009; external plates covering the
O’Connell et al. 2012). While BMP expression is necessary for tooth formation, BMP back and belly) all display
activity must be suppressed for the induction of hair placodes (Jussila and Thesleff 2012; the same pattern, whether
Sennett and Rendl 2012). they are on marine turtles
Other signaling pathways, such as those initiated by hedgehog and ectodysplasin, or desert tortoises. The
are also important to varying degrees (Biggs and Mikkola; Ahn 2014). The ectodys- mathematically inclined
might want to ask: How is
plasin pathway (activating the NF-κB transcription factor) is active in every cutaneous
this pattern generated?
appendage. People (and other animals) with anhidrotic ectodermal dysplasia thus have
defective growth of hair, teeth, and sweat glands (Mikkola et al. 2008).
(A)
Embryonic day Birth Puberty Adult
13.5 18.5
Estrogen Progesterone
Estrogen
Progesterone
Alveoli Prolactins
Terminal Fat pad
Figure 16.16 Stem cells and breast end bud
development. (A) The stages of mamma-
lian breast development in mice. Breast
development begins around embryonic Prolactins
day 11. The gland remains in the newborn Lactation Pregnancy
condition until puberty, when the ducts
expand. During pregnancy and lacta-
tion, the alveoli differentiate and produce (B)
milk. After pregnancy, the alveoli undergo Ductal
apoptosis, but they can be regenerated progenitor
during subsequent pregnancy. (B) Pos- Duct cell
sible stem and progenitor cells of the
breast. The mammary stem cell can Common Alveolar
generate two types of progenitor cells progenitor progenitor
(in addition to making another mammary
stem cell). One of these progenitors gives Mammary Alveolar cell
rise to the contractile myoepithelial cells stem cell
that line the alveoli and ducts, while the Myoepithelial
other progenitor generates the ducts and progenitor
alveoli. (After Visvander and Stingle 2014.)
Myoepithelial cell
The mammary gland (after which our vertebrate class was named) contains stem
cells for the reactivation of its growth at puberty and pregnancy (Figure 16.16A). Dur-
ing puberty, estrogens cause extensive branching of the ducts and elongation of the ter-
minal end buds. During pregnancy, the ducts, stimulated by progesterone and prolac-
tin, form tertiary side branches that differentiate into the milk-producing alveoli (Oakes
et al. 2006; Sternlicht et al. 2006). The mammalian mammary gland probably contains
Developing Questions a stem cell that is able to generate all the lineages of the gland. Data from genetically
Humans have sweat glands labeled mammary cells (Rios et al. 2014; Wang et al. 2015) suggest that there may be a
throughout their skin, single stem cell type that can make the two major progenitor cells of the breasts: one
whereas most mammals that generates the ducts and aveoli, and one that generates the myoepithelial cells that
have them only in their contract to push the milk out of the alveoli and toward the nipple (Figure 16.16B).
palms and soles. With
The best studied of the epidermal appendage stem cells is the hair stem cell. There
increasing brain size came
the necessity for a very appear to be three stem cell populations involved in producing epidermal structures.
efficient cooling system; One, discussed earlier, is found in the germinal layer of the epidermis and generates
thus hairless skin with the keratinocytes that characterize the interfollicular epidermis. A second group of stem
its many sweat glands. cells is critical for forming the sebaceous gland of each hair shaft, and a third group is
How might sweat glands critical for regenerating the hair shaft itself. Interestingly, it seems that there is also a
arise as an evolutionary primitive stem cell that can form all the others (Snippert et al. 2010), and members of
modification of ectodermal
each stem cell group can be recruited to any of the other three pools if needed, as when
appendages? What is the
evidence that sweat glands the skin repairs itself when wounded (Levy et al. 2007; Fuchs et al. 2008).
may be a modification of Hair is one structure that mammals are able to regenerate. Throughout life, hair
hair that develop at the follicles undergo cycles of growth (anagen), regression (catagen), rest (telogen), and
expense of hair follicles, regrowth. Hair length is determined by the amount of time the hair follicle spends in
Developmental
therebyBiology 11e
explaining both
Fig. 16.16 the anagen phase. Human scalp hair can spend several years in anagen, whereas arm
our large number of sweat hair grows for only 6–12 weeks in each cycle. The ability of hair follicles to regenerate
Dragonfly Media Group
glands and our bodies’
03/07/16 depends on the existence of a population of epithelial stem cells that forms in the per-
relative hairlessness?
manent bulge region of the follicle late in embryogenesis. When Philipp Stöhr drew
Ectodermal Placodes and the Epidermis 535
the histology of the human hair for his 1903 textbook, he showed this bulge (“Wulst”)
as the attachment site for the arrector pili muscles (which give a person “goosebumps”
when they contract). Research carried out during the 1990s suggested that the bulge
houses populations of at least two adult stem cell types: the hair follicle stem cells
(HFSCs), which gives rise to the hair shaft and sheath (Cotsarelis et al. 1990; Morris and
Potten 1999; Taylor et al. 2000); and the melanocyte stem cells, which give rise to the
pigment of the skin and hair (Nishimura et al. 2002). The bulge appears to be an impor-
tant niche that allows adult cells to retain the quality of “stemness.” Follicle stem cells
in the bulge can regenerate all the epithelial cell types of the hair, and without the stem
cells, there is no new follicle. However, if stem cells are selectively ablated by laser, cer-
tain bulge epithelial cells (which normally are not used for hair growth) repopulate the
stem cell population and can sustain hair follicle regeneration (Rompolas et al. 2013).
There appear to be two populations of HFSCs: a quiescent population in the bulge,
and a population primed for cell division just below the bulge. The entire skin organ
seems to be involved in hair cycling ( Figure 16.17 ). The HFSCs reside in the outer
layer of the bulge. The inner bulge cells are the progeny of the HFSCs, and they secrete
BMP6, BMP6,
FGF18 FGF18
Dermal
fibroblasts Bulge
BMP4 Wnts
HFSC
Figure 16.17 Regeneration of the hair shaft by the bulge hair follicle stem
(C) Early anagen (bulge cells (HFSCs). (A) During quiescence (telogen), the condensed mesenchyme of
stem cell activation) the dermal papilla contacts the stem cells (blue) in the outer layer of the bulge.
The HFSCs are quiescent because of BMP6 and Fgf18 produced by the inner
bulge layer, whose cells descend from the HFSC of the outer bulge, and because
of other BMPs produced by dermal mesoderm (fibroblasts) and fat cells (adipo-
cytes). (B) At the transition from telogen to anagen (growth), the dermal papilla is
induced by the mesenchyme cells to produce activators of hair growth (FGFs and
Wnts) as well as antagonists of BMP signals. This causes the proliferation and
differentiation of the hair follicle. (C) Contacting the dermal papilla at the base, the
Shh cells divide rapidly to generate the hair shaft and its channel. The cells close to
the earlier bulge become the outer layer of the bulge and have stem cell proper-
ties. An inner layer, several cell layers thick, is also derived from the HFSCs; this
layer eventually inhibits HFSC proliferation. At catagen (not shown), most cells
Outer
root Matrix undergo apoptosis, but the remaining stem cells survive in the bulge region. An
sheath epithelial strand then brings the dermal papilla up to the region of the bulge, and
the interaction between them appears to generate the hair germ of the next gen-
Dermal papilla eration of hair. (After Hsu and Fuchs 2012, Hsu et al. 2014.)
536 Chapter 16
BMP6 and Fgf18, two repressors of HFSC proliferation. In addition, the dermal fibro-
blasts and the subcutaneous fat cells also make growth-suppressive BMPs. The HFSCs
are activated at the beginning of the anagen phase by signals from the dermal papilla
of condensed mesenchyme. These signals are FGFs, Wnts, and BMP antagonists, and
they direct the epidermal stem cells to migrate out of the bulge. There, the epidermal
stem cells produce progenitor cells that proliferate downward and generate the seven
concentric columns of cells that form the outer root sheath from bulge to matrix.
This activation of the dermal papilla is regulated by the microenvironment of the
dermis. The underlying dermis appears to make more Wnts and less BMPs, while the
adipocyte precursor cells make more of the paracrine factor PDGF, which stimulates the
dermal papilla (Plikus et al. 2008; Rendl et al. 2008; Hsu and Fuchs 2012). As the dermal
papilla is moved farther away by the downward growth of the epithelial cells, its signals
are not received by the stem cells, and the bulge return to quiescence. During the latter
part of anagen, prostaglandin PGD2 appears to prevent the production of the progeni-
tor cells. During catagen, most of the basal (outer root sheath) epithelial cells undergo
apoptosis. Upper follicular stem cells remain, however. The outer root sheath cells close
to the old bulge contain HFSCs and become the outer layer, while those nearer to the
matrix differentiate to become the inner layer of the bulge. Apoptosis causes the outer
cells to be in contact with the dermal papilla in readiness for the next cycle (Hsu et al.
2011; Mesa et al. 2015).
Remarkably, activation of the bulge stem cells is regulated in part by the progenitor
cells they produced. The progenitor cells secrete Sonic hedgehog, which is essential for
the division of the bulge HFSCs. It is possible that the BMP6 and FGF signals from these
cells inhibit the stem cells beneath the bulge, while their Shh activates the bulge stem
cells. This means that the progenitor cells are not merely passive cells on their way to
differentiate, but they constitute a signaling center that can activate the quiescent bulge
stem cells (Figure 16.18; see also Figure 16.17C). The dermal papilla can thereby initiate
hair regeneration by stimulating the primed (sub-bulge) HFSCs to establish a population
of transit-amplifying cells, and then this progenitor cell population serves as a signaling
center to sustain the dermal papilla signaling needed to expand the transit amplifying
cells. These transit-amplifying cells also stimulate proliferation of quiescent stem cells.
Thus, the transit-amplifying cells regulate the proliferation of themselves, the primed
HFSCs, and the quiescent HFSCs, thereby coordinating the regeneration of the hair
follicle (Hsu et al. 2014).
Scientists Speak 16.1 Dr. Elaine Fuchs discusses stem cells in general and the
remarkable abilities of hair follicle stem cells in particular.
These findings about stem cell activation and quiescence has helped explain two
human variations: male pattern baldness and long eyelashes. Male pattern baldness,
which is characterized by a decrease in hair follicle size, appears to be caused by the
progressive inability of the HFSCs to generate progenitor cells. Indeed, in aged mam-
mals, inhibitory compounds from outside the niche may keep the HFSCs in a dormant
state. This cessation of progenitor cell production appears to be due to the prolonged
synthesis of prostaglandin PGD2, which is normally used to stop hair growth at the end
of the anagen phase. Bald men have higher levels of this factor, and transgenic mice
that overexpress the enzymes leading to prostaglandin PGD2 synthesis have hair loss.
Moreover, the genes encoding the enzymes producing this prostaglandin are upregu-
lated by testosterone4 (Garza et al. 2011, 2012) and repressed by the Wnt pathway—the
same pathway implicated in tooth regeneration. Epithelial Wnt secretion is necessary
for adult hair follicle growth and regeneration, and older mice have much higher levels
of Wnt inhibitors (such as Dickkopf) than younger mice (Myung et al. 2013; Chen et al.
2014). Normally, PGD2 probably acts as a counterbalance to the positive growth effects
of related prostaglandins PGE2 and PGF2α . These latter two prostaglandins appear to
stimulate the growth of hair by prolonging the anagen phase (Johnstone and Albert
2002; Sasaki et al. 2005). Indeed, solutions containing these prostaglandins or their
analogues have been approved for the cosmetic use of lengthening eyelashes.
Coda
In 1882, Thomas Huxley, one of Britain’s foremost naturalists and one of Charles Dar-
win’s most ardent supporters, reflected, “I remember … the intense satisfaction and
delight which I had in listening, by the hour together, to Bach’s fugues. … The source
of pleasure is exactly the same as in most of my problems in morphology—that you
have the theme in one of the old master’s works followed out in all its endless varia-
tions, always appearing and always reminding you of unity in variety.” In the epider-
mal placodes, one sees amazing variations on the theme of epithelial-mesenchymal
interaction. The placodes use similar pathways and similar forces to produce different
organs—feathers, hair, scales, mammary glands, and teeth. The epidermis and the eye
use similar paracrine factors and signaling pathways to ensure their coordinated devel-
opment and growth. As Huxley himself noted (see p. 785), few things are “invented”
de novo. It is the different combinations at different times that makes the difference.
4
Testosterone and (more importantly, as we saw in Chapter 6) its derivative hydrotestoster-
one are critical in producing male pattern baldness. Ancient civilizations noted that eunuchs
(castrated males) did not become naturally bald. Testosterone does not appear to play a role in
female hair thinning (Kaufman 2002).
16 Snapshot Summary
Ectodermal Placodes and the Epidermis
1. Ectodermal placodes are thickenings of cells, usually in The axons of the retinal ganglion cells form the optic
the ectoderm. The anterior placodes form the sensory nerve. The lens and cornea form from the surface ecto-
neurons of the eye, ear, and nose, as well as the lens of derm. Both must become transparent.
the eye. The more posterior placodes form the hair, teeth, 6. Reciprocal induction is critical in the specification and dif-
feather, scutes, and scales that cover the epidermis. ferentiation of the retina and lens. The cells that form the
2. The cranial placodes form in the ectoderm in the border organs have two “lives.” In the embryonic life, they con-
area between the neural tube and ectoderm. They are struct the organs; in the adult life, they function as part of
distinguished from neural crest cells by signals that inhibit an organ. The body is constructed by cells that are not
BMPs and Wnts. performing their adult roles.
3. The cranial sensory placodes originate in a pan-placodal 7. The basal layer of the surface ectoderm becomes the
region that is separated into individual placodes. germinal layer of the skin. Epidermal stem cells divide to
4. The vertebrate retina forms from an optic vesicle that produce differentiated keratinocytes and more stem cells.
extends from the brain. Pax6 plays a major role in eye 8. The enamel knot is the signaling center for tooth shape
formation, and the downregulation of Pax6 by Sonic and development.
hedgehog in the center of the brain splits the eye- 9. The hair follicular stem cells, which regenerate hair follicles
forming region of the brain in half. If Shh is not expressed during periods of cyclical growth, reside in the bulge of the
there, a single medial eye results. hair follicle. Male baldness appears to result from the inhi-
5. The photoreceptor cells of the retina gather light and bition of the Wnt pathway, preventing stem cell division.
transmit an electric impulse to the retinal ganglion cells.
Further Reading
Ahn, Y. 2015. Signaling in tooth, hair, and mammary placodes. Jernvall, J., T. Aberg, P. Kettunen, S. Keränen and I. Thesleff.
Curr. Top. Dev. Biol. 111: 421–452. 1998. The life history of an embryonic signaling center: BMP4
Ahtiainen, L. and 7 others. 2014. Directional cell migration, but induces p21 and is associated with apoptosis in the mouse tooth
not proliferation, drives hair placode morphogenesis. Dev. Cell enamel knot. Development 125: 161–169.
28: 588–602. Ogino, H., H. Ochi, H. M. Reza and K. Yasuda. 2012. Transcrip-
Biggs, L. C. and M. L. Mikkola. 2014. Early inductive events in tion factors involved in lens development from the preplacodal
ectodermal appendage morphogenesis. Semin. Cell Dev. Biol. 26: ectoderm. Dev. Biol. 363: 333–347.
11–21. Sick, S., S. Reinker, J. Timmer and T. Schlake. 2006. WNT and
Hsu, Y. C., L. Li and E. Fuchs. 2014. Emerging interactions DKK determine hair follicle spacing through a reaction-diffu-
between skin stem cells and their niches. Nature Med. 20: sion mechanism. Science 314: 1447–1450.
847-856.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
17
Paraxial Mesoderm
The Somites and Their Derivatives
The Punchline
The paraxial mesoderm lies adjacent to the notochord and neural tube. It gives rise
to the vertebrae, the skeletal muscles, and much of the connective tissue of the
skin. Anterior paraxial mesoderm is formed during gastrulation; in the posterior, it
is generated by multipotent neuromesodermal progenitors in the tailbud. Paraxial
mesoderm begins unsegmented, but as the axis elongates, an anterior-to-posterior
wave of boundary formation divides it with clocklike precision into similar-sized
somites. Somitogenesis is controlled by opposing gradients of FGF/Wnt from the
tailbud and retinoic acid from the anterior regions, which maintain progenitor cells
or encourage somite differentiation, respectively. Periodic oscillations of Notch-
Delta signaling provide the “clock” of somitogenesis, influencing the spatiotemporal
collinearity of Hox gene activation along the trunk. Hox expression is also
epigenetically regulated and is essential for proper axial identities. Physical boundaries
are established through an Eph-EphrinB2 mechanism of cell repulsion and extracellular
matrix deposition. Somite differentiation begins with the induction of the sclerotome
and dermomyotome, which give rise to bone and muscle, respectively. Signals from
the notochord, neural tube, lateral plate mesoderm, surface ectoderm, and migrating
neural crest cells contribute to the regulation of chondrogenesis and myogenesis.
540 Chapter 17
cells divided into the paraxial mesoderm, intermediate mesoderm, and lateral plate
mesoderm. The early paraxial mesoderm directly adjacent to the notochord lacks
somites; it takes the form of bilateral streaks of continuous mesenchymal cells, referred
to as the presomitic mesoderm (PSM), also known as the segmental plate. As studied
extensively in amniotes, when the primitive streak is regressing and the neural folds
begin to gather at the center of the embryo, the cells of the presomitic mesoderm will
form somites. Somites are epithelial, “block-like” clusters of cells that are bilaterally
Gilbert
positioned Biology
Developmental adjacent
11eto the neural
, Sinauer tube.
Associates
DevBio11e_17.01 Date 05-31-16
The regions of trunk and head mesoderm and their derivatives can be summarized
as follows (see Figure 17.1):
1. The central region of trunk mesoderm is the chordamesoderm (generally referred
to as the axial mesoderm). This tissue forms the notochord, a transient tissue
whose major functions include inducing and patterning the neural tube and
establishing the anterior-posterior body axis. Notochord cells are hydrostatically
pressurized with large vacuoles to provide a rigid rod-like structure for the devel-
oping embryo. Despite many notochord cells succumbing to apoptotic clearance,
the jelly-like core of the intervertebral disc, called the nucleus pulposus, is derived
from notochord cells (FIGURE 17.2; Choi et al. 2008; McCann et al. 2011).
2. Flanking the notochord on both sides is the paraxial, or somitic, mesoderm. The
tissues developing from this region will be located in the back of the embryo, sur-
rounding the spinal cord and, for some muscle descendants, in the limb and ven-
tral (abdominal wall) regions. Before those regions can be populated, the cells of
the paraxial mesoderm will form somites—transitory epithelial blocks of mesoder-
mal cells on either side of the neural tube—which will produce muscle and many
of the connective tissues of the back (dermis, muscle, and skeletal elements such
as the vertebrae and ribs; see Figure 17.2E,F). The anteriormost paraxial mesoderm
does not segment; it becomes the head mesoderm, which (along with the neural
crest) forms the skeleton, muscles, and connective tissue of the face and skull.
Paraxial Mesoderm 541
(D) Dermatome
Sclerotome of somite
Notochord Extra-
embryonic
Intraembryonic
coelom
coelom
Dermomyotome
Tp Distal rib
Pe
Nucleus pulposus
Outer disc
Vertebral body
Sclerotome
Dorsal aorta
lining of the body cavities. It also gives rise to the pelvic and limb skeleton (but not
the limb muscles, which are somitic in origin). Lateral plate mesoderm also helps
form a series of extraembryonic membranes that are important for transporting
nutrients to the embryo (see Figure 17.2B,C).
5. Anterior to the trunk mesoderm is the head mesoderm, consisting of the unseg-
mented paraxial mesoderm and prechordal mesoderm. This region provides the
head mesenchyme that forms much of the connective tissues and musculature of
the head (Evans and Noden 2006). The muscles derived from the head mesoderm
form differently than those formed from the somites. Not only do they have their
own set of transcription factors, but the head and trunk muscles are affected by
different types of muscular dystrophies (Emery 2002; Bothe and Dietrich 2006;
Harel et al. 2009).
dermomyotome
Myotome forms skeletal muscles Lateral edges generate primary myotome that forms muscle
Dermatome forms back dermis Central region forms muscle, muscle stem cells, dermis, brown fat cells
sclerotome
Forms vertebral and rib cartilage Forms vertebral and rib cartilage
Dorsal region forms tendons (syndetome)
Medial region forms blood vessels and meninges
Central mesenchymal region forms joints (arthrotome)
Forms smooth muscle cells of dorsal aorta
Thus, the somite contains a population of multipotent cells whose specification is VADE MECUM
correlated with (and depends on) their location within the somite. What is it about
The organization of the meso-
their position that influences their differentiation? Consider the structures neighbor-
derm in the neurula stage is simi-
ing each of the progenitor domains within the somite. How might they influence the
lar for all vertebrates. You can see
development of sclerotomal or dermomyotomal cells? At the midline are the notochord
this organization by viewing serial
and neural tube, laterally are the other mesodermal derivatives, and above them all is
sections of the chick embryo in
the epidermis. Later in this chapter, we will discuss how paracrine signals from these
the Chick-Mid segment.
surrounding tissues pattern the cell fates of the somite. First, however, we need to
understand how the paraxial mesoderm and somites are specified.
Wild-type
Wild-type
Anterior
Msgn1 gain-of-function
Msgn1 loss-of-function
Msgn1 and Tbx6 expression are Tbx6 expression
expanded into the anterior PSM reduced in PSM
Figure 17.5 Mesogenin 1 (Msgn1) is both sufficient and necessary for Tbx6 expression.
(A) Msgn1 gain-of-function. As visualized by in situ hybridization, misexpression of Msgn1 in the
presomitic mesoderm (lower two photos) is expanded throughout the trunk (left), which causes
an expansion of Tbx6 expression (right). (B) In contrast, loss of Msgn1 function results in the
reduction of Tbx6 expression (blue, circled domains). (A, lateral views; B, dorsal views.) (Based
on Chalamalasetty et al. 2014; photos courtesy of Terry Yamaguchi and Ravi Chalamalasetty.)
appropriate neural or mesodermal cell fates (Cunningham and Duester 2015; Henrique
et al. 2015). However, this model must still enable the development of distinct somite
identities along the anterior-posterior axis.
RA
Cyp26b
Tbx6
NMP
Presomitic
Msgn1 mesoderm
Caudal lateral
epiblast
Figure 17.6 Antagonistic signals along the anterior-posterior axis pattern neuromesodermal
progenitors (NMP) during paraxial mesoderm development. (A) Loss of retinoic acid synthesis
in the Raldh2 knockout mouse shows an anterior expansion of Fgf8 expression (blue past the
dashed line). (B) Model of signaling systems regulating the NMP from the caudal progenitor zone
(the caudal lateral epiblast) into the preneural tube or presomitic mesoderm. Posterior signals of
FGF and Wnt antagonize anterior retinoic acid signaling. Fgf8 and Wnt3a upregulate Mesogenin
1 (Msgn1) and Tbx6 expression to promote presomitic progenitor specification and repress neu-
ral cell fate specification (Sox2). (A from Cunningham et al. 2015; B after Henrique et al. 2015.)
specification of the mesoderm. For instance, if the entire presomitic mesoderm ectopi-
cally expresses Hoxa10, ribs are completely lost due to the replacement of thoracic ver-
tebrae with lumbar vertebra (FIGURE 17.7B). If Hoxb6 is misexpressed throughout the
PSM, however, all vertebrae form ribs (FIGURE 17.7C; Carapuço et al. 2005; Guerreiro
et al. 2013). In both cases, these transformations of vertebral identity were induced by
the ectopic expression within the PSM, not in the somites, which suggests that cells
of the PSM receive instructions for axial-level specification, and these instructions are
then implemented later during somite differentiation. In the chick, prior to cell migra-
tion through the primitive streak, Hox gene expression can be labial; once the paraxial
mesoderm cells have taken up position in the presomitic mesoderm, however, Hox gene
expression appears more fixed. Indeed, once established, each somite retains its pattern
of Hox gene expression, even if that somite is transplanted into another region of the
embryo (Nowicki and Burke 2000; Iimura and Pourquié 2006; McGrew 2008).
The temporal collinearity of Hox genes refers to a temporal control mechanism of
Hox gene activation that sets up the spatial collinearity of Hox gene expression along
the anterior-posterior axis of the embryo, such that this expression corresponds to the
genomic organization of Hox genes along the 3′-to-5′ orientation. In other words, the
earlier expressed Hox genes are both expressed by cells positioned more anteriorly in
the embryo and found in more 3′ chromosomal locations. In fact, it is the dynamic tem-
Developmental Biology 11e poral pairing of 3′-to-5′ Hox gene activation with the timing of cell ingression/migration
Fig. 17.06 into the paraxial mesoderm that then lays out the spatial pattern of Hox gene expression
Dragonfly Media Group
05/31/16 along the trunk (FIGURE 17.8A; Izpisúa-Belmonte et al. 1991). Initially, a progress zone
model was proposed in which the progressive activation of 3′-to-5′ Hox genes occurs,
Paraxial Mesoderm 547
Developing Questions
With the first investigations of the
Drosophila Hox genes by Morgan
(1915) and Lewis (1978) being
respectively, in earlier-to-later cells of the PSM (Kondo and Duboule 1999; Kmita so long ago, one might think we
and Duboule 2003). More recent investigations, however, have favored a model would understand by now all there
in which Hox genes control the timing of cell ingression in the streak; hence, cells is to know about Hox genes, but
that express anterior Hox genes will ingress early, whereas cells that express more a variety of questions regarding
posterior Hox genes ingress later (Iimura and Pourquié 2006; Denans et al. 2015). the regulatory mechanisms of Hox
During this period of paraxial mesoderm development, the axis is elongating as genes persist. You just learned
that there is a progressive 3′-to-
new progenitor cells enter the PSM from the caudal progenitor zone and occupy
5′ loosening in chromatin states
sequentially more posterior positions over time. Thus, more-anterior PSM cells of Hox clusters over the course of
will express more 3′ Hox genes, while the later-incorporated PSM cells will be
Gilbert paraxial mesoderm development.
Developmental
located in theBiology 11e,and
posterior Sinauer Associates
express more 5′ Hox paralogues—all of which results What triggers this early epigenetic
DevBio11e_17.07 Date 05-31-16 modification in the chromatin of
in the final identity of somites along the rostral-caudal axis (see Figure 17.8A;
reviewed in Casaca et al. 2014). 3′ Hox genes? Once initiated, is
This temporal activation of Hox genes has been called the Hox clock (Duboule the progressive transformation
across the cluster autonomously
and Morata 1994). How is such a linear activation of Hox genes carried out on
driven, or are additional regulators
the cellular level? Research has shown that the Hox genes change from a tightly required to propel this transition to
packed to an unpacked architecture2 in a chronological order that matches the the 5′ end of the cluster? Last, what
order of their expression in the PSM: first the 3′ Hox genes (Hoxd4) show signs of are the mechanisms that stabilize
unpacked structure, followed by the Hoxd8-9 clusters, then the Hoxd10, and finally the inheritance of the specific
epigenetic modifications of Hox
2
How does one examine chromatin states? The Duboule lab used a new technique called genes within a given segment? As
circular chromosome conformation capture (or 4C-seq) to observe the three-dimensional you can see, lots of questions still
genomic organization of Hox gene clusters and identify which Hox genes are in tightly remain!
packed or loosely packed chromatin states during paraxial mesoderm development.
548 Chapter 17
ic
Th l
r
ica
ba
al
ac
sion in the presomitic mesoderm is correlated with chromatin remod-
ud
m
rv
or
(A)
Lu
Ce
Ca
eling. (A) Illustration showing the successive migration of cells into
the PSM as the tailbud elongates, which correlates with the onset
nes 5′
Hox ge of progressively more 5′ Hox gene expression and the development
of different vertebral identities. (B) Changes in chromatin structure
3′ permit progressive access for differential Hox gene expression over
Elongation the course of PSM elongation. Colored PSM and tailbuds represent
tissues used to analyze Hoxd chromatin structure at the different
embryonic stages (E8.5–E10.5) (B after Noordermeer et al. 2014.)
Early entry
into PSM
Late entry
into PSM the more 5′ Hoxd11-12 (FIGURE 17.8B; Montavon and Duboule
2013; Noordermeer et al. 2014). Moreover, it appears that once a
(B) Transition to chromatin states cell has adopted its position in the PSM, it has also adopted its
particular chromatin state for its Hox genes, and all its daughter
Inactive Active cells retain a fixed memory of that state.
Figure 17.9 Neural tube and somites seen by scanning electron microscopy. When the
surface ectoderm is peeled away, well-formed somites are revealed, along with paraxial
mesoderm (bottom right) that has not yet separated into distinct somites. A rounding of the
paraxial mesoderm into a somitomere (area inside brackets) is seen at the lower left, and
neural crest cells can be seen migrating ventrally from the roof of the neural tube. (Courtesy
of K. W. Tosney.)
3
In amniotes, cell migration from the caudal progenitor zone has been interpreted to be more
a result of tissue deformation as opposed to individual cell migration (see Bénazéraf et al. 2010;
Bénazéraf and Pourquié 2013).
4
Collective migration is when self-propelled migrating cells exert directionally coordinated
forces upon one another, as opposed to individually migrating cells with loose contacts or the
movement of a group of cells by tissue pushing due to proliferation or intercalation. Other cells,
such as neural crest and even metastasizing cancer cells, have been suggested to use collective
migration.
550 Chapter 17
cells before they move into the PSM and differentiate (see Watch Development 17.1;
Bouldin et al. 2014). At least in the zebrafish tailbud, although cells are proliferating,
cell migration appears to be the more significant contributor to axis elongation (reviewed
in McMillen and Holley 2015).
WATCH DEVELOPMENT 17.1 Observe dividing NMPs in the maturation zone of the
zebrafish tailbud during somitogenesis.
In addition to cell migration and proliferation, intertissue adhesive forces also con-
tribute to the extension of the anterior-posterior axis. The principal tissues at play are
the paraxial mesoderm and adjacent notochord. As maturing NMP cells move into the
PSM, a fibronectin matrix becomes progressively deposited on the surface of the PSM
and the interfaces between the paraxial mesoderm (somites and PSM) and notochord
(see Figure 17.10A). During this period of axis elongation, chordamesodermal cells are
undergoing significant cellular changes that result in a stiffening and directed extension
of the notochord (Ellis et al. 2013a). Specifically, chordamesodermal cells use endosomal
trafficking to inflate large vacuoles (yes, that is very cool), which leads to an increase in
cell size that exerts pressure on the surrounding tissues (FIGURE 17.10B). Chordameso-
derm cells also secrete a sheath of extracellular matrix components (collagen, laminin)
that surrounds the notochord and resists expansion from the internal pressure of the
cells. As a result of this architecture and inflating chordamesoderm, the notochord elon-
gates in the direction of least resistance—toward the tail (see Figure 17.10A; Ellis et al.
2013b). At least in zebrafish, the paraxial mesoderm essentially “hitches a ride” on the
notochord by using the fibronectin matrix and integrin receptors to mechanically couple
Developmental Biology 11e
Fig. 17.10
Dragonfly Media Group
05/31/16
Paraxial Mesoderm 551
the posterior extension of the PSM with the elongation of the notochord
(FIGURE 17.10C; Dray et al. 2013; McMillen and Holley 2015).
Once the PSM is growing, how does it get chopped up into repeated
segments? A critical insight into the process was revealed when Xenopus
and mouse embryos were experimentally reduced in size: the resulting
number of somites generated was normal, but each somite was smaller
than normal (Tam 1981). This result suggested that a regulatory mech-
(A) (B)
anism controls the number of somites independent of the size of the Mesp-a eph-A4, ephrin-B2
segmenting tissue. We can therefore refine our questions to ask, What
mediates the epithelialization of PSM cells to physically create a bound-
ary and consequently a somite? What mechanism(s) defines the position
and timing of this boundary formation?
Mesp Eph-A4
Figure 17.11 Eph-Ephrin signaling regulates epithelialization during somite S-I
boundary formation. Expression of (A) Mesodermal posterior-a (Mesp-a;
dark purple) and (B) Eph-A4 (black arrows) and ephrin-B2 (red arrows) in the
paraxial mesoderm of zebrafish embryos (dorsal views). (C) Model of Mesp-a
and Eph-Ephrin signaling fostering mesenchymal-to-epithelial transitions that
define the apposing cells of a somite boundary. Mesp-a becomes restricted to
the anterior half of the S-I somitomere, which upregulates Eph-A4 within this Mesp Eph-A4
domain. In turn, Eph-A4 upregulates its binding partner ephrin-B2 in the cells of
the presumptive posterior S-0 somitomere, which triggers epithelialization and
S-II
formation of a boundary. Fissure formation is facilitated by repression of Cdc42 Mesp
and activation of integrin α5-fibronectin interactions downstream of ephrin-B2.
(A,B from Durbin et al. 2000.)
552 Chapter 17
Eph A4
in the chick embryo. (Courtesy
of J. Kastner.)
Rho family of small GTPases, such as Cdc42. Activated Ephrin B2 signaling leads to
the suppression of Cdc42 activity, which establishes a lower level of Cdc42 function in
the anterior half of somitomere zero (S0) compared to the posterior half of S0. A forced
reduction in Cdc42 activity leads to hyperepithelialized somites, whereas induced Cdc42
activity inhibits epithelialization (Nakaya et al. 2004;Watanabe et al. 2009). Therefore,
the progressive formation of boundaries by MET in the PSM is fulfilled by reducing
Cdc42 levels only in the peripheral cells of the somitomere, which creates a box around
the remaining mesenchymal cells which exhibit a higher level of Cdc42 until the next
subsequent fissure event. Although reductions in Cdc42 are required for epithelializa-
tion, differential regulation of other RhoGTPases, such as Rac1, are also involved in
epithelialization of somites (Burgess et al. 1995; Barnes et al. 1997; Nakaya et al. 2004).
In contrast to the repressive outcome of Eph A4-ephrin B2 signaling on Cdc42, this
signaling enhances the activity of integrin α5, which then serves to promote fibro-
nectin assemblies in the extracellular matrix surrounding the immature somite (see
Figure 17.11C; Lash and Yamada 1986; Hatta et al. 1987; Saga et al. 1997; Durbin et
al. 1998; Linask et al. 1998; Barrios et al. 2003; Koshida et al. 2005; Jülich et al. 2009;
Watanabe et al. 2009). This assembly of fibronectin reinforces epithelial cell separation
and completes somite boundary formation (Jülich et al. 2015; reviewed by McMillen
and Holley 2015).
The instructions for when to create a segmentation furrow are largely con- (A) Fgf8 (B) Raldh2 (C) Mesp
trolled by the clock-like oscillating signals of the Notch pathway. Each oscilla-
tion of Notch-Delta organizes groups of presomitic cells that will then segment
together at the appropriate threshold of Fgf signaling (see Maroto et al. 2012).
In the chick embryo, a new somite is formed about every 90 minutes. In mouse
embryos, this time frame is more variable but is closer to every 2 hours, whereas * * *
in zebrafish, a somite is formed approximately every 30 minutes (Tam 1981;
Kimmel et al. 1995).
S0 1
S-I
S-II
S-III 2
S-IV
S-V
S-VI 3
S-VII
S-VIII
S-IX
S-X
S-XI
S-XII
Tailbud
elongation
Posterior
RNA decay
gradient
Figure 17.14 A caudal Fgf8 gradient establishes the “determina- to form boundary locations at S-IV. Red arrows indicated points of
tion front.” (A) Schematic of a series of somitomere tissue reversals surgical inversion. (E,F) Fgf8 expression in the chick and mouse.
in which presomitic tissue at different axial locations was flipped Exonic and intronic in situ probes to reveal, respectively, any cell
along the anterior-posterior axis. (B–D) c-delta1 gene expression with Fgf8 mRNA or nuclear RNA (pre-RNA). Careful examination of
in chick embryos that had somitomere reversal at the axial level these results demonstrates two important properties of the Fgf8
denoted in the schematic. For each example, the control side is on gradient. The first is that the Fgf8 gene is actively transcribed only in
the left and the experimental side is on the right. Flipping somito- the tailbud (intronic probe). (G) The second property is that a gradi-
mere S0 showed complete commitment to maintain the positional ent of Fgf8 in the presomitic mesoderm is established by a mecha-
expression of c-delta1; thus, it was already determined. In contrast, nism of RNA decays. Green bar represents the caudal movement of
flipping somitomeres at positions S-VI and S-III showed, respec- cells actively transcribing Fgf8 and the trailing gradient is made by
tively, normal posterior expression of c-delta1 and disorganized RNA decay over time in cells no longer transcribing Fgf8. (A–D from
expression. These data suggested that cells become determined Dubrelle et al. 2001; E–G from Dubrelle and Pourquié 2004.)
when a somite boundary forms: the clock Scientists use the analogy of a clock
to describe the controls behind the periodicity of boundary (and somite) formation.
What would a molecular clock look like in an embryo? Does it have hands that physi-
cally tell a cell what time it is? What duration constitutes a period for this clock? In the
context of a cell, a clock can simply be the regular fluctuation of a protein’s activity on
Developmental Biology 11e
Fig. 17.14 and off, provided this change in activity is in fact repeated and rhythmic in nature. In
Dragonfly Media Group
06/06/16
Paraxial Mesoderm 555
the context of a tissue, however, this fluctuating protein timepiece needs to somehow
be communicated across a field of cells. Thus, one model for a molecular clock of somi-
togenesis would posit that the activity of a protein that regulates METs might become
functional in one cell of the PSM and as part of its function relay this event to its neigh-
boring cells through cell-to-cell interactions until its activity is cyclically inhibited. In
this way, each cell across a tissue could experience “on” and “off” states of protein
activity, or the ticking of a clock.
One of the key “clock” components that maintains the pace of somitogenesis is the
Notch signaling pathway (see Wahi et al. 2014). When a small group of cells from a
region constituting the posterior border at the presumptive somite boundary is trans-
planted into a region of presomitic mesoderm that would not ordinarily be part of the
boundary area, a new boundary is created. The transplanted boundary cells instruct
the cells anterior to them to epithelialize and separate. Nonboundary cells will not
induce border formation when transplanted to a nonborder area. However, these cells
can acquire boundary-forming ability if an activated Notch protein is electroporated
into them, which demonstrates that Notch signaling can induce the METs that underlie
somite formation (see Web Topic 17.1; Sato et al. 2002).
WEb Topic 17.1 Notch signaling and somite formation The Notch pathway
is one of the key agents in signaling where somites are to form.
Promoting METs is the behavioral output of this particular molecular clock, but for
Notch to represent this timekeeper, it would have to also satisfy the on-off rhythmicity
and transfer across cells. The endogenous level of Notch activity in the mouse PSM has
been visualized and shown to oscillate in a segmentally defined pattern that correlates
with boundary formation (Morimoto et al. 2005; Aulehla et al. 2008). Like a wave of
gene expression across the PSM, cells experience Notch upregulation and then down-
regulation from the caudal to rostral extents of the PSM. This wave of Notch expres-
sion crashes on somite 0, where a somite boundary forms at the interface between the
Notch-expressing and Notch-nonexpressing areas.
In addition, Notch signaling provides a mechanism to transfer this signal from cell-
to-cell across the PSM. As discussed in Chapter 4, full-length Notch forms a trans-
membrane protein that binds to its receptor, Delta, in adjacent cells. Delta is also a
transmembrane protein, and initial upregulation and presentation of Notch will trigger
a concomitant upregulation of Delta in adjacent cells, which in turn will reinforce Notch
in the other cells surrounding it. This is a pattern generating mechanism by Notch-Del-
ta signaling known as lateral inhibition . This receptor-to-receptor pairing provides a
mechanism for signal transfer throughout the PSM; however, this mechanism predicts
that the expression of Notch and Delta should display a mosaic pattern over the entire
PSM, yet it doesn’t. Like Notch, Delta also displays oscillatory expression patterns with
a posterior to anterior progression across the PSM—a key feature of the clock mecha-
nism. How is this possible?
Although there are interspecies differences in exactly which gene products oscillate,
in all vertebrate species the on-off ticking of the clock involves a negative feedback loop
of the Notch signaling pathway (Krol et al. 2011; Eckalbar et al. 2012). Thus, in all verte-
brates, at least one of the Notch target genes having dynamic oscillating expression in
the presomitic mesoderm is also able to inhibit the gene for Notch, which establishes a
negative feedback loop. These inhibitory proteins are unstable, and when the inhibitor
is degraded, Notch becomes active again. Such feedback creates a cycle (the “clock”) in
which the gene for Notch is turned on and off by the absence or presence of a protein
that Notch itself induces. These on-off oscillations could provide the molecular basis for
the periodicity of somite segmentation (Holley and Nüsslein-Volhard 2000; Jiang et al.
2000; Dale et al. 2003). Such oscillating Notch targets include Hairy1, Hairy/Enhancer of
split-related proteins (Her), and lunatic fringe, which are all activated by Notch, expressed
in a similar oscillating pattern throughout the PSM from the tailbud to the last formed
556 Chapter 17
Figure 17.15 Somite formation cor- (A) (B) (C) (D) Rostral
relates with wavelike expression of the
Somite
Hairy1 gene in the chick. (A) In the pos- S-0
S-0 S-0 S-0
terior portion of a chick embryo, somite S-I
SI has just budded off the presomitic S-I S-I S-I
mesoderm. Expression of the Hairy1 S-II S-II
gene (purple) is seen in the caudal half of
this somite as well as in the posterior por- Region of
tion of the presomitic mesoderm and in a Hairy1
thin band that will form the caudal half of expression
the next somite (S0). (B) A caudal fissure
(small arrow) begins to separate the new
somite from the presomitic mesoderm.
The posterior-most region of Hairy1
expression shifts anteriorly. (C) The newly Caudal
formed somite is now referred to as SI, 90 minutes
it retains the expression of Hairy1 in its (one somite forms)
caudal half. Again, the posterior-most
region of Hairy1 expression in the PSM
continues to shift anteriorly as well as
somite, and which all negatively feed back to repress Notch signaling (Chipman and
shortens. The former SI somite, now
Akam 2008; Pueyo et al. 2008). For instance, the Hairy1 gene was the first Notch target
called SII, undergoes differentiation.
(D) Creation of this newly formed somite found to show a rhythmic pattern of expression ( FIGURE 17.15). The Hairy1 gene is
SI is complete, and a new cycle of Hairy1 expressed first in a broad domain at the caudal end of the presomitic mesoderm. This
expression begins again. In the chick, expression domain moves anteriorly while narrowing until it reaches the rostral end
formation of each somite and the wave of of the PSM, at which time a new wave of expression begins in the caudal end. Aulehla
Hairy1 expression through the PSM takes and colleagues observed the waves of transcriptional activity of lunatic fringe in live
about 90 minutes.
mice embryos, which mimics the pattern seen of Hairy1. The time it takes for a wave of
expression to cross the presomitic mesoderm is 90 minutes in the chick, which is—not
coincidentally—the time it takes to form a pair of somites in this species. This dynamic
expression is not due to cell movement but to cells turning the gene on and off in dif-
ferent regions of the tissue through loops of negative feedback (Johnston et al. 1997;
Palmeirim et al. 1997; Jouve et al. 2000, 2002; Dale et al. 2003). Of relevance, loss of
function of Notch or its downstream cycling target genes in mice and humans leads to
major segmentation defects of the vertebrae, such as the spinal deformities in scoliosis
and spondylocostal dysostosis (FIGURE 17.16 ; Zhang et al. 2002; Sparrow et al. 2006).
Gilbert
Developmental Biology
terminating 11e, Sinauer
the notch Associates
clock with epithelialization As we discussed above,
DevBio11e_17.15 Date 05-20-16
Mesp is a global regulator of the Eph-Ephrin cascade that triggers MET and boundary
formation. Mesp is activated by Notch and, as a transcription factor, Mesp contributes
to the suppression of Notch (Morimoto et al. 2005). This cycle of alternating activation
and suppression causes Mesp expression to oscillate in time and space as well. Mesp
is initially expressed in a somite-wide domain; it is then repressed in the posterior half
of this domain but maintained in the anterior half, where it in turn represses Notch
activity. Wherever Mesp expression is maintained, that group of cells becomes the most
anterior in the next somite; Eph A4 is then induced, and the boundary forms immedi-
ately anterior to those cells (see Figure 17.11C; Saga et al. 1997; Watanabe et al. 2005).
In the posterior half of the prospective somite, where Mesp is not expressed, Notch
activity induces the expression of the transcription factor Uncx4.1, which contributes to
the specification of the somite’s posterior identity (Takahashi et al. 2000; Saga 2007). In
this way, the somite boundary is determined, and the somite is given anterior/posterior
polarity at the same time.
Paraxial Mesoderm 557
being at the right place at the right time: connecting the clock and the
determination front More posteriorly positioned PSM cells experiencing waves
of Notch signaling do not prematurely epithelialize because these cells are not com-
petent to sufficiently respond to Notch signaling due to the influence of FGFs. As long Developing Questions
as the presomitic mesenchyme is in a region of relatively high Fgf8 concentration, the
Is the clock analogy
clock will not function. At least in zebrafish, this lack of function appears to be due to sufficient? It certainly helps
the repression of Delta, the major ligand of Notch. The binding of Fgf8 to its receptor us understand the critical
enables the expression of the Her13.2 protein, which is necessary to inhibit transcrip- mechanisms influencing
tion of Delta (see Dequéant and Pourquié 2008). FGF signals are needed to get cells to somitogenesis. Like all
migrate anteriorly out of the tailbud, but as long as FGFs activate the ERK transcription clock analogies, however,
factors, the cells remain unresponsive to Notch ligands. It has recently been proposed it makes the assumption
that the rate of time stays
that Fgf8 synthesis also cycles, but at a different frequency than the Notch ligands
constant. Work in the
(Niwa et al. 2011; Pourquié 2011). Thus, through a combination of a sloping concentra- lab of Andrew Oates has
tion gradient of Fgf8 and its own unique pattern of cycling (probably by synthesizing demonstrated that, due to
its own inhibitors and by inhibition by retinoic acid), FGF signaling is downregulated the gradual change in the
in certain areas of the paraxial mesoderm, and cells in these regions become progres- rate of axis elongation over
sively more competent to respond to Notch signals (FIGURE 17.17 ). FGFs therefore time in zebrafish, the waves
establish the placement (i.e., determination front) of cells that are competent to respond of oscillating segmentation
genes (the period from
to oscillating Notch signals (the clock), which can induce Mesp2 to initiate METs and
onset to arrest) are also
Eph-mediated segment formation.5 shortening, a phenomenon
the researchers compare
how many somites to form? the rate of oscillations to the rate of axis to the Doppler effect
elongation A consequence of epithelialization depending on both receiving a (Soroldoni et al. 2014).
Notch-mediated wave of gene expression (as an “okay to segment”) and becoming How are the different
competent based on an Fgf8 concentration threshold means that the size and number of facets of somitogenesis
(axis elongation, the
somites is based on two factors: the rate of segmenting oscillations and the rate of axis
determination front,
elongation. In fact, it is the ratio of these two rates that sets the parameters for somite epithelialization, and
number and size. For instance, let us represent the rate of the clock as τ and the rate of the clock) intricately
axis elongation as α. If α is both sustained and in balance with τ, an infinite number coordinated to respond
of identically sized somites are theoretically possible. Alternatively, if τ is faster than to change? If time is not
steady, what new model
5
Pourquié (2011) has noted that this situation seems a lot like the one that exists in the limb can you come up with
bud (see Chapter 19), wherein a pool of newly formed cells that has been maintained by FGFs to integrate all these
in a relatively undifferentiated
Developmental Biology 11e and migratory state becomes differentiated into periodic ele- mechanisms?
ments
Fig. (limb cartilage) by interacting gradients of FGFs and retinoic acid.
17.16
Dragonfly Media Group
05/20/16
558 Chapter 17
Figure 17.17 Possible model for “clock-wave- SII SII SII SIII
front” somite specification. In each panel, the Somite
SI SI SI SII
FGF-induced transcription factor (pERK) and the
somite-specifying transcription factor (Mesp) are SI
Mesp
shown on the left, and the Notch-generated tran-
on
scription factor (NICD) and the inhibitory protein
Hes7 induced by NICD are shown on the right. Presomitic
mesoderm pERK pERK
(After Niwa et al. 2011.) pERK
on off
on
Time
Mesp pERK NICD Hes7
α somite formation will eventually catch up to the tailbud and terminate somitogen-
esis. The current model for the termination of somitogenesis is that axis elongation (α)
slows, and as new somites become progressively closer to the tailbud, they bring with
them the inhibitory actions of retinoic acid that arrest tailbud development (Gomez
and Pourquié 2009).
Somite size could also be altered in predictable ways by manipulating these rates.
Comparative analysis of somitogenesis across species has suggested that modulation
of the rate of the molecular clock has been a major mechanism for adaptation of somite
number. As an example, snakes can have several hundred somites, compared to the
approximately 60 found in the mouse and chick and approximately 30 found in zebra-
fish. Olivier Pourquié and colleagues compared the rates of PSM elongation and the
segmentation clock exhibited by corn snake, mouse, and chick (among other species).
The snake’s somites are about three times smaller than the somites of the mouse or
chick (Gomez et al. 2008). Although the PSM of snakes is modestly larger than that of
the chick or mouse, the most significant contribution to the greater number of smaller
somites in snakes is a highly accelerated clock. Genes such as lunatic fringe were found
to show upwards of 9 bands of oscillations in snakes, compared to 1–3 bands found in
the chick and mouse (FIGURE 17.18; Gomez et al. 2008). Therefore, a greater number
of Notch-mediated oscillations over the course of axis elongation will divide the PSM
more times, creating more somites and more vertebrae.
(A) (C)
118 somites 255 somites 315 somites Corn snake Chicken Mouse Zebrafish
Figure 17.18 How many somites does a snake have? (A) Embryos of corn snakes at
three different stages during somitogenesis. (B) Corn snakes have threefold more oscilla- Anterior PSM Posterior PSM
tions of Lunatic fringe expression in the PSM compared to similar-stage mouse embryos. Cyclic gene expression
(C) Four vertebrates and their patterns of somite formation. (A, B from Gomez et al. 2008;
C after Gomez and Pourquié 2009.)
to Notch, can upregulate at least three different Hox paralogue groups and initiate a
positive feedback loop with these Hox proteins (Peres et al. 2006). Based on this asso-
ciation, it is tempting to speculate that the segmentation clock might directly trigger the
timed activation of Hox genes; it is unknown, however, whether this influence occurs
in a collinear fashion or involves chromatin modifications as described above for Hox
gene expression.
Once Hox gene expression along the trunk is initiated, it will feed back upon the
determination front to terminate axis elongation and end somitogenesis. Specifically,
the collinear activation of the expression of Hox genes closer to the 5′ end of the clusters
results in a progressively greater repression of Wnt signaling in the tailbud (FIGURE
17.19; Denans et al. 2015). Recall that Wnt3a is secreted from the tailbud and displayed
in a caudal-to-rostral gradient similar to Fgf8. Wnt3a functions to promote the migra-
tion of neuromesoderm progenitors into the PSM, and in doing so fuels PSM growth
and axis elongation (Dunty et al. 2008). Thus, as new cells move into the PSM over
time and start to express increasingly more 5′ Hox genes with temporal collinearity,
Wnt signaling is progressively inhibited, and tailbud growth slows. In amniotes, the
segmentation clock does not significantly alter its rate during this time; therefore, the
rate of somite formation will outpace tailbud growth and exhaust the PSM, leading to
the end of somitogenesis (Denans et al. 2015). Moreover, Hox gene-mediated slow-
ing of tailbud growth is reinforced by the indirect repression of FGF signaling in two
Developmental Biology 11e
ways.
Fig. First, the encroaching reach of retinoic acid from the somites will inhibit FGF
17.18
expression withGroup
Dragonfly Media greater effectiveness; second, Wnt and FGF signaling will function in
a positive
05/13/16 feedback loop, maintaining each other’s expression in the tailbud (Aulehla
et al. 2003; Young et al. 2009; Naiche et al. 2011). Due to the progressive repression
560 Chapter 17
of Wnt signaling, FGF will indirectly also become downregulated over time. That, in
turn, will lead to the downregulation of Cyp26A1, providing further redundancy for
the hyperactivation of retinoic acid (Iulianella et al. 1999). Taken together, we have a
model in which the temporal collinear activation of 5′ Hox genes puts the brakes on
axis elongation through the direct inhibition of Wnt signaling, which indirectly halts
the determination front and exhausts the PSM (Denans et al. 2015).
Sclerotome Development
As a somite matures, it becomes divided into two major compartments, the sclero-
tome and the dermomyotome. These compartments are found in all vertebrates, and
similar structures are found in the cephalochordate amphioxus (lancelets), our closest
invertebrate relatives, indicating that they are ancient embryonic structures (Devoto
et al. 2006; Mansfield et al. 2015). How the sclerotome and dermomyotome develop is
a complex story involving epithelial-to-mesenchymal transitions (EMTs) and signal-
ing cascades. Here we turn to the development of the sclerotome, with a discussion of
dermomyotome formation to follow.
Shortly after somite formation, the outer epithelial cells and inner core of mesen-
chymal cells begin to show signs of differentiation (FIGURE 17.20A,E ). The first visible
indicator occurs in the ventromedial portion of the somite, where an EMT occurs to
form the sclerotome (FIGURE 17.20B). This EMT is important to establish a migratory
population of cells capable of moving into position around the midline axial structures
and building the vertebral column. Just prior to the transition, sclerotome progenitor
cells express the transcription factor Pax1, which is required for their transition into
a mesenchyme and subsequent differentiation into cartilage (Smith and Tuan 1996).
In this transition, the epithelial cells lose N-cadherin expression and become motile
mesenchyme ( FIGURE 17.20C,D,F; Sosic et al. 1997). Sclerotome cells also express
inhibitors of the muscle-forming transcription factors—myogenic regulatory factors,
or MRFs—which we will discuss soon (Chen et al. 1996).
As mentioned near the start of this chapter, the mesenchymal cells that make up
the sclerotome can be subdivided into several regions (see Figure 17.2E). Although
most sclerotome cells become precursors of the vertebral and rib cartilage, the dorsal
sclerotome forms the syndetome, giving rise to tendons, and the medial sclerotome
cells closest to the neural tube generate the meninges (coverings) of the spinal cord
Developmental Biology 11e
as well as giving rise to blood vessels that will provide the spinal cord with nutrients
Fig. 17.19
and oxygen
Dragonfly (Halata et al. 1990; Nimmagadda et al. 2007). The cells in the center of the
Media Group
somite
05/31/16 (which remain mesenchymal) also contribute to the sclerotome, becoming the
Paraxial Mesoderm 561
4
Neural tube
1 6
Sclerotome
progenitors
8
Floorplate Somite
5
Notochord 7
2
Dermomyotome
Myoblasts
BMP4
Epidermis Primaxial ?
Proliferating (back) NT3,
myoblasts Wnt1 Pax3, 7
muscles
Wnt
Wnt1,
Dermatome 3a
(dermis) Myf Pax3
Abaxial (body wall 5 MyoD
and limb) muscles
Pax1 BMP4,
Fgf5
Dermomyotome
Sclerotome Neural Shh
tube Shh
Dorsal
Neural Dermomyotome
tube Sclerotome
Vertebral
body
Notochord
Aorta
Ventral
(B)
Neural tube
Incipient spinal nerve Vertebra Nerve Muscle
Sclerotome Rostral segment
Myotome
Caudal segment
irregular bone deposition, vertebral fusion and curvature of the spine akin to scoliosis
in humans (FIGURE 17.23A,B ; Gray et al. 2014).
What happens to the notochord in the adult? A common misconception is that after
the notochord has provided inductions and axial support, it completely degenerates.
There is some truth to this idea in that some of the notochordal cells appear to die by
apoptosis once the vertebrae have formed, likely signaled by mechanical forces. It is
interesting, however, that those same tensile forces from invading vertebrae also seg-
ment the notochord into smaller units, which are retained and develop into the nuclei
pulposi (Aszódi et al. 1998; Choi et al. 2008; Guehring et al. 2009; McCann et al. 2011;
Risbud and Shapiro 2011; reviewed in Chan et al. 2014; Lawson and Harfe 2015). Most
important is that the notochordal origin of nuclei pulposi has been demonstrated
through lineage tracing experiments in the mouse (Choi et al. 2008; McCann et al. 2011).
The nuclei pulposi form a gel-like mass in the center of the intervertebral discs, which
Figure 17.23 Development of the spinal column and intervertebral discs. (A) Collagen
8a1a is normally expressed throughout the spinal column, as revealed by this Col2a1 trans-
genic zebrafish reporter (green). (B) Loss of Col8a1a clearly results in a failure to properly form
a straight spine and the presence of fused vertebrae, as visualized with Alizarin red staining
(magenta) for bone. (C) A vertebra with associated nucleus pulposus (NP) in an E15.5 mouse.
Vertebra (V); annulus fibrosis (AF). (D) A model of how the notochordal sheath functions to
maintain small portions of the notochord as they develop into the nuclei pulposi. Loss of proper
Sonic hedgehog signaling (in smoothened mutants) results in varying degrees of notochord
sheath reductions and consequently a failure to form nuclei pulposi. (dpf, days post fertiliza-
tion.) (A,B from Gray et al. 2014; C from Lawson and Harfe 2015; D after Choi and Harfe 2011.)
10 dpf
10 dpf
20 dpf
Scleraxis
Digits
Figure 17.24 Scleraxis is expressed in the progenitors of the tendons. (A) In situ hybridiza-
tion showing the pattern of scleraxis expression in the developing chick embryo. (B) Limb,
wrist, and digits of a newborn mouse, showing scleraxis (fused to GFP) in the tendons (green)
connecting muscles (stained red with antibodies to myosin). The neurons have been stained
blue by antibodies to neurofilament proteins. (A from Schweitzer et al. 2001, courtesy of R.
Schweitzer; B courtesy of A. K. Lewis and G. Kardon.)
are surrounded by the annulus fibrosus, a connective tissue derived from sclerotome
(FIGURE 17.23C). Those are the spinal discs that “slip” in certain back injuries.
Little is known about the mechanisms regulating intervertebral disc formation, but it
appears that the notochordal sheath is essential to the development of the nuclei pulpo- Developing Questions
si (Choi and Harfe 2011; Choi 2012). In experiments that cause a weakened extracellular
Some species do not
sheath to form, pressure from the forming vertebral bodies disperse the notochord cells,
develop nuclei pulposi; the
and the nuclei pulposi fail to form (FIGURE 17.23D; Choi and Harfe 2011). chick is one such species.
What becomes of notochord
Tendon formation: The syndetome cells in these animals?
The most dorsal part of the sclerotome will become the fourth compartment of the Do they all degenerate,
somite, the syndetome. The tendon-forming cells of the syndetome can be visualized or do some contribute
by their expression of the scleraxis gene (FIGURE 17.24 ; Schweitzer et al. 2001; Brent to other structures of
the spine? In addition,
et al. 2003). Because there is no obvious morphological distinction between the sclero-
although mechanical
tome
Gilbert and syndetome cells (they are both mesenchymal), our knowledge of this somitic forces seem to contribute
compartment had to11ewait
Developmental Biology untilAssociates
, Sinauer we had molecular markers (Pax1 for the sclerotome, to the development of
DevBio11e_17.24
scleraxis Date 05-31-16
for the syndetome) that could distinguish between them and allow researchers nuclei pulposi, do any
to follow the cells’ fates. molecular cues also guide
Because the tendons connect muscles to bones, it is not surprising that the syndetome their formation? Consider
(Greek syn, “connected”) is derived from the most dorsal portion of the sclerotome—that the array of guidance
cues expressed in midline
is, it is derived from sclerotome cells adjacent to the muscle-forming myotome ( FIG-
structures (Eph-ephrins,
URE 17.25A). The syndetome is made from the myotome’s secretion of Fgf8 onto the
netrins, slits); could
immediately subjacent row of sclerotome cells (Brent et al. 2003; Brent and Tabin 2004). they be instructing the
Other transcription factors limit the expression of scleraxis to the anterior and posterior coalescence of notochord
portions of the syndetome, causing two stripes of scleraxis expression (FIGURE 17.25B). cells into segmented foci?
Meanwhile, the developing cartilage cells, under the influence of Sonic hedgehog Amazingly, despite the
from the notochord and floor plate, synthesize the Sox5 and Sox6 transcription factors “central” role the notochord
plays in development,
that block scleraxis transcription while activating the cartilage-promoting factor Sox9
fundamental questions
(Yamashita et al. 2012). In this way, the cartilage protects itself from any spread of the about the development of
Fgf8 signal. The tendons then associate with the muscles directly above them and with its own cell lineage remain.
the skeleton (including the ribs) on either side of them (FIGURE 17.25C; Brent et al. 2005).
566 Chapter 17
(A) (B)
Myotome
(muscle)
Dermatome Dermatome
FGF
Sclerotome
(C)
Neural tube Vertebral progenitors Tendon Sox9 Scleraxis
(cartilage) progenitors Tendons
Anterior Sox5,
Sox6
Rib
Cartilage Tendon
Somite-derived
Lateral plate-derived
Somitic muscle
the dermomyotome to produce the myotome (see Figure 17.25A). Those myoblasts in
the myotome closest to the neural tube form the centrally located primaxial muscles,6
which include the intercostal musculature between the ribs and the deep muscles of the
back; those myoblasts farthest from the neural tube produce the abaxial muscles of
the body wall, limbs, and tongue. The dermatome is located in the centralmost region
of the dermomyotome and will form back dermis and several other derivatives. The
boundary between the primaxial and abaxial muscles and between the somite-derived
and lateral plate-derived dermis is called the lateral somitic frontier (FIGURE 17.26 ;
Christ and Ordahl 1995; Burke and Nowicki 2003; Nowicki et al. 2003). Various tran-
scription factors distinguish the primaxial and abaxial muscles.
The dermis of the ventral portion of the body is derived from the lateral plate, and
the dermis of the head and neck comes, at least in part, from the cranial neural crest.
However, in the trunk the dermatome’s major product is the precursors of the dermis
of the back. In addition, recent studies have shown that this central region of the der-
momyotome also gives rise to a population of muscle cells (Gros et al. 2005; Relaix et al.
2005). Therefore, some researchers (Christ and Ordahl 1995; Christ et al. 2007) prefer to
retain the term dermomyotome (or central dermomyotome) for this epithelial region. Soon,
this part of the somite also undergoes an epithelial-to-mesenchymal transition. FGF
signals from the myotome activate the transcription of the Snail2 gene in the central
dermomyotome cells, and the Snail2 protein is a well-known regulator of EMT (see
Figure 15.9; Delfini et al. 2009). During EMT, the mitotic spindles of the epithelial cells
are realigned so that cell division takes place along the dorsal-ventral axis. The ventral
daughter cell joins the other myoblasts from the myotomes, while the other daughter cell
Gilbert
Developmental Biology
locates dorsally, 11e, Sinauer
becoming Associates of the dermis. Reminiscent of sclerotome EMT
a precursor
DevBio11e_17.26 Date 05-31-16
progression, the N-cadherin holding these cells together is downregulated, and the two
daughter cells go their separate ways, with the remaining N-cadherin found only on
those cells entering the myotome (Ben-Yair and Kalcheim 2005).
6
As used here, the terms primaxial and abaxial designate the muscles from the medial and
lateral portions of the somite, respectively. The terms epaxial and hypaxial are commonly used,
but these terms are derived from secondary modifications of the adult anatomy (the hypaxial
muscles being innervated by the ventral regions of the spinal cord) rather than from the somitic
myotome lineages (see Nowicki 2003).
568 Chapter 17
The muscle precursor cells that delaminate from the epithelial plate to join the pri-
mary myotome cells remain undifferentiated, and they proliferate rapidly to account for
most of the myoblast cells. While most of these progenitor cells differentiate to form
muscles, some remain undifferentiated and surround the mature muscle cells. These
undifferentiated cells become skeletal muscle stem cells called satellite cells, and they
are responsible for postnatal muscle growth and muscle repair.
Neural Wnts
Shh
Myf5
tube
Low (Mef, six1/4)
Floor plate
Pax3 BMP4 Noggin MyoD Myogenin,
Myogenin, (hypaxial lip) MRF4,
MRF4 MRF5
Lateral plate
mesoderm Figure 17.27 Differential gene
Neural tube expression in myotome. (A) The primaxial
Ectoderm myotome is thought to be specified by a
combination of Wnts (probably Wnt1 and
Wnt3a) from the dorsal neural tube and
low concentrations of Sonic hedgehog
from the floor plate of the neural tube.
Pax3 in somitic cells allows expression
Lateral plate of Myf5 in response to paracrine factors,
mesoderm Notochord Somite which allows the cells to synthesize the
myogenic transcription factor Myf5. In
combination with a Six protein and Mef2,
the Mef2 (myocyte enhancer factor-2) family of proteins. MyoD can activate the Mef2 Myf5 activates the genes responsible for
gene and thereby regulate the differential timing of muscle gene expression. activating myogenin and MRF4. (B) BMP4
As discussed above, the myotome is induced in the somite at two different places is inhibited by Noggin produced by cells
by at least two distinct signals (see Punch et al. 2009). Studies using transplantation that migrate specifically to the lips of the
somite. In the absence of BMP4, Wnt
and knockout mice indicate that the primaxial myoblasts from the medial portion of
proteins from the epidermis are thought
the somite are induced by factors from the neural tube—probably Wnt1 and Wnt3a to induce the abaxial myotome. (After
from the dorsal region and low levels of Sonic hedgehog from the floor plate of the Punch et al. 2009.)
neural tube (see Figure 17.21; Münsterberg et al. 1995; Stern et al. 1995; Borycki et al.
2000). These factors induce the Pax3-containing cells of the somite to activate the Myf5
gene in the primaxial myotome. Myf5 (in concert with Mef2 and either Six1 or Six4)
activates the myogenin and MRF4 genes, whose proteins activate the muscle-specific
gene regulatory network (see Figure 17.27A; Buckingham et al. 2006). The cells of the
primaxial myotome appear to be originally confined by the laminin extracellular matrix
that outlines the dermomyotome and myotome. As the myoblasts mature, however, this
matrix dissolves, and the primaxial myoblasts migrate along fibronectin cables. Eventu-
ally, they align, fuse, and elongate to become the deep muscles of the back, connecting
to the developing vertebrae and ribs (Deries et al. 2010, 2012).
The abaxial myoblasts that form the limb and ventral body wall musculature arise
from the lateral edge of the somite. Two conditions appear necessary to produce these
muscle precursors: (1) the presence of Wnt signals and (2) the absence of BMPs (see
Figure 17.27B; Marcelle et al. 1997; Reshef et al. 1998). Wnt proteins (especially Wnt7a)
are made in the epidermis (see Figure 17.23; Cossu et al. 1996a; Pourquié et al. 1996;
Dietrich et al. 1998), but the BMP4 made by the adjacent lateral plate mesoderm would
normally prevent muscles from forming.
What, then, is inhibiting BMP activity? Several studies on chick embryos have found
that the dorsomedial and ventrolateral lips of the dermomyotome have attached at their
tips a population of cells that secrete the BMP inhibitor Noggin (Gerhart et al. 2006,
2011). These Noggin-secreting cells arise in the blastocyst, become part of the epiblast,
and distinguish themselves by expressing the mRNA for MyoD but not translating this
mRNA
Gilbert into protein. These particular cells migrate to become paraxial mesoderm, spe-
Developmental
cifically Biology
sorting out 11e, Sinauer
to the Associates and ventrolateral lips of the dermomyotome.
dorsomedial
DevBio11e_17.27 Date 05-31-16
There they synthesize and secrete Noggin, thus promoting differentiation of myoblasts.
If Noggin-secreting cells are removed from the epiblast, there is a decrease in the skeletal
musculature throughout the body, and the ventral body wall is so weak that the heart
570 Chapter 17
(A) Control (B) Ablated Figure 17.28 Ablating Noggin-secreting epiblast cells results in severe
muscle defects. Noggin-secreting epiblast cells were ablated in stage 2 chick
embryos using antibodies against G8. (A) The control embryo has normal
morphology (upper photograph) and abundant staining of myosin (lower pho-
tograph, red) in the muscles. (B) Embryos whose Noggin-secreting epiblast
cells are ablated have severe eye defects, severely reduced somatic muscu-
lature, and herniation of abdominal organs through the thin abdominal wall
(upper photograph, arrow). Severely reduced musculature (sparse myosin
in lower photograph) is characteristic of these embryos. (From Gerhart et al.
2006, courtesy of J. Gerhart and M. George-Weinstein.)
(A) (B)
NT
DML
DML
NT TZ
TZ
MY MY
(C)
cWNT1 HNK1 Merge
Nuclei
Acetylated tubulin
cWNT1
NT NT NT HNK1 (neural
S S crest marker)
S
Wnt1
myoblasts into muscle cells, which helps to maintain the pool of myogenic progeni-
tors (Ho et al. 2011). Thus, like a bee unknowingly carrying pollen to flowers along its
journey, a neural crest cell delivers morphogenic signals to cells throughout the somite
that influence their differentiation and growth.
Endochondral ossification
Figure 17.30 Schematic diagram of Endochondral ossification involves the formation of cartilage tissue from aggregated
endochondral ossification. (A) Mesenchy- mesenchymal cells and the subsequent replacement of cartilage tissue by bone (Horton
mal cells commit to becoming cartilage 1990). This type of bone formation is characteristic of the vertebrae, ribs, and limbs. The
cells (chondrocytes). (B) Committed vertebrae and ribs form from the somites, while the limb bones form from the lateral
mesenchyme condenses into compact plate mesoderm (see Chapter 19). Endochondral ossification can be divided into five
nodules. (C) Nodules differentiate into stages: commitment, compaction, proliferation, growth, and, finally, chondrocyte death
chondrocytes and proliferate to form the
and the generation of new bone.
cartilage model of bone. (D) Chondro-
cytes undergo hypertrophy and apop-
tosis while they change and mineralize phases 1 and 2: commitment and compaction First, the mesenchymal cells
their extracellular matrix. (E) Apoptosis commit to becoming cartilage (FIGURE 17.30A ). This commitment is stimulated by
of chondrocytes allows blood vessels to Sonic hedgehog, which induces nearby sclerotome cells to express the Pax1 transcrip-
enter. (F) Blood vessels bring in osteo- tion factor (Johnson et al. 1994; Teissier-Lavigne 1994). Pax1 initiates a cascade that is
blasts, which bind to the degenerating dependent on external paracrine factors and internal transcription factors.
cartilaginous matrix and deposit bone
During the second phase of endochondral ossification, the committed mesenchyme
matrix. (G) Bone formation and growth
consist of ordered arrays of proliferating, cells condense into compact nodules (FIGURE 17.30B). These inner cells become com-
hypertrophic, and mineralizing chondro- mitted to generating cartilage, and the outer cells become committed to becoming bone.
cytes. Secondary ossification centers
also form as blood vessels enter near the
tips of the bone. (After Horton 1990.)
Epiphyseal
growth
plate
Bone
marrow
Bone
Epiphyseal
growth
Commited cartilage Compact Proliferating Hypertrophic Osteoblasts Blood Proliferating plate
(mesenchymal) nodules chondrocytes chondrocytes (bone) vessel chondrocytes
cells
BMPs appear to be critical in this stage. They are responsible for inducing the expression
of the adhesion molecules N-cadherin and N-CAM and the transcription factor Sox9.
N-cadherin appears to be important in the initiation of these condensations, and N-CAM
critical for maintaining them (Oberlender and Tuan 1994; Hall and Miyake 1995). Sox9
activates other transcription factors as well as a suite of genes, including those encoding
collagen II and aggrecan, which are required in cartilage function. In humans, mutations
of the SOX9 gene cause camptomelic dysplasia, a rare disorder of skeletal development
that results in deformities of most of the bones of the body. Most affected babies die from
respiratory failure due to poorly formed tracheal and rib cartilage (Wright et al. 1995).
phases 3 and 4: proliferation and growth During the third phase of endo-
chondral ossification, the chondrocytes proliferate rapidly to form a cartilaginous model
for the bone ( FIGURE 17.30C). As they divide, the chondrocytes secrete a cartilage-
specific extracellular matrix. The outermost cells become the perichondrium that
ensheaths the cartilage.
In the fourth phase, the chondrocytes stop dividing and increase their volume dra-
matically, becoming hypertrophic chondrocytes (Figures 17.30D and 17.31). This step
appears to be mediated by the transcription factor Runx2 (also called CBFα1), which
(A)
phase 5: chondrocyte death and bone cell generation In the fifth phase, the
hypertrophic chondrocytes die by apoptosis (Hatori et al. 1995; Rajpurohit et al. 1999).
The hypertrophic cartilage is replaced by bone cells both on the outside and inside,
and blood vessels invade the cartilage model (FIGURE 17.30E–G). On the outside, the
osteoblasts begin forming bone matrix, constructing a bone collar around the calcified
and partially degraded cartilage matrix (Bruder and Caplan 1989; Hatori et al. 1995; St-
Jacques et al. 1999). The osteoblasts become responsive to Wnt signals that upregulate
Osterix, a transcription factor that instructs the osteoblasts to become mature bone
cells, or osteocytes (Nakashima et al. 2002; Hu et al. 2005).
New bone material is added peripherally from the internal surface of the periosteum,
a fibrous sheath covering the developing bone. The periosteum contains connective tis-
sue, capillaries, and bone progenitor cells (Long et al. 2012). At the same time, there is a
hollowing out of the internal region of the bone to form the bone marrow cavity. As car-
tilage cells die, they alter the extracellular matrix, releasing VEGF, which stimulates the
formation of blood vessels around the dying cartilage. If the blood vessels are inhibited
from forming, bone development is significantly delayed (Karsenty and Wagner 2002;
Yin et al. 2002). The blood vessels bring in both osteoblasts and osteoclasts, multinucle-
ated cells that eat the debris of the apoptotic chondrocytes and thus create the hollow
bone marrow cavity (Kahn and Simmons 1975; Manolagas and Jilka 1995). Osteoclasts
are not derived from the somite; rather, they are derived from a blood cell lineage (in
the lateral plate mesoderm) and come from the same precursors as macrophage blood
cells (Ash et al. 1980; Blair et al. 1986).
stem cells, and mechanical forces appear to be significant in the forma- (A) (B)
tion of bones, muscles, and tendons, and perhaps also for their repair
and regeneration in the adult. However, very little is known about how
mechanical stress is sensed, quantified, and transmitted as a change in
cytoplasmic chemicals.
Vertebrate skeletal bone development shows some dependence on Fibular
mechanotransduction. Tension and stress forces activate the gene for crest
Indian hedgehog (Ihh), a paracrine factor that activates the bone mor-
phogenetic proteins (BMPs; Wu et al. 2001). In the chick, several bones
do not form if embryonic movement in the egg is suppressed. One of
these bones is the fibular crest, which connects the tibia directly to
the fibula (FIGURE 17.32A,B). This direct connection is believed to be
important in the evolution of birds, and the fibular crest is a universal (C)
feature of the bird hindlimb (Müller and Steicher 1989; Müller 2003).
The jaws of cichlid fish differ enormously, depending on the food they
eat (FIGURE 17.32C; Meyer 1987). Similarly, normal primate jaw develop-
ment may be predicated on how much tension is produced by grinding
food: mechanical tension appears to stimulate Indian hedgehog expres-
sion in mammalian mandibular cartilage (Tang et al. 2004). If an infant
monkey is given soft food, its lower jaw is smaller than normal. Corruc-
cini and Beecher (1982, 1984) and Varrela (1992) have shown that people
in cultures where infants are fed hard food have jaws that “fit” better,
and these researchers speculate that soft baby food may explain why so
many children in Western societies need braces. Indeed, the notion that
mechanical tension can change jaw size and shape is the basis of the
functional hypothesis of modern orthodontics (Moss 1962, 1997).
In mammals, muscle force within the embryo is critical for the nor-
mal shaping of bone and the development of load-bearing capacity 1 cm
(Sharir et al. 2011). After birth, the patella (kneecap) is formed by pres-
Figure 17.32 Phenotypes can be produced by stress
sure on the skeleton, and it is thought that the aberrant skeletal devel-force on muscular and skeletal tissues. (A,B) The avian
opment seen in persons with cerebral palsy is caused by the absence of fibular crest (syndesmosis tibiofibularis) connects the tibia
pressure on these bones (Shefelbine and Carter 2004; Ward et al. 2006). directly to the fibula. The fibular crest is formed when
the movement of the active embryo inside the egg puts
WEb Topic 17.2 Paracrine factors, their receptors, and physical stress on the tibia. (A) Fibular crest forming in the
human bone growth Mutations in the genes encoding para- connective tissue of a 13-day chick embryo. (B) Absence
of fibular crest in the connective tissue of a 13-day embryo
crine factors and their receptors cause numerous skeletal anomalies in
whose movement was inhibited. The blue dye stains car-
humans and mice.
tilage; the red dye stains the bone elements. (C) The jaws
of cichlid fish are shaped by the hardness of the food they
eat. Different diets give different jaw structures. (A,B from
Maturation of Muscle Müller 2003, courtesy of G. Müller; C from Meyer 1987,
courtesy of A. Meyer.)
Myoblasts and myofibers Gilbert
Developmental Biology 11e, Sinauer Associates
The cells producing the myogenic regulatory factors are the myoblasts—committed
DevBio11e_17.33 Date 05-16-16
muscle cell precursors—but unlike most cells of the body, muscle cells do not function
as “individuals.” Rather, several myoblasts align together and fuse their cell membranes
to form a myofiber, a single large cell with several nuclei that is characteristic of muscle
tissue (Konigsberg 1963; Mintz and Baker 1967; Richardson et al. 2008). Myofibers in
the adult can be the result of thousands of fusion events involving mononucleated
cells. Studies on mouse embryos show that by the time a mouse is born, it has the adult
number of myofibers and that these multinucleated myofibers grow during the first
week after birth by the fusion of singly nucleated myoblasts (Ontell et al. 1988; Abmayr
and Pavlath 2012). After the first week, muscle cells can continue to grow by the fusion
of muscle stem cells (satellite cells, discussed later) into existing myofibers and by an
increase in contractile proteins within the myofibers.
576 Chapter 17
myoblast fusion The first step in fusion requires the myoblasts to exit the cell cycle,
which involves expression of cyclin D3 (Gurung and Pamaik 2012). Next, the myo-
blasts secrete fibronectin and other proteins onto their extracellular matrices and bind
to it through α5β1 integrin, a major receptor for these extracellular matrix components
(Menko and Boettiger 1987; Boettiger et al. 1995; Sunadome et al. 2011). If this adhesion
is experimentally blocked, no further muscle development ensues; thus, it appears that
the signal from the integrin-fibronectin attachment is critical for instructing myoblasts
to differentiate into muscle cells (FIGURE 17.33).
The third step is the alignment of the myoblasts into chains. This step is mediated
by cell membrane glycoproteins, including several cadherins (Knudsen 1985; Knudsen
et al. 1990). Recognition and alignment between cells take place only if the cells are
myoblasts. Fusion can occur even between chick and rat myoblasts in culture (Yaffe
and Feldman 1965); the identity of the species is not critical. The internal cytoplasm is
rearranged in preparation for the fusion, with actin regulating the regions of contact
between the cells (Duan and Gallagher 2009).
The fourth step is the cell fusion event itself. As in most membrane fusions, calcium
ions are critical, and fusion can be activated by calcium transporters, such as A23187,
that carry Ca2+ across cell membranes (Shainberg et al. 1969; David et al. 1981). Fusion
appears to be mediated by a set of metalloproteinases called meltrins. Meltrins were
discovered during a search for myoblast proteins that would be homologous to fertilin,
a protein implicated in sperm-egg membrane fusion. Yagami-Hiromasa and colleagues
(1995) found that one of these proteins, meltrin-α, is expressed in myoblasts at about
the same time that fusion begins, and that antisense RNA to the meltrin-α message
inhibited fusion when added to myoblasts. As the myoblasts become capable of fusing,
another myogenic regulatory factor— myogenin —becomes active. Myogenin binds to
the regulatory region of several muscle-specific genes and activates their expression.
Thus, whereas MyoD and Myf5 are active in the lineage specification of muscle cells,
(G)
Figure 17.33 Conversion of myoblasts into muscles in culture. (A) Determination of
myotome cells by paracrine factors. (B) Committed myoblasts divide in the presence
of growth factors (primarily FGFs) but show no obvious muscle-specific proteins. (C–E)
When the growth factors are used up, the myoblasts cease dividing, align, and fuse into
myotubes. (F) The myotubes become organized into muscle fibers that spontaneously
contract. (G) Autoradiograph showing DNA synthesis in myoblasts and the exit of fus-
ing cells from the cell cycle. Phospholipase C can “freeze” myoblasts after they have
aligned with other myoblasts but before their membranes fuse. Cultured myoblasts were
treated with phospholipase C and then exposed to radioactive thymidine. Unattached
myoblasts continued to divide and thus incorporated the radioactive thymidine into their
DNA. Aligned (but not yet fused) cells (arrowheads) did not incorporate the label. (A–F
after Wolpert 1998; G from Nameroff and Munar 1976, courtesy of M. Nameroff.)
Paraxial Mesoderm 577
WEb Topic 17.3 Muscle formation Research on chimeric mice has shown that
skeletal muscle becomes multinucleate by the fusion of cells, whereas heart muscle
becomes multinucleate by nuclear divisions within a cell.
17 Snapshot Summary
Paraxial Mesoderm
1. The paraxial mesoderm forms blocks of tissue intervertebral joints as well as the meninges and dorsal
called somites. Somites give rise to three major divi- aortic cells also come from the sclerotome.
sions: the sclerotome, the myotome, and the central 5. The primaxial myotome forms the back musculature. The
dermomyotome. abaxial myotome forms the muscles of the body wall,
2. The spatiotemporal expression of 3′-to-5′ Hox genes limb, diaphragm, and tongue.
along the paraxial mesoderm correlates with a progres- 6. The central dermomyotome forms the dermis of the back
sive loosening of chromatin structures via epigenetic as well as precursors of muscle and brown fat cells.
regulation as well as with the timing of ingression into
7. The somite regions are specified by paracrine factors
the paraxial mesoderm along the anterior-posterior axis.
secreted by neighboring tissues. The sclerotome is
Caudal gradient signals of FGFs and Wnts maintain NMP
specified to a large degree by Sonic hedgehog, which
cells in the progenitor state, whereas opposing gradients
is secreted by the notochord and floor plate cells. The
of retinoic acid promote differentiation of these cells.
two myotome regions are specified by different factors,
These antagonistic signals establish where a new somitic
and in both instances, myogenic regulatory factors are
boundary will form in the segmental plate.
induced in the cells that will become muscles.
3. Cyclic activation of Notch-Delta signaling throughout the
8. To form muscles, the myoblasts stop dividing, align
presomitic mesoderm establishes the timing of segment
themselves into myotubes, and fuse. Further myofiber
formation, and Eph receptor systems are involved in the
growth is facilitated by stem cells on the myotube periph-
physical formation of boundaries. Moreover, N-cadherin,
ery called satellite cells.
fibronectin, and Rac1 also appear to be important
in causing presomitic mesodermal cells to become 9. The major lineages that form the skeleton are the somites
epithelial. (axial skeleton), lateral plate mesoderm (appendages),
and neural crest and head mesoderm (skull and face).
4. The sclerotome forms the vertebral cartilage. In thoracic
vertebrae, the sclerotome cells also form the ribs. The 10. There are two major types of osteogenesis. In intramem-
branous ossification, which occurs primarily in the skull
580 Chapter 17
and facial bones, neural crest and head mesenchyme 12. Osteoclasts continually remodel bone throughout a
are converted directly into bone. In endochondral ossifi- person’s lifetime. The hollowing out of bone for the bone
cation, mesenchyme cells become cartilage. These car- marrow is accomplished by osteoclasts.
tilaginous models are later replaced by bone cells. 13. Tendons are formed through the conversion of the dor-
11. Hypertrophic cartilage cells make Indian hedgehog salmost layer of sclerotome cells into syndetome cells by
(Ihh) and vascular endothelial growth factor (VEGF). Ihh FGFs secreted by the myotome.
initiates osteoblast differentiation into bone, and VEGF
induces the construction of capillaries that enable bone
cells to be brought into the degenerating cartilage.
Further Reading
Barrios, A., R. J. Poole, L. Durbin, C. Brennan, N. Holder Henrique D., E. Abranches, L. Verrier and K. G. Storey. 2015.
and S. W. Wilson. 2003. Eph/Ephrin signaling regulates the Neuromesodermal progenitors and the making of the spinal
mesenchymal-to-epithelial transition of the paraxial mesoderm cord. Development 142: 2864–2875.
during somite morphogenesis. Curr. Biol. 13: 1571–1582. Hubaud, A. and O. Pourquié. 2014. Signalling dynamics in
Bouldin, C. M., C. D. Snelson, G. H. Farr and D. Kimelman. vertebrate segmentation. Nat. Rev. Mol. Cell Biol. 15: 709–721.
2014. Restricted expression of cdc25a in the tailbud is essential Jülich, D. and 7 others. 2015. Cross-scale integrin regulation
for formation of the zebrafish posterior body. Genes Dev. 28: organizes ECM and tissue topology. Dev. Cell 34: 33–44.
384–395.
Kumar, S. and G. Duester. 2014. Retinoic acid controls body
Brent, A. E., R. Schweitzer and C. J. Tabin. 2003. A somitic axis extension by directly repressing Fgf8 transcription.
compartment of tendon precursors. Cell 113: 235–248. Development 141: 2972–2977.
Cayuso, J., Q. Xu and D. G. Wilkinson. 2015. Mechanisms of Mansfield, J. H., E. Haller, N. D. Holland, and A. E. Brent. 2015.
boundary formation by Eph receptor and ephrin signaling. Dev Development of somites and their derivatives in amphioxus,
Biol. 40: 122–131. and implications for the evolution of vertebrate somites.
Chalamalasetty, R. B. and 5 others. 2014. Mesogenin 1 Evodevo May 14: 21.
is a master regulator of paraxial presomitic mesoderm Noordermeer, D. and 5 others. 2014. Temporal dynamics and
differentiation. Development 141: 4285–4297. developmental memory of 3D chromatin architecture at Hox
Choi, K. S. and B. D. Harfe. 2011. Hedgehog signaling is gene loci. Elife Apr 29; 3:e02557. doi: 10.7554/eLife.02557.
required for formation of the notochord sheath and patterning Nowotschin, S., A. Ferrer-Vaquer, D. Concepcion, V. E.
of nuclei pulposi within the intervertebral discs. Proc. Natl. Papaioannou and A. K. Hadjantonakis. 2012. Interaction of
Acad. Sci. USA 108: 9484–9489. Wnt3a, Msgn1 and Tbx6 in neural versus paraxial mesoderm
Christ, B., R. Huang and M. Scaal. 2007. Amniote somite lineage commitment and paraxial mesoderm differentiation in
derivatives. Dev. Dyn. 236: 2382–2396. the mouse embryo. Dev. Biol. 367: 1–14.
Denans, N., T. Iimura and O. Pourquié. 2015. Hox genes control Ordahl, C. P., E. Berdougo, S. J. Venters and W. F. J. Denetclaw.
vertebrate body elongation by collinear Wnt repression. Elife 26: 2001. The dermomyotome dorsomedial lip drives growth
4. and morphogenesis of both the primary myotome and
Dubrulle, J. and O. Pourquié. 2004. fgf8 mRNA decay dermomyotome epithelium. Development 128:1731–1744.
establishes a gradient that couples axial elongation to Rios, A. C., O. Serralbo, D. Salgado and C. Marcelle. 2011.
patterning in the vertebrate embryo. Nature 427: 419–422. Neural crest regulates myogenesis through the transient
Ellis, K., J. Bagwell and M. Bagnat. 2013. Notochord vacuoles activation of NOTCH. Nature 473: 532–535.
are lysosome-related organelles that function in axis and spine Serralbo, O. and C. Marcelle. 2014. Migrating cells mediate
morphogenesis. J. Cell Biol. 200: 667–679. long-range WNT signaling. Development 141: 2057–2063.
Gomez, C. and 5 others. 2008. Control of segment number in Wahi, K., M. S. Bochter and S. E. Cole. 2014. The many roles of
vertebrate embryos. Nature 454: 335–339. Notch signaling during vertebrate somitogenesis. Semin. Cell
Dev. Biol. Dec 4. pii: S1084-9521(14)00320-6.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
18
Intermediate and
Lateral Plate Mesoderm
Heart, Blood, and Kidneys
While the axial and paraxial mesoderm form the notochord and somites of
the dorsum, the intermediate and lateral plate mesoderms extend around the sides and
front of the body. The intermediate mesoderm forms the urogenital system, consisting
of the kidneys, the gonads, and their associated ducts. The outer (cortical) portion of the
adrenal gland also derives from this region. Farthest away from the notochord, the lateral
plate mesoderm gives rise to the heart, blood vessels, and blood cells of the circulatory
system, as well as to the lining of the body cavities. It gives rise to the pelvic and limb
skeleton (but not the limb muscles, which are somitic in origin). Lateral plate mesoderm
also helps form a series of extraembryonic membranes that are important for transporting
nutrients to the embryo.
These four subdivisions are thought to be specified along the mediolateral (center-to-
side) axes by increasing amounts of BMPs (Pourquié et al. 1996; Tonegawa et al. 1997).
The more lateral mesoderm of the chick embryo expresses higher levels of BMP4 than do
the midline areas, and one can change the identity of the mesodermal tissue by altering
How is the heart
BMP expression. While it is not known how this patterning is accomplished, it is thought
formed, and how that the different BMP concentrations may cause differential expression of the Forkhead
does it connect to the (Fox) family of transcription factors. The Foxf1 gene is transcribed in those regions that
arteries and veins?
The Punchline
The heart, blood vessels, and kidneys are mesodermal organs involved in the transport
of another mesodermal tissue, blood cells, throughout the body. The vertebrate kidney
develops from the interactions of two regions of intermediate mesoderm, the nephric
duct and the metanephric mesenchyme. Their interactions cause the mesenchyme to
form the nephron that filters the blood, and the collecting ducts and ureter that delivers
the filtrate to the bladder. Mesodermal progenitor cells form the primary heart field and
migrate ventromedially to build a linear heart tube. A secondary heart field, derived
from pharyngeal mesoderm, adds another large number of cells to this tube. As a
result of uneven cell proliferation and physical forces, the heart tube loops rightward
and begins forming ventricles and atria. Vasculogenesis involves the condensing of
splanchnic mesoderm cells to form blood islands, the outer cells of which become
endothelial (blood vessel) cells. Angiogenesis involves the remodeling of existing blood
vessels. Hematopoiesis—the formation of blood cells—involves a stem cell population
capable of generating numerous cell types.
582 Chapter 18
(A)
Neural tube
(B)
Paraxial
Intermediate Chorda- (somitic) Lateral plate mesoderm
mesoderm mesoderm mesoderm
Syndetome Endothelial
(tendons) cells
Mesonephric
Pronephros tubules
Nephric duct
Gonad Gonad
Nephrogenic
cord
Mesonephros
Mesonephros
Nephric
(Wolffian) duct
Metanephrogenic Metanephrogenic
Nephrogenic
mesenchyme mesenchyme
cord
Ureter
Cloaca Ureteric bud
Nephric bud
Lateral plate
mesoderm
Intermediate
mesoderm
Uninduced
Paraxial Pronephric intermediate
mesoderm kidney mesoderm
Cut separating
paraxial mesoderm Gap (results
from intermediate Cutting from separation)
mesoderm needle
Intermediate and Lateral Plate Mesoderm 585
the anteriormost region of the intermediate mesoderm. The anterior boundary of Hoxb4
expression is established by a retinoic acid gradient; adding activin locally will over-
come this gradient and allow the kidney to extend anteriorly (Barak et al. 2005; Preger-
Ben Noon et al. 2009).
(A) (B)
Metanephric Cap
mesenchyme condensate
form the mature nephrons of the functioning kidney, while the branched ureteric bud
gives rise to the collecting ducts and to the ureter, which drains the urine from the
kidney.
Clifford Grobstein (1955, 1956) documented this reciprocal induction in vitro. He
separated the ureteric bud from the metanephric mesenchyme and cultured them
either individually or together. In the absence of mesenchyme, the ureteric bud does not
branch. In the absence of the ureteric bud, the mesenchyme soon dies. But when they
are placed together, the ureteric bud grows and branches, and nephrons form through-
out the mesenchyme. This has been confirmed by experiments using GFP-labeled pro-
teins to monitor cell division and branching (Figure 18.5 ; Srinvas et al. 1999).
(A) (B)
Anterior
Fgf9, RA Ureteric bud
Anterior intermediate epithelium Somite
mesoderm cells RA
Metanephric
Posterior intermediate Notochord
mesenchyme
mesoderm cells
Posterior mesodermal
precursors Presomitic
WNTs mesoderm
Posterior CYP26
Time
(C)
Collecting duct
Distal tubule
Proximal tubule
Glomerulus
Figure 18.6 Creating organoids of
mouse kidneys from induced pluripotent
stem cells. (A) Schematic mechanism
of generating the ureteric bud and the
metanephric mesoderm from the poste-
step 2: the metanephric mesenchyme secretes gdnf to induce and direct rior mesodermal precursor cells. Those
the ureteric bud The stage is now set for the secretion of paracrine factors that precursor cells migrating from the pos-
can induce the ureteric buds to emerge. Under the influence of retinoic acid (which terior mesoderm early during gastrula-
is made in many of the surrounding tissues), the nearby nephric duct is instructed to tion leave the area of Wnt and proceed
toward areas of more FGFs and retinoic
express the Ret receptor on its cell surfaces (Rosselot et al. 2010). Ret is the receptor
acid. These become the progenitors
for glial-derived neurotrophic factor (GDNF), and GDNF is now secreted from the of the ureteric bud epithelium. Those
metanephric mesenchyme. GDNF secreted from the metanephric mesenchyme causes migrating later, after remaining longer in
the outgrowth of the ureteric bud from the nephric duct. Indeed, during formation of the Wnt-dominated area, become the
the ureter, a subset of nephric duct cells (those in which the Ret receptor is most highly progenitors of the metanephric mesen-
active) migrate to positions closest to the source of GDNF and thus form the tip of the chyme. (B) Retinoic acid signaling in the
emerging urteric bud ( Figure 18.7A ; Chi et al. 2009). Mice whose genes for either late the primitive streak stage. An RA-
degrading enzyme, CYP26, is expressed
GDNF or its receptor are knocked out die soon after birth from renal agenesis (lack of
in the presomitic mesoderm region and
kidneys) (Figure 18.7B–D; Moore et al. 1996; Pichel et al. 1996; Sánchez et al. 1996). shields PMP cells from RA signaling.
The ability of other regions of the nephric duct to proliferate appears to be suppressed (C) Immunofluorescence microscope
by activin, and one of the the major mechanisms of GDNF action may be to locally analysis of a kidney organoid formed
suppress this inhibitory activin; when activin was experimentally inhibited, numerous from human iPS cells that were exposed
ureteric buds formed (Maeshima et al. 2006). sequentially to Wnt signal promoters and
Developmental Biology 11e FGF signals. The insert is a higher-mag-
Fig. 18.06 nification view of a nephron segmented
step 3: the ureteric bud secretes fgf2 and bmp7 to prevent mesenchymal
Dragonfly Media Group into four compartments, including the
apoptosis The third signal in kidney development is sent from the ureteric bud to the collecting duct (green), distal (yellow) and
03/15/16
metanephric mesenchyme. If left uninduced by the ureteric bud, the mesenchyme cells proximal (blue) tubules, and the glomeru-
undergo apoptosis (Grobstein 1955; Koseki et al. 1992). However, if induced by the ure- lus (red). (After Takasato et al. 2015.)
teric bud, the mesenchyme cells are rescued from the precipice of death and are converted
into proliferating stem cells (Bard and Ross 1991; Bard et al. 1996). The factors secreted
588 Chapter 18
(A)
step 4: signals from the mesenchyme induce the branching of the ureteric
bud Paracrine factors including GDNF, Wnts, FGFs, and BMPs have been implicated
in the branching of the ureteric bud, probably working as “pushes” and “pulls” on cell
division and on the extracellular matrix (Ritvos et al. 1995; Miyazaki et al. 2000; Lin et al.
2001; Majumdar et al. 2003). The first protein regulating ureteric bud branching is GDNF
from the mesenchyme, which not only induces the initial ureteric bud from the nephric
duct but can also induce secondary buds from the ureteric bud once the bud enters the
Figure 18.8 Effect of GDNF on mesenchyme (Figure 18.8; Sainio et al. 1997; Shakya et al. 2005; Chi et al. 2008).
branching of the ureteric epithelium.
The ureteric bud and its branches
are stained orange (with antibodies (A) (B)
to cytokeratin 18), while the nephrons
are stained green (with antibodies to
nephron brush border antigens). (A) A
13-dayGilbert
embryonic mouse kidney cul-
tured 2Developmental
days with a control 11e, Sinauer
Biologybead (cir- Associates
cle) hasDevBio11e_18.07 Date 03-16-16
a normal branching pattern.
(B) A similar kidney cultured 2 days
with a GDNF-soaked bead shows a
distorted pattern, as new branches
are induced in the vicinity of the bead.
(From Sainio et al. 1997, courtesy of
K. Sainio.)
Intermediate and Lateral Plate Mesoderm 589
GDNF also appears to induce Wnt11 synthesis in the responsive cells at the tip of the
bud (see Figure 18.9A), and Wnt11 reciprocates by regulating GDNF levels (Majumdar
et al. 2003; Kuure et al. 2007). The cooperation between the GDNF/Ret pathway and the
Wnt pathway appears to coordinate the balance between branching and metanephric
mesenchyme proliferation such that continued kidney development is insured. In this
way, two groups of stem cells are maintained: the ureteric bud tip cells and the mes-
enchyme cap cells (Mugford et al. 2009; Barak et al. 2012).
WATCH DEVELOPMENT 18.1 Videos show the progressive branching of the mouse
kidney in vitro.
(B)
Figure 18.9 Wnts are critical for kidney development. (A) In the
11-day mouse kidney, Wnt9b is found on the stalk of the ureteric
bud, while Wnt11 is found at the tips. Wnt9b induces the metaneph-
ric mesenchyme to condense; Wnt11 will partition the metanephric
mesoderm to induce branching of the ureteric bud. Borders of the
bud are indicated by a dashed line. (B) A wild-type 18.5-day male
mouse (left) has normal kidneys, adrenal glands, and ureters. In a
mouse deficient for Wnt9b (right), the kidneys are absent. (From Car-
–/–
roll et al. 2005.) Wild-type Wnt9b
590 Chapter 18
Figure 18.10 Development of the blad- cells become smooth muscle cells capable of wavelike contractions (peristalsis) that
der and its connection to the kidney via the allow the urine to move into the bladder. These cells also secrete BMP4 (Cebrian
ureter. (A) The cloaca originates as an endo- et al. 2004), which upregulates genes for uroplakin, a cell membrane protein that
dermal collecting area that opens into the
causes differentiation of this region of the ureteric bud into the ureter. BMP inhibi-
allantois. (B) The urogenital septum divides
tors protect the region of the ureteric bud that forms the collecting ducts from this
the cloaca into the future rectum and the
urogenital sinus. The bladder forms from differentiation.
the anterior portion of that sinus, and the The bladder develops from a portion of the cloaca ( Figure 18.10A,B ). The
urethra develops from the posterior region cloaca1 is an endodermally lined chamber at the caudal end of the embryo that will
of the sinus. The space between the rectal become the waste receptacle for both the intestine and the kidney. Adult amphib-
opening and the urinary opening is the ians, reptiles, and birds use the cloaca to void both liquid and solid wastes. In mam-
perineum. (C–F) Insertion of the ureter into
mals, the cloaca becomes divided by a septum into the urogenital sinus and the rec-
the embryonic mouse bladder. (C) Day-10
tum. Part of the urogenital sinus becomes the bladder, while another part becomes
mouse urogenital tract. The nephric duct
is stained with GFP fused to a Hoxb7 pro- the urethra (which will carry the urine out of the body). The ureteric bud originally
moyter. (D) Urogenital tract from a day-11 empties into the bladder via the nephric (Wolffian) duct, which grows toward the
embryo, after ureteric bud outgrowth. (E) bladder through an ephrin-mediated pathway (Weiss et al. 2014). Once at the blad-
Whole mount urogenital tract from a day- der, the urogenital sinus cells of the bladder wrap themselves around both the ureter
12 embryo. The ducts are stained green and the nephric duct. Then the nephric ducts migrate ventrally, opening into the
and the urogenital sinus red. (F) The ureter
1
separates from the nephric duct and forms The term cloaca is Latin for “sewer”—a bad joke on the part of early European anatomists.
a separate opening into the bladder. (A,B
after Cochard 2002; C–F from Batourina et
al. 2002, courtesy of C. Mendelsohn.)
(C)
(A) (B)
Nephric duct (ç ) Urogenital
Nephric duct sinus:
Urorectal Metanephros Ureteric Nephric
Hindgut fold/septum duct (ureter) Urinary duct
bladder
Allantois portion
Genital Pelvic/
tubercle genital
portion
Cloacal
membrane
Genital
tubercle
Nephric
duct Ureter Nephric
duct
Nephric
duct
Ureter
Ureter Urogenital
Urogenital sinus
Urogenital sinus
sinus
Intermediate and Lateral Plate Mesoderm 591
urethra rather than into the bladder and the nephric duct ( Figure 18.10C–F ). The
caudal end of the nephric duct appears to undergo apoptosis, allowing the ureter to
separate from the nephric duct. Expansion of the bladder then moves the ureter to its
final position at the neck of the bladder (Batourina et al. 2002; Mendelsohn 2009). In
females, the entire nephric duct degenerates, while the Müllerian duct opens into the
vagina (see Chapter 6). In males, the nephric duct also forms the sperm outflow track,
so males expel sperm and urine through the same opening.
Thus, the blood-filtering kidneys emerge from the mutual induction of two parts of
the intermediate mesoderm, the ureteric bud and the metanephric mesenchyme. Now
we can focus more laterally, on the lateral plate mesoderm, and discern the genesis of
the heart, vessels, and blood.
WEb Topic 18.1 Coelom formation An animation illustrates the formation of the
coelom and the expansion of the lateral plate mesoderm.
During later development, the right- and left-side coeloms fuse and folds of tissue
extend from the somatic mesoderm, dividing the coelom into separate cavities. In
mammals, these mesodermal folds subdivide the coelom into the pleural, pericardial,
and peritoneal cavities, enveloping the thorax, heart, and abdomen, respectively. The
mechanism for creating the linings of these body cavities from the lateral plate meso-
derm has changed little throughout vertebrate evolution, and the development of the
amniote mesoderm can be compared with similar stages of frog embryos ( Figure
18.11B,C).
Consisting of a heart, blood cells, and an intricate system of blood vessels, the
circulatory system is the vertebrate embryo’s first functional unit, providing nourish-
ment to the developing organism. Few events in biology are as thought-provoking and
accessible as watching the heart beating in a two-day chick embryo, pumping the first
blood cells into vessels that have not even formed valves yet. The development of the
circulatory system provides excellent examples of induction, specification, cell migra-
tion, organ formation, and the role of stem cells in both embryonic development and
adult tissue regeneration.
592 Chapter 18
Lateral
Midgut plate
mesoderm
Splanchnopleure
Primitive gut
Yolk
Heart Development
The circulatory system is the first working unit in the developing embryo, and the heart
is the first functional organ. Like other organs, the heart arises through the specifi-
cation of precursor cells, the migration of these precursor cells to the organ-forming
region, the specification of cell types through signaling interactions within and between
tissues, and the coordination of morphogenesis, growth, and cell differentiation.
A minimalist heart
Both the chick and the mammalian heart are complex, rather baroque structures. How-
ever, the heart evolved from far simpler pumps (Stolfi et al. 2010). The four-chambered
masterpiece that is the mammalian heart is a developmental elaboration of the single-
Gilbert
chambered tunicate heart that forms from about two dozen cells. In tunicates (the
Developmental Biology 11e, Sinauer Associates closest invertebrate relative of the vertebrates; see Chapter 10), cardiac precursor cells
DevBio11e_18.11 Date 03-16-16 form bilateral cell clusters that migrate anteriorly and ventrally along the endoderm and
fuse at the ventral midline (Davidson et al. 2005). The few cells that form the tunicate
heart appear to have the same basic pattern of transcription factors that we see in the
chick and mouse heart lineages.
In the gastrulating tunicate embryo, only two pairs of mesodermal cells near the
vegetal pole represent the heart lineage. Each side of the embryo contains a pair of B8.9
and B8.10 blastomeres that express the MesP transcription factor, just like the cardiac
Intermediate and Lateral Plate Mesoderm 593
Anterior pharyngeal
(A) muscle precursors (B) (C)
Heart precursors
Figure 18.12 Heart development
in the tunicate Ciona. (A) In the tailbud-
stage embryo, transgenic MesP-GFP
precursor cells of vertebrates (Figure 18.12; Davidson et al. 2006). During neurulation, glows in regions where MesP is activated
each of these four cardiac founder cells divides asymmetrically to produce a small cell by Tbx6 in the B8.9 and B8.10 blasto-
that generates the cardiac precursors and a larger cell that generates anterior pharyn- meres. (B) At a slightly later stage, the
geal muscle precursors. The anterior tail cells do not migrate, but they express retinal- heart precursors migrate into the head
dehyde dehydrogenase and initiate a retinoic acid gradient that specifies the heart cells region. (C) Ventrolateral view in which
both left and right heart and muscle pre-
as in vertebrate embryos.
cursors can be observed. Cell divisions
Moreover, as in the vertebrate cardiac precursors, it appears that FGF signaling is are forming both the heart (left) and the
critical for the production of heart cells, with FGF signals combining with MesP to anterior muscles. (From Davidson et al.
induce the expression of the Nkx2-5, GATA, and Hand-family transcription factors 2005.)
(Davidson and Levine 2003; Simões-Costa et al. 2005). When the cardiopharyngeal
precursor cell divides, the cell that remains bound to the extracellular matrix of the
epidermis retains the FGF receptors, while the cell that does not adhere to the epider-
mis internalizes and degrades such receptors. As a result, the cell attached to the epi-
dermis can respond to FGF and become the heart precursor cell, while the cell without
FGF receptors cannot respond to the paracrine factor and produces pharyngeal muscle
instead (Cota and Davidson 2015).
(A)
Outflow
Posterior tract
Right Left
atrium atrium
Arterial
pole
First
heart Heart
field tube Outflow A–SHF
Second Venous tract
heart pole P–SHF
Anterior field Left Right Left
ventricle Left atrium ventricle ventricle
Embryonic
day 7.5 8.5 9.5 10.5
2
Note that these specialized myocardial nerve fibers are not the same thing as the Purkinje
neurons of the cerebellum mentioned in Chapter 13. Both were named for the nineteenth-cen-
tury Czech anatomist and histologist Jan Purkinje.
Gilbert
3
Developmental Biology 11e, Sinauer Associates A third heart field, extending more posteriorly, may exist (Bressan et al. 2013). In chick embry-
DevBio11e_18.13 Date 04-04-16 os, this third heart field includes those cells that generate the pacemaker myocytes that stimu-
late the rhythmic contractions of the heart muscles.
Intermediate and Lateral Plate Mesoderm 595
(Mikawa 1999; van Wijk et al. 2009). Moreover, as we will discuss later, it appears that
each progenitor cell is capable of becoming any of the differentiated heart cell types.
The cardiac precursor cells will be supplemented by cardiac neural crest cells; the latter
help make the outflow tract and the septum that separates the aorta from the pulmo-
nary trunk (see Figure 15.22; Porras and Brown 2008).
4
Mesp1 is a close relative of Mesp2, which directs somitogenesis (see Chapter 17). The tunicate
(see Chapter 10) has only one Mesp gene, and it specifies heart development through the acti-
vation of the Nkx and Hand genes, just as occurs in vertebrates (Satou et al. 2004). BMPs may
activate Mesp1 indirectly by inducing the expression of the Eomesodermin, a transcription fac-
tor that is important for both endoderm and mesodermal lineages. In the early mouse epiblast
(which has low amounts of Nodal), Eomesodermin activates Mesp1. Later, as the primitive
streak elongates, Eomesodermin acts with Nodal to activate genes for the Sox17 and Foxa2
transcription factors that specify the definitive endoderm (Costello et al. 2011).
596 Chapter 18
Cardiogenic
(A) Anterior LPM mesoderm
(heart field)
DKK, Crescent, Cerberus
(anterior endoderm) Fgf8
Lateral plate
mesoderm Wnt Noggin, BMP
(neural tube) Chordin
(notochord)
Hemangiogenic
Posterior LPM mesoderm (blood,
blood vessels)
(B) Foxh1
Mesp1 GATA4
Contractile proteins
Tbx5
Connexin 40
Figure 18.14 Model of inductive interactions involving the BMP blood-forming fields do not form in the center of the embryo.
and Wnt pathways that form the boundaries of the cardiogenic (B) Model gene regulatory network for the vertebrate heart initiated
mesoderm. (A) Wnt signals from the neural tube instruct lateral by BMP signals. BMP signaling activates the pivotal switches Nkx2-
plate mesoderm to become precursors of the blood and blood ves- 5 and Mesp1. These transcription factors act in concert to activate
sels. In the anterior portion of the body, Wnt inhibitors (Dickkopf, numerous heart-forming genes. Mesp1 has also been shown to
Crescent, Cerberus) from the pharyngeal endoderm prevent Wnt repress genes that would otherwise specify the cell into other fates.
from functioning, allowing later signals (BMP, Fgf8) to convert lateral The antagonism between Tbx20 (right side) and Tbx5 (left side) can
plate mesoderm into cardiogenic mesoderm. BMP signals will also also be seen. This model is provisional, as new ChIP-Seq tech-
be important for the differentiation of hemangiogenic (blood, blood niques have identified thousands of promoters activated at different
vessel) mesoderm. In the center of the embryo, Noggin and Chor- stages of heart development. (A after Davidson 2006; B after May
din signals from the notochord block BMPs. Thus, the cardiac and et al. 2012.)
reversed. It is thought that the endodermal component responsible for this movement
is an anterior-to-posterior concentration gradient of fibronectin. Antibodies against
fibronectin stop the migration, whereas antibodies against other extracellular matrix
components do not (Linask and Lash 1988).
This movement produces two populations of migrating cardiac precursor cells, one
on the right side of the embryo and another on the left. Each side has its own first and
second heart fields, and each of these populations starts to form its own heart tube. In
the chick, the fields are brought together around the 7-somite stage, when the foregut
is formed by the inward folding of the splanchnopleure. This movement places the two
cardiac tubes together (Varner and Taber 2012). The two endocardial tubes lie within
the common tube for a short time, but eventually these two tubes also fuse. The bilateral
origin of the heart can be demonstrated by surgically preventing the merger of the lateral
plate mesoderm (Gräper 1907; DeHaan 1959). This manipulation results in a condition
called cardia bifida, in which two separate hearts form, one on each side of the body
(Figure 18.15A). Thus, endoderm specifies heart progenitors, gives directionality to
their migration, and mechanically pulls the two heart fields together.
Although the chick is an excellent model for surgical manipulation, mouse and
zebrafish embryos have been more tractable genetically. In the zebrafish, heart pre-
cursor cells migrate actively from the lateral edges
toward the midline. Several mutations affecting
endoderm differentiation disrupt this process, (A) (B)
indicating that, as in the chick, the endoderm
is critical for cardiac precursor specification and
migration. The faust gene, which encodes the
GATA5 protein, is expressed in the endoderm and
is required for the migration of cardiac precursor
cells to the midline and also for their division
and specification. It appears to be important in
the pathway leading to activation of the zebrafish
nkx2-5 gene in the cardiac precursor cells (Reiter
et al. 1999). Another particularly interesting zebra- (C)
fish mutation is miles apart. Its phenotype is lim-
ited to cardiac precursor migration to the midline
and resembles the cardia bifida seen in experi-
mentally manipulated chick embryos ( Figure
18.15B,C ). Differentiation is not affected; the fish
form two normal heart tubes, but the tubes are not
connected properly to the blood vessels, and thus
cannot support circulation. The miles apart gene
encodes a protein that regulates the interactions of the cardiac cells with fibronectin,
and it is expressed in the endoderm on either side of the midline (Kupperman et al.
2000; Matsui et al. 2007).
In mice, cardia bifida can also be produced by mutations of genes that are expressed
in the endoderm. One of these genes, Foxp4, encodes a transcription factor expressed
in the early foregut cells, along the pathway the cardiogenic precursors travel toward
the midline. In these mutants, each heart primordia develops separately, and the
embryonic mouse contains two hearts, one on each side of the body (Figure 18.15D,E;
Li et al. 2004).
However, as the cells of the first heart field migrate along the endoderm to form the
heart tube, the cells of the second heart field remain in contact with the pharyngeal
endoderm. Here they are kept in a state of proliferation by a combination of paracrine
factors (probably Sonic hedgehog, Fgf8, and Wnts) (Chen et al. 2007; Lin et al. 2007).
The cells of the second heart field can be distinguished by their expression of the Islet1
transcription factor. These cells also begin to synthesize and secrete Fgf8, which acts in
an autocrine manner to stimulate the cells to migrate and add themselves to the ante-
rior and posterior portions of the heart tube formed by the first heart field progenitor
cells (Park et al. 2008). The anterior region of the second heart field contributes to the
right ventricle and the outflow tract, whereas its posterior region generates the atria
(Zaffran et al. 2004; Verzi et al. 2005; Galli et al. 2008).
As the second heart field precursor cells migrate, the posterior region becomes
exposed to increasingly higher concentrations of retinoic acid (RA) produced by the
posterior mesoderm. RA is critical in specifying these posterior precursor cells to become
the inflow, or “venous,” portions of the heart—the sinus venosus and atria. Originally,
these fates are not fixed, as transplantation or rotation experiments show that these
precursor cells can regulate and differentiate in accordance with a new environment.
But once the posterior cardiac precursors enter the realm of active RA synthesis, they
express the gene for retinaldehyde dehydrogenase; they then can produce their own RA,
and their posterior fate becomes committed (Figure 18.16; Simões-Costa et al. 2005).
As in kidney development, retinoic acid regulates the expression of Hox genes (espe-
cially Hoxa1, Hoxb1, and Hoxa3), which appear to promote different regional identities in
the second heart field precursors (Bertrand et al. 2011). In mice, the outflow tract region,
VADE MECUM as well as the cardiac neural crest cells that enter this region of the second heart field,
The vertebrate heart begins to display differential Hox gene expression based on their exposure to RA (Diman et al.
function early in development, 2011). This ability of RA to specify and commit heart precursor to become atria explains
as is seen in movies of the early- its teratogenic effects on heart development, wherein exposure of vertebrate embryos to
stage chick embryo. RA can cause expansion of atrial tissues at the expense of ventricular tissues (Stainier
and Fishman 1992; Hochgreb et al. 2003).
WEb Topic 18.2 Fusion of the heart and the first heartbeats Pulsations
of the chick heart begin while the paired primordia are still fusing. Isolated embryonic
heart cells will beat when placed in petri dishes.
Endocardium
Multipotent cardiovascular Flk1–
Mesoderm progenitor (MCPs) NFATc1+
Endothelium
Flk1–
Flk1+ Endothelial and Nkx2.5+
c-Kit+ Cardiomyocyte
hematopoeitic lineages
600 Chapter 18
ventricles) is formed at the boundary between those cells that express Tbx5 and those that
do not. Tbx5 protein works antagonistically to Tbx20, which becomes expressed in the
right ventricle. When the Tbx5 expression domain is ectopically expanded, the location
of the ventricular septum shifts to this new location. Moreover, a conditional knockout of
the mouse Tbx5 gene—specifically inactivating it during ventricular development—leads
to the formation of a lizardlike ventricle that lacks any septum (Takeuchi et al. 2003;
Koshiba-Takeuchi et al. 2009). Thus, Tbx5 is extremely important in separating the left
and right ventricles. Mutations in the human TBX5 gene cause Holt-Oram syndrome
(Bruneau et al. 1999), characterized by abnormalities of the heart and upper limbs.
In 3-day chick embryos and 4-week human embryos, the heart is a two-chambered
tube, with an atrium to receive blood and a ventricle to pump blood out. (In the chick
embryo, the unaided eye can see the remarkable cycle of blood entering the lower
Aorta Pulmonary
Aortic sac artery
Outflow tract
Truncus
Right ventricle
arteriosus
Left ventricle
Right atrium
Left atrium
Atrioventricular Sinus venosus
valve
Vitelline veins
Figure 18.18 Cardiac looping and chamber formation. (A) regions prior to looping. (D,E) Specification of the atria and ven-
Schematic diagram of cardiac morphogenesis in humans. On day tricles occurs even before heart looping. The atria and ventricles
21, the heart is a single-chambered tube. Regional specification of the mouse embryo express different types of myosin proteins;
of the tube is shown by the different colors. By day 28, cardiac here, atrial myosin stains blue and ventricular myosin stains orange.
looping has occurred, placing the presumptive atria anterior to the (D) In the tubular heart (prior to looping), the two myosins (and their
presumptive ventricles. In the newborn, the valves and chambers respective stains) overlap at the atrioventricular channel joining the
establish circulatory routes such that the left ventricle pumps into future regions of the heart. (E) After looping, the blue stain is seen in
the aorta and the right ventricle pumps into the pulmonary artery to the definitive atria and inflow tract, while the orange stain is seen in
the lungs. (B,C) Xin expression in the fusion of left and right heart the ventricles. The unstained region above the ventricles is the trun-
primordia of a chick. The cells fated to form the myocardium are cus arteriosus. Derived primarily from the neural crest, the truncus
stained for the Xin message, whose protein product is essential for arteriosus becomes separated into the aorta and pulmonary arter-
heart-tube looping. (B) Stage-9 chick neurula, in which Xin protein ies. (A after Srivastava and Olson 2000; B,C from Wang et al. 1999,
(purple) is seen in the two symmetrical heart-forming fields (arrows). courtesy of J. J.-C. Lin; D,E from Xavier-Neto et al. 1999, courtesy of
(C)Gilbert
Stage-10 chick embryo showing fusion of the two heart-forming N. Rosenthal.)
Developmental Biology 11e, Sinauer Associates
DevBio11e_18.18 Date 03-16-16
Intermediate and Lateral Plate Mesoderm 601
chamber and being pumped out through the aorta.) Looping of the heart converts the
original anterior-posterior polarity of the heart tube into the right-left polarity seen
in the adult organism. When this looping is complete, the portion of the heart tube
destined to become the atria lies anterior to the portion that will become the ventricles
(Figure 18.18).
This critically important process begins with the anterior part of the heart specify-
ing the direction of the bend. Looping begins immediately after the onset of rhythmic
heart contractions and the initiation of blood flow; pressure from the blood flow helps
drive looping to completion (Groenendijk et al. 2005; Hove et al. 2003). As the bending
of the heart tube deepens, an increasing volume of blood enters the heart. The volume
differences are thought to be transmitted to the cells through the extracellular matrix
and the cytoskeleton (Linask et al. 2005; Garita et al. 2011). Precise chamber alignment
is needed for the correct signaling for the formation of the heart valves, the ventricular
and atrial septa, and to allow for the heart to become connected to the embryonic vas-
culature that has been developing concomitantly within the embryo.
Scientists speak 18.1 Dr. Kersti Linask discusses the looping of the
vertebrate heart.
As the heart is looping, changes in the endocardium start forming the valves. The
beginning of heart valve development is the formation of endocardial cushions in the
canal between the atrium and ventricle and in the outflow tract of the looping heart
tube (Armstrong and Bischoff 2004). Cushion development is initiated by the myocar-
dium’s signaling to endocardial cells to express the Twist gene. Twist protein is a tran-
scription factor that initiates epithelial-mesenchymal transformation and cell migration.
And these endocardial cells leave the endocardium and migrate to form the endocardial
cushions (Barnett and Desgrosellier 2003; Shelton and Yutey 2008). Twist also activates
the gene for Tbx20, and together Twist and Tbx20 activate the proteins that cause the
proliferation and strengthening of the valves.
WATCH DEVELOPMENT 18.2 This video provides a medical view of human heart
development.
WEb Topic 18.3 Changing heart anatomy at birth The process of taking the
first breath actually alters the anatomy of the heart, allowing for pulmonary circulation.
Artery
Endothelial
cell Artery
Peri-
endothelial
cell Vein
Basal lamina Vein
Mesoderm Hemangioblasts Tube for- Recruit and interact Pruning and remodeling Maturation and remodeling
cells (birth, migra- mation, with pericyte support produce a “juvenile” produce a mature
tion, and endothelial cells. Maintain vessel vascular system vascular system
proliferation) cell-cell integrity and quiescence
interactions
WEb Topic 18.4 Constraints on the formation of blood vessels Not all
types of circulatory system can be functional. Physical constraints limit the types of vas-
cular systems.
5
The prefixes hem- and hemato- refer to blood (as in hemoglobin). Similarly, the prefix angio-
refers to blood vessels. The suffix -blast denotes a rapidly dividing cell, usually a stem cell. The
suffixes -poiesis and -poietic refer to generation or formation (poeisis is also the root of the word
poetry). Thus, hematopoietic stem cells are those cells that generate the different types of blood
cells. The Latin suffix -genesis (as in angiogenesis) means the same as the Greek -poiesis. The names
of zebrafish hematopoietic mutants can be very poetic. Most are named after wines, and one of
the genes producing a bloodless phenotype is named vlad tepes, after the historic Vlad Dracula.
Intermediate and Lateral Plate Mesoderm 603
(B)
with Fgf2 protein, blood islands emerge and form endothelial cells (Flamme and Risau
1992). Fgf2 is synthesized in the chick embryonic chorioallantoic membrane and is
responsible for the vascularization of this tissue (Ribatti et al. 1995).
The second family of proteins involved in vasculogenesis is the vascular endothe-
lial growth factors (VEGFs). This family includes several VEGFs, as well as placental
growth factor (PlGF), which direct the expansive growth of blood vessels in the pla-
centa. Each VEGF appears to enable the differentiation of the angioblasts and their
multiplication to form endothelial tubes. The most important VEGF in normal devel-
opment, VEGF-A, is secreted by the mesenchymal cells near the blood islands, and
hemangioblasts and angioblasts have receptors for this VEGF (Millauer et al. 1993). If
mouse embryos lack the genes encoding either VEGF-A or its major receptor (the Flk1
receptor tyrosine kinase), yolk sac blood islands fail to appear and vasculogenesis fails
to take place (Figure 18.21A ; Ferrara et al. 1996). Mice lacking genes for
the Flk1 receptor protein have blood islands and differentiated endothelial
(A)
cells, but these cells are not organized into blood vessels (Fong et al. 1995;
Shalaby et al. 1995). VEGF-A is also important in forming blood vessels to
the developing bone and kidney.6
Wild-type
A third set of proteins, the angiopoietins , mediate the interaction
between the endothelial cells and the pericytes —smooth-musclelike cells
that the endothelial cells recruit to cover them. Mutations of either the
angiopoietins or their receptor protein, Tie2, lead to malformed blood ves-
sels deficient in the smooth muscles that normally surround them (Davis et
al. 1996; Suri et al. 1996; Vikkula et al. 1996; Moyon et al. 2001).
VEGF
WEb Topic 18.5 Arterial, venous, and lymphatic vessels The
mutant
structure and function of the vascular tissues differs between the arteries, the
veins, and the vessels that specialize in transporting lymph throughout the body.
(B)
Angiogenesis: Sprouting of blood vessels and
remodeling of vascular beds
After an initial phase of vasculogenesis, angiogenesis begins. By this pro-
cess, the primary capillary networks are remodeled and veins and arteries
are made (see Figure 18.19). The critical factor for angiogenesis is VEGF-A
(Adams and Alitalo 2007). In many cases, VEGF-A secreted by an organ will
induce the migration of endothelial cells from existing blood vessels into
that organ, causing the endothelial cells to form capillary networks there.
Other factors, including hypoxia (low oxygen levels), can also induce the
secretion of VEGF-A and thus induce blood vessel formation.
During angiogenesis, some endothelial cells in the existing blood vessel
respond to the VEGF signal and begin “sprouting” to form a new vessel.
These are known as the tip cells , and they differ from the other vessel
cells. (If all the endothelial cells responded equally, the original blood vessel
would fall apart.) The tip cells express the Notch ligand Delta-like-4 (Dll4)
on their cell surfaces. The Dll4 ligand activates Notch signaling in the adja-
cent cells, preventing them from responding to VEGF-A (Noguera-Troise
Figure 18.21 VEGF and its receptors in mouse et al. 2006; Ridgway et al. 2006; Hellström et al. 2007). If Dll4 expression
embryos. (A) Yolk sacs of a wild-type mouse and a lit-
termate heterozygous for a loss-of-function mutation 6
VEGF needs to be regulated very carefully in adults, and studies indicate that it
of VEGF-A. The mutant embryo lacks blood vessels in can be affected by diet. The consumption of green tea has been associated with
its yolk sac and dies. (B) In a 9.5-day mouse embryo, lower incidences of human cancer and the inhibition of tumor cell growth in
VEGFR-3 (red), a VEGF receptor found on tip cells, is laboratory animals. Cao and Cao (1999) have shown that green tea and one of its
found at the angiogenic front of the capillaries (stained components, epigallocatechin-3-gallate (EGCG), prevent angiogenesis by inhibit-
green). (A from Tammela et al. 2008, courtesy of the ing VEGF. Moreover, in mice given green tea instead of water (at levels similar
authors; B from Ferrara and Alitalo 1999, courtesy of to humans drinking 2–3 cups of green tea), the ability of VEGF to stimulate new
K. Alitalo.) blood vessel formation was reduced by more than 50%.
Intermediate and Lateral Plate Mesoderm 605
is experimentally reduced, tip cells form along a large portion of the blood vessel in
response to VEGF-A.
The tip cells produce filopodia that are densely packed with VEGFR-2 (VEGF recep-
tor-2) on their cell surfaces. They also express another VEGF receptor, VEGFR-3, and
blocking VEGFR-3 greatly suppresses sprouting (Figure 18.21B ; Tammela et al. 2008).
These receptors enable the tip cell to extend toward the source of VEGF, and when the
cell divides, the division is along the gradient of VEGFs. Indeed, the filopodia of the tip
cells act just like the filopodia of neural crest cells and neural growth cones, and they
respond to similar cues (Carmeliet and Tessier-Lavigne 2005; Eichmann et al. 2005).
Semaphorins, netrins, neuropilins, and split proteins all have roles in directing the
sprouting tip cells to the source of VEGF.
7
The manatee is the only mammal known to have a vascularized cornea, and it turns out
that this exception proves the rule—the cornea of the manatee does not express the soluble
VEGF receptor. The manatee’s closest relatives (dugongs and elephants) do express it, and
their corneas are avascular (Ambati et al. 2006). This morphological distinction among related
taxa provides further evidence of the importance of soluble VEGF in preventing corneal
vascularization.
606 Chapter 18
stem cell in hematopoiesis is the pluripotent hematopoietic stem cell, or simply the
hematopoietic stem cell (HSC), which is capable of producing all the blood cells and
lymphocytes of the body. The HSC can achieve this by generating a series of intermedi-
ate progenitor cells whose potency is restricted to certain lineages.
Sites of hematopoiesis
In the early 1900s, numerous investigators (looking at many different vertebrate spe-
cies, including mongooses, bats, and humans) observed the emergence of blood cells
from the ventral endothelium of the aorta (Adamo and Garcia-Cardeña 2012). In the
1960s, however, experiments on mice concluded that all hematopoietic stem cells are
derived from cells originating in the extraembryonic blood islands surrounding the
yolk sac. The aortic hematopoiesis was thought of as an intermediate stop that the
stem cells made on their way to the spleen and bone marrow (the sites of adult hema-
topoiesis in mice).
However, in 1975 Françoise Dieterlen-Lièvre transplanted early chick yolk sacs onto
2-day (pre-circulation) quail embryos. Chick and quail blood cells can be readily dis-
tinguished under the microscope, and the chimeric animal survives. Dieterlen-Lièvre’s
analysis indicated that all the blood cells of the late quail embryo originated from the
quail host and not from the transplanted chick yolk sac. Moreover, hematopoietic activ-
ity within the embryo was restricted to one major site: the ventral portion of the aorta
(Dieterlen-Lièvre and Martin 1981). The grafting of splanchopleure from this aorta-
gonad-mesonephros (AGM ) region from one genetically variant mouse to another
confirmed that in mammals, too, definitive hematopoiesis takes place from inside the
embryo (Godin et al. 1993; Medvinsky et al. 1993). Soon afterward, hematopoietic stem
cells were identified in clusters of cells that were observed on the ventral region of the
10.5-day embryonic mouse aorta (Cumano et al. 1996; Medvinsky and Dziermak 1996).
While there is evidence that some yolk sac hematopoietic stem cells persist in the
adult mouse (see Samokhvalov et al. 2007; Frame et al. 2016), it is generally thought
that the yolk sac hematopoietic stem cells in mammals produce blood cells that allow
oxygen to be transported to the early embryo, but that nearly all the stem cells found
in the adult are those from the AGM that have migrated to the bone marrow (Jaffredo
et al. 2010).
In 2009, several laboratories proposed a new mechanism for blood cell production.
This new hypothesis was based on the discovery of a new cell type in the AGM, the
hemogenic endothelial cell.8 Recall from the discussion of somites in Chapter 17, that
the sclerotome produces angioblasts that migrate to the dorsal aorta and replace most of
the primary dorsal aorta cells. Before their replacement, the remaining primary, lateral
plate-derived endothelial cells of the dorsal aorta (now in the ventral area of the blood
vessel) give rise to blood-forming stem cells. These blood vessel-derived hematopoietic
stem cells are the critical source of adult blood stem cells (see Chapter 5). By analyzing
the types of cells made by the blood vessel endothelium, researchers were able to isolate
the hemogenic endothelial cells and showed that they produce the hematopoietic stem
cells that migrate to the liver and bone marrow (Eilken et al. 2009; Lancrin et al. 2009).
Furthermore, the transition from endothelial cell to hematopoietic stem cell was medi-
ated by the activation of the Runx1 transcription factor (Figure 18.22). In mice lacking
the Runx1 gene, blood stem cells failed to form in the yolk sac, umbilical arteries, dorsal
aorta, and placental vessels (Chen et al. 2009; Tober et al. 2016).
The Runx1 gene appears to be regulated by a complex and dynamic circuitry. More-
over, Runx1 protein expression is not initiated until after the heart starts beating. If
cardiac mutations prevent fluid flow through the aorta, Runx1 is not expressed. Rather,
shear forces (i.e., friction) from the fluid flow are required to activate the Runx1 gene
8
The relationship of the hemogenic endothelial cell and the hemangioblast is controversial. In
general, it is thought that hemangioblasts generate the hemogenic endothelial cells (see Ueno
and Weissman 2010) and that the hemangioblast is a precursor to the hemogenic endothelium.
Intermediate and Lateral Plate Mesoderm 607
FPO
Endothelial/ blood precursor
Flk1+, Fli1+, SCL+, GATA2+
SCL Fli1
Notch
Arterial endothelium
(D)
Flk1+, Fli1+, SCL+, GATA2+,
Ve-Cadherin+, Ephrin B2+
BMP4 Lmo2
Hemogenic endothelium
Flk1+, Fli1+, SCL+, GATA2+,
Ve-Cadherin+, Ephrin B2+ FPO
Runx1+ Shear
Shear Runx1 force
force
Figure 18.22 Pathway for hematopoietic stem cell formation. (A) on a single enhancer 23 base pairs downstream from the Runx1
In the developing mouse, hematopoietic stem cells arise from the transcription initiation site. Scl is critical for preventing blood and vas-
hemogenic endothelium of the aorta. Runx1 is critical for this conver- cular cells from becoming heart muscle. The mechanism by which
sion of endothelial cells into blood stem cells. The lateral plate meso- shear force is mechanotransduced to help activate Runx1 remains
dermal heritage of the hemogenic endothelium is seen, as well as the unknown. (C) Runx1 expression (purple) in the stage-19 chick
juxtacrine and paracrine factors that brought it to its fate. The tran- embryo; Runx1-expressing cells have become part of the blood
scription factors associated with each stage are shown at the right. vessel. (D) Runx1-expressing cells at stage 21 in the chick embryo.
(B) A simplified view of the factors activating Runx1 in the gene regu- Hematopoietic colonies are visible. (A after Swiers et al. 2010; B after
latory network establishing the hematopoietic stem cell in the mouse. Pimanda and Göttgens 2010; C,D from Jaffredo et al. 2010.)
The GATA2, Fli1, and Scl transcription factors bind at adjacent sites
in the ventral endothelium of the dorsal aorta (Adamo et al. 2009; North et al. 2009).9
The shear forces appear to elevate levels of nitric oxide (NO) in the endothelium. NO,
in turn, activates (perhaps through cGMP) Runx1 and other genes known to be critical
for blood cell formation. The transition from hemogenic endothelial cell to HSC does
not appear to be caused by an asymmetric cell division. Rather, there is a rearrangement
of cytoskeleton and tight junctions that resemble an epithelial-mesenchymal transition
such as those seen in the sclerotome or dermamyotome (Yue et al. 2012).
In non-amniote vertebrates, the splanchnopleure is also the source of the hema-
topoietic stem cells, and BMPs are crucial in inducing the blood-forming cells in all
vertebrates studied. In Xenopus, the ventral mesoderm forms a large blood island that is
9
Mechanotransduction of biophysical forces such as shear stress from blood flow is a major
player in cardiovascular development (see Linask and Watanabe 2015). Recall that it is also
required for normal heart development (Mironov et al. 2005) and for the correct patterning of
blood vessels (Lucitti et al. 2007; Yashiro et al. 2007). It is also needed for the fragmentation of
the platelet precursor cell—the megakaryocyte—into platelets. The megakaryocyte in the bone
marrow inserts small processes into the blood vessels surrounding the stem cell niche, and the
shear force there fragments these processes into platelets (Junt et al. 2007).
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_18.22 Date 04-04-16
608 Chapter 18
the first site of hematopoiesis. Ectopic BMP2 and BMP4 can induce blood cell and blood
vessel formation in Xenopus, and interference with BMP signaling prevents blood forma-
tion (Maéno et al. 1994; Hemmati-Brivanlou and Thomsen 1995). In the zebra-fish, both
yolk sac and aortic hematopoiesis are seen. As in the mammalian embryo, the second
wave of hematopoiesis is from the aorta. Hematopoietic stem cells can be seen arising
from the ventral aortic endothelium (Bertrand et al. 2010; Kissa and Herbomel 2010), and
the same genetic pathways leading to Runx1 expression (including the BMPs) regulate
this second, definitive wave of hematopoiesis (Mullins et al. 1996; Paik and Zon 2010).
juxtacrine factors that will direct cell differentiation (Morrison and Scadden 2014). Stem
cell niches often contain long-term, quiescent HSCs that are used to generate pro-
genitor cells on a continual basis, as well as shorter-acting HSCs that can respond to
immediate physiological needs (see Figure 18.24). Wnts that activate the noncanonical
pathways are secreted by niche osteoblasts to maintain the quiescent HSCs, whereas
the canonical Wnt pathway may be critical for inducing them to become the rapidly FIGURE 18.24 Hierarchy of hemato-
proliferating HSCs (Reya et al. 2003; Sugimura et al. 2012). It is probable that in adult poietic lineages. At the top of the hier-
mammals, the maintenance of the billions of blood cells is not dependent on a small archy are the long-term hematopoietic
number of hematopoietic stem cells, but on the steady-state production of numerous stem cells (LT-HSCs), which give rise to
long-lived progenitor cells that are specified for either a single lineage or multiple lin- short-term HSCs (ST-HSCs) that retain
limited self-renewing capabilities (see
eages (Sun et al. 2014).
Chapter 5). Rapidly dividing multipo-
tent progenitors (MPP) still possess the
Hematopoietic inductive microenvironments
potential to generate either myeloid (red
The major models of blood cell production envision blood differentiation as progressing blood cell types) or lymphoid lineages
down a series of less potent precursor cells. At the top are the multipotent hematopoi- (white blood cell types), beyond which
etic stem cells (HSCs) which can give rise to more restricted multipotent stem cells differentiation becomes increasingly
(such as the common myeloid precursor cell, CMP), and finally to lineage-commited restricted. Progeny of the MPP include
the common myeloid progenitors (CMP)
progenitor cells. Endocrine, paracrine, and juxtacrine factors are thought to push blood
and granulocyte–macrophage–lym-
cell differentiation down one path or another (Figure 18.24).
phocyte progenitors (GMLPs). Further
One of the major endocrine factors (i.e., hormones) is erythropoietin, which appears differentiation takes place, producing
to cause the common myeloid precursor cell (CMP) to make more megakaryocyte/ery- common lymphoid progenitors (CLPs),
throid precursor cells (MEPs) and biases the MEPs to make more erythrocytes (Lu et al. granulocyte–macrophage progenitors
2008; Klimchenko et al. 2009). The paracrine factors involved in blood cell and lympho- (GMPs), and megakaryocyte–erythrocyte
cyte formation are the cytokines. Cytokines can be made by several cell types, but they progenitors (MEPs), These progenitors
will further differentiate into the various
are collected and concentrated by the extracellular matrix of the stromal (mesenchymal)
red and white blood cell types. (After Cul-
len et al. 2014.)
Erythrocytes
MEP Platelets
Eosinophils
CMP
Monocytes
Dendritic
cells
GMLP
NK cells
Self-renewal
CLP B cells
Multipotency
Thymus
T lymphocytes
Differentiation
610 Chapter 18
cells at the sites of hematopoiesis (Hunt et al. 1987; Whitlock et al. 1987). For instance,
granulocyte-macrophage colony-stimulating factor (GM-CSF) and the multilineage
growth factor interleukin 3 (IL3) both bind to the heparan sulfate glycosaminoglycan
of the bone marrow stroma (Gordon et al. 1987; Roberts et al. 1988). The extracellular
matrix is then able to present these paracrine factors to the stem cells in concentrations
high enough to bind to their respective receptors. At different stages of maturation, the
stem cells become competent to respond to different factors.
The developmental path taken by a descendant of a pluripotent HSC depends on
which growth factors it meets, and is therefore determined by the stromal cells. Wolf
and Trentin (1968) demonstrated that short-range interactions between stromal cells
and stem cells determine the developmental fates of the stem cells’ progeny. These
investigators placed plugs of bone marrow in a spleen and then injected stem cells
into it. Those CMPs that came to reside in the spleen formed colonies that were pre-
dominantly erythroid, whereas those that came to reside in the bone marrow formed
colonies that were predominantly granulocytic. Colonies that straddled the borders of
the two tissue types were predominantly erythroid in the spleen and granulocytic in
the marrow. Such regions of determination are referred to as hematopoietic inductive
microenvironments (HIMs). As expected, the HIMs induce different sets of transcrip-
tion factors in these cells, and these transcription factors specify the fate of the particu-
lar cells (see Kluger et al. 2004).
The transcription factors of the HIM may act by pulling the equilibrium of the stem
cells transcription network in different directions (Krumsiek et al. 2011; Wontakal et al.
2012). By decomposing the interactions into negative feedback loops and feedforward
loops (of both activation and repression), there appear to be only four stable configura-
tions that this network can have. Such stable configurations are called “attractor states”
in systems theory, and these attractor states correspond to four cell types. Moreover,
certain mutations will make certain attractor states impossible, and these are the muta-
tions that block the differentiation of certain cell types.
This scheme of blood cell differentiation going through cell types of progressively
diminished potency may not work at all stages of life. Notta and colleagues used single-
cell transcriptomes to show that the midlevel stem cells (such as the CMP) were not
present during later stages of human development. It is possible that later in life, blood
cell production follows immediately from the HSC.
Coda
We ask a lot of our circulatory system. We require a precise flow of blood through the
valves each second of our lives; we demand fine-tuned coordination between our brain,
heart, bone marrow, and hormones such that the cardiac muscle contractions adapt to
our physiological needs; and we demand that the production of our blood cells—cells
made by precursors that formed in our embryo—be so precise that we get neither can-
cer nor anemia. Given all this, it is not surprising that blood cell differentiation, heart
development, kidney development, and blood vessel formation are now among the most
important fields of study in medical science. Congenital heart defects are among the
most prevalent types of birth defects, and cardiovascular disease is the most common
cause of death in industrialized nations. The questions of cardiogenesis, kidney forma-
tion, angiogenesis, and hematopoiesis that engaged Aristotle and Harvey still excite
major research programs.
Photo
Intermediate and Lateral Plate Mesoderm 611
18 Snapshot Summary
Intermediate and Lateral Plate Mesoderm
1. The intermediate mesoderm forms the kidneys, adrenal ventral layer is the splanchnic (visceral) mesoderm, which
glands, and gonads. It is specified through interactions overlies the endoderm and forms the splanchnopleure.
with the paraxial mesoderm that require Pax2, Pax8, and 7. The space between the two layers of lateral plate meso-
Lim1. derm forms the body cavity, or coelom.
2. The metanephric kidney of mammals is formed by recip- 8. The heart arises from splanchnic mesoderm on both
rocal interactions of the metanephric mesenchyme and sides of the body. This region of cells is called the
a branch of the nephric duct called the ureteric bud. The heart field, or cardiogenic mesoderm. The cardiogenic
ureteric bud and metanephric mensenchyme are speci- mesoderm is specified by BMPs in the absence of Wnt
fied depending on the length of time their progenitor cells signals.
are exposed to Wnt and FGF signals.
9. The Nkx2-5, Mesp1, and GATA transcription factors
3. The metanephric mesenchyme becomes competent are important in committing the cardiogenic mesoderm
to form nephrons by expressing WT1, and it starts to to become heart cells. These cardiac precursor cells
secrete GDNF. GDNF is secreted by the mesoderm and migrate from the sides to the midline of the embryo, in
induces the formation of the ureteric bud. the neck region.
4. The ureteric bud secretes Fgf2 and BMP7 to prevent 10. There are two major heart fields one each side of the
apoptosis in the metanephric mesenchyme. Without body. Each heart field has two regions: The first heart
these factors, this kidney-forming mesenchyme dies. field forms the scaffold of the heart tube and will form the
5. The ureteric bud secretes Wnt9b and Wnt6, which left ventricle. The rest of the heart is made largely by the
induce the competent metanephric mesenchyme to second heart field.
form epithelial tubules. As they form these tubules, the 11. A cardiac precursor cell can form each of the major
cells secrete Wnt4, which promotes and maintains their lineages of the heart. The cardiogenic mesoderm forms
epithelialization. the endocardium (which is continuous with the blood
6. The lateral plate mesoderm splits into two layers. The vessels) and the myocardium (the muscular component
dorsal layer is the somatic (parietal) mesoderm, which of the heart).
underlies the ectoderm and forms the somatopleure. The
612 Chapter 18
12. The endocardial tubes form separately and then fuse. smooth muscle-like pericytes) to cover the vessels. Eph-
The looping of the heart transforms the original anterior- rin ligands and Eph receptor tyrosine kinases are critical
posterior polarity of the heart tube into a right-left for capillary bed formation.
polarity. 18. The pluripotent hematopoietic stem cell (HSC) gener-
13. Retinoic acid is important in determining the anterior- ates other pluripotent stem cells, as well as lineage-
posterior polarity of the heart and kidneys restricted stem cells. It gives rise to both blood cells and
14. Tbx transcription factors are critical for specifying the lymphocytes.
heart chambers and for establishing the electrical cir- 19. In vertebrates, HSCs are thought to originate from
cuitry of the heart. hemogenic endothelial cells that characterize the blood
15. Coronary arteries and lymphatic vessels both come from islands, the dorsal aorta, and the placental vessels. The
the reprogramming of veins. definitive HSC appears to be derived from the ventral
portion of the aorta.
16. Blood vessels are constructed by two processes, vas-
culogenesis and angiogenesis. Vasculogenesis involves 20. The common myeloid precursor (CMP) is a blood stem
the condensing of splanchnic mesoderm cells to form cell that can generate the more committed stem cells
blood islands. The outer cells of these islands become for the different blood lineages. Hematopoietic induc-
endothelial (blood vessel) cells. Angiogenesis involves tive microenvironments (HIMs) determine the blood cell
the remodeling of existing blood vessels. differentiation.
17. Numerous paracrine factors are essential in blood vessel 21. The HSC depends on stem cell factor, which is provided
formation. Fgf2 is needed for specifying the angioblasts. to it by the perivascular cells of the sinusoids contained
VEGF-A is essential for the differentiation of the angio- in the stem cell niche.
blasts. Angiopoietins allow the smooth muscle cells (and
Further Reading
Adamo, L. and G. García-Cardeña. 2012. The vascular origin of Morrison, S. J. and D. T. Scadden. 2014. The bone marrow niche
hematopoietic cells. Dev. Biol. 362: 1–10. for haematopoietic stem cells. Nature 505: 327– 334.
Cooley, J., S. Whitaker, S. Sweeney, S. Fraser and B. Davidson. Sizarov, A., J. Ya, B. A. de Boer, W. H. Lamers, V. M. Christof-
2011. Cytoskeletal polarity mediates localized induction of the fels and A. F. Moorman. 2011. Formation of the building plan of
heart progenitor lineage. Nat. Cell Biol. 13: 952–957. the human heart: Morphogenesis, growth, and differentiation.
Diogo, R. and 7 others. 2015. A new heart for a new head in Circulation 123: 1125–1135.
vertebrate cardiopharyngeal evolution. Nature 520: 466-473. Takasato, M. and M. H. Little. 2015. The origin of the mam-
Ding, L., T. L. Saunders, G. Enikolopov and S. J. Morrison. malian kidney: Implications for recreating the kidney in vitro.
2012. Endothelial and perivascular cells maintain haematopoi- Development 142: 1937–1947.
etic stem cells. Nature 481: 457–462.
Krause, M., A. Rak-Raszewska, I. Pietilä, S. E. Quaggin and
S. Vainio S. 2015. Signaling during kidney development. Cells
4:112–132.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
19
Development of
the Tetrapod Limb
CONSIDER YOUR LIMB. It has fingers or toes at one end, a humerus or femur at the
other. You won’t find anyone with fingers in the middle of their arm. Also consider the
subtle but obvious differences between your hands and your feet. If your fingers were
replaced by toes, you would certainly know it. Despite these differences, the bones of your
feet are similar to the bones of your hand. It’s easy to see that they share a common pat-
tern. And finally, consider that both your hands are remarkably similar in size, as are both
your feet. These commonplace phenomena present fascinating questions to the develop-
mental biologist. How is it that vertebrates have four limbs and not six or eight? How is
it that the little finger develops at one edge of the limb and the thumb at the other? How
does the forelimb grow differently than the hindlimb? How can limb size be so precisely
regulated? Is there a conserved set of developmental mechanisms that can explain why
our hands have five digits, a chick’s wing three digits, and the horse’s hoof one?
Limb Anatomy
As the name denotes, tetrapods are four-limbed vertebrates (amphibians, reptiles, birds,
How many fingers and mammals). The bones of any tetrapod limb—be it arm or leg, wing or flipper—consist
am I holding up?
The Punchline
Designed for locomotion on land, tetrapod limbs have joints between the bones and
a set of digits at their distal ends. The limb begins as a “bud” of tissue on the sides
of the embryo when cells from the developing myotome and lateral plate mesoderm
migrate to and proliferate within the presumptive limb field, the limb mesenchyme.
This proliferative “progress zone” is covered by ectoderm, with a thickening at the
distal tip called the apical ectodermal ridge. Fgf8 signaling from this ridge antagonizes
flank-derived retinoic acid, initiating a positive feedback loop with mesenchyme
signaling (Fgf10 and Wnt) to promote limb bud outgrowth. Fgf8 specifies the posterior
mesenchyme into the “zone of polarizing activity,” which secretes Shh to set up the
anterior-posterior (thumb-pinkie) axis of the limb. Wnt signaling determines the dorsal-
ventral axis (knuckle-palm). Skeletogenesis is controlled by a “Turing-type” model of
self-organization through morphogen interactions. In certain animals the early webbed
tissue between the digits remains; in others, it dies via BMP-mediated apoptosis. Each
limb signaling system influences the differential expression of Hox genes along each
axis, modification of which supports the evolution of fins to fingers.
614 Chapter 19
Proximal
Distal
2
Anterior 3
lateral plate 4
Dorsal 5
mesoderm
Posterior Anterior Posterior
(heart)
AER
Forelimb Ventral
field 2
Posterior Anterior
lateral plate
mesoderm
(somitic) 4 3
Proximal
Distal
Progress
zone
3
AER
ZPA
Figure 19.1 Limb anatomy. (A) Illus- Posterior
tration of a chick embryo just prior to
limb growth showing three important
mesodermal cell types as well as the of a proximal stylopod (humerus/femur) adjacent to the body wall, a zeugopod (radius-
emergence of the limb field. (B) Axis
ulna/tibia-fibula) in the middle region, and a distal autopod (carpals-fingers/tarsals-
orientation and anatomy of the limb bud.
Apical ectodermal ridge (AER); zone of toes)1 (FIGURE 19.1). Fingers and toes can be referred to as phalanges or, more gener-
polarizing activity (ZPA). (C) Skeletal pat- ally, digits. The positional information needed to construct a limb has to function in a
tern of the human arm, chick wing, and three-dimensional 2 coordinate system:
horse forelimb. (According to convention, • The first dimension is the proximal-distal axis (“close-far”; that is, shoulder-to-
the digits of the chick wing are numbered finger or hip-to-toe). The bones of the limb are formed by endochondral ossi-
2, 3, and 4. The cartilage condensations
fication. They are initially cartilaginous, but eventually most of the cartilage
forming the digits appear similar to those
forming digits 2, 3, and 4 of mice and
is replaced by bone. Somehow the limb cells develop differently at early stages
humans; however, new evidence sug- of limb morphogenesis (when they make the stylopod) than at later stages
gests that the correct designation may be (when they make the autopod).
1, 2, and 3.) (A after Tanaka 2013; B after • The second dimension is the anterior-posterior axis (thumb-to-pinkie). Our
Logan 2003.) little fingers or toes mark the posterior end and our thumbs or big toes are at
the anterior end. In humans, it is obvious that each hand develops as a mirror
image of the other. One can imagine other arrangements—such as the thumb
developing on the left side of both hands—but these patterns do not occur.
• Finally, limbs have a dorsal-ventral axis: our palms (ventral) are readily distin-
guishable from our knuckles (dorsal).
1
These terms can be difficult to remember, but knowing their word origins can help. Stylo =
like a pillar; zeugo = joining; auto = self; pod = foot.
2
Actually, it is a four-dimensional system, in which time is the fourth axis. Developmental
biologists get used to seeing nature in four dimensions.
Developmental Biology 11e
Fig. 19.01
Dragonfly Media Group
05/10/16
Development of the Tetrapod Limb 615
Limb skeletal
Peribrachial Free Shoulder Endoderm precursors
flank tissue limb girdle
Lateral plate
mesoderm
(C) (D)
1. The highly proliferative mesenchyme that fuels limb bud growth is known as the
Figure 19.3 Deletion of limb bone progress zone (PZ) mesenchyme (a.k.a. the undifferentiated zone).
elements by the deletion of paralogous 2. The cells found within the most posterior region of the progress zone constitute
Hox genes. (A) 5′ Hox gene patterning the zone of polarizing activity (ZPA), since it patterns cell fates along the anterior-
of the forelimb. Hox9 and Hox10 para- posterior axis.
logues specify the humerus (stylopod).
Hox10 paralogues are expressed to a 3. The apical ectodermal ridge (AER) is a thickening of the ectoderm at the apex of
lesser extent in the radius and ulna (zeu- the developing limb bud (FIGURE 19.2D).
gopod). Hox11 paralogues are chiefly
responsible for patterning the zeugopod. Dev T u tor i al Tetrapod Limb Development Dr. Michael J.F. Barresi
Hox12 and Hox13 paralogues function describes the basics behind building a limb.
in the autopod, with Hox12 paralogues
functioning primarily in the wrist and to
a lesser extent in the digits. (B) A similar
but somewhat differing pattern is seen
Hox Gene Specification of Limb Skeleton Identity
in the hindlimb. (C) Forelimb of a wild-
Homeobox transcription factors, or Hox genes, play an essential role in specifying
type mouse (left) and of a double-mutant
mouse that lacks functional Hoxa11 whether a particular mesenchymal cell will become stylopod, zeugopod, or autopod.
and Hoxd11 genes (right). The ulna and Understanding their role has given researchers substantial new insight into the devel-
radius are severely reduced or absent in opment and evolution of the vertebrate limb.
the mutant. (D) Human polysyndactyly
(“many fingers joined together”) syn- From proximal to distal: Hox genes in the limb
drome results from a homozygous muta- The 5′ (AbdB-like) portions (paralogues 9–13) of the Hoxa and Hoxd gene complexes
tion at the HOXD13 loci. This syndrome
appear to be active in the limb buds of mice. Based on the expression patterns of these
includes malformations of the urogenital
system, which also expresses HOXD13. genes and on naturally occurring and gene knockout mutations, Mario Capecchi’s
(A,B after Wellik and Capecchi 2003; C laboratory (Davis et al. 1995) proposed a model wherein these Hox genes specify the
from Davis et al. 1995, courtesy of M. identity of a limb region (FIGURE 19.3A,B). Here, Hox9 and Hox10 paralogues specify
Capecchi; D from Muragaki et al. 1996, the stylopod, Hox11 paralogues specify the zeugopod, and Hox12 and Hox13 paralogues
courtesy of B. Olsen.)
12 12
group
11 11
10 10
9 9
(C) (D)
Hoxa11-,
Hoxd11-deficient
mutant
Wild-type
Development of the Tetrapod Limb 617
specify the autopod. This scenario has been confirmed by numerous experiments. For
instance, when Wellik and Capecchi (2003) knocked out all six alleles of the three
Hox10 paralogues (Hox10aaccdd) in mouse embryos, the resulting mice not only had
severe axial skeletal defects, they also had no femur or patella (they did have humer-
uses, however, because the Hox9 paralogues are expressed in the forelimb stylopod but
not in the hindlimb stylopod). When all six alleles of the three Hox11 paralogues were
knocked out, the resulting hindlimbs had femurs but neither tibias nor fibulas (and the
forelimbs lacked the ulnas and radii). Thus, the Hox11 knockout got rid of the zeugo-
pods (FIGURE 19.3C). Similarly, knocking out all the paralogous Hoxa13 and Hoxd13 loci
resulted in loss of the autopod (Fromental-Ramain et al. 1996). Humans homozygous
for a HOXD13 mutation show abnormalities of the hands and feet wherein the digits
fuse (FIGURE 19.3D), and humans with homozygous mutant alleles of HOXA13 also
have deformities of their autopods (Muragaki et al. 1996; Mortlock and Innis 1997). In
both mice and humans, the autopod (the most distal portion of the limb) is affected by
the loss of function of the most 5′ Hox genes.
Scientists Speak 19.1 Watch a Web conference with Dr. Denis Duboule on Hox
genes in the limb.
Scientists Speak 19.2 In this Web conference, Dr. Peter Currie discusses the
evolution of limb muscles in fish.
618 Chapter 19
(A) (D)
Teleost
AEF
3ʹ 5ʹ
Coelacanth
AEF
(B)
3ʹ 5ʹ
Ball-and- Tetrapod
socket joint Ulna
AER
3ʹ 5ʹ
Shoulder Elbow Radius Wrist Hox genes
Figure 19.4 Limb evolution. (A) Tiktaalik roseae, a fish with wrists and fingers, lived in shal-
(C)
low waters about 375 million years ago. This reconstruction shows Tiktaalik’s fishlike gills, fins,
scales, and (lack of) neck. The external nostrils on its snout, however, indicate that it could
breathe air. (B) Fossilized Tiktaalik bones reveal the beginnings of digits, wrists, elbows, and
shoulders and suggest that this amphibian-like fish could propel itself on stream bottoms and
perhaps live on land for short durations. The joints of the fin included a ball-and-socket joint in
the shoulder and a planar joint that allowed the wrist to bend. Other joints allowed the animal to
perch on its substrate. (C) Resistant contact with a substrate would allow flexion at the proximal
Flexion
joints (shoulder and elbow) and extension at the distal ones (wrist and digits). (D) Schematic
representations of the limb buds, adult limb structures, and the Hoxd gene cluster with associ-
ated 5′ and 3′ cis-regulatory enhancers of a teleost (zebrafish), hypothetical coelacanth, and
human. In this illustration of the limb buds, the proximal and distal mesenchyme tissue are red
Extension and orange/yellow, respectively, and the apical ectodermal fold and ridge (AEF/AER) are gray. In
the adult limbs, the formation of fin radials are seen in both teleost fish and coelacanths (red for
proximal, orange for distal, and gray for the dermoskeleton), whereas the digits of the autopod
are present in humans (yellow). Adaptation of the 5′ cis-regulatory regions of Hox genes may
underlie autopod evolution. (A © John Weinstein/Field Museum Library/ Getty Images; B,C after
Shubin et al. 2006; D after Schneider and Shubin 2013; Woltering et al. 2014; Zuniga 2015.)
The fish fin bud is homologous to the limb bud and similarly has progress zone
mesenchyme and an overlying apical ectodermal ridge (AER). However, after proxi-
mal patterning of the stylopod, the AER of the fin bud changes into an apical ecto-
dermal fold (AEF) that promotes fin ray development as opposed to digits ( FIGURE
19.4D). One hypothesis suggests that potential developmental delays in this AER-to-
AEF transition would permit longer exposure to distal signals from the AER, enabling
the progress zone mesenchyme to become increasingly permissive to autopod fates
Developmental Biology 11e (digits). Moreover, changes in the spatial and temporal pattern of distal Hox genes
Fig. 19.04
Dragonfly Media Group
05/18/16
Development of the Tetrapod Limb 619
may be responsible for the evolution of the tetrapod hand from (A) Mouse (E12.5) (B) Zebrafish
the distal fin region of ancient lobe-finned fish (Schneider mCsC 4 dpf
and Shubin 2013; Freitas and Gómez-Skarmeta 2014; Zuniga 3ʹ
2015). Increased numbers of cis-regulatory enhancers associ-
ated with the Hoxa/d clusters could provide one mechanism CsC
for heritable adaptation of the autopod (see Figure 19.4D). In Hoxd1
further support of this model, researchers have identified both
conserved enhancers (“global control region,” GCR, and CsB)
and tetrapod-specific enhancers (CsS) that are associated with
early (proximal) and later (distal) Hox gene expression. In fact,
mouse CsS enhancers can functionally drive reporter expres- (C) Hoxd13a 4 dpf
sion in transgenic zebrafish embryos similarly within the dis-
talmost mesenchyme (FIGURE 19.5; Freitas et al. 2012).
In conclusion, this brief examination of the evolution of the
tetrapod limb, from fish fins to human hands, has hopefully Hoxd13
illuminated the importance of Hox gene regulation during limb
development. Hox genes are critical for specifying fates along 5ʹ
each axis of the limb, and their expression is under the influ-
ence of signals emanating from the flank (proximal) and AER
(distal), among others. What are these signals, and how do they Figure 19.5 The tetrapod-specific cis-acting regulatory
function to (1) determine where limbs form, (2) promote limb element (Csc) for mouse Hoxd13 drives similar expression in the
bud outgrowth and patterning, and (3) specify fates along the zebrafish distal fin bud. (A) Hoxd13 is positioned downstream and
anteroposterior and dorsoventral axes? responsive to the actions of the CsC enhancer in the distal mouse
limb. (B) In the zebrafish fin, this same mouse CsC enhancer can
drive reporter gene expression (mCsC:GFP; blue, arrowheads)
Scientists Speak 19.3 This Web conference with Dr.
in the distal limits of the endoskeletal territory (dashed line). (C)
Sean Carroll covers cis-regulatory elements in evolution.
This mCsC:GFP expression pattern in the zebrafish fin is spatially
similar to the endogenous expression pattern of Hoxd13a (blue,
arrowheads) suggesting the CsC could be a conserved enhancer
Determining What Kind of Limb to of Hox gene regulation. (After Freitas et al. 2012.)
Form and Where to Put It
Because the limbs, unlike the heart or brain, are not essential for embryonic or fetal
life, one can experimentally remove or transplant parts of the developing limb, or cre-
ate limb-specific mutants, without interfering with the vital processes of the organism.
Such experiments have shown that certain basic “morphogenetic rules” for forming a
limb appear to be the same in all tetrapods. Grafted pieces of reptile or mammalian
limb buds can direct the formation of chick limbs, and regions taken from frog limb
buds can direct the patterning of salamander limbs (Fallon and Crosby 1977; Sessions
et al. 1989; Hinchliffe 1991). Moreover, regenerating salamander limbs appear to follow
many of the same rules as developing limbs (see Chapter 22; Muneoka and Bryant
1982). What are these morphogenetic rules?
(A) (B) vertebrates differ with respect to the somite level at which they
Transplantation of somites Transplantation of somites arise, their position is constant with respect to the level of Hox
from limb to flank level from flank to limb level gene expression along the anterior-posterior axis (see Chapter
Donor Recipient Donor Recipient 9). For instance, in fish (in which the pectoral and pelvic fins
13 13 13 13 correspond to the anterior and posterior limbs, respectively),
14 14 14 14 amphibians, birds, and mammals, the forelimb buds are found
15 15 15 15
Limb 16 16 Limb 16 16 at the most anterior expression region of Hoxc6, the position of
17 17 17 19
field 18 15 ? field 18 20 ? the first thoracic vertebra3 (Oliver et al. 1988; Molven et al. 1990;
19 16 19 21 Burke et al. 1995). It is probable that positional information from
20 17 20 22
21 18 21 23 the Hox gene expression domains causes the paraxial meso-
Flank 22 22 Flank 22 22
(non- 23 23 (non- 23 23 derm in the limb-forming regions to be different from all other
limb) 24 24 limb) 24 24 paraxial mesoderm. Transplantation experiments in which
25 25 25 25
26 26 26 26 paraxial mesoderm (somites) from different locations is placed
27 27 27 27
28 28 28 28 adjacent to the flank lateral plate shows that the paraxial meso-
derm from limb-forming regions promotes limb bud formation,
whereas the paraxial mesoderm from limbless flank actively
Control side Transplant side Control side Transplant side represses limb formation (FIGURE 19.6 ; Noro et al. 2011).
When it first forms, the limb field has the ability to regu-
late for lost or added parts. In the tailbud stage of the yellow-
spotted salamander (Ambystoma maculatum), any half of the
limb disc is able to generate an entire limb when grafted to
a new site (Harrison 1918). This potency can also be shown
by splitting the limb disc vertically into two or more segments
and placing thin barriers between the segments to prevent their
reunion. When this is done, each segment develops into a full
24 hrs 36 hrs
limb. Thus, like an early sea urchin embryo, the limb field rep-
Results: Larger limb bud Results: Smaller limb bud resents a “harmonious equipotent system” wherein a cell can
be instructed to form any part of the limb. The regulative ability
Figure 19.6 Transplantation of different regions of the presomit- of the limb bud has recently been highlighted by a remarkable
ic mesoderm (PSM) to the limb field causes changes in limb size.
experiment of nature. In numerous ponds in the United States,
(A) Transplanting PSM from the level of the presumptive forelimb
to the flank (region between the forelimb and hindlimb) results in a
multilegged frogs and salamanders have been found (FIGURE
larger forelimb bud (area between arrowheads). (B) Transplantation 19.7). The presence of these extra appendages has been linked
of PSM from the flank region to the level of the presumptive fore- to the infestation of the larval abdomen by parasitic trematode
limb results in a smaller forelimb bud. (After Noro et al. 2011.) worms. The eggs of these worms apparently split the devel-
oping tadpole limb buds in several places, and the limb bud
fragments develop as multiple limbs (Sessions and Ruth 1990;
Sessions et al. 1999).
Figure 19.7 Multilimbed Pacific tree frog (Hyla regilla), the result of
infestation of the tadpole-stage developing limb buds by trematode
cysts. The parasitic cysts apparently split the developing limb buds
in several places, resulting in extra limbs. In this adult frog’s skeleton,
the cartilage is stained blue, and the bones are stained red. (Courtesy
of S. Sessions.)
Wild-type Rdh10–/–
(A) RARE
posteriorly along the presomitic mesoderm), whereas RA is gener-
ated more anteriorly in somites and anterior presomitic mesoderm;
relevant for forelimb development, however, Fgf8 is also expressed
within the heart lateral plate mesoderm located just anterior to the
forelimb field (FIGURE 19.8). Investigations into forelimb develop-
ment in chick and mouse, as well as the pectoral fin of zebrafish,
suggest that the anterior and posterior expression of Fgf8 func-
tions to inhibit forelimb bud initiation (Tanaka 2013; Cunningham
and Duester 2015). For instance, gain of Fgf8 function by its direct
application or by constitutive activation of FGF receptors (FgfR)
results in a loss of the forelimb field (marked by loss of expression Heart Neural tube
of Tbx5; see Figure 19.8C) and truncated limbs (Marques et al.
Gilbert (B) Fgf8
2008; Cunningham
Developmental et ,al.
Biology 11e 2013).Associates
Sinauer
In contrast, RA is present
DevBio11e_19.07 throughout the somitic regions of the
Date 03-14-16
trunk adjacent to the forelimb field, where it is needed to repress
trunk Fgf8 expression and thus promote forelimb bud initiation.
Targeted loss of RA synthesis (by mutation or pharmacological
inhibition) in the vertebrate forelimb results in an expansion of
Fgf8 expression toward the presumptive forelimb field, a reduc-
tion in Tbx5 expression, and the failure to form forelimb buds—all
of which are consistent with a gain of Fgf8 signaling. Because RA
functions as a transcription factor ligand and has been shown to
directly repress Fgf8 gene transcription (Kumar and Duester 2014),
Caudal progenitor zone
(C) Tbx5
Figure 19.8 Antagonism between retinoic acid and Fgf8 determines
the pattern of Tbx5 expression in the mouse forelimb field. As seen in
control subjects at the left, reporter expression from the RA regula-
tory element (RARE) falls directly between Fgf8 expression in the heart
(anterior) and throughout the caudal progenitor zone. (A) RARE reporter
expression is almost completely repressed by the loss of the enzyme reti-
noid dehydrogenase 10 (Rdh10 mutant, right), the exception being mini-
mal expression in the neural tube. (B) In contrast, loss of Rdh10 results
in an expansion of Fgf8 expression into the axial region typical occupied
by RA. (C) Lack of RA signaling through the loss of Rdh10 also leads to a
reduction of Tbx5 expression in the forelimb field. (From Cunningham et
al. 2013.) Forelimb field
622 Chapter 19
Figure 19.9 Model for forelimb field (A) (B) Lateral plate mesoderm Ectoderm
initiation. (A) Initially, axial-level Hox genes Chick/mouse/fish forelimb
regulate Fgf8 and retinoic acid expres- Fgf8 bud initiation
sion, which function as antagonistic Heart EMT
Somite
signals that induce Tbx5 expression for Fgf8
initiation of the forelimb field. (B) Model
of the positive feedback loops between
Fore- RA Tbx5 Fgf10 +
signaling factors that promote forelimb
limb RA +
field Wnt3a
development across species. (C) Many of Wnt2b
the essential factors patterning hindlimb
development between chick and mouse
(C)
are the same and also generate positive
feedback loops of signaling. Some of the Chick hindlimb bud initiation
Fgf8
initiation factors for hindlimb induction do Pitx1
differ, however; namely, Islet1 is required Notochord Fgf8
for the mouse but not chick hindlimb. (A
Hox ?
genes Tbx4 Fgf10 +
after Cunningham and Duester 2015.)
+
Wnt3a
Wnt8c
the current model of forelimb bud initiation begins with RA restricting Fgf8 expression
from the presumptive limb region. In the absence of Fgf8, the lateral plate mesoderm is
permissive for forelimb bud formation and development (FIGURE 19.9A ; Tanaka 2013;
Cunningham and Duester 2015).
Although RA-Fgf8 antagonism plays a role during forelimb initiation and the early
stages of somitogenesis, RA is largely dispensable for hindlimb development. Loss of
RA synthesis in mice does not affect hindlimb bud formation, and overall hindlimb size
and patterning are normal (Cunningham et al. 2013). Thus, it is currently unknown
what signaling mechanisms underlie hindlimb bud initiation.
4
Tbx stands for “T-box,” a specific DNA-binding domain. The T (Brachyury) gene and its rela-
tives have a sequence
Developmental Biologythat
11e encodes this domain. We discussed Tbx5 in the context of heart ven-
tricle19.09
Fig. development in Chapter 18.
Dragonfly Media Group
05/31/16
Development of the Tetrapod Limb 623
of the lateral plate mesoderm (including the region that will form Figure 19.10 Fgf10 expression and action in the devel-
the hindlimbs) and regions of Tbx5 expression in the anterior por- oping chick limb. (A) Fgf10 becomes expressed in the lateral
tion (including the region that will form the forelimbs). When Fgf10- plate mesoderm in precisely those positions (arrows) where
limbs normally form. (B) When transgenic cells that secrete
secreting beads were used to induce an ectopic limb between the chick
Fgf10 are placed in the flanks of a chick embryo, the Fgf10
hindlimb and forelimb buds (FIGURE 19.10A,B), the type of limb pro- can cause the formation of an ectopic limb (arrow). (C) Limb
duced was determined by which Tbx protein was expressed. Limb buds type in the chick is specified by Tbx4 and Tbx5. In situ
induced by placing FGF beads close to the hindlimb (opposite somite hybridizations show that during normal chick development,
25) expressed Tbx4 and became hindlimbs. Limb buds induced close Tbx5 (blue) is found in the anterior lateral plate mesoderm,
to the forelimb (opposite somite 17) expressed Tbx5 and developed as whereas Tbx4 (red) is found in the posterior lateral plate
forelimbs (wings). Limb buds induced in the center of the flank tissue mesoderm. Tbx5-containing limb buds produce wings,
whereas Tbx4-containing limb buds generate legs. If a new
expressed Tbx5 in the anterior portion of the limb and Tbx4 in the pos-
limb bud is induced with an FGF-secreting bead, the type
terior portion; these limbs developed as chimeric structures, with the of limb formed depends on which Tbx gene is expressed
anterior resembling a forelimb and the posterior resembling a hindlimb in the limb bud. If placed between the regions of Tbx4 and
( FIGURE 19.10C–E ). Moreover, when a chick embryo was made to Tbx5 expression, the bead will induce the expression of
express Tbx4 throughout the flank tissue (by infecting the tissue with Tbx4 posteriorly and Tbx5 anteriorly. The resulting limb bud
a virus that expressed Tbx4), limbs induced in the anterior region of the will also express Tbx5 anteriorly and Tbx4 posteriorly and
flank often became legs instead of wings (FIGURE 19.10F,G). will generate a chimeric limb. (D) Expression of Tbx5 in the
forelimb (w, wing) buds and in the anterior portion of a limb
In further support of Tbx5 being the critical factor for the initia-
bud induced by an FGF-secreting bead (red arrow). Staining
tion and specification of the forelimb limb bud, loss of the Tbx5 gene for Mrf4 mRNA marks the somite positions.) (E) Expression
in chicks, mice, and fish all result in a complete failure of forelimb of Tbx4 in the hindlimb (le, leg) buds and in the posterior
formation that includes even the most proximal shoulder/girdle struc- portion of an FGF-induced limb bud (red arrow). (F) A chi-
ture (Garrity et al. 2002; Agarwal et al. 2003; Rallis et al. 2003). How- meric limb (red arrow) induced by an FGF bead. (G) At a
ever, the role of Tbx4 in hindlimb specification may differ between later stage of development the chimeric limb contains ante-
chicks and mice. In chicks, loss of Tbx4 function in the hindlimb field rior wing structures (feathers) and posterior leg structures
(scales). (After Ohuchi et al. 1998, Ohuchi and Noji 1999;
completely inhibits leg initiation and growth (Takeuchi et al. 2003);
photographs courtesy of S. Noji.)
in mice, hindlimb bud growth and initial patterning appear normal
Tbx5
(A) Fgf10 (B) (C) Stage 14/15
(early day 3) Tbx4
15
FGF Wing
20
bead
Chimera
Leg
Wing
Leg
624 Chapter 19
when Tbx4 is knocked out (Naiche and Papaioannou 2003), although leg development
is arrested prematurely. This finding suggests that in mice, Tbx4 normally plays more
of a role in the maintenance of hindlimb outgrowth than its initial formation.
More recent investigations have revealed two additional transcription factors
involved in the initiation of the hindlimb: Pitx1 and Islet1. Indeed, misexpression of
Pitx1 in the mouse forelimb causes its muscles, bones, and tendons to develop into
ones that look like those of a hindlimb (Minguillon et al. 2005; DeLaurier et al. 2006;
Ouimette et al. 2009); Tbx4 expressed in the mouse forelimb will not have this effect.
Additionally, Pitx1 protein activates hindlimb-specific genes in the forelimb, includ-
ing Hoxc10 and Tbx4. Interestingly, a mutation in the human PITX1 gene that causes a
haploinsufficiency in Pitx1 protein results in a bilateral “club foot” phenotype (Alvarado
et al. 2011). These results indicate that Pitx1 is sufficient for hindlimb specification;
however, the hindlimb is neither completely lost nor severely mispatterned in Pitx1-
null mice, although some hindlimb structures are malformed (Duboc and Logan 2011).
This observation suggests that yet another factor may be involved. Islet1, a homeodo-
main transcription factor, is transiently expressed in the hindlimb field before Fgf10
expression and leg bud formation in mice (Yang et al. 2006). When Islet1 is inactivated
specifically in the lateral plate mesoderm, hindlimbs do not form, which is consistent
with a role in hindlimb initiation (Itou et al. 2012). Transcriptional regulation of Islet1
and of Pitx1 are independent of each other’s function, as are their roles in hindlimb
development. Despite both genes being documented to similarly upregulate Fgf10 and
Tbx4, Islet1 functions to induce hindlimb bud initiation (see Figure 19.9C, black arrows),
whereas Pitx1 plays a role in hindlimb patterning (see Figure 19.9C, gray arrows).
Epithelial-to-mesenchymal transition
(A) (B) Stage 13 + 1 h (C) Stage 13 + 12 h (D) Stage 13 + 24 h
Somatopleure Epithelial
mesoderm
mesoderm
Epithelial
Coelom
Coelom
Coelom
Coelom
GFP F-actin
Development of the Tetrapod Limb 625
2 Extra Wing is
(A) (B) AER duplicated
3 Leg
Forelimb mesenchyme
mesenchyme
AER Leg
4 Nonlimb Wing
mesenchyme AER regresses;
limb development
ceases
5 AER
replaced by Normal
FGF bead wing
of the limb; (2) maintaining the expression of those molecules that generate the ante-
rior-posterior (thumb-pinkie) axis; and (3) interacting with the proteins specifying the
anterior-posterior and dorsal-ventral (knuckle-palm) axes so that each cell is given
instructions on how to differentiate (see Figure 19.1).
The proximal-distal growth and differentiation of the limb bud are made possible by
a series of interactions between the AER and the limb bud mesenchyme directly (200
μm) beneath it. As mentioned previously, this distal mesenchyme is called the progress
zone (PZ) mesenchyme because its proliferative activity extends the limb bud (Harrison
1918; Saunders 1948; Tabin and Wolpert 2007). These interactions were demonstrated
by the results of several experiments on chick embryos (FIGURE 19.12C ):
1. If the AER is removed at any time during limb development, further development
of distal limb skeletal elements ceases.
Gilbert 2. If an extra AER is grafted onto an existing limb bud, supernumerary structures are
Developmental Biology 11e, Sinauer Associates
DevBio11e_19.12 Date 05-10-16 formed, usually toward the distal end of the limb.
3. If leg mesenchyme is placed directly beneath the wing AER, distal hindlimb struc-
tures (toes) develop at the end of the limb. (If this mesenchyme is placed farther
from the AER, however, the hindlimb [leg] mesenchyme becomes integrated into
wing structures.)
4. If limb mesenchyme is replaced by nonlimb mesenchyme beneath the AER, the
AER regresses and limb development ceases.
Development of the Tetrapod Limb 627
Thus, although the mesenchyme cells induce and sustain the AER and determine the
type of limb to be formed, the AER is responsible for the sustained outgrowth and
development of the limb (Zwilling 1955; Saunders et al. 1957; Saunders 1972; Krab-
benhoft and Fallon 1989). The AER keeps the mesenchyme cells directly beneath it in
a state of mitotic proliferation and prevents them from forming cartilage (see ten Berge
et al. 2008).
FGF and Wnt proteins also regulate the shape and growth of the early limb bud. The
initial limb mesenchyme cells are not randomly organized. Rather, they show a polarity
such that they extend their long axes perpendicular to the ectoderm (Gros et al. 2010;
Sato et al. 2010). Wnt signaling appears to determine this orientation and also promotes
cell division in the plane of the ectoderm, thereby extending the limb bud outward.
FGF signals increase the velocity of cell migration, causing cells to migrate distally. As
a result, the limb bud flattens in the anterior-posterior axis while growing distally (i.e.,
toward the source of Fgf8).
Fgf8 is the major active factor in the AER, and Fgf8-secreting beads can substitute for
the AER functions in inducing limb growth (see Figure 19.12C, panel 5). There are other
FGFs made by the AER, including Fgf4, Fgf9, and Fgf17 (Lewandoski et al. 2000; Bou-
let et al. 2004). Loss of any one of these FGFs cause only mild to no defects in skeletal
pattern, though, suggesting significant redundancy exists within this family for limb
patterning. However, genetic removal of multiple FGF genes demonstrated increasingly
severe and specific skeletal malformations with each additional FGF gene removed,
which supports the idea that AER-derived FGFs exhibit some control over patterning
(see Figure 19.9B,C, red arrows; Mariani et al. 2008).
Scientists Speak 19.4 A Web conference with Dr. Francesca Mariani on the
instructive roles of FGF signaling in proximal-to-distal patterning.
WEb Topic 19.1 Induction of the AER This complex event involves interaction
between the dorsal and ventral compartments of the ectoderm. The Notch pathway may
be critical; misexpression of the genes in this pathway can result in the absence or dupli-
cation of limbs.
the role of the aer In 1948, John Saunders made a simple and profound observa-
tion: if the AER is removed from an early-stage wing bud, only a humerus forms. If
the AER is removed slightly later, humerus, radius, and ulna form (Saunders 1948;
Iten 1982; Rowe et al. 1982). Explaining how this happens has not been easy. First it
had to be determined whether the positional information for proximal-distal polarity
resided in the AER or in the progress zone mesenchyme. Through a series of reciprocal
transplantations, this specificity was found to reside in the mesenchyme. If the AER
had provided the positional information—somehow instructing the undifferentiated
mesoderm beneath it as to what structures to make—then older AERs combined with VADE MECUM
younger mesoderm should have produced limbs with deletions in the middle, whereas
An interview with Dr. John Saun-
younger AERs combined with older mesenchyme should have produced duplications
ders contains movies of his work
of structures. This was not found to be the case; rather, normal limbs formed in both
on limb development, which
experiments (Rubin and Saunders 1972). But when the entire progress zone (including
identified the AER and the ZPA as
both the mesoderm and the AER) from an early embryo was placed on the limb bud
two of the major signaling centers
of a later-stage embryo, new proximal structures were produced beyond those already
in limb formation. His transplanta-
present (FIGURE 19.13A). Conversely, when old progress zones were added to young tion studies provided the frame-
limb buds, distal structures developed such that digits were seen to emerge from the work for the molecular character-
humerus without an intervening ulna and radius (FIGURE 19.13B); Summerbell and ization of the mechanisms of limb
Lewis 1975). These experiments demonstrated that the mesenchyme specifies the skel- formation.
etal identities along the proximal-distal axis, which beckons the next question: “How?”
628 Chapter 19
Old PZ
onto young
limb buds
Graft locations
1 mm 1 mm
Distal limb
Proximal Cyp26b1 Distal graft Stage 21–22
Retinoic FGFs/
acid Wnts
Meis1/2 Hoxa13
1 mm 1 mm
Stage 24
1 mm 1 mm
Untreated
stage 18
mesenchyme
Stylopod
Zeugopod Autopod
Stage 18
Meis mesenchyme
incubated
with
Hox11 Hox13 FGF/Wnt
Figure 19.14 (A) Model for limb patterning, whereby the proxi- the expression pattern of specific proximodistal transcription factors
mal-distal axis is generated by opposing gradients of retinoic acid in transplanted mesenchyme (dark staining). Meis1 is specific for the
(RA) (blue shading) from the proximal flank and of FGFs and Wnts stylopod, Hoxa11 is specific for the zeugopod, and Hoxa13 is spe-
(pink shading) from the distal AER. (B) Grafting procedure in chick cific for the autopod. Mesenchyme from the earliest limb bud (stage
embryos showing transplantation of limb bud tips to the head region 18) will form all three types of cartilage. When the mesenchyme is
of another chick embryo. Bud tips were either untreated or treated first incubated in Fgf8 and Wnt3a, however, the autopod transcrip-
by inserting a bead soaked in RA (asterisks mark bead location). tion factor (Hoxa13) is greatly expressed, whereas the stylopod
Results showed that RA proximalizes the bones forming from the marker (Meis1) is drastically reduced. The addition of RA in culture
transplanted mesenchyme. Untreated limb bud tips (shaded) gen- is required to maintain competence to express Meis1 proximally (not
erated specific limb cartilage depending on age. However, when shown). (A after Macken and Lewandoski 2011; B after Roselló-Díez
the bud tip was treated with 1 mg/ml RA, the skeleton that formed et al. 2011; C after Cooper et al. 2011, photographs courtesy of the
became more proximal. (C) Treatment with FGFs and Wnts changes authors.)
proximal-distal determining genes, such as Meis1/2, Hoxa11, and Hoxa13 in the stylopod,
zeugopod, and autopod, respectively (Cooper et al. 2011). For instance, RA promotes the
Developmental
expression Biology
of the more11e
proximal Meis1, whereas Fgf8 inhibits expression of this gene. The
Fig. 19.14
opposite relationship holds true for the more distal Hoxa13 (see Figure 19.14A,C). The
Dragonfly Media Group
upregulation
06/03/16 of Meis1 by RA is a protective one because, aside from promoting extreme
proximal cell fates, Meis1 protein also represses CYP26b1 transcription. In fact, recent
refinements of this model suggest that there are two distinct thresholds of RA-to-Fgf8
630 Chapter 19
mean that RA plays a role in establishing the early limb field, as opposed to RA affect-
ing patterning along the proximal-distal axis. Developing Questions
As an alternative to the dual gradient model, Cunningham and colleagues have pro- Autonomous or
posed a single gradient model that focuses on the instructive patterning signals from nonautonomous yet again?
proteins derived from the AER (Cunningham et al. 2013; reviewed in Cunningham and It seems that the current
Duester 2015). Specifically, initial expression of Meis1/2 throughout the early limb bud challenge for the limb
specifies stylopod fates; then, distal FGF expression functions both to repress Meis1/2, field (and you) will be
to further investigate the
preventing the adoption of more proximal fates by distal mesenchyme, and to repress
nature of, and interactions
RA through Cyp26b1 induction, thus preventing RA from interfering with distal pat- between, autonomous
terning. The keys to this proposed single gradient model are, first, that RA does not play and nonautonomous
an instructive role beyond forelimb field induction and, second, that the autonomously mechanisms. The
timed collinear expression of Hox genes along the proximal-distal axis (see Tarchini model should include
and Duboule 2006) will be permitted to appropriately pattern cell fates in the absence mechanisms—epigenetic or
of excessive RA signaling. otherwise—for controlling
developmental time. Do
you think the evidence
is there to support a dual
Turing’s model: A reaction-diffusion mechanism gradient model, or are
of proximal-distal limb development distal gradients of FGF
Genes and proteins don’t produce a skeleton. Cells do. The cell types of the stylopod proteins alone sufficient?
and the autopod are identical; it is only how they are arranged in space that differs.
Amazingly, disassociated limb mesenchyme placed in culture is capable of self-orga-
nizing, expressing 5′ Hox genes, and forming limblike structures with rods and nodules
of cartilage (Ros et al. 1994), which raises the foundational question, how do these cells
“know” to organize appropriately? Applied to the embryonic limb, why is only one
cartilage element formed in the stylopod while two are formed in the zeugopod and
several in the autopod? How do the gradients surrounding these cells tell them how
to create different parts of the skeleton in different places? Why are the fingers and
toes always at the distal end of the limb? The answers may come from a model that
involves the diffusion of two or more negatively interacting signals. This is known as
the reaction-diffusion mechanism for developmental patterning.
Autopod
sectional view of the activator morphogen
TGF-β at successive stages of chick limb Activator (A)
development (increasing time is shown
from bottom to top). The concentration Time 2
of TGF-b is indicated by color (low =
green; high = red). (E) Three-dimensional
Relative concentration
Zeugopod
view of the cells undergoing condensa-
tion into bone (gray) as predicted by
this computer simulation. Note that the
number of “bones” in each region of the
limb correlates with the number of TGF-b
concentration peaks over developmental Time 3
time, as shown in (D). (A from Kondo et
al. 2010; D,E from Zhang et al. 2013.)
Stylopod
Position
Turing’s mathematics show that if I diffuses more readily than A, sharp waves of con-
centration differences will be generated for morphogen A (FIGURE 19.16C ).
The diffusion of the interacting signals may initially be random, yet due to the activa-
tor-inhibitor dynamics of this LALI-type Turing model, there will be alternating areas of
high and low concentrations of a morphogen, which can produce differential cell fates.
When the concentration of the activating morphogen is above a certain threshold level,
a cell (or group of cells) can be instructed to differentiate in a certain way.
“turing” along the limb Turing’s model has produced fascinating results when
applied to limb development ( FIGURE 19.16D,E ). It appears that reaction-diffusion
Developmental
dynamics canBiology
tell us11e
how the limb bud acquires its proximal-distal polarity as well as
Fig. 19.16
Dragonfly Media Group
05/19/16
Development of the Tetrapod Limb 633
how the number of digits is regulated at the distal tip of the “Frozen” Active Apical
limb (Turing and digits will be covered later in this chapter). domain domain ectodermal
The reaction-diffusion system has been proposed to be suffi- ridge
cient for establishing patterns of precartilage and noncartilage
tissues (Zhu et al. 2010).
Inhibitory
FgfR2
Stuart Newman’s laboratory has demonstrated that a reac- FgfR3 domain
tion-diffusion mechanism can pattern limb mesenchyme, and
FgfR1
that size and shape matter (Hentschel et al. 2004; Chaturvedi Fgf8
FgfR2
et al. 2005; Newman and Bhat 2007; Zhu et al. 2010; reviewed FgfR3
in Zhang et al. 2013). To mathematically model limb chondro-
genesis within a Turing framework, the key parameters need to
be identified. During chondrogenesis along the proximal-distal
axis, the AER is seen as dividing the limb into two domains:
the inhibitory domain (also called the apical zone), the most distal
mesenchyme subjacent to the AER, in which precartilage con- Autoactivation Activators
densation is repressed; and the active zone, which lies proximally Extracellular matrix molecules
(fibronectin) BMPs
adjacent to the inhibitory domain and is the morphogenetically Activin (TGF-β)
Cell adhesion molecules
active domain where cartilage-forming condensations coalesce. Transcription factors Galectin-1
A third domain, the “frozen zone” well beyond the influence of Turing
the AER, contains the formed cartilage primordia of the skel- system
eton at proximal regions of the developing limb (FIGURE 19.17). Aggregation
As mentioned earlier, Gros and colleagues (2010) found that into nodules Candidates:
the Wnt and FGF proteins secreted from the AER induce specific Noggin, FGFs,
Notch, Galectin-8
patterns of cell division and growth in the underlying mesen-
chyme. Moreover, factors secreted by the AER keep the most Cartilage Inhibitors
distal mesenchyme in a plastic, undifferentiated state (Kosher et
al. 1979), signaling that is in part mediated via FgfR1. It is within Figure 19.17 Reaction-diffusion mechanism for proximal-distal
the more proximal active zone of the limb mesenchyme that limb specification. In the inhibitory domain immediately outside the
the Turing parameters apply. The active and frozen zones are AER, cells are kept dividing by FGFs and Wnts and are prevented
from forming cartilage. Behind this area, in the active domain, car-
further defined (both in tissue and in differential equations of
tilaginous nodules actively form according to a reaction-diffusion
the math model) by their unique expression of FgfR2 and FgfR3, mechanism. Here each cell secretes and can respond to activating
respectively (Szebenyi et al. 1995; Hentschel et al. 2004). The paracrine factors of the TGF-β family (TGF-β, BMPs, activin) and cell
limb mesenchyme cells within the active zone synthesize activa- adhesion factors such as galectin-1. These factors stimulate their
tors of cartilage nodule formation. These activators include TGF- own synthesis as well as that of the extracellular matrix and cell
β, BMPs, activins, and certain carbohydrate-binding proteins adhesion proteins that promote aggregation. The activating cells
called galectins. Galectins can induce the formation of certain also stimulate the synthesis of diffusible inhibitors of aggregation
(including Noggin and galectin-8), preventing cell adhesion in neigh-
cell adhesion molecules and extracellular matrix proteins, such
boring regions. The places where nodules can form are governed by
as fibronectin, that cause cells to aggregate together to form the the geometry of the limb bud (i.e., the geometry decides how many
cartilaginous skeleton. These same cells, however, also synthe- “waves” of activator will be allowed). In the “frozen” domain, the
size inhibitors of aggregation, such as Noggin and inhibitory aggregated nodules can now differentiate into cartilage, thus
galectins. As a result, what were once cartilage-forming aggre- “freezing” the configuration. (After Zhu et al. 2010.)
gates inhibit the areas surrounding them from forming more
such aggregates (see Figure 9.17, lower panel). Broader space
allocation to the limb allows more aggregates to form.
At different sizes of the limb, different numbers of precartilaginous condensations
can form. First, a single condensation can fit (humerus), then two (ulna and radius),
then several (wrist, digits). In this reaction-diffusion hypothesis, the aggregations of
precartilage mesenchyme actively recruit more cells from the surrounding area and lat-
erally inhibit the formation of other foci of condensation. The number of these conden-
sations, then, depends on the geometry of the active zone and the strength of the lateral
inhibition. Once formed, the aggregates of mesenchyme interact with one another not
only to recruit more cells but also to express the transcription factors (Sox9) and extra-
cellular matrix (collagen 2) characteristic of cartilage (Lorda-Diez et al. 2011).
According to the model, waves of synthesis and inhibition would form the original
pattern of the limb. By placing such constraints as geometry, diffusibility, and theBiology
Developmental rates 11e
Fig. 19.17
Dragonfly Media Group
05/11/16
634 Chapter 19
of synthesis and degradation of each activator and inhibitor, Zhu and colleagues have
been able to model the types of skeleton formed as the limb bud grows. First, the com-
puter model accurately mimicked the normal patterning of the limb (FIGURE 19.18A).
Next, it simulated the aberrant skeletons formed as a result of manipulations (FIGURE
(A) (B)
Proximal
23
AER
intact
Distal
24
AER
removed
T = 1.4 early
25
T = 2.0
AER
26 removed
Late
T = 2.7
27–28
Add extra
ZPA
T = 3.0
30
(C)
Shh–/–, Gli3–/–
Talpid–/–
Gilbert
Development of the Tetrapod Limb 635
Anterior
Transplanted
ZPA
Normal
ZPA
Posterior
Figure 19.19 When a ZPA is grafted to anterior limb bud mesoderm, duplicated digits
emerge as a mirror image of the normal digits. (After Honig and Summerbell 1985; photograph
courtesy of D. Summerbell.)
19.18B) and mutations (FIGURE 19.18C ). Altering the geometries also could yield the
Developing Questions
patterns seen in fossil limbs (FIGURE 19.18D).
Mathematical modeling
WATCH DEVELOPMENT 19.1 Witness a computer simulation of the acquisition of can point the develop-
mental biologist toward
skeletal limb patterns over time based upon a reaction-diffusion model.
new questions and
experiments, and Turing’s
model has certainly
Specifying the Anterior-Posterior Axis done so with regard
to pattern formation
The specification of the anterior-posterior axis of the limb is the earliest restriction in during organogenesis.
limb bud cell potency from the pluripotent condition. In the chick, this axis is specified For example, which
factors in the active zone
shortly before a limb bud is recognizable.
are the main “reactive”
activators and inhibitors?
Sonic hedgehog defines a zone of polarizing activity Although TGF-β is a well-
Viktor Hamburger (1938) showed that as early as the 16-somite stage, prospective supported candidate for
wing mesoderm transplanted to the flank area develops into a limb with the anterior- the chondrogenic activator,
posterior and dorsal-ventral polarities of the donor graft, not those of the host tissue. there has been little
Several later experiments (Saunders and Gasseling 1968; Tickle et al. 1975) suggested experimental data to
characterize the potential
that the anterior-posterior axis is specified by a small block of mesodermal tissue near
inhibitors that mathematical
the posterior junction of the young limb bud and the body wall. When tissue from this modeling is predicting.
region is taken from a young limb bud and transplanted to a position on the anterior Another parameter to
side of another limb bud, the number of digits on the resulting wing is doubled (FIGURE evaluate is cell movements.
19.19). Moreover, the structures of the extra set of digits are mirror images of the nor-
mally produced structures. Polarity is maintained, but the information is now coming
from both an anterior and a posterior direction. Thus, this region of the mesoderm has
been called the zone of polarizing activity, or ZPA .
The search for the molecule(s) that confer polarizing activity on the ZPA became
Gilbert
one of the most intensive quests in developmental biology. In 1993, Riddle and col-
Developmental Biology 11e, Sinauer Associates
leagues showed by in
DevBio11e_19.19 Datesitu hybridization that Sonic hedgehog (Shh), a vertebrate homo-
03-15-16
logue of the Drosophila hedgehog gene, was expressed specifically in that region of the
limb bud known to be the ZPA ( FIGURE 19.20A). As evidence that this association
between the ZPA and Sonic hedgehog was more than just a correlation, Riddle and
colleagues (1993) demonstrated that the secretion of Shh protein is sufficient for polar-
izing activity. They transfected embryonic chick fibroblasts (which normally would
never synthesize Shh) with a viral vector containing the Shh gene (FIGURE 19.20B).
The gene became expressed, translated, and secreted in these fibroblasts, which were
then inserted under the anterior ectoderm of an early chick limb bud. Mirror-image
digit duplications like those induced by ZPA transplants were the result. Moreover,
636 Chapter 19
Normal
development
4
3
beads containing Sonic hedgehog protein were shown to cause the same duplications
(López-Martínez et al. 1995; Yang et al. 1997). Thus, Sonic hedgehog appears to be the
active agent of the ZPA.
This fact was confirmed by a remarkable gain-of-function mutation. The hemimelic
extra-toes (hx) mutant of mice has extra digits on the thumb side of the paws (FIGURE
19.21A,B). This phenotype is associated with a single base-pair difference in the limb-
specific Shh enhancer, a highly conserved region located a long distance (about 1 mil-
lion base pairs) upstream from the Shh gene itself (Lettice et al. 2003; Sagai et al. 2005).
Maas and Fallon (2005) made a reporter construct by fusing a β-galactosidase gene to
this long-range limb enhancer region from both wild-type and hx-mutant genes. They
injected these reporter constructs into the pronuclei of newly fertilized mouse eggs to
obtain transgenic embryos. In the transgenic mouse embryos carrying the reporter
gene with wild-type limb enhancer, staining for β-galactosidase activity revealed a
single patch of expression in the posterior mesoderm of each limb bud (i.e., in the ZPA;
FIGURE 19.21C ). However, mice carrying the mutant hx reporter construct showed
β-galactosidase activity in both the anterior and posterior regions of the limb bud (FIG-
URE 19.21D). It thus appears that (1) this enhancer has both positive and negative func-
tions, and (2) in the anterior region of the limb bud, some inhibitory factor represses the
ability of this enhancer to activate Shh transcription. The inhibitor probably cannot bind
to the mutated enhancer; thus, in hx mutant mice, Shh is expressed in both the anterior
and posterior regions of the limb bud, and this anterior Shh expression causes extra
Gilbert
digits to develop. Similar mutations in the long-range limb enhancer of Shh produce
Developmental Biology 11e, Sinauer Associates
polydactylous phenotypes in humans and other mammals (FIGURE 19.21E,F; Gurnett
DevBio11e_19.20 Date 06-03-16
et al. 2007; Lettice et al. 2008; Sun et al. 2008).
(E) (F)
finishes its job. Rather, the descendants of Shh-secreting cells become the bone and
muscle of the posterior limb (Ahn and Joyner 2004; Harfe et al. 2004). Indeed, digits 5
and 4 (and part of digit 3) of the mouse hindlimb are formed from the descendants of
Shh-secreting cells (FIGURE 19.22).
It seems that specification of the digits is primarily dependent on the amount of
time the Shh gene is expressed and only a little bit on the concentration of Shh protein
that other cells receive (see Tabin and McMahon 2008). The difference between digits 4
and 5 is that the cells of the more posterior digit 5 express Shh longer and are exposed
to Shh (in an autocrine manner) for a longer time. Digit 3 is made up of some cells that
secreted Shh for a shorter period than those of digit 4, and they also depend on Shh
diffusion from the ZPA (indicated by digit 4 being lost when Shh is modified such that
it cannot diffuse away from cells). Digit 2 is dependent entirely on Shh diffusion for its
specification, and digit 1 is specified independently of Shh. Indeed, in a naturally occur-
ring chick mutant that lacks Shh expression in the limb, the only digit that forms is digit
1. Furthermore, when the genes for Shh and Gli3 are conditionally knocked out in the
Gilbert
Developmental Biology 11e, Sinauer Associates
638 Chapter 19
3
Digit 4
Digit 5
4
Shh 5
mouse limb, the resulting limbs have numerous digits, but the digits have no obvious
specificity (Litingtung et al. 2002; Ros et al. 2003; Scherz et al. 2007). Vargas and Fal-
lon (2005) propose that digit 1 is specified by Hoxd13 in the absence of Hoxd12. Forced
expression of Hoxd12 throughout the digital primordia leads to the transformation of
digit 1 into a more posterior digit (Knezevic et al. 1997).
By using conditional knockouts of the mouse Shh gene (i.e., researchers could stop
Shh expression at different times during mouse development), Zhu and Mackem (2011)
found that Sonic hedgehog works by two temporally distinct mechanisms. The first
phase involves the specification of digit identity (from the posterior pinky to the anterior
thumb). In this phase, Shh acts as a morphogen, with the digit identities being specified
first by the concentration of Shh in that region of the limb bud, and then by the duration
of exposure to Shh. In the second phase, Shh works as a mitogen to stimulate the prolif-
Gilbert eration and expansion of the limb bud mesenchyme, thus helping shape the limb bud.
The mechanism by which Sonic hedgehog establishes a digit’s identity may involve
Developmental Biology 11e, Sinauer Associates
DevBio11e_19.22 Date 05-11-16 cell-cycle regulation and the BMP pathway. The time and concentration dependent
actions of Shh lead to the graded activation of the downstream transcriptional effector
Gli3. These targets include the genes for the BMP antagonist Gremlin, the cell cycle
regulator Cdk6, and the genes that synthesize hyaluronic acid (a component of cell
adhesion). Shh (through Gli3) restricts the proliferation of cartilage progenitor cells (by
downregulating Cdk6) and promotes their BMP-stimulated differentiation into carti-
lage by inhibiting the BMP antagonist Gremlin and by upregulating hyaluronic acid
synthase 2 (Vokes et al. 2008; Liu et al. 2012; Lopez-Rios et al. 2012).
Shh initiates and sustains a gradient of BMP proteins across the limb bud, and this
BMP gradient can specify the digits (Laufer et al. 1994; Kawakami et al. 1996; Drosso-
poulou et al. 2000). Identity is not specified directly in each digit primordium, however.
Rather, the identity of each digit is determined by the interdigital mesoderm—that is, by
the webbing between the digits (the region of mesenchyme that will shortly undergo
apoptosis).
The interdigital tissue specifies the identity of the digit forming anteriorly to it (i.e.,
toward the thumb or big toe). Thus, when Dahn and Fallon (2000) removed the webbing
Development of the Tetrapod Limb 639
Wild-type
(A) (B) 1 (D) 1 2 (E) 1 2→1
2→1
3
3
3
2
p2 4
4 4
p3 3 1
(C) (F) 1
2
4 2
3→2 3→2
4
4
Figure 19.23 Regulation of digit iden-
tity by BMP concentrations in the inter-
digital space anterior to the digit and by
between the cartilaginous condensations forming chick hindlimb digits 2 and 3, the Gli3. (A) Scheme for removal of interdigi-
second digit was changed into a copy of digit 1 ( FIGURE 19.23A,B ). Similarly, when tal (ID) regions. (B) Removal of ID region 2
the webbing on the other side of digit 3 was removed, the third digit formed a copy of between digit primordia 2 (p2) and 3 (p3)
digit 2 (FIGURE 19.23A,C ). Moreover, the positional value of the webbing could be causes digit 2 to change to the struc-
ture of digit 1. (C) Removing ID region 3
altered by changing the BMP level (FIGURE 19.23D–F ). Each digit has a characteristic
(between digit primordia 3 and 4) causes
array of nodules that form the digit skeleton, and Suzuki and colleagues (2008) have digit 3 to form the structures of digit 2.
shown that the different levels of BMP signaling in the interdigital webbing regulate the (D) Wild-type digits and their ID spaces.
recruitment of progress zone mesenchymal cells into the nodules that make the digits. (E,F) The same transformations as in (B)
and (C) can be obtained by adding beads
Sonic hedgehog and FGFs: Another positive feedback loop containing the BMP inhibitor Noggin
When the limb bud is relatively small, an initial positive feedback loop is established to the ID regions. (E) When a Noggin-
containing bead (green dot) is placed in
between Fgf10 produced in the mesoderm and Fgf8 produced in the ectoderm, promot-
ID region 2, digit 2 is transformed into a
ing limb outgrowth (FIGURE 19.24A). As the limb bud grows, the ZPA is established, copy of digit 1. (F) When the Noggin bead
and another regulatory loop is created (FIGURE 19.24B). BMPs in the mesoderm would is placed in ID region 3, digit 3 is trans-
downregulate FGFs in the AER were it not for the Shh-dependent expression of a BMP formed into a copy of digit 2. (After Dahn
inhibitor, Gremlin (Niswander et al. 1994; Zúñiga et al. 1999; Scherz et al. 2004; Vokes and Fallon 2000; Litingtung et al. 2002;
et al. 2008). Sonic hedgehog in the ZPA activates Gremlin, which inhibits BMPs, thus B–F, photographs courtesy of R. D. Dahn
promoting the maintenance of FGF expression and continued limb bud outgrowth. FGF and J. F. Fallon.)
in turn inhibits repressors of Shh to complete the positive feedback loop. As with most
multigene pathways, however, this interactivity is more complicated.
Depending on the levels of FGFs in the apical ectodermal ridge, the zone of polar-
izing activity can be either activated or shut down; two feedback loops have been dem-
onstrated ( FIGURE 19.24C ; Verheyden and Sun 2008; Bénazet et al. 2009). At first,
relatively
Gilbert low levels of AER FGFs activate Shh and keep the ZPA functioning. The FGF
Developmental
signals appearBiology 11e, Sinauer
to inhibit AssociatesEtv4 and Etv5, which are repressors of Sonic
the proteins
DevBio11e_19.23
hedgehog transcriptionDate 05-11-16
(see Figure 21.24B; Mao et al. 2009; Zhang et al. 2009). Thus, the
AER and ZPA mutually support each other through the positive loop of Sonic hedgehog
and FGFs (Todt and Fallon 1987; Laufer et al. 1994; Niswander et al. 1994). In the more
anterior region of the limb bud, Fgf8 positively regulates Etv4/5, which in turn repress
Shh in this region, further reinforcing the posterior-to-anterior gradient of Shh from
the ZPA (Mao et al. 2009).
As a result of Shh stimulation through FGF signaling, levels of Gremlin (a powerful
BMP antagonist) become high, and the positive FGF/Shh loop sustains limb growth
( FIGURE 19.24D). As long as the Gremlin signal can diffuse to the AER, FGFs will
be made and the AER maintained. However, as FGF levels consequently also rise, a
640 Chapter 19
negative feedback loop to block Gremlin expression in the distal mesenchyme is trig-
gered (FIGURE 19.24E ). This repression of Gremlin synthesis paired with the progres-
sive expansion of the limb bud creates increased distance between Gremlin and the
signaling centers (AER and ZPA) in the distalmost mesenchyme. At that time, the BMPs
abrogate FGF synthesis, the AER collapses, and the ZPA (with no FGFs to support it) is
terminated. The embryonic phase of limb development ends (FIGURE 19.24F ).
POST Shh
GCR POST
d1 d3 d13 GCR
5′ Posterior d12 Phase II
d11
d12 5′
d10
d10-11
Autopod
d4-9 d13
Anterior
Shh
Posterior Anterior
second phase of Hoxd expression the ZPA instructs the expression patterns, and these
patterns define the identities of the digits. Moreover, transplantation of either the ZPA
or other Shh-secreting cells to the anterior margin of the limb bud at this stage leads to
the formation of mirror-image patterns of Hoxd expression and results in mirror-image
digits (Izpisúa-Belmonte et al. 1991; Nohno et al. 1991; Riddle et al. 1993).
What genes are these Hox proteins regulating? Some clues come from the analysis
of mutations of the Hox13 series of genes. As mentioned above, people with mutations
in the HOXD13 gene have portions of their autopods that fuse together rather than
separate. Ectopic expression of the chicken Hoxa13 gene (usually expressed in the distal
ends of developing chick limbs) appears to make the cells expressing it “stickier,” as
well as making the “wavelength” between cartilage and web smaller. These properties
might cause the cartilaginous nodules to condense in specific ways (Yokouchi et al.
1995; Newman 1996; Sheth et al. 2012).
Sharpe, and Kmita labs used a “reaction-diffusion” simulation with assumed generic
activator and inhibitor morphogens. This simulation showed that distal Hox genes in
combination with AER-derived Fgf gradients were sufficient modulators of the wave-
length of a Turing system to recapitulate the skeletogenic pattern of digits in normal
mice and in Gli3-null backgrounds (Sheth et al. 2012).
This Turing model predicts that slight size changes of the distal limb bud will alter the
number of digits. That was indeed found to be the case, and it may be a simple way of
gaining or losing digits during evolution.5 In fact, comparison of the polydactyly in the
combined Hox/Gli3 mutants with the limbs of early tetrapods and the fins of Sarcopteryg-
ian (lobe-finned) and Actinopterygian (ray-finned) fishes strongly suggest that there may
be a conserved, self-organizing, reaction-diffusion mechanism for digit skeletogenesis.
The assumptions built into this Turing model predict that morphogen activators and
inhibitors should be present in the distal limb mesenchyme at the time of chondrogen-
esis. But what morphogens? The search was on. How might you identify the activators
and inhibitors of this system? Figure 19.27 A BMP-Sox9-Wnt Turing-
The Sharpe lab approached this problem by first characterizing the temporal and type mechanism governs digit formation.
(A) Sox9 gene expression is in alternating
spatial patterns of early precartilage formation in the distal limb, by looking at expres-
stripes with BMP and the Wnt pathway
sion patterns of the precartilage marker Sox9. Meanwhile, Raspopovic and colleagues
genes, Axin2 and Lef1. (B) Proper limb
compared the transcriptomes of limb mesenchyme cells expressing Sox9 with those of growth and digit formation is correctly
cells not expressing Sox9 and found that developmental genes were expressed differ- simulated through a Turing mechanism of
ently in the two populations. Namely, Wnt- and BMP-related genes were highly upreg- BMP/Wnt and Sox9 interactions (BSW)
ulated only in cells that were not expressing Sox9 (“out of phase”) (FIGURE 19.27A). paired with distal expression of Hoxd13
In addition, it is known that loss of the Sox9 gene eliminates any periodic expression and Fgf8. (C) These computer simulations
of digit development under this model
pattern of Wnt and BMP in the limb (Akiyama et al. 2002), suggesting that Sox9 is not
(top panel) match the endogenous in
situ pattern of Sox9 gene expression
5
Thus, dogs with larger limb buds may generate enough cells that an additional cartilage con- remarkably well (bottom panel). (D)
densation can fit into the autopod (Alberch 1985). Such appears to be the case with the St. Ber- Illustration of BMP-Sox9-Wnt expression
nard and Great Pyrenees breeds. Fondon and Garner (2004) have shown that one allele of the in the limb bud with a representation of
Alx-4 gene is homozygous in only one breed of dog, the Great Pyrenees. These dogs are char-
the quantitative differences among these
acterized by polydactyly (an extra toe, the dew claw). Here, there is apparently more growth of
genes along the anterior-posterior axis.
the limb bud such that another condensation can emerge in the autopod.
(A–C from Raspopovic et al. 2014; D after
Zuniga and Zeller 2014.)
only a marker for precartilage but also potentially a direct component of the regulatory
gene network. Based on these results, Raspopovic created a “three-node” BMP-Sox9-
Wnt (BSW) Turing-type network—in which BMP functions as the activator of Sox9
and Wnt the inhibitor—to simulate the skeletogenesis of digits in the mouse (FIGURE
19.27B). It is interesting that only by including the wavelength modulating parameters
of an FGF gradient for the timing of proximal-distal growth and the spatial restrictions
of distal Hox genes did the BSW Turing model simulate accurately the self-organizing
nature of digit development (FIGURE 19.27C ).
the ventral mesenchyme cells, those cells develop a dorsal phenotype (Riddle et al. 1995; Dorsal
Vogel et al. 1995; Altabef and Tickle 2002). Human and mouse lmx1b mutants also reveal
this gene’s importance for specifying dorsal limb fates. Lmx1b knockouts in mice produce Wnt7a
a syndrome in which the dorsal limb phenotype is lacking and those cells have taken on
ventral fates, exhibiting footpads, ventral tendons, and sesamoids (all ventral-specific
structures; FIGURE 19.28B,C). Similarly in humans, loss-of-function mutations in the Lmx1b
LMX1B gene result in nail-patella syndrome (no nails on the digits, no kneecaps), in
which the dorsal sides of the limbs have been ventralized (Chen et al. 1998; Dreyer et al.
1998). The Lim1 protein probably specifies the cells to differentiate in a dorsal manner,
which is critical, as we saw in Chapter 15, for the innervation of motor neurons (whose
BMP
growth cones recognize inhibitory factors made differentially in the dorsal and ventral
compartments of the limb bud). Conversely, the transcription factor Engrailed-1 marks
the ventral ectoderm of the limb bud and is induced by BMPs in the underlying meso-
derm (FIGURE 19.29). If BMPs are knocked out in the early limb bud, Engrailed-1 is not En1
expressed, and Wnt7a is expressed in both dorsal and ventral ectoderm. The result is a
malformed limb that is dorsal on both sides (Ahn et al. 2001; Pizette et al. 2001). Ventral
The dorsal-ventral axis is also coordinated with the other two axes. Indeed, the
Figures 19.29 Model of dorsal-to-
Wnt7a-deficient mice described earlier lacked not only dorsal limb structures but also
ventral patterning in the limb bud by
posterior digits, suggesting that Wnt7a is also needed for the anterior-posterior axis (Parr
Wnt and BMP signaling. Wnt7a induces
and McMahon 1995). Yang and Niswander (1995) made a similar set of observations in dorsal cell fates of the limb bud through
chick embryos. These investigators removed the dorsal ectoderm from developing limbs Lmx1b, whereas BMP signaling functions
and found that the result was the loss of posterior skeletal elements from the limbs. The through Engrailed-1 (En1) to regulate ven-
reason these limbs lacked posterior digits was that Shh expression was greatly reduced. tral limb patterning.
Viral-induced expression of Wnt7a was able to substitute for the dorsal ectoderm signal
and restore Shh expression and posterior phenotypes. These findings showed that Sonic
hedgehog synthesis is stimulated by the combination of Fgf4 and Wnt7a proteins. Con-
versely, overactive Wnt signaling in the ventral ectoderm causes an overgrowth of the
AER and extra digits, indicating that the proximal-distal patterning is not independent
of dorsal-ventral patterning either (Loomis et al. 1998; Adamska et al. 2004).
Thus, at the end of limb patterning, BMPs are responsible for simultaneously shut-
ting down the AER, indirectly shutting down the ZPA, and inhibiting the Wnt7a signal
along the dorsal-ventral axis (Pizette et al. 2001). The BMP signal eliminates growth
and patterning along all three axes. When exogenous BMP is applied to the AER, the
elongated epithelium of the AER reverts to a cuboidal epithelium and ceases to produce
FGFs; and when BMPs are inhibited by Noggin, the AER continues to persist days after
it would normally have regressed (Gañan et al. 1998; Pizette and Niswander 1999).
Figure 19.30 Patterns of cell death in leg (A) DUCK LEG PRIMORDIUM
primordia of (A) duck and (B) chick embryos. Minimal cell death
Blue shading indicates areas of cell death. In the
duck, the regions of cell death are very small,
whereas there are extensive regions of cell
death in the interdigital tissue of the chick leg.
(After Saunders and Fallon 1966.)
Interior necrotic zone
Anterior Posterior
necrotic necrotic
zone zone
In addition to the interdigital necrotic zone, three other regions of the limb are
“sculpted” by cell death. The ulna and radius are separated from each other by an
interior necrotic zone, and two other regions, the anterior and posterior necrotic
zones, further shape the end of the limb (see Figure 19.30B; Saunders and Fallon 1966).
Although these zones are referred to as “necrotic,” this term is a holdover from the days
when no distinction was made between necrotic (pathologic or traumatic) cell death
and apoptotic cell death. These cells die by apoptosis, and the death of the interdigital
tissue is associated with the fragmentation of their DNA (Mori et al. 1995).
The signal for apoptosis in the autopod is provided by the BMP proteins, whose
expression, interestingly, is dependent on upregulated synthesis of interdigital RA
(Cunningham and Duester 2015). BMP2, BMP4, and BMP7 are each expressed in the
interdigital mesenchyme, and blocking BMP signaling (by infecting progress zone
cells with retroviruses carrying dominant negative BMP receptors) prevents interdigi-
tal apoptosis (Yokouchi et al. 1996; Zou and Niswander 1996; Abara-Buis et al. 2011).
Because these BMPs are expressed throughout the progress zone mesenchyme, it is
thought that cell death would be the default state unless there were active suppres-
sion of the BMPs. This suppression may come from the Noggin protein, which is made
in the developing cartilage of the digits and in the perichondrial cells surrounding it
(Capdevila and Johnson 1998; Merino et al. 1998). If Noggin is expressed throughout
the limb bud, no apoptosis is seen.
6
In bats, the amount of BMPs synthesized is extraordinarily high and recruits more mesenchy-
mal cells into the cartilage, thereby extending the digits to a much greater length than in most
other mammals (Cooper et al. 2012).
Development of the Tetrapod Limb 647
expressed at the regions between the bones, where joints will (A)
BMP BMP
form, and appears critical for joint formation ( FIGURE 19.31B ;
Macias et al. 1997; Brunet et al. 1998). Mouse mutations of the Wnt/ FGF
gene for Gdf5 produce brachypodia, a condition characterized b-catenin (from AER)
by the lack of limb joints (Storm and Kingsley 1999). In mice
homozygous for loss-of-function of the BMP antagonist Noggin,
Dkk-1
no joints form. Rather, BMP7 in these Noggin-defective embryos
appears to recruit nearly all the surrounding mesenchyme into
the digits (FIGURE 19.31C).
Blood vessels and Wnt proteins also appear to be critical in
joint formation. The conversion of mesenchyme cells into nod- Cartilage Apoptosis
ules of cartilage-forming tissue establishes the bone boundaries.
The mesenchyme will not form such nodules in the presence of
(B) (C)
blood vessels, and one of the first indications of cartilage forma-
tion is the regression of blood vessels in the region wherein the
nodule will form (Yin and Pacifici 2001). Wnt proteins are critical
in sustaining transcription of Gdf5, and β-catenin produced by
the Wnts is able to suppress the Sox9 and collagen-2 genes that
characterize precartilage cells (Hartmann and Tabin 2001; Tufan
and Tuan 2001).
Joints are not just absences of bone. Rather, joints are com-
plex structures that incorporate a lubrication system, an immune
system, and a ligament system, all joined to the proper articu-
lation of the skeleton. One critical element of joint formation
that allows this differentiation is muscle contraction. In nor-
mal joint formation, the cells that will form the joint lose their
chondrocyte characteristics (such as expression of collagen-2
and Sox9) and instead begin to express Gdf5, Wnt4, Wnt9a,
and Ext1 (a protein necessary for synthesizing heparan sulfate). Figure 19.31 Possible involvement of BMPs in stabilizing car-
These cells will form the articulate cartilage and the synovium, tilage and apoptosis. (A) Model for the dual role of BMP signals
which secretes lubricating synovial fluid (Koyama et al. 2008; in limb mesodermal cells. BMP can be received in the presence
of FGFs (to produce apoptosis) or Wnts (to induce bone). When
Mundy et al. 2011). Kahn and colleagues (2009) have shown that
FGFs from the AER are present, Dickkopf (Dkk) is activated. This
the movement of the bones is necessary for maintaining this
protein mediates apoptosis and at the same time inhibits Wnt
commitment to form joints. In mutant mice where the muscles from aiding in skeleton formation. (B,C) Effects of Noggin. (B) A
do not form or are paralyzed, the joint cells revert back to a car- 16.5-day autopod from a wild-type mouse, showing Gdf5 expres-
tilaginous phenotype. sion (dark blue) at the joints. (C) A 16.5-day Noggin-deficient
mutant mouse autopod, showing neither joints nor Gdf5 expres-
Continued limb growth: Epiphyseal plates sion. Presumably, in the absence of Noggin, BMP7 was able to
convert nearly all the mesenchyme into cartilage. (A after Grote-
The three axes of human limbs are specified in a highly asym-
wold and Rüther 2002; B,C from Brunet et al. 1998, courtesy of
metrical fashion. However, their growth over the next 16 years is
A. P. McMahon.)
so symmetrical that the length of one arm matches the other to
within 0.2% (Ballock and O’Keefe 2003; Wolpert 2010). If all our
cartilage were turned into bone before birth, we could not grow
any larger, and our bones would be only as large as the original cartilaginous model.
But growth zones— epiphyseal plates —form at the proximal and distal ends of each
developing long bone. At the portion of the epiphyseal plate farthest from the new bone
is a germinal region of cartilaginous stem cells, followed by regions of proliferating
Gilbert
cartilage cells, mature cartilage cells (chondrocytes), and hypertrophic cartilage cells.
Developmental Biology 11e, Sinauer Associates
The hypertrophic cartilage cells (which increase their size five- to DevBio11e_19.31
tenfold) undergo Date 03-15-16
apoptosis and are replaced by bone cells (osteocytes).
In the long bones of many mammals (including humans), endochondral ossifica-
tion spreads outward in both directions from the center of the bone (FIGURE 19.32).
Although more than 10,000 new cartilage cells may be made daily, the number appears
to be identical in each arm. Cartilage proliferation in humans is high through about 3
years of age. The major factor of differential growth (between the arms and legs of a
648 Chapter 19
(A) (B)
PTHrP
1
Proliferating
chondrocytes
2
4
Hypertrophic Ihh
chondrocytes
Joint formation
Figure 19.32 Model for endochon-
dral ossification in the limb. (A) In situ
hybridization in the limb of a 21.5-day
mouse embryo shows collagen-2 mRNA human or between the legs of a human versus the legs of a dog), however, is probably
(green) in the proliferative growth plate the swelling of the hypertrophic cartilage. Not only can different numbers of cartilage
cartilage and Gdf5 mRNA (red) in the cells be made, but those cells can enlarge to different sizes (Cooper et al. 2013). After a
region destined to become a joint. growth spurt at puberty, the epiphyseal growth plates fuse, and there are no longer any
Nuclei are stained blue. (B) Regulation stem cells for growth. As long as the epiphyseal plates are able to produce chondrocytes,
of cartilage cell proliferation by PTHrP
the bone continues to grow.
(parathyroid hormone related protein)
and Indian hedgehog (Ihh). (1) PTHrP acts
Fibroblast growth factor receptors: Dwarfism
on receptors on proliferating chondro-
cytes to keep them dividing and thereby The rate of growth appears to be intrinsic to each bone. Each growth plate is con-
delays the production of Ihh. (2) When the trolled locally (probably by differences in the sensitivity to growth factors), but the
source of PTHrP production becomes coordinated growth of the entire skeleton is maintained by circulating factors. Thus,
sufficiently far away, Ihh is synthesized; when transplantations are made between growth plates of old and young mammals,
Ihh acts on its receptor (present on chon-
the growth rate of the transplanted growth plate depends on the age of the donor ani-
drocytes) to increase the rate of chon-
mal, not that of the host animal (Wolpert 2010). However, discoveries of human and
drocyte proliferation and (3) to stimulate
the production of PTHrP at the ends mouse mutations resulting in abnormal skeletal development have provided remark-
of bones. (4) Ihh also acts on the peri- able insights into how hormones and paracrine factors can control the eventual size
chondrial cells enveloping the cartilage, of the limbs.
converting them into the osteoblasts of Fibroblast growth factors are critically important in halting the growth of the epiph-
the bone collar. (A courtesy of Dr. P. Tyl- yseal plates, telling the cells to differentiate rather than divide (Deng et al. 1996; Web-
zanowski; B after Kronenberg 2003.)
ster and Donoghue 1996). In humans, mutations of the receptors for FGFs can cause
these receptors to become active prior to receiving the normal FGF signal. Such muta-
tions give rise to the major types of human dwarfism. Achondroplasia is a dominant
condition caused by mutations in the transmembrane region of FGF receptor 3 (FgfR3).
Roughly 95% of achondroplastic dwarfs have the same mutation of the FgfR3 gene: a
base-pair substitution that converts glycine to arginine at position 380 in the trans-
membrane region of the protein. In addition, mutations in the extracellular portion of
the FgfR3 protein or in the tyrosine kinase intracellular domain may result in thanato-
phoric dysplasia, a lethal form of dwarfism that resembles homozygous achondroplasia
(Bellus et al. 1995; Tavormina et al. 1995).
As mentioned in Chapter 1, dachshunds have an achondroplastic mutation, but its
cause is slightly different than that of the human form. Dachshunds have an extra copy
of the Fgf4 gene, which is also expressed in the developing limb. This extra copy causes
excess production of Fgf4, activating FgfR3 and accelerating the pathway that stops the
growth of chondroblasts and hastens their differentiation. The same extra copy of Fgf4
has been found in other short-limbed dogs, such as corgis and basset hounds (Parker
Gilbert
Developmental Biology 11e, Sinauer Associates et al. 2009).
DevBio11e_19.32 Date 05-11-16
Development of the Tetrapod Limb 649
WEb Topic 19.2 Growth hormone and estrogen receptors As its name
implies, growth hormone (GH) is a major factor in the regulation of growth, including limb
growth. Interactions with the gonadal steroids, especially estrogen, appear to be impor-
tant for bone growth.
WEb Topic 19.3 Dinosaurs and chicken fingers One piece of evidence that
birds were descended from dinosaurs is that both groups retain three digits. To some
researchers, however, it seems that birds have digits 2, 3, and 4, whereas dinosaurs had
digits 1, 2, and 3. Recent evidence has uncovered a change in gene transcription that
might explain this conundrum.
Scientists Speak 19.5 Watch three web conferences on limb evolution. Dr.
Peter Currie discuses the evolution of limb muscle in fish, Dr. Michael Shapiro
describes the evolution of pelvic reduction in sticklebacks, and Dr. James Noonan
talks about the evolution of the human thumb.
web-footed friends We can start with the sculpting of the autopod. The regulation
of BMPs is critical in creating the webbed feet of ducks (Laufer et al. 1997b; Merino et
al. 1999). The interdigital regions of duck feet exhibit the same pattern of BMP expres-
sion as the webbing of chick feet. However, whereas the interdigital regions of the chick
feet appear to undergo BMP-mediated apoptosis, developing duck feet synthesize the
BMP inhibitor Gremlin and block this regional cell death (FIGURE 19.33). Moreover,
the webbing of chick feet can be preserved if Gremlin-soaked beads are placed in the
interdigital regions. Thus, the evolution of web-footed birds probably involved the inhi-
bition of BMP-mediated apoptosis in the interdigital regions. In Chapter 26, we will find
that the bat embryo uses a similar mechanism to acquire its wings.
7
Earlier in this chapter, we noted that developmental biologists get used to thinking in four
dimensions. Evolutionary developmental biologists have to think in five dimensions: the three
standard dimensions of space, the dimension of developmental time (hours or days), and the
dimension of evolutionary time (millions of years).
650 Chapter 19
Chick
hindlimb
Duck
hindlimb
three ways. First, the FGF signaling of the forelimb AER was preserved for a much lon-
ger duration, which caused the formation of longer fingers by the continual addition of
phalanges. Second, interdigital apoptosis was prevented by blocking BMP activity in a
manner similar to that described above for duck feet. Third, the Sonic hedgehog signal
from the hindlimb ZPA ceased early in development. Once the ZPA signal diminished,
Gilbert the AER could not be sustained, and the hindlimb ceased to develop (Thewissen et al.
Developmental Biology 11e, Sinauer Associates
DevBio11e_19.33 2006). FIGURE
Date 19.34 shows the elongated flipper phalanges and truncated hindlimb of
03-15-16
an embryonic dolphin. Thus, despite creationists claiming there is no way whales could
have evolved from land mammals (see Gish 1985), in fact the combination of develop-
mental biology and paleontology explains the phenomenon extremely well.
Remnants of
pelvic girdle
Hyperphalangy
in digits 2 and 3
Figure 19.34 A 110-day embryo of a pantropical spotted dolphin (Stella attenuata), stained
to show bones (red) and cartilage (blue). Hyperphalangy (extremely long fingers) is seen in the
forelimb (correlating with continued Fgf8 expression in the AER), and a rudimentary hindlimb is
seen (correlating with the reduction of AER signaling following the elimination of Shh from the
ZPA). (From Cooper 2009; courtesy of L. N. Cooper and the Thewissen laboratory.)
Development of the Tetrapod Limb 651
19 Snapshot Summary
Development of the Tetrapod Limb
1. The positions where limbs emerge from the body axis 7. The anterior-posterior axis is defined by the expression
depend on Hox gene expression. of Sonic hedgehog in the zone of polarizing activity, a
2. The proximal-distal axis of the developing limb is initiated region in the posterior mesoderm of the limb bud. If ZPA
by the induction of the ectoderm at the dorsal-ventral tissue (or Shh-secreting cells or beads) is placed in the
boundary by Fgf10 from the mesenchyme. This induc- anterior margin of a limb bud, a second, mirror-image
tion forms the apical ectodermal ridge (AER). The AER pattern of Hox gene expression occurs, along with a cor-
secretes Fgf8, which keeps the underlying mesenchyme responding mirror-image duplication of the digits.
proliferative and undifferentiated. This area of mesen- 8. The ZPA is maintained by the interaction of FGFs from
chyme is called the progress zone. the AER with mesenchyme made competent to express
3. Tbx5 induces the forelimb, whereas Tbx4 (chick) and Sonic hedgehog by its expression of particular Hox
Islet1 (mouse) induce hindlimb identity. genes. Sonic hedgehog acts in turn, probably in an
indirect manner, and probably through the Gli factors, to
4. Two opposing gradients—one of FGFs and Wnts from
change the expression of the Hox genes in the limb bud.
the AER, the other of retinoic acid from the flank—pat-
tern the proximal-distal axis of the chick limb. In mice, 9. Sonic hedgehog specifies digits in at least two ways.
however, retinoic acid appears unnecessary for proximal- It works through BMP inhibition in the interdigital mes-
distal patterning, suggesting a single gradient of FGFs enchyme, and it also regulates the proliferation of digit
and Wnts in mice. cartilage. Mutations in the long-range enhancer for Shh
can cause polydactyly by creating a second ZPA in the
5. As the limb grows outward, the stylopod forms first, then
anterior margin of the limb bud.
the zeugopod, and last, the autopod. Each phase of
limb development is characterized by a specific pattern 10. The dorsal-ventral axis is formed in part by the expres-
of Hox gene expression. The evolution of the autopod sion of Wnt7a in the dorsal portion of the limb ecto-
involved a duplication and reversal of Hox gene expres- derm. Wnt7a also maintains the expression level of
sion that distinguishes fish fins from tetrapod limbs. Sonic hedgehog in the ZPA and of Fgf4 in the posterior
AER. Fgf4 and Shh reciprocally maintain each other’s
6. Turing-type models suggest that a reaction-diffusion
expression.
mechanism can explain the constant pattern of stylopod-
zeugopod-autopod seen in tetrapod limbs.
652 Chapter 19
11. Levels of FGFs in the AER can either support or inhibit growth plates. The cartilage in these regions proliferates,
the production of Shh by the ZPA. As the limb bud allowing the resulting bone to grow larger. The cartilage
grows and more FGFs are produced in the AER, Shh is eventually replaced by bone and growth stops.
expression is inhibited. This in turn causes the lowering 15. The differences in bone growth between different parts
of FGF levels, and eventually proximal-distal outgrowth of the body and between different species is due primar-
ceases. ily to the expansion of hypertrophic cartilage (which will
12. A “three-node” BMP-Sox9-Wnt Turing-type network later be replaced by bone).
underlies skeletogenesis of digits in the mouse such that 16. By modifying paracrine factor secretion, different limb
cells expressing BMP function to activate Sox9, with morphologies can form, initiating the development of
Wnt serving as its inhibitor. webbed feet, flippers, or hands. By eliminating the
13. Cell death in the limb is mediated by BMPs and is nec- synthesis of certain paracrine factors, limbs can be pre-
essary for the formation of digits and joints. Differences vented from forming (as in whales and snakes).
between the unwebbed chicken foot and the webbed 17. BMPs are involved both in inducing apoptosis and in
duck foot can be explained by differences in the expres- differentiating the mesenchymal cells into cartilage. The
sion of Gremlin, a protein that antagonizes BMPs. regulation of BMP effects by Noggin and Gremlin pro-
14. The ends of the long bones of humans and other mam- teins is critical in forming the joints between the bones of
mals contain cartilaginous regions called epiphyseal the limb and in regulating proximal-distal outgrowth.
Further Reading
Cooper, K. L., J. K. Hu, D. ten Berge, M. Fernandez-Teran, M. Riddle, R. D., R. L. Johnson, E. Laufer and C. Tabin. 1993. Sonic
A. Ros and C. J. Tabin. 2011. Initiation of proximal-distal pat- hedgehog mediates the polarizing activity of the ZPA. Cell 75:
terning in the vertebrate limb by signals and growth. Science 1401–1416.
332: 1083–1086. Roselló-Díez, A., C. G. Arques, I. Delgado, G. Giovinazzo and
Cunningham, T. J. and G. Duester. 2015. Mechanisms of reti- M. Torres. 2014. Diffusible signals and epigenetic timing coop-
noic acid signalling and its roles in organ and limb develop- erate in late proximo-distal limb patterning. Development 141:
ment. Nature Rev. Mol. Cell Biol. 16: 110–123. 1534-1543.
Freitas, R., C. Gómez-Marín, J. M. Wilson, F. Casares and J. L. Schneider, I. and N. H. Shubin. 2013. The origin of the tetrapod
Gómez-Skarmeta. 2012. Hoxd13 contribution to the evolution limb: From expeditions to enhancers. Trends Genet. 29: 419–426.
of vertebrate appendages. Dev. Cell 23: 1219–1229. Sekine, K. and 10 others. 1999. Fgf10 is essential for limb and
Kawakami, Y. and 12 others. 2011. Islet1-mediated activation lung formation. Nature Genet. 21: 138–141.
of the β-catenin pathway is necessary for hindlimb initiation in Todt, W. L. and J. F. Fallon. 1987. Posterior apical ectodermal
mice. Development 138: 4465–4473. ridge removal in the chick wing bud triggers a series of events
Mahmood, R. and 9 others. 1995. A role for Fgf8 in the initia- resulting in defective anterior pattern formation. Development
tion and maintenance of vertebrate limb outgrowth. Curr. Biol. 101: 501–515.
5: 797–806. Verheyden, J. M. and X. Sun. 2008. An FGF-Gremlin inhibi-
Merino, R., J. Rodriguez-Leon, D. Macias, Y. Gañan, A. N. tory feedback loop triggers termination of limb bud outgrowth.
Economides and J. M. Hurle. 1999. The BMP antagonist Grem- Nature 454: 638–641.
lin regulates outgrowth, chondrogenesis, and programmed cell Zhang, Y. T., M. S. Alber and S. A. Newman. 2013. Mathemati-
death in the developing limb. Development 126: 5515–5522. cal modeling of vertebrate limb development. Math. Biosci. 243:
Niswander, L., S. Jeffrey, G. R. Martin and C. Tickle. 1994. A 1–17.
positive feedback loop coordinates growth and patterning in Zuniga, A. 2015. Next generation limb development and
the vertebrate limb. Nature 371: 609–612. evolution: Old questions, new perspectives. Development 142:
Raspopovic, J., L. Marcon, L. Russo and J. Sharpe. 2014. Digit 3810–3820.
patterning is controlled by a BMP-Sox9-Wnt Turing network
modulated by morphogen gradients. Science 345: 566–570.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
20
The Endoderm
Tubes and Organs for
Digestion and Respiration
The endoderm forms the gut and respiratory tubeS of the adult amniote,
where it is essential for the exchange of gases and foods. In the embryonic amniote, whose
food and oxygen come from the mother via the placenta, the endoderm’s first major func-
tion is to induce the formation of several mesodermal organs. As we have seen in earlier
chapters, the endoderm is critical for instructing the formation of the notochord, heart,
blood vessels, and even the mesodermal germ layer. The endoderm’s second embryonic
function is to construct the linings of two tubes within the vertebrate body. The diges-
tive tube extends the length of the body, and buds from the digestive tube form the liver,
gallbladder, and pancreas. The respiratory tube forms as an outgrowth of the digestive
tube and eventually bifurcates into the two lungs. The region of the digestive tube anterior
to the point where the respiratory tube branches off is the pharynx. A third embryonic
function is to form the epithelium of several glands. Epithelial outpockets of the pharynx
give rise to the tonsils and to the thyroid, thymus, and parathyroid glands.
The endoderm arises from two sources. The main source is the set of cells that enters
the interior of the embryo through the primitive streak during gastrulation. This is often
How do some called the definitive endoderm. It replaces the visceral endoderm that is primarily form-
gut cells become ing the yolk sac. However, not all the visceral endoderm is removed. Live-cell imaging
studies using fluorescent markers show that definitive endoderm doesn’t replace visceral
pancreas cells while
endoderm as a sheet (Kwon et al. 2008; Viotti et al. 2014a). Rather, individual definitive
the neighboring gut endoderm cells can be seen intercalating into the visceral endoderm layer. The descen-
cells become liver or dants of these epiblast cells remain in the embryonic region while most (but not all) of
intestine?
The Punchline
The endoderm consists of the digestive tube, the respiratory tube, and their associated
glands. The Sox17 transcription factor plays a major role in specifying the endoderm.
The gut tube becomes defined along the anterior-posterior axis. The anterior cells
become the pharynx, lung, and thyroid glands; the posterior cells become the intestine;
and the cells between them become the precursors of the pancreas, gallbladder, and
liver. Splanchnic mesoderm plays important roles in specifying the morphogenesis of
the different regions of the digestive tube. Its secretion of Sonic hedgehog induces a
nested pattern of Hox genes, which in turn distinguish regions of the mesoderm that
interact with the adjacent endoderm. The β cells of the pancreas produce insulin, and
the delineation of the pathway leading to their development has allowed the generation
of insulin-producing β cells from induced pluripotent stem cells.
654 Chapter 20
Primitive streak
0h 2.5 h 5h 8h
Time
Figure 20.1 Definitive endoderm
cells from mouse epiblast replace the
cells of the visceral endoderm. Here, the original visceral endoderm becomes extraembryonic. The Sox17 transcription factor
the visceral endoderm of the embryo
marks the endoderm in many species, and the Sox17 gene appears to be activated in
has been genetically marked with green
some cells as they leave the primitive streak. In mutants lacking Sox17, the definitive
fluorescent protein and can be seen
enveloping the epiblast. Epiblast cells endoderm does not form (Viotti et al. 2014b).
were randomly labeled with red dye The presence of Sox17 protein makes the definitive endoderm cells different from
and filmed as they migrated through the the mesodermal cells that also travel through the primitive streak; the mesodermal
primitive streak and replaced the vis- cells express the gene for the Brachyury transcription factor, and Brachyury appears
ceral endoderm cells. (From Viotti et al. to be critical for the development of the mesoderm. Whether Sox17 or Brachyury is
2014b, courtesy of A. K. Hadjantonakis.)
Lung
F,
icoids HG
Glucocort t, TNFα Hepatocyte
Hepatoblast OSM, Wn (liver)
Definitive P Cholangiocyte
Epiblast Mesendoderm endoderm PFG K, BM TNFβ, Notch, BMP,
MAP nt (bile duct)
W FGF, Wnt, Hippo
Nodal Nodal Exocrine
Pancreas
pancreas
BMPs, FGFs, Wnts
Wnt
BM F
BMP
FG
Endocrine
P
MG-HG pancreas
Intestine
Mesoderm
Posterior
expressed appears to depend on the concentration of Nodal secreted from the visceral
Developing Questions
endoderm. High levels of Nodal induce Sox17, while BMPs and FGFs act against Nodal
and specify the migrating cells to become mesoderm (Figure 20.1; Vincent et al. 2003; The gut tube is not
symmetrical. It rotates in
Dunn et al. 2004).
specific directions, placing
The definitive endoderm of the gut is then defined by three regions, each with a the stomach near the heart
distinct embryonic origin and delineated by their location along the anterior-posterior and the appendix on the
axis (Gordillo et al. 2015). As should be all too apparent by now, the A-P axis of verte- right-hand side. What
brates is specified by gradients of Wnts, FGFs, and BMPs, each of which is at the highest molecular and cellular
concentration posteriorly (Figure 20.2). The endoderm near the head will form the events cause gut looping?
anterior foregut cells, which will generate the precursors of the lung and thyroid glands.
The endoderm in the posterior becomes a collection of midgut-hindut precursor cells
and will form the intestinal progenitor cells. The region between them—in the area of
moderate BMPs, FGFs, and Wnts—become the posterior foregut precursors. These are
the cells that give rise to the pancreas and the liver.
The gut cells initially form a flat sheet beneath the embryo (in the chick or human)
or around the embryo (in the mouse). From the flat sheet of definitive endoderm, these
cells form a tube. Mammalian gut tube development begins at two sites that migrate
toward each other and fuse in the center (Lawson et al. 1986; Franklin et al. 2008). In
the foregut, cells from the lateral portions of the anterior endoderm move ventrally to
form the tube of the anterior intestinal portal (AIP); the caudal intestinal portal (CIP)
forms from the posterior endoderm. The AIP and CIP migrate toward each other and
come together to form the midgut (Figure 20.3).
The openings of the anterior and posterior ends of the gut tube are unique in that
they are the only regions of the embryo where endoderm meets ectoderm. At first, the
oral end is blocked by a region of endodermal cells that join to the mouth ectoderm
(the stomodeum) at the oral plate. Eventually (at about 22 days in human embryos),
the oral plate breaks, creating the oral opening of the digestive tube. The opening itself
is lined by ectodermal cells. This arrangement creates an interesting situation, because
the oral plate ectoderm is in contact with the brain ectoderm, which has curved around
toward the ventral portion of the embryo. These two ectodermal regions interact with
each other, with the roof of the oral region forming Rathke’s pouch and becoming
the glandular portion of the pituitary gland. The neural tissue on the floor of the
diencephalon gives rise to the infundibulum, which becomes the neural portion of
the pituitary. Thus, the pituitary gland has a dual origin, which is reflected in its adult
functions. There is a similar meeting of endoderm and ectoderm at the anus; this is
called the anorectal junction .
The Pharynx
The anterior endodermal portion of the digestive and respiratory tubes begins in the
pharynx. Using a reporter gene (the above-mentioned Sox17) that becomes activated
only in the endoderm, Rothova and colleagues (2012) found that there is a dividing
line between ectoderm and endoderm in the mammalian mouth. In mammals, the
teeth and the major salivary glands are from the ectoderm. The anterior taste buds
are ectodermal (generated by cranial placodes; see Chapter 16), but the posterior taste
buds, as well as some of the posterior salivary and mucus glands, are derived from the
endoderm.
The embryonic pharynx in mammals contains four pairs of endoderm-derived pha-
ryngeal pouches. Between these pouches are four pharyngeal arches (Figure 20.4).
The first pair of pharyngeal pouches become the auditory cavities of the middle ear and
the associated eustachian tubes. The second pair of pouches give rise to the walls of the
tonsils. The thymus is derived from the third pair of pharyngeal pouches; the thymus
will direct the differentiation of T lymphocytes during later stages of development. One
pair of parathyroid glands is also derived from the third pair of pharyngeal pouches,
while the other pair is derived from the fourth pair of pouches. In addition to these
656 Chapter 20
Neural folds
beginning
Intermediate
Hindgut Midgut to fuse Foregut
mesoderm
Somite Body
stalk Neural
plate
Caudal Anterior Heart
intestinal intestinal
Intra- portal
embryonic portal (AIP) Pericardial
Endoderm (CIP) coelom
body cavity
Intraembryonic
~ 3 WEEKS cavity
Body wall Tail Anterior
bud Liver neuropore
Parietal
mesoderm Endoderm Thyroid
of yolk sac Body stalk
layer
Dorsal
Amniotic mesentery Pancreas Dorsal aorta
cavity Liver Stomach
Visceral
Mesonephros mesoderm Lung bud
Notochord
layer Thyroid
Allantois
Parietal Stomodeum
~ 4 WEEKS mesoderm (mouth precursor)
layer Heart
Proctodeum
Serous Yolk
(anus precursor) Brain
membrane stalk
Rathke’s
Intraembryonic (peritoneum) pouch
cavity Wall of gut
Figure 20.3 Endodermal folding during early human development. (A) Cross sections through
the kidney-forming region. (B) Sagittal sections through the embryo’s midline. (After Sadler 2009.)
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_20.03 Date 03-07-16
The Endoderm 657
Pharyngeal arches
Pharyngeal Thyroid
pouch 1 primordium
1
Tonsil in External 1
wall of pouch 2 2 auditory
channel 2 Eustachian
Parathyroid 3 Auditory (auditory) Tympanic
primordium tube 3 tube cavity
4 4
Thymus
Parathyroid Parathyroid IV
primordium Parathyroid III Thyroid
Postbranchial Postbranchial Tonsil
body body
Tongue
Figure 20.4 Formation of glandular primordia from the pharyngeal pouches. The pouches Larynx
are symmetrical; only the right side is shown. The end of each of the first pharyngeal pouches
becomes the tympanic cavity of the middle ear and the eustachian tube. The second pouches
Parathyroid
receive aggregates of lymphoid tissue and become the tonsils. The dorsal portion of the third Thyroid glands
pharyngeal pouches forms part of the parathyroid gland, while the ventral portion forms the
thymus. Both migrate caudally and meet with the tissue from the fourth pharyngeal pouches to Postbranchial Thymus
form the rest of the parathyroid and the postbranchial body. The thyroid, which had originated body
in the midline of the pharynx, also migrates caudally into the neck region. (After Carlson 1981.)
paired pouches, a small, central diverticulum is formed between the second pharyngeal
pouches on the floor of the pharynx. This pocket of endoderm and mesenchyme will
bud off from the pharynx and migrate down the neck to become the thyroid gland. The
respiratory tube sprouts from the pharyngeal floor (between the fourth pair of pharyn-
geal pouches) to form the lungs, as we will see below.
Many streams of cranial neural crest cells migrate into the pouches that are form-
ing the thyroid, parathyroid, and thymus glands. Sonic hedgehog from the endoderm
appears to act as a survival factor, preventing apoptosis of the neural crest cells (Moore-
Scott and Manley 2005; see Chapter 15). In addition, genetic analysis combined with
transplantation studies of zebrafish has shown that FGFs (mainly Fgf3 and Fgf8) from
the ectoderm and mesoderm are important not only for the migration and survival of
neural crest cells, but also for the formation of the pouches themselves. Mice deficient
in both Fgf8 and Fgf3 genes lack all the pharyngeal pouches, even when endoderm is
present. Instead of migrating laterally and ventrally to form pouches, the endoderm
remains in the anterior pharynx and does not spread out (Crump et al. 2004).
Endoderm Wnt
cells inhibitors
(sFRPs)
Stomach Pyloric Mesenchyme
sphincter cells
Barx1
Pancreas
Sphincter muscle
(C)
Small
intestine
Liver
Colon
cSox2
Pdx1
Rectum
Hox
CdxC
CdxA
along the way into the esophagus, stomach, duodenum, and intestines, and putting out
branches that become (among other things) the thyroid, thymus, pancreas, and liver.
What tells the endodermal tube to become these particular tissues at particular places?
Why do we never see a mouth opening directly into a stomach? The endoderm and the
splanchnic lateral plate mesoderm undergo a complicated set of interactions, and the
signals for generating the different gut tissues appear to be conserved throughout the
vertebrate classes (see Wallace and Pack 2003). One possible model for the polarity of
the gut tube starts off with the specification of the pharynx and then follows with the
specification of the remainder of the gut tube. Studies on chick embryos using beads
containing either retinoic acid or inhibitors of its synthesis (Bayha et al. 2009) show
that the pharynx can develop only in areas containing little or no RA, whereas the RA
gradient patterns the pharyngeal arch endoderm in a graded manner. This is probably
accomplished by activating and repressing particular sets of transcription factor genes.
The second phase of gut specification is thought to involve signals from the splanch-
nic mesoderm-derived mesenchyme surrounding the endodermal tube. As the diges-
tive tube encounters different mesenchymes, mesenchyme cells instruct the endoderm
to differentiate into esophagus, stomach, small intestine, and colon (Okada 1960; Gum-
pel-Pinot et al. 1978; Fukumachi and Takayama 1980; Kedinger et al. 1990). Wnt signals
are thought to be especially important. The initial (“default”) specification of the entire
gut tube is thought to be anterior (i.e., stomach/esophagus). However, graded Wnt sig-
naling from the posterior mesoderm (instructed by RA and FGF gradients) provides a
signal that induces in the gut endoderm the posteriorizing transcription factors Cdx1
and Cdx2 (see Figure 20.5A), as well as the paracrine factor Indian hedgehog. At high
concentrations, the Cdx transcription factors induce formation of the large intestine,
whereas at lower concentrations they induce formation of the small intestine. Indeed,
when b-catenin is artificially expressed in the foregut tissue, the Cdx2 gene is activated
and the anterior endoderm tissue is transformed into the more posterior, intestinal type
of tissue (Sherwood et al. 2011; Stringer et al. 2012).
The molecular pathways by which Wnt signals from the mesenchyme influence the
gut tube are just becoming known (Figure 20.5B ). Cdx2, for instance, suppresses
genes such as Hhex and thereby prevents the stomach, liver, and pancreas from form-
ing in the posterior (Bossard and Zaret 2000; McLin et al. 2007). In the anterior regions
of the gut tube (which form the thymus, pancreas, stomach, and liver), Wnt signal-
ing is blocked. In the stomach-forming domain, the mesenchyme lining the gut tube
expresses the transcription factor Barx1, which activates production of two Frzb-like
Wnt antagonists (the proteins sFRP1 and sFRP2) that block Wnt signaling in the vicin-
ity of the stomach but not around the intestine. (Indeed, Barx1-deficient mice do not
develop stomachs and express intestinal markers in that tissue; Kim et al. 2005.)
Wnt-based polarity may be transient and needs to be strengthened and refined by
further interactions between the endoderm and the surrounding mesenchymes. Rob-
erts and colleagues (1995, 1998) have implicated Sonic hedgehog (Shh) in endodermal
specification. Shh is thought to be made by the endoderm and secreted in different
concentrations at different sites. Its targets appear to be the mesodermal cells sur-
rounding the gut tube. Secretion of Shh by the hindgut endoderm induces a nested
pattern of “posterior” Hox gene expression in the mesoderm. As in the vertebrae (see
Chapter 12), the anterior borders of Hox gene expression delineate the morphological
boundaries of the regions that will form the cloaca, large intestine, cecum, mid-cecum
(at the midgut-hindgut border), and posterior portion of the midgut (Roberts et al.
1995; Yokouchi et al. 1995). When experimentally generated Hox-expressing viruses
cause misexpression of Hox genes in the mesoderm, the mesodermal cells alter the dif-
ferentiation of the adjacent endoderm (Roberts et al. 1998). The Hox genes are thought
to specify the mesoderm so that it can further interact with the endodermal tube and
more finely specify its regions.
Once the boundaries of the transcription factors are established, differentiation can
begin. The regional differentiation of the mesoderm (into smooth muscle types) and
660 Chapter 20
the regional differentiation of the endoderm (into different functional units such as
the stomach, duodenum, and small intestine) are synchronized. For instance, in cer-
tain regions the intestinal mesenchyme secretes BMP4, which instructs the mesoderm
anterior to it to express the Sox9 and Nkx2-5 transcription factors. Sox9 and Nkx2-5
tell the mesoderm to become the smooth muscles of the pyloric sphincter rather than
the smooth muscle that normally lines the stomach and intestine (Theodosiou and
Tabin 2005).
The interaction between the splanchnic mesoderm and the endoderm continues long
Developing Questions
after the specification stage of development. One derivative of the splanchnic meso-
One of the major human derm is the dorsal mesentery, a fibrous membrane that connects the endoderm to
birth defects is pyloric the body wall. The looping of the intestinal tube is driven by a combination of growth
stenosis, a condition in
intrinsic to the endoderm coupled with the connection of that tube to the dorsal mes-
which the muscles of the
pyloric sphincter thicken entery (Savin et al. 2011). If the connection is severed, the mesentery shrinks and the
and prevent food from gut becomes a long, thin, tube with no folding (Figure 20.5C).
entering the intestine. How Interactions of mesoderm and endoderm are also important for the formation of
do these muscles arise and villi in the gut. The differentiation of smooth muscle in the mesoderm constricts the
function, and what might underlying growing endoderm and mesenchyme, thus creating compressive stresses
cause the defect? that cause the endoderm to buckle and ultimately lead to villi formation (Shyer et al.
2013). This buckling is critical for localizing the intestinal stem cells at the base of
the villi. Originally, all gut tube cells have the potential to become stem cells, but the
buckling allows certain tissues to interact more readily than others and causes inhibi-
tory paracrine factors (most importantly BMP4) to restrict stem cell formation to those
regions farthest away from the tip of the villi (Shyer et al. 2015).
Scientists speak 20.1 Dr. Cliff Tabin and Dr. Amy Shyer speak about how the
stem cells of the intestine get to the correct places.
The further development of the intestine involves (1) the differentiation of the Pan-
eth cells and the progeny of intestinal stem cells, which was discussed in Chapter 5; and
(2) interactions between the gut epithelium and symbiotic bacteria to complete the dif-
ferentiation of the cell types, which will be discussed in Chapter 25. Interestingly, in at
least parts of the endoderm, differentiated cells can revert to becoming stem cells. This
may be due to their being exposed to the outside environment as we eat and breathe.
When stem cells are removed from the stomach, a differentiated secretory cell (called
the chief cell) loses its differentiated properties and becomes a stem cell (Stang et al.
2013). Similarly, the differentiated cells of the trachea can divide to generate lung stem
cells when the original stem cells are deleted (Tata et al. 2013). Even the Paneth cell
precursor of the intestine, which is usually committed to maturing into differentiated
Paneth cells and enteroendocrine cells, can return to a stem cell status if the intestine is
injured (Buczaki et al. 2013). So the endoderm appears to be remarkable, if not unique,
in having a high degree of plasticity between differentiated cells and stem cells.
Figure 20.6 Pancreatic development in humans. (A) At 30 days, the ventral pancreatic bud
is close to the liver primordium. (B) By 35 days, it begins migrating posteriorly, and (C) comes
into contact with the dorsal pancreatic bud during the sixth week of development. (D) In most
individuals, the dorsal pancreatic bud loses its duct into the duodenum; however, in about 10%
of the population, the dual duct system persists.
together and eventually fuse. In humans, only the ventral duct survives to carry diges-
tive enzymes into the intestine. In other species (such as the dog), both dorsal and
ventral ducts empty into the intestine.
The posterior foregut endoderm contains progenitor cells that can give rise to pan-
creas, liver, and gallbladder. There is an intimate relationship between the splanchnic
lateral plate mesoderm and the foregut endoderm. Just as the foregut endoderm is criti-
cal in specifying the cardiogenic mesoderm, the mesoderm, especially the blood-vessel
endothelial cells, induce the endodermal tube to produce the liver primordium and the
pancreatic rudiments.
The chromatin of the multipotent stem cells of the ventral foregut endoderm may
Gilbert
be primed forBiology
Developmental their differential activation. The genes involved in forming the liver pro-
11e, Sinauer Associates
genitor cells
DevBio11e_20.06are silenced in a different
Date 03-07-16 manner than those genes involved in forming
the pancreatic progenitor cells. Thus, a single signal may be able to de-repress an entire
battery of specification genes (Xu et al. 2011; Zaret 2016).
Cardiogenic mesoderm
before the FGF signal is given (Lee et al. 2005; Hirai et al. 2010). Mouse embryos lack-
ing Foxa1 and Foxa2 gene expression in their endoderm fail to produce a liver bud or to
express liver-specific enzymes.
Once the signal is given, other Forkhead transcription factors, such as HNF4a,
become critical. HNF4a is essential for the morphological and biochemical differentia-
tion of the hepatic bud into liver tissue (Parviz et al. 2003). When conditional mutants
of HNF4a were made such that this factor was absent only in the developing liver,
neither tissue architecture, cellular structure, nor liver-specific enzymes were seen in
Gilbert
the liver bud cells.
Developmental Biology 11e, Sinauer Associates
The two major liver cell types are the hepatocytes (liver cells) and the cholangio-
DevBio11e_20.07 Date 03-09-16
cytes that form the cells of the bile ducts (see Figure 20.2). Paracrine factors of the
TGF-b family as well as Notch signaling from the blood vessels appear to stimulate
the production of the duct cells, while glucocorticoid hormones and other paracrine
factors (hepatocyte growth factor and Wnts) help specify the hepatocytes (Schmidt
et al. 1995; Clotman et al. 2005). In addition, there are other cells in the liver, includ-
ing the liver sinusoidal endothelial cells. These are specialized endodermal cells that
create the blood channels in the liver (Goldman et al. 2014). These cells are critical for
liver functioning, as they bring nutrients and poisonous substances into the liver to be
metabolized and degraded. Sinusoidal endothelial cells also appear to play a critical
role in liver regeneration, since they are the source of two paracrine factors—hepato-
cyte growth factor and angiopoietin-2—that are critical for the organized division of
hepatoblast stem cells (Ding et al. 2010; DeLeve 2013; Hu et al. 2014). The ability of the
mammalian liver to regenerate has been a fascinating topic, since it grows back only
the same amount of liver tissue as was removed or destroyed. We are just beginning to
understand how our body accomplishes this, and we will return to discuss liver regen-
eration more fully in Chapter 22.
pancreas formation The formation of the pancreas may be the flip side of liver
formation. Whereas the heart cells promote and the notochord prevents liver formation,
the notochord may actively promote pancreas formation, while the heart may block the
pancreas from forming. It seems this particular region of the digestive tube has the abil-
ity to become either pancreas or liver. One set of conditions (presence of heart, absence
of notochord) induces the liver, while the opposite conditions (presence of notochord,
absence of heart) cause the pancreas to form.
The notochord activates pancreas development by repressing Shh expression in the
endoderm (Apelqvist et al. 1997; Hebrok et al. 1998). (This was a surprising finding,
since the notochord is a source of Shh protein and an inducer of further Shh gene
The Endoderm 663
Ventral Dorsal
endoderm endoderm
Retinoic acid
(Wnt suppressed,
Shh suppressed)
Foxa1, Foxa2
Activin
Htxb9, Ptfta
Pdx
1
FGF, Foxa1, Pancreatic Endocrine
BMP Foxa2 bud progenitor
Ngn3
Fgf10
Pax4 Arx
Cholanglocyte Hepatocyte
(bile duct cell) Ductal cells Acinar cells β cells δ cells α cells PP cells
Fasting blood
glucose
Adult iPS Definitive Primitive Pancreatic Endocrine ted
skin cell cell endoderm foregut progenitor progenitor β cell splan
t r an
β c e l ls
NGN3
NANOG SOX17 FOXA2, PDX1
HNF1B
Insulin
iPS cell factors
release
Paracrine factors
Paracrine factor inhibitors
Diabetic mouse
Trachea
sFRPs
block Wnt
Respiratory
diverticulum Lung buds
(laryngotracheal
groove) Esophagus
Wnt
signaling
Figure 20.12 Partitioning of the foregut into
the esophagus and respiratory diverticulum dur-
ing the third and fourth weeks of human gestation.
(A,B) Lateral and ventral views, end of week 3. (C)
Ventral view, week 4. (D) Model for the roles of Wnt
signaling and Barx1-expressing mesenchyme in Mesenchyme Ciliated
differentiating the esophagus and the trachea. The respiratory
absence of Barx1 protein and presence of Wnt epithelia
signaling result in the expression of Nkx2-1 and (E)
the differentiation of respiratory epithelium. When Left Right
Barx1 is present, Wnt signaling is blocked and the
Sox2 transcription factor is transcribed, helping to
make the region esophageal. (E) After embryonic
mouse lung epithelium had branched into two
bronchi, the entire rudiment was excised and cul-
tured. The right bronchus was left untouched while
the tip of the left bronchus was covered with tra-
cheal mesenchyme. The tip of the right bronchus
formed the branches characteristic of the lung,
whereas hardly any branching occurred in the left
bronchus. (A–C after Langman 1981; D after Woo
et al. 2011; E from Wessells 1970, courtesy of N.
Wessells.)
The Endoderm 667
from the tracheal tube and the trachea’s development into the lungs fails to happen
(Goss et al. 2009). Conversely, extra lungs can form if b-catenin is expressed ectopically
in the gut tube (Harris-Johnson et al. 2009).
The dorsal portion of the respiratory tube remains in contact with mesenchyme that
contains the Barx1 transcription factor and is producing the Wnt-blocking sFRPs. The
sFRPs are soluble Frizzled-related proteins similar to Frzb (see Chapter 11); sFRPs can
bind to Wnts and prevent their reaching their cell membrane receptors, thus blocking
Wnt activity and helping to specify the epithelium of the esophagus. The ventral por-
tion of the respiratory tube, however, comes into contact with a mesenchyme that does
not produce sFRPs. The Wnt signals, which were blocked earlier, here convert the tube
into the ciliated respiratory epithelium of the trachea (Figure 20.12D; Woo et al. 2011).
As in the digestive tube, the regional specificity of the mesenchyme determines the
differentiation of the developing respiratory tube. In the developing mammal, respira-
tory epithelium responds in two distinct fashions. In the region of the neck, it grows
straight, forming the trachea. After entering the thorax, it branches, forming the two
bronchi and then the lungs. The respiratory epithelium of an embryonic mouse can be
isolated soon after it has split into two bronchi, and the two sides can be treated differ-
ently. Figure 20.12E shows the result when the right bronchial epithelium was allowed
to retain its lung mesenchyme while the left bronchus was surrounded with tracheal
mesenchyme (Wessells 1970). The right bronchus proliferated and branched under the
influence of the lung mesenchyme, whereas the left bronchus continued to grow in an
unbranched manner. Moreover, the differentiation of the respiratory epithelia into tra-
chea cells or lung cells depends on the mesenchyme it encounters (Shannon et al. 1998).
The stem cells of the airway passages are fascinating in many ways. As mentioned
earlier, the endoderm can replace its stem cells by reverting differentiated cells to a
stem cell condition. In the lungs, one group of differentiated cells, the Clara cells, can
divide to produce stem cells when the original stem cells are removed. In addition, the
parent stem cells provide niches for their daughter cells to develop (Pardo-Saganta et
al. 2015). The basal stem cells of the trachea produce progenitor cells that will become
the secretory and ciliated cells of the airways. The progenitor cells, however, need the
Notch signal from their parent cells in order to remain progenitor cells. Without Notch,
they undergo terminal differentiation into ciliated cells. Thus, the parent stem cell here
is still “taking care” of its daughters and maintaining their proliferative capacities.
WEb Topic 20.1 Induction of the lung The induction of the lung involves inter-
play between FGFs and Sonic hedgehog. However, it appears to be different from the
induction of either the pancreas or the liver.
The lungs are among the last of the mammalian organs to fully differentiate. The
lungs must be able to draw in oxygen at the newborn’s first breath. To accomplish this,
the alveolar cells secrete a surfactant into the fluid within the lungs. This surfactant,
consisting of specific proteins and phospholipids such as sphingomyelin and lecithin,
is secreted very late in gestation; in humans, surfactant usually reaches physiologically
useful levels at about week 34 of gestation. Surfactant enables the alveolar cells to touch
one another without sticking together. Thus, infants born prematurely—that is, before
their surfactant has reached functional levels—often have difficulty breathing and have
to be placed on respirators until their surfactant-producing cells mature.
Mammalian birth occurs very soon after lung maturation. Some evidence suggests
that the embryonic lung may actually signal the mother to start delivery. Condon and Developing Questions
colleagues (2004) showed that surfactant protein A—one of the final products produced When a baby is born
by the embryonic mouse lung—activates macrophages in the amniotic fluid. These prematurely, its lung cells
macrophages migrate from the amnion to the uterine muscle, where they produce are often not differentiated.
What can physicians
immune system proteins such as interleukin-1β (IL1β). IL1β initiates the contractions
do to accelerate lung
of labor, both by activating cyclooxygenase-2 (which stimulates production of the pros- development?
taglandins that contract the uterine muscle cells) and by antagonizing the progesterone
668 Chapter 20
receptor (Figure 20.13). Mice deficient in surfactant proteins have a significant delay
in the onset of labor, while surfactant-stimulated macrophages injected into the uteri
of female mice induce early labor (Montalbano et al. 2013). Thus, one of the critical
signals initiating birth is given only when the lungs have matured to the point where
a newborn can take its first breath, and this signal may be transmitted to the mother
via her immune system.
20 Snapshot Summary
The Endoderm
1. The Sox17 transcription factor is crucial for the specifica- 5. In some areas of the gut, removal of stem cells results in
tion of the endoderm. In vertebrates, the endoderm con- the de-differentiation of some functional cells to form a
structs the digestive (gut) tube and the respiratory tube. new stem cell population.
2. The gut tube is divided into three regions by the gradient 6. The two major cell types of the liver are the hepatocytes,
of Wnts, BMPs, and FGFs along its anterior-posterior which regulate body metabolism, and the cholangiocytes
axis. The endoderm in the posterior becomes a collec- that line the ducts.
tion of midgut-hindut precursor cells, and forming the 7. The endoderm helps specify the splanchnic mesoderm;
intestines. The endoderm near the head will form the the splanchnic mesoderm, especially the heart and the
anterior foregut cells, which will generate the precursors blood vessels, helps specify the endoderm.
of the lung and thyroid glands. The region between them
8. The pancreas forms in a region of endoderm that lacks
becomes the posterior foregut precursor cells, giving rise
Shh expression. The Pdx1 and Ptf1a transcription fac-
to the pancreas, gallbladder, and the liver.
tors are expressed in this region.
3. Four pairs of pharyngeal pouches become the endoder-
9. The endocrine and exocrine cells of the pancreas have a
mal lining of the eustacian tubes, the tonsils, the thymus,
common origin. The Ngn3 transcription factor probably
and the parathyroid glands. The thyroid also forms in this
decides endocrine fate.
region of endoderm.
10. By mimicking the conditions of embryonic development,
4. Gut tissues form by reciprocal interactions between the
human iPSCs can be transformed into precursors of
endoderm and the mesoderm. Wnt signals from the
pancreatic β cells and generate cells that secrete insulin.
mesoderm and Sonic hedgehog from the endoderm
appear to play a role in inducing a nested pattern of Hox 11. The respiratory tube is derived as an outpocketing of
gene expression in the mesoderm surrounding the gut. the digestive tube. The regional specificity of the mes-
The regionalized mesoderm then instructs the endoder- enchyme it meets determines whether the tube remains
mal tube to become the different organs of the digestive straight (as in the trachea) or branches (as in the bronchi
tract. and alveoli).
Further Reading
Clotman, F. and 7 others. 2005. Control of liver cell fate decision Odom, D. T. and 12 others. 2004. Control of pancreas and liver
by a gradient of TGF-β signaling modulated by Onecut tran- gene expression by HNF transcription factors. Science 303:
scription factors. Genes Dev. 19: 1849–1854. 1378–1381.
Fishman, M. P. and D. A. Melton. 2002. Pancreatic lineage Pagliuca, F. W. and 8 others. 2014. Generation of functional
analysis using a retroviral vector in embryonic mice demon- human pancreatic β cells in vitro. Cell 159: 428–439.
strates a common progenitor for endocrine and exocrine cells. Rezania, A. and 12 others. 2014. Reversal of diabetes with
Int. J. Dev. Biol. 46: 201–207. insulin-producing cells derived in vitro from human pluri-
Kim, B.-M., G. Buchner, I. Miletich, P. T. Sharpe and R. A. Shiv- potent stem cells. Nature Biotechnol. 32: 1121–1133.
dasani. 2005. The stomach mesenchymal transcription factor Viotti , M., S. Nowotschin and A. K. Hadjantonakis. 2014.
Barx1 specifies gastric epithelial identity through inhibition of Sox17 links gut endoderm morphogenesis and germ layer
transient Wnt signaling. Dev. Cell 8: 611–622. segregation. Nature Cell Biol. 16: 1146–1156.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
21
Metamorphosis
The Hor monal Reactivation
of Development
The Punchline
Metamorphosis is the suite of dramatic developmental changes whereby an
immature organism is given a new, usually sexually mature, form. Changes are
initiated by endocrine factors—hormones—that potentially affect every cell in the
body. Some cells are told to divide, some to differentiate, and some to die. The
transformation from larva (caterpillar, tadpole, pluteus) to adult provides striking
examples of rapid developmental change. In insects and amphibians, the axes of the
larvae become the axes of the adult, even though the cells forming these axes have
changed. In sea urchins, none of the axes of the larva are preserved, as the adult
forms from a small pouch on the left side of the larval gut. Metamorphosis in all three
groups is accomplished by lipid hormones that activate transcription factors.
672 Chapter 21
the open ocean. The sea urchin adult, on the other hand, is pentameral (i.e., has fivefold
symmetry) and feeds by scraping algae from rocks on the seafloor. There is no trace of
the adult form in the body plan of the larva.1
Secondary larvae are found among those animals whose larvae and adults possess
the same basic body plan. Thus, despite the obvious differences between the caterpillar
and the butterfly, these two life stages retain the same major body axes and develop by
deleting and modifying old parts while adding new structures into a preexisting frame-
work. Similarly, the frog tadpole, although specialized for an aquatic environment, is
a secondary larva, organized on the same pattern as the adult will be (Jagersten 1972;
Raff and Raff 2009).
Metamorphosis is one of the most striking of developmental phenomena, and the
extensive morphological changes undergone by some species have fascinated develop-
mental anatomists for centuries (Merian 1705; Swammerdam 1737). But we know only
an outline of the molecular bases of metamorphosis, and only for a handful of species.
Amphibian Metamorphosis
Amphibians are actually named for their ability to undergo metamorphosis, their appella-
tion coming from the Greek amphi (“double”) and bios (“life”). Amphibian metamorphosis
is associated with morphological changes that prepare an aquatic organism for a primar-
ily terrestrial existence. In urodeles (salamanders), these changes include the resorption
of the tail fin, the destruction of the external gills, and a change in skin structure. In
anurans (frogs and toads), the changes are more dramatic, with almost every organ
subject to modification (Table 21.1; see also Figure 1.3). The changes in amphibian meta-
morphosis are initiated by thyroid hormones such as thyroxine (T4) and tri-iodothyronine
(T3) that travel through the blood to reach all the organs of the larva. When the larval
organs encounter these thyroid hormones, they can respond in any of four ways: growth
(as in the hindlimbs of the frog), death (as in the tail of the frog), remodeling (as in the
frog’s intestine), and respecification (as in the liver enzymes of the frog).
1
Although there is controversy on the subject, larvae probably evolved after the adult form
had been established. In other words, animals evolved through direct development, and larval
forms came about as specializations for feeding or dispersal during the early part of the life
cycle (Jenner 2000; Rouse 2000; Raff and Raff 2009). Even so, the biphasic life cycle may be a
trait characteristic of metazoans (see Degnan and Degnan 2010).
Source: Data from Turner and Bagnara 1976 and Reilly et al. 1994
Metamorphosis 673
VADE MECUM by the demonstration that the death of the tadpole muscle cells is prevented by blocking
the activity of the apoptosis-inducing enzyme caspase-9 (Rowe et al. 2005). However,
For photographs of amphibian
later in metamorphosis, the tail muscles are eaten by macrophages, perhaps because
metamorphosis (and for the
the extracellular matrix that supported the muscle cells has been digested by proteases.
sounds of the adult frogs), check
Death also comes to the tadpole’s red blood cells. During metamorphosis, tadpole
out the metamorphosis and frog
calls sections of the “Amphibians”
hemoglobin is replaced by adult hemoglobin, which binds oxygen more slowly and
segment. releases it more rapidly (McCutcheon 1936; Riggs 1951). The red blood cells carrying
the tadpole hemoglobin have a different shape than the adult red blood cells, and these
larval red blood cells are specifically digested by macrophages in the liver and spleen
after the adult red blood cells are made (Hasebe et al. 1999).
remodeling during metamorphosis Among frogs and toads, certain larval struc-
tures are remodeled for adult needs. The larval intestine, with its numerous coils for
digesting plant material, is converted into a shorter intestine for a carnivorous diet.
Schrieber and his colleagues (2005) have demonstrated that the new cells of the adult
intestine are derived from functioning cells of the larval intestine (instead of there being
a subpopulation of stem cells that give rise to the adult intestine). As the extracellular
matrix of the old intestine dissolves, most of the intestinal epithelial cells die. Those that
survive appear to dedifferentiate and become intestinal stem cells (Stolow and Shi 1995;
Ishizuya-Oka et al. 2001; Fu et al. 2005; Hasabe et aal. 2013).
Much of the nervous system is remodeled as neurons grow
(A) Tadpole (B) Early metamorphosis and innervate new targets. While some neurons (like those in
the optic pathway) emerge, other larval neurons, such as certain
motor neurons in the tadpole jaw, switch their allegiances from
larval muscle to newly formed adult muscle (Alley and Barnes
1983). Still others, such as the cells innervating the tongue
muscle (a newly formed muscle not present in the larva), lie
dormant during the tadpole stage and form their first synapses
during metamorphosis (Grobstein 1987). The lateral line sys-
tem of the tadpole (which allows the tadpole to sense water
movement and helps it hear) degenerates, and the ears undergo
further differentiation (see Fritzsch et al. 1988). The middle ear
develops, as does the tympanic membrane characteristic of frog
(C) Late metamorphosis (D) Froglet and toad outer ears. 3 Thus, the anuran nervous system under-
goes enormous restructuring as some neurons die, others are
born, and others change their specificity.
The shape of the anuran skull also changes significantly as
practically every structural component of the head is remodeled
(Trueb and Hanken 1992; Berry et al. 1998). The most obvious
change is that new bone is being made. The tadpole skull is pri-
marily neural crest-derived cartilage; the adult skull is primarily
neural crest-derived bone ( Figure 21.2 ; Gross and Hanken
2005). As the lower jaw of the adult forms, Meckel’s cartilage
elongates to nearly double its original length, and dermal
bone forms around it. While Meckel’s cartilage is growing, the
Figure 21.2 Changes in the Xenopus skull during metamorpho- gills and pharyngeal arch cartilage (which were necessary for
sis. Whole mounts were stained with alcian blue to stain cartilage aquatic respiration in the tadpole) degenerate. Other cartilage
and alizarin red to stain bone. (A) Prior to metamorphosis, the pha- is extensively remodeled. Thus, as in the nervous system, some
ryngeal (branchial) arch cartilage (open arrowheads) is prominent, skeletal elements proliferate, some die, and some are remod-
Meckel’s cartilage (arrows) is at the tip of the head, and the cerato- eled. The mechanisms by which one hormone signals differ-
hyal cartilage (arrowheads) is relatively wide and anteriorly placed.
ential effects in different, and often adjacent tissues, remains
(B–D) As metamorphosis ensues, the pharyngeal arch cartilage
disappears, Meckel’s cartilage elongates, the mandible (lower jaw- unknown.
bone) forms around Meckel’s cartilage, and the ceratohyal cartilage
narrows and becomes more posteriorly located. (From Berry et al. 3
Tadpoles experience a brief period of deafness as the neurons
1998, courtesy of D. D. Brown.) change targets; see Boatright-Horowitz and Simmons 1997.
Metamorphosis 675
Percentage of postmetamorphic
CO2
ATP 80 Argininosuccinate lyase
Carbamoylphosphate
70
Ornithine
enzyme levels
carbamoyltransferase 60
50
Ornithine Citrulline 40
Aspartate
30 Urea excretion
Argininosuccinate 20
Urea
synthetase
10
Arginase Argininosuccinate 0
Arginine
e bs
Argininosuccinate
dp ed
er bs
tio il
ain d
tio il
em lim
r p ta
In rge
m u
r p ta
em lim
ta Tail
H e
ge
n
lyase
re ailb
so id
s
n
ol
re
s o al
re M
d
Fo
re iti
yt
in
nl
Fumarate
O
Progressive stages of metamorphosis
corticotropin-releasing hormone (CRH, which can be activated T3 concentration TRβ mRNA expression
either developmentally or by external stresses). CRH generates TRα mRNA expression T3 response mRNA expression
steroids such as cortisosterone. Corticosterone probably has two
modes of action (Kulkarni and Bucholz 2014). First, it acts direct- Embryonic stages Larval stages Metamorphosis
ly on the frog pituitary, instructing it to release thyroid-stimulat- 50
ing hormone (TSH), thereby initiating thyroid hormone synthe- Functional thyroid gland
sis. Second, it may act at the level of the promoter and enhancer 40
Arbitrary units
of the hormone-responsive genes to make the responding cells
more responsive to low amounts of T3 (Denver 1993, 2003). 30
The tissues that respond earliest to the thyroid hormones are
20
those that express high levels of deiodinase II and thus can con-
vert T4 directly into T3 (Cai and Brown 2004). For instance, the 10
limb rudiments, which have high levels of both deiodinase II
and TRα, can convert T4 into T3 and use it immediately through Activation
the TRα receptor. Thus, during the early stage of metamorpho- Activation
TR and T3 Repression T3 dependent
sis, the limb rudiments are able to receive thyroid hormone and independent
use it to initiate leg growth (Becker et al. 1997; Huang et al.
2001; Schreiber et al. 2001). Corepressor complex Coactivator complex
As the thyroid matures to the stage of prometamorphosis, it
secretes more hormones. However, many major changes (such
as tail resorption, gill resorption, and intestinal remodeling)
must wait until the metamorphic climax stage. At that time, No transcription Transcription
the concentration of T4 rises dramatically and TRβ levels peak
inside the cells. Since one of the targets of T3 is the TRb gene, it Figure 21.5 The hormonal control of Xenopus metamorphosis.
is thought that TRβ is the principal receptor mediating the met- During premetamorphosis, thyroid hormone titres are low, and
amorphic climax. In the tail, there is only a small amount of TRα unliganded TRα binds to the chromatin and fixes transcriptional
during premetamorphosis, and deiodinase II is not detectable. repressors that stabilize nucleosomes. During metamorphic cli-
However, during prometamorphosis, rising levels of thyroid max, blood levels of thyroid hormones increase, and the TRα
hormones induce higher levels of TRβ. At metamorphic climax, binds thyroxine. This causes the exchange of transcriptional
repressors to transcriptional activators. The nucleosomes dis-
deiodinase II is expressed and the tail begins to be resorbed.
perse, and the T3-sensitive genes are activated. One of these
In this way, the tail undergoes absorption only after the legs
genes encodes TRβ, which further accelerates the metamorphic
are functional (otherwise, the poor amphibian would have no responses. Eventually, feedback inhibition lowers the amount of
means of locomotion). The wisdom of the frog is simple: “Never circulating thyroid hormones, and metamorphosis ends. (After
get rid of your tail before your legs are working.” Grimaldi 2013.)
Some tissues do not seem to be responsive to thyroid hor-
mones. For instance, thyroid hormones instruct the ventral reti-
na to express ephrin B and to generate the ipsilateral neurons seen in Figure 21.1D. The
dorsal retina, however, is not responsive to thyroid hormones and does not generate
new neurons. The dorsal retina appears to be insulated from thyroid hormones by
expressing deiodinase III, which degrades the T3 produced by deiodinase II. If deiodin-
ase III is activated in the ventral retina, neurons will not proliferate and no ipsilateral
axons will form (Kawahara et al. 1999; Marsh-Armstrong et al. 1999).
The frog brain also undergoes changes during metamorphosis, and one of its func-
tions is to downregulate metamorphosis once metamorphic climax has been reached.
Thyroid hormones eventually induce a negative feedback loop, shutting down the pitu-
itary cells that instruct the thyroid to secrete them (Saxén et al. 1957; Kollros 1961; White
and Nicoll 1981). Huang and colleagues (2001) have shown that, at the climax of meta-
morphosis, deiodinase II expression is seen in those cells of the anterior pituitary that
secrete thyrotropin, the hormone that activates thyroid hormone expression. The result-
ing T3 is thought to activate genes that block secretion of thyrotropin, thereby initiating
the negative feedback loop so that less thyroid hormone is made (Sternberg et al. 2011).
Developmental Biology 11e
Fig. 21.05
WEb Topic 21.1 Variations on the themes of amphibian metamorphosis Dragonfly Media Group
Direct development and paedomorphosis are themes of amphibian development
02/17/16 that
alter the life cycles.
678 Chapter 21
(A) (B)
Tail tip
transplanted
to trunk
Tail
The metamorphosis of tadpoles into frogs is one of the most rapid and accessible
examples of development, obvious even to the eyes of children. Yet it still presents an
enormous set of enigmas. As Don Brown and Liquan Cai (2007) have asked, “What will
encourage the modern generation of scientists to study the wonderful biological prob-
lems presented by amphibian metamorphosis?” Recent work has shown the importance
of metamorphosis for studying regeneration, and it is also a critical area area where
development and ecology have a marked impact on each other.
Metamorphosis in Insects
Insects are the most speciose of Earth’s animals, and the diversity of their life cycles
makes science fiction pale by comparison. There are three major patterns of insect devel-
opment. A few insects, such as springtails, have no larval stage and undergo direct, or
ametabolous, development (Figure 21.7A). Immediately after hatching, ametabolous
insects have a pronymph stage bearing the structures that enabled it to get out of the
egg. But after this transitory stage, the insect looks like a small adult; it grows larger after
each molt with a new cuticle, but is unchanged in form (Truman and Riddiford 1999).
Other insects, notably grasshoppers and bugs, undergo a gradual, or hemimetabo-
lous, metamorphosis (Figure 21.7B). After spending a very brief period of time as a
pronymph (whose cuticle is often shed as the insect hatches), the insect looks like an
immature adult and is called a nymph. The rudiments of the wings, genital organs, and
Nymph
(instar 2)
other adult structures are present and become progressively more mature with each molt.
At the final molt, the emerging insect is a winged and sexually mature adult, or imago.
In the holometabolous development of insects such as flies, beetles, moths, and but-
terflies, there is no pronymph stage (Figure 21.7C). The juvenile form that hatches from
the egg is called a larva. The larva (a caterpillar, grub, or maggot) undergoes a series of
molts as it becomes larger. The stages between these larval molts are called instars. The
number of larval molts before becoming an adult is characteristic of a species, although
environmental factors can increase or decrease the number. The larval instars grow in
a stepwise fashion, each instar being larger than the previous one. Finally, there is a
dramatic and sudden transformation between the larval and adult stages: after the final
instar, the larva undergoes a metamorphic molt to become a pupa. The pupa does not
feed, and its energy must come from those foods it ingested as a larva. During pupa-
tion, adult structures form and replace the larval structures. Eventually, an imaginal
molt forms the adult (imago) cuticle beneath the pupal cuticle, and then the adult later
emerge from the pupal case at adult eclosion. While the larva is said to hatch from an
egg, the imago is said to eclose from the pupa. Carroll Williams (1958) characterized
holometabolous metamorphosis as the switch between foraging and reproduction: “The
earth-bound early stages built enormous digestive tracts and hauled them around on
caterpillar treads. Later in the life-history these assets could be liquidated and reinvest-
ed in the construction of an entirely new organism—a flying-machine devoted to sex.”
Imaginal discs
In holometabolous insects, the transformation from juvenile into adult occurs within
Figure 21.8 Locations and develop-
the pupal cuticle. Most of the larval body is systematically destroyed by programmed
mental fates of imaginal discs and ima- cell death, while new adult organs develop from relatively undifferentiated nests of
ginal tissues in the third instar larva (left)
of Drosophila melanogaster. (After Kalm
et al. 1995.) Discs for:
Mouthparts
Frontal plate
and upper lip
Antenna
Head
Eye
Thorax
Foregut imaginal Leg
cells
Histoblasts Haltere
Midgut imaginal Abdomen
cells Wing
Imaginal
tracheoblasts
Hindgut imaginal
cells
Genitalia
Metamorphosis 681
imaginal cells. Thus, within any larva there are two distinct (A)
populations of cells: the larval cells, which are used for the func-
tions of the juvenile insect; and thousands of imaginal cells,
which lie within the larva in clusters, awaiting the signal to
differentiate.
There are three main types of imaginal cells (Figure 21.8):
1. The cells of imaginal discs will form the cuticular struc-
tures of the adult, including the wings, legs, antennae, eyes,
head, thorax, and genitalia.
2. Histoblasts (tissue-forming cells) are imaginal cells that
will form the adult abdomen.
(B)
3. There are clusters of imaginal cells within each organ that
will proliferate to form the adult organ as the larval organ
degenerates.
Embryo (specification) Figure 21.10 Sequence of leg imaginal disc development in Drosophila. Specification of the disc
type occurs within the embryo. Proliferation of the disc cells and specification as to the type of leg
cell that each will produce are accomplished in the larval stages. Elongation of the disc takes place
in the early pupal (“prepupa”) stage, and differentiation of the leg tissues occurs while the insect is a
pupa. T1, basitarsus; T2–5, tarsal segments 2–5. (After Fristrom and Fristrom 1975; Kalm et al. 1995.)
Gilbert
Leg Developmental Biology 11e, Sinauer Associates
discs Prepupa (morphogenesis)
DevBio11e_21.09 Date 02-16-16 Pupa (differentiation)
Larval instars
(proliferation, Peripodial Coxa
pattern, membrane T2–5
formation) Femur T1 T1 Trochanter Femur
Presumptive Trochanter Tibia Tibia Femur Tibia T1 T2–5
thorax
Coxa
Femur
Claw
Tibia Trochanter Femur Coxa
Claw Tibia
Presumptive Femur Presumptive Trochanter Presumptive
Coxa thorax Trochanter thorax Coxa thorax
T2–5 T1
Claws
Tarsus
Claws
682 Chapter 21
at the center of the disc telescope out to become the most distal portions of the leg—the
claws and the tarsus. The outer cells become the proximal structures—the coxa and the
adjoining epidermis (Schubiger 1968). After differentiating, the cells of the appendages
and epidermis secrete a cuticle appropriate for each specific region. Although the disc
is composed primarily of epidermal cells, a small number of adepithelial cells migrate
into the disc early in development. During the pupal stage, these cells give rise to the
muscles and nerves that serve the legs.
specification and proliferation Specification of the general cell fates (i.e., that
the disc is to be a leg disc and not a wing disc) occurs in the embryo and is mediated
primarily by the Hox genes such as Ultrabithorax and Antennapedia. Increasingly specific
cell fates are specified in the larval stages, as the cells proliferate (Kalm et al. 1995).
The type of leg structure (claw, femur, etc.) generated is determined by the interac-
tions between several genes in the imaginal disc. Figure 21.11 shows the expression
of three genes involved in determining the proximal-distal axis of the fly leg. In the
third instar leg disc, the center of the disc secretes the highest concentration of two
morphogens, Wingless (Wg, a Wnt paracrine factor) and Decapentaplegic (Dpp, a BMP
paracrine factor). High concentrations of these paracrine factors induce expression of
the Distal-less gene. Moderate concentrations induce the expression of the dachshund
gene, and lower concentrations induce the expression of the homothorax gene.
Those cells expressing Distal-less telescope out to become the most distal structures
of the leg—the claw and distal tarsal segments. Those expressing homothorax become
the most proximal structure, the coxa. Cells expressing dachshund become the femur and
proximal tibia. Areas where the transcription factors overlap produce the trochanter and
distal tibia (Abu-Shaar and Mann 1998). These regions of gene expression are stabilized
by inhibitory interactions between the protein products of these genes and of the neigh-
boring genes. In this manner, the gradient of Wg and Dpp proteins is converted into dis-
crete domains of gene expression that specify the different regions of the Drosophila leg.
(A) (B)
eversion and differentiation The mature leg disc in the third instar of Drosophila
does not look anything like the adult structure. It is determined but not yet differenti-
ated; its differentiation requires a signal, in the form of a set of pulses of the “molting”
hormone 20-hydroxyecdysone (20E; see Figure 21.12A). The first pulse, occurring in
the late larval stages, initiates formation of the pupa, arrests cell division in the disc,
and initiates the cell shape changes that drive the eversion of the leg. The elongation of
imaginal discs occurs is due largely to cell shape changes within the disc epithelium,
supplemented by cell division (Condic et al. 1991; Taylor et al. 2008). Using fluorescently
labeled phalloidin to stain the peripheral microfilaments of leg disc cells, Condic and
coworkers showed that the cells of early third instar discs are tightly arranged along
the proximal-distal axis. When the hormonal signal to differentiate is given, the cells
change their shape and the leg is everted, the central cells of the disc becoming the most
distal (claw) cells of the limb. The leg structures will differentiate within the pupa, so
that by the time the adult fly ecloses they are fully formed and functional: in fact they
use their legs in their final escape from the pupal case.
WEb Topic 21.2 Insect metamorphosis The three links in this web topic discuss
(1) the experiments of Wigglesworth and others who identified the hormones of meta-
morphosis and the glands producing them; (2) the variations that Drosophila and other
insects play on the general theme of metamorphosis; and (3) the remodeling of the insect
nervous system during metamorphosis.
WEb Topic 21.3 Parasitoid wasp development Parasitoid wasps helped con-
vince Darwin that God could not be both benevolent and all-powerful. The life cycles of
the predatory insects are fascinating examples of one species exploiting the development
of another species to its own advantage.
C
O H OCH3
20-Hydroxyecdysone (20E)
(“molting” hormone)
OH 20E
HO
OH
HO
glands degenerate (Riddiford 1982; Nijhout 1994). It appears, then, that the first pulse
of 20E during the last larval instar triggers the processes that inactivate larva-specific
genes and initiates the morphogenesis of imaginal disc structures. The second pulse
transcribes pupa-specific genes and initiates the molt (Nijhout 1994). At the imaginal
molt, when 20E acts in the absence of juvenile hormone, the imaginal discs fully dif-
ferentiate and the molt gives rise to an adult.
ecdysone receptors Like amphibian thyroid hormones, 20E cannot bind to DNA
by itself. It must first bind to nuclear proteins called ecdysone receptors (EcRs). EcRs
are evolutionarily related to, and almost identical in structure to, the thyroid hormone
receptors of amphibians. An EcR protein forms an active molecule by dimerizing with
an Ultraspiracle (Usp) protein. Usp is the homologue of amphibian RXR, which we
learned earlier dimerizes with TR to form the active thyroid hormone receptor (Koelle
VADE MECUM
et al. 1991; Yao et al. 1992; Thomas et al. 1993). So the EcR-Usp receptor complex of
insects is very similar in structure to the TR-RXR complex of amphibians. The EcR and The segment on the fruit fly con-
Usp proteins each attach to the DNA; they then dimerize on the enhancer or promoter tains a sequence showing how to
perform a chromosome squash
element of the ecdysone-responsive genes (Szamborska-Gbur et al. 2014).
using the Drosophila larval sali-
It is thought that in the absence of hormone-bound EcR, Usp
vary gland.
recruits inhibitors of the transcription of ecdysone-responsive
genes (Tsai et al. 1999). This inhibition is converted into acti-
vation when ecdysone binds to its receptor. The presence of (A)
ecdysone-bound EcR-USp recruits histone methyltransferases
that activate the ecdysone-responsive genes (Sedkov et al. 2003).
However, other mechanisms may also be at work. For instance,
Johnston and colleagues (2011) have found that in the absence of
hormone-bound EcR, another transcription factor, E75, binds to
these ecdysone-responsive sites and inhibits transcription. Thus, (B)
ecdysone helps mediate the competition of EcR-Usp with E75 for
the same cis-regulatory sites.
(E)
Figure 21.13 20E-induced puffs in cultured salivary gland cells of
D. melanogaster. (A) Uninduced control. (B–E) 20E-stimulated chro-
mosomes at (B) 25 minutes, (C) 1 hour, (D) 2 hours, and (E) 4 hours.
(Courtesy of M. Ashburner.)
686 Chapter 21
nuclear receptor—the Met protein6 —and converting this receptor into a transcription
factor. The JH-bound Met protein activates the Kr-h1 gene, whose product, a repressive
transcription factor, blocks the activation of the Broad gene (Figure 21.14C; Minakuchi
et al. 2008; Charles et al. 2011; Li et al. 2011). Thus, in the presence of JH, the Broad gene
is not activated and metamorphosis is blocked.
6
Not to be confused with the unrelated Met receptor in vertebrates (which is a cell membrane
receptor for hepatocyte growth factor), the Met receptor for JH was identified by its ability to FIGURE 21.14 20-hydroxyecdysone
bind methoprene, an insecticide that works by mimicking JH, thus preventing metamorphosis initiates developmental cascades. (A)
(Konopova and Jindra 2007; Charles et al. 2011).
Schematic of the major gene expression
cascade in Drosophila metamorphosis.
When 20E binds to the EcR/Usp receptor
(A) complex, it activates the early response
Pupation Head eversion genes, including E74, E75, and Broad.
Genes Their products activate the “late genes.”
20E + EcR/Usp 20E + EcR/Usp The activated EcR/Usp complex also
encoding
20E-degrading activates a series of genes whose prod-
enzymes ucts are transcription factors and which
EcR, E74, E75 activate the β FTZ-F1 gene. The βFTZ-F1
protein modifies the chromatin so that
the next 20E pulse activates a different
E75 E74, E75 set of late genes. The products of these
genes also inhibit the early-expressed
genes, including those for the EcR recep-
tor. (B) Postulated cascade leading from
DHR4
ecdysone reception to death of the larval
salivary gland. The 20E binds to the
EcR-A isoform of the ecdysone receptor.
DHR3 After complexing with Usp, the activated
transcription factor complex stimulates
transcription of the early response genes
E74A, E75B, and the Broad complex.
bFTZ-F1
These promote apoptosis in the salivary
gland cells. (C) When juvenile hormone
Late Late binds to its receptor, Met, it activates the
genes-1 genes-2 Kr-h1 gene. Kr-h1 protein is a repressive
transcription factor that blocks activation
Third instar Mid prepupa Late prepupa Pupa of the Broad gene by 20E. (A after King-
Jones et al. 2005, Rewitz et al. 2010; B
after Buszczak and Segraves 2000; C
(B) 20E after Hiruma and Kaneko 2013.)
Larval-pupal
Reaper Hid commitment
(apoptosis inducer) (apoptosis inducer) Diap2
Larval salivary
gland death
688 Chapter 21
WEb Topic 21.4 Precocenes and synthetic JH Given the voracity of insect
larvae, it is amazing that any plants survive. However, many plants get revenge on their
predators by making compounds that alter insect metamorphosis, thus preventing the
animals from developing or reproducing.
Hedgehog Projected
Dorsal gradient
PMad activity
of Gbb
+ Dpp
Anterior Posterior
Ventral dpp
Anterior Posterior Gradient sal
compartment compartment shown in (B)
omb
brk brk
Metamorphosis 689
brinker (brk) gene is no longer inhibited; thus, brk is expressed outside the signaling
domain. Specific cell fates of the wing are specified in response to the action of these
transcription factors. (For example, the fifth longitudinal vein of the wing is formed at
the border of optomotor blind and brinker; see Figure 21.15B). Although experimental
evidence shows that Dpp regulates wing growth, the mechanisms by which it does this
remain unknown (Hamaratoglu et al. 2014; Hariharan 2015).
(A) (B) Figure 21.16 Determining the dorsal-ventral axis. (A) The prospective
ventral surface of the wing is stained by antibodies to Vestigial protein (green),
while the prospective dorsal surface is stained by antibodies to Apterous pro-
tein (red). The region of yellow illustrates where the two proteins overlap in the
margin. (B) Wingless protein (purple) synthesized at the marginal juncture orga-
nizes the wing disc along the dorsal-ventral axis. The expression of Vestigial
(green) is seen in cells close to those expressing Wingless. (C) The dorsal and
ventral portions of the wing disc telescope out to form the two-layered wing.
Gene expression patterns are indicated on the double-layered wing. (A,B cour-
tesy of S. Carroll and S. Paddock.)
(C)
Anterior Posterior
Dorsal
Dorsal (Apterous expression)
Margin
Pupal
cuticle
690 Chapter 21
WEb Topic 21.5 Homologous specification If a group of cells in one imaginal disc
are mutated such that they give rise to a structure characteristic of another imaginal disc
(for instance, cells from a leg disc giving rise to antennal structures), the regional specifica-
tion of those structures will be in accordance with their position in the original disc.
Figure 21.17 The imaginal rudiment growing in the left side of the
pluteus larva of a sea urchin. The rudiment will become the adult sea
urchin, while most of the larval stage will be dissolved. The fivefold
Imaginal rudiment symmetry of the rudiment is obvious. (Courtesy of G. Wray.)
Metamorphosis 691
21 Snapshot Summary
Metamorphosis
1. Amphibian metamorphosis includes both morphological specify their body axes differently than the adult,
and biochemical changes. Some structures are remod- whereas secondary larvae (such as those of insects and
eled, some are replaced, and some new structures are amphibians) have body axes that are the same as adults
formed. of the species.
2. The hormone responsible for amphibian metamorphosis 7. Ametabolous insects undergo direct development.
is tri-iodothyronine (T3). The synthesis of T3 from thyrox- Hemimetabolous insects pass through nymph stages
ine (T4) and the degradation of T3 by deiodinases can wherein the immature organism is usually a smaller ver-
regulate metamorphosis in different tissues. T3 binds to sion of the adult.
thyroid hormone receptors and acts predominantly at 8. In holometabolous insects, there is a dramatic meta-
the transcriptional level. morphosis from larva to pupa to sexually mature adult.
3. Many changes during amphibian metamorphosis are In the stages between larval molts, the larva is called an
regionally specific. The tail muscles degenerate; the instar. After the last instar, the larva undergoes a meta-
trunk muscles persist. An eye will persist even if trans- morphic molt to become a pupa. The pupa undergoes
planted into a degenerating tail. an imaginal molt to become an adult.
4. Metamorphic change in amphibians can be brought 9. During the pupal stage, the imaginal discs and histo-
about by cell death, cell differentiation, or by cell-type blasts grow and differentiate to produce the structures
switching. of the adult body.
5. The specific timing of metamorphic events can be 10. The anterior-posterior, dorsal-ventral, and proximal-
orchestrated by the different events occurring at differ- distal axes are sequentially specified by interactions
ent levels of thyroid hormones. between different compartments in the imaginal discs.
6. Animals with direct development do not have a larval The disc “telescopes out” during development, its cen-
stage. Primary larvae (such as those of sea urchins) tral regions becoming distal.
692 Chapter 21
11. Molting is caused by the hormone 20-hydroxyecdysone types of ecdysone receptors in a cell may influence the
(20E). In the presence of high levels of juvenile hormone, response of that cell to 20E. The ecdysone receptors
the molt gives rise to another larval instar. In low concen- bind to DNA to activate or repress transcription.
trations of juvenile hormone, the molt produces a pupa; 13. Sea urchins undergo complete metamorphosis, form-
if no juvenile hormone is present, the molt is an imaginal ing a primary larva, the pluteus. Almost the entire body
molt. of the adult sea urchin comes from the left coelomic
12. The ecdysone receptor gene produces a nuclear RNA sac of the pluteus archenteron, known as the imaginal
that can form at least three different proteins. The rudiment.
Further Reading
Cai, L. and D. D. Brown. 2004. Expression of type II iodothyro- Hamaratoglu, F., M. Affolter and G. Pyrowolakis. 2014. Dpp/
nine deiodinase marks the time that a tissue responds to thy- BMP signaling in flies: From molecules to biology. Sem. Cell
roid hormone-induced metamorphosis in Xenopus laevis. Dev. Dev. Biol. 32: 128–136.
Biol. 266: 87–95. Hiruma. K. and Y. Kaneko. 2013. Hormonal regulation of insect
Grimaldi, A., N. Buisien, T. Miller, Y.-B. Shi and L. M. Sachs. metamorphosis with special reference to juvenile hormone bio-
2013. Mechanisms of thyroid hormone receptor action during synthesis. Curr. Top. Dev. Biol. 103: 73–100.
development: Lessons from amphibian studies. Bioch. Biophys. Jiang, C., A. F. Lamblin, H. Steller and C. S. Thummel. 2000.
Acta 1830: 3882–3892. A steroid-triggered transcriptional hierarchy controls salivary
gland cell death during Drosophila metamorphosis. Mol. Cell 5:
445–455.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
22
Regeneration
The Punchline
Regeneration is a postembryonic event that operates under familiar embryonic
developmental programs. The ability to regenerate tissues varies across species,
from a capacity for near-total regeneration in hydras and planarians, to the ability to
replace complex structures in salamanders and fish, to the limited ability to add and
replace cells for growth and maintenance in mammals. During regeneration, focal
cell proliferation or cell migration to the wound location creates an undifferentiated
blastema whose outgrowth and differentiation replace the damaged tissues. A
blastema can be created by pluripotent stem cells, as in the planarian, or lineage-
restricted progenitor cells derived by dedifferentiation, as in the salamander limb.
Regeneration can also occur through a remodeling of existing tissues through
compensatory proliferation or the transdifferentiation of differentiated cells, as
exemplified during regeneration of the zebrafish heart. The mammalian liver cannot
regenerate completely, but when a lobe of this organ is damaged or removed,
the remaining liver mass can grow to compensate for the loss. Virtually every
developmental pathway discussed in this book plays a role in regeneration. Among
these recurring players is the Wnt/β-catenin pathway.
694 Chapter 22
Mammals
Hydra Planaria Amphibians
and fish
Entire Whole anterior Full limbs, tail, fins, Antler Some organs
individual and posterior lens, CNS, heart,
from small halves of body other organs
fragment
Figure 22.1 Representative organ-
isms and their comparative regenerative
capabilities.
Regeneration 695
Unipotent
Stem cell-mediated regeneration stem cell Epimorphosis
Multipotent
stem cell
Dedifferentiation
Direct conversion
2
Hydra is both the genus name and the common name for these animals. For simplicity, we
will use the common (unitalicized) form in this discussion. The animal is named after the
Hydra, the many-headed serpent from Greek mythology. Whenever one of the Hydra’s heads
was chopped off, it regenerated two new ones. Hercules finally defeated the monster by cau-
terizing the stumps of its heads with fire. Hercules seems to have had a significant interest in
Developmental
regeneration: heBiology 11e the bound Prometheus, thereby stopping his daily series of partial
also freed
Fig. 22.02
hepatectomies (see p. 718).
Dragonfly Media Group
06/01/16
696 Chapter 22
Endoderm
Bud
Ectoderm
20 Days
Foot (little or no
Basal disc cell movement)
of both epithelial and muscle cells. Although hydras lack a true mesoderm, they do
contain secretory cells, gametes, stinging cells (nematocytes), and neurons that are not
part of the two epithelial layers (FIGURE 22.3B ; Li et al. 2015). Hydras can reproduce
sexually, but they do so only under adverse conditions (such as crowding or cold tem-
peratures). They usually multiply asexually, by budding off a new individual. The buds
form about two-thirds of the way down the animal’s body axis.
differentiate within the apical and basal extremities (Buzgariu et al. (A) Hypostome
2015). Compared to myoepithelial stem cells, interstitial stem cells
are paused in the G2 phase of the cell cycle for a longer period and
cycle at a faster rate (Buzgariu et al. 2014), suggesting that the inter-
stitial stem cells are poised to immediately respond to a need for cell
replacement through rapid proliferation. These three cell types are
all that are needed to form a hydra, and if hydra cells are separated
and reaggregated, a new hydra will form (Gierer et al. 1972; Technau
2000; Bode 2011).
(B)
The head activator
Experimental embryology—indeed, experimental biology—can be
said to have started with Tremblay’s studies of hydra regeneration. 3
In 1741, Tremblay reported that “the story of the Phoenix who is
Induced
reborn from his own ashes, fabulous as it is, offers nothing more basal disc
marvelous than the discovery of which we are going to speak.” He
Basal
found that when he cut a hydra into as many as 40 pieces, “there are disc
reborn as many complete animals similar to the first.” Each piece
would regenerate a head at its original apical end and a foot at its Weak apical
original basal end. (Imagine if a person could be generated from a induction
piece as small as a kneecap!)
Every portion of the hydra’s body column along the apical-basal
axis is potentially able to form both a head and a foot. The animal’s
polarity, however, is coordinated by a series of morphogenetic gra- (C) Hypostome or
dients that permit the head to form only at one place and the basal
disc to form only at another. Evidence for such gradients was first
obtained from grafting experiments begun by Ethel Browne in the
early 1900s. When hypostome tissue from one hydra is transplanted
into the middle of another hydra, the transplanted tissue forms a new
apical-basal axis, with the hypostome extending outward (FIGURE
22.4A). When a basal disc is grafted to the middle of a host hydra, a or
new axis also forms, but with the opposite polarity, extending a basal
disc (FIGURE 22.4B). When tissues from both ends are transplanted No induction
Basal
simultaneously into the middle of a host, either no new axis is formed disc
or the new axis has little polarity (FIGURE 22.4C; Browne 1909; New-
man 1974). These experiments have been interpreted to indicate the
existence of a head activation gradient (highest at the hypostome)
Weak basal
and a foot activation gradient (highest at the basal disc). The head induction
activation gradient can be measured by implanting rings of tissue
from various levels of a donor hydra into a particular region of the Figure 22.4 Grafting experiments demonstrating different
host trunk (Wilby and Webster 1970; Herlands and Bode 1974; Mac- morphogenetic capabilities in different regions of the hydra
Williams 1983b). The higher the level of head activator in the donor apical-basal axis. (A) Hypostome tissue grafted onto a host
tissue, the greater the percentage of implants that will induce the trunk induces a secondary axis with an extended hypostome.
(B) Basal disc tissue grafted onto a host trunk induces a sec-
formation of new heads. The head activation factor is concentrated in
ondary axis with an extended basal disc. (C) If hypostome and
the hypostome and decreases linearly toward the basal disc. basal disc tissues are transplanted together, only weak (if any)
inductions are seen. (After Newman 1974.)
the hypostome as organizer Ethel Browne (1909; also see
Lenhoff 1991) noted that the hypostome acted as an “organiz-
er” of the hydra. This notion has been confirmed by Broun and
Bode (2002), who demonstrated that (1) when transplanted, the
3
Tremblay’s advice to researchers is pertinent even today: He advises us to go directly
Gilbertto nature
and to avoid the prejudices that our education has given us. Moreover, “one should not become
Developmental Biology 11e, Sinauer Associates
disheartened by want of success, but should try anew whatever has failed. It is even good to
DevBio11e_22.04 Date 03-30-16
repeat successful experiments a number of times. All that is possible to see is not discovered,
and often cannot be discovered, the first time.” (Quoted in Dinsmore 1991.)
698 Chapter 22
Figure 22.5 Formation of secondary (A) Host tissue Donor hypostome (B) Host tissue
axes following transplantation of head
regions into the trunk of a hydra. The host
endoderm was stained with India ink. (A)
Hypostome tissue grafted onto the trunk
induces the host’s own trunk tissue to
become tentacles and head. (B) Sub-
hypostomal donor tissue placed on the
host trunk self-differentiates into a head
and upper trunk. (From Broun and Bode
2002, courtesy of H. R. Bode.)
hypostome can induce host tissue to form a second body axis; (2) the hypostome pro-
duces the head activation signal; (3) the hypostome is the only “self-differentiating”
region of the hydra; and (4) the hypostome also produces a “head inhibition signal”
that suppresses the formation of new organizing centers.
By inserting small pieces of hypostome tissue into a host hydra whose cells were
labeled with India ink (colloidal carbon), Broun and Bode found that the hypostome
induced a new body axis and that almost all of the resulting head tissue came from host
tissue, not from the differentiation of donor tissue (FIGURE 22.5A). In contrast, when
tissues from other regions (such as the subhypostomal region) were grafted onto a host
trunk, a head and apical trunk of a new hydra formed from the grafted donor tissue
(FIGURE 22.5B). In other words, only the hypostome region could alter the fates of the
trunk cells and cause them to become head cells. Broun and Bode also found that the
signal did not have to emanate from a permanent graft. Even transient contact with the
hypostome region was sufficient to induce a new axis from a host hydra. In these cases,
all the tissue of the new axis came from the host.
WEb Topic 22.1 Ethel Browne and the organizer As detailed in Chapter 11,
Spemann and Mangold’s work with amphibians introduced the concept of “the organiz-
er” into embryology, and Spemann’s laboratory helped make the idea a unifying principle
of embryology. It has been argued, however, that the concept actually had its origins in
Browne’s experiments on hydra.
a gradient of wnt3 is the inducer The major head inducer of the hypostome
organizer is a set of Wnt proteins acting through the canonical β-catenin pathway
(Hobmayer et al. 2000; Broun et al. 2005; Lengfeld et al. 2009; also see Bode 2009).
Gilbert
These Wnt proteins
Developmental Biology are
11e, seen in Associates
Sinauer the apical end of the early bud, defining the hypostome
region as the
DevBio11e_22.05bud elongates ( FIGURE 22.6A). If the Wnt signaling inhibitor GSK3 is
Date 05-23-16
itself inhibited throughout the body axis, ectopic tentacles form at all levels, and each
piece of the trunk has the ability to stimulate the outgrowth of new buds. Similarly,
transgenic hydra made to globally misexpress the downstream Wnt effector β-catenin
form ectopic buds all along the body axis and even on top of newly formed ectopic buds
(FIGURE 22.6B ; Gee et al. 2010). When the hypostome is brought into contact with the
trunk of an adult hydra, it induces expression of the Brachyury gene in a Wnt-dependent
manner—just as vertebrate organizers do—even though hydras lack mesoderm (Broun
Regeneration 699
Figure 22.6 Wnt/β-catenin signaling during hydra budding. (A) Wnt3 mRNA
expression (purple) in the hypostome during early bud (left), midstage bud (center), and
a bud with early tentacles (right). (B) Transgenic hydra made to misexpress β-catenin
(the downstream Wnt effector) have numerous ectopic buds (including buds formed on
top of other buds, such as the example marked with an arrow). (A from Hobmayer et al.
2000, courtesy of T. W. Holstein and B. Hobmeyer; B from Gee et al. 2010.)
et al. 1999; Broun and Bode 2002). These results strongly indicate that Wnt proteins (in
Developing Questions
particular Wnt3) function as the head organizer during normal hydra development, but
do they function similarly during regeneration? In hydra, what triggers
Wnt3 upregulation upon
amputation? Moreover,
morphallaxis and epimorphosis in hydra When a hydra is decapitated, the
if a midsection cut and a
Wnt pathway is activated in the apical portion that will form a new head. If the cut is more apical cut both result
made just below the hypostome, Wnt3 is upregulated in the epithelial cells near the cut in Wnt activation, how is
surface, which causes the remodeling of existing cells to form the head. No proliferation apoptosis triggered in the
is seen in this case; hence, it is morphallactic regeneration (regeneration by cell trans- first scenario and not in the
differentiation). If the hydra is cut at its midsection, however, the cells derived from other?
the interstitial stem cell (neurons, nematocytes, secretory cells, and gametes) undergo
apoptosis immediately below the cut site. Before dying, however, these cells produce
a burst of Wnt3, which activates β-catenin in the interstitial cells beneath them. This
β-catenin surge causes a wave of proliferation in the interstitial cells as well as remodel-
ing in the epithelial cells. Here we have epimorphic regeneration (regeneration by cell
dedifferentiation), or epimorphosis (Chera et al. 2009). Canonical Wnt signaling is thus
important both in normal budding and in head regeneration.
(A) Host’s head removed: No secondary axis induced (B) Intact host: No secondary axis induced
Donor
(C) Host’s head removed: Secondary axis induced (D) Intact host: Graft away from head region induces secondary axis
Donor
Figure 22.7 Grafting experiments
provide evidence for a head inhibition
gradient. (A) Hypostomal tissue grafted to
the amputated region inhibits regenera- and Webster 1970; MacWilliams 1983a). It is thought that the head inhibitor and the
tion of the head. (B) Subhypostomal tis- head activator (Wnts) are both made in the hypostome, but that the head inhibition
sue does not generate a new head when gradient falls off more rapidly than the head activator gradient (see Bode 2011, 2012).
placed close to an existing host head. The place where the head activator is uninhibited by the head inhibitor becomes the
(C) Subhypostomal tissue generates a
budding zone.
head if the existing host head is removed.
A head also forms at the site where the But that does not account for the bottom third of the column. What prevents cells
host’s head was amputated. (D) Subhy- there from becoming heads? Head formation at the base appears to be prevented by the
postomal tissue generates a new head production of another substance, a foot activator (MacWilliams et al. 1970; Hicklin and
when placed far away from an existing Wolpert 1973; Schmidt and Schaller 1976; Meinhardt 1993; Grens et al. 1999). The inhi-
host head. (After Newman 1974.) bition gradients for the head and the foot may be important in determining where and
when a bud can form. In young adult hydras, the gradients of head and foot inhibitors
appear to block bud formation. However, as the hydra grows, the sources of these labile
substances grow farther apart, creating a region of tissue about two-thirds down the
trunk where levels of both inhibitors are minimal. This region is where the bud forms
(FIGURE 22.8A ; Shostak 1974; Bode and Bode 1984; Schiliro et al. 1999).
Certain hydra mutants have defects in their ability to form buds, and these defects
can be explained by alterations of the inhibition gradients. The L4 mutant of Hydra
magnipapillata, for instance, forms buds very slowly, and does so only after reaching
a size about twice as long as wild-type individuals. The amount of head inhibitor in
these mutants was found to be much greater than in wild-type individuals (Takano
and Sugiyama 1983).
Several small peptides have been found to activate foot formation, and researchers
are beginning to sort out the mechanisms by which these proteins arise and function
Gilbert (see Harafuji et al. 2001; Siebert et al. 2005). The specification of cells from the basal
Developmental Biology 11e, Sinauer Associates
region through the body column may be mediated by a gradient of tyrosine kinase,
DevBio11e_22.07 Date 06-01-16
however. The product of the shinguard gene is a tyrosine kinase that extends in a gradi-
ent from the ectoderm just above the basal disc through the lower region of the trunk.
Buds appear to form where this gradient fades ( FIGURE 22.8B ). The shinguard gene
appears to be activated through the product of the manacle gene, a putative transcription
factor that is expressed earlier in the basal disc ectoderm (Bridge et al. 2000).
Regeneration 701
(A) (B)
Budding
adult
Newly Young
dropped adult
bud
Head inhibition
Foot
inhibition
Head Foot
(A)
(B) (C)
n
atio
Bisect e gener
Regeneration R
Regeneration
R eg
ener
atio
n
(D)
Regeneration
that would be organized into new structures by paracrine factors located at the wound
surface (see Baguña 2012). In 2011, however, a series of experiments by Wagner and col-
Figure 22.9 Flatworm regeneration
leagues provided substantial evidence that dedifferentiation does not occur. Rather, the
and its limits. (A) Time course of a planar-
ian flatworm regenerating a new head
regeneration blastema forms from pluripotent stem cells called clonogenic neoblasts
following head amputation. (B) If the pla- (cNeoblast), a set of pluripotent cells in flatworms that serve as stem cells to replace the
narian is cut in half, the anterior portion of aging cells of the adult body (FIGURE 22.10A; Newmark and Sánchez Alvarado 2000;
the lower half regenerates a head while Pellettieri and Sánchez Alvarado 2007; reviewed in Adler and Sánchez Alvarado 2015).
the posterior of the upper half regener- Clonogenic neoblasts can migrate to a wound site and regenerate the tissue. Wagner
ates a tail. The same tissue can generate and colleagues were able to show that if planaria are irradiated at a dosage that destroys
a head (if it is at the anterior portion of the
nearly all neoblasts (dividing cells are killed more readily by radiation than nondivid-
tail piece) or a tail (if it is at the posterior
portion of the head piece). (C) If a flat-
ing cells, which is the basis for irradiating cancer sites), there would be some individual
worm is cut into three pieces, the middle animals in which a single cNeoblast survived. From this neoblast, dividing progenitor
piece will regenerate a head from its cells formed, ultimately producing cell types of all germ layer origins. This single-cell
anterior end and a tail from its posterior response demonstrated that neoblasts are pluripotent cells residing in the adult body,
end. (D) If the middle slice is too narrow, capable of regenerating all tissues of the planarian (FIGURE 22.10B).
there is no discernible morphogen gradi- If cNeoblasts are essential for regeneration, their total loss should prevent regenera-
ent within it, and regeneration is abnor-
tion. Next the researchers irradiated planaria so that all dividing cells were destroyed
mal. (A from Gentile et al. 2011; B–D after
Gosse 1969.)
(FIGURE 22.10C). These planaria died because of failed tissue replacement. However,
transplantation of a single clonogenic neoblast into such an irradiated flatworm could,
in some cases, restore all the cells of the organism. Not only did the flatworm survive,
it split into more planaria, and all cells of these new planaria had the same genotype as
the single donor neoblast. These results conclusively demonstrated that the regenera-
tion of the flatworm was the result of the production of new cells from adult pluripotent
stem cells (Wagner et al. 2011).
(A)
Postmitotic
cNeoblast blastema cell
(Wound-specific signals)
Activated by
Pluripotent injury Multipotent
Control
RNAi
zfp-1
RNAi
S phase
S phase
G2/M G2/M
Postmitotic
CNS Intestine prog-1
precursors
Eyes Muscle
Nephridia Epidermis
(zfp-1-expressing) are then directly responsible for creating the remaining epidermal cell
types. Planaria lacking a zeta population can be made through zfp-1 RNAi knockdown.
When the head of these planarian were amputated, the sigma neoblasts were able to fuel
the regeneration of all the cells of a new head, except for the epidermal lineages (FIGURE
22.12B,C; van Wolfswinkel et al. 2014).
These data all support a vital role for stem cells in regeneration. But we are still left with
the question, How are the specific cell types patterned correctly? How does the flatworm
tell the posterior blastema to become tail and the anterior blastema to become head?
(FIGURE 22.15). Not surprisingly, it was found that Notum expression is downregulated
in regeneration-deficient species (Lui et al. 2013). Moreover, transcriptome analysis of
blastemas in regenerating planaria found that only one out of 4,401 genes examined was
differentially expressed between anterior- and posterior-facing blastemas! That gene was
Notum, expressed only in the anterior blastema (Wurtzel et al. 2015). If Notum expression
18 hours
3 days
is knocked down, causing too much Wnt to become functionally active, the anterior-fac-
Developing Questions
ing blastema will form a tail (Petersen and Reddien 2011). These results strongly suggest
that the anterior expression of Notum functions to antagonize the posteriorly produced Many details of the inter-
actions between anterior
Wnt, leading to head specification. It has also been proposed that regulation of the bal-
and posterior signaling
ance between Wnt and Notum signals may underlie not only head-tail specification but systems still need to be
also regulation of organ size (Hill and Petersen 2015). In addition, there appears to be an determined. For instance,
anterior-to-posterior gradient of Erk signaling that functions as a positive inducer of head does Erk signaling positively
specification. Wnt signaling achieves its repression of head regeneration by inhibiting regulate Notum gene
Erk. Therefore, only in those more anterior regions lacking Wnt (due to Notum’s repres- expression? Moreover,
sion of Wnt) can Erk induce head regeneration (FIGURE 22.14D; Umesono et al. 2013). although much of the
current work has focused
Scientists Speak 22.1 Dr. Alejandro Sánchez Alvarado describes the role of on the role of canonical
stem cells during planarian regeneration in this short documentary. Wnt/β-catenin signaling,
noncanonical Wnt signal-
ing has long been known
Salamanders: Epimorphic Limb Regeneration to influence cell and tissue
polarity. What role, if any,
When an adult salamander limb is amputated, the remaining limb cells reconstruct a do the noncanonical Wnt
signaling pathways have in
new limb, complete with all its differentiated cells arranged in the proper order. Remark-
planarian regeneration?
ably, the limb regenerates only the missing structures and no more. For example, when
the limb is amputated at the wrist, the salamander forms a new wrist and foot, but not a
new elbow. In some way, the salamander limb “knows” where the proximal-distal axis
has been severed and is able to regenerate from that point on (FIGURE 22.16).
Salamanders accomplish epimorphic regeneration by cell dedifferentiation to form a
regeneration blastema, which in this case is an aggregation of relatively undifferenti-
ated cells derived from the originally differentiated tissue that then proliferates and
redifferentiates into the new limb parts (FIGURE 22.17; see Brockes and Kumar 2002;
Gardiner et al. 2002; Simon and Tanaka 2013). Bone, dermis, and cartilage just beneath
the site of amputation contribute to the regeneration blastema, as do satellite cells from
nearby muscles (Morrison et al. 2006). Hence, unlike the flatworm, which formed its
regeneration blastema from adult pluripotent stem cells, much of the salamander limb’s
Original
limb
Amputation
7 days
21 days
25 days
32 days
AEC
Blastema
Bone
Bone progenitors
Connective tissue
Dedifferentation
Fibroblast progenitors
Muscle
Muscle progenitors
Regenerating axons
regeneration blastema appears to arise from the dedifferentiation of adult cells followed
by cell division and the redifferentiation of those cells back into their original cell types.6
6
There is still controversy over whether this is “true” dedifferentiation of normally postmitotic
cells or whether much of the limb blastema is formed from the activation of uncommitted stem
cells (see Nacu and Tanaka 2011).
innervating the limb degenerate for a short distance proximal to the plane of amputa-
tion (see Chernoff and Stocum 1995).
During the next four days, the extracellular matrices of the tissues beneath the
wound epidermis are degraded by proteases, liberating single cells that undergo dra-
matic dedifferentiation: bone cells, cartilage cells, fibroblasts, and myocytes all lose
their differentiated characteristics. Genes that are expressed in differentiated tissues
(such as the mrf4 and myf5 genes expressed in muscle cells) are downregulated, while
there is a dramatic increase in the expression of genes such as msx1 that are associ-
ated with the proliferating progress zone mesenchyme of the embryonic limb (Simon
et al. 1995). This cell mass is the regeneration blastema, and these cells are the ones
that will continue to proliferate and that will eventually redifferentiate to form the
new structures of the limb (FIGURE 22.18 ; Butler 1935). Moreover, during this time,
M
M
A
D1 D2
U R
R U
H
P
FIGURE 22.18 Regeneration in the larval forelimb of the spot- (E) At 9 days, early redifferentiation can be seen. Chondrogenesis
ted salamander Ambystoma maculatum. (A) Longitudinal section has begun in the proximal part of the regenerating humerus (H). The
of the upper arm, 2 days after amputation. The skin and muscle letter A marks the apical mesenchyme of the blastema, and U and
(M) have retracted from the tip of the humerus. (B) At 5 days after R are the precartilaginous condensations that will form the ulna and
amputation, a thin accumulation of blastema cells is seen beneath radius, respectively. P represents the stump where the amputation
the thickened epidermis, where the apical epidermal cap (AEC) was made. (F) At 10 days after amputation, the precartilaginous
forms. (C) At 7 days, a large population of mitotically active blas- condensations for the carpal bones (wrist, C) and the first two digits
tema cells lies distal to the humerus. (D) At 8 days, the blastema (D1, D2) can also be seen. (From Stocum 1979, courtesy of D. L.
elongates by mitotic activity; much dedifferentiation has occurred. Stocum.)
710 Chapter 22
the wound epidermis thickens to form the apical epidermal cap (AEC) (see Figure
22.17B), which acts similarly to the apical ectodermal ridge during normal limb devel-
opment (see Chapter 19; Han et al. 2001).
Thus, the previously well-structured limb region at the cut edge of the stump forms a
FIGURE 22.19 Blastema cells retain proliferating mass of indistinguishable cells just beneath the apical epidermal cap. One
their specification even when they dedif- of the major questions of regeneration is whether the cells keep a “memory” of what
ferentiate. (A,B) Schematic representation
they had been. In other words, do new muscles arise from old muscle cells that dedif-
of the procedure wherein a particular tis-
ferentiated, or can any cell of the blastema become a muscle cell? Kragl and colleagues
sue (in this case, cartilage) is transplanted
from a salamander expressing a GFP (2009) found that the blastema is not a collection of homogeneous, fully dedifferentiated
transgene into a wild-type salamander cells. Rather, in the regenerating limbs of the axolotl salamander, muscle cells arise only
limb. Later, the limb is amputated through from old muscle cells, dermal cells come only from old dermal cells, and cartilage can
the region of the limb containing GFP arise only from old cartilage or old dermal cells. Thus, the blastema is not a collection
expression, and a blastema is formed of unspecified multipotent progenitor cells. Rather, the cells retain their specification,
containing GFP-expressing cells that had
and the blastema is a heterogeneous assortment of restricted progenitor cells.
been cartilage precursors. The regener-
Kragl and colleagues (2009) performed an experiment in which they transplanted
ated limb is then studied to see if GFP is
found only in the regenerated cartilage limb tissue from a salamander whose cells expressed green fluorescent protein (GFP)
tissues or in other tissues. The dashed into different regions of limbs of normal salamanders that did not have the GFP trans-
lines in (B) mark the position of the gene (FIGURE 22.19). If they transplanted the GFP-expressing limb cartilage into a
amputation. (C) Longitudinal section of a salamander limb that did not contain the GFP transgene, the GFP-expressing cartilage
regenerated limb 30 days after amputa- would integrate normally into the limb skeleton. They later amputated the limb through
tion. Muscle cells are stained red; nuclei
the region containing GFP-marked cartilage cells. The blastema was found to contain
are stained blue. The majority of GFP-
GFP-expressing cells, and when the blastema differentiated, the only GFP-expressing
expressing cells (green) were found in
regenerated cartilage; no GFP was seen cells found were in the limb cartilage. Similarly, GFP-marked muscle cells gave rise
in the muscle. (After Kragl et al. 2009, only to muscle, and GFP-marked epidermal cells only produced the epidermis of the
courtesy of E. Tanaka.) regenerated limb.
Fate?
Positional identity?
GFP-expressing limb Wild-type limb Blastema
(B)
Regeneration
7 days 5 days
Left Right
(B)
Regeneration
restored
(D) (E)
WE
As mentioned above, the regeneration of the salamander limb along the anterior-
posterior axis appears to follow rules similar to those that generate the developing limb. Developing Questions
Indeed, the opposing retinoic acid-FGF gradients postulated for the development of The limb will regenerate
the limb were first hypothesized for the regeneration of limb structures along this axis only those distal tissues
(Crawford and Stocum 1988). It is known that the size and pattern of the regenerated removed, which suggests
limb depends on the proximal-to-distal position of the amputation such that the limb that key positional
information is resident in
only generates tissues that had been distal to the cut, replacing them in the appropriate
the salamander limb to
pattern. What factors beyond retinoic acid and FGFs are controlling this pattern forma- provide instructions for
tion? Many different signaling molecules have been implicated, including Wnts, BMPs, cell fate patterning during
Hedgehogs, and Notch (reviewed in Satoh et al. 2015; Singh et al. 2015). But the story is regeneration. Treatment
not yet clear, and odd patterns of regeneration can result from applying some of these with retinoic acid, use of
molecules. For example, if a regenerating salamander limb is exposed to retinoic acid, an epidermal graft from
the blastema is reprogrammed to produce a full limb with all proximodistal structures, a contralateral position,
or BMP and FGF signals
regardless of the position of the amputation (Maden 1983; Niazi et al. 1985; McCusker
can induce different
et al. 2014). In addition, if beads coated with BMP proteins or a combination of BMPs types of growth where it
and FGFs are implanted in a wound site on a salamander limb, an accessory limb will normally would not occur,
form (see Figure 22.21E; Makanae et al. 2014). however. What are the key
components of positional
WEb Topic 22.2 Axes of regeneration The phenomena of epimorphic regenera- information? How is this
tion can be seen formally as events that reestablish continuity among tissues that the positional information
amputation has severed. How does the amputated stump know to start at the cut site able to be maintained
and accessed during
and not start making a whole new arm from the shoulder? How does it build the same
regeneration?
dorsal-ventral axis as the stump?
wnt upon a fin The zebrafish caudal fin fans out along the dorsal-to-ventral axis with
16 to 18 segmented boney rays separated from one another by inter-ray tissue. The regen-
erative capacity of the fin is so robust and easily accessible that clipping caudal fins for
molecular analysis is a routine procedure in most zebrafish research labs. The fin ray is
primarily made of bone, but it also includes a diverse set of other cell types, including fibro-
blasts, blood vessels, nerves, and pigment cells. Like the salamander limb, upon amputa-
(A) tion the zebrafish fin rays first close the wound with epidermal cells that form an apical
Amputated epidermal cap, and most tissue types undergo dedifferentiation, proliferation, and distal
migration to establish a blastema (Knopf et al. 2011; Stewart and Stankunas 2012). Some
contributions may occur from as yet unidentified resident stem/progenitor cells capable
of generating osteoblasts in the absence of any committed bone cells (Singh et al. 2012).
Regenerated
FIGURE 22.23 Zebrafish fin ray regeneration. (A) The
caudal fin of the adult zebrafish is capable of regenerat-
ing following amputation (dashed line). The magnified
view of the caudal fin depicts the fin ray bones, inter-ray
IGF membranes, and regenerated tissues (blastema). (B,C)
Hh
Schematic of a longitudinal section of a single regener-
BMP ated fin ray. (B) The upper half of the schematic shows
Wnt/β-catenin the spatial domains where various signaling pathways
operate, all of which appear to function downstream of
Ray Inter-ray Blastema canonical Wnt signaling. (C) The lower half of the sche-
FGF Notch RA matic indicates the different cell compartments involved
bones membranes
in regeneneration, as described in the text. Distal is
to the right, and proximal to the left. (A after Shi et al.
2015; B,C after Wehner and Weidinger 2015.)
(B) Signaling
system
Outer
epidermal
(C) Blastema layers
anatomy
Non-proliferative
fibroblasts
Proximal Distal
blastema blastema
Regeneration 715
The regenerated fin can be divided into four basic sections (FIGURE 22.23): (1) the distal
blastema made up of nonproliferative fibroblasts, (2) the proliferative proximal blastema that
constitutes the major portion of the dedifferentiated mesenchyme, (3) the differentiating
proximal blastema that functions to add differentiated cells to existing and newly formed
tissues during outgrowth, and (4) the lateral-encompassing epidermal layers that serve as FIGURE 22.24 Testing the spatiotem-
complex signaling centers throughout regeneration. Despite the seemingly simple distal poral requirements of Wnt/β-catenin sig-
outgrowth that typifies fin regeneration, the molecular regulation of this process is highly naling during fin regeneration. (A) Experi-
complex and involves all major signaling pathways known to play roles during embryonic mental design using the Tet/On system
for inducible gene expression. One
development. We will focus on just one here, the Wnt/β-catenin signaling pathway, which
transgenic fish possesses a tissue spe-
appears to be the first “domino” that begins to reveal the regenerative pattern of fin rays cific promoter (ubiquitin or her4.3), driving
(comprehensively reviewed in Wehner and Weidinger 2015). The Wnt/β-catenin pathway the expression of tetracycline and cyan
is active in the distal blastema and the lateralmost regions of the proximal proliferative fluorescent protein. A different transgenic
blastema constituting progenitors of osteoblasts and actinotrichia (fibrous elements of the fish has a transgene with the tet promoter
fin; see Figure 22.23). Loss and gain of function of Wnt/β-catenin signaling results in driving Axin1-YFP expression; functional
the decrease and increase of blastema proliferation and regeneration rate, respectively transcription of this transgene will only
occur in combination with doxycycline
(Kawakami et al. 2006; Stoick-Cooper et al. 2007; Huang et al. 2009; Wehner et al. 2014).
(DOX). Crossing the two fish generates
The Weidinger lab demonstrated that misexpression of the β-catenin inhibitor Axin1 double transgenic individuals (repre-
throughout the fin blastema or just in the lateral progenitor zones resulted in significantly sented by dots and stripes) that enable
reduced fin rays as well as a failure of fin rays to ossify (FIGURE 22.24; Wehner et al. the spatial (tissue-specific promoter) and
2014). It appears, however, that Wnt/β-catenin functions indirectly through the modula- temporal (DOX) expression of Axin1. (B,C)
tion of other mitogenic regulators, such as Hedgehog proteins (Sonic hedgehog and Indian Misexpression of Axin1 disrupts regener-
hedgehog), Fgf8, retinoic acid, and insulin-like growth factor (see Figure 22.23B). ation. The photos at left show the pattern
of Axin1 misexpression (yellow) driven by
the ubiquitin (B) or her4.3 (C) promoter.
epimorphosis, compensation, and transdifferentiation: the heart of the
The photos at right show the tail fin 12
matter The zebrafish has a relatively simple tubular heart. Venous blood enters the days after amputation, with (+DOX) or
sinus venosus, passes into the single atrium, is pumped into the single ventricle, and without (–DOX) Axin1 misexpression.
leaves the heart through the bulbus arteriosis. Several different injury models—involv- (B) When Wnt/β-catenin is inhibited by
ing surgical removal of pieces of the myocardium, cryo-injury, and genetically induced misexpressing Axin1 throughout the fin
tissue-specific ablation—have been adopted to study regeneration of heart tissues in (ubiquitin promoter), there is a reduced
rate of fin regeneration. (C) When Axin1 is
zebrafish (reviewed in Shi et al. 2015). The zebrafish heart retains the ability to regener-
misexpressed only in the osteoblast pro-
ate throughout the life of the fish, which is in part due to the sustained mitotic capacity genitor cells of the fin (her4.3 promoter),
of the cardiac myocytes (muscle cells) that constitute a majority of the heart tissue (Poss ossification of the fin ray bones during
et al. 2002). It is clear that a major contribution to regeneration of the adult heart comes regeneration is severely impaired (red
directly from preexisting cardiac myocytes. Indeed, use of the “Zebrabow” transgenic stain, brackets). (A after Wehner et al.
2014; B,C from Wehner et al. 2014.)
(C)
Does loss of Wnt/
– DOX β-catenin signaling Expression in
in specific tissues osteoblast
of the regenerated progenitors
fin ray impair (her4.3 promoter)
+ DOX regeneration?
system (see Chapter 2) for tracing the lineage of cells under the control
of heart-specific promoters has demonstrated that previously differen-
tiated cardiac myocytes give rise to clones of regenerated cells (FIGURE
22.25 ; Gupta and Poss 2012).
Work from many labs has shown that heart regeneration in the adult
zebrafish is carried out primarily through the dedifferentiation of pre-
existing cardiomyocytes (epimorphosis), establishment of a blastema at
(B) Control (uninjured) the wound site through local proliferation and migration, and, finally,
redifferentiation of blastema cells to repair the heart (Curado and Stainier 2006;
Lepilina et al. 2006; Kikuchi et al. 2010; Zhang et al. 2013). In addition, it has
been shown that healthy ventricular tissue far from the acute injury also responds
by increasing proliferation (hyperplasia), which is a compensatory mechanism of
regeneration (FIGURE 22.26; Poss et al. 2002; Sallin et al. 2015). Compensatory
regeneration is often accompanied by hypertrophic growth (i.e., increase in cell
size), but this has yet to be shown to occur in zebrafish heart regeneration
Pr The developing zebrafish heart also appears to be capable of morphallaxis
Cor or transdifferentiation during regeneration. Researchers working with zebra-
fish larvae induced severe injury to the ventricular tissue of the larval heart by
causing apoptosis of the ventricular cardiomyocytes (Zhang et al. 2013). They
14 days postablation
did so by targeting the expression of nitroreductase (NTR) in ventricular cardio-
myocytes using the ventricular myosin heavy chain (vmhc) promoter and inducing
cell death by administering an NTR-reactive cytotoxic prodrug. This procedure
severely ablated ventricular tissue in this larval heart. What happened next was
remarkable. Neighboring differentiated atrial cardiomyocytes responded to the
injury by migrating into the damaged ventricular tissue and upregulating ven-
tricule-specific genes such as vmhc (FIGURE 22.27A). Months later, fate mapping
of these migrating atrial cardiomyocytes revealed that they remained in the ven-
tricular wall, contributing to a fully regenerated and functioning ventricle and
heart (FIGURE 22.27B). Zhang and colleagues went on to show that Notch-Delta
60 days postablation signaling is highly upregulated in the atrial myocardium and is required for this
atrial-mediated repair of ventricular damage (FIGURE 22.27C). Pharmacological
inhibition of Notch signaling with DAPT exposure during ablation of ventricle
tissue severely impairs heart regeneration (FIGURE 22.27D; Zhang et al. 2013).
These results suggest that, at least during larval development, cardiac myocytes
are capable of undergoing transdifferentiation to support regeneration of the
heart. Thus, it appears the cells of the zebrafish heart employ multiple mecha-
nisms to power its regeneration: blastema formation through epimorphosis,
compensatory proliferation, and Notch-mediated transdifferentiation.
WATCH DEVELOPMENT 22.1 Videos from the laboratory of Dr. Neil Chi docu-
ment the fascinating work being done on zebrafish heart regeneration.
Gilbert
Developmental Biology 11e, Sinauer Associates
DevBio11e_23.25 Date 05-24-16
Regeneration 717
(A) (B) 7 days postablation 17 days postablation FIGURE 22.26 Epimorphosis and compen-
Uninjured heart Initiation of regeneration Progression of regeneration sation in adult zebrafish heart regeneration.
(A) Normal heart hemostasis with respect
to the levels of growth and proliferation. (B)
Regenerative response 7 and 17 days follow-
ing ventricular injury. The regenerating heart
first produces a focal blastema at the wound
surface, fueled by epimorphic processes
during which cardiomyocytes (CMs) dedif-
ferentiate, proliferate, and redifferentiate into
Cardiac blastema new ventricular cardiomyoctyes. Compensa-
Post-infarct tissue tory regeneration through increased levels
of proliferation is triggered throughout the
Homeostatic growth Compensatory regeneration
ventricular tissue, even in areas devoid of any
and cell turnover Epimorphic regeneration
injury. (After Sallin et al. 2015.)
CM proliferation Increased CM proliferation (hyperplasia)
(A) (B)
Atrial cardiomyocytes Atrial cardiomyocytes Ventricle tissue
Ventricle-specific genes
Control Ablated
A A
V
V *
*
A
V
(C) (D)
OFT No recovery
OFT Recovered
V 100
Percent regeneration
V 80
60
A 40
Developmental Biology 11e A 20
Fig. 22.26 AVC 0
Dragonfly Media Group AVC Ablated DAPT +
06/01/16 only ablated
Control Ablated
FIGURE 22.27 Transdifferentiation of atrial cardiomyocytes into heart. (C) Notch-Delta signaling is required for the successful regen-
ventricular cardiomyocytes during larval heart regeneration. (A) erative contributions from atrial cardiomyocytes. Twenty-four hours
After researchers induced apoptosis of ventricular cardiomyocytes, after ventricular cell ablation (right photograph), deltaD along with
fate mapping of differentiated atrial cardiomyocytes (green) shows other related genes (blue stain) are highly upregulated in the atrial
migration from the atrium to the ablated ventricle tissue. At the cardiomyocytes, particularly in those migrating toward the ventricu-
transition point during this migration, the atrial cells start express- lar tissue. (D) Pharmacological inhibition of Notch signaling with
ing ventricular markers, suggesting transdifferentiation (see Watch DAPT exposure during ablation of ventricle tissue severely impairs
Development 22.1). (B) Twelve months following ablation of ventricu- heart regeneration. A, atrium; V, ventricle; AVC, atrioventricular
lar tissue, infiltrating atrial cardiomyocytes (green) fully differentiate canal; OFT, outflow tract. (From Zhang et al. 2013.)
into the ventricular tissue (red) and contribute to a functional adult
718 Chapter 22
Regeneration in Mammals
Although mammals do not have the same level of regenerative abilities as the other
organisms covered in this chapter, they can regenerate certain structures. Mammals
operate less on the principle of “start again from scratch” than from the premise that
“if you can’t remake it, make it bigger.”
fingers and hearts are not so different Mammals such as rodents and
humans have been shown to regenerate the tips of their digits if the organism is young
enough. First, a regeneration blastema composed of progenitor cells forms at the tip of
the digit (Fernando et al. 2011). As in salamander limb regeneration, respecification
does not occur (Lehoczky et al. 2011; Rinkevich et al. 2011). Instead, the new epi-
dermis is derived from ectoderm-restricted progenitor cells, and the new bone comes
from osteoblast progenitor cells. This similarity to salamander limb regeneration pro-
vides hope that we can apply what we learn about salamander regeneration to enhance
regenerative abilities in humans.
It is interesting that heart tissue can also regenerate in mice, but only within the
first week of neonatal life. After that, the ability is lost, presumably because the cardio-
myocytes withdraw from the cell cycle (Porrello et al. 2011). It is known, though, that
cardiomyocytes in adult mammals (as in adult zebrafish) will respond to a heart attack
by re-entering the cell cycle, thus contributing to injury repair (Senyo et al. 2013).
committing the cell to mitosis (White et al. 2005). The removal (A) DNA synthesis
or injury of the liver is sensed through the bloodstream: some
H DNA NP DNA
liver-specific factors are lost while others (such as bile acids
and gut lipopolysaccharides) increase. These lipopolysaccha-
rides activate some non-hepatocytes to secrete paracrine factors
that allow the remaining hepatocytes to re-enter the cell cycle. Liver mass
The Kupffer cell secretes interleukin 6 (IL6) and tumor necro-
sis factor-α (which are usually involved in activating the adult
immune system), and the stellate cells secrete the paracrine (B) Growth-regulated genes
factors hepatocyte growth factor (HGF, or scatter factor) and
TGF-β. The specialized blood vessels of the liver also produce
HGF as well as Wnt2 (Ding et al. 2010).
Hepatocytes that are still connected to one another in an epi-
thelium cannot respond to HGF, however. Hepatocytes activate
cMet (the receptor for HGF) within an hour of partial hepatecto-
my, and the blocking of cMet (by RNA interference or knockout) (C) Cell cycle-regulated genes
blocks liver regeneration (Borowiak et al. 2004; Huh et al. 2004;
Paranjpe et al. 2007). The trauma of partial hepatectomy may
activate metalloproteinases that digest the extracellular matrix
and permit the hepatocytes to separate and proliferate. These
enzymes also may cleave HGF to its active form (Mars et al.
1995). Together, the factors produced by the endothelial cells,
Kupffer cells, and stellate cells allow the hepatocytes to divide by (D) Gene expression after growth phase
preventing apoptosis, activating cyclins D and E, and repressing
cyclin inhibitors such as p27 (see Taub 2004).
The liver stops growing when it reaches the appropriate size;
the mechanism for how this is achieved is not yet known. One
clue, though, comes from parabiosis experiments, in which the
circulatory systems of two rats are surgically joined together. 02 4 8 24 36 48 60 75 168 216
Partial hepatectomy in one parabiosed rat causes the other rat’s Hours post-hepatectomy
liver to enlarge (Moolten and Bucher 1967). Therefore, some fac-
FIGURE 22.28 Correlation of changes in gene expression with
tor or factors in the blood appear to be establishing the size of
increases in liver mass following partial hepatectomy in mammals.
the liver. Huang and colleagues (2006) have proposed that these (A) Initial peaks in DNA synthesis are seen in both hepatocytes
factors are bile acids that are secreted by the liver and posi- (H DNA; green) and thereafter in nonparenchymal cells (NP DNA;
tively regulate hepatocyte growth. Partial hepatectomy stimu- yellow). This burst in DNA synthesis corresponds with the upregu-
lates the release of bile acids into the blood. These bile acids are lation of growth-regulated (B) and cell cycle-regulated (C) gene
received by the hepatocytes and activate the Fxr transcription expression, both of which taper off as the liver mass (brown shad-
ing in panel A) reaches its normal volume. (D) Overall gene expres-
factor, which promotes cell division. Mice without functional
sion remains high after the growth phase, reflecting the functional-
Fxr protein cannot regenerate their livers. Therefore, bile acids
ity of the regenerated liver tissue. (After Taub 2004.)
(a relatively small percentage of the products secreted by the
liver) appear to regulate the size of the liver, keeping it at a par-
ticular volume of cells. The molecular mechanisms by which these factors interact and
by which the liver is first told to begin regenerating and then to stop regenerating after
reaching the appropriate size remain to be discovered.
Because human livers have the power to regenerate, a patient’s diseased liver can
be replaced by compatible liver tissue from a living donor (usually a genetically close
relative, whose own liver grows back). Human livers regenerate more slowly than those
of mice, but function is restored quickly (Pascher et al. 2002; Olthoff 2003). In addition,
mammalian livers possess a “second line” of regenerative ability. If the hepatocytes are
unable to regenerate the liver sufficiently within a certain amount of time, the oval cells
divide to form new hepatocytes. Oval cells are a small progenitor cell population that
can produce hepatocytes and bile duct cells. They appear to be kept in reserve and are
used only after the hepatocytes have attempted to heal the liver (Fausto and Campbell
2005; Knight et al. 2005).
Developmental Biology 11e
Fig. 22.28
Dragonfly Media Group
05/17/16
720 Chapter 22
22 Snapshot Summary
Regeneration
1. There are four major types of regeneration. In stem-cell 5. In the regenerating limb blastemas of amphibians, cells
mediated regeneration (such as planarian regeneration), do not become multipotent. Rather, cells retain their
new cells are routinely produced to replace the ones that specifications, with bone arising from preexisting car-
die. In epimorphosis (such as regenerating salamander tilage, neurons coming from preexisting neurons, and
limbs and fish fins), tissues form into a regeneration blas- muscles coming either from preexisting muscle cells or
tema, divide, and redifferentiate into the new structure. from muscle stem cells.
In morphallaxis (characteristic of hydra), there is a repat- 6. Mitogens such as nAG are provided by the apical epi-
terning of existing tissue with little or no growth. In com- dermal cap and by the glia surrounding the limb axons,
pensatory regeneration (such as in the mammalian liver), which are capable of inducing regeneration of limbs even
cells divide but retain their differentiated state. in the absence of nerves. Salamander limb regeneration
2. Hydra appears to have a head activation gradient, a appears to use the same pattern formation system as
head inhibition gradient, a foot activation gradient, and the developing limb.
a foot inhibition gradient. Budding occurs where these 7. Multiple modes of regeneration have been discovered to
gradients are minimal. operate in zebrafish. Distal regeneration of the zebrafish
3. The hypostome region of hydra appears to be an orga- fin occurs largely through the dedifferentiation of existing
nizer region that secretes paracrine factors (Wnt3) to cell types followed by the active proliferation of a blaste-
alter the fates of surrounding tissue through an epimor- ma-like outgrowth. Zebrafish heart tissue also employs
phic mechanism. an initial mode of epimorphsis followed by a compensa-
4. In planarian flatworms, regeneration occurs by forming a tory regenerative period of proliferation.
regeneration blastema produced by pluripotent clonogen- 8. In the mammalian liver, no regenerating blastema is
ic neoblasts. Wnt signaling gradients appear to direct the formed, and the liver regenerates the same volume as it
anterior-posterior differentiation of these cells in a pattern lost. Each cell appears to generate its own cell type. A
regulated by the head-expressed Wnt inhibitor Notum. reserve population of multipotent progenitor cells divides
when these tissues cannot regenerate the missing portions.
Regeneration 721
Further Reading
Bode, H. R. 2012. The head organizer in Hydra. Int. J. Dev. Biol. McCusker, C., J. Lehrberg and D. M. Gardiner. 2015. Position-
56: 473–478. specific induction of ectopic limbs in non-regenerating blaste-
Gee, L., J. Hartig, L. Law, J. Wittlie, K. Khalturin, T. C. Bosch mas on axolotl forelimbs. Regeneration 1: 27–34.
and H. R. Bode. 2010. β-Catenin plays a central role in setting Sikes, J. M. and P. A. Newmark. 2013. Restoration of anterior
up the head organizer in hydra. Dev. Biol. 340: 116–124. regeneration in a planarian with limited regenerative ability.
Gupta, V. and K. D. Poss. 2012. Clonally dominant cardiomyo- Nature 500: 77–80.
cytes direct heart morphogenesis. Nature 484: 479–84. Taub, R. 2004. Liver regeneration: From myth to mechanism.
Hill, E. M. and C. P. Petersen. 2015. Wnt/Notum spatial feed- Nature Rev. Mol. Cell Biol. 5: 836–847.
back inhibition controls neoblast differentiation to regulate Umesono, Y. and 9 others. 2013. The molecular logic for planar-
reversible growth of the planarian brain. Development 142: ian regeneration along the anterior-posterior axis. Nature 500:
4217–4229. 73–76.
Kragl, M., D. Knapp, E. Nacu, S. Khattak, M. Maden, H. H. van Wolfswinkel, J. C., D. E. Wagner and P. W. Reddien.
Epperlein and E. M. Tanaka. 2009. Cells keep a memory of 2014. Single-cell analysis reveals functionally distinct classes
their tissue origin during axolotl limb regeneration. Nature 460: within the planarian stem cell compartment. Cell Stem Cell 15:
60–65. 326–339.
Kumar, A., J. W. Godwin, P. B. Gates, A. A. Garza-Garcia and Wagner, D. E., I. E. Wang and P. W. Reddien. 2011. Clonogenic
J. P. Brockes. 2007. Molecular basis for the nerve dependence of neoblasts are pluripotent adult stem cells that underlie planar-
limb regeneration in an adult vertebrate. Science 318: 772–777. ian regeneration. Science 332: 811e816.
Kumar, A., J. P. Delgado, P. B. Gates, G. Neville, A. Forge and J. Wagner, D. E., J. J. Ho and P. W. Reddien. 2012. Genetic regula-
P. Brockes. 2011. The aneurogenic limb identifies developmen- tors of a pluripotent adult stem cell system in planarians identi-
tal cell interactions underlying vertebrate limb regeneration. fied by RNAi and clonal analysis. Cell Stem Cell 10: 299–311.
Proc. Natl. Acad. Sci. USA 108: 13588–13593. Wehner, D. and 11 others. 2014. Wnt/β-catenin signaling
Li, Q., H. Yang and T. P. Zhong. 2015. Regeneration across defines organizing centers that orchestrate growth and dif-
metazoan phylogeny: Lessons from model organisms. J. Genet. ferentiation of the regenerating zebrafish caudal fin. Cell. Rep.
Genomics 42: 57–70. 6: 467–481.
Liu, S. Y. and 9 others. 2013. Reactivating head regrowth in a Wurtzel, O., L. E. Cote, A. Poirier, R. Satija, A. Regev and P.
regeneration-deficient planarian species. Nature 500: 81–84. W. Reddien. 2015. A generic and cell-type-specific wound
McCusker, C. D. and D. M. Gardiner. 2014. Understanding response precedes regeneration in planarians. Dev. Cell 35:
positional cues in salamander limb regeneration: Implications 632–645.
for optimizing cell-based regenerative therapies. Dis. Model Zhang, R. and 11 others. 2013. In vivo cardiac reprogram-
Mech. 7: 593–599. ming contributes to zebrafish heart regeneration. Nature 498:
497–501.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
23
The Punchline
There is no single hypothesis that explains aging and senescence. Mutations in genes
encoding DNA repair enzymes and factors regulating metabolic rates may be crucial
in aging, and the insulin signaling cascade (involving the interplay of metabolism and
diet) mediates between fertility and aging. In addition, random epigenetic changes in
DNA and chromatin can inactivate genes as one ages. New research suggests that
stem cells and their niches are critical for normal organismal function and that as
mutations and epigenetic changes accumulate, these stem cells may die or become
nonfunctional. As cells become senescent, they have been seen to secrete paracrine
factors that mimic inflammatory responses and suppress organ function.
724 Chapter 23
Genetic factors play roles in determining longevity both between and within species
(Wilson et al. 2007). Most people cannot expect to live 122 years. Life expectancy—the
average length of time a given individual of a given species can expect to live—is not
characteristic of species but of populations. It is sometimes defined as the age at which
half the population still survives. A baby born in England during the 1780s could expect
to live to be 35 years old. In Massachusetts during that same time, life expectancy was
28 years. These ages represent the normal range of human life expectancy for most
of the human race throughout recorded history (Arking 1998). Even today, in some
countries (Angola, Chad, Lesetho, and several others) life expectancy is only around
45 years. Males in the United States today have a life expectancy of about 76 years, and
females can expect to live around 81 years.1
Given that in most times and places people did not live much past the age of 40,
our awareness of human aging is relatively new. In 1900, 50% of Americans were dead
before the age of 60; a 70-year-old person was exceptional in 1900 but is commonplace
today. People in 1900 did not have the “luxury” of dying from heart attacks or can-
cers, because these conditions are most likely to affect people over 50. Rather, many
people died (as they are still dying in large parts of the world) from microbial and viral
infections. Until recently, relatively few people exhibited the general human senescent
phenotype: gray hair, sagging and wrinkling skin, arthritic joints, osteoporosis (loss
of bone calcium), loss of muscle fibers and muscular strength, memory loss, eyesight
deterioration, and slowed sexual responsiveness. As the melancholy Jacques notes in
Shakespeare’s As You Like It, those who did survive to senescence left the world “sans
teeth, sans eyes, sans taste, sans everything.”
Species-specific life spans appear to be determined by genes that effect a trade-off
between the energy used for early growth and reproduction (which results in somatic
damage) versus the energy allocated for maintenance and repair. In other words, aging
results from natural selection operating more strongly on early survival and repro-
duction than on having a vigorous postreproductive life. Molecular evidence indicates
that certain genetic components of longevity are conserved between species—flies,
worms, mammals, and even yeast all appear to use the same set of genes to promote
survival and longevity (see Vijg and Campisi 2008; Kenyon 2010). Four sets of genes
are well known to be involved in aging and its prevention, and each set appears to
be conserved between phyla and even kingdoms. These are the genes encoding (1)
DNA repair enzymes, (2) proteins of the insulin signaling pathway, (3) proteins in the
mTORC1 signaling pathway (a cascade that regulates translation), and (4) chromatin
remodeling enzymes.
(A) (B)
100
Human
Elephant
60
30
Cow
Life span (years)
10
6
Hamster
Rat
3
Mouse
Shrew
1
0 10 20 30 40 50
DNA repair (grains/nucleus) Figure 23.1 Life span and the aging
phenotype. (A) Correlation between life
span and the ability of fibroblasts to
repair DNA in various mammalian spe-
proteins, the cell may make an even greater number of faulty proteins (Orgel 1963; cies. Repair capacity is represented
Murray and Holliday 1981; Kamileri et al. 2012). in autoradiography by the number of
grains from radioactive thymidine per cell
nucleus. Note that the y axis (life span) is
reactive oxygen species Two major sources of mutation are radiation and reac-
logarithmic. (B) Hutchinson-Gilford pro-
tive oxygen species (ROS). The ROS produced by normal metabolism can oxidize and geria. Although they are not yet 8 years
damage cell membranes, proteins, and nucleic acids. Some 2–3% of the oxygen atoms old, these children have a phenotype
taken up by our mitochondria are reduced insufficiently and form ROS: superoxide similar to that of an aged person. The
ions, hydroxyl (“free”) radicals, and hydrogen peroxide. Evidence that ROS molecules hair loss, fat distribution, and skin trans-
are critical in the aging process includes observations that fruit flies and nematodes parency are characteristic of the normal
aging pattern as seen in elderly adults.
overexpressing the enzymes that destroy ROS (catalase and superoxide dismutase) live
The mutation causes an aberrant nuclear
significantly longer than do control animals (Orr and Sohal 1994; Parkes et al. 1998;
envelope protein that appears to prevent
Sun and Tower 1999; Feng et al. 2001). However, these correlations have not held up DNA repair (Coppedè and Migliore 2010).
in some other studies, so the genetic ability to destroy free oxygen radicals may not be (A after Hart and Setlow 1974; B © Asso-
essential for a long life (Pérez et al. 2009; van Raamsdonk and Hekimi 2012). ciated Press.)
telomerase and p53 The transcription factor p53 is one of the most important regu-
lators of cell division. This factor can stop the cell cycle, cause cellular senescence in
rapidly dividing cells, instruct genes to initiate cellular apoptosis, and activate DNA
repair enzymes. In most cells, p53 is bound to a repressor protein that keeps p53 inac-
tive. However, ultraviolet radiation, oxidative stress, and other factors that cause DNA
damage will separate p53 from its repressor, allowing it to function. The induction of
apoptosis or cellular senescence by p53 can be beneficial (when destroying cancer cells)
or deleterious (when destroying, say, neurons or stem cells).
One of the chief ways of activating p53 (and related proteins such as p63) is to damage
the telomeres, the protective nucleoprotein caps on the tips of the chromosomes (similar
Gilbert
to the way aglets on the tips of shoelaces keep them from unwinding). When p53 is acti-
Developmental Biology 11e, Sinauer Associates
vated by damaged telomeres, DNA replication halts, and if the repair doesn’t work, apop-
DevBio11e_23.01 Date 02-09-16
tosis is initiated. If the cell is a stem cell or some other rapidly replicating cell, this will
reduce the numbers of cells produced, and the lack of stem cells will produce an “aged”
phenotype. The relationship between shortened telomeres and stem cell depletion has
been seen in degenerative diseases such as mouse muscular dystrophy (Sacco et al. 2010).
There is a positive correlation between telomere length and longevity in humans
(Atzmon et al. 2010), and telomeres appear to shorten with age in the stem cell
726 Chapter 23
compartments of mice and humans (Zhang and Ju 2010). The enzyme complex that
maintains telomere integrity is telomerase, which acts as an antisenescence complex.
Mice and humans with telomerase deficiencies age prematurely (Mitchell et al. 1999).
Overexpressing telomerase or reactivating it in senescent cells extends longevity in mice
without increasing cancer (Tomás-Loba et al. 2008; Jaskelioff et al. 2011; Bernardes de
Jesus et al. 2012). However, except for the rare genetic telomere syndromes, telomere
length only gives a statistical probability of age; it does not predict the lifespan of an
individual (Blackburn et al. 2015).
(A) C. elegans (B) Mouse (C) Drosophila Figure 23.2 A possible pathway for
regulating longevity. In each case, the
insulin signaling pathway inhibits the
synthesis of the Foxo transcription factor
proteins that would otherwise increase
DAF-2 IGF-1R InR cellular longevity.
(insulin receptor) (insulin-like growth factor receptor) (insulin receptor)
Increased cellular
life span
Increased longevity
of the organism
signaling pathway does affect life span in mammals (Figure 23.2B). Dog breeds with
low levels of insulin-like growth factor 1 (IGF-1) live longer than breeds with higher
levels of this factor. Mice with loss-of-function mutations of the insulin signaling path-
way live longer than their wild-type littermates (see Partridge and Gems 2002; Blüher
et al. 2003; Kurosu et al. 2005). Holzenberger and colleagues (2003) found that mice
heterozygous for the insulin receptor IGF-1R not only lived about 30% longer than their
wild-type littermates, they also had greater resistance to oxidative stress. In addition,
mice lacking one copy of their IGF-1R gene lived about 25% longer than wild-type mice.
The insulin signaling pathway also appears to regulate life span in Drosophila (Fig-
ure 23.2C ). Flies with weak loss-of-function mutations of the insulin receptor gene
or genes in the insulin signaling pathway live nearly 85% longer than wild-type flies
(Clancy et al. 2001; Tatar et al. 2001). These long-lived mutants are sterile, and their
metabolism resembles that of flies that are in diapause (Kenyon 2001). The insulin
receptor in Drosophila is thought to regulate a Forkhead transcription factor (dFoxo)
similar to the Foxo/DAF-16 protein of C. elegans. When the Drosophila dFoxo gene is acti-
vated in the fat body, it can lengthen the fly’s life span (Giannakou et al. 2004; Hwang-
bo et al. 2004). From an evolutionary point of view, the insulin pathway may mediate
a trade-off between reproduction and survival/maintenance. Many (although not all)
of the long-lived mutants have reduced fertility. Thus, it is interesting that another
longevity signal originates in the gonad. When the germline cells are removed from C.
elegans, the worms live longer. The germline stem cells produce a substance that blocks
the effects of a longevity-inducing steroid hormone (Hsin and Kenyon 1999; Gerisch
et al. 2001; Shen et al. 2012).
Calorie restriction is another way of downregulating the insulin pathway (Kenyon
2001; Roth et al. 2002; Holzenberger et al. 2003). Calorie restriction may reduce levels
of IGF-1 (the main ligand of IGF-1R) and of circulating insulin, although other mecha-
nisms
Gilbertare also being explored (e.g., Selman et al. 2009). Studies in primates (including
Developmental
humans) haveBiology 11e, Sinauerthat
not concluded Associates
low calorie intake extends their longevity, although
DevBio11e_23.02
it does appear to retardDatethe
02-11-16
age-associated decline of heartbeat variability and motor
coordination (see Colman et al. 2009; Mattison et al. 2012; Stein et al. 2012).
728 Chapter 23
Chromatin modification
Chromatin modification may be very important in aging. The sirtuin genes, which
encode histone deacetylation (chromatin-silencing) enzymes, have been found to
prevent aging throughout the eukaryotic kingdoms, including in yeasts and mam-
mals (Howitz et al. 2003; Oberdoerffer et al. 2008). Sirtuins prevent genes from being
expressed at the wrong times and places, and they help repair chromatin breaks. When
DNA strands break (as inevitably happens as the body ages), sirtuin proteins are called
on to fix them and cannot attend to their usual functions. Thus, genes that are usually
silenced become active as the cells age.
Alternatively, there are other areas of the body, such as the brain, where histone
deacetylases can generate an aging phenotype. Cognitive decline, especially in the ability
to recall past experiences, is a normal part of the mammalian aging syndrome. Long-term
memories are stabilized by chromatin remodeling in the hippocampus and frontal lobes
of the brain, a process involving DNA methylation and histone modifications (Swank et
al. 2001; Korzus 2004; Miller et al. 2008; Penner et al. 2011). Peleg and colleagues (2010)
have shown that the normal transcription associated with long-term memory stabiliza-
tion is disrupted as mice age, and that this lack of transcription is associated with lessened
H4K12 acetylation. Indeed, this ability to store memory can be retrieved by infusing into
the hippocampus an inhibitor of histone deacetylase (Figure 23.3).
3 3
Figure 23.3 Age-related memory
60
Gene expression (arbitrary units)
H4K12 level (arbitrary units)
20
gressively more methylated. Cells removed from early
embryos have hardly any methylation at these sites,
while cells taken from centenarians are heavily methyl-
ated. Using cells from a person’s saliva, Horvath’s analy- 10
sis of DNA methylation allows prediction of a person’s
age to within 2 years (Figure 23.6). Moreover, Hannum
Gilbert 00
and colleagues (2013) showed that tumors of breast, kid- 0 Developmental Biology 11e, Sinauer Associates
ney, and lung tissues had more heavily methylated DNA AA DevBio11e_23.04
CCA FA AA
Date 06-03-16 CCA FA
than surrounding nontumor tissues, causing them to Males Females
appear about 40% “older” than the patients from whom Figure 23.5 Methylation of the estrogen receptor gene in atheroscle-
they were removed. This could be due to the methyla- rotic plaques and adjacent nonplaque blood vessel tissue in the ascend-
tion of a gene involved with the chromatin remodeling ing aorta (AA), common carotid artery (CCA), and femoral artery (FA).
processes. (After Kim et al. 2007.)
730 Chapter 23
Chronological age
Chronological age
80
45
40 60
35 40
30 20
25
0
20 0 20 40 60 80 100
20 30 40 50 60 DNA methylation age
DNA methylation age
(A) (C)
Young plasma injection
Old plasma injection
4
Young blood Old blood **
plasma plasma
Number of errors
3
**
(B) **
2
0
1 2 3 4 5 6 7 8 9 10
Day 1 Day 2
training training
Blocks
Young plasma injected Old plasma injected
Figure 23.7 Factors in plasma (the liquid portion of blood) of old mice alter the develop-
ment of new neurons and behaviors in young mice. (A) Protocol whereby plasma from young
mice is injected into other young mice (left), or plasma from old mice is injected into young mice
(right). (B) Young mice receiving young plasma continue to manufacture new neurons (dark
stain), whereas the number of new neurons decreases in young mice injected with old plasma.
(C) In training to do a particular task, mice receiving young or old plasma initially had the same
number of errors. One day later, mice that received young plasma remembered their former
mistakes and made fewer errors than mice that received old plasma. (After Villeda et al. 2011.)
into older mice increased brain capillary production, neuron formation, and olfactory
Developing Questions
discrimination (Figure 23.8; Katsimpardi et al. 2014; Poggioli et al. 2015).
Since the stem cells are not transfused from one animal to the other, it appears that How might induced
pluripotent stem cells (iPSCs)
GDF11 helps the function of the stem cell niche. It is not yet known whether GDF11 (or
link aging, regeneration,
young blood plasma in general) extends the lifespan or improves the health of mice or and development?
humans (see Scudellari 2015). There is also the danger that, when working with stem
cells, there is a fine balance between underproliferation (leading to aging) and over-
proliferation (leading to cancer).
WEb Topic 23.1 Cellular senescence and aging There (A) Capillaries
may be a cell state state opposite that of the stem cell. “Senescent Control GDF11-treated
cells” produce paracrine factors that appear to cause many of the
symptoms of aging.
Gilbert
Developmental Biology 11e, Sinauer Associates
732 Chapter 23
PLA
Figure 23.9 Life cycle of Turritopsis NK
TO
dohrnii and Hydractinia carnea. In the nor- NI
C
mal life cycle of cnidarians, the colonies of B
TH
polyps bud off medusa (jellyfish) into the W
U
RO
D
DI
sea water. After a period of planktonic life,
NG
the mature medusa release their gametes. Polyp stages
NY
LO
Fertilization occurs and the mature medusa
CO
dies. The embryo forms a larva (planula),
which then transforms itself into a ball-like
stage from which a new polyp emerges. Polyp
In T. dohrnii and H. carnea, the medusa
formation
can dedifferentiate into a ball-like stage, REVERSE
which can generate a polyp and start the DEVELOPMENT
life cycle again (“reverse development”; red Primary
arrows). (After Schmich et al. 2007.) polyp
Stolons
Medusa
ti o n
D i f f e re n t a
Ball-like
Ball-like stage
stage
Gametes Medusa
Planula dies after
ET
M
AM larva spawning
OR
PH
OSI
S
they don’t seem to undergo a typical aging syndrome. Turtles seem to have “negligible
senescence,” in that their mortality rate does not increase with age, nor does their
reproductive rate decrease with age. In these species, older females lay as many eggs (if
not more) as their younger counterparts. Miller (2001) showed that a 60-year-old female
three-toed box turtle (Terrapene carolina triunguis) lays as many eggs annually as she
ever did. If turtle telomeres shorten with age, it happens (like so many turtle things)
extremely slowly (Girondot and Garcia 1998; Hatase et al. 2008). Interestingly, turtles
have special adaptations against oxygen deprivation, and these enzymes also protect
against ROS (Congdon et al. 2003; Lutz et al. 2003; Krivoruchko and Storey 2010).
In monarch butterflies (Danaus plexippus), adults that migrate to wintering grounds
in the mountains of central Mexico live several months (August–March), whereas their
summer counterparts live only about 2 months (May–July). The regulation of this dif-
ference appears to be juvenile hormone (JH; Herman and Tatar 2001). The migrating
butterflies are sterile because of suppressed synthesis of JH. If migrants are given JH
in the laboratory, they regain fertility but lose their longevity. Conversely, when sum-
mer monarchs have their corpora allata removed so they can no longer make JH (see
Chapter 21), their longevity increases 100%. Mutations in the insulin signaling pathway
of Drosophila likewise decrease JH synthesis (Tu et al. 2005). This decrease in JH makes
the flies small, sterile, and long-lived, adding to whatever longevity-producing effect
protection against ROS might have.
Finally, there may be organisms, especially among the cnidarians, that can actually
cheat death. As we saw in Chapter 22, hydra appear to be immortal, retaining their
stem cell populations. The hydrozoans Turritopsis dohrnii and Hydractinia carnea are two
cnidarian species known to have evolved a remarkable variation on this theme. These
organisms have both a polyp stage (similar to the hydra) and a medusa (“jellyfish”)
stage in their life cycle. In most hydrozoan species, the polyp stage gives rise the sexual
medusa stage.Biology
Developmental The medusae
11e then produce gametes that spawn the next generation
Fig. 23.09
Dragonfly Media Group
02/23/16
Aging and Senescence 733
and, like most adults, they senesce and die. However, the medusae of T. dohrnii and
H. carnea can revert to the polyp stage after becoming sexually mature (Bavestrello et
al. 1992; Piraino et al. 1996), a feat called reverse development (Schmich et al. 2007).
The multilayered medusa essentially dedifferentiates to become a two-layered ball-like
stage similar to that of a larva before becoming a polyp, and then develops into a polyp
itself (Figure 23.9).
24 Snapshot Summary
Aging and Senescence
1. The maximum life span of a species is the longest time 5. An insulin signaling pathway, involving a receptor for
an individual of that species has been observed to sur- insulin and insulin-like proteins, may be an important
vive. Life expectancy is usually defined as the age at component of genetically limited life spans. It may
which approximately 50% of the members of a given upregulate mTORC1 and downregulate Foxo transcrip-
population still survive. tion factors.
2. Aging is the time-related deterioration of the physiologi- 6. Random DNA methylation appears to repress gene
cal functions necessary for survival and reproduction. expression as a cell ages. Enzymes involved with chro-
The phenotypic changes of senescence (which affect all matin modification may be important mediators of such
members of a species) are not to be confused with dis- aging events.
eases of senescence, such as cancer and heart disease 7. In many cases, the aging phenotype is the result of
(which affect some individuals but not others). apoptosis of stem cells or progenitor cells.
3. Reactive oxygen species (ROS) can damage cell mem- 8. A few animal species (such as turtles) display “negligible
branes, inactivate proteins, and mutate DNA. Muta- senescence” in that their mortality rates do not increase
tions that alter the ability to make or degrade ROS can nor do reproductive rates decrease with age. Some cni-
change the life span. darian species appear to be potentially immortal.
4. Proteins that regulate DNA repair and cell division (such
as p53 and telomerase) may be important regulators of
aging.
734 Chapter 23
Further Reading
Blackburn, E. H., E. S. Epel and J. Lin. 2015. Human telomere Johnson, S. C., P. S. Rabinovitch and M. Kaeberlein. 2013.
biology: A contributory and interactive factor in aging, dis- mTOR is a key modulator of ageing and age-related disease.
ease risks, and protection. Science 350: 1193–1198. (Note: The Nature 493: 338–345.
December 4, 2015, issue of Science focuses on aging and con- Kenyon, C. J. 2010. The genetics of ageing. Nature 464: 504–512.
tains several relevant articles.)
Underwood, E. 2015. The final countdown. Science 350:
Fraga, M. F. and 20 others. 2005. Epigenetic differences arise 1188–1190.
during the lifetime of monozygotic twins. Proc. Natl. Acad. Sci.
USA 102: 10604–10609.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
24
Development in
Health and Disease
Birth Defects, Endocrine Disruptors,
and Cancer
The Punchline
Development sometimes (even often) goes wrong. Genetic and chromosomal
mutations can delete genes, destroy gene function, or render genes or proteins active
in the wrong times or places, all of which may lead to congenital anomalies (birth
defects). Teratogens are chemicals in the environment (such as alcohol and retinoic
acid) that can prevent particular genes or proteins from functioning or can activate
processes at the wrong places and times. Endocrine disruptors are environmental
chemicals (such as BPA and DES) that activate or suppress hormone function, thus
altering normal development. Cancer can result when developmental pathways are
either reactivated or suppressed in the adult, leading to abnormal cell proliferation. Like
birth defects, cancers can be caused by genetic alterations, environmental agents or
chance circumstances.
736 Chapter 24
3. Stochastic (random) events. Chance plays a role in determining the phenotype, and
some developmental anomalies are just “bad luck” (Molenaar et al. 1993; Holliday
2005; Smith 2011).
Most of this chapter will deal with genetic and environmental effects.1 We will start,
however, by briefly examining the role of random events.
(A) Mosaic pleiotropy (B) Relational pleiotropy Figure 24.1 Mosaic and relational pleiotropy.
(A) In mosaic pleiotropy, a gene is independently
Gene A Gene A expressed in several tissues. Each tissue needs
the gene product and develops abnormally in its
absence. (B) In relational pleiotropy, a gene prod-
uct is needed by only one particular tissue. How-
ever, a second tissue needs a signal from the first
tissue in order to develop properly. If the first tissue
develops abnormally, the signal is not given, so the
second tissue also develops abnormally.
event (such as an aneuploidy) in which several genes are deleted or added, or (2) pleiot-
ropy—the production of several effects by a single gene or pair of genes (see Grüneberg
1938; Hadorn 1955). Syndromes are said to have mosaic pleiotropy when the effects
are produced independently as a result of the gene being critical in different parts of
the body (Figure 24.1A). For instance, the KIT gene is expressed in blood stem cells,
pigment stem cells, and germ stem cells, where it is needed for their proliferation. When
this gene is defective, the resulting syndrome of anemia (lack of red blood cells), albi-
nism (lack of pigment cells), and sterility (lack of germ cells) is evidence of mosaic
pleiotropy. Syndromes are said to have relational pleiotropy when a defective gene
in one part of the embryo causes a defect in another part, even though the gene is not
expressed in the second tissue (Figure 24.1B). For example, failure of MITF expression
in the pigmented retina prevents this structure from fully differentiating. This failure
of pigmented retina growth in turn causes a malformation of the choroid fissure of
the eye, resulting in the drainage of vitreous humor. Without this fluid, the eye fails
to enlarge (hence microphthalmia, “small eye”). The lenses and corneas are therefore
smaller, even though they themselves do not express MITF.
Mosaic syndromes can be the result of aneuploidies —errors in the number of par-
ticular chromosomes. Even an extra copy of the tiny chromosome 21 disrupts numer-
ous developmental functions. This trisomy 21 causes a set of anomalies—among them
facial muscle changes, heart and gut abnormalities, and cognitive problems—collec-
tively known as Down syndrome (Figure 24.2). Certain genes on chromosome 21 are
thought to encode transcription factors and regulatory microRNAs, and the extra copy
of chromosome 21 probably causes an overproduction of these regulatory proteins.
Gilbert
Such overproduction results in the misregulation of genes necessary for heart, muscle,
Developmental Biology 11e, Sinauer Associates
and nerve formation (Chang
DevBio11e_24.01
and Min 2009; Korbel et al. 2009). One such regulatory
Date 02-01-16
(A) (B)
Figure 24.2 Down syndrome. (A) Down syndrome, caused by a third copy of chromo-
some 21, is characterized by a particular facial pattern, cognitive deficiencies, the absence
of a nasal bone, and often heart and gastrointestinal defects. (B) The procedure shown here
tests for chromosome number using fluorescently labeled probes that bind to DNA on chro-
mosomes 21 (pink) and 13 (blue). This person has Down syndrome (trisomy 21) but has the
normal two copies of chromosome 13. (A © MoodBoard/Alamy; B courtesy of Vysis, Inc.)
738 Chapter 24
WEb Topic 24.1 Preimplantation genetics The ability to identify allelic variants in
a single cell has enabled medical professionals to determine whether an embryo carries
deleterious genes. It also enables people to determine the embryo’s sex, allowing a par-
ent to implant into the uterus only embryos of the desired sex.
Exogenous agents that cause birth defects are called teratogens (Table 24.1). Most
teratogens produce their effects during certain critical timeframes. Human development
is usually divided into an embryonic period (to the end of week 8) and a fetal period
(the remaining time in utero). Most organ systems form during the embryonic period;
the fetal period is generally one of growth and modeling. Thus, maximum fetal sus-
ceptibility to teratogens is between weeks 3 and 8 (Figure 24.3). The nervous system,
however, is constantly forming and remains susceptible throughout development. Prior
to week 3, exposure does not usually produce congenital anomalies because a teratogen
encountered at this time either damages most or all of the cells of an embryo, resulting
in its death, or it kills only a few cells, allowing the embryo to fully recover.
The largest class of teratogens includes drugs and chemicals. Viruses, radiation,
high body temperature, and metabolic conditions in the mother can also act as terato-
gens. Some chemicals found naturally in the environment can cause birth defects. For
example, jervine and cyclopamine are products of the plant Veratrum californicum that
block Sonic hedgehog signaling and lead to cyclopia (see Figure 4.31B). Nicotine, a
natural product concentrated in tobacco smoke, is associated with impaired lung and
brain development (Dwyer et al. 2008; Maritz and Harding 2011). Some viruses can
cause congenital anomalies. The mosquito-borne Zika virus has been implicated in
microcephaly, a birth defect characterized by small brains and heads (CDC 2016; Mla-
kar et al. 2016). Evidence indicates that, in pregnant women, Zika virus directly infects
the neural progenitor cells of the fetal cortex, resulting in the death of these cells, which
could result in the smaller brain and head of the newborn (Tang et al. 2016).
740 Chapter 24
Heart
Upper limbs
Eyes
Lower limbs
Teeth
Palate
External genitalia
Ear
SCIENTISTS SPEAK 24.2 Dr. Daniel Gorelick discusses using transgenic zebrafish
as organisms to detect BPA and other developmentally disruptive compounds in
water.
Alcohol as a teratogen
In terms of the frequency of its effects and its cost to society, the most devastating
teratogen is undoubtedly alcohol (ethanol). Babies born with fetal alcohol syndrome Figure 24.5 Effects of alcohol on fetal
(FAS) are characterized by small head size, an indistinct philtrum (the pair of ridges brains. (A,B) Comparison of a brain from
an infant with fetal alcohol syndrome (A)
that runs between the nose and mouth above the center of the upper lip), a narrow ver-
with a brain from a normal infant of the
million border on the upper lip, and a low nose bridge (Lemoine et al. 1968; Jones and
same age (B). The brain from the infant
Smith 1973). The brains of such children may be dramatically smaller than normal and with FAS is smaller, and the pattern of
often show poor development, the results of deficiencies of neuronal and glial migra- convolutions is obscured by glial cells
tion ( Figure 24.5A,B ; Clarren 1986). FAS is the most prevalent type of congenital that have migrated over the top of the
mental retardation syndrome, occurring in approximately 1 out of every 650 children brain. (C,D) Regionally specific abnor-
born in the United States (May and Gossage 2001). Although the IQs of children with malities of the corpus callosum seen by
diffusion tensor imaging of myelinated
FAS vary substantially, the mean is about 68 (Streissguth and LaDue 1987). Most adults
neurons. The difference in fiber tracks
and adolescents with FAS cannot handle money and have difficulty learning from past
in a child with FASD (C) compared with
experiences (see Dorris 1989; Kulp and Kulp 2000). those of a same-age unaffected child (D)
Fetal alcohol syndrome represents only a portion of a range of defects caused by suggests that there are significant abnor-
prenatal alcohol exposure. The term fetal alcohol spectrum disorder (FASD) has been malities in neurons that would normally
coined to encompass all of the alcohol-induced malformations and functional deficits project through the posterior regions of
that occur. In many FASD children, behavioral abnormalities exist without any gross the brain into the cortex of the parietal
and temporal lobes. (A,B courtesy of S.
physical changes in head size or notable reductions in IQ (NCBDD 2009). However,
Clarren; C,D from Wozniak and Muetzel
2011, courtesy of the authors.)
(A) (C)
(B) (D)
742 Chapter 24
recent techniques that can identify neural tracts in the brain have found subtle abnor-
malities that correlate with altered mental processing speed and executive functioning
(such as planning, memorizing, and retaining information) (Figure 24.5C,D; Wozniak
and Muetzel 2011).
As with other teratogens, the amount and timing of fetal exposure to alcohol, as well
as the genetic background of the fetus, contribute to the developmental outcome. Vari-
ability in the mother’s ability to metabolize alcohol also may account for some outcome
differences (Warren and Li 2005). While FASD is most strongly associated with high
levels of alcohol consumption, the results of animal studies suggest that even a single
episode of consuming the equivalent of two alcoholic drinks during pregnancy may
lead to loss of fetal brain cells. (“One drink” is defined as 12 oz. of beer, 5 oz. of wine, or
1.5 oz. of hard liquor.) It is important to note that alcohol can cause permanent damage
to a fetus at a time before most women even realize they are pregnant.
how alcohol affects development: lessons from the mouse When mice are
exposed to alcohol at the time of gastrulation, ethanol induces defects of the face and
brain that are comparable to those in humans with FAS ( Figure 24.6 ; Sulik 2005).
As in human fetuses, the nose and upper lip of the ethanol-exposed pups are poorly
developed, and nervous system problems involve failure to close the neural tube and
incomplete development of the forebrain (see Chapters 13 and 14). This mouse model
of FAS can be used to study the ways by which ethanol causes its effects on the embryo.
It appears that ethanol works on several processes, and can interfere with cell migra-
tion, proliferation, adhesion, and survival. Hoffman and Kulyk (1999) showed that
Normal Alcohol-exposed
instead of migrating and dividing, neural crest cells of alcohol-exposed fetuses prema-
turely initiate their differentiation into facial cartilage. Among the numerous genes that
are misregulated following maternal alcohol exposure in mice are several involved in
the cytoskeletal reorganization that enables cell movement (Green et al. 2007). In addi-
tion, cell death is apparent shortly after alcohol exposure. In later-stage mouse embryos
exposed to ethanol, the death of neural crest-derived cells is seen as early as 12 hours
following the exposure. When the time of alcohol exposure corresponds to the third
and fourth weeks of human development, cells that should form the median portion
of the forebrain, upper midface, and cranial nerves are killed. This has been confirmed
in early chick embryos, where transient ethanol exposure at environmentally relevant
doses (about 25 mM) decimates migrating cranial neural crest cells, causing cell death
throughout the head region (Flentke et al. 2011).
One reason for this cell death in mouse embryos is that alcohol treatment results
in the generation of superoxide radicals that can damage cell membranes ( Figure
24.7A–C; Davis et al. 1990; Kotch et al. 1995; Sulik 2005). In model systems, antioxi-
dants have been effective in reducing both the cell death and the malformations caused
by alcohol (Chen et al. 2004).
Abnormal signaling may also underlie excessive cell death. In alcohol-exposed
embryos, expression of Sonic hedgehog (which is important in establishing the facial
(D)
0 mM 5 mM 25 mM
75
Percent adherent cells
Scientists speak 24.3 Dr. Kathy Sulik discusses the biological bases of fetal
alcohol syndrome.
Br
Figure 24.8 Glyphosate herbicide teratogenicity. (A) Xenopus tadpole raised under control
conditions, stained with Alcian blue to show facial cartilages. Br, branchial; Ce, ceratohyal; I,
infrarostral; Me, Meckel; Qu, quadrate. (B) Xenopus tadpole raised in environmentally relevant
concentrations of glyphosate and similarly stained. Its branchial arches and midline facial car-
tilage (cranial neural crest derivatives) failed to develop properly. (C) If an embryo is injected
such that only one side (arrow) is exposed to glyphosate, that side shows cranial neural crest
anomalies. (D) Control chick embryos show sonic hedgehog gene expression in the notochord
(black arrow) and prechordal mesoderm (red arrow). Chick embryos grown in glyphosate show
a severe reduction of sonic hedgehog expression in the prechordal (craniofacial) mesoderm.
(Photographs courtesy of A. Carrasco.)
the activity of endogenous RA (Paganelli et al. 2010). When Xenopus embryos were
Developing Questions
incubated in solutions containing ecologically relevant concentrations of these herbi-
cides, RA-responsive reporter gene activation was dramatically altered, and the embry- In the northern United
States, certain ponds
os exhibited cranial neural crest defects and facial disorders similar to those seen in
contain a high proportion
RA teratogenesis (Figure 24.8). Glyphosate is the most widely used (and profitable) of frogs that have six or
herbicide in North America, where over 180 tons of it have been applied. It acts by more limbs. What are the
blocking a plant enzyme that is critical for the synthesis of certain amino acids. One of possible causes of these
the powerful abilities of genetic engineering has been to manufacture wide-spectrum malformations?
herbicides such as Roundup and then breed crop plants that are resistant to this herbi-
cide. This means that if you spray a large area, all the weeds will be killed and the only
plants remaining will be those that are glyphosate-resistant. In 2010, 70% of the corn
and 93% of the soybeans grown in the United States were from genetically modified
herbicide-resistant seeds (Hamer 2010).
Gilbert
WEb Topic 24.3
Developmental The
Biology , Sinauer Associates origins of adult human disease Can
11edevelopmental
food be consideredDate
DevBio11e_24.08 a teratogen?
02-01-16 In certain instances, the foods a mammal eats during
pregnancy may activate certain genes in the fetus that can either help or predispose it to
certain illnesses later in life.
746 Chapter 24
Endocrine Disruptors:
The Embryonic Origins of Adult Disease
A specialized area of teratogenesis involves the misregulation of the endocrine system
during development. Endocrine disruptors are exogenous (coming from outside the
body) chemicals that disrupt development by interfering with the normal functions of
hormones (Colborn et al. 1993, 1997). The phenotypic changes produced by endocrine
disruptors are not the obvious anatomical birth defects produced by classic teratogens.
Rather, the anatomical alterations induced by endocrine disruptors are often seen only
microscopically; the major changes are physiological. These functional changes are
more subtle than those produced by other teratogens, but they can be extremely impor-
tant phenotypic alterations. Their effects often manifest later in adult life and may
persist for generations after exposure to the disruptor.
Endocrine disruptors can interfere with hormone function in many ways:
• They can mimic the effect of a natural hormone. A paradigmatic example is
the endocrine disruptor diethylstilbestrol (DES), which binds to the estrogen
receptor and mimics estradiol, a hormone that is very active in building the
tissues of the female reproductive tract.
• They can act as antagonists and inhibit the binding of a hormone to its recep-
tor or block the synthesis of a hormone. DDE, a metabolic product of the
insecticide DDT, can act as an anti-testosterone, binding to the androgen
receptor and preventing normal testosterone from functioning properly.
• They can affect the synthesis, elimination, or transportation of a hormone in
the body. The herbicide atrazine, for example, elevates the synthesis of estro-
gen and can convert testes into ovaries in frogs. One of the ways that poly-
chlorinated biphenyls (PCBs) disrupt the endocrine system is by interfering
with the elimination and degradation of thyroid hormones.
• Some endocrine disruptors can “prime” the organism to be more sensitive
to hormones later in life. As we will see, bisphenol A exposure during fetal
development makes breast tissue more responsive to steroid hormones during
puberty.
It was long thought that there were only a few teratogenic agents, and that the only
ones in danger were the fetuses of women who were inadvertently exposed to high
doses of these chemicals during pregnancy. We now recognize that endocrine disrup-
tors are everywhere in our technological society (including rural areas, where pesticides
and herbicides are abundant), and that low-dose exposure to endocrine disruptors can
be sufficient to produce significant disabilities later in life. Endocrine disruptors include
chemicals in the materials that line baby bottles and the brightly colored plastic con-
tainers from which we drink our water; chemicals used in cosmetics, sunblocks, and
hair dyes; and chemicals that prevent clothing from being highly flammable. As expect-
ed when so many chemicals are involved, we are exposed to not just one but to multiple
endocrine disruptors, simultaneously and continuously. And, in another important dif-
ference between endocrine disruptors and classic teratogens, more damage may be
done by a “moderate” dose of endocrine disruptor than by higher doses, since higher
concentrations may activate negative feedback processes that detoxify or eliminate the
chemical (see Myers et al. 2009; Belcher et al. 2012; Vandenberg et al. 2012).
There are numerous endocrine disruptors, including diethylstilbestrol, bisphenol
A, phthalates, and tributyltin. Other compounds having endocrine-disrupting capa-
bilities include the herbicide atrazine, and compounds released as a result of hydraulic
fracturing (“fracking”) (see Gilbert and Epel 2015; Kabir et al. 2015). We encounter
many of these substances on a daily basis and we are exposed to them prenatally. The
developmental effects of this level of exposure are just beginning to be studied (Wild
2005; Rappaport and Smith 2010).
Development in Health and Disease 747
WEb Topic 24.4 DDT as an endocrine disruptor DDT was first found to be
damaging to the development of birds. Since then it has been implicated in disrupting
human development as well.
Diethylstilbestrol (DES)
One of the first endocrine disruptors to be identified was the potent environmental
estrogen diethylstilbestrol, or DES. This drug was thought to ease pregnancy and pre-
vent miscarriages, and it is estimated that in the United States more than 1 million
pregnant women and their fetuses were exposed to DES between 1947 and 1971. (This
is probably a small fraction of exposures worldwide.) Although research from the 1950s
showed that in fact DES had no beneficial effects on pregnancy, it continued to be pre-
scribed until the FDA banned it in 1971. The ban was imposed when a specific type of
tumor (clear-cell adenocarcinoma) was discovered in the reproductive tracts of some of
the women whose mothers took DES during pregnancy (Figure 24.9).
DES interferes with sexual and gonadal development by causing cell type changes
in the female reproductive tract (the derivatives of the Müllerian duct, which forms the
upper portion of the vagina, cervix, uterus, and oviducts; see Figure 6.1). In many cases,
DES causes the boundary between the oviduct and the uterus (the uterotubal junction) to
be lost, resulting in infertility, low fertility, and a high risk for other reproductive health
problems (Robboy et al. 1982; Newbold et al. 1983; Hoover et al. 2011).
Symptoms similar to human DES syndrome occur in mice exposed to DES in utero,
allowing the mechanisms of this endocrine disruptor to be uncovered. Normally, the
regions of the female reproductive tract are specified by the Hoxa genes, which are
expressed in a nested fashion throughout the Müllerian duct ( Figure 24.10 ). Ma
Normal Oviduct
(Fallopian
tube)
DES-exposed
Cervix
Vagina
T-shaped,
constricted uterus
of plastics were estrogenic compounds, and that they were present in doses large enough
to have profound effects on human sexual development (vom Saal et al. 2007). The most
important of these compounds is bisphenol A.
Bisphenol A (BPA)
In the early years of hormone research, the steroid hormones were very difficult to iso-
late, so chemists manufactured synthetic analogues that would accomplish the same
tasks. Bisphenol A, one of these analogues, was first synthesized as an estrogenic com-
pound in the 1930s. Later, polymer chemists realized that BPA could be used in plas-
tic production, and today it is one of the top 50 chemicals produced worldwide. Four
corporations in the United States make almost 2 billion pounds of it each year for use
in the resin lining most cans, as well as the polycarbonate plastic in baby bottles, chil-
dren’s toys, and water bottles. It is also used in dental sealant and (strange as it sounds)
in cash register receipts. In its modified form, tetrabromo-bisphenol A, it is the major
flame retardant on fabrics.
Human exposure comes primarily from BPA that has leached from food containers
(von Goetz et al. 2010). Babies and infants acquire BPA through polycarbonate bottles;
Gilbert
teenagers and
Developmental adults
Biology 11eget mostAssociates
, Sinauer of their BPA by consuming canned food that has been
stored in containers
DevBio11e_24.12 Date 02-09-16BPA-containing resins. Since 95% of urine samples
lined with
taken from people in the U.S. and Japan have measurable BPA levels (Calafat et al.
2005), public health concerns have been raised over the roles BPA might play in causing
reproductive failure, cancer, and behavioral anomalies.
WEb Topic 24.6 BPA and altered behavior Fetal exposure of mice to BPA leads
to changes in behavior. In humans, prenatal BPA exposure has been associated with
aggression and hyperactivity.
bpa and reproductive health BPA does not remain fixed in plastic forever (Krish-
nan et al. 1993; vom Saal 2000; Howdeshell et al. 2003). If you let water sit in an old
polycarbonate rat cage at room temperature for a week, you can measure about 300 μg
per liter of BPA in the water. That is a biologically active amount—a concentration that
will reverse the sex of a male frog and cause weight changes in the uterus of a young
mouse. It also can cause chromosome anomalies. When a laboratory technician mis-
takenly rinsed some polycarbonate cages in an alkaline detergent, BPA was released
750 Chapter 24
from the plastic and the female mice housed in the cages showed meiotic abnormalities
in 40% of their oocytes (the normal level of such abnormalities is about 1.5%). When
BPA was administered to pregnant mice under controlled circumstances, Hunt and her
colleagues (2003) showed that short, low-dose exposure to BPA was sufficient to cause
meiotic defects in maturing mouse oocytes (Figure 24.13). This effect was also seen in
primates. Exposure of fetal female monkeys to low doses of BPA (at levels comparable to
that found in human serum) caused ovarian and meiotic abnormalities similar to those
observed in mice. There were several abnormalities of ovarian function, including abnor-
mal meiotic chromosome behavior and aberrant follicle formation (Hunt et al. 2012).
BPA crosses the human placenta and accumulates in concentrations that can
alter development in laboratory animals (Ikezuki et al. 2002; Schönfelder et al. 2002).
Indeed, women exposed to high levels of BPA during pregnancy had an 83% higher
rate of miscarriages than women who had not been so heavily exposed (Lathi et al.
2014). In model organisms, BPA at environmentally relevant concentrations can cause
abnormalities in fetal gonads, prostate enlargement, low sperm counts, and behavioral
changes when these fetuses become adults (vom Saal et al. 1998, 2005; Palanza et al.
2002; Kubo et al. 2003). When vom Saal and colleagues (1997) gave pregnant mice 2
parts per billion BPA—that is, 2 nanograms per gram of body weight—for the 7 days at
the end of pregnancy (equivalent to the period when human reproductive organs are
developing), male offspring showed an increase in prostate size of about 30% (Wetherill
2002; Timms et al. 2005). Female mice exposed to low doses of BPA in utero had reduced
fertility and fecundity as adults (Cabaton et al. 2007).
This lower fertility may be the result of several actions in addition to the above-
mentioned effects on developing eggs. First, BPA and other endocrine disruptors are
found to prevent the sex-specific maturation of those parts of the mouse brain regu-
lating ovulation (Ruben et al. 2006; Gore et al. 2011). Second, female mice exposed in
utero to low doses of BPA (2000 times lower than the dosage considered safe by the U.S.
government) had alterations in the organization of their uterus, vagina, breast tissue,
and ovaries, as well as altered estrous cycles as adults (Howdeshell et al. 1999, 2000;
Markey et al. 2003). And third, BPA alters the gamete-specific methylation pattern of
imprinted genes in mouse embryos and placentas (Susiarjo et al. 2013).
WEb Topic 24.7 Testicular dysgenesis The amount of sperm produced by human
males appears to have declined rapidly during the past 50 years. There is evidence that
estrogen-enhancing endocrine disruptors are causing this decline.
bpa and cancer susceptibility BPA appears to make breast tissue more sensitive
to estrogens, and it is thought that in utero exposure to BPA may predispose women to
breast cancer later in life. Fetal exposure to BPA caused the development of early-stage
cancer in the mammary glands of one-third of the rats exposed to environmentally
relevant doses of BPA later in life (Murray et al. 2006). None of the control rats devel-
oped such cancers. Furthermore, daily gestational exposure to as little as 25 ng BPA per
kilogram of body weight, followed at puberty by a “subcarcinogenic dose” of a chemical
carcinogen, resulted in the formation of tumors only in those animals exposed to BPA
(Durando et al. 2006). Indeed, altered mammary development had already manifested
during fetal life in BPA-exposed mice, and at puberty, the mammary glands produced
more terminal buds and were more sensitive to estrogen, which may have predisposed
these mice toward breast cancer as adults (Muñoz-de-Toro et al. 2005). Moreover, expo-
sure of female monkey fetuses to low doses of BPA (at levels comparable to those found
in human blood serum) caused changes in mammary development similar to those
seen in BPA-exposed mice (Figure 24.14). In the above experiments, BPA was shown
to be a factor that predisposed the rats to develop a cancer when they encountered
estrogenic chemicals later in life. However, new studies with a different strain of rats
have shown that when rat embryos are exposed to relatively small doses of BPA (lev-
els considered safe by the EPA), they can develop palpable postnatal tumors without
Development in Health and Disease 751
10
0
0 2.5 25 250 1000
BPA dose (µg/kg/day)
Scientists speak 24.5 Dr. Frederick vom Saal discusses the endocrine disrup-
tive effects of BPA and the problems of regulating this compound.
Testosterone (ng/ml)
3
Scientists Speak 24.6 Dr. Tyrone Hayes describes his studies documenting
that a leading herbicide turns male frogs into females and is associated with geni-
tal abnormalities and cancers in humans.
50% of the fluid used in fracking returns to the surface (DOE 2009). Water samples
taken from both standing water and groundwater at fracking sites contained estro-
genic compounds, antiestrogenic compounds, and antiandrogenic (antitestosterone)
compounds (Kassotis et al. 2014; Webb et al. 2014). Some compounds in the water
activated enhancers of estrogen-responsive genes and others prevented the activation
of testosterone-responsive genes. One of the sites where the water was tested had been
a ranch prior to drilling and fracking, but ranching had to be discontinued because the
animals were no longer producing offspring. A recent study concerning fracking in rural
Colorado documented an increased incidence of congenital heart disease in children
born in families residing close to the fracking wells (McKenzie et al. 2014).
SCIENTISTS SPEAK 24.7 Dr. Susan Nagel discusses her identification of endo-
crine-disrupting chemicals in water produced by hydraulic fracturing (fracking)
activities.
Transgenerational Inheritance
of Developmental Disorders
A lifetime of chopping wood will not give your offspring bulging biceps, nor would
the loss of your arms in an accident cause your offspring to be born limbless. This is
because the environmental agents—exercise or trauma in these cases—do not cause
mutations in the DNA. In order to be transmitted, mutations must not only be somatic,
they must enter the germ line. Thus, genetic mutations acquired in skin cells that are
overexposed to sunlight will not be transmitted. However, one of the most surprising
results of contemporary developmental genetics has been the discovery that certain
environmentally induced phenotypes can be transmitted from generation to generation.
DNA methylation seems to be a mechanism that can circumvent the mutational block
to the transmission of acquired traits.
Certain agents can cause the same alterations of DNA methylation throughout
the body, and these alterations in methylation can be transmitted by the sperm and
egg. Jablonka and Raz (2009) have documented dozens of cases where different “epi-
alleles”—DNA containing different methylation patterns—can be stably transmitted
from generation to generation. In mammals, epiallelic inheritance was first documented
by studies of the endocrine disruptor vinclozolin, a fungicide widely used on grapes.
When injected into pregnant rats during particular days of gestation, vinclozolin caused
testicular dysgenesis in the male offspring. The testes started forming normally, but
as the mouse got older, its testes degenerated and quit producing sperm. What’s more
interesting is that the male mice fathered by mice with this induced testicular dysgen-
esis (often by artificial means) also get testicular dysgenesis. So do their male offspring
and the subsequent generation’s male offspring (Anway et al. 2005, 2006; Guerrero-
Bosagna et al. 2010). Thus, when a pregnant rat is given vinclozolin, even her great-
grandsons are affected (Figure 24.16).
The mechanism for this inheritance in rats appears to be DNA methylation. The pro-
moters of more than 100 genes in the Sertoli cells (see Chapter 6) have their methylation
patterns changed by vinclozolin, and altered promoter methylation can be seen in the
sperm DNA for at least three subsequent generations (Guerrero-Bosagna et al. 2010;
Stouder and Paolini-Giacobino 2010). These genes include those whose products are
necessary for cell proliferation, G proteins, ion channels, and receptors. It is important
to note that by the third (F3) generation, there could have been no direct exposure to
vinclozolin. The fetus is inside the treated mother; and the fetus has germ cells (of the F2
generation) inside itself. But even though the offspring of the F3 and F4 generations have
never been exposed to vinclozolin, their phenotype is changed by the initial injection
to their great-grandmother.
Similar studies have indicated that other endocrine disruptors—DES, bisphenol A,
and PCBs—also have transgenerational effects (Skinner et al. 2010; Walker and Gore
754 Chapter 24
7 6 F4
(B) (C)
2011). Indeed, the behavioral changes induced by BPA in mice may last at least four
generations (Wolstenhome et al. 2012). The public health ramifications of this type of
inheritance are just beginning to be explored.
Scientists Speak 24.8 Dr. Michael Skinner discusses his research on transgen-
erational epigenetic diseases.
It once was thought that carcinogensis and metastasis were caused by the prolifera-
tion of a cell that had acquired mutations enabling it to become “autonomous,” thus
defining cancer by intracellular mechanisms that enable a cell to become independent
of its environment. But this turns out to be only part of the explanation. We now know
that the initial cancer cells modify their environment, turning it into a cancer-promot-
ing niche. Cancer is being recast as the result of a stepwise progression of conditions
that depends on reciprocal interactions between incipient cancer cells and the sup-
porting cells of their tissue environment. The progressive alteration of cell-cell interac-
tions leads to aberrant tissue architecture, and possibly to the formation of niches that
generate cancer cells. Indeed, cancer cells appear to proceed by recapitulating steps of
normal development, including the formation of a niche in which to proliferate. Thus,
both carcinogenesis and congenital anomalies can be seen as diseases of tissue organi-
zation, differentiation, and intercellular communication. As we will see, they are often
caused by defects in the same pathways. There are many reasons to view malignancy
and metastasis in terms of development, four of which will be discussed here:
1. Context-dependent tumor formation
2. Defects in cell-cell communication as the initiator of cancers
3. Cancer stem cells
4. Epigenetic reprogramming of cancer cells
context-dependent tumors Many tumor cells have normal genomes, and whether
or not these tumors become malignant depends on their environment (Pierce et al.
1974; Mack et al. 2014). The most remarkable of these cases is the teratocarcinoma, a
tumor of germ cells or stem cells (Illmensee and Mintz 1976; Stewart and Mintz 1981).
Teratocarcinomas are malignant growths of cells that resemble the inner cell mass of
the mammalian blastocyst, and they can kill the organism. However, if a teratocarci-
noma cell is placed on the inner cell mass of a mouse blastocyst, it will integrate into
the blastocyst, lose its malignancy, and divide normally. Its cellular progeny can become
part of numerous embryonic organs. Should its progeny form part of the germ line, the
sperm or egg cells formed from the tumor cell will transmit the tumor genome to the
next generation. Thus, whether the cell becomes a tumor or becomes part of the embryo
can depend on its surrounding cells.
It is possible that the stem cell environment suppresses tumor formation by its secre-
tion of inhibitors of the paracrine pathways. For instance, many tumor cells, such as
melanomas, secrete the paracrine factor Nodal. This aids their proliferation and also
helps supply them with blood vessels. When placed in an environment of embryonic
stem cells (which secrete Nodal inhibitors), aggressive melanoma tumors (which are
derived from neural crest cells) become normal pigment cells (Hendrix et al. 2007;
Postovit et al. 2008). Remarkably, such malignant melanoma cells, when transplanted
into early chick embryos, downregulate their Nodal expression and migrate as non-
malignant cells along the neural crest cell pathways (Figure 24.17; Kasemeier-Kulesa
et al. 2008).
Figure 24.17 When aggressively metastatic human melanoma cells are Anterior
injected into a 2-day chick embryo dorsal neural tube (A), they form normal
migratory chains (B) and follow the neural crest migration roots to integrate (C)
into facial cartilage (C) and sympathetic ganglia (D). There, they form non-
malignant melanocytes. (From Kasemeier-Kulesa et al. 2008.)
(A) (B)
Dorsal Ventral
(D)
defects in paracrine pathways This brings us to the next notion: that tumors can
occur by disruptions of paracrine signaling between cells. Rubin and de Sauvage (2006)
Gilbert concluded that “several key signaling pathways, such as Hedgehog, Notch, Wnt and BMP/
Developmental Biology 11e, Sinauer Associates
DevBio11e_24.17 Date 02-01-16 TGF-β/Activin, are involved in most processes essential to the proper development of an
Development in Health and Disease 757
the cancer stem cell hypothesis Another aspect of viewing cancers as diseases
of development is that the properties of tumors may emerge because of a population
of cells that are analogous to adult stem cells. The idea that cancers had stem cells was
one of the first links connecting cancer research and developmental biology. Pierce
and Johnson (1971) reported that “malignant tissue, like normal tissue, maintains
itself by proliferation and differentiation of its stem cells.” That same year, Pierce and
758 Chapter 24
Tumor Tumor
cell cell Tumor cell Stroma cell
Hedgehog Hedgehog Hedgehog
pathway pathway pathway
Restoration of
miRNA expression
the RA binding sites in DNA, where it represses RA-responsive genes as well as cre-
ates a larger condensed chromatin structure (Nowak et al. 2009). Expression of this
“new” transcription factor in neutrophil progenitors causes the cell to become malig-
nant (Miller et al. 1992; Grignani et al. 1998). Treatment of APL patients with all-trans
retinoic acid results in remission in more than 90% of cases because the additional RA is
able to effect the differentiation of the leukemic cells into normal neutrophils (Hansen
et al. 2000; Fontana and Rishi 2002).
Recently, microRNAs have begun to be tested in differentiation therapy. In many
tumors, there are specific microRNAs that are downregulated (Berdasco 2009; Mishra
and Merlino 2009). These downregulated microRNAs are usually tumor suppressors
that prevent changes in DNA methylation. Taulli and colleagues (2009) have shown that
the microRNA miRNA-206, which is normally present in skeletal muscle cells, is down-
regulated in muscle cell tumors. Adding miRNA-206 to muscle tumor cells restores their
differentiated phenotype and blocks cancer formation. This suggests a tissue-specific
mechanism for stopping cancers by causing them to differentiate (Figure 24.20).
Coda
Developmental biology is increasingly important in modern medicine. Preventive
medicine, public health, and conservation biology demand that we learn more about
the mechanisms by which industrial chemicals and drugs can damage embryos. The
ability to effectively and inexpensively assay compounds for potential harm is critical.
Gilbert
Developmental
Developmental biology
Biology also provides
11e, Sinauer new ways of understanding carcinogenesis and
Associates
new approaches
DevBio11e_24.20 to preventing and
Date 02-01-16 curing cancers. And finally, developmental biology
is providing the explanations for how mutated genes and aneuploidies cause their aber-
rant phenotypes.
760 Chapter 24
It is critical to realize that the agents we put into the environment, the cosmetics we
put on our skin, and the substances we eat and drink can reach developing embryos,
fetuses, and larvae. Developing organisms have different physiologies as they construct,
rather than merely sustain, their phenotypes, and chemicals that appear harmless to
adults may disrupt the development of embryos. It takes a community to raise an embryo.
24 Snapshot Summary
Development in Health and Disease
1. Developmental anomalies due to genetic errors and 5. Teratogenic agents include chemicals such as alcohol
environmental influences result in a relatively low rate of and retinoic acid, as well as heavy metals, certain patho-
survival of all human conceptions. gens, and ionizing radiation. These agents adversely
2. Chance plays a role in developmental outcomes. There is affect normal development and can result in malforma-
large variation in the amounts of transcription and trans- tions and functional deficits.
lation, such that at different times, cells are making more • There may be multiple effects of alcohol on cells and
or less developmentally important proteins. tissues that result in this syndrome of cognitive and
physical abnormalities.
3. Pleiotropy occurs when several different effects are pro-
duced by a single gene. In mosaic pleiotropy, each effect • The compound retinoic acid is active in development,
is caused independently by the expression of the same and too much or too little of it can cause congenital
gene in different tissues. In relational pleiotropy, abnormal anomalies.
gene expression in one tissue influences other tissues, 6. Endocrine disruptors can bind to or block hormone
even though those other tissues do not express that gene. receptors or block the synthesis, transport, or excretion
4. Genetic heterogeneity occurs when mutations in more of hormones. Presently, bisphenol A and other endocrine
than one gene can produce the same phenotype. Phe- disruptive compounds are being considered as possible
notypic heterogeneity arises when the same gene can agents of low sperm counts in men and a predisposition
produce different defects (or differing severities of the to breast cancer in women.
same defect) in different individuals. • Environmental estrogens can cause reproductive
system anomalies by suppressing Hox gene
Development in Health and Disease 761
expression and Wnt pathways. These substances movement, and some tumors revert to nonmalignancy
can also cause obesity, and in some cases they when placed in environments that support normal mor-
activate the transcription factors predisposing phogenesis and curtail excessive cell proliferation.
mesenchymal stem cells to differentiate into adipose • Cancers can arise from errors in cell-cell
tissue. communication. These errors include alterations of
• In some instances, endocrine disruptors methylate paracrine factor synthesis.
DNA, and these patterns of methylation can be • In many instances, tumors have a rapidly dividing
inherited from one generation to the next. Such cancer stem cell population which produces more
methylation can alter metabolism and development cancer stem cells as well as more quiescent and
by turning genes off. differentiated cells.
7. Cancer can be seen as a disease of altered development.
Cancers metastasize in manners similar to embryonic cell
Further Reading
Anway, M. D., A. S. Cupp, M. Uzumcu and M. K. Skipper. 2005. Howdeshell, K. L., A. K. Hotchkiss, K. A. Thayer, J. G. Van-
Epigenetic transgeneration effects of endocrine disruptors and denbergh and F. S. vom Saal. 1999. Plastic bisphenol A speeds
male fertility. Science 308: 1466–1469. growth and puberty. Nature 401: 762–764.
Bissell, M. J., D. C. Radisky, A. Rizki, V. M. Weaver and Lammer, E. J. and 11 others. 1985. Retinoic acid embryo-pathy.
O. W. Petersen. 2002. The organizing principle: Microenviron- New Engl. J. Med. 313: 837–841.
mental influences in the normal and malignant breast. Differen- Maffini, M. V., A. M. Soto, J. M. Calabro, A. A. Ucci and
tiation 70: 537–546. C. Sonnenschein. 2004. The stroma as a crucial target in mam-
Gilbert, S. F. and D. Epel. 2015. Ecological Developmental Biology: mary gland carcinogenesis. J. Cell Sci. 117: 1495–1502.
The Environmental Regulation of Development, Health, and Evolu- Steingraber, S. 2003. Having Faith: An Ecologist’s Journey to
tion, 2nd edition. Sinauer Associates. Sunderland, MA. Motherhood. New York: The Berkley Publishing Group.
Guerrero-Bosagna, C., M. Settles, B. Lucker and M. K. Skin- Sulik, K. K. 2005. Genesis of alcohol-induced craniofacial dys-
ner. 2010. Epigenetic transgenerational actions of vinclozolin morphism. Exp. Biol. Med. 230: 366–375.
on promoter regions of the sperm epigenome. PLoS One Sep
30;5(9). pii: e13100. Tang, H. and 14 others. 2016. Zika virus infects human cortical
neural progenitors and attenuates their growth. Cell Stem Cell.
Hanahan, D., and R. A. Weinberg. 2011. Hallmarks of cancer: doi: org/10/1016/j.stem.2016.02.016.
The next generation. Cell 144: 646–674.
Hayes, T. B. and 21 others. 2011. Demasculinization and femi-
nization of male gonads by atrazine: Consistent effects across
vertebrate classes. J. Steroid Biochem. Mol. Biol. 127: 64–73.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
25
Development
and the Environment
Biotic, Abiotic, and Symbiotic
Regulation of Development
It was long thought that the environment played only a minor role in
development. Nearly all developmental phenomena were believed to be a “readout” of
nuclear genes, and those organisms whose development was significantly controlled by
the environment were considered interesting oddities. When environmental agents played
roles in development, they appeared to be destructive, such as the roles played by terato-
gens and endocrine disruptors (see Chapter 24). However, recent studies have shown that
the environmental context plays significant roles in the normal development of almost all species,
and that animal genomes have evolved to respond to environmental conditions. Moreover, there
are symbiotic associations wherein the development of one organism is regulated by the
molecular products of organisms of other species. In fact, such cases appear to be the rule
rather than the exception.
One reason developmental biologists have largely ignored the environment’s effects
is that most animals studied in developmental biology—C. elegans, Drosophila, zebrafish,
Xenopus, chicks, and laboratory mice—have been selected for their lack of such effects
(Bolker 2012). These model organisms make it easier to study the genes that regulate
development, but they can leave us with the erroneous impression that everything needed
to form the embryo is present in the fertilized egg. With new concerns about the loss of
Why should microbes organismal diversity and the effects of environmental pollutants, there is renewed interest
be considered an in the regulation of development by the environment (see van der Weele 1999; Bateson
important part of and Gluckman 2011; Gilbert and Epel 2015).
normal development?
The Punchline
The material within a fertilized egg does not fully determine the organism’s
phenotype. Rather, the inherited genome can respond to numerous environmental
factors. Chemical signals from symbionts, usually bacteria, are needed for normal
development. In mammals, the gut microbiome is acquired at birth and is critical
for the development of the gut, the capillary network, and the immune system. It is
possible that it is also needed for normal development of the brain. In addition, abiotic
conditions such as temperature can be critical for normal development. In many
non-mammalian vertebrates, the sex of an organism depends on the temperature
it experiences during development. And finally, biotic conditions such as diet,
conspecific crowding, or the presence of predators can alter development in ways that
enable the phenotype to be more adaptive. Responding to environmental cues can
help the organism to integrate into its habitat.
764 Chapter 25
Diet-induced polyphenisms
Diet can play major roles in determining a developing animal’s phenotype. The effects
of diet in development are seen in the caterpillar of Nemoria arizonaria. When the cat-
erpillar hatches on oak trees in the spring, it has a form that blends remarkably with
the young oak flowers (catkins). But those larvae hatching from their eggs in the sum-
mer would be very obvious if they still looked like oak flowers. Instead, they resemble
newly formed twigs. Here, it is the diet (young versus old oak leaves) that determines
the phenotype (Figure 25.1C,D; Greene 1989).
Diet is also largely responsible for the formation of fertile “queens” in ant, wasp,
and bee colonies (Figure 25.1E,F ). In honeybees, adult females are either workers
or queens. The queen is the only reproductive member of the hive, laying up to 2,000
eggs per day. Queens also live 10 times longer than the average worker. The larvae are
fed by the workers, and only those larvae fed adequately become queens. The protein
inducing these queen-forming activities is called royalactin . Royalactin binds to the
Development and the Environment 765
(A) (B)
(C) (D)
(E) (F)
EGF receptor in the fat body of the honeybee larvae and stimulates the production of
Gilbert
juvenile Biology
Developmental hormone,11e, which
Sinauer elevates
Associatesthe levels of yolk proteins that are necessary for egg
production (Figure
DevBio11e_24.01 25.2 ; Kamakura 2011). RNAi against either the EGF receptor or
Date 02-16-16
its downstream targets abolishes the effects of royalactin.
766 Chapter 25
(A) (B) FIGURE 25.2 Diet-induced developmental changes can produce either
200 250 reproductively competent queens or sterile workers. Royalactin induces
functional ovaries (A) and increased body weight (B) in the honeybee Apis
(ovariole number)
160 200
emergence (mg)
Weight at adult
mellifera. (After Kamakura 2011.)
Ovary size
120 150
80 100
WEb Topic 25.1 Inducible caste determination in
40 50 ant colonies In some species of ants, the loss of soldier
ants creates conditions that induce more workers to become
0 0
soldiers.
Royalactin Casein (control)
when dung really matters For a male dung beetle
(Onthophagus), what really matters in life is the amount and
quality of the dung he eats as a larva. The hornless female
dung beetle digs tunnels, then gathers balls of dung and bur-
ies them in these tunnels. She then lays a single egg on each
dung ball; when the larvae hatch, they eat the dung. Metamor-
phosis occurs when the dung ball is finished, and the anatomi-
Queen Worker
cal and behavioral phenotypes of the males are determined
by the quality and quantity of this maternally provided food
(Emlen 1997; Moczek and Emlen 2000). The amount and qual-
ity of food determines the titer of juvenile hormone during the
larva’s last molt. This, in turn, determines the size of the larva
at metamorphosis and positively regulates the growth of the
imaginal discs that make the horns (Figure 25.3A ; Emlen and
Nijhout 1999; Moczek 2005).
If juvenile hormone is added to tiny O. taurus males during
(A) Horned male Hornless male the sensitive period of their last molt, the cuticle in their heads
expands to produce horns. Thus, whether a male is horned or
hornless depends not on the male’s genes but on the food his
mother left for him. Horns do not grow until the male beetle
larva reaches a certain size. After this threshold body size, horn
growth is very rapid.1 Thus, although body size has a normal
distribution, there is a bimodal distribution of horn sizes: about
half the males have no horns, whereas the other half have
horns of considerable length (Figure 25.3B).
1
Developmentally, there is a trade-off between primary and second-
(B) ary male sexual characters here. Making a large horn appears to take
1.50 away resources from making the penis. The growth rates of both the
horn and the penis may be regulated through the Foxo transcription
factor, which is upregulated by diet (Parzer and Moczek 2008; Snell-
1.25 Rood and Moczek 2012).
Horn length (mm)
1.00
0.75 FIGURE 25.3 Diet and Onthophagus horn phenotype. (A) Horned
and hornless males of the dung beetle Onthophagus acuminatus
0.50 (horns have been artificially colored). Whether a male is horned or
hornless is determined by the titer of juvenile hormone at the last
Gilbert molt, which in turn depends on the size of the larva. (B) There is
0.25
Developmental Biology 11e, Sinauer Associates a sharp threshold of body size under which horns fail to form and
DevBio11e_24.02 Date 05-19-16 above which horn growth is linear with the size of the beetle. This
0 threshold effect produces males with no horns and males with large
2.25 2.5 2.75 3.0 3.25 3.5 3.75 4.0 horns, but very few with horns of intermediate size. (After Emlen
Body size (mm) 2000; photographs courtesy of D. Emlen.)
Development and the Environment 767
Horned males guard the females’ tunnels and use their horns to Dung heap
prevent other males from mating. The size of the horns determines
a male’s behavior and chances for reproductive success; the male
with the biggest horns wins such contests. But what about the males
with no horns? Hornless males do not fight with the horned males
for mates. Since they, like the females, lack horns, they are able to dig
their own tunnels. These “sneaker males” dig tunnels that intersect
those of the females and mate with the females while the horned Guarding
male
male stands guard at the tunnel entrance (Figure 25.4; Emlen 2000;
Moczek and Emlen 2000). Indeed, about half the fertilized eggs in
most populations are from hornless males. In short, then, the ability
to produce a horn is inherited, but whether a horn is produced and
how big the horn becomes is regulated by the environment.
“Sneaker”
diet and dna methylation Dietary alterations can produce male
changes in DNA methylation, and these methylation changes can
Brood Egg
affect the phenotype. In the above-mentioned case of honeybee phe-
Female ball
notype, larvae can also be transformed from workers into queens by
preventing DNA methylation (Kucharski et al. 2008; Lyko et al. 2010).
Such diet-induced changes in DNA methylation can also affect
mammalian phenotypes. Waterland and Jirtle (2003) demonstrat- FIGURE 25.4 The presence or absence of horns determines
the male reproductive strategy in some dung beetle species.
ed this by using mice containing the viable-yellow allele of Agouti.
Females dig tunnels in the soil beneath a pile of dung and
Agouti is a dominant gene that gives mice yellowish hair color; it also
bring dung fragments into the tunnels. These will be the food
affects lipid metabolism such that the mice become fatter. The via- supply of the larvae. Horned males guard the tunnel entrances
ble-yellow allele has a transposable element inserted into the Agouti and mate repeatedly with the females. They fight to prevent
gene. This transposable element contains a cis-regulatory element other males from entering the tunnels, and the males with long
that allows Agouti to be expressed throughout the skin. Moreover, horns usually win such contests. Smaller, hornless males do
whereas most regions of the adult genome have hardly any intraspe- not guard tunnels, but dig their own to connect with those of
females. They can then mate and exit, unchallenged by the
cies variation in CpG methylation, there are large DNA methylation
guarding male. (After Emlen 2000.)
differences between individuals at these transposon sites. Such CpG
methylation can block transcription of the gene. When the Agouti
promoter is methylated, the gene is not transcribed. The mouse’s fur
remains black, and lipid metabolism is not altered.
Waterland and Jirtle fed pregnant viable-yellow Agouti mice methyl donor supple-
ments, including folate, choline, and betain. They found that the more methyl supple-
mentation, the greater the methylation of the transposon insertion site in their fetuses’
genomes, and the darker the pigmentation of the offspring. Although the mice in Fig-
ure 25.5 are genetically identical, their mothers were fed different diets during preg-
nancy. The mouse whose mother did not receive methyl donor supplementation is fat
and yellow—the Agouti promoter was unmethylated, so the gene was active. The mouse
born to the mother that was given folate supplements is sleek and dark; the methylated
Agouti gene was not transcribed.
Gilbert
FIGURE 25.5 Maternal diet can affect phenotype. These two mice are genetically
Developmental Biology 11e, Sinauer Associates
identical; both contain the viable-yellow allele of theDate
DevBio11e_24.04 Agouti gene, whose protein product
02-10-16
converts brown pigment to yellow and accelerates fat storage. The obese yellow mouse
is the offspring of a mother whose diet was not supplemented with methyl donors (e.g.,
folate) during her pregnancy. The embryo’s Agouti gene was not methylated, and Agouti
protein was made. The sleek brown mouse was born of a mother whose prenatal diet
was supplemented with methyl donors. The Agouti gene was turned off, and no Agouti
protein was made. (After Waterland and Jirtle 2003, photograph courtesy of R. L. Jirtle.)
768 Chapter 25
Differential gene methylation has been linked to human health problems. Dietary
restrictions during a woman’s pregnancy may show up as heart or kidney problems
in her adult children. Moreover, studies in rats showed that differences in protein and
methyl donor concentration in the mother’s prenatal diet affected gene expression and
subsequent metabolism in the pups’ livers (Lillycrop et al. 2005; Gilbert and Epel 2015).
This has led to a new area of preventative medicine, the field of developmental origin
of health and disease (see Web Topic 24.3).
Predator-induced polyphenisms
Imagine a species whose larvae are frequently confronted by a particular predator in
their pond or tidepool. One could then imagine an individual that could recognize
soluble molecules secreted by that predator and could use those molecules to activate
the development of structures that would make this individual less palatable to the
predator. This ability to modulate development in the presence of predators is called
predator-induced defense, or predator-induced polyphenism.
To demonstrate predator-induced polyphenism, one has to show that the pheno-
typic modification is caused by the presence of the predator, and that the modification
increases the fitness of its bearers when the predator is present (Adler and Harvell 1990;
Tollrian and Harvell 1999). Figure 25.6A shows the typical and predator-induced
morphs for several species. Two things characterize each case: (1) the induced morph is
more successful at surviving the predator, and (2) soluble filtrate from water surround-
ing the predator is able to induce the changes. Chemicals that are released by a predator
and can induce defenses in its prey are called kairomones.
Several rotifer species will alter their morphology when they develop in pond water
in which their predators were cultured (Dodson 1989; Adler and Harvell 1990). The
predatory rotifer Asplanchna releases a soluble compound that induces the eggs of a prey
rotifer species, Keratella slacki, to develop into individuals with slightly larger bodies and
anterior spines 130% longer than they otherwise would be, making the prey more dif-
ficult to eat. When exposed to the effluent of the crab species that preys on it, the snail
Thais lamellosa develops a thickened shell and a “tooth” in its aperture. In a mixed snail
population, crabs will not attack the thicker-shelled snails until more than half of the
typical-morph snails are devoured (Palmer 1985).
One of the more interesting mechanisms of predator-induced polyphenism is that
of certain echinoderm larvae. When exposed to the mucus of their fish predator, sand
dollar plutei larvae clone themselves, budding off small groups of cells that quickly
become larvae themselves. The tiny plutei are too small to be seen by the fish, and
thereby escape being eaten (Vaughn and Strathmann 2008; Vaughn 2009).
(A) (B)
Rotifer Barnacle Mollusc Carp
(Keratella) (Chthamalus) (Thais) (Carassius)
Predator absent
(typical)
Aperture Thickened,
Spines rotated “toothed” shell Expanded body depth
Predator
present
FIGURE 25.6 Predator-induced defenses. (A) Typical (upper row) and predator-induced (C) Embryonic stage
(lower row) morphs of various organisms. The numbers beneath each column represent the
percentages of organisms surviving predation when both induced and uninduced individuals Kairomone
were presented with predators (in various assays). (B) Scanning electron micrographs show reception
predator-induced (left) and typical (right) morphs of genetically identical individuals of the water
from predator
flea Daphnia. In the presence of chemical signals from a predator, Daphnia grows a protective
DD1 gene
“helmet.” (C) Possible pathway for the development of Daphnia’s defensive phenotype through
the endocrine system. DD1 is thought to be involved in kairomone reception and/or fate deter-
mination during the embryonic stage. It may play a role in the neural reception of the signal. Developmental fate
The other genes are thought to play roles in the morphogenesis of postembryonic juveniles. (A determination
after Adler and Harvell 1990 and references cited therein; B courtesy of A. A. Agrawal; C after
Miyakawa et al. 2010.)
Postembryonic juvenile
2
Indeed,
Gilbertthe vertebrate immune system is a wonderful example of predator-induced polyphen-
ism. Here, our immune
Developmental Biologycells use chemicals
11e, Sinauer from our predators (viruses and bacteria) to change
Associates
ourDevBio11e_24.06
phenotype so that we Date
can better resist them (see Frost 1999).
02-10-16
770 Chapter 25
SCIENTISTS SPEAK 25.1 Dr. Karen Warkentin discusses her work on the plasticity
of tadpole hatching.
3
Researchers have speculated that some dinosaurs may have had temperature-dependent
sex determination and that their sudden demise may have been caused by a slight change in
temperature, creating conditions where only males or only females hatched (see Ferguson and
Joanen 1982; Miller et al. 2004). Unlike many turtle species, whose members have long repro-
ductive lives, can hibernate for years, and whose females can store sperm, dinosaurs may have
had relatively brief reproductive lives and no ability to hibernate through prolonged bad times.
772 Chapter 25
WEb Topic 25.2 When adversity changes development This topic describes
some of the organisms that alter their development when faced with environmental
stress. In Volvox, rising temperatures of the spring bring about sexuality. In Dictyostelium,
lack of food leads to multicellularity. Other organisms would rather skip development and
wait for better times.
SCIENTISTS SPEAK 25.2 Dr. John Tyler Bonner discusses his pioneering work
demonstrating how the environment alter development to turn a single cell
organism multicellular.
butterfly wings Tropical regions of the world often have a hot wet season and
a cooler dry season. In Africa, a polyphenism of the dimorphic Malawian butterfly
(Bicyclus anynana) is adaptive to these seasonal changes. The dry (cool) season morph
is a mottled brown butterfly that survives by hiding in dead leaves on the forest floor.
In contrast, the wet (hot) season morph, which routinely flies, has prominent ventral
eyespots that deflect attacks from predatory birds and lizards (Figure 25.9; Brakefield
and Frankino 2009; Olofsson et al. 2010; Prudic et al. 2015).
The factor determining the seasonal pigmentation of B. anynana is not diet, but the
temperature during its pupation. Low temperatures produce the dry-season morph;
higher temperatures produce the wet-season morph (Brakefield and Reitsma 1991), and
the molecular mechanisms by which temperatures regulate phenotype are known. In
the late larval stages, transcription of the Distal-less gene in the wing imaginal discs is
restricted to a set of cells that will become the signaling center of each eyespot. In the
early pupa, higher temperatures elevate the formation of 20-hydroxyecdysone (20E; see
Chapter 21). This hormone sustains and expands the expression of Distal-less in those
FIGURE 25.9 Phenotypic plasticity in regions of the wing imaginal disc, resulting in prominent eyespots. In the dry season,
Bicyclus anynana is regulated by temper- the cooler temperatures prevent the accumulation of 20E in the pupa, and the foci of
ature during pupation. High temperature Distal-less signaling are not sustained. In the absence of the Distal-less signal, eyespots
(either in the wild or in controlled labora- do not form (Brakefield et al. 1996; Oostra et al. 2014). Distal-less protein is believed to
tory conditions) allows the accumulation be the transcription factor that determines the size of the eyespot (see Figure 25.9). In
of 20-hydroxyecdysone (20E), a hormone
Bicyclus, we see the adaptive significance of polyphenism and how this type of devel-
that is able to sustain Distal-less expres-
sion in the pupal imaginal disc. The opmental plasticity integrates an organism into its environment.
region of Distal-less expression becomes The importance of hormones such as 20E for mediating environmental signals con-
the focus of each eyespot. In cooler trolling wing phenotypes has been documented in the Araschnia butterfly (Figure
weather, 20E is not formed, Distal-less 25.10). Araschnia develops alternative phenotypes depending on whether the fourth
expression in the imaginal disc begins and fifth instars experience a photoperiod (hours of daylight) that is longer or shorter
but is not sustained, and eyespots fail than a particular critical day length. Below this critical day length, ecdysone levels are
to form. (Courtesy of S. Carroll and P.
Brakefield.)
Decreased amount of 20-hydroxyecdysone Dry-season form
OH
HO
OH
HO
˚C
<20 HO
Larva O
low and the butterfly has the orange wings characteristic of spring butter-
flies. Above the critical point, ecdysone is made and the summer pigmenta-
tion forms. The summer form can be induced in spring pupae by injecting
20E into the pupae. Moreover, by altering the timing of 20E injections, one
can generate a series of intermediate forms not seen in the wild (Koch and
Bückmann 1987; Nijhout 2003).
WEb Topic 25.3 The environmental induction of behavioral
phenotypes Several behaviors, including learning and the propensity
for anxiety, may be induced by the environment through developmental
pathways.
of reef fish—that attract coral larvae from long distances. Vermeij and colleagues (2010)
made recordings of Caribbean reefs and found that the larvae swam to the source of the
sound, even in the laboratory. These findings mean that coral reefs face danger from
noise pollution as well as from thermal and chemical pollution. Steve Simpson (2010),
who headed the study, has warned, “Anthropogenic noise has increased dramatically in
recent years, with small boats, shipping, drilling, pile driving and seismic testing now
sometimes drowning out the natural sounds of fish and snapping shrimps.”
Jaw-hyoidean Jaw-hyoidean
FIGURE 25.11 Polyphenism in tad- muscle group muscle group
poles of the spadefoot toad Scaphiopus
couchii. The typical morph (right) is an
omnivore, feeding on arthropods and
Interhyoidean Interhyoidean
algae. When ponds are drying out quick-
muscle muscle
ly, however, a carnivorous (cannibalistic)
morph forms (left). It develops a wider
mouth, larger jaw muscles, and an intes- Intestinal Intestinal
tine modified for a carnivorous diet. The coils coils
center photograph shows a cannibalistic CARNIVORE OMNIVORE
tadpole eating a smaller pondmate. (Pho- (eats other tadpoles) (eats brine shrimp, algae)
tograph © Wild Horizon/Getty Images; Ventral surface Ventral surface
drawings courtesy of R. Ruibel.)
Development and the Environment 775
to be responsible for the subsequent elevation of the thyroid hormones that initiate
metamorphosis (Boorse and Denver 2003). As in many other cases of polyphenism, the
developmental changes are mediated through the endocrine system. Sensory organs
send a neural signal to regulate hormone release. The hormones then can alter gene
expression in a coordinated and relatively rapid fashion.
In other species of spadefoot toads, the polyphenism is based on diet. In Spea mul-
tiplicata, the carnivorous morph appears to be induced by the eating of shrimp by the
young larva. This carnivorous morph can then eat larger prey, including the tadpoles
of Scaphiopus, while the other larvae primarily eat organic detritus (Levis et al. 2015).
The carnivores grow faster than the detritus-eaters and are more likely to survive if the
ponds dry up quickly.
Developmental Symbioses
In addition to the above-mentioned abiotic and biotic relationships in which the envi-
ronment regulates development, there is a special type of biotic relationship called
symbiosis. Contrary to the popular use of the term to mean a mutually beneficial rela-
tionship, the word symbiosis (Greek, sym, “together”; bios, “life”) can refer to any close
association between organisms of different species (see Sapp 1994). In many symbiotic
relationships, one of the organisms involved is much larger than the other, and the
smaller organism may live on the surface or inside the body of the larger. In such rela-
tionships, the larger organism is referred to as the host and the smaller as the symbi-
ont. There are two important categories of symbiosis:6
• Parasitism occurs when one partner benefits at the expense of the other. An
example of a parasitic relationship is that of a tapeworm living in the human
digestive tract, wherein the tapeworm steals nutrients from its host.
• Mutualism is a relationship that benefits both partners. A striking example
of this type of symbiosis can be found in the partnership between the Egyp-
tian plover (Pluvianus aegyptius) and the Nile crocodile (Crocodylus niloticus).
Although it regards most birds as lunch, the crocodile allows the plover to
roam its body, feeding on the harmful parasites there. In this mutually benefi-
cial relationship, the bird obtains food while the crocodile is rid of parasites.
In addition, the term endosymbiosis (“living inside”) is widely used to describe the
situation in which one cell lives inside another cell, a circumstance thought to account
for the evolution of the organelles of the eukaryotic cell (see Margulis 1971), and one
that describes the Wolbachia developmental symbioses discussed at length later in this
chapter.
Symbiosis, and especially mutualism, is the basis for life on Earth. The symbiosis
between Rhyzobium bacteria and the roots of legume plants is responsible for converting
atmospheric nitrogen into a usable form for generating amino acids, and is therefore
essential for life. Symbioses between fungi and plants are ubiquitous and are often nec-
essary for plant development (see Gilbert and Epel 2015; Pringle 2009). Orchid seeds,
for example, contain no energy reserves, so a developing orchid plant must acquire
carbon from mycorrhizal fungi. (This is why orchids grow best in moist tropical envi-
ronments, where fungi are plentiful.) The coastal zone ecosystem throughout the world
6
Commensalism—defined as a relationship that is beneficial to one partner and neither benefi-
cial nor harmful to the other partner—is sometimes thought of as a third category of symbiosis.
Although many symbioses appear on the surface to be commensal, recent studies suggest that
very few symbiotic relationships are truly neutral with respect to either party.
776 Chapter 25
there is a steep gradient of oxygen from the outside of the cluster to deep within it; thus
embryos on the inside of the cluster develop more slowly than those near the surface
(Strathmann and Strathmann 1995). The embryos seem to get around this problem by
coating themselves with a thin film of photosynthetic algae, which they obtain from
the pond water. In clutches of amphibian and snail eggs, photosynthesis from this
algal “fouling” enables net oxygen production in the light, whereas respiration exceeds
photosynthesis in the dark (Bachmann et al. 1986; Pinder and Friet 1994; Cohen and
Strathmann 1996). Thus, the symbiotic algae “rescue” the eggs by their photosynthesis.
Horizontal transmission is crucial for the symbiotic gut bacteria found in many ani-
mals, including humans. As we will see later in this chapter, mammalian gut bacteria
are critical in forming the blood vessels of the intestine, and possibly in regulating stem
cell proliferation (Pull et al. 2005; Liu et al. 2010). Human infants usually acquire these
symbionts as they travel through the birth canal. Once the amnion breaks, the micro-
biota of the mother’s reproductive tract can colonize the infant’s skin and gut. This is
supplemented by bacteria from the parents’ skin, especially the mother’s skin during
nursing. The colonization of the infant by the microbes is a critically important event,
and the mammalian immune system appears to encourage certain bacteria to enter the
body, while discouraging others (see Gilbert et al. 2012). Indeed, some of the complex
sugars found in human mothers’ milk are not digestible by the infant. Rather, they serve
as food for certain bacterial symbionts that help the infants’ bodies develop (Zivkovic
et al. 2011). Although each baby starts with a unique bacterial profile, within a year the
types and proportions of bacteria have converged to the adult human profile that char-
acterizes the human digestive tract (Palmer et al. 2007).
The substance V. fischeri secretes to effect these changes turns out to be fragments of
the bacterial cell wall, and the active agents are tracheal cytotoxin and lipopolysaccha-
ride (Koropatnick et al. 2004). This finding was surprising, because these two agents are
known to cause inflammation and disease that endanger the survival of the host (and
therefore the bacteria). Indeed, tracheal cytotoxin is responsible for the tissue damage
in both whooping cough and gonorrheal infections. The destruction and replacement of
ciliated tissue in the respiratory tract and oviduct are due to these bacterial compounds.
After the bacteria have induced the morphological changes in the host, the host secretes
a peptide into the Vibrio-containing crypts which neutralizes the bacterial toxin (Troll et
al. 2010). Both organisms change their gene expression patterns, and both benefit from
their association: The bacteria get a home and express their light-generating enzymes,
and the squid develops a light organ that allows it to swim at night in shallow waters
without casting a shadow.
FIGURE 25.14 Comparison of ovaries and oocytes of the wasp Asobara tabida from
control females and females treated with rifampicin antibiotic to remove Wolbachia. (A) The
ovaries of control females had an average of 228 oocytes, whereas those of rifampicin-
treated females had an average of 36 oocytes. (B) When DNA in the oocytes was stained,
oocytes from control females had a nucleus (arrow) as well as a mass of Wolbachia at one
end (boxed area). Oocytes from rifampicin-treated females had a nucleus but no Wolba-
chia; these eggs were sterile. (From Dedeine et al. 2001.)
Development and the Environment 779
and cause sex-determination anomalies in amphibians. But the major use and effect of
atrazine is to kill plant life; it is a potent nonspecific herbicide. Once applied, atrazine
can remain active in the soil for more than 6 months and can be carried by wind and
rainwater to new sites. However, the egg masses of many amphibian and snail species
depend on algal symbionts to provide oxygen to the eggs deepest in the clutch. The
spotted salamander (Ambystoma maculatum) lays eggs that recruit a green algal symbi-
ont so specific that its name is Oophilia amblystomatis (“lover of Ambystoma eggs”). The
algae is actually stored in the mother’s body and appears to be deposited along with
the eggs (Kerney et al. 2011). Concentrations of atrazine as low as 50 μg/L completely
eliminate this algae from the eggs, and the amphibian’s hatching success is greatly
lowered (Figure 25.15; Gilbert 1944; Mills and Barnhart 1999; Olivier and Moon 2010).
2001). Stappenbeck and colleagues (2002) have demonstrated that in the absence of par-
ticular intestinal microbes, the capillaries of the small intestinal villi fail to develop their
(A) complete vascular networks (Figure 25.17). In zebrafish, microbes regulate (through
the canonical Wnt pathway) the normal proliferation of the intestinal stem cells. With-
out these microbes, the intestinal epithelium has fewer cells, and it lacks goblet cells,
entroendocrine cells, and the characteristic intestinal brush border enzymes (Figure
25.18; Rawls et al. 2004, 2006; Bates et al. 2006).
FIGURE
Gilbert 25.17 Gut microbes are necessary for mammalian capillary development. (A) The
Developmental
capillary networkBiology 11eof, Sinauer
(green) Associates
germ-free mice is severely reduced compared with (B) the capillary
DevBio11e_24.16
network Date10
in those same mice 02-10-16
days after inoculation with normal gut bacteria. (C) The addi-
tion of Bacteroides thetaiotaomicron alone is sufficient to complete capillary formation. (From
Stappenbeck et al. 2002.)
Development and the Environment 781
FIGURE 25.18 Bacteria stimulate stem cell division and cell dif- (A) (B) Germ-free + bacteria
ferentiation in the zebrafish gut. (A) Quantitation of S-phase (dividing) 20
intestinal epithelial cells in conventionally raised (control), germ-free,
and germ-free plus added bacteria specimens. (B) Germ-free zebrafish
given bacteria have normal amounts of stem cell division and epithelial
(C) Germ-free
Germ-free mice
and help a pregnant woman adapt to the physiological stresses
of carrying a fetus. When transferred into a germ-free mouse, Gilbert
800
Developmental Biology 11e, Sinauer Associates
bacteria from women in the early stages of pregnancy cause a DevBio11e_24.18 Date 02-10-16
normal phenotype to develop in the hosts. When bacteria from 400
women late in their pregnancy are transferred into germ-free
mice, the mice get fatter and display some of the metabolic 0
Frontal Anterior
changes (such as insulin desensitization) associated with preg- cortex olfactory organ
nant women (Figure 25.20 ; Koren et al. 2012).
In short, mammals have coevolved with bacteria to the FIGURE 25.19 Egr1 gene expression in mice depends on sym-
point that our bodily phenotypes do not fully develop without biotic microbes. (A) In situ hybridization of Egr1 mRNA in a section
through the frontal cortex of the brain, showing high levels of Egr1
them. The microbial community of our gut can be viewed as an
protein in a mouse that has conventional microbes compared with
“organ” that provides us with certain functions that we haven’t a mouse remaining germ-free. (B) Quantitation using radioactive
evolved (such as the ability to process plant polysaccharides). probes showed that symbiont-containing mice had significantly
And, like our developing organs, microbes induce changes in higher levels of Egr1 in the frontal cortex and anterior olfactory
neighboring tissues. As Mazmanian and colleagues (2005) have region than germ-free mice did. (After Diaz Heijtz et al. 2011.)
782 Chapter 25
Bacterial groups:
Firmicutes
Bacteroidetes
Proteobacteria
Normal mouse Fatter mouse with Inflammation proteins
insulin desensitization
Developing Questions concluded, “The most impressive feature of this relationship may be that the host not
only tolerates but has evolved to require colonization by commensal microorganisms
Given that mammals for its own development and health.”
need microbes to help
construct their guts and
immune systems, is there Coda
any evidence that children
born by Cesarean delivery Phenotype is not merely the expression of one’s inherited genome. Rather, there are
(surgical “C-section”; i.e., interactions between an organism’s genotype and environment that elicit a particular
without passing through the phenotype from a genetically controlled repertoire of possible phenotypes. Environ-
birth canal) have different mental factors such as temperature, diet, physical stress, the presence of predators,
gut bacteria and may
and crowding can generate a phenotype that is suited for that particular environment.
be more prone to certain
diseases than those born Environment is therefore considered to play a role in the generation of phenotypes in
without surgery? addition to its well-established role in the selection of phenotypes. The fact that we code-
velop with other organisms is an important concept for developmental biology and for
evolutionary biology. This may be extremely important for medicine, especially if brain
development can be affected by bacteria. Indeed, research is ongoing as to whether
bacteria may be responsible for autism spectrum disorders (see Gonzalez et al. 2011).
Ecological developmental biology is providing the molecular basis for the genotype-
by-environment interactions that are increasingly attracting the interests of evolution-
ary biologists (Schlichting and Pigliucci 1998). Different genomes alter their expression
patterns differently in response to the same environmental change. The sensitivity of
dung beetle larvae to changes in juvenile hormone, the threshold for sex specifica-
Gilbert
tion changes
Developmental in turtles,
Biology and Associates
11e, Sinauer numerous other developmental responses to the environ-
DevBio11e_24.20
ment are selectableDate 02-10-16 (see Moczek and Nijhout 2002; McGaugh and Janzen
phenotypes
2011; Moczek et al. 2011). As the genes for these environmentally induced develop-
mental pathways are becoming known (Matsumoto and Crews 2012; Snell-Rood and
Moczek 2012), molecular mechanisms can be proposed for the genome-environment
interactions.
Ecological developmental biology also calls into question the notions of autonomy
and independent development. Moreover, if we are not truly “individuals” but have a
Development and the Environment 783
25 Snapshot Summary
Development and the Environment
1. The environment plays critical roles during normal devel- determining sex in several organisms, including many
opment. These agents include temperature, diet, crowd- reptiles and fish.
ing, and the presence of predators. 6. Predator-induced polyphenisms have evolved such that
2. Developmental plasticity makes it possible for environ- prey species can respond morphologically to the presence
mental circumstances to elicit different phenotypes from of a specific predator. In some instances, this induced
the same genotype. The genome encodes a repertoire adaptation can be transmitted to the progeny of the prey.
of possible phenotypes. The environment often selects 7. There are several routes through which gene expression
which of those phenotypes will become expressed. can be influenced by the environment. Environmental
3. Reaction norms are phenotypes that quantitatively factors can methylate genes differentially; they can
respond to environmental conditions, such that the phe- induce gene expression in surrounding cells; and they
notype reflects small differences in the environmental can be monitored by the nervous system, which then
conditions. produces hormones that affect gene expression.
4. Polyphenisms represent “either/or” phenotypes; that is, 8. Behavioral phenotypes can also be induced by the envi-
one set of conditions elicits one phenotype, while anoth- ronment. Conditions experienced as the brain matures
er set of conditions elicits another. after birth can alter patterns of DNA methylation and
5. Seasonal cues such as photoperiod, temperature, or thereby change hormone reception and behaviors.
type of food can alter development in ways that make 9. Organisms usually develop with symbiotic organisms,
the organism more fit under the conditions it encoun- and signals from the symbionts can be critical for normal
ters. Changes in temperature also are responsible for development.
784 Chapter 25
10. Symbionts can be acquired horizontally (through infec- intestinal blood vessels and gut-associated lymphoid tis-
tion) or vertically (through the oocyte). sue of some mammalian species fail to form properly.
11. In an obligate mutualism, both partners are needed for 13. Symbionts can induce normal gene expression in hosts;
the survival of the other; in an obligate developmental and the host phenotype is deficient without the bacterial-
mutualism, at least one partner is needed for the proper induced patterns of gene expression. The differentiation
development of another. of certain immune cells, gut cells, and neural cells may
12. The mammalian gut contains symbionts that actively depend on symbiont-induced gene expression.
regulate intestinal gene expression to generate proteins 14. In vertebrates, gut symbionts may be important for the
that are normal physiological components of intestinal development of the gut, the immune system, and per-
development and function. Without these symbionts, the haps even portions of the nervous system.
Further Reading
Agrawal, A. A., C. Laforsch and R. Tollrian. 1999. McFall-Ngai, M. J. 2002. Unseen forces: The influence of
Transgenerational induction of defenses in animals and plants. bacteria on animal development. Dev. Biol. 242: 1–14.
Nature 401: 60–63. McFall-Ngai, M. J. 2014. The importance of microbes in animal
Brakefield, P. M. and N. Reitsma. 1991. Phenotypic plasticity, development: Lessons from the squid-Vibrio symbiosis. Annu.
seasonal climate, and the population biology of Bicyclus Rev. Microbiol. 68: 177–194.
butterflies (Satyridae) in Malawi. Ecol. Entomol. 16: 291–303. Moczek, A. P. 2005. The evolution of development of novel
Caldji, C., I. C. Hellstrom, T. Y. Zhang, J. Diorio and M. traits, or how beetles got their horns. BioScience 55: 937–951.
J. Meaney. 2011. Environmental regulation of the neural Relyea, R. A. and N. Mills. 2001. Predator-induced stress makes
epigenome. FEBS Lett. 585: 2049–2058. the pesticide carbaryl more deadly to grey treefrog tadpoles
Gilbert, S. F. and D. Epel. 2015. Ecological Developmental Biology: (Hyla versicolor). Proc. Natl. Acad. Sci. USA 2491–2496.
Integrating Epigenetics, Medicine, and Evolution, 2nd Ed. Sinauer Stappenbeck, T. S., L. V. Hooper and J. I. Gordon. 2002.
Associates, Sunderland, MA. Developmental regulation of intestinal angiogenesis by
Gilbert, S. F., T. C. Bosch and C. Ledón-Rettig. 2015. Eco-Evo indigenous microbes via Paneth cells. Proc. Natl. Acad. Sci. USA
Devo: Developmental symbiosis and developmental plasticity 99: 15451–15455.
as evolutionary agents. Nature Rev. Genet. 16: 611–622. Waterland, R. A. and R. L. Jirtle. 2003. Transposable elements:
Hooper, L. V., M. H. Wong, A. Thelin, L. Hansson, P. G. Falk Targets for early nutritional effects of epigenetic gene
and J. I. Gordon. 2001. Molecular analysis of commensal host- regulation. Mol. Cell. Biol. 23: 5293–5300.
microbial relationships in the intestine. Science 291: 881–884.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
26
The Punchline
Changes in anatomy come about through changes in development. These changes in
development form the bases of morphological variation needed for evolution. Much of
the ability to alter development comes from the flexibility of enhancers. Development
can be altered by changing the sequence of enhancer elements, which can change the
cell type a gene is expressed in, the time at which a gene is expressed, or the amount
of gene expression. Altering enhancers can also lead to the recruitment of a battery
of genes or the formation of a new cell type. Evolution can also occur by changing
the protein-encoding region of genes producing transcription factors. In addition,
developmental plasticity may accelerate the evolutionary process and bias it toward
certain phenotypes.
786 Chapter 26
2
Interestingly, the loss of the pelvic spines in several stickleback populations appears to have
been the result of independent losses of this Pitx1 expression domain. This finding suggests
that if the loss of Pitx1 expression in the pelvis occurs, this trait can be readily selected (Colo-
simo et al. 2004). Here we see that by combining the approaches of population genetics and
developmental genetics one can determine the mechanisms by which evolution can occur.
Development and Evolution 789
(A) (B)
WEb Topic 26.2 Correlated progression In many cases, modules must coevolve.
The upper and lower jaws, for instance, have to fit together properly; if one changes, so
must the other. If the sperm-binding proteins on the egg change, then so must the egg-
binding proteins on the sperm. This site looks at correlated changes during evolution.
(A)
Figure 26.3 Evidence of the evolutionary conservation of regulatory genes. (A) The cnidar-
ian homologue of the vertebrate Bmp4 and Drosophila Decapentaplegic genes is expressed
asymmetrically at the edge of the blastopore (marked with an asterisk) in the embryo of the
sea anemone Nematostella. This gene represents an ancestral form of the protostome and
deuterostome forms of the gene. (B) The Hox gene Anthox6, a cnidarian member of the para-
*
logue 1 group of Hox genes, is expressed at the blastopore side (asterisk) of the larval sea
* anemone. (C) The Pax6 gene for eye development is an example of a gene ancestral to both
protostomes and deuterostomes. The micrograph shows ommatidia of the compound insect
eye emerging in the leg of a fruit fly (a protostome) in which mouse (deuterostome) Pax6 cDNA
was expressed in the leg disc. (A,B from Finnerty et al. 2004, courtesy of M. Martindale; C from
Halder et al. 1995, courtesy of W. J. Gehring and G. Halder.)
(B)
molecules, and signal transduction cascades are remarkably similar from one
phylum to another. Indeed, it appears that the development of jellyfish and flat-
worms uses the same major kit of transcription factors and paracrine factors as
flies and vertebrates (Finnerty et al. 2004; Carroll et al. 2005; Putnam et al. 2007;
Ryan et al. 2007; Hejnol et al. 2009).
the small toolkit Certain transcription factors (such as those of the BMP,
Hox, and Pax groups) are found in all animal phyla. In fact, some “toolkit genes”
(C)
appear to play the same roles in multiple animal lineages. The BMP levels appear
to be used throughout the animal kingdom to specify the dorsal-ventral axis
(Figure 26.3A); the Wnt and Hox genes appear to specify the anterior-poste-
rior axis in all the bilaterians (Figure 26.3B); and the Pax6 gene appears to be
involved in specifying light-sensing organs, irrespective of whether the eye is
that of a mollusk, an insect, or a primate4 (Figure 26.3C). Similarly, homologues
of Otx specify head formation in both vertebrates and invertebrates; and though
insect and vertebrate hearts are very different, both are formed using tinman/
Nkx2-5 (see Erwin 1999). Certain microRNAs appear to be found in all animals,
and these appear to play the same or very similar developmental roles in what-
ever phylum they are found (Christodoulou et al. 2010). These include miRNA-
124, which is found in the central nervous systems of protostomes and deutero-
stomes; miRNA-12, which is found in guts throughout the animal kingdom; and
miRNA-92, which helps specify ciliated locomotor cells in deuterostome and
protostome larvae. Discovering that the same set of transcription factors and
microRNAs causes the specification of the same types of cells throughout the
animal kingdom is a very powerful argument that the protostomes and deutero-
stomes are derived from a common ancestor that used these factors in similar
ways to specify its organs (Davidson and Erwin 2010).
Gilbert
Developmental Biology 11e, Sinauer Associates duplication and divergence One theme that resounds through studies of para-
DevBio11e_26.03 Date 02-16-16 crine and transcription factors is that these proteins (and the genes that encode them)
come in families. How do gene families come into existence? The answer is through
duplication of an original gene and the subsequent independent mutation of the origi-
nal duplicates (Figure 26.4). This creates a family of genes that are related by common
descent (and which are often still adjacent to each other.) This scenario of duplica-
tion and divergence is seen in the Hox genes, the globin genes, the collagen genes,
the Distal-less genes, and in many paracrine factor families (e.g., the Wnt genes). Each
member of such a gene family is homologous to the others (that is, their sequence
similarities are due to descent from a common ancestor and are not the result of con-
vergence for a particular function), and they are called paralogues. Susumu Ohno
(1970), one of the founders of the gene family concept, likened gene duplication to a
4
This doesn’t mean that the eye is the only thing that is specified by Pax6, or that Pax6 hasn’t
become regulated by different proteins in different phyla (Lynch and Wagner 2010).
Development and Evolution 791
A1 A2 Gene A A1 A2 Gene A
sneaky criminal circumventing surveillance. While the “police force” of natural selec-
tion makes certain that there is a “good” gene properly performing its function, that
gene’s duplicate, unencumbered by the constraints of selection, can mutate and under-
take new functions.
Such “subfunctionalization” has since been shown to be the case in many gene fami-
lies, including the Hox genes. Hox genes represent an especially complex and important
case of duplication and divergence. We find that (1) there are related Hox genes in each
animal group (such as Deformed, Ultrabithorax, and Antennapedia in Drosophila, or the 39
Hox genes in mammals); and (2) there are several clusters of Hox genes in vertebrates
(the 39 mammalian Hox genes, for example, are clustered on four different chromo-
somes). The similarity of all the Hox genes is best explained by descent from a common
ancestral gene, probably in the single-celled protozoa or sponges. This would mean
that in Drosophila, the Deformed, Ultrabithorax, and Antennapedia genes all emerged as
duplications of an original gene. The sequence patterns of these three genes (especially
in the homeodomain region) are extremely well conserved. Such tandem gene duplica-
tions are thought to be the result of errors in DNA replication, and such errors are not
uncommon. Once replicated, the gene copies can diverge by random mutations in their
coding
Gilbert sequences and enhancers, developing different expression patterns and new
functions (Lynch
Developmental and
Biology 11eConery
, Sinauer2000; Damen 2002; Locascio et al. 2002).
Associates
DevBio11e_26.04 Date 02-16-16
Thus, every Drosophila Hox gene has a homologue (and sometimes several) in ver-
tebrates. In some cases, the homologies go very deep and can also be seen in the gene’s
functions. Not only is the vertebrate Hoxb4 gene similar in sequence to its Drosophila
homologue, Deformed (Dfd), but human HOXB4 can perform the functions of Dfd when
introduced into Dfd-deficient Drosophila embryos (Malicki et al. 1992). As mentioned in
Chapter 12, the Hox genes of insects and humans are not just homologous—they occur
in the same order on their respective chromosomes. Their expression patterns are also
remarkably similar: the more 3′ Hox genes have more anterior expression boundaries 5
5
The conservation of Hox genes and their colinearity demands an explanation. One possibility
(Kmita et al. 2000, 2002) is that the Hox genes “compete” for a remote enhancer that recognizes
the Hox genes in a polar fashion. This enhancer most efficiently activates Hox genes at the 5′
end. Another proposal (Gaunt 2015) suggests that spatial colinearity evolved as a mechanism
to physically separate genes, thus avoiding accidents of transcriptional activation.
792 Chapter 26
Figure 26.5 Duplication and diver- (A) SRGAP2 gene Chromosome (B) Neuron
gence of human SRGAP2. (A) The
SRGAP2 gene is found as a single copy
in the genomes of all mammals except Mammalian ancestor
humans. In the lineage giving rise to
humans, duplication events gave rise to
four similar versions of the gene, des- Duplication
ignated A–D. (B) The “ancestral” gene, A B
SRGAP2A, with minor contributions
from SRGAP2B and D, enables the Partial
Dendritic
maturation of dendritic spines (protu- duplication
spine
berances) on the surfaces of neurons. A B C
SGRAP2C is a partial duplication, and
its product inhibits SRGAP2A, slowing
dendritic spine maturation and promot- Duplication
ing neuronal migration. This partial A BD C
duplication may have allowed for the Non-human Humans
evolution of longer maturation time and Non-human Humans mammals
greater flexibility in the human brain. mammals
(After Geschwind and Konopka 2012.)
(see Figure 12.23). Thus, these genes are homologous between species (as opposed to
members of a gene family being homologous within a species). Genes that are homolo-
gous between species are called orthologues.
One of the most important gene duplication events in human evolution may have
been the duplication of SRGAP2, a gene that may have enabled the expansion of the
human cerebral cortex. The protein encoded by this gene is expressed in the mam-
malian brain cortex and appears to slow down cell division and decrease the length
and density of dendritic processes. However, humans differ from all other animals
(including chimpanzees) by having duplicated this gene twice. Moreover, the second
duplication event was not complete, so one of the newly formed genes is only a partial
duplicate. This partial gene produces a truncated SRGAP2 protein, SRGAP2C, that is
also made in the cerebral cortex and which inhibits the activity of normal SRGAP2 made
from the complete genes. As a result, cell division in the cerebral cortex continues for
longer periods of time, and the dendrites are larger with more connections ( Figure
Gilbert 26.5 ; Charrier et al. 2012; Dennis et al. 2012). Based on genomic evidence, these gene
duplication
Developmental events
Biology 11e areAssociates
, Sinauer calculated to have taken place about 2.4 million years ago. This
DevBio11e_26.05
would be aboutDatethe
02-16-16
time of Australopithecus, the increase in primate brain size, and the
first known use of tools (Tyler-Smith and Xue 2012).
Deep Homology
One of the most exciting contributions of evolutionary developmental biology has been
the discovery not only of homologous regulatory genes, but also of homologous signal
transduction pathways, many of which have been mentioned earlier in this book. In
different organisms, these pathways are composed of homologous proteins arranged in
a homologous manner (Zuckerkandl 1994; Gilbert 1996; Gilbert et al. 1996). This shows
a level of parsimony even deeper than that of the individual genes.
In some instances, homologous pathways made of homologous components are
used for the same function in both protostomes and deuterostomes. This has been
called deep homology (Shubin et al. 1997, 2009). Conserved similarities in both the
pathway and its function over millions of years of phylogenetic divergence are con-
sidered to be evidence of deep homology between these modules (Shubin et al. 1997).
One example is the Chordin/BMP4 interaction discussed in Chapter 11. In both ver-
tebrates and invertebrates, Chordin/Short-gastrulation (Sog) inhibits the lateralizing
effects of BMP4/Decapentaplegic (Dpp), thereby allowing the ectoderm protected by
Development and Evolution 793
Drosophila Mouse Figure 26.6 The same set of instructions forms the nervous
systems of both protostomes and deuterostomes. In the fruit fly (a
Dpp Chrd protostome), the TGF-β family member Dpp (Decapentaplegic) is
expressed dorsally and is opposed by Sog ventrally. In the mouse
podermis
Hy Nkx2 M Nkx2 (a deuterostome), the TGF-β family member Bmp4 is expressed
Gsx Gsx ventrally and is countered dorsally by Chordin (Chrd). The highest
concentration of Chordin/Sog becomes the midline (M). The mid-
Msx Msx line is dorsal in vertebrates and ventral in insects, and the concen-
Msh Msh tration gradient of the TGF-β family protein (BMP4 or Dpp) activates
ind ind genes specifying the regions of the nervous system in the same
vnd M vnd order in both groups: vnd/Nkx2, followed by ind/Gsx, and finally
Epidermis Msh/Msx. These genes have been seen to be expressed in a simi-
lar fashion in cnidarians. (After Ball et al. 2004.)
Sog Bmp4
Chordin/Sog to become the neurogenic ectoderm.6 These reactions are so similar that
Drosophila Dpp protein can induce ventral fates in Xenopus and can substitute for Sog
(Figure 26.6; Holley et al. 1995).
According to this scheme, the central nervous system of the bilaterian animals origi-
nated only once, and the BMP-Chordin mechanism was already being used in the
bilaterian ancestor of protostomes and deuterostomes. The positioning of BMP signal-
ing at the ventral (vertebrate) or dorsal (invertebrate) location was a later occurrence
(see Mizutani and Bier 2008). This idea has been supported by evidence that annelid
worms and cephalochordates also use inhibition of the BMP pathway in forming their
central nervous systems (Danes et al. 2007; Yu et al. 2007). Thus, despite their obvi-
ous differences, the protostome and deuterostome nervous systems seem to be formed
by the same set of instructions. Indeed, deep homology has also been proposed for
the formation of certain parts of the vertebrate and invertebrate brains (Strausfeld and
Hirth 2013).
SCIENTISTS SPEAK 26.1 Dr. Sean Carroll, a pioneer in the field, talks about the
questions underlying evolutionary developmental biology.
In other words, the allelic substitutions of the genes that encode protein sequences—
which seem to be pretty much the same for chimpanzees and humans—were not seen
as being important. The important differences are where, when, and how much the
genes are activated. In 1977, the idea that change within regulatory genes is critical to
evolution was extended by François Jacob, the Nobel laureate who helped establish the
operon model of gene regulation. First, Jacob said, evolution works with what it has: it
6
In addition to this central inhibitory reaction, there are other reactions that add to the deep
homology of the instructions for forming the protostome and deuterostome neural tube.
The proteins involved in the diffusion and stability of BMPs and Chordin also are conserved
between insects and vertebrates (Larrain et al. 2001).
794 Chapter 26
combines existing parts in new ways rather than creating new parts. Second, he pre-
dicted that such “tinkering” would be most likely to occur in those genes that construct
the embryo, not in the genes that function in adults (Jacob 1977).
Wallace Arthur (2004) catalogued four ways in which Jacob’s “tinkering” can take
place at the level of gene expression to generate phenotypic variation available for natu-
ral selection:
1. Heterotopy (change in location)
2. Heterochrony (change in time)
3. Heterometry (change in amount)
4. Heterotypy (change in kind)
These changes can only be accomplished if the gene expression patterns are modu-
lar—that is, if they are controlled by different enhancer elements. The modularity of
development allows one part of the organism to change without necessarily affecting
the other parts.7
Heterotopy
One important way of creating new structures is to alter the location where a transcrip-
tion factor or paracrine factor is expressed. This spatial alteration of gene expression is
called heterotopy (Greek, “different place”). Heterotopy allows different cells to take
on a new identity (as sea urchin micromeres did when they recruited the genes for the
skeleton formation; see Chapter 10) or to activate or inhibit a paracrine factor-mediated
process in a new area of the body (as when Gremlin inhibits BMP-mediated apoptosis
in the webbing between digits; see Figure 19.33). There are many other examples, some
of which we will describe next.
how the bat got its wings and the turtle got its shell In Chapter 1, we
mentioned that the bat evolved its wing by changing the development of the forelimb
such that the cells in the interdigital webbing did not die. It turns out that the bat
retains its forelimb webbing in a manner very similar to how the duck embryo retains
its hindlimb webbing—by blocking the BMPs that would otherwise cause the inter-
digital cells to undergo apoptosis (see Figure 1.19). Both Gremlin and FGF signaling
appears to block BMP functions in the bat wing. Unlike other mammals, bats express
Fgf8 in their interdigital webbing, and this protein is critical for maintaining the cells
there. If FGF signaling is inhibited (by drugs such as SU5402), BMPs can induce apop-
tosis of the forelimb webbing, just as in other mammals (Laufer et al. 1997; Weatherbee
et al. 2006). The Fgf8 in the webbing also appears to be responsible for providing the
mitotic signal that extends the digits of the bat, thereby expanding its wing (Hockman
et al. 2008; Sears 2008).
The formation of the turtle shell also uses BMPs and FGFs, but in different ways.
What distinguishes turtles from other vertebrates are their ribs—they migrate laterally
into the dermis instead of forming a rib cage (Figure 26.7 ). Certain regions of the
turtle dermis attract rib precursor cells, and these dermal regions differ from those of
other vertebrates because they synthesize Fgf10. Fgf10 seems to attract the ribs, since
the ribs do not enter the dermis if the Fgf10 signal is blocked (Burke 1989; Cebra-
Thomas et al. 2005). The lateral growth of the ribs causes some muscles to establish
new attachment sites and causes the scapula (shoulder blades) to reside inside the ribs.
This phenomenon is seen only in the turtles (Nagashima et al. 2009). Once inside the
dermis, the rib cells do what rib cells are expected to do—they undergo endochondral
ossification wherein the cartilage cells are replaced by bone. To do this, BMPs are made.
7
This chapter concentrates on transcriptional-level changes that can generate new morphologi-
cal forms, but morphological changes can be instigated at these levels as well. Abzhanov and
Kaufman (1999), for instance, have shown that post-transcriptional regulation of the Sex combs
reduced gene is critical in converting legs into maxillipeds in the terrestrial crustacean sowbug
Porcellio scaber.
Development and Evolution 795
*
*
(B)
bud’s zone of polarizing activity. The shorter the duration of Shh expression, the fewer
the number of digits (Shapiro et al. 2003). In primates, there is a heterochronic shift in
the transcription of a set of cerebral mRNAs, such that the expression pattern in adult
humans resembles that seen in juvenile chimpanzees (Somel et al. 2009).
Heterometry
Heterometry is a change in the amount of a gene product or structure. We mentioned
such heterometric changes in Chapter 16 when we discussed the evolution of the blind
Mexican cavefish (see Figure 16.7). We saw that overproduction of Sonic hedgehog
protein (Shh) in the midline prechordal plate downregulates the Pax6 gene, preventing
eye formation. But overexpression of Shh has other consequences as well. Not only does
it cause the degeneration of the eyes, it also causes the jaw size and number of taste
buds to increase (Franz-Odendaal and Hall 2006; Yamamoto et al. 2009). Since cavefish
live in complete darkness, the expansion of their jaw size and gustatory sense at the
expense of sight can be selected. Heterometry can also be seen in the human response
to parasitic worms: a mutation causing overproduction of interleukin 4
has been (and is being) selected in populations where such parasites are
endemic (Rockman et al. 2003).
WEb Topic 26.3 Allometry Modularity and heterochrony combine in
Bmp4 expression allometry: when different parts of an organism grow at different rates than their
ancestor. The skulls of different dog breeds is a good example of this, as are
the skulls of whales. But the human brain allometry is especially spectacular.
G. fuliginosa
darwin’s finches One of the best examples of heterometry involves
Darwin’s celebrated finches, a set of 15 closely related birds collected
by Charles Darwin and his shipmates during their visit to the Galápa-
gos and Cocos islands in 1835. These birds helped Darwin frame his
evolutionary theory of descent with modification, and they still serve
as one of the best examples of adaptive radiation and natural selection
G. fortis (see Weiner 1994; Grant and Grant 2008). Systematists have shown that
these finch species evolved in a particular manner, with a major specia-
tion event being the split between the cactus finches and the ground
finches. The ground finches evolved deep, broad beaks that enable them
to crack seeds open, whereas the cactus finches evolved narrow, pointed
beaks that allow them to probe cactus flowers and fruits for insects and
flower parts. Earlier research (Schneider and Helms 2003) had shown
that species differences in the beak pattern were caused by changes in
G. magnirostris
the growth of the neural crest-derived mesenchyme of the frontonasal
process (i.e., those cells that form the facial bones). Abzhanov and his
colleagues (2004) found a remarkable correlation between the beak shape
of the finches and the timing and amount of Bmp4 expression (Figure
26.8). No other paracrine factor showed such differences. The expression
of Bmp4 in ground finches started earlier and was much greater than
G. scandens
Figure 26.8 Correlation between beak shape and the expression of Bmp4
in five species of Darwin’s finches. In the genus Geospiza, the ground finches
(represented by G. fuliginosa, G. fortis, and G. magnirostris) diverged from
the cactus finches (represented by G. scandens and G. conirostris). The dif-
ferences in beak morphology correlate to heterochronic and heterometric
changes in Bmp4 expression in the beak. Bmp4 (red arrow) is expressed earlier
and at higher levels in the seed-crushing ground finches. The photographs of
the embryonic beaks were taken at the same stage (stage 29) of development.
G. conirostris
This gene expression difference provides one explanation for the role of natural
selection on these birds. (After Abzhanov et al. 2004.)
Development and Evolution 797
Bmp4 expression in cactus finches. In all cases, the Bmp4 expression pattern correlated
with the breadth and depth of the beak.
The importance of these expression differences was confirmed experimentally by
changing the Bmp4 expression pattern in chick embryos to mimic the heterometric and
heterochronic changes in the ground finches (Abzhanov et al. 2004; Wu et al. 2004).
When Bmp4 expression was enhanced in the frontonasal process mesenchyme, the
chick developed a broad beak reminiscent of the beaks of the ground finches. Con-
versely, when BMP signaling was inhibited in this region (by Noggin, a BMP inhibitor),
the beak lost depth and width.
But this was only the beginning of the story. Gene chip technology showed that the
level of Calmodulin gene expression in the beak primordia of the sharp-beaked cactus
finches was 15-fold greater than in the beak primordia of the blunt-beaked ground
finches. Calmodulin is a protein that combines with many enzymes to make their activ-
ity dependent on calcium ions. In situ hybridization and other techniques demonstrated
that the Calmodulin gene is expressed at higher levels in the embryonic beaks of cactus
finches than in the embryonic beaks of ground finches (Figure 26.9). When Calmodu-
lin was upregulated in the embryonic chicken beak to mimic the finchlike expression
domain, the chick beak too became long and pointed.
The frontonasal mesenchyme gives rise to two modules that form the adult beak: the
premaxillary bone and the prenasal cartilage. The prenasal cartilage develops earlier in
beak development and establishes the species-specific beak morphology. The morphol-
ogy of prenasal cartilage is coordinately regulated by BMP and Calmodulin signals,
and these signals correlate well with the exact scaling parameters of the evolving beak
CaM
shapes (Campàs et al. 2011; Mallarino et al. 2011, 2012). Thus, enhancers controlling
the amount of beak-specific BMP4 and Calmodulin synthesis may have been critically
important in the evolution of Darwin’s finches. BMP4 and Calmodulin represent two
targets for natural selection, and together they explain the shape variations of Darwin’s
finches (Abzhanov et al. 2006; Campàs et al. 2011).
Heterotypy
In heterochrony, heterotopy, and heterometry, mutations affect the regulatory regions
of the gene. The gene’s product—the protein—remains the same, although it may be
synthesized in a new place, at a different time, or in different amounts. The changes
of heterotypy affect the actual coding region of the gene, and thus can change the
functional properties of the protein being synthesized. These changes in the protein-
encoding regions of the gene are usually seen in genes that are expressed in only one or
a few tissues, suggesting that pleiotropy (see below) constrains such changes in broadly
expressed genes (Haygood et al. 2010; Wu et al. 2011). However, changes in the coding
sequence of transcription factors can have profound consequences in animal and plant
evolution (Wang et al. 2005).
how pregnancy may have evolved in mammals One of the most amazing fea-
tures of mammals is the female uterus, a structure that can hold, nourish, and protect a
developing fetus within its mother’s body. One of the key proteins enabling this internal
gestation is prolactin. Prolactin promotes differentiation of the uterine epithelial cells,
regulates trophoblast growth, allows blood vessels to spread toward the embryo, and
helps downregulate the immune and inflammatory responses so the mother’s body
does not perceive the embryo as a “foreign body” and reject it.
At about the same time the mammalian uterus and pregnancy evolved, one of the
mammalian Hox genes—Hoxa11—appears to have undergone intensive mutation and
selection in the lineage that gave rise to placental mammals. Analysis shows that the
sequence of the Hoxa11 protein changed in mammals such that it associates and inter-
acts with another transcription factor, Foxo1a (Figure 26.10 ; Lynch et al. 2004, 2008).
Association with Foxo1a enables Hoxa11 to upregulate prolactin expression from the
enhancer used in uterine epithelial cells. Hoxa11 from non-eutherian mammals (i.e.,
opossum and platypus) and from chickens does not upregulate prolactin. If the Hoxa11
mRNA in mouse uterine cells is experimentally knocked out, no prolactin is expressed.
4.5
4
Fold change in prolactin expression
11
H A1 A/
A /
H A1 /
A A/
A1 /
s A A/
A1 /
se 1A
m o1A
en o1A
1
/lu
an 1
ian 1
ian 1
pu xo1
sa 1
Eu Hsa 11
Th saF 1
O s a 11
Pl saF 1
11
1
xo
m xo
ou xo
er xo
er oxo
ox
32
ssu ox
ick ox
Fo
hu aFo
m Fo
th Fo
aty o
po F
Ch aF
sa
sa
s
H
et al. 2008.)
Development and Evolution 799
Homeodomain Polyalanine
Insects
Fly WFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAVQGGHLDQ
Mosquito WFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAALHEQN
Polyalanine
Butterfly WFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAAAAAAQGHPEH
Moth WFQNRRMKLKKEIQAIKELNEQEKQAQRQKAAAAAAAAAAAAQGHPEH
Beetle WFQNRRMKLKKEIQAIKELNEQEKQAQAQKAAAAAAAVAAQVDPN
Springtail WFQNRRMKLKKEIQAIKELNEQEKQAQAAKAGLFINLGGLIANSF…
Shrimp WFQNRRMKLKKEIQAIKELNEQEKQAQNAKQANATAVTPGATTDSTPTP…
Spider WFQNRRMKLKKEIQAIKELNEQERQAQAAKTA––––STSTVSSNSNSNN…
Common
Centipede WFQNRRMKLKKEIQAIKELNEQDKRITPSKLHSNC–SSPTGILVTMKKM
ancestor
Onycophoran WFQNRRMKLKKEMQTIKDLNEQEKK–––QRDTLSTV
why insects have six legs Insects have only six legs while most other arthropod
groups (think of spiders, millipedes, centipedes, lobsters, and shrimp) have many more.
How is it that the insects form legs only in their three thoracic segments and have no
legs on their abdominal segments? The answer seems to be found in the relationship
Gilbert
between Ultrabithorax
Developmental Biology 11e, protein (Ubx) and the Distal-less gene. In most of the arthropod
Sinauer Associates
DevBio11e_26.11
groups, Ubx does not Date 02-16-16
inhibit Distal-less. However, in the insect lineage, a mutation
occurred in the Ubx gene wherein the original 3′ end of the protein-coding region was
replaced by a group of nucleotides encoding a stretch of about 10 alanine residues at
the C-terminus (Figure 26.11; Galant and Carroll 2002; Ronshaugen et al. 2002). This
polyalanine region represses Distal-less transcription in the abdominal segments.
When a brine shrimp Ubx gene is experimentally modified to encode the insect
polyalanine region, the shrimp embryo represses the Distal-less gene. The ability of Ubx
to inhibit Distal-less thus appears to be the result of a gain-of-function mutation that
characterizes the insect lineage.
WEb Topic 26.5 How the chordates got a head The neural crest is responsible
for forming the heads of chordates. But how did the neural crest come into existence? It
is probable that ancestral deuterostomes had all the requisite genes, but only in the chor-
dates did these genes become linked together into the network that became the neural
crest cell.
physical constraints The laws of diffusion, hydraulics, and physical support are
immutable and will permit only certain physical phenotypes to arise. For example,
blood cannot circulate to a rotating organ; thus a vertebrate on wheeled appendages
(of the sort that Dorothy saw in Oz) cannot exist, and this entire evolutionary avenue
is closed off. Similarly, structural parameters and fluid dynamics would prohibit the
existence of 6-foot-tall mosquitoes or 25-foot-long leeches.
morphogenetic constraints Bateson (1894) and Alberch (1989) noted that when
organisms depart from their normal development, they do so in only a limited number
of ways. For instance, although there have been many modifications of the vertebrate
Figure 26.12 Reaction-diffusion (Tur- limb over 300 million years, some modifications (such as a middle digit shorter than
ing) mechanism of pattern generation. its surrounding digits, or a zeugopod more proximal than the stylopod; see Chapter
Generation of periodic spatial hetero-
19) are never seen (Holder 1983; Wake and Larson 1987). These observations suggest
geneity can come about spontaneously
when two reactants, S and P, are mixed a limb construction scheme that follows certain rules (Oster et al. 1988; Newman and
together under the conditions that S Müller 2005).
inhibits P, P catalyzes production of both One of the major sources of morphogenetic constraints lies in the limited ways that
S and P, and S diffuses faster than P. (A) differentiated patterns can arise from homogeneity. Chief among these patterning
The conditions of the reaction-diffusion mechanisms is the reaction-diffusion mechanism. This mechanism for developmental
mechanism yielding a peak of P and a patterning, formulated by Alan Turing (1952), is a way of generating complex chemical
lower peak of S at the same place. (B)
patterns out of substances that are initially homogenously distributed. Turing realized
The distribution of the reactants is initially
random, and their concentrations fluctu- that this patterning would not occur in the presence of a single morphogen, but that it
ate over a given average. As P increases could be achieved by two homogeneously distributed substances (“substance P” and
locally, it produces more S, which dif- “substance S”) if the rates of production of each substance depended on the other. He
fuses to inhibit more peaks of P from went on to show that the dynamics of such a network could produce stable patterns that
forming in the vicinity of its production. could be used to drive developmental change.
The result is a series of P peaks (“stand-
ing waves”) at regular intervals.
Time 2 S
Time 3
Position
Development and Evolution 801
WEb Topic 26.7 How do the correct number of cusps form in A tooth?
The vertebrate tooth has evolved according to what foods the animal can eat, and the
different tooth shapes reflect different times and amounts of paracrine factor expression.
pleiotropic constraints As genes acquire new functions, they may become active
in more than one module, making evolutionary change more difficult. Pleiotropy, the
ability of a gene to play different roles in different cells, is the “opposite” of modularity,
involving the connections between parts rather than their independence. Pleiotro-
pies may underlie the constraints seen in mammalian development. Galis speculates
that mammals have only seven cervical vertebrae (whereas birds may have dozens)
because the Hox genes that specify these vertebrae have become linked to stem cell
proliferation in mammals (Galis 1999; Galis and Metz 2001; Abramovich et al. 2005;
Schiedlmeier et al. 2007). Thus, changes in Hox gene expression that might facilitate
evolutionary changes in the skeleton might also misregulate cell proliferation and lead
to cancers. Galis supports this speculation with epidemiological evidence showing that
changes in skeletal morphology correlate with childhood cancer. The intraembryonic
selection against having more or fewer than seven cervical ribs appears to be remark-
ably strong. At least 78% of human embryos with an extra anterior rib (i.e., six cervi-
cal vertebrae) die before birth, and 83% die by the end of the first year. These deaths
appear to be caused by multiple congenital anomalies or cancers (Figure 26.13; Galis
et al. 2006).
(A) (B)
35 n=88
30
n=234 n=750
n=227
20
n=68 n=35
15
10
5
Figure 26.13 Extra cervical ribs are associated with child- n=
hood cancers. (A) Radiogram showing an extra cervical rib. (B) 220,026
Nearly 80% of fetuses with extra cervical ribs die before birth. 0
emia
n
a
or
mor
rs
ma
Those surviving often develop cancers very early in life. This indi-
com
com
latio
ance
s tum
asto
cates strong selection against changes in the number of mam-
n tu
Leuk
g sar
e sar
popu
od c
malian cervical ribs. (After Galis et al. 2006, courtesy of F. Galis.) robl
Wilm
Brai
tissu
Ewin
ldho
Neu
eral
Soft
Gen
l chi
Tota
wherein environmentally induced traits could be inherited through the germ line. We
now know that Lamarck was wrong in thinking that phenotypes acquired by use or
disuse could be transmitted. Children of weightlifters don’t inherit their parents’ phy-
Gilbert
Developmental Biology 11e,siques,
Sinauer and accident victims who have lost limbs can rest assured that their children will
Associates
DevBio11e_26.13 be06-06-16
Date born with normal arms and legs. If the DNA of the germ cells is not altered, envi-
ronmentally induced variation will not be transmitted from one generation to the next.
But what if an environmental agent were to cause changes not only in the somatic
DNA but also in the germline DNA? Then the effect might be able to be transmitted
from one generation to the next. There are two known major “epigenetic inheritance
systems”—epialleles and symbionts—that allow environmentally induced changes to
be transmitted from generation to generation. A third process, genetic assimilation,
shows that some environmentally induced traits, when continually selected, are sta-
bilized genetically so that the trait is inherited without having to be induced in each
generation.
epialleles While the alleles that are the basis of the genetic inheritance system are
variants of the DNA sequence, the epialleles of epigenetic inheritance systems are vari-
ants of chromatin structure that can be inherited between generations. In most known
cases, epialleles are differences in DNA methylation patterning that are able to affect
the germ line and thereby be transmitted to offspring. The asymmetrical peloria variant
of the toadflax plant (Linaria vulgaris; Figure 26.14) was first described by Linnaeus in
1742 as a stably inherited form. In 1999, Coen showed that this variant was due not to
a distinctive allele, but rather to a stable epiallele. Instead of carrying a mutation in the
cycloidea gene, the peloria form of this gene was hypermethylated. It does not matter to
the developing system whether a gene has been inactivated by a mutation or by altered
chromatin configuration (Cubas and Coen 1999). The effect is the same.
Development and Evolution 803
(A)
Figure 26.14 Epigenetic forms of toadflax. (A) Typical Linaria, with a relatively unmethyl-
ated cycloidea gene. (B) The cycloidea gene of the peloria variant is relatively heavily methyl-
ated. The epialleles that create the different phenotypes of this species are stably inherited.
(Courtesy of R. Grant-Downton.)
(B)
There are dozens of examples of epiallelic inheritance (Jablonka and Raz 2009; Gil-
bert and Epel 2015). These include:
• Diet-induced DNA methylation. In the viable Agouti phenotype in mice,
methylation differences affect coat color and obesity. When a pregnant female
is fed a diet high in methyl donors, the specific methylation pattern at the
Agouti locus is transmitted not only to the progeny developing in utero, but
also to the progeny of those mice and to their progeny (Jirtle and Skinner
2007). Similarly, enzymatic and metabolic phenotypes are established in utero
by protein-restricted diets in rats when protein restriction during a grand-
mother rat’s pregnancy leads to a specific methylation pattern in her pups and
grandpups (Burdge et al. 2007).
• Endocrine disruptor-induced DNA methylation. The endocrine disrup-
tors vinclozolin, methoxychlor, and bisphenol A have the ability to alter
Gilbert
DNA methylation patterns in the germ line, thereby causing developmental
Developmental Biology 11e, Sinauer Associates
anomalies and predispositions
DevBio11e_26.14 Date 02-16-16 to diseases in the grandpups of mice exposed
to these chemicals in utero (see Figure 24.16; Anway et al. 2005, 2006a,b;
Newbold et al. 2006; Crews et al. 2007, 2012).
• Behavior-induced DNA methylation. Stress-resistant behavior of rats was
shown to be due to methylation patterns, induced by maternal care, in the
glucocorticoid receptor genes. Meaney (2001) found that rats that received
extensive maternal care had less stress-induced anxiety and, if female, devel-
oped into mothers that gave their offspring similar levels of maternal care.
Figure 26.15 The color of adult pea aphids depends on whether or not their cells contain
Rickettsiella bacterial symbionts. (A) Without Rickettsiella, red aphid newborns become red
adults. (B) With Rickettsiella, red aphid newborns become green adults. (From Tsuchida et al.
2010, photographs courtesy of T. Tsuchida.)
variation can result from the introduction of a new symbiont to the community. Third,
Developing Questions
changes that occur through recombination or random mutation accumulate more rap-
Recent evidence suggests idly in a microbial symbiont than in the host. And fourth, there is the possibility of
that symbionts may be horizontal gene transfer between members of the symbiotic community.
pivotal in evolutionary
Symbionts can be a source of selectable variation. The pea aphid Acrythosiphon pisum,
events. How might
bacteria be involved with for example, has numerous species of symbionts living within most of it cells. One spe-
reproductive isolation cies of symbiotic bacteria, Buchnera aphidicola, can provide the aphid with either higher
and with the origins of fecundity or greater heat tolerance, depending on which allele of a heat-shock protein
multicellular animals? the bacteria produces. Another symbiotic bacterium, a species of Rickettsiella, contains
alleles that can alter the aphid’s color (Figure 26.15). A third bacterial symbiont, Ham-
iltonella defensa can (if it is the appropriate strain) provide proteins that defend the host
aphid against parasitoid wasps (Dunbar et al. 2007; Oliver et al. 2009; Tsuchida et al.
2010). These symbionts are usually inherited through the aphid’s egg cytoplasm (see
Chapter 25). Thus, selectable epigenetic variation may be acquired through the egg, but
using a different set of genes.
(B) 4 (C) 4
Polyphenic line
Response to heat shock (color score)
Unselected line
3 Monophenic line 3
2 2
1 1
0 0
2 4 6 8 10 12 14 20 25 30 35 40
Generation Temperature (°C)
1. The phenotype is not random. The environment elicited the novel phenotype, and
the phenotype has already been tested by natural selection. This would eliminate
a long period of testing phenotypes derived by random mutations. As Garson and
colleagues (2003) note, although mutation is random, developmental parameters
may account for some of the directionality in morphological evolution.
2. The phenotype already exists in a large portion of the population. One of the problems
of explaining new phenotypes is that the bearers of such phenotypes are “mon-
sters” compared with the wild-type. How would such mutations, perhaps present
only in one individual or one family, become established and eventually take over
a population? The developmental model solves this problem: this phenotype has
been around for a long while, and the capacity to express it is widespread in the
population; it merely needs to be genetically stabilized by modifier genes that
already exist in the population.
Given these two strong advantages, the genetic assimilation of morphs originally pro-
duced through developmental plasticity may contribute significantly to the origin of
new species. Ecologist Mary Jane West-Eberhard has noted that “contrary to popular
belief, environmentally initiated novelties may have greater evolutionary potential than
mutationally induced ones. Therefore, the genetics of speciation can profit from studies
in changes of gene expression as well as changes in gene frequency and genetic isola-
tion.” Evolutionary developmental biology is a young science, and the relative impor-
Gilbert
tance of environmentally induced novelties is just beginning to be explored.
Developmental Biology 11e, Sinauer Associates
DevBio11e_26.18 Date 02-16-16
Coda
In the late 1800s, experimental embryology separated itself from evolutionary biology
to mature on its own. However, one of those pioneers, Wilhelm Roux, promised that
once it did mature, embryology would return to evolutionary biology with powerful
mechanisms to help explain how evolution takes place. Evolution is a theory of change,
and population genetics can identify and quantify the dynamics of such change. How-
ever, Roux realized that evolutionary biology needed a theory of body construction that
would provide a means by which a specific mutation becomes manifest as a selectable
phenotype.
808 Chapter 26
When confronted with the question of how the arthropod body plan arose, Hughes
and Kaufman (2002) begin their study by saying:
To answer this question by invoking natural selection is correct—but insufficient.
The fangs of a centipede … and the claws of a lobster accord these organisms
a fitness advantage. However, the crux of the mystery is this: From what
developmental genetic changes did these novelties arise in the first place?
This is exactly the question for which modern developmental biology has been able to
provide some answers, and it continues to do so.
1. Developmental biology has established how the underpinnings of variation—
modularity, molecular parsimony, and gene duplication—enable extensive chang-
es in development to occur without destroying the organism.
2. Developmental biology has explained how four modes of genetic change—heter-
otopy, heterochrony, heterometry, and heterotypy—can act during development to
produce new and large variations in morphology.
3. Finally, developmental biology has shown that epigenetic inheritance—epialleles,
symbionts, and genetic assimilation—can provide selectable variations and aid
their propagation through a population.
In 1922, Walter Garstang declared that ontogeny (an individual’s development) does
not recapitulate phylogeny (evolutionary history). Rather, ontogeny creates phyloge-
ny, and evolution is generated by heritable changes in development. “The first bird,”
said Garstang, “was hatched from a reptile’s egg.” The developmental model has been
formulated to account for both the homologies and the differences seen in evolution.
Indeed, we are still approaching evolution in the two ways that Darwin recognized, and
descent with modification remains central. We are now at the point, however, where we
can answer evolutionary questions using both population genetics and developmental
biology. By integrating population genetics with developmental biology, we can begin
to explain the construction and evolution of biodiversity.
26 Snapshot Summary
Development and Evolution
1. Evolution is the result of inherited changes in develop- 9. Changes in Hox gene number may allow these genes
ment. Modifications of embryonic or larval development to take on new functions. Large changes in the num-
can create new phenotypes that can then be selected. bers of Hox genes correlate with major transitions in
2. Darwin’s concept of “descent with modification” evolution.
explained both homologies and adaptations. The simi- 10. The formation of new cell types may result from dupli-
larities of structure are due to common ancestry (homol- cated genes whose regulation has diverged. The Hox
ogy), while the modifications are due to natural selection genes and many other gene families started as single
(adaptation to the environmental circumstances). genes that were duplicated.
3. Homology means that similarity between organisms or 11. Like structures and genes, signal transduction path-
genes can be traced to descent from a common ances- ways can be homologous, with homologous proteins
tor. In some instances, certain genes specify the same organized in homologous ways. These pathways can be
traits throughout the animal phyla. used for different developmental processes both in dif-
4. Evolution can occur through the “tinkering” of exist- ferent organisms and within the same organism.
ing genes. The ways of effecting evolutionary change 12. The modularity of development allows parts of the
through development at the level of gene expression embryo to change without affecting other parts. This
are: change in location (heterotopy), change in timing modularity of development is due in large part of the
(heterochrony), change in amount (heterometry), and modularity of enhancers.
change in kind (heterotypy). 13. Co-option (recruitment) of existing genes and pathways
5. Changes in gene sequence can give Hox genes new for new functions is a fundamental mechanism for cre-
properties that may have significant developmental ating new phenotypes. Such instances include the use
effects. The constraint on insect anatomy of having only of the limb-development signaling pathway to form eye
six legs is one example; the evolution of the uterus is spot pigmentation in fly wings, the formation of beetle
another. elytra, and the production of the larval skeleton of sea
6. Changes in the location of gene expression during urchins.
development appear to account for the evolution of the 14. Developmental constraints prevent certain phenotypes
turtle shell, the loss of limbs in snakes, the emergence from arising. Such constraints may be physical (no
of feathers, and the evolution of differently shaped rotating limbs), morphogenetic (no middle digit smaller
molars. than its neighbors), or phyletic (no neural tube without a
7. Changes in the timing of gene expression have been notochord).
important in the formation of limbs throughout the ani- 15. New gene transcription can be caused by modifying
mal kingdom. existing DNA elements to become enhancers, mutating
8. Changes in the amount and timing of gene expression the DNA sequences bound by transcription factors to
can account for the development of beak phenotypes in eliminate an enhancer, or by having a transposable ele-
Darwin’s finches and the size of the human brain. ment add an enhancer sequence or mutate an existing
one.
810 Chapter 26
16. Epigenetic inheritance systems include epialleles, where- permissive environments, has been well documented in
in inherited patterns of DNA methylation can regulate the laboratory.
gene expression. A heavily methylated gene can be as 19. Evolutionary developmental biology is able to show how
nonfunctional as a genetically mutant allele. small genetic or epigenetic changes can generate large
17. Symbiotic organisms are often needed for development phenotypic changes and enable the production of new
to occur, and variants of these organisms may cause dif- anatomical structures. The merging of the population
ferent modes of development. genetic model with the developmental genetic model of
18. Genetic assimilation, wherein a phenotypic character evolution is creating a new evolutionary synthesis that
initially induced by the environment becomes, though can account for macroevolutionary as well as microevo-
a process of selection, produced by the genotype in all lutionary phenomena.
Further Reading
Abzhanov, A., W. P. Kuo, C. Hartmann, P. R. Grant, R. Grant Lynch, V. J., A. Tanzer, Y. Wang, F. C. Leung, B. Gelelrsen,
and C. Tabin. 2006. The calmodulin pathway and evolution of D. Emera and G. P. Wagner. 2008. Adaptive changes in the
beak morphology in Darwin’s finches. Nature 442: 563–567. transcription factor HoxA-11 are essential for the evolution
Amundson, R. 2005. The Changing Role of the Embryo in Evolu- of pregnancy in mammals. Proc. Natl. Acad. Sci. USA. 105:
tionary Thought: Roots of Evo-Devo. Cambridge University Press, 14928–14933.
New York. Merino, R., J. Rodríguez-Leon, D. Macias, Y. Ganan, A. N.
Carroll, S. B. 2006. Endless Forms Most Beautiful: The New Science Economides and J. M. Hurle. 1999. The BMP antagonist Grem-
of Evo-Devo. Norton, New York. lin regulates outgrowth, chondrogenesis and programmed cell
death in the developing limb. Development 126: 5515–5522.
Cohn, M. J. and C. Tickle. 1999. Developmental basis of limb-
lessness and axial patterning in snakes. Nature 399: 474–479. Rockman, M. V., M. W. Hahn, N. Soranzo, D. B. Goldstein and
G. A. Wray. 2003. Positive selection on a human-specific tran-
Davidson, E. H. and D. H. Erwin. 2009. An integrated view of scription factor binding site regulating IL4 expression. Curr.
Precambrian eumetazoan evolution. Cold Spring Harb. Symp. Biol. 13: 2118–2123.
Quant. Biol. 74: 65–80.
Shapiro, M. D., and 7 others. 2004. Genetic and developmental
Gilbert, S. F. and D. Epel. 2015. Ecological Developmental Biology: basis of evolutionary pelvic reduction in three-spine stickle-
Integrating Epigenetics, Medicine, and Evolution, 2nd Ed. Sinauer backs. Nature 428: 717–723.
Associates, Sunderland, MA.
Shubin, N., C. Tabin and S. B. Carroll. 2009. Deep homology
Kuratani, S. 2009. Modularity, comparative embryology and and the origins of evolutionary novelty. Nature 457: 818–823.
evo-devo: Developmental dissection of body plans. Dev. Biol.
332: 61–69. Smith, K. 2003. Time’s arrow: Heterochrony and the evolution
of development. Int. J. Dev. Biol. 47: 613–621.
Go to www.devbio.com ...
... for Web Topics, Scientists Speak interviews, Watch Development videos, Dev Tutorials,
and complete bibliographic infor mation for all literature cited in this chapter.
Glossary
A substrate. The latter provides a surface development to a small adult form fol-
for migrating cells to travel along. lowing a transitory pronymph stage.
Abaxial muscles Muscles derived from
the lateral portions of the myotome. Adult pluripotent stem cells Stem cells Amnion “Water sac.” A membrane
in an adult organism capable of regener- enclosing and protecting the embryo
Acetylation See Histone acetylation.
ating all cell types of the adult. Example: and its surrounding amniotic fluid.
Achondroplasia Condition wherein neoblasts of planarian flatworms. Derived from the two layers of the
chondrocytes stop proliferating earlier somatopleure: ectoderm that supplies
Adult stem cell niche Niche that houses
than usual, resulting in short limbs epithelial cells, and mesoderm that gen-
adult stem cells and regulates stem cell
(achondroplasic dwarfism). Often erates the connective tissue.
self-renewal, survival, and differentia-
caused by mutations that activate the
FgfR3 gene prematurely.
tion of the progeny that leave the niche. Amniote egg Egg that develops extra-
Adult stem cells Stem cells found in the embryonic membranes (the amnion,
Acron Anterior region of the body of an chorion, allantois, and yolk sac) that
tissues of organs after the organ has
arthropod (including insects); in front of provide nourishment and other envi-
matured. Adult stem cells are usually
the mouth and includes the brain. ronmental needs to the developing
involved in replacing and repairing tis-
Acrosomal process A fingerlike pro- sues of that particular organ, forming embryo. Characteristic of the amniote
cess in the sperm head extended by the a subset of cell types. Compare with vertebrates: the reptiles and birds, in
polymerization of actin filaments dur- Adult pluripotent stem cells; Embry- which the egg typically develops in a
ing the early stages of fertilization in onic stem cells. shell outside the mother’s body; and the
sea urchins and many other species. It mammals, where the egg has become
Afferent Carrying to, as in neurons that
contains surface molecules for species- modified to develop inside the mother.
carry information to the central nervous
specific recognition between sperm and Amniotes The groups of vertebrates in
system (spinal cord and brain), from
egg. which the embryo develops an amnion
sensory receptor cells (e.g., sound waves
Acrosome (acrosomal vesicle) Cap- from the ear, light signals from the (water sac) that surrounds the body of
like organelle that, together with the retina, touch sensations from the skin); the embryo. Includes reptiles, birds, and
sperm nucleus, forms the sperm head. or vessels that carry fluid (e.g., blood) to mammals. Compare with Anamniote.
Contains proteolytic enzymes that can a structure. Amniotic fluid A secretion that serves as
digest the extracellular coats surround- a “shock absorber” for the developing
Aging The time-related deterioration of
ing the egg, allowing the sperm to gain embryo while preventing it from dry-
the physiological functions necessary
access to the egg cell membrane, to ing out.
for survival and reproduction.
which it fuses.
Allantois In amniote species, extraem- Ampulla Latin, “flask.” The segment of
Acrosome reaction The Ca 2+-dependent the mammalian oviduct, distal to the
fusion of the acrosome with the sperm bryonic membrane that stores urinary
wastes and helps mediate gas exchange. uterus and near the ovary, where fertil-
cell membrane, resulting in exocytosis ization takes place.
and release of proteolytic enzymes that It is derived from splanchnopleure at
allow the sperm to penetrate the egg the caudal end of the primitive streak. Anagen The growth phase of a hair fol-
extracellular matrix and fertilize the In mammals, the size of the allantois licle, during which the hair grows in
egg. depends on how well nitrogenous length.
wastes can be removed by the chorionic Analogous Structures and/or their
Actinomyosin contractions Contractile placenta. In reptiles and birds, the allan-
forces within a cell caused by myosin respective components whose similarity
tois becomes a large sac, as there is no arises from their performing a similar
attaching to and moving along filamen- other way to keep the toxic by-products
tous actin. Examples: contractions of function rather than their arising from
of metabolism away from the develop- a common ancestor (e.g., the wing of a
muscle cells; apical constrictions of neu- ing embryo.
ral plate cells at the hinge points. butterfly vs. the wing of a bird). Com-
Allometry Developmental changes that pare with Homologous.
Actinopterygian fishes Ray-finned fish; occur when different parts of an organ-
includes teleosts. Anamniotes The fish and amphibians;
ism grow at different rates. i.e., the vertebrate groups that do not
Activins Members of the TGF-β super- Alternative nRNA splicing A means of form an amnion during embryonic
family of proteins; with Nodal, impor- producing multiple different proteins development. Compare with Amniotes.
tant in specifying the different regions from a single gene by splicing together
of the mesoderm and for distinguish- Anchor cell The cell connecting the
different sets of exons to generate dif- overlying gonad to the vulval precur-
ing the left and right body axes of ferent types of mRNAs.
vertebrates. sor cells in C. elegans. If the anchor cell
Amacrine neurons Neurons of the is destroyed, the VPCs will not form a
Adepithelial cells Cells that migrate into vertebrate neural retina that lack large vulva, but instead become part of the
the imaginal discs early in the devel- axons. Most are inhibitory. See also hypodermis.
opment of the holometabolous insect Neural retina.
larva; these cells give rise to muscles Androgen Masculinizing substance,
and nerves in the pupal stage. Ametabolous A pattern of insect devel- usually a steroid hormone such as
opment in which there is no larval testosterone.
Adhesion Attachment between cells stage and the insect undergoes direct
or between a cell and its extracellular Androgen insensitivity syndrome Inter-
sex condition in which an XY individual
G–2 Glossary
has a mutation in the gene encoding the Anterior necrotic zone A zone of pro- salamander limb and acts similarly to
androgen receptor protein that binds grammed cell death on the anterior side the apical ectodermal ridge during nor-
testosterone. This results in a female of the developing tetrapod limb that mal limb development.
external phenotype, lack of a uterus and helps shape the limb. Apicobasal axis Apical-to-basal axis.
oviducts and presence of abdominal Anterior neuropore See Neuropore. Apoptosis Programmed cell death.
testes. Anterior visceral endoderm Apoptosis is an active process that
Anencephaly A congenital defect (AVE) Mammalian equivalent to the prunes unneeded structures (e.g., frog
(almost always lethal) resulting from chick hypoblast and similar to the head tails, male mammary tissue), controls
failure to close the anterior neuropore. portion of the amphibian organizer, it the number of cells in particular tissues,
The forebrain remains in contact with creates an anterior region by secreting and sculpts complex organs (e.g., palate,
the amniotic fluid and subsequently antagonists of Nodal. retina, digits, and heart). See also Anoi-
degenerates, so the vault of the skull Anterior-posterior (anteroposterior or kis; Necrotic zones.
fails to form. AP) axis The body axis defining the Aqueous humor Nourishing fluid that
Aneuploidy Condition in which one or head versus the tail (or mouth versus bathes the lens of the vertebrate eye and
more chromosome(s) is either lacking or anus). When referring to the limb, this supplies pressure needed to stabilize the
present in multiple copies. refers to the thumb (anterior)-pinkie curvature of the eye.
Aneurogenic Devoid of any neural (posterior) axis. Archenteron The primitive gut of an
innervation. Anti-Müllerian hormone (AMH) TGF-β embryo. In the sea urchin, it is formed
Angioblasts From angio, blood vessel; family paracrine factor secreted by the by invagination of the vegetal plate into
and blast, a rapidly dividing cell (usu- embryonic testes that induces apoptosis the blastocoel.
ally a stem cell). The progenitor cells of of the epithelium and destruction of Area opaca The peripheral ring of avian
blood vessels. the basal lamina of the Müllerian duct, blastoderm cells that have not shed their
Angiogenesis Process by which the preventing formation of the uterus and deep cells.
primary network of blood vessels cre- oviducts. Also known as anti-Müllerian Area pellucida A 1-cell-thick area in the
ated by vasculogenesis is remodeled factor, or AMF. Sometimes called Mül- center of the avian blastoderm (follow-
and pruned into a distinct capillary bed, lerian-inhibiting factor (MIF). ing shedding of most of the deep cells)
arteries, and veins. Anurans Frogs and toads. Compare with that forms most of the actual embryo.
Angiopoietins Paracrine factors that Urodeles. Aromatase Enzyme that converts tes-
mediate the interaction between endo- Aorta-gonad-mesonephros region tosterone to estradiol (a form of estro-
thelial cells and pericytes. (AGM) A mesenchymal area in the gen). Excess aromatase in the environ-
Animal cap In amphibians, the roof lateral plate splanchnopleure near the ment is linked to herbicides and other
of the blastocoel (in the animal ventral aorta that produces the hemato- chemicals and is believed to contribute
hemisphere). poietic stem cells. to reproductive disorders (demasculin-
Animal hemisphere The upper half of Aortic arches These begin as sym- ization and feminization, particularly in
an egg containing the animal pole. In metrically arranged, paired vessels that male amphibians).
the amphibian embryo, the cells in the develop within the paired pharyngeal Arthrotome Mesenchymal cells in the
animal hemisphere having little yolk arches and link the ascending/ventral center of the somite that contribute to
divide rapidly and become actively and descending/dorsal paired aortae. the sclerotome, becoming the vertebral
mobile (“animated”). Some of the aortic arches degenerate. joints, the intervertebral discs, and
Animal pole The pole of the egg or Apical constriction Constriction of the those portions of the ribs closest to the
embryo where the concentration of yolk apical end of a cell, caused by localized vertebrae.
is relatively low; opposite end of the egg contraction of actinomyosin complexes Astrocytes See Astroglial cells.
from the vegetal pole. at the apical border. Astroglial cells (astrocytes) A diverse
Anoikis Rapid apoptosis that occurs Apical ectodermal fold (AEF) The ecto- class of star (astro) shaped glial cells
when epithelial cells lose their attach- derm overlying the mesenchyme of the that carry out an array of functions,
ment to the extracellular matrix. developing fish fin that promotes fin ray including establishing the blood-brain
Anorectal junction The meeting of development; derived from the original barrier, responding to inflammation
endoderm and ectoderm at the anus in apical ectodermal ridge, which becomes in the CNS, and supporting synapse
vertebrate embryos. the AEF in ray-finned fish after the homeostasis and neural transmission.
proximal patterning of the stylopod. Autocrine interaction The same cells
Antennapedia complex A region of
Drosophila chromosome 3 containing Apical ectodermal ridge (AER) A ridge that secrete paracrine factors also
the homeotic genes labial (lab), Anten- along the distal margin of the limb respond to them.
napedia (Antp), sex combs reduced (scr), bud that will become a major signal- Autonomous specification A mode of
deformed (dfd), and proboscipedia (pb), ing center for the developing limb. cell commitment in which the blasto-
which specify head and thoracic seg- Its roles include (1) maintaining the mere inherits a determinant, usually
ment identities. mesenchyme beneath it in a plastic, pro- a set of transcription factors from the
liferating state that enables the linear egg cytoplasm, and these transcrip-
Anterior heart field Cells of the heart (proximal-distal) growth of the limb;
field forming the outflow tract (conus tion factors regulate gene expression to
(2) maintaining the expression of those direct the cell into a particular path of
and truncus arteriosus, right ventricle). molecules that generate the anterior-
Anterior intestinal portal (AIP) The development.
posterior axis; and (3) interacting with
posterior opening of the developing the proteins specifying the anterior- Autophagy Intracellular system that
foregut region of the primitive gut tube; posterior and dorsal-ventral axes so that removes and replaces damaged organ-
it opens into the future midgut region each cell is given instructions on how to elles and senescent cells.
which is contiguous with the yolk sac at differentiate. Autopod The distal bones of a verte-
this stage. Apical epidermal cap (AEC) Forms in brate limb: carpals and metacarpals
the wound epidermis of an amputated (forelimb), tarsals and metatarsals
Glossary G–3
(hindlimb), and phalanges (“digits”; the Bicoid Anterior morphogen critical for their synaptonemal complex during
fingers and toes). establishing anterior-posterior polarity prophase of the first meiotic division.
Axial protocadherin A type of proto- in the Drosophila embryo. Functions as a Also called a tetrad.
cadherin expressed in the presumptive transcription factor to activate anterior- Blastocoel A fluid-filled cavity of the
notochord cells that allow them to sepa- specific gap genes and as a translational blastula stage of an embryo.
rate from the paraxial (somite-forming) repressor to suppress posterior-specific Blastocyst A mammalian blastula. The
mesoderm to form the notochord. gap genes. blastocoel is expanded and the inner
Found in amphibian embryos. See Bilaminar germ disc An amniote cell mass is positioned on one side of
Protocadherin. embryo prior to gastrulation; consists of the ring of trophoblast cells.
Axon Thin extension of the nerve cell epiblast and hypoblast layers. Blastoderm The layer of cells formed
body. Transmits signals (action poten- Bilateral holoblastic cleavage Cleavage during cleavage at the animal pole in
tials) to targets in the central and pattern, found primarily in tunicates, telolecithal eggs, as in fish, reptiles, and
peripheral nervous systems. Axonal in which the first cleavage plane estab- birds. Because the yolk concentrated in
migration is crucial to development of lishes the right-left axis of symmetry in the vegetal region of the egg impedes
the vertebrate nervous system. the embryo and each successive division cleavage, only the small amount of yolk-
Axoneme The portion of a cilium or orients itself to this plane of symmetry. free cytoplasm at the animal pole is able
flagellum consisting of two central Thus the half-embryo formed on one to divide in these eggs. During develop-
microtubules surrounded by a row of side of the first cleavage plane is the ment, the blastoderm spreads around
9 doublet microtubules. The motor mirror image of the other side. the yolk as it forms the embryo.
protein dynein attached to the doublet Bilaterians (triploblasts) Those ani- Blastodisc Small region at the animal
microtubules provides the force for cili- mals characterized by bilaterian body pole of the telolecithal eggs of fish,
ary and flagellar function. symmetry and the presence of three birds, and reptiles, containing the yolk-
germ layers (endoderm, ectoderm, and free cytoplasm where cleavage can
B mesoderm). Includes all animal groups occur and that gives rise to the embryo.
except the sponges, cnidarians, cteno- Following cleavage, the blastodisc
Basal disc The “foot” of a hydra; phores, and placozoans.
enables the animal to stick to rocks or becomes the blastoderm.
the undersides of pond plants. Bindin A 30,500-Da protein on the acro- Blastomere A cleavage-stage cell result-
somal process of sea urchin sperm that ing from mitosis.
Basal lamina Specialized, closely knit mediates the species-specific recogni-
sheets of extracellular matrix that Blastopore The invagination point
tion between the sperm and the egg where gastrulation begins. In deutero-
underlie epithelia, composed largely of vitelline envelope during fertilization.
laminin and type IV collagen. Epithelial stomes, this marks the site of the anus.
cells adhere to the basal lamina in part Bindin receptors Species-specific recep- In protostomes, this marks the site of
via binding between integrins and lam- tors on the vitelline envelope of sea the mouth.
inin. Sometimes called the basement urchin eggs that bind to the bindin on Blastula Early-stage embryo consisting
membrane. the acrosomal process of sperm during of a sphere of cells surrounding an inner
fertilization. fluid-filled cavity, the blastocoel.
Basal layer (stratum germinativum) The
inner layer of both the embryonic and Biofilm Mats of microorganisms, such as Blood islands Aggregations of heman-
adult epidermis. This layer contains bacteria, that generate an extracellular gioblasts in the splanchnic mesoderm. It
epidermal stem cells attached to a base- matrix. These regulate larval settlement is generally thought that the inner cells
ment membrane. of many marine invertebrate species. of these blood islands become blood
Basal transcription factors Transcrip- Bipolar interneurons Neurons in the progenitor cells, while the outer cells
tion factors that specifically bind to neural retina, positioned between the become angioblasts.
the CpG-rich sites, forming a “saddle” photoreceptors (rods and cones) and BMP family See Bone morphogenetic
that can recruit RNA polymerase II and ganglion cells for transmitting signals proteins.
position it for transcription. from the photoreceptors to the ganglion
cells. BMP4 A protein in the BMP family, used
Basic fibroblast growth factor extensively in neural development; for
(Fgf2) One of three growth fac- Bipotential (indifferent) gonad Com- example, BMP4 is produced by target
tors required for the generation of mon precursor tissue derived from the organs innervated by the trigeminal
hemangioblasts from the splanchnic genital ridge in mammals, from which nerve and causes differential growth
mesoderm. See also Angiopoietins; the male and female gonads diverge. and differentiation of the neurons. Also
Vascular endothelial growth factors Bisphenol A (BPA) Synthetic estrogenic involved in bone differentiation. See
(VEGFs). chemical compound used in plastics and Bone morphogenetic proteins.
β-Catenin A protein that can act as an flame retardants. BPA has been associ- Bone marrow-derived stem cells
anchor for cadherins or as a transcrip- ated with meiotic defects, reproductive (BMDCs) See Mesenchymal stem
tion factor (induced by the Wnt path- abnormalities, and precancerous condi- cells.
way). It is important in the specification tions in rodents.
Bone morphogenetic proteins (BMPs)
of germ layers throughout the animal Bithorax complex The region of Dro- Members of the TGF-β superfamily
phyla. sophila chromosome 3 containing the of proteins. Originally identified by
Bergmann glia Type of glial cell; extends homeotic gene Ultrabithorax (Ubx), their ability to induce bone formation,
a thin process throughout the develop- which is required for the identity of the BMPs are extremely multifunctional,
ing neuroepithelium of the cerebellum. third thoracic segment, and the abdomi- having been found to regulate cell divi-
nal A (abdA) and Abdominal B (AbdB) sion, apoptosis, cell migration, and
bHLH proteins The basic helix-loop- genes, which are responsible for the
helix family of transcription factors, differentiation.
segmental identities of the abdominal
including such proteins as scleraxis, the segments. Bottle cells Invaginating cells dur-
MRFs (MyoD, Myf5, and myogenin), ing amphibian gastrulation, in which
and c-Myc. Bivalent The four chromatids of a the main body of each cell is displaced
homologous pair of chromosomes and toward the inside of the embryo while
G–4 Glossary
maintaining contact with the outside Cardiac neural crest Subregion of the into RNA, which is then translated into
surface by way of a slender neck. cranial neural crest that extends from proteins.
Brainbow Genetic method used to trig- the otic (ear) placodes to the third Central nervous system The brain and
ger the expression of different combina- somites. Cardiac neural crest cells spinal cord of vertebrates.
tions and amounts of different fluores- develop into melanocytes, neurons, Centrolecithal Type of egg, such as
cent proteins within cells, labeling them cartilage, and connective tissue. Car- those of insects, that has yolk in the
with a seeming “rainbow” of possible diac neural crest also contributes to the center and undergoes superficial
colors that can be used to identify each muscular-connective tissue wall of the cleavage.
individual cell in a tissue, organ, or large arteries (the “outflow tracts”) of
the heart, as well as contributing to the Centromere A region of a chromosome
whole embryo. where sister chromatids are attached to
Brain-derived neurotrophic factor septum that separates pulmonary circu-
lation from the aorta. each other by the kinetochore.
(BDNF) A paracrine factor that regu- Centrosome-attracting body
lates neural activity and appears to be Cardiogenic mesoderm See Heart
fields. (CAB) Cellular structure that, in some
critical for synapse formation by induc- invertebrate blastomeres, positions
ing local translation of neural messages Cardiomyocytes Cardiac cells derived the centrosomes asymmetrically and
in the dendrites. BDNF is required for from heart field tissue that form the recruits particular mRNAs so that the
the survival of a particular subset of muscular layers of the heart and its resulting daughter cells are different
neurons in the striatum (a region of the inflow and outflow tracts. sizes and have different properties.
brain involved in movement). Catagen Regression phase of the hair Cephalic Referring to the head.
Branchial arches See Pharyngeal follicle regeneration cycle.
arches. Cephalic furrow A transverse furrow
Catenins A complex of proteins that formed during gastrulation in Dro-
Brown adipose cells (brown fat) Adi- anchor cadherins inside the cell. The sophila that separates the future head
pose cells derived from the central der- cadherin-catenin complex forms the region (procephalon) from the germ
momyotome. Brown fat cells produce classic adherens junctions that help band, which will form the thorax and
heat, as opposed to white adipose cells hold epithelial cells together and, by abdomen.
that store lipids. Brown fat cells contain binding to the actin (microfilament)
numerous mitochondria and dissipate cytoskeleton of the cell, integrate the Cephalic neural crest See Cranial neu-
energy as heat instead of synthesizing epithelial cells into a mechanical unit. ral crest.
ATP. One of them, β-catenin, can also be a Chemoaffinity hypothesis Hypothesis
Bulge A region of the hair follicle that is transcription factor. put forth by Sperry in 1965 suggest-
a niche for adult stem cells. Caudal Referring to the tail. ing that nerve cells in the brain acquire
individual chemical tags that distin-
Caudal intestinal portal (CIP) The ante- guish them from one another and that
C rior opening of the developing hindgut these guide the assembly and organiza-
Cadherins Calcium-dependent adhe- region of the primitive gut tube; it opens tion of the neural circuits in the brain.
sion molecules. Transmembrane pro- into the future midgut region, which
is contiguous with the yolk sac at this Chemoattractant A biochemical that
teins that interact with other cadherins causes cells to move toward it.
on adjacent cells and are critical for stage.
Caudal progenitor zone A region in Chemotaxis Movement of a cell down
establishing and maintaining intercel- a chemical gradient, such as sperm fol-
lular connections, spatial segregation the tailbud of vertebrate embryos that
is made up of multipotent neuromeso- lowing a chemical (chemoattractant)
of cell types, and the organization of secreted by the egg.
animal form. derm progenitor cells. See also Neu-
romesoderm progenitors. Chiasmata Points of attachment
Cajal-Retzius cells Reelin-secreting between homologous chromosomes
cells in the neocortex just under the pial Cavitation In mammalian embryos, a
process whereby the trophoblast cells during meiosis that are thought to rep-
surface. Reelin directs the migration resent regions where crossing-over is
of newly born neurons toward the pial secrete fluid into the morula to cre-
ate a blastocoel. The membranes of occurring.
surface.
trophoblast cells pump sodium ions Chimera An organism consisting of a
Calorie restriction Dietary restriction as mixture of cells from two individuals.
a means of extending mammalian lon- (Na+) into the central cavity, drawing in
gevity (at the expense of fertility). water osmotically and thus creating and Chimeric embryo Embryo made from
enlarging the blastocoel. tissues of more than one genetic source.
Canalization See Robustness.
Cell adhesion molecules Adhesion ChIP-Seq Chromatin immunoprecipita-
Cancer stem cell hypothesis The molecules that hold cells together. The tion sequencing. A lab protocol used
hypothesis that the malignant part of major group of these is the cadherins. to identify the precise DNA sequences
a tumor is either an adult stem cell that See also Cadherins. bound by particular transcription fac-
has escaped the control of its niche tors or nucleosomes containing specific
or a more differentiated cell that has Cell lineage The series of cell types
starting from an undifferentiated, plu- modified histones.
regained stem cell properties.
ripotent stem cell through stages of Chondrocyte-like osteoblasts Cranial
Cap sequence See Transcription ini- increasing differentiation to the termi- neural crest cells undergoing early
tiation site. nally differentiated cell type. stages of intramembranous ossification.
Capacitation The set of physiological Cellular blastoderm Stage of Drosophila These cells downregulate Runx2 and
changes by which mammalian sperm development in which all the cells are begin expressing the osteopontin gene,
become capable of fertilizing an egg. arranged in a single-layered jacket giving them a phenotype similar to a
Cardia bifida A condition in which two around the yolky core of the egg. developing chondrocyte.
separate hearts form, resulting from Central dogma The explanation of the Chondrocytes Cartilage cells.
manipulation of the embryo or genetic transfer of information coded in DNA Chondrogenesis Formation of cartilage,
defects that prevent fusion of the two to make proteins: DNA is transcribed in which chondrocytes differentiate
endocardial tubes. from condensed mesenchyme.
Glossary G–5
Chordamesoderm Axial mesoderm in Cleavage furrow A groove formed in the the lysosome instead of permitting their
a chordate embryo that produces the cell membrane in a dividing cell due to expression in the cell membrane.
notochord. tightening of the microfilamentous ring. Commitment Describes a state in which
Chordate An animal that has, at some Cloaca Latin, “sewer.” An endodermally a cell’s developmental fate has become
stage of its life cycle, a notochord and a lined chamber at the caudal end of the restricted even though it is not yet dis-
dorsal nerve cord or neural tube. embryo that will become the receptacle playing overt changes in cellular bio-
Chordin A paracrine factor with orga- for waste from the intestine and the chemistry and function.
nizer activity. Chordin binds directly kidneys and products from the gonads. Committed stem cells Includes mul-
to BMP4 and BMP2 and prevents their Amphibians, reptiles, and birds retain tipotent and unipotent stem cells that
complexing with their receptors, thus this organ and use it to void gametes have the potential to become any of a
inducing dorsal ectoderm to form neural and both liquid and solid wastes. In relatively few cell types (multipotent) or
tissue. mammals, the cloaca becomes divided only one cell type (unipotent).
Chorioallantoic membrane Forms in by a septum into the urogenital sinus Compaction A unique feature of mam-
some amniote species, such as birds, by and the rectum. malian cleavage, mediated by the cell
fusion of the mesodermal layer of the Cloacal membrane At the caudal end of adhesion molecule E-cadherin. The cells
allantoic membrane with the mesoder- the hindgut formed by closely apposed in the early (around eight-cell) embryo
mal layer of the chorion. This extremely endoderm and ectoderm; future site of change their adhesive properties and
vascular envelope is crucial for bird the anus. become tightly attached to each other.
development and is responsible for Cloning See Somatic cell nuclear Comparative embryology Study of how
transporting calcium from the eggshell transfer. anatomy changes during the develop-
into the embryo for bone production. Clonogenic neoblasts (cNeoblasts) ment of different organisms.
Chorion An extraembryonic membrane Pluripotent stem cells in flatworms that Compensatory regeneration Form of
essential for gas exchange in amniote migrate to a wound site and regenerate regeneration in which the differentiated
embryos. It is generated from the extra- the tissue; form the regeneration blas- cells divide but maintain their differen-
embryonic somatopleure. The chorion tema of flatworms. tiated functions (e.g., mammalian liver).
adheres to the shell in birds and reptiles, cNeoblasts See Clonogenic neoblasts. Competence The ability of cells or tis-
allowing the exchange of gases between
Coelom Space between the somatic sues to respond to a specific inductive
the egg and the environment. It forms
mesoderm and splanchnic mesoderm signal.
the embryonic/fetal portion of the pla-
that becomes the body cavity. In mam- Conditional specification The ability
centa in mammals.
mals, the coelom becomes subdivided of cells to achieve their respective fates
Chorionic villus sampling Taking a into the pleural, pericardial, and peri- by interactions with other cells. What a
sample from the placenta at 8–10 weeks toneal cavities, enveloping the thorax, cell becomes is in large measure speci-
of gestation to grow fetal cells to be heart, and abdomen, respectively. fied by paracrine factors secreted by its
analyzed for the presence or absence
Coherence Scientific evidence that fits neighbors.
of certain chromosomes, genes, or
into a system of other findings and is Cones Color-sensitive photoreceptor
enzymes.
therefore more readily accepted. cells in the neural retina. See Neural
Chromatid Half of a mitotic pro-
Cohesin proteins Protein rings that retina.
phase chromosome, which consists
encircle the sister chromatids dur- Congenital adrenal hyperplasia A con-
of duplicate “sister” chromatids that
ing meiosis, provide a scaffold for the dition causing female pseudohermaph-
are attached to each other by the
assembly of the meiotic recombination roditism due to the presence of excess
kinetochore.
complex, resist the pulling forces of the testosterone.
Chromatin The complex of DNA and spindle microtubules, and thereby keep
protein in which eukaryotic genes are Congenital defect Any defect that an
the sister chromatids attached during individual is born with. Congenital
contained. the first meiotic division and promote defects can be hereditary. or they can
Chromosome diminution The fragmen- pairing of homologous chromosomes, have an environmental cause (e.g.,
tation of chromosomes just prior to cell allowing recombination. exposure to teratogenic plants, drugs,
division, resulting in cells in which only Collective migration Migration of self- chemicals, radiation, etc.). They can also
a portion of the original chromosome propelled cells exerting directionally be idiopathic (i.e., cause is unknown).
survives. Chromosome diminution coordinated forces upon one another,
occurs during cleavage in Parascaris Conjoined twins Monozygotic twins
as opposed to individually migrating that share some part of their bodies;
aequorum in the cells that will generate cells or the movement of a group of cells
the somatic cells while the future germ they may even share a vital organ, such
caused by tissue pushing due to prolif- as a heart or liver.
cells are protected from this phenom- eration or intercalation.
enon and maintain an intact genome. Consensus sequence When referring
Combinatorial association In devel- to an intron, these are located at the 5′
Ciliary body A vascular structure at the opmental genetics, the principle that
junction between the neural retina and and 3′ ends of the introns that signal the
enhancers contain regions of DNA that “splice sites” of the intron.
the iris that secretes the aqueous humor. bind transcription factors, and it is this
Cis-regulatory elements Regulatory combination of transcription factors that Conserved dopamine neurotrophic
elements (promoters and enhancers) activates the gene. factor (CDNF) A neurotrophin that
that reside on the same stretch of DNA enhances the survival of the mid-
Commensalism A symbiotic relation- brain dopaminergic neurons. See also
as the gene they regulate. ship that is beneficial to one partner and Neurotrophin.
Cleavage A series of rapid mitotic cell neither beneficial nor harmful to the
divisions following fertilization in many other partner. Contact inhibition of locomotion The
early embryos; cleavage divides the mechanism whereby cells are prohib-
Commissureless (Comm) An endo- ited from forming locomotory pseu-
embryo without increasing its mass. somal protein in Drosophila, expressed dopodia along contact surfaces with
in axons prior to their crossing the mid- other cells. These interactions with the
line; functions to route Robo proteins to
G–6 Glossary
cell membranes of other cells prevent and most mammals. A mechanical Crossing over The exchange of genetic
“backward” migration over other cells block to polyspermy that in sea urchins material during meiosis, whereby genes
and result in “forward” migration of the becomes complete about a minute after from one chromatid are exchanged with
leading edge of cells. successful sperm-egg fusion, in which homologous genes from another.
Context dependency The meaning or enzymes from the egg’s cortical gran- Crown cells Cells neighboring the nodal
role of an individual component of a ules contribute to the formation of a cells, critical to setting up the left-right
system (such as a transcription factor) is fertilization envelope that blocks further axis in the mammalian embryo. Crown
dependent on its context. For example, sperm entry. cells each have a single immobile cilium
in the formation of tetrapod limb joints, Cortical granules Membrane-bound, that senses the left-to-right movement
the same BMPs can induce either cell Golgi-derived structures located in the of fluids caused by the motile cilia on
death or cell differentiation, depending egg cortex; contain enzymes and other node cells. This sets up a cascade of
on the stage of the responding cell. components. The exocytosis of these events within the crown cells that serve
Conus arteriosus Cardiac outflow tract; granules at fertilization is homologous to maintain Nodal expression on the
along with the truncus arteriosus will to the exocytosis of the acrosome in left side, where it can activate Pitx1
become the base of the aorta and pul- sperm in the acrosome reaction. genes, which determine the left- and
monary arteries. Cortical plate The layer of cells in the right-sidedness.
Convergent extension A phenomenon developing cerebrum of mammals Crypt A deep tubular recess or pit.
wherein cells intercalate to narrow the formed by neurons in the ventricular Example: intestinal crypts between the
tissue and at the same time move it zone migrating outward along radial intestinal villi.
forward. Mechanism used for elonga- glial processes to a position near the Crystallins Transparent, lens-specific
tion of the archenteron in the sea urchin outer surface of the brain, where proteins.
embryo, notochord of the tunicate they will set up the six layers of the Cumulus A layer of cells surrounding
embryo, and involuting mesoderm of neocortex. the mammalian egg, made up of ovar-
the amphibian. This movement is remi- CpG islands Regions of DNA rich in ian follicular (granulosa) cells that nur-
niscent of traffic on a highway when the CpG sequence: a cytosine and a ture the egg until it is released from the
several lanes must merge to form a guanosine connected by a normal phos- ovary. The innermost layer of cumulus
single lane. phate bond. Promoters often contain cells, the corona radiate, is released with
Coordinated gene expression The such islands, and transcription is often the egg at ovulation.
simultaneous expression of many differ- initiated nearby, possibly because they Cutaneous appendages Species-
ent genes in a specific cell type. Its basis bind the basal transcription factors that specific epidermal modifications that
is often a single transcription factor recruit RNA polymerase II. include hairs, scales, scutes, feathers,
(e.g., Pax6) that is crucial to several dif- Cranial (cephalic) neural crest Neural hooves, claws, and horns.
ferent enhancer sequences; the different crest cells in the future head region that CXCR4 The receptor for stromal-derived
enhancers are differentially “primed,” migrate to produce the craniofacial mes- factor 1 (SDF1). See also Stromal-
and the binding of the same factor to all enchyme, which differentiates into the derived factor 1.
of them activates all the genes at once. cartilage, bone, cranial neurons, glia,
and connective tissues of the face. These Cyclic adenosine 3′,5′-monophosphate
Cornified layer (stratum corneum) The (cAMP) An important component of
outer layer of the epidermis, consisting cells also enter the pharyngeal arches
and pouches to give rise to thymic cells, several intracellular signaling cascades
of keratinocytes that are now dead, flat- and the soluble chemotactic substance
tened sacs of keratin protein with their the odontoblasts of the tooth primordia,
and the bones of the middle ear and jaw. that directs the aggregation of the myx-
nuclei pushed to one edge of the cell. amoebae of Dictyostelium to form a grex.
These cells are continually shed through- Cranial sensory placodes Ectoder-
out life and are replaced by new cells. mal thickenings that form in the cra- Cyclin B The larger subunit of mitosis-
nial region of the vertebrate embryo; promoting factor, shows the cyclical
Corona radiata The innermost layer of behavior that is key to mitotic regula-
cumulus cells around a mammalian includes the olfactory (nasal), otic (ear),
and lens (eye) placodes, and placodes tion, accumulating during S and being
egg, immediately adjacent to the zona degraded after the cells have reached M.
pellucida. that give rise to sensory neurons of vari-
ous cranial nerves. Also called cranial Cyclin B regulates the small subunit of
Corpora allata Insect glands that secrete MPF, the cyclin-dependent kinase.
juvenile hormone (JH) during larval ectodermal placodes.
Craniorachischisis The failure of the Cyclin-dependent kinase Small subunit
molts. of MPF, activates mitosis by phosphory-
Correlative evidence Evidence based entire neural tube to close.
lating several target proteins, including
on the association of events. The “find Cranium The vertebrate skull, composed histones, the nuclear envelope lamin
it” of “find it, lose it, move it.” See also of the neurocranium (skull vault and proteins, and the regulatory subunit of
Gain-of-function evidence; Loss-of- base) and the viscerocranium (jaws and cytoplasmic myosin, resulting in chro-
function evidence. other pharyngeal arch derivatives). matin condensation, nuclear envelope
Cortex An outer structure (in contrast Cre-lox A site-specific recombinase depolymerization, and the organization
with medulla, an inner structure). technology that allows control over the of the mitotic spindle. Requires cyclin B
Cortical cytoplasm A thin layer of spatial and temporal pattern of a gene to function.
gel-like cytoplasm lying immediately knockout or gene misexpression. Cyclooxygenase-2 (COX2) An enzyme
beneath the cell membrane of a cell. In CRISPR Clustered Regularly Inter- that generates prostaglandins from the
an egg, the cortex contains high concen- spaced Short Palindromic Repeat. A fatty acid arachidonic acid.
trations of globular actin molecules that stretch of DNA in prokaryotes that Cyclopia Congenital defect character-
will polymerize to form microfilaments when transcribed into RNA serve as ized by a single eye, caused by muta-
and microvilli during fertilization. guides for recognizing segments of viral tions in genes that encode either Sonic
Cortical granule reaction The basis of DNA. Used in association with Cas9 hedgehog or the enzymes that synthe-
the slow block to polyspermy in many (CRISPR-associated enzyme 9) in a size cholesterol and can be induced by
animal species, including sea urchins method for gene editing that is relatively
fast and inexpensive.
Glossary G–7
certain chemicals that interfere with the D descent from a common ancestor and
cholesterol biosynthetic enzymes. to explain adaptations to the conditions
Dauer larva A metabolically dormant
Cystoblasts/cystocytes Derived from larval stage in C. elegans. See also of particular environments by natural
the asymmetric division of the germline Diapause. selection.
stem cells of Drosophila, a cystoblast
Decidua The maternal portion of the Determination The stage of commitment
undergoes four mitotic divisions with following specification; the determined
placenta, made from the endometrium
incomplete cytokinesis to form a cluster stage, assumed irreversible, is when a
of the uterus.
of 16 cystocytes (one ovum and 15 nurse cell or tissue is capable of differentiating
cells) interconnected by ring canals. Deep cells A population of cells in the autonomously even when placed into a
zebrafish blastula between the envelop- non-neutral environment.
Cytokines Paracrine factors impor-
ing layer (EVL) and the yolk syncytial
tant in cell signaling and the immune
layer (YSL) that give rise to the embryo Determination front Equivalent to the
response. During blood formation, they “wavefront” of the “clock-wavefront”
proper.
are collected and concentrated by the model for somite formation; where
extracellular matrix of the stromal (mes- Deep homology Signal transduction boundaries of somites form, determined
enchymal) cells at the sites of hemato- pathways composed of homologous by a caudal HIGH-to-rostralLOW gradient of
poiesis and are involved in blood cell proteins arranged in a homologous FGF in the presomitic mesoderm.
and lymphocyte formation. manner that are used for the same
Determined Committed to a given fate.
function in both protostomes and
Cytokinesis The division of the cell A cell is determined if it maintains its
deuterostomes.
cytoplasm into two daughter cells. The developmental maturation toward its
mechanical agent of cytokinesis is a Definitive endoderm The endoderm fate even when placed in a new environ-
contractile ring of microfilaments made that enters the interior of the amniote ment. See also Determination.
of actin and the motor protein myosin. embryo through the primitive streak
Deuterostomes In the deuterostome
Each daughter cell receives one of the during gastrulation, replacing the
animal groups (including echinoderms,
nuclei produced by nuclear division visceral endoderm, which is primar-
tunicates, cephalochordates, and verte-
(karyokinesis). ily forming the yolk sac and allantois
brates), during embryonic development
along with the splanchnic lateral plate
Cytonemes Specialized filopodial the first opening (i.e., the blastopore)
mesoderm.
projections that extend out from a cell becomes the anus while the second
(sometimes more than 100 μm) to make Delamination The splitting of one cel- opening becomes the mouth (hence,
contact with another cell producing a lular sheet into two more or less parallel deutero stoma, “mouth second”). Com-
paracrine factor. Paracrine factors may sheets. pare with Protostomes.
be delivered to target cells by attaching Delta protein Cell surface ligand for Development The process of progres-
to receptors on the tips of cytonemes Notch; participates in juxtacrine interac- sive and continuous change that gener-
and traveling down the length of the tion and activation of the Notch pathway. ates a complex multicellular organism
cytonemes to the body of the target Dendrites The fine, branching exten- from a single cell. Development occurs
cells. A cytoneme can also extend from sions (dendritic arbor) emanating from throughout embryogenesis, maturation
a cell producing a paracrine factor to neurons; dendrites pick up electric to the adult form, and continues into
make contact with a target cell. impulses from other cells. senescence.
Cytoplasmic bridges Continuity Dendritic arbor Extensive branching Developmental biology The discipline
between adjacent cells that results from found in the dendrites of some neurons, that studies embryonic and other devel-
incomplete cytokinesis, e.g., during such as Purkinje neurons. opmental processes, such as replace-
gametogenesis. Dental lamina A broad epidermal thick- ment of old cells by new, regeneration,
Cytoplasmic determination factors ening in the jaw that later resolves into metamorphosis, aging, and develop-
Factors found in the cytoplasm of a cell separate placodes, which together with ment of disease states such as cancer.
that determine cell fate. Example: gradi- the underlying mesenchyme form teeth. Developmental constraints In evolu-
ents of different cytoplasmic determina- Dermal bone Bone that forms in the tion, the limitation of the number and
tion factors that dictate cell fate along dermis of the skin, such as most of the forms of possible phenotypes that can
the anterior-posterior axis are found bones of the skull and face. They can be be created by the interactions that are
in the syncytial blastoderm of the Dro- derived from head mesoderm or cranial possible among molecules and between
sophila embryo. neural crest-derived mesenchymal cells. modules in the developing organism.
Cytoplasmic polyadenylation-element- Dermal papilla A component of mes- Developmental plasticity The ability of
binding-protein (CPEB) Protein that enchymal-epithelial induction during an embryo or larva to react to an envi-
binds to mRNA in the 3′ UTR and helps hair formation; a small node formed by ronmental input with a change in form,
to control translation. When phosphor- dermal fibroblasts beneath the epidermal state, movement, or rate of activity (i.e.,
ylated, it allows for the elongation of the hair germ that stimulates proliferation of phenotypic change).
polyadenine (polyA) tail on the mRNA. the overlying epidermal basal stem cells, Dextral coiling Right-coiling. In a snail,
Cytotrophoblast Mammalian extra- which will give rise to the hair shaft. having its coils open to the right of its
embryonic epithelium composed of the Dermatome The central portion of the shell. See also Sinistral coiling.
original trophoblast cells, it adheres to dermomyotome that produces the pre- Diacylglycerol (DAG) Second messen-
the endometrium through adhesion cursors of the dermis of the back and a ger generated in the IP3 pathway from
molecules and, in species with invasive population of muscle cells. membrane phospholipid phosphati-
placentation such as the mouse and dylinositol 4,5-bisphosphate (PIP2),
Dermomyotome Dorsolateral portion of
human, secretes proteolytic enzymes along with IP3. DAG activates protein
the somite that contains skeletal muscle
that enable the cytotrophoblast to enter kinase C, which in turn activates a
progenitor cells (including those that
the uterine wall and remodel the uterine protein that exchanges sodium ions for
migrate into the limbs) and the cells that
blood vessels so that the maternal blood hydrogen ions, raising the pH within
generate the dermis of the back.
bathes fetal blood vessels. the cell.
Descent with modification Darwin’s
theory to explain unity of type by
G–8 Glossary
Diakinesis Greek, “moving apart.” In to revert to differentiation rather than Certain cytosine residues that are fol-
the first meiotic division, the stage that continued proliferation. lowed by guanosine residues are meth-
marks the end of prophase I, when the Digestive tube The primitive gut of the ylated and the resulting methylcytosine
nuclear envelope breaks down and embryo, which extends the length of stabilizes nucleosomes and prevents
chromosomes migrate to the metaphase the body from the pharynx to the clo- transcription factors from binding.
plate. aca. Buds from the digestive tube form Important in X chromosome inactiva-
Diapause A metabolically dormant, the thyroid, thymus, and parathyroid tion and DNA imprinting.
nonfeeding stage of an organism dur- glands, lungs, liver, gallbladder, and DNA-binding domain Transcription fac-
ing which development and aging are pancreas. tor domain that recognizes a particular
suspended; can occur at the embryonic, 5α-Dihydrotestosterone (DHT) A DNA sequence.
larval, pupal, or adult stage. steroid hormone derived from testos- Dorsal blastopore lip Location of
Dickkopf German, “thick head,” “stub- terone by the action of the enzyme the involuting marginal zone cells of
born.” A protein that interacts directly 5α-ketosteroid reductase 2. DHT is amphibian gastrulation. Migrating
with the Wnt receptors, preventing Wnt required for masculinization of the male marginal cells sequentially become the
signaling. urethra, prostate, penis, and scrotum. dorsal lip of the blastopore, turn inward
Dictyate resting stage The prolonged Diploblasts “Two-layer” animals; and travel along the inner surface of the
diplotene stage of the first meiotic divi- they posses endoderm and ectoderm outer animal cap cells (i.e., the blasto-
sion in mammalian primary oocytes. but most species lack true mesoderm. coel roof).
They remain in this stage until just Includes the ctenophores (comb jel- Dorsal closure A process that brings
prior to ovulation, when they complete lies) and cnidarians (jellyfish, corals, together the two sides of the epidermis
meiosis I and are ovulated as secondary hydra, sea anemones). Compare with of the Drosophila embryo at the dorsal
oocytes. Bilaterians. surface.
Diencephalon The caudal subdivision of Diplotene Greek, “double threads.” In Dorsal mesentery A derivative of the
the prosencephalon that will form the the first meiotic division, the fourth splanchnic mesoderm, this fibrous
optic vesicles, retinas, pineal gland, and and last stage of prophase I, when the membrane connects the endoderm to
the thalamic and hypothalamic brain synaptonemal complex breaks down the body wall. Involved in the looping of
regions, which receive neural input from and the two homologous chromosomes the developing intestines.
the retina. start to separate but remain attached at Dorsal root ganglia (DRG) Sensory
Diethylstilbestrol (DES) A potent envi- points of chiasmata where crossing-over spinal ganglia derived from the trunk
ronmental estrogen. DES administra- is occurring. Follows pachytene stage. neural crest that migrate along the ven-
tion to pregnant women interferes with Direct development Embryogenesis tral pathway and stay in the sclerotome.
sexual and gonadal development in characterized by the lack of a larval Sensory neurons of the DRG connect
their female offspring resulting in infer- stage, where the embryo proceeds to centrally with neurons in the dorsal
tility, subfertility, ectopic pregnancies, construct a small adult. horn of the spinal cord.
adenocarcinomas, and other effects. Discoidal cleavage Meroblastic cleav- Dorsal-ventral (dorsoventral or DV)
Differential adhesion hypothesis A age pattern for telolecithal eggs, in axis The plane defining the back (dor-
model explaining patterns of cell sort- which the cell divisions occur only in sum) versus the belly (ventrum). When
ing based on thermodynamic principles. the small blastodisc, as in birds, reptiles, referring to the limb, this axis refers
Cells interact so as to form an aggregate and fish. to the knuckles (dorsal) and palms
with the smallest interfacial free energy Disruption Abnormality or congenital (ventral).
and therefore, the most thermodynami- defect caused by exogenous agents Dorsolateral hinge points (DLHPs) In
cally stable pattern. (teratogens) such as plants, chemicals, the formation of the avian and mamma-
Differential gene expression A basic viruses, radiation, or hyperthermia. lian neural tube, two hinge regions in
principle of developmental genetics: Dissociation The ability of one mod- the lateral sides of the neural plate that
In spite of the fact that all the cells of ule to develop differently from other bend the two sides of the plate inward
an individual body contain the same modules. toward each other after the medial
genome, the specific proteins expressed Distal tip cell A single nondividing cell hinge point (MHP) has bent the plate
by the different cell types are widely located at the end of each gonad in C. along its midline.
diverse. Differential gene expression, elegans that maintains the nearest germ Dorsolateral pathway Pathway taken
differential nRNA processing, differen- cells in mitosis by inhibiting their going by trunk neural crest cells traveling
tial mRNA translation, and differential into meiosis. dorsolaterally beneath the ectoderm to
protein modification all work to allow become melanocytes.
the extensive differentiation of cell Dizygotic twins “Two eggs.” Twins that
result from two separate but approxi- Dosage compensation Equalization of
types.
mately simultaneous fertilization expression of X chromosome-encoded
Differential RNA processing The splic- events. Genetically such “fraternal” gene products in male and female cells.
ing of mRNA precursors into messages (Latin frater, “brother”) twins are full Can be achieved by (1) doubling the
that specify different proteins by using siblings. Compare with Monozygotic transcription rate of the male X chromo-
different combinations of potential twins. somes (Drosophila), (2) partially repress-
exons. ing both X chromosomes (C. elegans), or
Dmrt1 Protein that in birds, frogs, and
Differentiation The process by which fish appears to activate Sox9, the central (3) inactivating one X chromosome in
an unspecialized cell becomes special- male-determining gene in vertebrates. each female cell (mammals).
ized into one of the many cell types that Dmrt1 is also needed for maintaining Double-negative gate A mechanism
make up the body. testicular structures in mammals. whereby a repressor locks the genes
Differentiation therapy Treatments for DNA methylation A method of control- of specification, and these genes can
cancer that use transcription factors and ling the level of gene transcription in be unlocked by the repressor of that
other molecules to “normalize” can- vertebrates by the enzymatic methyla- repressor. (In other words, activation by
cers—that is, to cause cancerous cells tion of the promoters of inactive genes. the repression of a repressor.)
Glossary G–9
Doublesex (Dsx) A Drosophila gene to, and almost identical in structure to, Embryo A developing organism prior to
active in both males and females, thyroid hormone receptors. birth or hatching. In humans, the term
but whose RNA transcript is spliced Ecdysozoans One of the two major embryo generally refers to the early
in a sex-specific manner to produce protostome groups; characterized by stages of development, starting with the
sex-specific transcription factors: the exoskeletons that periodically molt. fertilized egg until the end of organo-
female-specific transcription factor acti- The arthropods (including insects and genesis (first 8 weeks of gestation). After
vates female-specific genes and inhibits crustaceans) and the nematodes (round- this, the developing human is called a
male development; the male-specific worms, including the model organism fetus until its birth.
transcription factor inhibits female traits C. elegans) are two prominent groups. Embryogenesis The stages of develop-
and promotes male traits. See also Lophotrochozoans. ment between fertilization and hatching
Down syndrome Syndrome caused by Ecomorph See Morph. (or birth).
having an extra copy of chromosome Ectoderm Greek ektos, “outside.” The Embryology The study of animal devel-
21 in humans; includes anomalies such cells that remain on either the outside opment from fertilization to hatching
as facial muscle changes, heart and gut (amphibian) or dorsal (avian, mam- or birth.
abnormalities, and cognitive problems. malian) surface of the embryo following Embryonic axis Any of the positional
Ductus arteriosus A vessel that forms gastrulation. Of the three germ layers, axes in an embryo; includes anterior-
from left aortic arch VI, serves as a the ectoderm forms the nervous system posterior (head-tail), dorsal-ventral
shunt between the embryonic/fetal pul- from the neural tube and neural crest; (back-belly), and right-left.
monary artery and the descending aorta also generates the epidermis covering Embryonic epiblast In mammals, the
in mammals. It normally closes at birth the embryo. epiblast cells that contribute to the
(if not, a pathological condition results Ectodermal appendage placodes embryo proper that split off from the
called patent ductus arteriosus). Thickenings of the epidermal ectoderm epiblast cells that line the amniotic
Duplication and divergence Tandem involved in forming non-sensory struc- cavity.
gene duplications resulting from repli- tures such as hair, teeth, feathers, mam- Embryonic germ cells (EGCs) Pluripo-
cation errors. Once replicated, the gene mary and sweat glands. tent embryonic cells with characteristics
copies can diverge by random mutations Ectodermal appendages Structures of the inner cell mass derived from
developing different expression patterns that form from specific regions of epi- PGCs that have been treated particu-
and new functions. dermal ectoderm and underlying mes- lar paracrine factors to maintain cell
Dynein A motor protein that travels enchyme through a series of interactive proliferation.
along microtubules. It is an ATPase, an inductions; includes hairs, scales, scutes Embryonic period In human develop-
enzyme that hydrolyzes ATP, convert- (such as the coverings of turtle shells), ment, the first 8 weeks in utero prior to
ing the released chemical energy into teeth, sweat glands, mammary glands, the fetal period; the time during which
mechanical energy. In cilia and flagella, and feathers. most organ systems form.
dynein is attached to the axoneme Ectodermal placodes Thickenings of
microtubules that provides the force for Embryonic shield A localized thicken-
the surface ectoderm in embryos that ing on the future dorsal side of the fish
propulsion by allowing the active slid- become the rudiment of numerous
ing of the outer doublet microtubules, embryo; functionally equivalent to the
organs. Includes cranial placodes, ecto- dorsal blastopore lip of amphibians.
causing the flagellum or cilium to bend. dermal appendage placodes.
Dysgenesis Greek, “bad beginning.” Embryonic stem cells (ESCs) Pluripo-
Ectodysplasin (EDA) cascade A tent stem cells of the mammalian inner
Refers to defective development. gene cascade specific for cutaneous cell mass blastomeres that are capable of
appendage formation. Vertebrates with generating all the cell types of the body.
E dysfunctional EDA proteins exhibit a Emergent properties See Level-specif-
20E See 20-Hydroxyecdysone. syndrome called anhidrotic ectodermal ic properties and emergence.
Early allocation and progenitor expan- dysplasia characterized by absent or
malformed cutaneous appendages (hair, EMT See Epithelial-to-mesenchymal
sion model An alternative to the transition.
progress zone model of proximal-distal teeth, and sweat glands).
Efferent Carried away from. Often Enamel knot The signaling center for
specification of the limb, wherein the
used in reference to neurons that carry tooth development, a group of cells
cells of the entire early limb bud are
information away from the central ner- induced in the epithelium by the neural
already specified; subsequent cell
vous system (brain and spinal cord) to crest-derived mesenchyme that secretes
divisions simply expand these cell
be acted on by the peripheral nervous paracrine factors that pattern the cusp
populations.
system (muscles), or a vessel that carries of the tooth.
E-cadherin A type of cadherin expressed
fluid away from a structure. Compare Endoblast See Secondary hypoblast.
in epithelial tissues as well as all early
mammalian embryonic cells (the E with Afferent. Endocardial cushions Tissue in the
stands for epithelial). See Cadherins. Efferent ducts Ducts that link the rete developing vertebrate heart derived
testis to the Wolffian duct, formed from from the endocardium. It forms the
Ecdysone Insect steroid hormone,
remodeled tubules of the mesonephric septa that divide the atrioventricular
secreted by the prothoracic glands,
kidney. area of the originally tubular heart into
that is modified in peripheral tissues
Egg chamber An ovariole or egg tube left and right atria and ventricles in
to become the active molting hormone
(over a dozen per ovary) in which the amniotes; in amphibians, it separates
20-hydroxyecdysone. Crucial to insect
Drosophila oocyte will develop, contain- the two atria (the ventricle remains
metamorphosis.
ing 15 interconnected nurse cells and a undivided; in fish, all chambers remain
Ecdysone receptor Nuclear protein undivided). The endocardial cushions
that binds to ecdysone in insects; when single oocyte.
also form the atrioventricular valves.
bound it forms an active complex with Egg jelly A glycoprotein meshwork out-
side the vitelline envelope in many spe- Endocardium The internal lining of the
another protein that binds to DNA,
cies, most commonly it is used to attract heart chambers, derived from the heart
inducing transcription of ecdysone-
and/or to activate sperm. fields.
responsive genes. Evolutionarily related
G–10 Glossary
Endochondral ossification Bone forma- acetyltransferases) that break up the amniotes. It also forms the avian cho-
tion in which mesodermal mesenchyme nucleosomes in the area or (2) stabiliz- rion and allantois.
becomes cartilage and the cartilage is ing the transcription initiation complex. Epiboly The movement of epithelial
replaced by bone. It characterizes the Enhancer modularity The principle that sheets (usually of ectodermal cells) that
bones of the trunk and limbs. having multiple enhancers allows a pro- spread as a unit (rather than individu-
Endocrine disruptors Hormonally tein to be expressed in several different ally) to enclose the deeper layers of the
active compounds in the environment tissues while not being expressed at all embryo. Epiboly can occur by the cells
(e.g., DES; BPS; aromatase) that can in others, according to the combina- dividing, by the cells changing their
have major detrimental effects on devel- tion of transcription factor proteins the shape, or by several layers of cells inter-
opment, particularly of the gonads. enhancers bind. calating into fewer layers. Often, all
Many endocrine disruptors are also Enteric ganglia See Parasympathetic three mechanisms are used.
obesogens (cause increased production ganglia. Epibranchial placodes A subgroup of
of fat cells and fat accumulation). cranial placodes that form in the pha-
Enterocoely The embryonic process
Endocrine factors Hormones that travel of forming the coelom by extending ryngeal region of the vertebrate embryo.
through the blood to their target cells mesodermal pouches from the gut. Gives rise to the sensory neurons of
and tissues to exert their effects. Typical of most deuterostomes. See also three cranial nerves: facial (VII), glosso-
Endoderm Greek endon, “within.” The Schizocoely. pharyngeal (IX), and vagus (X).
innermost germ layer; forms the epi- Enveloping layer (EVL) A cell popula- Epicardium The outer surface of the
thelial lining of the respiratory tract, the tion in the zebrafish embryo at the mid- heart that forms the coronary blood ves-
gastrointestinal tract, and the acces- blastula transition made up of the most sels that feed the heart, derived from the
sory organs (e.g., liver, pancreas) of superficial cells from the blastoderm, heart fields.
the digestive tract. In the amphibian which form an epithelial sheet a single Epidermal placodes The thickenings
embryo, the yolk-containing cells of the cell layer thick. The EVL is an extra- of epidermal ectoderm associated with
vegetal hemisphere become endoderm. embryonic protective covering that is ectodermal appendages. See Ectoder-
In amniote embryos, the endoderm is sloughed off during later development. mal appendage placodes.
the most ventral of the three germ lay-
Environmental integration Describes Epidermis Outer layer of the skin,
ers, and also forms the epithelium of the
the influence of cues from the environ- derived from ectoderm.
yolk sack and allantois.
ment surrounding the embryo, fetus, or Epididymis Derived from the Wolffian
Endometrium The epithelial lining of larva on their development. duct, the tube adjacent to the testis that
the uterus.
Ependyma Epithelial lining of the spi- links the efferent tubules to the ductus
Endosome A membrane-bound vesicle nal cord canal and the ventricles of the deferens.
that is internalized by a cell through brain. Epigenesis The view supported by
endocytosis. Internalizing ligand-recep-
Ependymal cells Epithelial cells that Aristotle and William Harvey that
tor complexes in endosomes is a com-
line the ventricles of the brain and canal the organs of the embryo are formed
mon mechanism in paracrine signaling.
of the spinal cord; they secrete cerebro- de novo (“from scratch”) at each
Endosteal osteoblasts Osteoblasts that spinal fluid. generation.
line the bone marrow and are responsi-
Eph receptors Receptor for ephrin Epigenetics The study of mechanisms
ble for providing the niche that attracts
ligands. that act on the phenotype without
hematopoietic stem cells (HSCs), pre-
Ephrins Juxtacrine ligands. Binding changing the nucleotide sequence of
vents apoptosis, and keeps the HSCs in
between an ephrin ligand on one cell the DNA. Specifically, these changes
a state of plasticity.
and an Eph receptor on an adjacent cell work “outside the gene” (i.e., epigeneti-
Endosymbiosis Greek, “living within.” cally) by altering gene expression rather
results in signals being sent to both
Describes the situation in which one cell than by altering the gene sequence as
cells. These signals are often those of
lives inside another cell or one organism mutation does. Epigenetic changes can
either attraction or repulsion, and eph-
lives within another. sometimes be transmitted to future
rins are often seen directing cell migra-
Endothelins Small peptides secreted by tion and defining where cell boundaries generations, a phenomenon referred to
blood vessels that have a role in vaso- are to form. As well as directing neural as epigenetic inheritance.
constriction and can direct the migra- crest cell migration, ephrins and Eph Epimorphic regeneration See
tion of certain neural crest cells as well receptors function in the formation of Epimorphosis.
as the extension of certain sympathetic blood vessels, neurons, and somites. Epimorphin A multifunctional protein:
axons that have endothelin receptors,
Epialleles Variants of chromatin struc- in the membranes of mesenchymal
e.g. targeting of neurons from the
ture that can be inherited between cells, it directs epithelial morphogene-
superior cervical ganglia to the carotid
generations. In most known cases, epi- sis; when expressed by sclerotome cells,
artery.
alleles are differences in DNA methyla- it acts to attract further prechondrogenic
Endothelium The single-layer sheet tion patterning that are able to affect the sclerotome cells to the region of the
of epithelial cells lining of the blood germ line and thereby be transmitted to notochord and neural tube, where the
vessels. offspring. cells form vertebrae.
Energids In Drosophila, the nuclei at the Epiblast The outer layer of the thickened Epimorphosis Form of regeneration
periphery of the syncytial blastoderm margin of the epibolizing blastoderm observed when adult structures under-
and their associated cytoplasmic islands in the gastrulating fish embryo or the go dedifferentiation to form a relatively
of cytoskeletal proteins. upper layer of the bilaminar gastrulat- undifferentiated mass of cells that then
Enhancer A DNA sequence that con- ing embryonic disc in amniotes (rep- redifferentiates to form the new struc-
trols the efficiency and rate of tran- tiles, birds and mammals. The epiblast ture (e.g., amphibian limb regeneration).
scription from a specific promoter. contains ectoderm precursors in fish Epiphyseal plates Cartilaginous growth
Enhancers bind specific transcription and all three germ layer precursors of zones at the proximal and distal ends
factors that activate the gene by (1) the embryo proper (plus the amnion) in of the long bones that allow continued
recruiting enzymes (such as histone bone growth.
Glossary G–11
Episomal vectors Vehicles for gene Estrus Greek oistros, “frenzy.” The Eye field Region in the anterior portion
delivery usually derived from viruses estrogen-dominated stage of the ovar- of the neural tube that will develop into
that do not insert themselves into host ian cycle in female non-human mam- the neural and pigmented retinas.
DNA. mals that are spontaneous or periodic
Epithelial-mesenchymal interactions ovulators, characterized by the display F
Induction involving interactions of of behaviors consistent with receptivity
to mating. Also called “heat.” Fasciculation In neural development,
sheets of epithelial cells with adjacent the process of one axon adhering to and
mesenchymal cells. Properties of these Euchromatin The comparatively open using another axon for growth.
interactions include regional specific- state of chromatin that contains most of
ity (when placed together, the same the organism’s genes, most of which are Fast block to polyspermy Mechanism
epithelium develops different structures capable of being transcribed. Compare by which additional sperm are pre-
according to the region from which the with Heterochromatin. vented from fusing with a fertilized
mesenchyme was taken), genetic speci- sea urchin egg by changing the electric
Eukaryotic initiation factor-4 (eIF4E) A potential to a more positive level. Has
ficity (the genome of the epithelium protein that is important for the initia-
limits its ability to respond to signals not been demonstrated in mammals.
tion of translation. Binds to the 5′ cap of
from the mesenchyme, i.e., the response mRNAs and contributes to the protein Fate map Diagrams based on having
is species-specific). complex that mediates RNA unwinding; followed cell lineages from specific
Epithelial-to-mesenchymal transition brings the 3′ end of the message next to regions of the embryo in order to “map”
(EMT) An orderly series of events the 5′ end, allowing the mRNA to bind larval or adult structures onto the
whereby epithelial cells are trans- to and be recognized by the ribosome. region of the embryo from which they
formed into mesenchymal cells. In Interacts with eukaryotic initiation arose. The superimposition of a map of
this transition, a polarized stationary factor-4G (eIF4G), a scaffold protein “what is to be” onto a structure that has
epithelial cell, which normally interacts that allows the mRNA to bind to the yet to develop into these organs.
with basement membrane through its ribosome. Female pronucleus The haploid nucleus
basal surface, becomes a migratory Eukaryotic organisms Organisms of the egg.
mesenchymal cell that can invade tis- whose cells contain membrane-bound Fertilization Fusion of male and female
sues and form organs in new places. organelles, including a nucleus with gametes followed by fusion of the hap-
See also Mesenchymal-to-epithelial chromosomes that undergo mitosis. loid gamete nuclei to restore the full
transition. Can be single-celled or multicellular. complement of chromosomes character-
Epithelium Epithelial cells tightly linked Evolutionary developmental biology istic of the species and initiation in the
together on a basement membrane to (“evo-devo”) A model of evolution egg cytoplasm of those reactions that
form a sheet or tube with little extracel- that integrates developmental genetics permit development to proceed.
lular matrix. and population genetics to explain and Fertilization cone An extension from
Equatorial region The junction between the origin of biodiversity. the surface of the egg where the egg and
the inner acrosomal membrane and the Exon In a gene, the region or regions of sperm have fused during fertilization.
sperm cell membrane in mammals. It DNA that encode the protein. Compare Caused by polymerization of actin, it
is exposed by the acrosomal reaction with Intron. provides a connection that widens the
and is where membrane fusion between cytoplasmic bridge between egg and
External granular layer A germinal zone sperm, allowing the sperm nucleus and
sperm and egg begins.
of cerebellar neuroblasts that migrate proximal centriole to enter the egg.
Equivalence group In the development from the germinal neuroepithelium
of C. elegans, the group of six vulval pre- to the outer surface of the developing Fertilization envelope Forms from the
cursor cells, each of which is competent cerebellum. vitelline envelope of the sea urchin egg
to become induced by the anchor cell. following cortical granule release. Gly-
External YSL (eYSL) A region of the cosaminoglycans released by the corti-
Erythroblast Cell that matures from the yolk syncytial layer (YSL) in fish embry-
proerythroblast and synthesizes enor- cal granules absorb water to expand the
os. The eYSL forms from yolk syncytial space between the cell membrane and
mous amounts of hemoglobin. nuclei that move further vegetally, stay- fertilization envelope.
Erythrocyte The mature red blood ing ahead of the blastoderm margin as
cell that enters the circulation where the blastoderm expands to surround the Fetal alcohol syndrome (FAS) Condi-
it delivers oxygen to the tissues. It is yolk cell. See Yolk syncytial layer. tion of babies born to alcoholic moth-
incapable of division, RNA synthesis, or ers, characterized by small head size,
Extracellular matrix (ECM) Macromol- specific facial features, and small brain
protein synthesis. Amphibians, fish, and ecules secreted by cells into their imme-
birds retain the functionless nucleus; that often shows defects in neuronal
diate environment, forming a region of and glial migration. FAS is the most
mammals extrude it from the cell. noncellular material in the interstices prevalent congenital mental retardation
Erythroid progenitor cell A committed between the cells. Extracellular matrices syndrome. Another term, fetal alcohol
stem cell that can form only red blood are made up of collagen, proteoglycans, spectrum disorder (FASD) has been
cells. and a variety of specialized glycopro- coined to encompass the less visible
Erythropoietin A hormone that acts on tein molecules such as fibronectin and behavioral effects on children exposed
erythroid progenitor cells to produce laminin. prenatally to alcohol.
proerythroblasts, which will generate Extraembryonic endoderm Formed by Fetal period In human development, the
red blood cells. delamination of the hypoblast cells from period following the embryonic period,
ESCs See Embryonic stem cells. the avian epiblast or mammalian inner from the end of 8 weeks to birth; the
Estrogen A group of steroid hormones cell mass to line the yolk sac. period after organ systems have mostly
(including estradiol) needed for com- Extraembryonic vasculogenesis The formed and generally growth and mod-
plete postnatal development of the formation of blood islands in the yolk eling is occurring.
Müllerian ducts (in females) and the sac (i.e., outside the embryo). α-Fetoprotein In mammals, a protein
Wolffian ducts (in males). Necessary for that binds and inactivates fetal estrogen,
fertility in both sexes.
G–12 Glossary
but not testosterone, in both male and Floor plate Ventral region of the neural G
female fetuses and shown in rodents to tube important in establishing dorsal- G protein A protein that binds GTP and
be critical for normal sexual differentia- ventral polarity. Induced to form by is activated or inactivated by GTP modi-
tion of the brain. Sonic hedgehog secreted from the adja- fying enzymes (such as GTPases). They
Fetus The stage in mammalian devel- cent notochord. It becomes a secondary play important roles in the RTK path-
opment between the embryonic stage signaling center that also secretes Sonic way and in cytoskeletal maintenance.
and birth, characterized by growth and hedgehog, establishing a gradient that
is highest ventrally. Gain-of-function evidence A strong
modeling. In humans, from the ninth
type of evidence, wherein the initia-
week of gestation to birth. Fluorescent dye Compounds, such as tion of the first event causes the second
Fibroblast growth factor 9 (Fgf9) A fluorescein and green fluorescent pro- event to happen even in instances
growth factor involved in testes devel- tein (GFP), that emit bright light at a where or when neither event usually
opment in mammals, stimulating pro- specific wavelength when excited with occurs. The “move it” of “Find it, lose
liferation and differentiation in Sertoli ultraviolet light. it, move it.” See also Correlative evi-
cells and their maintenance of Sox9 Focal adhesions Where the cell mem- dence; Loss-of-function evidence.
expression. Suppresses Wnt4 signaling, brane adheres to the extracellular matrix Gamete A specialized reproductive cell
which would otherwise direct ovarian in migrating cells, mediated by connec- through which sexually reproducing
development. Also involved in meta- tions between actin, integrin and the parents pass chromosomes to their off-
nephric kidney development, promoting extracellular matrix. spring; an egg or a sperm.
development of a population of stem Follicle A small group of cells around a
cell for nephrons. See also Fibroblast Gametogenesis The production of
cavity. E.g., mammalian ovarian follicle, gametes.
growth factors. composed of a single ovum surrounded
Fibroblast growth factor receptors by granulosa cells and thecal cells; hair Ganglia Clusters of neuronal cell bod-
(FGFRs) A set of receptor tyrosine follicle, feather follicle, where a hair or ies whose axons form a nerve. Singular,
kinases that are activated by FGFs, feather is produced. ganglion.
resulting in activation of the dormant Follicle-stimulating hormone (FSH) A Gap genes Drosophila zygotic genes
kinase and phosphorylation of certain peptide hormone secreted by the expressed in broad (about three seg-
proteins (including other FGF receptors) mammalian pituitary that promotes ments wide), partially overlapping
within the responding cell. ovarian follicle development and domains. Gap mutants lacked large
Fibroblast growth factors (FGFs) A spermatogenesis. regions of the body (several contiguous
family of paracrine factors that regulate segments).
Follicular stem cells Multipotent adult
cell proliferation and differentiation. stem cells that reside in the bulge niche Gastrula A stage of the embryo follow-
Fibronectin A very large (460 kDa) of the hair follicle. They give rise to the ing gastrulation that contains the three
glycoprotein dimer synthesized by hair shaft and sheath. germ layers that will interact to generate
numerous cell types and secreted into the organs of the body.
Follistatin A paracrine factor with
the extracellular matrix. Functions as a organizer activity, an inhibitor of both Gastrulation A process involving move-
general adhesive molecule, linking cells activin and BMPs, causes ectoderm to ment of the blastomeres of the embryo
to one another and to other substrates become neural tissue. relative to one another resulting in the
such as collagen and proteoglycans, and formation of the three germ layers of
Foot activation gradient A gradient, the embryo.
provides a substrate for cell migration. highest at the basal disc, that appears
Filopodia Long, thin processes con- to be present in Hydra that permits the GDNF See Glial-derived neurotrophic
taining microfilaments; cells can move basal disc to form only in one place. factor.
by extending, attaching, and then Foramen ovale In the fetal mammalian GEF See GTP exchange factor; RTK
contracting filopodia. Produced e.g. heart, an opening in the septum sepa- pathway.
by migrating mesenchyme cells in sea rating the right and left atria. Gene regulatory networks (GRNs)
urchin embryos, growth cones for nerve Patterns generated by the interactions
outgrowth, tip cells in blood vessel Forkhead transcription factors Tran-
scription factors (e.g., Fox proteins, among transcription factors and their
formation. enhancers that help define the course
HNF4α) that are especially important
Fin bud Bud of tissue in fish embryos in the endoderm that will form liver, that development follows.
that gives rise to a fin; homologous to where they help activate the regula- Genetic assimilation The process by
the limb bud of tetrapods. tory regions surrounding liver-specific which a phenotypic character initially
First polar body The smaller cell pro- genes. produced only in response to some
duced when a primary oocyte goes Forward genetics Genetic technique of environmental influence becomes,
through its first meiotic division, exposing an organism to an agent that through a process of selection, taken
producing one large cell, the second- causes random mutations and screen- over by the genotype so that it is formed
ary oocyte, which retains most of the ing for particular phenotypes. Compare even in the absence of the environ-
cytoplasm, and a tiny cell, the first polar with Reverse genetics. mental influence that had first been
body, which is ultimately lost. Both necessary.
cells are haploid. Frizzled Transmembrane receptor for
Wnt family of paracrine factors. Genetic heterogeneity The production
Flagellum A long, motile extension of of similar phenotypes by mutations in
a cell containing a central axoneme of Frontonasal process Cranial promi- different genes.
microtubules in a 9+2 arrangement (9 nence formed by neural crest cells from
the midbrain and rhombomeres 1 and Genital disc Region of the Drosophila
outer doublets and 2 central singlets). Its larva that will generate male or female
whipping action (“flagellation”) func- 2 of the hindbrain that forms the fore-
head, the middle of the nose, and the genitalia. Male and female genitalia are
tions for propulsion, as in the tail of a derived from separate cell populations
sperm. primary palate.
of the genital disc, as induced by para-
crine factors.
Glossary G–13
Genital ridge A thickening of the chromosomal determinants entered attracts vagal and sacral neural crest
splanchnic mesoderm and of the under- different cells. Only the nuclei in those cells, and it is produced by the meta-
lying intermediate mesodermal mesen- cells destined to become germ cells nephrogenic mesenchyme to induce the
chyme on the medial edge of the meso- (gametes) were postulated to contain all formation and branching of the ureteric
nephros; it forms the testis or ovary. the different types of determinants. The buds.
Also called the germinal ridge. See also nuclei of all other cells would have only Glochidium The larva of some fresh-
germinal epithelium. a subset of the original determinants. water bivalve molluscs, such as uniod
Genital tubercle A structure cranial to Germ ring A thickened ring of cells clams; has a shell resembling a tiny bear
the cloacal membrane during the indif- in the margin of the deep cells that trap, used to attach to the gills or fins
ferent stage of differentiation of the appears in a fish embryo once the blas- of fish. It feeds on the fish’s body fluids
mammalian external genitalia. It will toderm has covered about half of the until it drops off to metamorphose into
form either the clitoris in the female yolk cell. Composed of a superficial an adult clam.
fetus or the penis in the male. layer, the epiblast, and an inner layer, Glycogen synthase kinase 3
Genome The complete DNA sequence of the hypoblast. (GSK3) Targets β-catenin for
an individual organism. Germ stem cell (GSC) In female Dro- destruction.
Genomic equivalence The theory that sophila, the stem cell that gives rise to Glycosaminoglycans (GAGs) Com-
every cell of an organism has the same the oocyte. plex acidic polysaccharides consist-
genome as every other cell. Germarium In female Drosophila, niche ing of unbranched chains assembled
Genomic imprinting A phenomenon in the anterior region of an ovariole from many repeats of a two-sugar
in mammals whereby only the sperm- containing germ stem cells and several unit. The carbohydrate component of
derived or only the egg-derived allele of somatic cell types. proteoglycans.
the gene is expressed, sometimes due Germinal crescent A region in the ante- Gonadotropin-releasing hormone (GRH;
to inactivation of one allele by DNA rior portion of the avian and reptilian GnRH) Peptide hormone released
methylation during spermatogenesis or blastoderm area pellucida containing from the hypothalamus that stimulates
oogenesis. the hypoblasts displaced by migrat- the pituitary to release the gonado-
Germ band A collection of cells along ing endodermal cells. It contains the tropins follicle-stimulating hormone
the ventral midline of the Drosophila primordial germ cells (precursors of the and luteinizing hormone, which are
embryo that forms during gastrula- germ cells), which later migrate through required for mammalian gametogenesis
tion by convergence and extension that the blood vessels to the gonads. and steroidogenesis.
includes all the cells that will form the Germinal epithelium Epithelium of Gonialblast In male Drosophila, a com-
trunk of the embryo and the thorax and the bipotential gonad, derived from mitted progenitor cell that divides to
abdomen of the adult. splanchnic mesoderm, that will form become the precursors of the sperm.
Germ cells A group of cells set aside the somatic (i.e., non-germ cell) compo- Gonocytes Mammalian primordial
for reproductive function; germ cells nent of the gonads. germ cells (PGCs) that have arrived at
become the cells of the gonads (ovary Germinal neuroepithelium A layer of the genital ridge of a male embryo and
and testis) that undergo meiotic cell rapidly dividing neural stem cells one have become incorporated into the sex
divisions to generate the gametes. Com- cell layer thick that constitute the origi- cords.
pare with Somatic cells. nal neural tube. Granule cells Derived from neuro-
Germ layer One of the three layers of Germinal ridge See Genital ridge. blasts of the external granule layer of
the embryo, ectoderm, mesoderm, and Germinal vesicle breakdown the developing cerebellum. Granule
endoderm, in triploblastic organisms, or (GVBD) Disintegration of the primary neurons migrate back toward the ven-
of the two layers, ectoderm and endo- oocyte nuclear membrane (germinal tricular (ependymal) zone, where they
derm, in diploblastic organisms, gener- vesicle) upon resumption of meiosis produce a region called the internal
ated by the process of gastrulation, that during oogenesis. granule layer.
will form all of the tissues of the body Germline stem cells In Drosophila, pole Granulosa cells Cortical epithelial cells
except for the germ cells. cell (primordial germ cells) derivatives of the fetal ovary, granulosa cells sur-
Germ line The line of cells that become that divide asymmetrically to produce round individual germ cells that will
germ cells, separate from the somatic another stem cell and a differentiated become the ova and will form, with
cells, found in many animals, including daughter cell called a cystoblast, which thecal cells, the follicles that envelop
insects, roundworms, and vertebrates. in turn produces a single ovum and 15 the germ cells and secrete steroid
Specification of the germ line can occur nurse cells. hormones. The number of granulosa
autonomously from determinants found GFP See Green fluorescent protein. cells increase and form concentric lay-
in cytoplasmic regions of the egg, or can ers around the oocyte as the oocyte
occur later through induction by neigh- Glia Supportive cells of the central ner- matures prior to ovulation.
boring cells. vous system, derived from the neural
tube, and of the peripheral nervous sys- Gray crescent A band of inner gray
Germ plasm Cytoplasmic determi- tem, derived from neural crest. cytoplasm that appears following a
nants (mRNA and proteins) in the rotation of the cortical cytoplasm with
eggs of some species, including frogs, Glial guidance A mechanism important respect to the internal cytoplasm in the
nematodes, and flies, that autonomously for positioning young neurons in the marginal region of the 1-cell amphib-
specify the primordial germ cells. developing mammalian brain (e.g., the ian embryo. Gastrulation starts in this
granule neuron precursors travel on the location.
Germ plasm theory The first testable long processes of the Bergmann glia in
model of cell specification, proposed by the cerebellum). Gray matter Regions of the brain and
Weismann in 1888, in which each cell spinal cord rich in neuronal cell bodies.
of the embryo would develop autono- Glial-derived neurotrophic factor Compare with White matter.
mously. Instead of dividing equally, (GDNF) A paracrine factor that binds
to the Ret receptor tyrosine kinase. It is Green fluorescent protein (GFP) A pro-
the chromosomes were hypothesized tein that occurs naturally in certain jel-
to divide in such a way that different produced by the gut mesenchyme that
lyfish. It emits bright green fluorescence
G–14 Glossary
when exposed to ultraviolet light. The animal hemisphere synthesize and Hematopoietic inductive microenviron-
GFP gene is widely used as a transgenic secrete a hatching enzyme that digests ments (HIMs) Cell regions that induce
label for cells in developmental and the fertilization envelope. different sets of transcription factors in
other research, since cells that express Head activation gradient A morphoge- multipotent hematopoietic stem cells;
GFP are easily identified by a bright netic gradient in Hydra that is highest these transcription factors specify the
green glow. at the hypostome and permits the head developmental path taken by descen-
GRNs See Gene regulatory networks to form. dants of those cells.
Growth and differentiation factors Head mesoderm Mesoderm located Hematopoietic stem cell (HSC) A plu-
(GDFs) See Paracrine factors. anterior to the trunk mesoderm, con- ripotent stem cell type that generates a
Growth cone The motile tip of a neuro- sisting of the unsegmented paraxial series of intermediate progenitor cells
nal axon; leads nerve outgrowth. mesoderm and prechordal mesoderm. whose potency is restricted to certain
This region provides the head mes- blood cell lineages. These lineages are
Growth factor A secreted protein that then capable of producing all the blood
binds to a receptor and initiates signals enchyme that forms much of the con-
nective tissues and musculature of the cells and lymphocytes of the body.
to promote cell division and growth.
head. Hemimetabolous A form of insect meta-
Growth plate closure Causes the ces- morphosis that includes pronymph,
sation of bone growth at the end of Head process In avian embryos, the
anterior portion of the chordamesoderm nymph, and imago (adult) stages.
puberty. High levels of estrogen induce
apoptosis in the hypertrophic chon- that passes through Hensen’s node Hemogenic endothelial cell Primary
drocytes and stimulate the invasion and migrates anteriorly, ahead of the endothelial cells of the dorsal aorta, in
of bone-forming osteoblasts into the notochordal mesoderm, to come to lie the ventral area, derived from the lateral
growth plate. underneath cells that will form fore- plate. They give rise to the hematopoi-
brain and midbrain. etic stem cells (HSCs) that migrate to
GTP exchange factor (GEF) In the RTK the liver and bone marrow and become
(receptor tyrosine kinase) pathway, Heart fields (cardiogenic mesoderm)
In vertebrates, two regions of splanch- the adult hematopoietic stem cells.
this factor exchanges a phosphate that
transforms a bound GDP on a G protein nic mesoderm, one on each side of the Hensen’s node In avian embryos,
into a bound GTP, activating the G pro- body, that become specified for heart a regional thickening of cells at the
tein. See also RTK pathway. development. In amniotes, the cardiac anterior end of the primitive streak.
cells of the heart field migrate through The center of Hensen’s node contains a
GTPase-activating protein (GAP) The the primitive streak during gastrulation funnel-shaped depression (sometimes
protein that enables the G protein Ras such that the medial-lateral arrange- called the primitive pit) through which
to quickly return to its inactive state. ment of these early cells will become the cells can enter the embryo to form
This is done by hydrolyzing Ras’s bound anterior-posterior (rostral-caudal) axis the notochord and prechordal plate.
GTP back to GDP. Ras becomes acti- of the developing heart tube. Hensen’s node is the functional equiva-
vated through the RTK pathway. lent of the dorsal lip of the amphibian
Heart tube Linear (anterior-to-posterior)
Gurken A protein coded for by the structure formed at the midline of the blastopore (i.e., the organizer) and the
gurken gene. The gurken message is heart fields; will become the atria, ven- fish embryonic shield. Also known as
synthesized in the nurse cells of the tricles, and the base of the aorta and the primitive knot.
Drosophila ovary and transported into pulmonary arteries. Heparan sulfate proteoglycans (HSPGs)
the oocyte, where it is translated into One of the most widespread proteogly-
the protein along an anterior-posterior Hedgehog A family of paracrine factors
used by the embryo to induce particu- cans in the extracellular matrix, it can
gradient. It signals follicle cells closest bind many members of different para-
to the oocyte nucleus to posteriorize; lar cell types and to create boundaries
between tissues. Hedgehog proteins crine families and present them in high
part of the process that will set up the concentrations to their receptors.
anterior-posterior axis of the egg and must become complexed with a mol-
future embryo. ecule of cholesterol in order to function. Hepatectomy Surgical removal of part
Vertebrates have at least three homo- of the liver.
Gynandromorph Greek gynos, logues of the Drosophila hedgehog gene:
“female”; andros, “male.” An animal Hepatic diverticulum The liver precur-
sonic hedgehog (shh), desert hedgehog sor, a bud of endoderm that extends out
in which some body parts are male (dhh), and indian hedgehog (ihh).
and others are female. Compare with from the foregut into the surrounding
Hermaphrodite. Hedgehog pathway Proteins activated mesenchyme.
by the binding of a Hedgehog protein to Hepatocyte growth factor (HGF) Para-
Gyrencephalic Having numerous the Patched receptor. When Hedgehog
folds in the cerebral cortex, as in crine factor secreted by the stellate cells
binds to Patched, the Patched protein’s of the liver that allows the hepatocytes
humans and cetaceans. Compare with shape is altered such that it no longer
Lissencephalic. to re-enter the cell cycle during com-
inhibits Smoothened. Smoothened acts pensatory regeneration. Also called
to release the Ci protein from the micro- scatter factor.
H tubules and to prevent its being cleaved. Hermaphrodite An individual in which
Hair follicle stem cells See Follicular The intact Ci protein can now enter the both ovarian and testicular tissues
stem cells. nucleus, where it acts as a transcrip- exists, having either ovotestes (gonads
tional activator of the same genes it once
Halteres A pair of balancers on the third containing both ovarian and testicular
repressed. tissue) or an ovary on one side and
thoracic segment of two-winged flies,
such as Drosophila. Hemangioblasts Rapidly dividing cells, a testis on the other. Compare with
usually stem cells, that form blood ves- Gynandromorph.
Haptotaxis Directional migration of
sels and blood cells. Heterochromatin Chromatin that
cells on a substrate, up a gradient of
adhesiveness. Hematopoiesis The generation of blood remains condensed throughout most of
cells. the cell cycle and replicates later than
Hatched blastula Free-swimming sea
urchin embryo, after the cells of the most of the other chromatin. Usually
Glossary G–15
transcriptionally inactive. Compare Histone methylation The addition of example, diploid organisms have two
with Euchromatin. methyl groups to histones. Can either copies (homologues) of each chromo-
Heterochronic parabiosis Surgically activate or further repress transcrip- some, one inherited from each parent.
joining the circulatory systems of two tion, depending on the amino acid that (2) Evolutionary features in different
animals of different ages; has been used is methylated and the presence of other species that are similar by reason of
to study the effects of aging on stem methyl or acetyl groups in the vicinity. descent from a common ancestor.
cells in mice. Histone methyltransferases Enzymes Homophylic binding Binding between
Heterochrony Greek, “different time.” A that add methyl groups to histones and like molecules, as when a receptor in the
shift in the relative timing of two devel- either activate or repress transcription. membrane of one cell binds to the same
opmental processes as a mechanism to Holobiont Term for the composite type of receptor in the cell membrane of
generate phenotypic variation avail- organism of a host and its persistent another cell.
able for natural selection. One module symbionts. Horizontal neurons Neurons in the
changes its time of expression or growth Holoblastic cleavage Greek holos, neural retina that transmit electrical
rate relative to the other modules of the “complete.” Refers to a cell division impulses in the plane of the retina; help
embryo. (cleavage) pattern in the embryo in to integrate sensory signals coming
Heterometry Greek, “different mea- which the entire egg is divided into from many photoreceptor cells.
sure.” A change in the amount of a gene smaller cells, as it is in echinoderms, Horizontal transmission When a host
product as a mechanism to generate amphibians and mammals. that is born free of symbionts but sub-
phenotypic variation available for natu- Holometabolous The type of insect sequently becomes infected, either by
ral selection. metamorphosis found in flies, beetles, its environment or by other members
Heterophilic binding Binding between moths, and butterflies. There is no of the species. Can also refer to the
different molecules, as when a receptor pronymph stage. The insect hatches as transfer of genes from one organism to
in the membrane of one cell binds to a a larva (a caterpillar, grub, or maggot) another without involving reproduction,
different type of receptor in the mem- and progresses through instar stages as can occur in bacteria. Compare with
brane of another cell. as it gets bigger between larval molts, Vertical transmission.
Heterotopy Greek, “different place.” a metamorphic molt to become a pupa, Host The larger organism in a symbiotic
The spatial alteration of gene expression an imaginal molt and finally the emer- relationship in which one of the organ-
(e.g., transcription factors or paracrine gence (eclose) of the adult (imago). isms involved is much larger than the
factors) as a mechanism to generate Homeobox A 180-base pair DNA other, and the smaller organism may
phenotypic variation available for natu- sequence that characterizes genes that live on the surface or inside the body of
ral selection. code for homeodomain proteins, includ- the larger. Also refers to the organism
Heterotypy Greek, “different kind.” ing Hox genes. receiving a graft from a donor in a tissue
The alteration of the actual coding Homeorhesis How the organism stabi- transplant.
region of the gene, changing the func- lizes its different cell lineages while it is Hox genes Large family of related genes
tional properties of the protein being still constructing itself. that dictate (at least in part) regional
synthesized, as a mechanism to gener- Homeostasis Maintenance of a stable identity in the embryo, particularly
ate phenotypic variation available for physiological state by means of feedback along the anterior-posterior axis. Hox
natural selection. responses. genes encode transcription factors that
High CpG-content promoters (HCPs) regulate the expression of other genes.
Homeotic complex (Hom-C) The region All known mammalian genomes con-
Promoters with many CpG islands; of Drosophila chromosome 3 containing
these promoters often regulate develop- tain four copies of the Hox complex per
both the Antennapedia complex and the haploid set, located on four different
mental genes required for the construc- bithorax complex.
tion of the organism; their default state chromosomes (Hoxa through Hoxd in
Homeotic mutants Result from muta- the mouse, HOXA through HOXD in
is “on.” See also CpG islands. tions of homeotic selector genes, humans). The mammalian Hox/HOX
Histoblast nests Clusters of imaginal in which one structure is replaced genes are numbered from 1 to 13, start-
cells that will form the adult abdomen by another (as where an antenna is ing from that end of each complex that
in holometabolous insects. replaced by a leg). is expressed most anteriorly.
Histone Positively charged proteins that Homeotic selector genes A class of Hu proteins RNA binding proteins that
are the major protein component of Drosophila genes regulated by the pro- stabilize mRNAs involved in neuronal
chromatin. See also Nucleosome. tein products of the gap, pair-rule, and development, preventing them from
Histone acetylation The addition of segment polarity genes whose tran- being quickly degraded. Examples:
negatively charged acetyl groups to scription determines the developmental HuA, HuB, HuC, and HuD.
histones, which neutralizes the basic fate of each segment. Hub A regulatory microenvironment in
charge of lysine and loosens the his- Homing The ability of a cell to migrate Drosophila testes where the stem cells
tones, and thus activates transcription. and find its tissue specific destination. for sperm reside.
Histone acetyltransferases Enzymes Homodimer Two identical protein mol- Hyaline layer A coating around the sea
that place acetyl groups on histones ecules bound together. urchin egg formed by the cortical gran-
(especially on lysines in histones H3 Homologous Structures and/or their ule protein hyalin. The hyaline layer
and H4). Acetyltransferases desta- respective components whose similarity provides support for the blastomeres
bilize the nucleosomes so that they arises from their being derived from a during cleavage.
come apart easily, thus facilitating common ancestral structure. For exam-
transcription. Hydatidiform mole A human tumor
ple, the wing of a bird and the forelimb which resembles placental tissue, arise
Histone deacetylases Enzymes that of a human. Compare with Analogous. when a haploid sperm fertilizes an
remove acetyl groups from histones, Homologue (1) One of a pair (or egg in which the female pronucleus is
stabilizing the nucleosomes and pre- larger set) of chromosomes with the absent and the entire genome is derived
venting transcription. same overall genetic composition. For from the sperm, which precludes
G–16 Glossary
normal development and is cited as evi- antennae, halters, eyes, head, thorax, Instar The stages between larval molts
dence for genomic imprinting. and genitalia in holometabolous insects. in holometabolous insects. During
20-Hydroxyecdysone (20E) An insect Imaginal molt Final molt in a holome- these stages, the larva (caterpillar, grub,
hormone, the active form of ecdysone, tabolous insect when the adult (imago) or maggot) feeds and grows larger
that initiates and coordinates each cuticle forms beneath the pupal cuticle, between each molt, until the end of
molt, regulates the changes in gene and the adult later emerges from the the final instar stage, when the larva is
expression that occur during meta- pupal case at adult eclosion. transformed into a pupa.
morphosis, and signals imaginal disc Imaginal rudiment Develops from the Instructive interaction A mode of
differentiation. left coelomic sac of the pluteus larva and inductive interaction in which a signal
Hyperactivation The increased and will form many of the structures of the from the inducing cell is necessary for
more forceful motility displayed by adult sea urchin. initiating new gene expression in the
capacitated sperm of some mammalian Imago A winged and sexually mature responding cell.
species. Hyperactivation has been pro- adult insect. Insulator DNA sequence that limits
posed to help detach capacitated sperm In situ Latin, “on site.” In its natural the range within which an enhancer
from the oviductal epithelium, allow position or environment. can activate a given gene’s expres-
sperm to travel more effectively through sion (thereby “insulating” a promoter
viscous oviductal fluids, and facilitate In situ probe Complementary DNA or from being activated by another gene’s
penetration of the extracellular matrix of RNA used to localize a specific DNA or enhancers).
the cumulus cells. RNA sequence in a tissue.
Insulin signaling pathway Pathway
Hypertrophic chondrocytes Formed Indel An insertion or deletion of DNA involving a receptor for insulin and
during the fourth phase of endochon- bases. insulin-like proteins; may be an impor-
dral ossification, when the chondro- Indifferent gonad See Bipotential tant component of genetically limited
cytes, under the influence of the tran- gonad. life spans, wherein downregulation
scription factor Runx2, stop dividing Indirect developers Animals for which of the pathway can correspond to an
and increase their volume dramatically. embryonic development includes a lar- increased lifespan.
Hypoblast The inner layer of the thick- val stage with characteristics very dif- Insulin-like growth factors (IGFs)
ened margin of the epibolizing blasto- ferent from those of the adult organism, Growth factors that initiate an FGF-
derm in the gastrulating fish embryo or which emerges only after a period of like signal transduction cascade that
the lower layer of the bilaminar embry- metamorphosis. interferes with the signal transduction
onic blastoderm in birds and mammals. Induced pluripotent stem (iPS) cells pathways of both BMPs and Wnts. IGFs
The hypoblast in fish (but not in birds Adult cells that have been converted to are required for the formation of the
and mammals) contains the precursors cells with the pluripotency of embryonic anterior neural tube, including the brain
of both the endoderm and mesoderm. stem cells. Usually accomplished by and sensory placodes of amphibians.
In birds and mammals, it contains the activation of certain transcription Integration A principle of the theoretical
precursors to the extraembryonic endo- factors. systems approach: How the parts are
derm of the yolk sac. Inducer Tissue that produces a signal (or put together, and how they interact to
Hypoblast islands (primary hypo- signals) that induces a cellular behavior form the whole.
blast) Derived from area pellu- in some other tissue. Integrins A family of receptor proteins,
cida cells of the avian blastoderm that Induction The process by which one cell named for the fact that they integrate
migrate individually into the subger- population influences the development extracellular and intracellular scaffolds,
minal cavity to form individual discon- of neighboring cells via interactions at allowing them to work together. On
nected clusters containing 5–20 cells close range. the extracellular side, integrins bind to
each. Does not contribute to the embryo sequences found in several adhesive
Ingression Migration of individual cells
proper. proteins in extracellular matrix, includ-
from the surface layer into the interior
Hypomorphic mutations Mutations that of the embryo. The cells become mes- ing fibronectin, vitronectin (in the basal
reduce gene function, as opposed to a enchymal (i.e., they separate from one lamina of the eye), and laminin. On
“null” mutation that results in the loss another) and migrate independently. the cytoplasmic side, integrins bind to
of a protein’s function. talin and α-actinin, two proteins that
Inner cell mass (ICM) A small group of
Hypostome A conical region of the connect to actin microfilaments. This
internal cells within a mammalian blas-
“head” of a hydra that contains the dual binding enables the cell to move
tocyst that will eventually develop into
mouth. by using myosin to contract the actin
the embryo proper and its associated
microfilaments against the fixed extra-
yolk sac, allantois, and amnion.
cellular matrix.
I Inositol 1,4,5-trisphosphate (IP3 ) A
Interdigital necrotic zone A zone of
Imaginal cells Cells carried around in second messenger generated by the
programmed cell death in the develop-
the larva of the holometabolous insect phospholipase C enzyme that releases
ing tetrapod limb that separates the dig-
that will form the structures of the intracellular Ca 2+ stores. Important in
its from one another; when the cells in
adult. During the larval stages, these the initiation of both cortical granule
this zone do not die, webbing between
cells increase in number, but do not dif- release and sea urchin development.
the digits remains, as in the duck foot.
ferentiate until the pupal stage; include Inside-out gradient of development
imaginal discs, histoblasts, and clusters Interior necrotic zone A zone of pro-
The developmental process in the neo-
of imaginal cells within each larval grammed cell death in the developing
cortex and the rest of the brain in which
organ. tetrapod limb that separates the radius
the neurons with the earliest birthdays
from the ulna.
Imaginal discs Clusters of relatively form the layer closest to the ventricle
undifferentiated cells set aside to pro- and subsequent neurons travel greater Interkinesis The brief period between
duce adult structures. Imaginal discs distances to form the more superficial the end of meiosis I and the beginning
will form the cuticular structures of layers. of meiosis II.
the adult, including the wings, legs,
Glossary G–17
Interkinetic nuclear migration The gastrulation, includes precursors of the Karyokinesis The mitotic division of the
movement of nuclei within certain cells pharyngeal endoderm, head mesoderm, cell’s nucleus. The mechanical agent of
as they go through the cell cycle; seen in notochord, somites, and heart, kidney, karyokinesis is the mitotic spindle.
the germinal neuroepithelium in which and ventral mesoderm. Keratinocytes Differentiated epidermal
nuclei translocate from the basal end Involution Inturning or inward move- cells that are bound tightly together and
to the apical end of the cells near the ment of an expanding outer layer so that produce a water-impermeable seal of
ventricular surface, where they undergo it spreads over the internal surface of lipid and protein.
mitosis, after which they slowly migrate the remaining external cells. Koller’s sickle See Primitive streak.
basally again. Ionophore A compound that allows the Kupffer’s vesicle Transient fluid-filled
Intermediate mesoderm Mesoderm diffusion of ions such as Ca 2+ across organ housing the cilia that control left-
immediately lateral to the paraxial lipid membranes, permitting them right asymmetry in zebrafish.
mesoderm. It forms the outer (cortical) to traverse otherwise impermeable
portion of the adrenal gland and the barriers.
urogenital system, consisting of the L
Iris A pigmented ring of muscular tissue
kidneys, gonads, and their associated in the eye that controls the size of the Labioscrotal folds Folds surrounding
ducts. pupil and determines eye color. the cloacal membrane in the indifferent
Intermediate progenitor cells (IP cells) stage of differentiation of mammalian
Isolecithal Greek, “equal yolk.” external genitalia. They will form the
Neuron precursor cells of the subven- Describes eggs with sparse, equally dis-
tricular zone; derived from radial glial labia majora in the female and the scro-
tributed yolk particles, as in sea urchins, tum in the male. Also called urethral
cells. mammals, and snails.
Intermediate spermatogonia The first folds or genital swellings.
Isthmus The narrow segment of the lacZ gene The E. coli gene for β-galac-
committed stem cell type of the mam- mammalian oviduct adjacent to the
malian testis, they are committed to tosidase; commonly used as a reporter
uterus. gene.
becoming spermatozoa.
Intermediate zone See Mantle zone. Lamellipodia Broad locomotory pseu-
J dopods containing actin networks;
Internal granular layer A layer in the
cerebellum that is formed by the migra- Jagged protein Ligand for Notch, par- found on migrating cells, also found on
tion of granule cells from the external ticipates in juxtacrine interaction and growth cones of neurons.
granular layer back toward the ventricu- activation of the Notch pathway. Laminae Layers. In the brain, neurons
lar zone. JAK Janus kinase proteins. Linked to are organized into laminae and clusters
Internal YSL (iYSL) A region of the yolk FGF receptors in the JAK-STAT cascade. (nuclei).
syncytial layer (YSL) in fish embryos. JAK-STAT cascade A pathway acti- Laminin A large glycoprotein and major
The iYSL forms from yolk syncytial vated by paracrine factors binding to component of the basal lamina, plays
nuclei that move under the blastoderm receptors that span the cell membrane a role in assembling the extracellular
as it expands to surround the yolk cell. and are linked on the cytoplasmic side matrix, promoting cell adhesion and
See Yolk syncytial layer. to JAK (Janus kinase) proteins. The growth, changing cell shape, and per-
Intersex A condition in which male and binding of ligand to the receptor phos- mitting cell migration.
female traits are observed in the same phorylates the STAT (signal transducers Lampbrush chromosomes Chromo-
individual. and activators of transcription) family of somes in an amphibian primary oocyte
transcription factors. during the diplotene stage of the first
Interstitial stem cell A type of stem cell
found within the ectodermal layer of Junctional neurulation Formation of meiotic prophase that stretch out large
Hydra that generates neurons, secretory the neural tube in the transition zone loops of DNA, representing sites of
cells, nematocytes, and gametes. between the primary neural tube upregulated RNA synthesis.
(which lies anterior to the hindlimbs) Lanugo The first hairs of human embry-
Intraembryonic vasculogenesis The and the secondary neural tube (which
formation of blood vessels during os, usually shed before birth.
extends posteriorly from the sacral Large micromeres A tier of cells pro-
embryonic organogenesis. Compare region in mammals or is just in the tail
with Extraembryonic vasculogenesis. duced by the fifth cleavage in the sea
region in fish and amphibians). urchin embryo when the micromeres
Intramembranous bone Bone formed Juvenile hormone (JH) A lipid hormone
by intramembranous ossification divide. Become the primary mesen-
in insects that prevents the ecdysone- chyme cells, which form the skeletal
Intramembranous ossification Forma- induced changes in gene expression that spicules of the larva.
tion of bone directly in mesenchyme are necessary for metamorphosis. Thus,
without a cartilaginous precursor. There Larva The sexually immature stage of an
its presence during a molt ensures that organism, often of significantly differ-
are three main types of intramembra- the result of that molt is another larval
nous bone: sesamoid bone and perios- ent appearance than the adult and fre-
instar, not a pupa or an adult. quently the stage that lives the longest
teal bone, which come from mesoderm, Juxtacrine interactions When cell
and dermal bone which originate from and is used for feeding or dispersal.
membrane proteins on one cell surface Larval settlement Ability of marine lar-
cranial neural crest-derived mesenchy- interact with receptor proteins on adja-
mal cells. vae to suspend development until they
cent (juxtaposed) cell surfaces. experience a particular environmental
Introns Non-protein-coding regions Juxtacrine signaling Signaling between
of DNA within a gene. Compare with cue for settlement.
cells that are juxtaposed, i.e., in direct Laryngotracheal groove An outpouch-
Exon. contact with one another.
Invagination The infolding of a region of ing of endodermal epithelium in the
cells, much like the indenting of a soft K center of the pharyngeal floor, between
rubber ball when it is poked. Kairomones Chemicals that are released the fourth pair of pharyngeal pouches,
by a predator and can induce defenses that extends ventrally. The laryngotra-
Involuting marginal zone (IMZ) Cells cheal groove then bifurcates into the
that involute during Xenopus in its prey.
G–18 Glossary
branches that form the paired bronchi from the somatic layer of the limb field urchin embryo undergoes an unequal
and lungs. lateral plate mesoderm (the limb skeletal equatorial cleavage.
Lateral inhibition The inhibition of a cell precursor cells) and from the somites Male pronucleus The haploid nucleus of
by the activity of a neighboring cell. (the limb muscle precursor cells). the sperm.
Lateral plate mesoderm Mesodermal Limb field An area of the embryo con- Malformation Abnormalities caused
sheet lateral to the intermediate meso- taining all of the cells capable of form- by genetic events such as gene muta-
derm. Gives rise to appendicular bones, ing a limb. tions, chromosomal aneuploidies, and
connective tissues of the limb buds, Lineage-restricted stem cells Stem translocations.
circulatory system (heart, blood vessels, cells derived from multipotent stem Mammalian gut-associated lymphoid
and blood cells), muscles and connec- cells, and which can now generate only tissue (GALT) Lymphoid tissue that
tive tissues of the digestive and respira- a particular cell type or set of cell types. mediates mucosal immunity and oral
tory tracts, and lining of coelom and its Lissencephalic Having a cerebral cortex immune tolerance, allowing mammals
derivatives. It also helps form a series that lacks folds, as in mice. Compare to eat food without creating an immune
of extraembryonic membranes that are with Gyrencephalic. response to it. Intestinal microbes are
important for transporting nutrients to Long noncoding RNAs (lncRNAs) Tran- critical for the maturation of GALT.
the embryo. scriptional regulators that inactivate Mantle zone (intermediate zone) Sec-
Lateral somitic frontier The boundary genes on one of the two chromosomes ond layer of the developing spinal cord
between the primaxial and abaxial mus- of a diploid organism. For example, Xist and medulla that forms around the
cles and between the somite-derived is a lncRNA involved in the inactivation original neural tube. Because it contains
and lateral plate-derived dermis. of genes on the second X chromosome neuronal cell bodies and has a grayish
Leader sequence See 5′ Untranslated of females. Some lncRNAs appear to be appearance grossly, it will form the gray
region. specific for either the maternal or pater- matter.
Lens placode Paired epidermal thick- nal copy of a gene. Marginal zone (1) The third and outer
enings induced by the underlying optic Lophotrochozoans One of two major zone of the developing spinal cord and
cups to invaginate to form the lens ves- protostome groups, many of which are medulla composed of a cell-poor region
icles, which differentiate into the adult characterized spiral cleavage and by composed of axons extending from
transparent eye lenses that allow light the larval form known as the trocho- neurons residing in the mantle zone.
to impinge on the retinas. phore. A diverse group that includes Will form the white matter as glial cells
Lens vesicle The vesicle that forms from the annelids (segmented worms such cover the axons with myelin sheaths,
the lens placode. It differentiates into as earthworms), molluscs (e.g., snails), which have a whitish appearance. (2)
the lens. It also induces the overlying and flatworms (e.g., Planaria). See also In amphibian gastrula, where gastrula-
ectoderm to become the cornea, and Ecdysozoans. tion begins, the region surrounding
induces the inner side of the optic cup to Loss-of-function evidence The absence the equator of the blastula, where the
differentiate into the neural retina. of the postulated cause is associated animal and vegetal hemispheres meet.
Leptotene Greek, “thin thread.” In the with the absence of the postulated (3) In bird and reptile gastrulae (= mar-
first meiotic division, the first stage effect. The “lose it” of “find it, lose it, ginal belt), a thin layer of cells between
of prophase I, when the chromatin is move it.” See also Correlative evi- the area pellucida and the area opaca,
stretched out thinly such that one can- dence; Gain-of-function evidence. important in determining cell fate dur-
not identify individual chromosomes. Low CpG-content promoters (LCPs) ing early development.
DNA replication has already occurred, These promoters are usually found in Maskin Protein in amphibian oocytes
and each chromosome consists of two the genes whose products characterize that creates a repressive loop structure
parallel chromatids. mature, fully differentiated cells. The in messenger RNA, preventing its
Level-specific properties and emer- CpG sites are usually methylated and translation. It creates the loop by bind-
gence A principle of the theoretical their default state is “off,” although they ing to two other proteins, cytoplasmic
systems approach: The properties of a can be activated by specific transcrip- polyadenylation-element-binding pro-
system at any given level of organiza- tion factors. See also CpG islands. tein (CPEB) and eIF4E factor, which are
tion cannot be totally explained by Lumen The hollow space within any bound to opposite ends of the mRNA.
those of levels “below” it. tubular or globular structure or organ. Master regulator Transcription factors
Leydig cells Testis cells derived from the Luteinizing hormone (LH) A hormone that can control cell differentiation by
interstitial mesenchyme cells surround- secreted by the mammalian pituitary (1) being expressed when the specifica-
ing the testis cords that make the testos- that stimulates the production of steroid tion of a cell type begins, (2) regulating
terone required for secondary sex deter- hormones, such as estrogen from the the expression of genes specific to that
mination and, in the adult, required to ovarian follicle cells and testosterone cell type, and (3) being able to redirect a
support spermatogenesis. from the testicular Leydig cells. A surge cell’s fate to this cell type.
Life expectancy The length of time an in LH levels causes the primary oocyte Maternal contributions The stored
average individual of a given species to complete meiosis I and prepares the mRNAs and proteins within the
can expect to live; it is characteristic of follicle for ovulation. cytoplasm of the egg, produced from
populations, not of species. Lymphatic vasculature The vessels of the maternal genome during the pri-
the circulatory system that transport mary oocyte stage. See also Maternal
Ligand A molecule secreted by a cell message.
that elicits a response in another cell by lymph (as opposed to the blood vessels
binding to a receptor on that cell. of the circulatory system). Maternal effect genes Encode messen-
ger RNAs that are localized to different
Lim genes Genes coding for transcrip- regions of the Drosophila egg.
tion factors that are structurally related M
to proteins encoded by Hox genes. Maternal message Messenger RNA
Macromeres Larger cells generated by that is made in the egg and stored in
Limb bud A circular bulge that will form asymmetrical cleavage, e.g., the four the egg’s cytoplasm while the egg is a
the future limb. The limb bud is formed large cells generated by the fourth primary oocyte. At this point, the egg
by the proliferation of mesenchyme cells cleavage when the vegetal tier of the sea is still diploid within the ovary. The
Glossary G–19
mRNA, therefore, is being made from portion of the cytoplasm is cleaved. The eight blastomeres, each with the same
the maternal genome. cleavage furrow does not penetrate the volume.
Maternal-to-zygote transition The yolky portion of the cytoplasm because Mesonephric duct See Wolffian duct.
embryonic stage when maternally pro- the yolk platelets impede membrane Mesonephros The second kidney of the
vided mRNAs are degraded and control formation there. Only part of the egg is amniote embryo, induced in the adja-
of development is handed over to the destined to become the embryo, while cent mesenchyme by the middle portion
zygote’s own genome; often occurs in the other portion—the yolk—serves as of the nephric (Wolffian) duct. It func-
the mid-blastula stage. Seen in many nutrition for the embryo, as in insects, tions briefly in urine filtration in some
different animal groups. fish, reptiles, and birds. mammalian species and mesonephric
Maximum lifespan Maximum number Meroistic oogenesis Type of oogenesis tubules form the tubes that transport
of years an individual of a given species found in certain insects (including Dro- the sperm from the testes to the ure-
has been known to survive and is char- sophila and moths), in which cytoplas- thra (the epididymis and vas deferens).
acteristic of that species. mic connections remain between the Forms the adult kidney of anamniotes
Medial hinge point (MHP) In birds and cells produced by the oogonium. (fish and amphibians).
mammals, formed by the cells at the Mesencephalon The midbrain, the Messenger RNA (mRNA) RNA that
midline of the neural plate. MHP cells middle vesicle of the developing verte- codes for a protein and leaves the nucle-
become anchored to the notochord brate brain; major derivatives include us after being processed from nuclear
beneath them and form a hinge, which optic tectum and tegmentum. Its lumen RNA in a manner that excises non-
forms a furrow at the dorsal midline becomes the cerebral aqueduct. coding domains and protects the ends
and helps bend the neural plate as it Mesenchymal stem cells (MSCs) Also of the strand.
forms a neural tube. called bone marrow-derived stem cells, MET See Mesenchymal-to-epithelial
Mediator A large, multimeric complex of or BMDCs. Multipotent stem cells that transition.
nearly 30 protein subunits that in many originate in the bone marrow, MSCs are Metalloproteinases Matrix metallopro-
genes is the link that connects RNA able to give rise to numerous bone, car- teinases (MMP). Enzymes that digest
polymerase II (bound to the promoter) tilage, muscle, and fat lineages. extracellular matrices and are important
to an enhancer sequence, thus forming Mesenchymal-to-epithelial transition in many types of tissue remodeling in
a pre-initiation complex at the promoter. (MET) Transformation of mesenchy- disease and development, including
Medullary cord Forms by condensa- mal cells into epithelial cells. Occurs, metastasis, branching morphogenesis of
tion of mesenchyme cells and then for example, during somite formation, epithelial organs, placental detachment
mesenchymal-to-epithelial transition in when somites form from presomitic at birth, and arthritis.
the caudal region of the avian embryo mesoderm. See also Epithelial-to-mes- Metamorphic climax When the major
during the process of secondary neuru- enchymal transition. metamorphic changes, such as tail and
lation. It will then cavitate to form the Mesenchyme Loosely organized gill resorption, and intestinal remodel-
caudal section of the neural tube. embryonic connective tissue consisting ing, occur in the amphibian. The con-
Meiosis A unique division process that of scattered fibroblast-like and some- centration of T4 rises dramatically and
in animals occurs only in germ cells, to times migratory mesenchymal cells TRβ levels peak.
reduce the number of chromosomes to separated by large amounts of extracel- Metamorphic molt Pupal molt; in holo-
a haploid complement. All other cells lular matrix. metabolous insects, the molt at the end
divide by mitosis. Meiosis differs from Mesenchyme cap cells A population of the final instar stage, when the larva
mitosis in that (1) meiotic cells undergo of multipotent stem cells, derived from becomes a pupa.
two cell divisions without an interven- metanephric kidney mesenchyme, Metamorphosis Changing from one
ing period of DNA replication, and (2) that cover the tips of the ureteric bud form to another, such as the transfor-
homologous chromosomes (each con- branches and can form all the cell types mation of an insect larva to a sexually
sisting of two sister chromatids joined at of the nephron. mature adult or a tadpole to a frog.
a kinetochore) pair together and recom- Mesentoblast In snail embryos, the 4d
bine genetic material. Metanephric mesenchyme An area of
blastomere whose progeny give rise to mesenchyme, derived from posterior
Melanoblasts Pigment progenitor cells. most of the mesodermal (heart, kidney regions of the intermediate mesoderm,
Melanocyte stem cells Adult stem cells and muscles) and endodermal (gut involved in mesenchymal-epithelial
derived from trunk neural crest cells tube) structures. interactions that generate the meta-
that form melanoblasts and come to Mesoderm Greek mesos, “between.” The nephric kidney and will form the secre-
reside in the bulge niche of the hair or middle of the three embryonic germ tory nephrons. Also called metanephro-
feather follicle and which give rise to the layers, lying between the ectoderm and genic mesenchyme.
pigment of the skin, hair, and feathers. the endoderm. The mesoderm gives Metanephros/metanephric kidney The
Melanocytes Cells containing the pig- rise to muscles and skeleton, connective third kidney of the embryo and the per-
ment melanin. Derived from neural tissue, the urogenital system (kidneys, manent kidney of amniotes.
crest cells that undergo extensive migra- gonads, and ducts), blood and blood
vessels, and most of the heart. Metaphase plate A structure present
tion to all regions of the epidermis. during mitosis or meiosis in which the
Meltrins Set of metalloproteinases Mesodermal mantle The cells that invo- chromosomes are attached via their
involved in cell fusion events, such as lute through the ventral and lateral blas- kinetochores to the microtubule spindle
the fusion of myoblasts to form a myofi- topore lips during amphibian gastrula- and are lined up between the two poles
ber and of macrophages to form osteo- tion and will form the heart, kidneys, of the cell. If the metaphase plate forms
clasts. See also Metalloproteinases. bones, and parts of several other organs. midway between the two poles the divi-
Meroblastic cleavage Greek meros, Mesomeres The eight cells generated sion will be symmetrical; if it is closer to
“part.” Refers to the cell division (cleav- in the sea urchin embryo by the fourth one pole, it will be asymmetrical, pro-
age) pattern in zygotes containing cleavage when the four cells of the ducing one larger cell and one smaller.
large amounts of yolk, wherein only a animal tier divide meridionally into
G–20 Glossary
Metastasis The invasion of cancerous of cell division, and (3) transcription of existing tissues with little new growth
cells into other tissues. new (zygotic) mRNAs needed for gas- (e.g., Hydra).
Metazoa Animals. trulation and cell specification. Morphogenesis The organization of the
Metencephalon The anterior subdivi- Midpiece Section of sperm flagellum cells of the body into functional struc-
sion of the rhombencephalon; gives rise near the head that contains rings of tures via coordinated cell growth, cell
to the cerebellum (coordinates move- mitochondria that provide the ATP migration, and cell death.
ments, posture, and balance) and pons needed to fuel the dynein ATPases and Morphogenetic determinants Tran-
(fiber tracts for communication between support sperm motility. scription factors or their mRNAs that
brain regions). miRNA See MicroRNA. will influence the cell’s development.
Methylation See Histone methylation. MITF Microphthalmia-associated tran- Morphogens Greek, “form-givers.”
5-Methylcytosine A “fifth” base in scription factor. A transcription factor Diffusible biochemical molecules that
DNA, made enzymatically after DNA necessary for melanoblast specifica- can determine the fate of a cell by their
is replicated by converting cytosine to tion and pigment production. Its name concentrations, in that cells exposed to
5-methycytosine—only cytosines fol- comes from the fact that a mutation in high levels of a morphogen will activate
lowed by a guanosine can be converted. the gene for this transcription factor different genes than those exposed to
In mammals, about 5% of cytosines in causes small eyes (microphthalmia) in lower levels.
DNA are converted to 5-methylcytosine. mice. Morpholino An antisense oligonucle-
Microfilaments Long cables of polymer- Mitosis-promoting factor (MPF) Con- otide against an mRNA; used to experi-
ized actin and a major component of sists of cyclin B and a cyclin-dependent mentally inhibit protein expression.
the cytoskeleton. In combination with kinase (CDK), required to initiate entry Morula Latin, “mulberry.” Vertebrate
myosin, forms contractile forces neces- into the mitotic (M) phase of the cell embryo of 16–64 cells; precedes the
sary for cytokinesis; formed during cycle in both meiosis and mitosis. blastula or blastocyst stage. Mammalian
fertilization in the egg’s cortex to extend Model systems Species that are easily morula occurs at the 16-cell stage, con-
microvilli; attached indirectly by other studied in the laboratory and have spe- sists of a small group of internal cells
molecules to transmembrane adhe- cial properties that allow their mecha- (that will form the inner cell mass) sur-
sion molecules, such as cadherins and nisms of development to be readily rounded by a larger group of external
integrins. observed (e.g., sea urchins, Drosophila, cells (that will form the trophoblast).
Microglia Small glial cells of the cen- C. elegans, zebrafish, and mouse). Mosaic embryos Embryos in which
tral nervous system that carry out an Modularity A principle of the theoretical most of the cells are determined by
immune function by engulfing dying systems approach. The organism devel- autonomous specification, with each cell
and dysfunctional neurons and glia. ops as a system of discrete and interact- receiving its instructions independently
Micromeres Small cells created by ing modules. and without cell-cell interaction.
asymmetrical cleavage, e.g., four small Module A discrete unit of growth, char- Mosaic pleiotropy A gene is indepen-
cells generated by the fourth cleavage acterized by more internal than external dently expressed in several tissues.
at the vegetal pole when the vegetal tier integration. Each tissue needs the gene product and
of the sea urchin embryo undergoes an Molecular parsimony The principle develops abnormally in its absence.
unequal equatorial cleavage. that development in all lineages uses mRNA cytoplasmic localization The
Micropyle The only place where Dro- the same types of molecules (the “small spatial regulation of mRNA transla-
sophila sperm can enter the egg, at the toolkit”). The “toolkit” includes tran- tion, mediated by (1) diffusion and
future dorsal anterior region of the scription factors, paracrine factors, local anchoring, (2) localized protec-
embryo, a tunnel in the chorion (egg- adhesion molecules, and signal trans- tion, and (3) active transport along the
shell) that allows sperm to pass through duction cascades that are remarkably cytoskeleton.
it one at a time. similar from one phylum to another. Müller glial cells Cells of the neural
MicroRNA (miRNA) Small (about 22 Monospermy Only one sperm enters the retina that support and maintain the
nucleotide) RNAs complementary to a egg, and a haploid sperm nucleus and neurons therein.
portion of a particular mRNA that regu- a haploid egg nucleus combine to form Müllerian duct (paramesonephric
lates translation of a specific message. the diploid nucleus of the fertilized egg duct) Duct running lateral to the
MicroRNAs uusally bind to the 3′ UTR (zygote), thus restoring the chromosome mesonephric (Wolffian) duct in both
of mRNAs and inhibit their translation. number appropriate for the species. male and female mammalian embryos.
Microspikes Essential for neuronal Monozygotic twins Greek, “one-egg.” These ducts regress in the male fetus,
pathfinding, microfilament-containing Genetically “identical” twins; form but form the oviducts, uterus, cervix,
pointed filopodia of the growth cone when the cells of a single early-cleavage and upper part of the vagina in the
that elongate and contract to allow axo- embryo become dissociated from one female fetus. Compare with Wolffian
nal migration. Microspikes also sample another, either by the separation of early duct.
the microenvironment and send signals blastomeres or by the separation of the Müllerian-inhibiting factor (MIF) See
back to the soma. inner cell mass into two regions within Anti-Müllerian hormone.
Microvilli Small microfilament-contain- the same blastocyst. Compare with Multicellular eukaryotic organism A
ing projections that extend from the Dizygotic twins. eukaryotic organism with multiple cells
surface of cells; e.g., on the egg surface Morph One of several different poten- that remain together as a functional
during fertilization where they may aid tial phenotypes that result from envi- whole; subsequent generations form the
sperm entry into the cell. ronmental conditions. Also called an same coherent individuals composed of
Mid-blastula transition The transition ecomorph. multiple cells. (Includes plants, fungi,
from the early rapid biphasic (only M Morphallactic regeneration See and animals.)
and S phases) mitoses of the embryo to Morphallaxis. Multipotent cardiac progenitor cells
a stage characterized by (1) mitoses that Morphallaxis Type of regeneration that Progenitor cells of the heart field that
include the “gap” stages (G1 and G2) of occurs through the repatterning of form cardiomyocytes, endocardium,
the cell cycle, (2) loss of synchronicity
Glossary G–21
epicardium, and the Purkinje fibers of can be used as a coenzyme for lipid population—the neural crest cells—that
the heart. biosynthesis and may be important in detach during formation of the neural
Multipotent stem cells Adult stem cells the construction of the many new cell tube and migrate to form a variety of
whose commitment is limited to a rela- membranes required during cleavage. cell types and structures, including
tively small subset of all the possible NADP+ is also used to make NAADP. sensory neurons, enteric neurons, glia,
cells of the body. Naïve pluripotent state The most pigment cells, and (in the head) bone
Mutualism A form of symbiosis in which immature, undifferentiated state of and cartilage.
the relationship benefits both partners. embryonic stem cells with the greatest Neural crest effectors Transcription
Myelencephalon The posterior subdivi- potential for pluripotency. factors (e.g., MITF and Rho GTPase)
sion of the rhombencephalon; becomes Nanos Protein critical for the establish- activated by neural crest specifiers that
the medulla oblongata. ment of anterior-posterior polarity of give the neural crest cells their migra-
the Drosophila embryo. Nanos mRNA tory properties and some of their differ-
Myelin sheath Modified oligoden- entiated properties.
drocyte (in CNS) or Schwann cell (in is tethered to the posterior end of the
peripheral NS) plasma membrane that oocyte and is translated after ovulation Neural crest specifiers A set of tran-
surrounds nerve cell axons, providing and fertilization. Nanos protein diffuses scription factors (e.g., FoxD3, Sox9, Id,
insulation that confines and speeds from the posterior end, while Bicoid dif- Twist, and Snail) induced by the neural
electrical impulses transmitted along fuses from the anterior end, setting up plate border-specifying transcription
axons. two opposing gradients that establish factors, that specify the cells that are to
the anterior-posterior polarity of the become the neural crest.
Myoblast Muscle precursor cell. embryo. Neural folds Thickened edges of the
Myocardium Heart muscle. Necrosis Pathologic cell death caused neural plate that move upward during
Myoepithelia Epithelia whose cells pos- by factors such as inflammation of toxic neurulation and migrate toward the
sess characteristics of both epithelial injury. Compare with Apoptosis. midline and eventually fuse to form the
and muscle cells, e.g., the two epithelial Necrotic zones Regions of the tet- neural tube.
layers of Hydra. rapod limb “sculpted” by apoptotic Neural groove U-shaped groove that
Myofiber Muscle cell that is multinucle- (programmed) cell death; the term forms in the center of the neural plate
ate and forms from the fusion of myo- “necrotic” zone is a holdover from a during primary neurulation.
blasts; skeletal muscle cell. time when no distinction was made Neural keel A band of neural precursor
Myogenic regulatory factors (MRFs) between necrosis and apoptosis. The cells that are brought into the dorsal
Basic helix-loop-helix transcription four necrotice regions are interdigital, midline during convergence and exten-
factors (such as MyoD, Myf5 and myo- anterior, posterior, and interior. sion movements in the epiblast of the
genin) that are critical regulators of Negative feedback loop A process in fish embryo. It extends over the axial
muscle development. which the product of the process inhib- and paraxial mesoderm and eventually
Myogenin A myogenic regulatory factor its an earlier step in the process. forms a rod of tissue that separates from
that regulates several genes involved in Neocortex A layer of gray matter in the epidermal ectoderm and develops
the differentiation and repair of skeletal the cerebrum that is a distinguish- a slit-like lumen to become the neural
muscle cells. See also Myogenic regu- ing feature of the mammalian brain; it tube.
latory factors. stratifies into six layers of neuronal cell Neural plate The region of the dorsal
Myostatin Greek, “muscle stopper.” bodies, each with different functional ectoderm that is specified to be neu-
A member of the TGF-β family, it properties. ral ectoderm. It later folds upward to
negatively regulates muscle develop- Neoteny Retention of the juvenile body become the neural tube.
ment. Genetic defects in the gene or its form throughout life while the germ Neural plate border The border between
negative regulatory miRNA cause huge cells and reproductive system mature the neural plate and the epidermis.
muscles to develop in some mammals, (e.g., the Mexican axolotl). See also Neural plate border specifiers A set of
including humans. Progenesis. transcription factors (e.g., Distalless-5,
Myotome Portion of the somite that Nephric duct See Wolffian duct. Pax3, and Pax7), induced by the neural
gives rise to all skeletal muscles of the Nephron Functional unit of the kidney. plate inductive signals, that collectively
vertebrate body except for those in the confer upon the border region the abil-
head. The myotome has two compo- Nerve growth factor (NGF) Neurotro-
phin involved primarily in the growth ity to form neural crest and dorsal neu-
nents: the primaxial component, closest ral tube cell types. Induce expression of
to the neural tube, which forms the of nerve cells. Released from potential
target tissues, it works at short ranges as neural crest specifiers.
musculature of the back and rib cage, Neural plate inductive signals Para-
and the abaxial component, away from either a chemotactic factor or chemore-
pulsive factor for axonal guidance. Also crine factors (e.g., BMPs, Wnts, FGFs
the neural tube, which forms the mus- and Notch) that interact to specify the
cles of the limbs and ventral body wall. important in the selective survival of
different subsets of neurons. boundaries between neural and non-
Netrins Paracrine factors found in a gra- neural ectoderm during gastrulation. In
N dient that guide axonal growth cones. amphibians, inductive signals secreted
N-cadherin A type of cadherin that is They are important in commissural by the notochord are sufficient to speci-
highly expressed on cells of the devel- axon migration and retinal axon migra- fy neural plate; in chick, signals secreted
oping central nervous system (the N tion. Netrin-1 is secreted by the floor by the ventral ectoderm and paraxial
stands for Neural). May play roles in plate; netrin-2 is secreted by the lower mesoderm specify the boundaries.
mediating neural signals. See also region of the spinal cord. Neural restrictive silencer element
Cadherins. Neural crest A transient band of cells, (NRSE) A regulatory DNA sequence
NAD+ kinase Activated during the early arising from the lateral edges of the found in several mouse genes that
response of the sea urchin egg to the neural plate, that joins the neural tube prevents a promoter’s activation in
sperm, converts NAD+ to NADP+, which to the epidermis. It gives rise to a cell any tissue except neurons, limiting the
G–22 Glossary
expression of these genes to the nervous Neurotrophins 3 and 4/5 (NT3, NT4/5) Nuclear RNA (nRNA) The original tran-
system. Neurotrophin 3 attracts sensory neu- scription product. Sometimes called
Neural restrictive silencer factor rons from the dorsal root ganglia; NT4/5 heterogeneous nuclear RNA (hnRNA)
(NRSF) A zinc finger transcrip- attracts facial motor neurons and cere- or pre-messenger RNA (pre-mRNA);
tion factor that binds the NRSE and bellar granule cells. contains the cap sequence, the 5′ UTR,
is expressed in every cell that is not a Neurula Refers to an embryo during exons, introns, and the 3′ UTR.
mature neuron. neurulation (i.e., while the neural tube Nuclear RNA selection Means of con-
Neural retina Derived from the inner is forming). trolling gene expression by processing
layer of the optic cup, composed of a Neurulation Process of folding of the specific subsets of the nRNA population
layered array of cells that include the neural plate and closing of the cranial into mRNA in different types of cells.
light- and color-sensitive photoreceptor and caudal neuropores to form the neu- Nuclei pulposi A gel-like mass in the
cells (rods and cones), the cell bodies of ral tube. center of the intervertebral discs derived
the ganglion cells, bipolar interneurons Newt anterior gradient protein (nAG) from notochordal cells.
that transmit electric stimuli from the Factor released by neurons in the blas- Nucleosome The basic unit of chroma-
rods and cones to the ganglion cells, tema of a regenerating salamander limb tin structure, composed of an octamer
Müller glial cells that maintain its integ- that is thought to be the nerve-derived of histone proteins (two molecules each
rity, amacrine neurons (which lack large factor necessary for proliferation of the of histones H2A, H2B, H3, and H4)
axons), and horizontal neurons that blastema cells. wrapped with two loops containing
transmit electric impulses in the plane Nieuwkoop center The dorsalmost approximately 147 base pairs of DNA.
of the retina. vegetal blastomeres of the amphibian Nucleus (1) The membrane-enclosed
Neural stem cells (NSCs) Stem cells of blastula, formed as a consequence of the organelle housing the eukaryotic chro-
the central nervous system capable of cortical rotation initiated by the sperm mosomes. (2) An organized cluster of
neurogenesis throughout life. In verte- entry; an important signaling center the cell bodies of neurons in the brain
brates, NSCs retain much of the charac- on the dorsal side of the embryo. One with specific functions and connections.
teristics of their embryonic progenitor of its main functions is to induce the Nurse cells Cells that provides nourish-
cell, the radial glial cell. Organizer. ment to a developing egg. In Drosophila
Neural tube The embryonic precursor to NMPs See Neuromesoderm ovarioles, fifteen interconnected nurse
the central nervous system (brain and progenitors. cells generate mRNAs and proteins that
spinal cord). Nodal A paracrine factor and member of are transported to a single developing
Neuroblast An immature dividing pre- the TGF-β family involved in establish- oocyte.
cursor cell that can differentiate into the ing left-right asymmetry in vertebrates Nymph Insect larval stage that resem-
cells of the nervous system. and invertebrates. bles an immature adult of the species.
Neurocranium The vault and base of the Node The mammalian homologue of Becomes progressively more mature
skull. Hensen’s node. though a series of molts.
Neuromesoderm progenitors (NMPs) Noggin A BMP antagonist (i.e., blocks
A population of multipotent progenitor BMP signaling). O
cells with the potential to contribute to Noninvoluting marginal zone (NIMZ) Obesogens Substances the increase
both the neural tube and paraxial meso- Region of cells on the exterior of the the production and accumulation of
derm, found in the posteriormost region gastrulating amphibian embryo that do fat and adipose (fat) cells in the body.
of the tail. not involute. They expand by epiboly Several endocrine disruptors, including
Neurons Nerve cells; cells specialized along with the animal cap cells to cover DES and BPA, have been shown to be
for the conduction and transmission of the entire embryo, eventually forming obesogens.
information via electrical and chemical the surface ectoderm. Obligate mutualism Symbiosis in which
signals. Non-skeletogenic mesenchyme the species involved are interdependent
Neuropore The two open ends (anterior Formed from the veg2 layer of the with one another to such an extent that
neuropore and posterior neuropore) of 60-cell sea urchin embryo, it gener- neither partner could survive without
the neural tube that later close. ates pigment cells, immunocytes, and the other.
Neurotransmitters Molecules (e.g., ace- muscle cells. Also called secondary Olfactory placodes Paired epidermal
tylcholine, GABA, serotonin) secreted mesenchyme. thickenings that form the nasal epi-
at the ends of axons. These molecules Notch protein Transmembrane protein thelium (smell receptors) as well as the
cross the synaptic cleft and are received that is a receptor for Delta, Jagged, or ganglia for the olfactory nerves.
by the adjacent neuron, thus relaying Serrate, participants in juxtacrine inter- Oligodendrocytes A type of glial cell
the neural signal. See also Synapse. actions. Ligand binding causes Notch within the central nervous system
Neurotrophin/neurotropin Neurotrophic to undergo a conformational change that wrap themselves around axons to
(Greek, “nourishing”) refers to a fac- that enables a part of its cytoplasmic produce a myelin sheath. Also called
tor’s ability to keep the neuron alive, domain to be cut off by the presenilin-1 oligodendroglia.
usually by supplying growth factors. protease. The cleaved portion enters Omphalomesenteric (umbilical)
Neurotropic (Latin, “turning”) refers the nucleus and binds to a dormant veins The veins that form from yolk
to a substance that attracts or repulses transcription factor of the CSL family. sac blood islands. These veins bring
neurons. Because many factors have When bound to the Notch protein, the nutrients to the mammalian embryo
both properties, both terms are used; CSL transcription factors activate their and transport gases to and from sites of
in the recent literature, neurotrophin target genes. respiratory exchange with the mother.
appears to be preferred. See also Nerve Notochord A transient mesodermal rod
growth factor; Brain-derived neuro- Oncogenes Regulatory genes that pro-
in the most dorsal portion of the embryo mote cell division, reduce cell adhesion,
trophic factor; Conserved dopamine that plays an important role in induc-
neurotrophic factor (CDNF); Neuro- and prevent cell death. Can promote
ing and patterning the nervous system. tumor formation and metastasis. Proto-
trophins 3 and 4/5. Characteristic feature of chordates. oncogenes are the normal version of
Glossary G–23
these genes, which, when overexpressed Osteoblast A committed bone precur- chromatids. Crossing over occurs dur-
or misexpressed through mutations or sor cell. ing this stage.
inappropriate methylations, are called Osteoclasts Multinucleated cells Pair-rule genes Drosophila zygotic
oncogenes and can result in cancer. derived from a blood cell lineage that genes, regulated by gap gene proteins.
Oocyte A developing egg. A primary enter the bone through the blood ves- Pair-rule genes are each expressed in
oocyte is in a stage of growth, has not sels and destroy bone tissue during seven stripes that divide the embryo
gone through meiosis, and has a diploid remodeling. into transverse bands perpendicular
nucleus. A secondary oocyte has com- Osteocytes Bone cells. Derived from to the anterior-posterior axis. Pair-rule
pleted its first meiotic division but not osteoblasts that become embedded in mutants lack portions of every other
the second, and is haploid. the calcified osteoid matrix. segment.
Oogonium A single female germ cell Osteogenesis Bone formation; the PAL-1 A maternally expressed tran-
that is mitotic. When it leaves this stage, transformation of mesenchyme into scription factor in the oocyte of the
it becomes a primary oocyte. Plural, bone tissue through a progression from nematode C. elegans that is required for
oogonia. osteoclast to osteoblast to osteocyte. the differentiation of the P1 lineage of
Optic cups Double-walled chambers See Endochondral ossification; Intra- cells. P1 is one of the cells of the two-
formed by the invagination of the optic membranous ossification. cell embryo.
vesicles. Osteoid matrix A collagen-proteoglycan PAR proteins Found in the cytoplasm
Optic nerve Cranial nerve (CN II) that secreted by osteoblasts that is able to of oocytes of the nematode C. elegans;
forms from axons of the neural retina bind calcium. involved in determining the anterior-
that grow back to the brain by traveling Otic placodes Paired epidermal thick- posterior axis of the embryo following
down the optic stalk. enings that invaginate to form the inner fertilization.
Optic vesicle Extend from the dienceph- ear labyrinth, whose neurons form the Paracrine factor A secreted, diffus-
alon and activate the head ectoderm’s acoustic ganglia that enable us to hear. ible protein that provides a signal that
latent lens-forming ability. Outer radial glia (oRG) Progenitor cells interacts with and changes the cellular
Oral plate A region where the ectoderm that reside in the subventricular zone of behavior of neighboring cells and tissues.
of the stomodeum meets the endoderm the cerebrum and give rise to interme- Paracrine signaling Signaling between
of the primitive gut. It later breaks open diate progenitor (IP) cells. cells that occurs across long distances
to form the oral opening. Outflow tract In the developing heart, through the secretion of paracrine fac-
Organization/activation hypothesis made up of the conus arteriosus and tors into the extracellular matrix.
The theory that sex hormones act dur- truncus arteriosus; becomes the base of Paralogues Genes that are similar in
ing the fetal or neonatal stage of a the aorta and the pulmonary arteries. sequence because they are the result of
mammal’s life to organize the nervous Oval cells A population of progeni- gene duplication events in an ancestral
system in a sex-specific manner, and tor cells in the liver that divide and species. Compare with Orthologues.
that during adult life, the same hor- form new hepatocytes and bile duct Parasegment A “transegmental” unit
mones may have transitory motivational cells when hepatocytes themselves in Drosophila that includes the posterior
(or “activational”) effects. are unable to regenerate the liver compartment of one segment and the
Organizer In amphibians, the dorsal sufficiently. anterior compartment of the immedi-
lip cells of the blastopore and their Ovariole The Drosophila egg chamber. ately posterior segment; appears to be
derivatives (notochord and head endo- the fundamental unit of embryonic gene
Oviparity Young hatch from eggs ejected expression.
mesoderm). Functionally equivalent by the mother, as in birds, amphibians,
to Hensen’s node in chick, the node and most invertebrates. Parasitism Type of symbiosis in which
in mammals, and the shield in fish. one partner benefits at the expense of
Organizer action establishes the basic Ovoviviparity Young hatch from eggs the other.
body plan of the early embryo. Also held within the mother’s body where
they continue to develop for a period of Parasympathetic (enteric) ganglia
known as the Spemann Organizer or Ganglia of the parasympathetic (“rest
(more correctly) the Spemann-Mangold time, as in certain reptiles and sharks.
Compare with Viviparity. and digest”) nervous system derived
organizer. from vagal and sacral neural crest cells.
Organogenesis Interactions between, Ovulation Release of the egg from the
ovary. Paraxial (somitic) mesoderm Thick
and rearrangement of, cells of the three bands of embryonic mesoderm imme-
germ layers to produce tissues and Ovum The mature egg (at the stage of diately adjacent to the neural tube and
organs. meiosis at which it is fertilized). Plural, notochord. In the trunk, paraxial meso-
Organoids Rudimentary organs, usually ova. derm gives rise to somites, in the head
the size of a pea, grown in culture from it (along with the neural crest) gives rise
pluripotent stem cells. P to the skeleton, connective tissues and
Orthologues Genes from different spe- p53 A transcription factor that can stop musculature of the face and skull.
cies that are similar in DNA sequence the cell cycle, cause cellular senescence Paraxial protocadherin Adhesion pro-
because those genes were inherited in rapidly dividing cells, instruct the ini- tein expressed specifically in the parax-
from a common ancestor. Compare with tiation of apoptosis, and activate DNA ial (somite-forming) mesoderm during
Paralogues. repair enzymes. One of the most impor- amphibian gastrulation; essential for
Oskar A protein involved in setting up tant regulators of cell division. convergent extension.
the anterior-posterior axis of the Dro- Pachytene Greek, “thick thread.” In the Parietal endoderm Cells of the primitive
sophila egg and future embryo by bind- first meiotic division, the third stage endoderm that contact the trophoblast
ing nanos mRNA in the posterior region of prophase I during which the chro- of the mammalian embryo. See Primi-
of the egg, which will establish the pos- matids thicken and shorten and can be tive endoderm.
terior end of the future embryo. seen by light microscopy as individual Parietal mesoderm See Somatic
Ossification See Osteogenesis. mesoderm.
G–24 Glossary
Parthenogenesis Greek, “virgin birth.” pharyngeal arches. In amniotes, there Pioneer nerve fibers Axons that go
When an ovum is activated in the are four pharyngeal clefts in the early ahead of other axons and serve as
absence of sperm. Normal development embryo, but only the first becomes a guides for them.
can proceed in many invertebrates and structure (the external auditory meatus). Pioneer transcription factors Tran-
some vertebrates. Pharyngeal pouches Inside the phar- scription factors (e.g., Fox A1 and Pax7)
Pathway selection The first step in ynx, these are where the pharyngeal that can penetrate repressed chroma-
the specification of axonal connection, epithelium (endoderm) pushes out lat- tin and bind to their enhancer DNA
wherein the axons travel along a route erally to form pairs of pouches between sequences, a step critical to establishing
that leads them to a particular region of the pharyngeal arches. These give rise certain cell lineages.
the embryo. to the auditory tube, wall of the tonsil, Piwi One of the proteins, along with
Pattern formation The set of processes thymus gland, parathyroids and thyroid. Tudor, Vasa, and Nanos, expressed in
by which embryonic cells form ordered Pharyngula Term often applied to germ cells to suppress gene expression.
spatial arrangements of differentiated the late neurula stage of vertebrate Placenta The organ in placental mam-
tissues. embryos. mals that serves as the interface
P-cadherin A type of cadherin found Pharynx The region of the digestive tube between fetal and maternal circulations
predominantly on the placenta, where anterior to the point at which the respi- and has endocrine, immune, nutritive
it helps the placenta stick to the uterus ratory tube branches off. and respiratory functions. It consists of
(the P stands for placenta). See also Phenotypic heterogeneity Refers to the a maternal portion (the uterine endo-
Cadherins. same mutation producing different phe- metrium, or decidua, which is modified
Pericardial cavity The division of the notypes in different individuals. during pregnancy) and a fetal compo-
coelom that surrounds the heart. Com- Phenotypic plasticity The ability of an nent (the chorion).
pare with Peritoneal cavity; Pleural organism to react to an environmen- Placodes An area of ectodermal thick-
cavity. tal input with a change in form, state, ening. These include the cranial plac-
Perichondrium Connective tissue that movement, or rate of activity. odes (e.g., the olfactory, lens, and otic
surrounds most cartilage, except at Pheromones Vaporized chemicals placodes); and the epidermal placodes of
joints. emitted by an individual that results cutaneous appendages such as hair and
Pericytes Smooth-musclelike cells in communication with another indi- feathers, which are formed via inductive
recruited to cover endothelial cells dur- vidual. Pheromones are recognized by interactions between the dermal mesen-
ing vasculogenesis. the vomeronasal organ of many mam- chyme and the ectodermal epithelium.
Periderm A temporary epidermis-like malian species and play a major role in PLC See Phospholipase C.
covering in the embryo that is shed once sexual behavior. PLCζ (Phospholipase C zeta) A soluble
the inner layer differentiates to form a Phosphatidylinositol 4,5-bisphosphate form of phospholipase C found in the
true epidermis. (PIP2 ) A membrane phospholipid that head of mammalian sperm that is
Periosteal bone Bone that adds thick- during the IP3 pathway is split by the released during gamete fusion in fer-
ness to long bones and is derived enzyme phospholipase C (PLC) to yield tilization. It sets off the IP3 pathway in
from mesoderm via intramembranous two active compounds: IP3 and diacylg- the egg that results in Ca 2+ release and
ossification. lycerol (DAG). The IP3 pathway is acti- activation of the egg.
Periosteum A fibrous sheath containing vated during fertilization, launching the Pleiotropy The production of several
connective tissue, capillaries, and bone slow block to polyspermy and activating effects by one gene or pair of genes.
progenitor cells and that covers the the egg to start developing. Pleural cavity The division of the coe-
developing and adult bone. Phospholipase C (PLC) Enzyme in lom that surrounds the lungs. Compare
Peritoneal cavity The division of the the IP3 pathway that splits membrane with Pericardial cavity; Peritoneal
coelom that encloses the abdominal phospholipid phosphatidylinositol cavity.
organs. Compare with Pericardial 4,5-bisphosphate (PIP2) to yield IP3 and Pluripotent Latin, “capable of many
cavity; Pleural cavity. diacylglycerol (DAG). things.” A single pluripotent stem cell
Permissive interaction Inductive inter- Phylotypic stage The stage that typifies has the ability to give rise to different
action in which the responding tissue a phylum, such as the late neurula or types of cells that develop from the
has already been specified, and needs pharyngula of vertebrates, and which three germ layers (mesoderm, endo-
only an environment that allows the appears to be relatively invariant and to derm, ectoderm) from which all the
expression of these traits. constrain its evolution. cells of the body arise. The cells of the
Pial surface The outer surface of the mammalian inner cell mass (ICM) are
P-granules The germ plasm in C. pluripotent, as are embryonic stem cells.
elegans. Isolated to a single germline brain; “pial” refers to its being next to
the pia mater, one of the meninges of Each of these cells can generate any
precursor cell (P4 blastomere) early in cell type in the body, but because the
cleavage. the brain.
PIE-1 A maternally expressed tran- distinction between ICM and tropho-
Pharyngeal arches Paired bars of mes- blast has been established, it is thought
enchymal tissue (derived from paraxial scription factor in the oocyte of the
nematode C. elegans that is necessary for that ICM cells are not able to form the
mesoderm, lateral plate mesoderm, and trophoblast. Germ cells and germ cell
neural crest cells), covered by endoderm germline cell fate.
tumors (such as teratocarcinomas) can
internally and ectoderm externally. Pigmented retina The melanin-contain- also form pluripotent stem cells. Com-
Found near the pharynx of the ver- ing layer of the vertebrate eye that lies pare with Totipotent.
tebrate embryo, the arches form gill behind the neural retina. It forms from
the outer layer of the optic cup. The Pluripotent hematopoietic stem
supports in fish, and many skeletal and cell See Hematopoietic stem cell
connective tissue structures in the face, black melanin pigment absorbs light
coming through the neural retina, pre- (HSC).
jaw, mouth, and larynx in other verte-
brates. Also called branchial arches. venting it from bouncing back through Pluteus larva Type of larva found in sea
the neural retina, which would distort urchins and brittle stars; a planktonic
Pharyngeal clefts Clefts (invaginations) larva that is bilaterally symmetrical,
of external ectoderm that separate the the image perceived.
Glossary G–25
ciliated, and has long arms supported Polydactyly The presence of extra Precursor cells (precursors) Widely
by skeletal spicules. (supernumerary) digits, such as the dew used term to denote any ancestral cell
Polar body The smaller cell, containing claw on Great Pyrenees dogs. type (stem or progenitor cells) of a par-
hardly any cytoplasm, generated during Polyphenism A type of phenotypic plas- ticular lineage (e.g., neuronal precur-
the asymmetrical meiotic division of the ticity, refers to discontinuous (“either/ sors; blood cell precursors).
oocyte. The first polar body is haploid or”) phenotypes elicited by the environ- Predator-induced polyphenism The
and results from the first meiotic divi- ment. Compare with Reaction norm. ability to modulate development in the
sion and the secondary polar body is Polyspermy The entrance of more than presence of predators in order to express
also haploid and results from the second one sperm during fertilization resulting a more defensive phenotype.
meiotic division. in aneuploidy (abnormal chromosome Preeclampsia Medical condition of
Polar granule component (PGC) A number) and either death or abnormal pregnant women characterized by
protein important for germ line specifi- development. An exception, called hypertension, poor renal filtration, and
cation and localized to Drosophila polar physiological polyspermy, occurs in fetal distress. A leading cause of prema-
granules. PGC inhibits transcription some organisms such as Drosophila ture birth and both fetal and maternal
of somatic cell-determining genes by and birds, where multiple sperm enter deaths.
preventing the phosphorylation of RNA the egg but only one sperm pronucleus Preformationism The view, supported
polymerase II. fuses with the egg pronucleus. by the early microscopist Marcello Mal-
Polar granules Particles containing fac- Polytene chromosomes Chromosomes pighi, that the organs of the embryo
tors important for germ line specifica- in the larval cells of Drosophila (but not are already present, in miniature form,
tion that are localized to the pole plasm the imaginal cells that give rise to the within the egg (or sperm). A corollary,
and pole cells of Drosophila. adult) in which the DNA undergoes embôitment (encapsulation), stated that
Polar lobe An anucleate bulb of cyto- many rounds of replication without sep- the next generation already existed in a
plasm extruded immediately before aration, forming large “puffs” that are prefigured state within the germ cells
first cleavage, and sometimes before easily visible and indicate active gene of the first prefigured generation, thus
the second cleavage, in certain spirally transcription. ensuring that the species would remain
cleaving embryos (mostly in the mol- Population asymmetry Mode of main- constant.
lusc and annelid phyla). It contains the taining homeostasis in a population of Preimplantation genetics Testing for
determinants for the proper cleavage stem cells in which some of the cells are genetic diseases using blastomeres from
rhythm and the cleavage orientation of more prone to producing differentiated embryos produced by in vitro fertiliza-
the D blastomere. progeny, while others divide to main- tion before implanting the embryo in
Polarization The first stage of cell migra- tain the stem cell pool. the uterus.
tion, wherein a cell defines its front and Posterior marginal zone (PMZ) The end Pre-initiation complex The complex of
its back ends, directed by diffusing sig- of the chick blastoderm where primitive RNA polymerase II at the promoter with
nals (such as a chemotactic protein) or streak formation begins and acts as the transcription factors on the enhancer, as
by signals from the extracellular matrix. equivalent of the amphibian Nieuwkoop brought together by the Mediator mol-
These signals will reorganize the cyto- center. The cells of the PMZ initiate ecules. See also Mediator.
skeleton such that the front part of the gastrulation and prevent other regions Pre-metamorphosis The first stage in
cell will form lamellipodia (or filopodia) of the margin from forming their own amphibian metamorphosis; the thy-
with newly polymerized actin. primitive streaks. roid gland has begun to mature and is
Pole cells About five nuclei in the Dro- Posterior necrotic zone A zone of secreting low levels of T4 and very low
sophila embryo that reach the surface of programmed cell death on the posterior levels of T3. The TRα receptor is present,
the posterior pole during the ninth divi- side of the developing tetrapod limb but the TRβ receptor is not.
sion cycle and become enclosed by cell that helps shape the limb. Prenatal diagnosis The use of chorionic
membranes. The pole cells give rise to Posterior neuropore See Neuropore. villus sampling or amniocentesis to
the gametes of the adult. Postsynaptic cell The target cell that diagnose many genetic diseases before
Pole plasm Cytoplasm at the posterior receives chemical neurotransmitters a baby is born.
pole of the Drosophila oocyte that con- from a presynaptic neuron, causing Presomitic mesoderm (PSM) The
tains the determinants for producing depolarization or hyperpolarization of mesoderm that will form the somites.
the abdomen and the germ cells. the target cell’s membrane. Also known as the segmental plate.
PolyA tail A series of adenine (A) resi- Posttranslational regulation Modi- Presynaptic neuron Neuron that trans-
dues that are added by enzymes to the fications that determine whether the mits chemical neurotransmitters to a
3′ terminus of the mRNA transcript in translated protein will be active. These target cell, causing the depolarization
the nucleus. The polyA tail confers sta- modifications can include cleaving an or hyperpolarization of the target cell’s
bility on the mRNA, allows the mRNA inhibitory peptide sequence; seques- membrane.
to exit the nucleus, and permits the tration and targeting to specific cell Primary capillary plexus A network of
mRNA to be translated into protein. regions; assembly with other proteins capillaries formed by endothelial cells
Polyadenylation The insertion of a “tail” to form a functional unit; binding an during vasculogenesis.
of some 200–300 adenylate residues ion (such as Ca 2+); or modification by Primary cilium A single, non-motile cil-
on the RNA transcript, about 20 bases the covalent addition of a phosphate or ium found on most cells; lacks a central
downstream of the AAUAAA sequence. acetate group. pair of microtubules and is involved in
This polyA tail (1) confers stability on Potency In referring to stem cells, the part of the hedgehog signaling pathway
the mRNA, (2) allows the mRNA to exit power to produce different types of dif- by transporting signaling molecules on
the nucleus, and (3) permits the mRNA ferentiated cells. its microtubules using motor proteins.
to be translated into protein. Prechordal plate mesoderm Precursor Primary embryonic induction The pro-
Polycomb proteins Family of proteins of the head mesoderm. The mesoderm cess whereby the dorsal axis and central
that bind to condensed nucleosomes, cells that move inward during gastrula- nervous system forms through interac-
keeping the genes in an inactive state. tion ahead of the chordamesoderm. tions with the underlying mesoderm,
G–26 Glossary
derived from the dorsal lip of the blasto- serves as an opening through which Promoter Region of a gene containing
pore in amphibian embryos. migrating cells pass into the deep layers the DNA sequence to which RNA poly-
Primary larvae Larvae that represent of the embryo. merase II binds to initiate transcription.
dramatically different body plans than Primitive knot/pit See Hensen’s node. See also CpG islands; Enhancer.
the adult form and that are morphologi- Primitive streak The first morphologi- Pronephric duct Arises in the interme-
cally distinct from the adult; the plutei cal sign of gastrulation in amniotes, it diate mesoderm, migrates caudally, and
of sea urchins are such larvae. Compare first arises from a local thickening of the induces the adjacent mesenchyme to
with Secondary larvae. epiblast at the posterior edge of the area form the pronephros, or tubules of the
Primary neurulation The process that pellucida, called Koller’s sickle. Homol- initial kidney of the embryo. The pro-
forms the anterior portion of the neural ogous to the amphibian blastopore. nephric tubules form functioning kid-
tube. The cells surrounding the neural Primordial germ cells (PGCs) Gamete neys in fish and in amphibian larvae but
plate direct the neural plate cells to pro- progenitor cells, which typically arise are not believed to be active in amni-
liferate, invaginate, and pinch off from elsewhere and migrate into the develop- otes. As the duct continues growing
the surface to form a hollow tube. ing gonads. downward it induces the mesonephric
Primary oocytes A developing egg that mesenchyme to form tubules, at which
Proacrosin The inactive form of a mam- point it is called the mesonephric duct.
has passed through the oogonial stage malian sperm proteinase that is stored
and is in a stage of growth prior to Also called Wolffian duct and nephric
in the acrosome and released during the duct.
any meiotic division. Contains a large acrosomal reaction and helps the sperm
nucleus called a germinal vesicle. At move through the zona pellucida of the Pronephros The first region of kidney
this stage, mRNA (maternal mRNA) egg. mesenchyme to form kidney tubules in
is being made and stored in the egg. In vertebrates. The pronephros is a func-
Proerythroblast A red blood cell tioning kidney in fish and amphibian
mammals, a primary oocyte is arrested precursor.
in first meiotic prophase until just prior larvae, but is not believed to be active in
to ovulation, when the first meiotic divi- Progenesis Condition in which the amniotes, and degenerates after other
sion is completed and the egg becomes gonads and germ cells develop at a fast- regions of the kidney develop.
a secondary oocyte. The second meiotic er rate than the rest of the body, becom- Pronuclei The male and female haploid
division is then arrested and is not com- ing sexually mature while the rest of the nuclei within a fertilized egg that fuse to
pleted until after fertilization. body is still in a juvenile phase. Com- form the diploid nucleus of the zygote.
pare with Neoteny.
Primary sex determination The deter- Pronymph The stage immediately after
mination of the gonads to form either Progenitor cells Relatively undiffer- hatching in ametabolous insects, when
the egg-forming ovaries or sperm-form- entiated cells that have the capacity to the organism bears the structures that
ing testes. Primary sex determination is divide a few times before differentiating enabled it to get out of the egg; after this
chromosomal and is not usually influ- and, unlike stem cells, are not capable of stage, the insect looks like a small adult.
enced by the environment in mammals, unlimited self-renewal. They are some-
times called transit amplifying cells Prosencephalon The forebrain; the
but can be affected by the environment most anterior vesicle of the developing
in other vertebrates. because they divide while migrating.
vertebrate brain. Will form two second-
Primary spermatocytes Derived from Progerias Premature aging syndromes; ary brain vesicles: the telencephalon and
mitotic division of the type B spermato- in humans and mice, appear to be the diencephalon.
gonia, these are the cells that first go caused by mutations that prevent the
functioning of DNA repair enzymes. Protamines Basic proteins, tightly com-
through a period of growth and then pacted through disulfide bonds, that
enter meiosis. Progesterone A steroid hormone package the DNA of the sperm nucleus.
Primaxial muscles The intercostal mus- important in the maintenance of preg-
nancy in mammals. Progesterone Protein-protein interaction domain A
culature between the ribs and the deep domain of a transcription factor that
muscles of the back, formed from those secreted from the cumulus cells may act
as a chemotactic factor for sperm. enables it to interact with other proteins
myoblasts in the myotome closest to the on the enhancer or promoter.
neural tube. Programmed cell death See Apoptosis.
Proteoglycans Large extracellular
Primed pluripotent state The state of an Progress zone (PZ) Highly proliferative matrix molecules consisting of core
embryonic stem cell that has undergone limb bud mesenchyme directly beneath proteins (such as syndecan) with cova-
some maturation toward the epiblast the apical ectodermal ridge (AER). The lently attached glycosaminoglycan
lineage. proximal-distal growth and differentia- polysaccharide side chains. Two of the
Primitive endoderm The layer of endo- tion of the limb bud are made possible most widespread are heparan sulfate
derm cells created during early mam- by a series of interactions between the proteoglycan and chondroitin sulfate
malian development when the inner AER and the progress zone. Also called proteoglycan.
cell mass splits into two layers. The the undifferentiated zone.
Proteome The number and type of pro-
lower layer, in contact with the blas- Progress zone model Model for speci- teins encoded by the genome.
tocoel, is the primitive endoderm, and fication of proximal-distal specifica-
tion of the limb that postulates that Prothoracic gland In insects, a gland
is homologous to the hypoblast of the that secretes ecdysone, a molting
avian embryo. It will form the inner each mesoderm cell is specified by the
amount of time it spends dividing in the hormone; production of ecdysone is
lining of the yolk sac, and will be used stimulated by the prothoracicotropic
for positioning the site of gastrulation, progress zone. The longer a cell spends
in the progress zone, the more mitoses it hormone.
regulating the movements of cells in the
epiblast, and promoting the maturation achieves and the more distal its specifi- Prothoracicotropic hormone (PTTH) A
of blood cells. It is an extraembryonic cation becomes. peptide hormone that initiates the molt-
layer that does not provide cells to the Prometamorphosis The second stage ing process in insects when it is released
body of the embryo. in amphibian metamorphosis, during by neurosecretory cells in the brain in
which the thyroid matures and secretes response to neural, hormonal, or envi-
Primitive groove A depression that ronmental signals. PTTH stimulates the
forms within the primitive streak that more thyroid hormones.
Glossary G–27
production of ecdysone by the protho- Random epigenetic drift The hypoth- Reelin An extracellular matrix protein
racic gland. esis that the chance accumulation of found in the developing cerebellum and
Protocadherins A class of cadherins inappropriate epigenetic methylation cerebrum. In the cerebellum it permits
that lack the attachment to the actin due to errors made by the DNA meth- neurons to bind to glial cells as neurons
skeleton through catenins. They are an ylating and demethylating enzymes migrate and form layers; in the cere-
important means of keeping migrat- could be the critical factor in aging and brum it directs migration of neurons
ing epithelia together, and they are cancers. toward the pial surface.
important in separating the notochord Ras A G-protein in the RTK pathway. Regeneration The ability to reform body
from surrounding mesoderm during its Mutations in the RAS gene account for structure or organ that has been dam-
formation. a large proportion of cancerous human aged or destroyed by trauma or disease.
Protostomes Greek, “mouth first.” tumors. Regeneration blastema A collection of
Animals that form their mouth regions Rathke’s pouch An outpocketing of the relatively undifferentiated cells that are
from the blastopore, such as molluscs. ectoderm in the roof of the oral region organized into new structures by para-
Compare with Deuterostomes. that forms the glandular portion of the crine factors located at the cut surface.
Proximal-distal axis The close-far axis, pituitary gland in vertebrates. It meets The collection of cells may be derived
e.g., shoulder-finger or hip-toe (in rela- the infundibulum, an outpocketing of from differentiated tissue near the site
tion to the body’s center). the floor of the diencephalon, which of amputation that dedifferentiate, go
Pseudohermaphroditism Intersex forms the neural portion of the pituitary through a period of mitosis, and then
conditions in which the secondary sex gland. redifferentiate into the lost structures,
characteristics differ from what would Reaction norm A type of phenotypic as in the regenerating salamander limb,
be expected from the gonadal sex. Male plasticity in which the genome encodes or may be from pluripotent stem cells
pseudohermaphroditism (e.g., androgen the potential for a continuous range of that migrate to the cut surface, as in
insensitivity syndrome) describes con- potential phenotypes; the environment flatworm regeneration.
ditions wherein the gonadal sex is male the individual encounters determines Regenerative medicine The therapeu-
and the secondary sex characteristics which of the potential phenotypes tic use of stem cells to correct genetic
are female, while female pseudoher- develops. Compare with Polyphenism. pathologies (e.g., sickle-cell anemia) or
maphroditism describes the reverse Reaction-diffusion model Model for repair damaged organs.
situation (e.g., congenital adrenal developmental patterning, especially Regulation The ability to respecify cells
hyperplasia). that of the limb, wherein two homo- so that the removal of cells destined to
Pupa A non-feeding stage of a holome- geneously distributed substances (an become a particular structure can be
tabolous insect following the last instar activator, substance A, that activates compensated for by other cells produc-
when the organism is going through itself as well as forming its own, faster- ing that structure. This is seen when an
metamorphosis, being transformed diffusing inhibitor, substance I) interact entire embryo is produced by cells that
from a larva into an adult (imago). to produce stable complex patterns would have contributed only certain
Purkinje fibers Modified heart muscle during morphogenesis. According to parts to the original embryo. It is also
cells in the inner walls of the ventricles, this model, set forth in the early 1950s seen in the ability of two or more early
specialized for rapid conduction of the by mathematician Alan Turing, the embryos to form one chimeric indi-
contractile signal. Essential for synchro- patterns generated by this reaction- vidual rather than twins, triplets, or a
nizing the contractions of the ventricles diffusion mechanism represent regional multiheaded individual.
in amniotes. differences in the concentrations of the Relational pleiotropy The action of
two substances. a gene in one part of the embryo
Purkinje neurons Large, mutibranched
neurons that are the major cell type of Reactive oxygen species (ROS) Meta- that affects other parts, not by being
the cerebellum. bolic by-products that can damage cell expressed in these other parts but by
membranes and proteins and destroy having initiated a cascade of events that
DNA. ROS are generated by mitochon- affect these other parts.
R dria due to insufficient reduction of oxy- Reporter gene A gene with a product
R-cadherin A type of cadherin critical gen atoms and include superoxide ions, that is readily identifiable and not usu-
in forming the retina (the R stands for hydroxyl (“free”) radicals, and hydrogen ally made in the cells of interest. Can
retina). See Cadherins. peroxide. be fused to regulatory elements from a
RA See Retinoic acid. Receptor A protein that functions to gene of interest, inserted into embryos,
Radial glial cells (radial glia) Neural bind a ligand. See also Ligand. and then monitored for reporter gene
progenitor cells found in the ventricular Receptor tyrosine kinase (RTK) A expression. If the sequence contains
zone (VZ) of the developing brain. At receptor that spans the cell membrane an enhancer, the reporter gene should
each division, they generate another VZ and has an extracellular region, a trans- become active at particular times and
cell and a more committed cell type that membrane region, and a cytoplasmic places. The genes for green fluorescent
leaves the VZ to differentiate. region. Ligand (paracrine factor) bind- protein (GFP) and β-galactosidase (lacZ)
ing to the extracellular domain causes a are common examples.
Radial holoblastic cleavage Cleavage
pattern in echinoderms. The cleavage conformational change in the receptor’s Resact A 14-amino-acid peptide that
planes, which divide the egg completely cytoplasmic domains, activating kinase has been isolated from the egg jelly of
into separate cells (holoblastic), are activity that uses ATP to phosphorylate the sea urchin Arbacia punctulata that
parallel or perpendicular to the animal- specific tyrosine residues of particular acts as a chemotactic factor and sperm-
vegetal axis of the egg. proteins. activating peptide for sperm of the same
Reciprocal inductions A common species, i.e., it is species-specific and
Radial intercalation In fish embryos, the
sequential feature of induction: One is thereby a mechanism to ensure that
movement of deep epiblast cells into the
tissue induces another, and that tissue fertilization is also species-specific. See
more superficial epiblast layer, helping
then acts back on the original inducing also Sperm-activating peptide.
to power epiboly during gastrulation.
tissue and induces it, thus the inducer Resegmentation Occurs during forma-
becomes the induced. tion of the vertebrae from sclerotomes;
G–28 Glossary
the rostral segment of each sclerotome the sexually mature adult-stage medusa in the roof plate cells, which in turn
recombines with the caudal segment of is able to revert to the polyp stage. induces a cascade of TGF-β proteins in
the next anterior sclerotome to form the Reverse genetics Genetic technique adjacent cells of the neural tube.
vertebral rudiment and this enables the of knocking out or knocking down Rosettes Pinwheel-like structures, such
muscles of the vertebral column derived the expression of a gene in an organ- as the structures made up of small clus-
from the myotomes to coordinate the ism and then studying the phenotype ters of neural stem cells surrounded by
movement of the skeleton, permitting that results. Compare with Forward ciliated ependymal cells found in the
the body to move laterally. genetics. V-SVZ of the mammalian cerebrum.
Respiratory tube The future respiratory Rho GTPases A family of molecules Rostral-caudal Latin, “beak-tail.”
tract, which forms as an epithelial out- including RhoA, Rac1, and Cdc42 that An anterior-posterior positional axis;
pocketing of the pharynx, and eventu- convert soluble actin into fibrous actin often used when referring to vertebrate
ally bifurcates into the two lungs. cables that anchor at the cadherins. embryos or brains.
Responder During induction, the tissue These help mediate cell migration by Rotational cleavage The cleavage pat-
being induced. Cells of the respond- lamellipodia and filopodia and the tern for mammalian and nematode
ing tissue must have receptors for the cadherin-dependent remodeling of the embryos. In mammals, the first cleav-
inducing molecules and be competent to cytoskeleton. age is a normal meridional division
respond to the inducer. Rhombencephalon The hindbrain, the while in the second cleavage, one of the
Resting membrane potential The mem- most caudal vesicle of the developing two blastomeres divides meridionally
brane potential (membrane voltage) vertebrate brain; will form two second- and the other divides equatorially. In
normally maintained by a cell, deter- ary brain vesicles, the metencephalon C. elegans, each asymmetrical division
mined by the concentration of ions on and myelencephalon. produces one founder cell that produces
either side of the membrane. Generally Rhombomeres Periodic swellings differentiated descendants; and one
this is –70mV, where the inside of the that divide the rhombencephalon into stem cell. The stem cell lineage always
cell is negatively charged with respect to smaller compartments, each with a undergoes meridional division to pro-
the exterior. different fate and different associated duce (1) an anterior founder cell and (2)
Rete testis A network of thin canals that nerve ganglia. a posterior cell that will continue the
convey sperm from the seminiferous Right-left axis Specification of the two stem cell lineage.
tubules to the efferent ducts. lateral sides of the body. Roundabout proteins (Robo) Proteins
Reticulocyte Cell derived from the Ring canals The cytoplasmic intercon- that are receptors for slit proteins,
mammalian erythroblast that has nections between the cystocytes that involved in controlling the crossing of
expelled its nucleus. Although reticulo- become the ovum and nurse cells in an the midline of commissural axons.
cytes, lacking a nucleus, can no longer ovariole of Drosophila. Royalactin Protein that induces a hon-
synthesize globin mRNA, they can RNA interference Process by which eybee larva to become a queen. Fed to
translate existing messages into glo- miRNAs inhibit expression of specific the larva by worker bees, the protein
bins. A reticulocyte differentiates into genes by degrading their mRNAs. binds to EGF receptors in the larva fat
a mature red blood cell (erythrocyte), body and stimulates the production of
in which even translation of mRNA RNA polymerase II An enzyme that juvenile hormone, which elevates the
doesn’t take place. binds to a promoter on DNA and, when levels of yolk proteins necessary for egg
activated, catalyzes the transcription of production.
Retina See Neural retina. an RNA template from the DNA.
Retinal ganglion cells (RGCs) Neurons R-spondin1 (Rspo1) Small, soluble pro-
RNA-induced silencing complex tein that upregulates the Wnt pathway
in the retina of the eye whose axons (RISC) A complex containing several
are guided to the optic tectum of the and is critical for ovary formation in
proteins and a microRNA, which can mammals.
brain. Guidance cues come from netrin, then bind to the 3′ UTR of messages and
slit, semaphorin, and ephrin families of inhibit their translation. RTK pathway The receptor tyrosine
molecules. kinase (RTK) is dimerized by ligand,
RNA-Seq (RNA sequencing) Using which causes autophosphorylation of the
Retinal homeobox (Rx) A transcription next-generation sequencing technology
factor coded for by the Rx gene. Pro- receptor. An adaptor protein recognizes
to sequence and quantify the RNA pres- the phosphorylated tyrosines on the RTK
duced in the eye field and helps specify ent in a biological sample.
the retina. and activates an intermediate protein,
Robo proteins See Roundabout GEF, which activates the Ras G protein
Retinoic acid (RA) A derivative of proteins.
vitamin A and morphogen involved in by allowing the phosphorylation of the
anterior-posterior axis formation. Cells Robustness (canalization) The abil- GDP-bound Ras. At the same time, the
receiving high levels of RA express pos- ity of an organism to develop the same GAP protein stimulates the hydrolysis
terior genes. phenotype despite perturbations from of this phosphate bond, returning Ras to
the environment or from mutations. It its inactive state. The active Ras activates
Retinoic acid-4-hydroxylase An is a function of interactions within and the Raf protein kinase C (PKC), which in
enzyme that degrades retinoic acid. between developmental modules. turn phosphorylates a series of kinases.
Retinotectal projection The map of Rods Photoreceptors in the neural retina Eventually, an activated kinase alters
retinal connections to the optic tec- of the vertebrate eye that are more gene expression in the nucleus of the
tum. Point-for-point correspondence sensitive to low light than cones. They responding cell by phosphorylating cer-
between the cells of the retina and the contain only one light-sensitive pigment tain transcription factors (which can then
cells of the tectum that enables the ani- and therefore do not transmit informa- enter the nucleus to change the types of
mal to see an unbroken image. tion about color. genes transcribed) and certain translation
Reverse development The transforma- Roof plate Dorsal region of the neural
factors (which alter the level of protein
tion of a mature stage of an organism synthesis). In many cases, this pathway is
tube important in the establishment
to a more juvenile stage of its life cycle. reinforced by the release of Ca2+.
of dorsal-ventral polarity. The adjacent
Seen in certain hydrozoan species where epidermis induces expression of BMP4
Glossary G–29
S Secondary oocyte The haploid oocyte somatic cells, which are in turn derived
Sacral neural crest Neural crest cells following the first meiotic division (this from the genital ridge epithelium.
that lie posterior to the trunk neural division also generates the first polar Sesamoid bone Small bones at joints
crest and along with the vagal neural body). that form as a result of mechanical
crest generate the parasympathetic Secondary sex determination Devel- stress (such as the patella). They are
(enteric) ganglia of the gut that are opmental events, directed by hormones derived from mesoderm via intramem-
required for peristaltic movement in the produced by the gonads that affect the branous ossification.
bowels. phenotype outside the gonads. This Sex-lethal (Skl) An autosomal gene in
Sarcopterygian fishes Lobe-finned fish, includes the male or female duct sys- Drosophila involved in sex determina-
including coelacanths and lungfish. tems and external genitalia, and, in tion. It codes for a splicing factor that
Tetrapods evolved from sarcopterygian many species, sex-specific body size, initiates a cascade of RNA processing
ancestors. vocal cartilage, and musculature. events, which eventually lead to male-
Satellite cells Populations of muscle Secondary spermatocytes A pair of specific and female-specific transcrip-
stem cells and progenitor cells that haploid cells derived from the first mei- tion factors, the Doublesex proteins. See
reside alongside adult muscle fibers and otic division of a primary spermatocyte, Doublesex.
can respond to injury or exercise by pro- which then complete the second divi- Shh See Sonic hedgehog.
liferating into myogenic cells that fuse sion of meiosis to generate the four hap- Shield See Embryonic shield.
and form new muscle fibers. loid spermatids.
Signal transduction cascades Path-
Scatter factor See Hepatocyte growth Segment polarity genes Drosophila ways of response whereby paracrine
factor. zygotic genes, activated by the proteins factors bind to a receptor that initiates
encoded by the pair-rule genes, whose a series of enzymatic reactions within
Schizocoely The embryonic process of mRNA and protein products divide the
forming the coelom by hollowing out the cell that in turn have often several
embryo into segment-sized units, estab- responses as their end point, such as the
a previously solid cord of mesodermal lishing the periodicity of the embryo.
cells. Typical of protostomes. See also regulation of transcription factors (such
Segment polarity mutants showed that different genes are expressed in the
Enterocoely. defects (deletions, duplications, polarity
Schwann cell Type of glial cell of the cells reacting to these paracrine factors)
reversals) in every segment. and/or the regulation of the cytoskel-
peripheral nervous system that gener- Segmentation genes Genes whose
ates a myelin sheath, allowing rapid eton (such that the cells responding to
products divide the early Drosophila the paracrine factors alter their shape or
transmission of electrical signals along embryo into a repeating series of seg-
an axon. are permitted to migrate).
mental primordia along the anterior- Silencer A DNA regulatory element that
Sclerotomes Blocks of mesodermal cells posterior axis. Include gap genes, pair-
in the ventromedial half of each somite binds transcription factors that actively
rule genes, and segment polarity genes. repress the transcription of a particular
that will differentiate into the verte- Selective affinity Principle that explains
brae, intervertebral discs (except for the gene.
why disaggregated cells reaggregate to Single stem cell asymmetry A mode of
nuclei pulposi) and ribs, in addition to reflect their embryonic positions. Spe-
the meninges of the spinal cord and the stem cell division in which two types
cifically, the inner surface of the ecto- of cells are produced at each division, a
blood vessels that serve the spinal cord. derm has a positive affinity for meso-
They are also critical in patterning the stem cell and a developmentally com-
dermal cells and a negative affinity for mitted cell.
neural crest and motor neurons. the endoderm, while the mesoderm has
Sebaceous gland Glands that are asso- positive affinities for both ectodermal Sinistral coiling Left-coiling. In a snail,
ciated with hair follicles and produce an and endodermal cells. having its coils open to the left of its
oily substance, sebum, that serves to shells. See also Dextral coiling.
Self-renewal The ability of a cell to
lubricate the hair and skin. divide and produce a replica of itself. Sinus venosus The posterior region of
Secondary hypoblast Underlies the the developing heart, where the two
Semaphorins Extracellular matrix pro- major vitelline veins bringing blood to
epiblast in the bilaminar avian blasto- teins that repel migrating neural crest
derm. A sheet of cells derived from deep the heart fuse. Inflow tract to the atrial
cells and axonal growth cones. area of the heart.
yolky cells at the posterior margin of
the blastoderm that migrates anteriorly, Seminiferous tubules In male mam- Sinusoidal endothelial cells Cells that
displacing the hypoblast islands (pri- mals, form in the gonad from the testis line the large blood channels (sinusoids)
mary hypoblast). Hypoblast cells do not cords. They contain Sertoli cells (nurse of the liver and critical to liver function.
contribute to the avian embryo proper, cells) and spermatogonia (sperm stem Also provides paracrine factors needed
but instead form portions of the external cells). for division of hepatoblast stem cells
membranes, especially the yolk sac, and Senescence The physiological deterio- during liver regeneration. Long consid-
provide chemical signals that specify ration that characterizes old age. ered mesodermal in origin, they now
the migration of epiblast cells. Also Septum A partition that divides a cham- are known to be derived at least in part
called endoblast. ber, such as the atrial septa that split by specialized endodermal cells.
Secondary larvae Larvae that possess the developing atrium into left and right Sirtuin genes Encode histone deacety-
the same basic body plan as the adult; atria. Plural, septa. lation (chromatin-silencing) enzymes
caterpillars and tadpoles are examples. Sertoli cells Large secretory support that guard the genome, preventing
Compare with Primary larvae. cells in the seminiferous tubules of the genes from being expressed at the
Secondary neurulation The process that testes involved in spermatogenesis in wrong times and places, and may help
forms the posterior portion of the neural the adult through their role in nourish- repair chromosomal breaks. They may
tube by the coalescence of mesenchyme ing and maintaining the developing be important defenses against prema-
cells into a solid cord that subsequently sperm cells. They secrete AMH in the ture aging.
forms cavities that coalesce to create a fetus and provide a niche for the incom- Skeletogenic mesenchyme Also called
hollow tube. ing germ cells. They are derived from primary mesenchyme, formed from the
G–30 Glossary
first tier of micromeres (the large micro- other components of lateral mesoderm cell commitment is still capable of being
meres) of the 60-cell sea urchin embryo. (splanchnic, near endoderm, ven- reversed.
They ingress, moving into the blasto- tral) by the intraembryonic coelom. Spemann’s Organizer See Organizer.
coel, and form the larval skeleton. Together with the overlying ectoderm, Sperm head Consists of the nucleus,
SKN-1 A maternally expressed tran- the somatic mesoderm comprises the acrosome, and minimal cytoplasm.
scription factor in the oocyte of the somatopleure, which will form the body
wall. The somatic mesoderm also forms Sperm-activating peptides
nematode C. elegans that controls the
part of the lining of the coelom. Not (SAPs) Small chemotactic peptides
fate of the EMS cell, one of the cells of
to be confused with somitic (paraxial) found in the jelly of echinoderm eggs.
the 4-cell stage that marks the ventral
mesoderm. They diffuse away from the egg jelly in
region of the developing embryo.
seawater and are species specific, only
Slit proteins Proteins of the extracel- Somatopleure Made up of somatic attracting sperm of the same species.
lular matrix that are chemorepulsive; lateral plate mesoderm and overlying Resact, found in the sea urchin Arbacia
involved in inhibiting migration of neu- ectoderm. punctulata, is an example.
ral crest cells and in controlling growth Somites Segmental blocks of meso- Spermatids Haploid sperm cells, the
of commissural axons. derm formed from paraxial mesoderm stage following the second meiotic divi-
Slow block to polyspermy See Cortical adjacent to the notochord (the axial sion. In mammals, spermatids are still
granule reaction. mesoderm). Each contain major com- connected to one another by cytoplas-
Smad family Transcription factors partments: the sclerotome, which forms mic bridges, allowing for diffusion of
activated by members of the TGF-β the axial skeleton (vertebrae and ribs), gene products across the cytoplasmic
superfamily that function in the SMAD and the dermomyotome, which goes bridges.
pathway. See also SMAD pathway. on to form dermatome and myotome.
The dermatome forms the dermis of the Spermatogenesis The production of
SMAD pathway The pathway activated back; the myotome forms musculature sperm.
by members of the TGF-β superfam- of the back, rib cage, and ventral body. Spermatogonia Sperm stem cells. When
ily. The TGF-β ligand binds to a type Additional muscle progenitors detach a spermatogonium stops undergoing
II TGF-β receptor, which allows that from the lateral edge of the dermomyo- mitosis, it becomes a primary sper-
receptor to bind to a type I TGF-β tome and migrate into the limbs to form matocyte and increases in size prior to
receptor. Once the two receptors are in the muscles of the fore- and hindlimbs. meiosis.
close contact, the type II receptor phos-
Somitic mesoderm See Paraxial meso- Spermatozoa The male gamete or
phorylates a serine or threonine on the
derm. Not to be confused with somatic mature sperm cell.
type I receptor, thereby activating it. The
activated type I receptor can now phos- mesoderm. Spermiogenesis The differentiation of
phorylate the Smad proteins. Smads 1 Somitogenesis The process of seg- the mature spermatozoa from the hap-
and 5 are activated by the BMP family mentation of the paraxial mesoderm to loid round spermatid.
of TGF-β factors, while the receptors form somites, beginning cranially and Spina bifida A congenital defect result-
binding activin, Nodal, and the TGF-β extending caudally. Its components are ing from incomplete closure of the spine
family phosphorylate Smads 2 and 3. (1) periodicity, (2) fissure formation around the spinal cord, usually in the
These phosphorylated Smads bind to (to separate the somites), (3) epithe- lower back. There are differing degrees
Smad4 and form the transcription factor lialization, (4) specification, and (5) of severity, the most severe being when
complex that will enter the nucleus. differentiation. the neural folds also fail to close.
Small micromeres A cluster of cells pro- Somitomeres Early pre-somites, con- Spiral holoblastic cleavage Character-
duced by the fifth cleavage at the veg- sisting of paraxial mesoderm cells orga- istic of several animal groups, including
etal pole in the sea urchin embryo when nized into whorls of cells. annelid worms, some flatworms, and
the micromeres divide. Sonic hedgehog (Shh) The major most molluscs. Cleavage is at oblique
Solenoids Structures, created from hedgehog family paracrine factor. Shh angles to the animal-vegetal axis, form-
tightly wound nucleosomes stabilized has distinct functions in different tis- ing a “spiral” arrangement of daugh-
by histone H1, that inhibit transcription sues of the embryo. For example, it is ter blastomeres. The cells touch one
of genes by preventing transcription secreted by the notochord inducing the another at more places than do those of
factors and RNA polymerases from ventral region of the neural tube to form radially cleaving embryos, assuming the
gaining access to the genes. the floor plate. It is also involved in the most thermodynamically stable packing
establishment of left-right asymmetry, orientation.
Soma Greek, “body.” Can refer to the
cell body (particularly of neurons) or to primitive gut tube differentiation, prop- Splanchnic (visceral) mesoderm Also
the cells that form an organism’s body er feather formation in birds, differen- called the visceral mesoderm and
(as distinct from the germ cells). tiation of the sclerotome, and patterning splanchnic lateral plate mesoderm;
the anterior-posterior axis of limb buds. derived from lateral mesoderm closest
Somatic cell nuclear transfer (SCNT)
Sox9 An autosomal gene involved in to the endoderm (ventral) and separated
Less accurately known as “cloning,”
several developmental processes, most from other component of lateral meso-
the procedure by which a cell nucleus
notably bone formation. In the genital derm (somatic, near ectoderm, dorsal)
is transferred into an activated enucle-
ridge of mammals, it induces testis for- by the intraembryonic coelom. Together
ated egg and directs the development
mation, and XX humans with an extra with the underlying endoderm, it forms
of a complete organism with the same
copy of SOX9 develop as males. the splanchnopleure. The splanchnic
genome as the donor cell.
Specification The first stage of commit- mesoderm will form the heart, capil-
Somatic cells Cells that make up the laries, gonads, the visceral peritoneum
body—i.e., all cells in the organism that ment of cell or tissue fate during which
the cell or tissue is capable of differenti- and serous membranes that cover the
are not germ cells. Compare with Germ organs, the mesenteries, and blood cells.
cells. ating autonomously (i.e., by itself) when
placed in an environment that is neu- Splanchnopleure Made up of splanchnic
Somatic (parietal) mesoderm Derived tral with respect to the developmental lateral plate mesoderm and underlying
from lateral mesoderm closest to the pathway. At the stage of specification, endoderm. See Splanchnic mesoderm.
ectoderm (dorsal) and separated from
Glossary G–31
Spliceosome A complex made up of necessary for creating the bipotential another neuron or another type of cell)
small nuclear RNAs (snRNAs) and gonad. It declines in the developing and information in the form of neu-
splicing factors, that binds to splice sites ovary but remains at high levels in the rotransmitter molecules (e.g., acetyl-
and mediates the splicing of nRNA. developing testis, masculinizing both choline, GABA, serotonin) is exchanged
Splicing enhancer A cis-acting sequence Leydig and Sertoli cells. across the synaptic cleft between the
on nRNA that promotes the assembly of Stochastic Pertaining to a random pro- two cells.
spliceosomes at RNA cleavage sites. cess that provides a set of random vari- Synapsis The highly specific parallel
Splicing factors Proteins that bind to ables that can be analyzed statistically, alignment (pairing) of homologous
splice sites or to the areas adjacent to but not necessarily predicted. chromosomes during the first meiotic
them. Stomodeum An ectoderm-lined invagi- division.
Splicing isoforms Different proteins nation in the oral region of the embryo Synaptic cleft The small cleft that sepa-
encoded by the same gene and gener- that meets the endoderm of the closed rates the axon of a signaling neuron
ated by alternative splicing. gut tube to form the oral plate. from the dendrite or soma of its target
Splicing silencer A cis-acting sequence Stratum germinativum See Basal layer. cell.
on nRNA that acts to exclude exons Stromal derived factor 1 (SDF1) A Synaptonemal complex The protein-
from an mRNA sequence. chemoattractant. SDF1is secreted, for aceous ribbon that forms during synap-
Src family kinases (SFK) Family of example, by ectodermal placodes, there- sis between homologous chromosomes,
enzymes that phosphorylate tyrosine by attracting cranial neural crest cells holding them together. A ladderlike
residues; involved in many signal- toward the placode. structure with a central element and
ing events, including the responses of Stylopod The proximal bones of a ver- two lateral bars that are associated with
growth cones to chemoattractants. tebrate limb, adjacent to the body wall; the homologous chromosomes. See
either the humerus (forelimb) or the Synapsis.
Sry Sex-determining region of the Y
chromosome. The Sry gene encodes the femur (hindlimb). Syncytial blastoderm Describes the
mammalian testis-determining factor. Subgerminal cavity A space between Drosophila embryo during cleavage
It is probably active for only a few hours the blastoderm and the yolk of avian when nuclei have divided, but no cell
in the genital ridge, during which time eggs which is created when the blas- membranes have yet formed to separate
it synthesizes the Sry transcription fac- toderm cells absorb water from the the nuclei into individual cells.
tor, whose primary role is to activate the albumen (“egg white”) and secrete fluid Syncytial specification The interac-
Sox9 gene required for testis formation. between themselves and the yolk. tions of nuclei and transcription factors,
STAT Signal transducers and activators Subgranular zone (SGZ) A region of which eventually result in cell speci-
of transcription. A family of transcrip- the hippocampus in the cerebrum that fication, that take place in a common
tion factors, part of the JAK-STAT contains neural stem cells, allowing for cytoplasm, as in the early Drosophila
pathway. Important in the regulation of adult neurogenesis in this region. embryo.
human fetal bone growth. Subventricular zone A region in the Syncytiotrophoblast A population of
Stem cell A relatively undifferentiated vertebrate cerebrum that is formed as cells from the mammalian tropho-
cell from the embryo, fetus, or adult progenitor cells migrate away from the blast that undergoes mitosis without
that, that divides and when it does so, ventricular zone. cytokinesis resulting in multinucleate
produces (1) one cell that retains its cells. The syncytiotrophoblast tissue
Sulcus limitans A longitudinal groove is thought to further the progression
undifferentiated character and remains that divides the developing spinal cord
in the stem cell niche; and (2) a second of the embryo into the uterine wall by
and medulla into dorsal (receives sen- digesting uterine tissue.
cell that leaves the niche and can under- sory input) and ventral (initiates motor
go one or more paths of differentiation. functions) halves. Syncytium Many nuclei residing in a
See also Adult stem cell; Embryonic common cytoplasm, results either from
Superficial cleavage The divisions of karyokinesis without cytokinesis or
stem cell. the cytoplasm of centrolecithal zygotes
Stem cell factor (SCF) Paracrine factor from cell fusion.
that occur only in the rim of cytoplasm
important for maintaining certain stem around the periphery of the cell due to Syndetome Greek syn, “connected.”
cells, including hematopoietic, sperm, the presence of a large amount of cen- Derived from the most dorsal sclero-
and pigment stem cells. Binds to the Kit trally-located yolk, as in insects. tome cells, which express the scleraxis
receptor protein. gene and generate the tendons.
Surfactant A secretion of specific pro-
Stem cell mediated regeneration Pro- teins and phospholipids such as sphin- Syndrome Greek, “happening togeth-
cess by which stem cells allow an gomyelin and lecithin produced by the er.” Several malformations or patholo-
organism to regrow certain organs or type II alveolar cells of the lungs very gies that occur concurrently. Genetically
tissues (e.g., hair, blood cells) that have late in gestation. The surfactant enables based syndromes are caused either
been lost. the alveolar cells to touch one another by (1) a chromosomal event (such as
Stem cell niche An environment (regu- without sticking together. trisomy 21, or Down syndrome) where
latory microenvironment) that provides several genes are deleted or added, or
Symbiont The smaller organism in a (2) by one gene having many effects.
a milieu of extracellular matrices and symbiotic relationship in which the
paracrine factors that allows cells resid- other organism is much larger and Systems theory In development, refers
ing within it to remain relatively undif- serves as the host, while the smaller to an approach that views the organ-
ferentiated. Regulates stem cell prolif- organism may live on the surface or ism as coming together through the
eration and differentiation. inside the body of the larger. interactions of its component processes.
Stereoblastulae Blastulae that have no Although the emphasis applied to each
Symbiosis Greek, “living together.” varies, the theoretical systems approach
blastocoel, e.g., blastulae produced by Refers to any close association between
spiral cleavage. can be characterized by six principles:
organisms of different species. (1) context-dependent properties; (2)
Steroidogenic factor 1 (Sf1) A tran- Synapse Junction at which a neuron level-specific properties and emer-
scription factor that in mammals is contacts its target cell (which can be gence; (D) heterogeneous causation; (4)
G–32 Glossary
integration; (5) modularity and robust- Testis cords Loops in the medullary There are several different TR types,
ness; and (6) homeorhesis (stability (central) region of the developing tes- including TRα and TRβ.
while undergoing change). tis formed by the developing Sertoli Thyroxine (T4 ) Thyroid hormone
cells and the incoming germ cells. Will containing four iodine molecules; is
T become the seminiferous tubules and converted to the more active T3 form
site of spermatogenesis. through removal of one iodine mol-
T-box (Tbx) A specific DNA-binding
domain found in certain transcription Testis-determining factor A protein ecule. Increases basal metabolic rate
factors, including the T (Brachyury) encoded by the Sry gene on the mam- in cells. Initiates metamorphosis in
gene, Tbx4 and Tbx5. Tbx4 and Tbx5 malian Y chromosome that organizes amphibians.
help specify hindlimbs and forelimbs, the gonad into a testis rather than an Tip cells Certain endothelial cells that
respectively. ovary. can respond to vascular endothe-
Target selection The second step in Testosterone A steroid hormone that is lial growth factor (VEGF) and begin
the specification of axonal connection, androgenic. In mammals, it is secreted “sprouting” to form a new vessel during
wherein the axons, once they reach the by the fetal testes and masculinizes the angiogenesis. See also Ureteric bud tip
correct area, recognize and bind to a set fetus, stimulating the formation of the cells.
of cells with which they may form stable penis, male duct system, scrotum, and Tissue engineering A regenerative
connections. other portions of the male anatomy, as medicine approach whereby a scaffold is
well as inhibiting development of the generated from material that resembles
Telencephalon The anterior subdivision breast primordia.
of the prosencephalon; will eventually extracellular matrix or decellularized
form the cerebral hemispheres. Tetrad See Bivalent. extracellular matrix from a donor, is
Tetrapods Latin, “four feet.” Includes seeded with stem cells, and is used to
Telogen The resting phase of the hair replace an organ or part of an organ.
follicle regeneration cycle. the vertebrates amphibians, reptiles,
birds, and mammals. Evolved from Torpedo The receptor protein for
Telolecithal Describes the eggs of birds lobe-finned fish (sarcopterygian) Gurken. When expressed in terminal
and fish which have only one small area ancestors. follicle cells in a Drosophila egg cham-
at the animal pole of the egg that is free ber, it binds to Gurken produced by the
of yolk. TGF-β family Transforming growth
factor-β. A family of growth factors egg, which signals these follicle cells to
Telomerase Enzyme complex that can within the TGF-β superfamily. differentiate into posterior follicle cells
extend the telomeres to their full length and synthesize a molecule that activates
and maintains telomere integrity. TGF-β superfamily More than 30 struc-
turally related members of a group of protein kinase A in the egg; part of the
Telomeres Repeated DNA sequences at paracrine factors. The proteins encoded process that sets up the anterior-poste-
the ends of chromosomes that provide a by TGF-β superfamily genes are pro- rior axis of the egg and future embryo.
protective cap to the chromosomes. cessed such that the carboxy-terminal Totipotent Latin, “capable of all.”
Telson A tail-like structure; the posteri- region contains the mature peptide. Describes the potency of certain stem
or most segment of certain arthropods. These peptides are dimerized into cells to form all structures of an organ-
Seen in insect larvae such as Drosophila. homodimers (with themselves) or het- ism, such as the earliest mammalian
Temporal colinearity The mechanism erodimers (with other TGF-β peptides) blastomeres (up to the 8-cell stage),
that controls the timing of Hox gene and are secreted from the cell. The which can form both trophoblast cells
activation, which occurs anteriorly first TGF-β superfamily includes the TGF-β and the embryo precursor cells. Com-
and progressively more posteriorly; family, activin family, bone morphoge- pare with Pluripotent.
sets up spatial colinearity of Hox gene netic proteins (BMPs), Vg1 family, and trans-activating domain The tran-
expression relative to their 3′-to-5′ other proteins, including glial-derived scription factor domain that activates
genomic organization. neurotrophic factor (GDNF; necessary or suppresses the transcription of the
Teratocarcinoma A tumor derived from for kidney and enteric neuron differ- gene whose promoter or enhancer it
malignant primordial germ cells and entiation) and anti-Müllerian hormone has bound, usually by enabling the
containing an undifferentiated stem (AMH; involved in mammalian sex transcription factor to interact with the
cell population (embryonal carcinoma, determination). proteins involved in binding RNA poly-
or EC cells) that has biochemical and Thecal cells Steroid hormone-secreting merase or with enzymes that modify
developmental properties similar to cells of the mammalian ovary that, histones.
those of the inner cell mass. EC cells together with the granulosa cells, form trans-regulatory elements Soluble
can differentiate into a wide variety of the follicles surrounding the germ cells. molecules whose genes are located
tissues, including gut and respiratory They differentiate from mesenchyme elsewhere in the genome and which
epithelia, muscle, nerve, cartilage, and cells of the ovary. bind to the cis-regulatory elements.
bone. Thermotaxis Migration that is directed They are usually transcription factors or
Teratogens Greek, “monster-formers.” by a gradient of temperature, either up microRNAs.
Exogenous agents that cause disrup- or down the gradient. Transcription The process of copying
tions in development resulting in tera- Threshold model A model of develop- DNA into RNA.
togenesis, the formation of congenital ment wherein biological events are trig- Transcription elongation complex (TEC)
defects. Teratology is the study of birth gered when a specific concentration of a A complex of several transcription fac-
defects and of how environmental morphogen or hormone is reached. tors that breaks the connection between
agents disrupt normal development. Thyroid hormone receptors (TRs) RNA polymerase II and the Mediator
Terminal end bulbs The ends of the Nuclear receptors that bind the thyroid complex, allowing transcription (which
extensive branches of ducts in the mam- hormones tri-iodothyronine (T 3 ), as has been initiated) to proceed.
mary glands of mammals. Under the well as thyroxine (T4 ). Once bound to Transcription elongation suppressor
influence of estrogens at puberty, the the hormone, the TR becomes a tran- A repressive transcription factor that
ducts grow by the elongation of these scriptional activator of gene expression. functions to prevent the transcription
buds. elongation complex from associating
Glossary G–33
with RNA polymerase II, pausing a third cell forming before the polar cancer. Gene products may inhibit
transcription. lobe is reabsorbed back into the CD cell division or increase the adhesion
Transcription factor A protein the binds blastomere. between cells; they can also induce
to DNA with precise sequence recogni- Tri-iodothyronine (T3 ) The more active apoptosis of rapidly dividing cells. Can-
tion for specific promoters, enhancers, form of thyroid hormone, produced cer can result from either mutations or
or silencers. through the removal of an iodine inappropriate methylations that inacti-
Transcription factor domains The three molecular from thyroxine (T4 ). See Thy- vate tumor suppressor genes.
major domains are a DNA-binding roxine (T4 ). Tunica albuginea In mammals, a thick,
domain, a trans-activating domain and Triploblasts See Bilaterians. whitish capsule of extracellular matrix
a protein-protein interaction domain. Trisomy 21 Condition (in humans) of that encases the testis.
Transcription initiation site DNA having three copies of chromosome “Turing-type” model See Reaction-
sequence of a gene that codes for the 2 (an example of aneuploidy). Causes diffusion model.
addition of a modified nucleotide “cap” Down syndrome. Type II deiodinase Intracellular enzyme
at the 5′ end of the RNA soon after Trithorax Family of proteins that are that removes an iodine atom from the
it is transcribed. Also called the cap recruited to retain the memory of the outer ring of thyroxine (T4 ), converting
sequence. transcriptional state of regions of DNA it into the more active T3 hormone.
Transcription termination as the cell goes through mitosis; keeps Type III deiodinase Intracellular
sequence DNA sequence of a gene active genes active. enzyme that removes an iodine atom
where transcription is terminated. Trophectoderm cells In the mamma- from the inner ring of T3 to convert it
Transcription continues for about 1000 lian embryo, the outer layer of cells of into the inactive compound T2 , which
nucleotides beyond the AATAAA site the blastocyst that surround the inner will eventually be metabolized to
of the 3′ untranslated region of the gene cell mass and blastocoel; develop into tyrosine.
before being terminated. the embryonic side of the placenta. Type IV collagen A type of collagen that
Transcription-associated factors Trophoblast The external cells of the forms a fine meshwork; found in the
(TAFs) Proteins that stabilize RNA early mammalian embryo (i.e., the mor- basal lamina, an extracellular matrix
polymerase on the promoter of a gene ula and the blastocyst) that will bind to that lies underneath epithelia.
and enable it to initiate transcription. the uterus. Trophoblast cells form the Type A spermatogonia In mammals,
Transcriptome Total messenger RNAs chorion (the embryonic portion of the sperm stem cells that undergo mitosis
(mRNAs) expressed by genes in an placenta). Also called trophectoderm. and maintain the population of Type A
organism or a specific type of tissue or Truncus arteriosus Cardiac outflow spermatogonia while also generating
cell. tract precursor that along with the Type B spermatogonia.
Transdifferentiation The transformation conus arteriosus will form the base of Type B cells A type of neural stem cell
of one cell type into another. the aorta and pulmonary artery. found in the rosettes of the V-SVZ of the
Transforming growth factor See TGF-β Trunk neural crest Neural crest cells cerebrum; fuel the generation of specific
superfamily. migrating from this region become types of neurons in the olfactory bulb
Transgene Exogenous DNA or gene the dorsal root ganglia containing the and striatum.
introduced through experimental sensory neurons, sympathetic ganglia, Type B spermatogonia In mammals,
manipulation into a cell’s genome. adrenal medulla, the nerve clusters sur- precursors of the spermatocytes and the
Transit amplifying cells See Progenitor rounding the aorta, and Schwann cells last cells of the line that undergo mito-
cells. if they migrate along a ventral pathway, sis. They divide once to generate the
and they generate melanocytes of the primary spermatocytes.
Transition zone In neural tube develop- dorsum and belly if they migrate along a
ment in vertebrates, the zone between dorsolateral pathway.
the region that undergoes primary neu- U
rulation and the region that undergoes Tubulin A dimeric protein that polymer- Umbilical cord Connecting cord derived
secondary neurulation. The size of this izes to form microtubules. Microtubules from the allantois that brings the
zone varies among different species. See are a major component of the cyto- embryonic blood circulation to the uter-
also Primary neurulation and Second- skeleton; they are found in centrioles ine vessels of the mother in placental
ary neurulation. and basal bodies; they also form the mammals.
mitotic spindle and axoneme of cilia and
Translation The process in which the flagella. Umbilical veins See Omphalomesen-
codons of a messenger RNA are trans- teric veins and Vitelline veins.
lated into the amino acid sequence of a Tudor One of the proteins, along with
Piwi, Vasa, and Nanos, expressed in Undifferentiated zone See Progress
polypeptide chain. zone.
germ cells to suppress gene expres-
Translation initiation site The ATG sion. Also involved in anterior- Unipotent stem cells Stem cells that
codon (becomes AUG in mRNA), which posterior polarity in the Drosophila generate only one cell type, such as the
signals the beginning of the first exon embryo by localizing Nanos, a posterior spermatogonia of the mammalian testes
(protein-coding region) of a gene. morphogen. that only generate sperm.
Translation termination Tumor angiogenesis factors Factors Unsegmented mesoderm Bands of par-
codon Sequence in a gene, TAA, secreted by microtumors; these factors axial mesoderm prior to their segmenta-
TAG, or TGA, which is transcribed as a (including VEGFs, Fgf2, placenta-like tion into somites.
codon in the mRNA—when a ribosome growth factor, and others) stimulate 3′ Untranslated region (3′ UTR) A
encounters this codon, the ribosome mitosis in endothelial cells and direct region of a eukaryotic gene and RNA
dissociates and the protein is released. the cell differentiation into blood vessels following the translation termination
Trefoil stage A stage in certain spirally in the direction of the tumor. codon that, although transcribed, is not
cleaving embryos, wherein a particu- Tumor suppressor genes Regulatory translated into protein. It includes the
larly large polar lobe is extruded at first genes whose gene products protect region needed for insertion of the polyA
cleavage, giving the appearance of against a cell progressing towards
G–34 Glossary
tail on the transcript that allows the Vasculogenesis The de novo creation from the germinal neuroepithelium of
transcript to exit the nucleus. of a network of blood vessels from the the original neural tube and contains
5′ Untranslated region (5′ UTR) Also lateral plate mesoderm. See also Extra- neural progenitor cells that are a source
called a leader sequence or leader RNA; embryonic vasculogenesis. of neurons and glial cells. Will form the
a region of a eukaryotic gene or RNA. Vegetal hemisphere The bottom portion ependyma.
In a gene, it is a sequence of base pairs of an ovum, where yolk is more con- Ventricular-subventricular zone
between the transcription initiation and centrated. The yolk can be an impedi- (V-SVZ) Region of the cerebrum that
translation initiation sites; in an RNA, ment to cleavage, as in the amphibian contains neural stem cells and is capable
it is its 5′ end. These are not translated embryo, causing the yolk-filled cells to of neurogenesis in the adult.
into protein, but can determine the rate divide more slowly and undergo less Vertical transmission In referring to
at which translation is initiated. movement during embryogenesis. symbiosis, the transfer of symbionts
Ureteric bud tip cells A population of Vegetal plate Area of thickened cells from one generation to the next through
stem cells that form at the tips of the at the vegetal pole of the sea urchin the germ cells, usually the eggs.
ureteric bud branches during meta- blastula. Vg1 A family of proteins that is part of
nephric kidney formation. Vegetal pole The yolk containing end of the TGF-β superfamily. Important in
Ureteric buds In amniotes, paired epi- the egg or embryo, opposite the animal specifying mesoderm in amphibian
thelial branches induced by the meta- pole. embryos. See also TGF- β superfamily.
nephrogenic mesenchyme to branch Vegetal rotation During frog gastrula- Visceral endoderm A region of the
from each of the paired nephric ducts. tion, internal cell rearrangements place primitive endoderm where the cells
Ureteric buds will form the collecting the prospective pharyngeal endoderm contact the epiblast in the mammalian
ducts, renal pelvis, and ureters that take cells adjacent to the blastocoel and embryo. See Primitive endoderm.
the urine to the bladder. immediately above the involuting Visceral mesoderm See Splanchnic
Urodeles Amphibian group that mesoderm. mesoderm.
includes the salamanders. Compare VEGF See Vascular endothelial Viscerocranium The jaws and other
with Anurans. growth factors. skeletal elements derived from the pha-
Urogenital sinus In mammals, the VegT pathway Involved in dorsal- ryngeal arches.
region of the cloaca that is separated ventral polarity and specification of Vital dyes Stains used to label liv-
from the rectum by the urogenital sep- the organizer cells in the amphibian ing cells without killing them. When
tum. The bladder forms from the ante- embryo. The VegT pathway activates the applied to embryos, vital dyes have been
rior portion of the sinus, and the urethra expression of Nodal-related paracrine used to follow cell migration during
develops from the posterior region. In factors in the cells of the vegetal hemi- development and generate fate maps of
females, also forms Skene’s glands; in sphere of the embryo, which in turn specific regions of the embryo.
males it also forms the prostate gland. activate the Smad2 transcription factor Vitelline envelope In invertebrates,
Uterine cycle A component of the men- in the mesodermal cells above them, the extracellular matrix that forms a
strual cycle, the function of the uterine activating genes that give these cells fibrous mat around the egg outside the
cycle is to provide the appropriate envi- their “organizer” properties. cell membrane and is often involved in
ronment for the developing blastocyst. Vellus Short and silky hair of the fetus sperm-egg recognition and is essen-
and neonate that remains on many tial for the species-specific binding of
V parts of the human body that are usu- sperm. The vitelline envelope contains
Vagal neural crest Neural crest cells ally considered hairless, such as the several different glycoproteins. It is
from the neck region, which overlaps forehead and eyelids. In other areas of supplemented by extensions of mem-
the cranial/trunk crest boundary. the body, vellus hair gives way to longer brane glycoproteins from the cell mem-
Together with the sacral neural crest, and thicker “terminal” hair. brane and by proteinaceous “posts”
generates the parasympathetic (enteric) Ventral furrow Invagination of the pro- that adhere the vitelline envelope to the
ganglia of the gut, which are required spective mesoderm, about 1000 cells membrane.
for peristaltic movement of the bowels. constituting the ventral midline of the Vitelline veins The veins, continu-
Vas (ductus) deferens Derived from the embryo, at the onset of gastrulation in ous with the endocardium, that carry
Wolffian duct, the tube through which Drosophila. nutrients from the yolk sac into the
sperm pass from the epididymis to the Ventral pathway Migration pathway sinus venosus of the developing verte-
urethra. of trunk neural crest cells that travel brate heart. In birds, these veins form
Vasa One of the proteins, along with ventrally through the anterior of the from yolk sac blood islands, and bring
Tudor, Piwi, and Nanos, expressed in sclerotome and contribute to the sym- nutrients to the embryo and transport
germ cells to suppress gene expres- pathetic and parasympathetic ganglia, gases to and from the sites of respiratory
sion. Also involved in anterior- adrenomedullary cells, and dorsal root exchange. In mammals they are called
posterior polarity in the Drosophila ganglia. omphalomesenteric veins or umbilical
embryo by localizing Nanos, a posterior Ventricular (ependymal) cells Cells veins.
morphogen. derived from the neuroepithelium that Vitellogenesis The formation of yolk
Vascular endothelial growth factors line the ventricles of the brain and proteins, which are deposited in the
(VEGFs) A family of proteins involved secrete cerebrospinal fluid. primary oocyte.
in vasculogenesis that includes several Ventricular radial glia (vRG) Progenitor Viviparity Young are nourished in and
VEGFs, as well as placental growth fac- cells that reside in the ventricular zone. born from the mother’s body rather
tor. Each VEGF appears to enable the They give rise to neurons, outer radial than hatched from an egg, as in placen-
differentiation of the angioblasts and glia (oRG), and intermediate progenitor tal mammals. Compare with Oviparity.
their multiplication to form endothelial (IP) cells. See also Ventricular zone. Vulval precursor cells (VPCs) Six cells
tubes. Also critical for angiogenesis. Ventricular zone (VZ) Inner layer of the in the larval stage of C. elegans that will
developing spinal cord and brain. Forms form the vulva via inductive signals.
Glossary G–35
W Wolffian (nephric) duct In vertebrates, the yolk sac and the walls of the gut are
the duct of the developing excretory continuous.
White matter The axonal (as opposed to
neuronal) region of the brain and spinal system that grows down alongside the Yolk syncytial layer (YSL) A cell popu-
cord. Name derives from the fact that mesonephric mesoderm and induces lation in the zebrafish cleavage stage
myelin sheaths give the axons a whit- it to form kidney tubules. In amniotes, embryo formed at the ninth or tenth
ish appearance. Compare with Gray it later degenerates in females, but in cell cycle, when the cells at the vegetal
matter. males, becomes the epididymis and vas edge of the blastoderm fuse with the
deferens. underlying yolk cell, producing a ring of
Wholist organicism Philosophical
notion stating that the properties of the Wound epidermis In salamander limb nuclei in the part of the yolk cell cyto-
regeneration, the epidermal cells that plasm that sits just beneath the blasto-
whole cannot be predicted solely from
migrate over the stump amputation to derm. Important for directing some of
the properties of its component parts,
cover the wound surface immediately the cell movements of gastrulation.
and that the properties of the parts are
informed by their relationship to the following amputation; later thickens to
whole. It was very influential in the con- form the apical ectodermal cap. Z
struction of developmental biology. Zebrabow Transgenic zebrafish used to
Wnt pathways Signal transduction cas- X trigger the expression of different com-
cades initiated by the binding of a Wnt X chromosome inactivation In mam- binations and amounts of different fluo-
protein to its receptor Frizzled on the mals, the irreversible conversion of the rescent proteins within cells, labeling
cell membrane. This binding can initi- chromatin of one X chromosome in each them with a seeming “rainbow” of pos-
ate any of number of different pathways female (XX) cell into highly condensed sible colors that can be used to identify
(“canonical” and “noncanonical”) to heterochromatin—a Barr body—thus each individual cell in a tissue, organ, or
activate Wnt-responsive genes in the preventing excess transcription of genes whole embryo.
nucleus. on the X chromosome. See also Dosage Zeugopod The middle bones of the ver-
Wnt4 A protein in the Wnt family; in compensation. tebrate limb; the radius and ulna (fore-
mammals it is involved in primary limb) or tibia and fibula (hindlimb).
sex determination, kidney develop- Y Zona pellucida Glycoprotein coat
ment, and the timing of meiosis. It is Yellow crescent Region of the tunicate (extracellular matrix) around the mam-
expressed in the bipotential gonads, zygote cytoplasm extending from the malian egg, synthesized and secreted by
but becomes undetectable in XY gonads vegetal pole to the equator that forms the growing oocyte.
becoming testes; it is maintained in after fertilization by the migration of Zona proteins 1, 2, and 3 (ZP1, ZP2,
XX gonads becoming ovaries. See also cytoplasm containing yellow lipid inclu- ZP3) The three major glycoproteins
Wnts. sions; will become mesoderm. Contains found in the zona pellucida of the mam-
Wnt7a A Wnt protein especially impor- the mRNA for transcription factors that malian egg; the human zona pellucida
tant in specifying dorsal-ventral polar- will specify the muscles. also contains ZP4. Involved in binding
ity in the tetrapod limb; expressed in Yolk cell The cell containing the yolk sperm in a relatively, but not absolutely,
the dorsal, but not ventral, ectoderm of in a fish embryo, once the yolk-free species-specific manner.
limb buds. If expression in this region cytoplasm at the animal pole of the egg Zone of polarizing activity (ZPA) A
is eliminated, both dorsal and ventral divides to form individual cells above small block of mesodermal tissue in the
sides of the limb form structures appro- the yolky cytoplasm. Initially, all the very posterior of the limb bud progress
priate for the ventral surface, such as cells maintain a connection with the zone. Specifies the anterior-posterior
ventral footpads on both surfaces of a underlying yolk cell. axis of the developing limb through
paw. See also Wnts. the action of the paracrine factor Sonic
Yolk plug The large endodermal cells
Wnts A gene family of cysteine-rich gly- that remain exposed on the vegetal sur- hedgehog.
coprotein paracrine factors. Their name face surrounded by the blastopore of the Zygote A fertilized egg with a diploid
is a fusion of the name of the Drosophila amphibian gastrulating embryo. chromosomal complement in its zygote
segment polarity gene wingless with nucleus generated by fusion of the hap-
the name of one of its vertebrate homo- Yolk sac The first extraembryonic mem-
brane to form, derived from splanch- loid male and female pronuclei.
logues, integrated. Wnt proteins are criti-
cal in establishing the polarity of insect nopleure that grows over the yolk to Zygotene Greek, “yoked threads.” In
and vertebrate limbs, promoting the enclose it. The yolk sac mediates nutri- the first meiotic division, it is the second
proliferation of stem cells, and in several tion in developing birds and reptiles. It stage of prophase I, when homologous
steps of urogenital system development. is connected to the midgut by the yolk chromosomes pair side by side; follows
duct (vitelline duct), so that the walls of leptotene.
Author Index
A Akiyama, H., 643 Aoyama, H., 563, 566 Bachiller, D., 400
Abarca-Buis, R. F., 646 Akiyama, T., 131, 152 Apelqvist, A., 662 Bachmann, M. D., 777
Abbasi, A. A., 640, 641 Akkers, R. C., 337 Appel, T. A., 359 Bachvarova, R. F., 382, 389
Abdalla, H., 392 Al-Drees, M. A., 161, 162, Arai, F., 163 Bae, S., 353
Abe, M. H., 258 163, 164 Arango, N. A., 191 Bagga, S. J., 80
Abercrombie, M., 473 Alberch, P., 643, 800 Aravin, A. A., 80–81 Baggiolini, A., 466, 467
Ables, J. L., 156 Albert, D. M., 537 Arcelay, E., 242 Bagnara, J. T., 672
Abmayr, S. M., 575 Alberts, B. M., 280 Archer, T. C., 415 Baguña, J., 702
Abou-Haila, A., 241 Alder, J., 445 Ardeshir, A., 781 Bahat, A., 243
Abramovich, C., 801 Alekseyenko, A. A., 278 Aréchaga, J., 344 Bai, C. B., 157
Abu-Issa, R., 593 Alev, C., 382 Arendt, D., 382 Baibakov, B., 244
Abu-Shaar, M., 682 Alexandre, P., 447, 448, 455 Aristotle, 9 Baier, H., 507
Abzhanov, A., 466, 794, 796, Alfandari, D., 473 Arking, R., 724 Bailey, A. P., 518
797, 798 Alfonso, J., 157 Armand, O., 577 Bailey, T. J., 521
Acevedo, N., 751 Alford, L. M., 314 Armon, R., 349 Baird, A. A., 461
Ackerman, S. L., 499 Alitalo, K., 604 Armstrong, E. J., 601 Baird, M. L., 76
Acloque, H., 107 Allan, D. W., 495 Armstrong, N., 323 Baker, B. S., 199, 200, 201
Adachi, A., 137 Allen, B. M., 675 Arn, E. A., 289 Baker, C. V., 518
Adamo, A., 394 Alley, K. E., 674 Arnheiter, H., 523 Baker, D. J., 728
Adamo L., 606, 607 Allis, C. D., 50 Arnoult, C., 242 Baker, M. A., 242
Adams, J. M., 510 Alsan, B. H., 595 Artama, M., 426 Baker, T. G., 211
Adams, R. H., 604 Altabef, M., 645 Artavanis-Tsankonas, S., 137 Baker, W. W., 575
Adamska, M., 645 Alvarado, D. M., 624 Arthur, W., 785, 794 Bakkers, J., 528
Adkins, M. W., 62 Alvarez, I. S., 419 Artus, J., 148, 149 Balaskas, N., 433, 434
Adler, C. E., 702 Alvarez-Buylla, A., 134, 141, Asamoto, K., 563 Balasubramanian, R., 132,
Adler, F. R., 768, 769 153, 154, 155, 157, 164, 441, Asaoka-Taguchi, M., 203 133
449 Ash, P. J., 574 Balinsky, B. I., 327, 385, 415
Affolter, M., 22
Alvarez-Dolado, M., 164 Ashburner, M., 685, 686 Ball, E. E., 793
Afzelius, B. A., 219, 405
Ambati, B. K., 605 Ashworth, D., 48 Ballock, R. T., 647
Agarwal, P., 622, 623
Amemiya, S., 690 Askan, I., 63 Bally-Cuif, L., 153
Agassiz, A., 368
Amiri, A., 304 Asumda, F. Z., 146 Baltus, A. E., 203
Agathon, A., 375
Amundson, R., 800 Aszódi, A., 564 Baltzley, M., 33
Agger, K., 52
Ancel, P., 334 Atit, R., 568 Bangi, E., 688
Agius, E., 344, 354, 361
Andersen, F. G., 60 Atkinson, B. G., 675 Bao, B., 673
Agrawal, A. A., 768
Anderson, D. D., 426 Atzmon, G., 725 Barak, H., 585, 589
Aguirre, A., 156, 528
Anderson, D. J., 61, 476, 477, Aubret, F., 806, 807 Barash, Y., 76
Ahlgren, S. C., 744
496 Auerbach, R., 754 Barbash, J. E., 752
Ahlgren, U., 663
Anderson, K. V., 105, 132, 305 Aulehla, A., 555, 559 Barbosa-Morais, N. L., 73
Ahmad, I., 502
Anderson, M. J., 205 Austin, C. P., 502 Barbour, B., 440
Ahmad, S. M., 201
Anderson, R., 203 Austin, C. R., 221, 241 Bard, J. B. L., 585, 587
Ahn, D., 617
Anderson, R. M., 718 Austin, J., 196 Bard, L., 492
Ahn, K., 645
Andersson, S., 196 Avella, M. A., 244 Barinaga, M., 456, 507
Ahn, S., 637
Andrée, B., 595 Avila, F. W., 199 Barker, N., 159, 160
Ahn, Y., 531, 533
Andreu, M. J., 304 Axel, R., 477 Barkoulas, M., 138
Ahrenger, J., 268
Angeles Rabadán, M., 16, 418 Ayer-Le Lievre, C. S., 466 Barlow, A., 482
Ahrens, K., 519
Angerer, L. M., 319 Azevedo, F. A., 440, 488 Barlow, P., 393
Aihara, M., 690
Angerer, R. C., 319 Barnes, G. L., 552
Ajduk, A., 248
Angier, N., 61 B Barnes, M. D., 674
Akam, M., 556
Anthony, T. E., 449 Barnett, J. V., 601
Akam, M. E., 302 Babb, S. G., 101
Anton, R., 599 Barnhart, M. C., 779
Akers, R. M., 495 Babcock, D. F., 225
Anway, M. D., 753, 754, 803 Barrangou, R., 89
Akitaya, T., 472 Babu, D., 129
AI–2 Author Index
Barresi, M. J. F., 30, 35, 46, Bengal, E., 62 Blair, H. C., 574 Boycott, A. E., 257
116, 144, 416, 447, 466, 503, Benoff, S., 242 Blair, S. S., 689 Boyer, L. A., 394
514, 549, 616 Benoit, B., 281 Blanpain, C., 529, 595 Bradbury, J., 368
Barrett, M. J., 480 Benson, G. V., 748 Blau, H. M., 81 Bradford, S. T., 187, 191
Barrionuevo, F., 190 Bentivoglio, M., 441 Bleil, J. D., 244, 245 Bradke, F., 490
Barrios, A., 551, 552 Bentley, D., 493 Blitz, E., 578 Bradley, P. L., 306
Barrios, F., 191 Bentley, J. K., 224 Blitz, I. L., 356 Brakefield, P. M., 772, 805
Bartel, D. P., 81 Bentley, N. J., 63 Bloom, W., 209 Brand, M., 119, 120, 132, 133,
Bartke, T., 50 Bentzinger, F., 578 Blüher, M. B., 727 153, 156, 622
Bartolomei, M. S., 72 Berardi, A. C., 608 Blum, M., 129, 365 Brand, T., 390
Barzel, A., 206 Berdasco, M., 759 Blumenbach, J. F., 10 Brand-Saberi, B., 566
Basak, O., 154, 155, 156 Berendsen, A. D., 131 Blumenstyk, G., 752 Brandt, A., 281
Basch, M. L., 468 Berezikov, E., 80 Boatright-Horowitz, S. S., 674 Brannon, M., 353, 354
Bashaw, G. J., 500 Berger, S. L., 52 Bockman, D. E., 483 Brar, G. A., 207
Bassett, A. R., 89 Bergeron, J. M., 751 Bode, H. R., 697, 698, 699, 700 Braude, P., 392
Basson, C. T., 26 Bergstrom, D. A., 577 Bode, P. M., 700 Braukmann, S., 337, 395
Bassuk, A. G., 421, 422 Berkes, C. A., 64 Boehm, A. M., 726 Braun, R. E., 210
Bastock, R., 268 Berkovitz, G. D., 193 Boettger, T., 384 Bravo, J. A., 781
Bates, J. M., 780 Berleth, T., 290 Boettiger, D., 576 Breau, M. A., 519
Bateson, P., 783 Berman, D. M., 757 Bogart, J. P., 233 Breitling, R., 122
Bateson, W., 302, 800 Bermardes de Jesus, B., 726 Boggs, R. T., 200 Brendza, R. P., 290
Batourina, E., 590, 591 Bernard, P., 187 Bogin, B., 456 Brennan, J., 185, 191, 193, 400
Battaglin, W. A., 752 Berondes, H. D., 685 Bökel, C., 119, 132, 133 Brenner, C. A., 396
Baumgartner, S., 290, 294 Berrill, N. J., 328 Bolker, J., 763 Brenner, M., 443
Bavestrello, G., 733 Berruti G., 210 Bollenbach, T., 115 Brenner, S., 266
Baxter, L. L., 479 Berry, D. L., 674 Bollenbacher, W. E., 684 Brent, A. E., 120, 565, 566
Bayha, E., 659 Bertocchini, G., 382, 389, 390, Bonanomi, E., 494 Bressan, M., 594
Bazzini, A. A., 82 400, 407 Boncinelli, E., 402 Brewster, R., 103
Beachy, P. A., 124, 522 Bertrand, J. Y., 608 Bondue, A., 595 Bridge, D. M., 700
Beams, H. W., 336, 369 Bertrand, N., 598 Bonhoeffer, F., 507 Bridges, C. B., 198
Beane, W. S., 325 Betancur, P., 470 Bonnefoy, E., 280 Briggs, R., 65
Bearce, E. A., 489 Betters, E., 481 Bonner, J. T., 772, 787 Brill, G., 568
Beaulieu, C., 460 Beukeboom, L. W., 182 Booker, B., 511 Bringas, P., Jr., 115
Beazley, K. E., 526 Bhanot, P., 299 Boorse, G. C., 775 Briscoe, J., 120, 122, 123, 124,
Beck, C. W., 544 Bhat, K. M., 500 Booth, B. W., 755 125, 131, 431, 432, 433, 434,
Becker, K. B., 676, 677 Bhat, R., 96, 633 Borland, R. M., 395 464, 494
Becker, P. B., 71 Bhattacharyya, S., 519 Borowiak, M., 719 Brittis, P. A., 503
Beddington, R. S. P., 400 Bhullar, B. A., 795 Borowiec, M. L, 252 Brockes, J. P., 707
Bedford, J. M., 246 Bianchi, E., 245 Borycki, A., 569 Brody, T. B., 278
Beecher, C. L., 575 Bianco, P., 164, 165, 608 Bossard, P., 659 Broitman-Maduro, G., 271
Beermann, W., 47 Biedler, L., 336 Boswell, R. E., 203 Bronner, M., 469, 470
Beetschen, J. C., 337 Bier, E., 283, 306, 359, 793 Bothe, I., 542 Bronner-Fraser, M., 68, 466,
Begbie, J., 518 Bieser, K. L., 202, 751 Bothma, J. P., 308 468, 472, 475, 476, 518
Begon, M., 24 Biggs, L. C., 530, 531, 533 Bottardi, S., 56 Brose, K., 500
Behringer, R. R., 584 Bïjtel, J. H., 360 Bou Khalil, M., 241 Broun, M., 697, 698, 699
Behrndt, M., 371 Binns, W., 124 Boucaut, J.-C., 343 Brown, C. B., 595
Bejarano-Escobar, R. G., 502 Bird, A., 55, 71 Bouchard, M., 584 Brown, D. D., 50, 674, 676,
Belcher, S. M., 746 Bird, C. W., 55, 71, 78 677, 679
Boué, A., 735
Beldade, P., 764 Birk, O. S., 183 Brown, K. E., 523
Boulais, P. E., 161, 163, 164
Bell, A. C., 72 Birsoy, B., 344, 361 Browne, E. N., 697
Bouldin, C. M., 550
Bell, L. R., 199, 200 Bischoff, J., 601 Bruce, A. E., 371
Boulet, A. M., 627
Bell, S. E., 748 Bischoff, M., 135, 136 Bruce, A. W., 398
Bourlat, S. J., 253, 254
Bellairs, R., 380, 382 Bissell, M. J., 106, 107 Bruder, S. P., 574
Boutin, E. L., 748
Bellus, G. A., 648, 738 Bitgood, M. J., 122 Brugmann, S. A., 485
Bouwmeester, T., 362
Belo, J., 400 Black, D. L., 76 Bruneau, B. G., 600
Boveri, T., 45, 203, 229
Beloussov, L. V., 342 Blackburn, E. H., 726 Brunet, L. J., 647
Bovolenta, P., 503
Ben-Yair, R., 567, 577 Blackless, M., 196 Brunet, T., 372
Bowerman, B., 270, 272
Ben-Zvi, D., 116 Blackwell, T. K., 270 Bry, L., 779
Bowles, J., 191, 203, 205
Bénazéraf, B., 549 Blader, P., 368 Bryant, P. J., 689
Box, N., 80
Bénazet, J. D., 639 Bryant, S., 694
Author Index AI–3
Bryant, S. V., 619 Campbell, R. D., 696 Cebra-Thomas, J., 794, 795 Chen, Y. P., 364
Bu, P., 426 Campisi, J., 724 Cebrian, C., 590 Chen, Z., 500
Buchanan, A. E., 177 Campos-Ortega, J. A., 282, Cecconi, F., 511 Chen J., 758
Bucher, N. L., 719 372 Cela, C., 115 Cheng, C. Y., 210
Buchholz, D. R., 676, 677 Caneparo, L., 368 Centers for Disease Control, Cheng, H.-J., 504, 507
Buckingham, M., 569, 577 Cao, R., 604 427, 436 Cheng, L. Y., 326
Bückmann, D., 773 Cao, Y., 62, 604 Cepko, C. L., 440, 449, 527 Cheng, P. F., 364
Buczacki, S. J., 160, 660 Caparrós-Martín, J. A., 134 Cerezales, S. P., 240 Chenn, A., 448
Bull, J. J., 202, 212, 771 Capdevila, J., 646 Cha, B. J., 289, 335 Chera, S., 699
Bullejos, M., 193 Capecchi, M. R., 404, 545, Chabry, L. M., 328 Chernoff, E. A. G., 709
Bultje, R. S., 454, 455 616, 617 Chacón, M. R., 492 Cherr, G. N., 322
Burden, S. J., 508 Capel, B., 185, 188, 191, 192, Chai, X., 452 Cheung, T. H., 577, 578
Burdge, G. C., 71, 803 193, 202 Chakravarti, D., 364 Chi, N., 716
Burdsal, C. A., 399 Caplan, A. I., 164, 574 Chalamalasetty, R. B., 544, Chi, X., 587, 588
Burgess, R., 552 Capovilla, M., 296 545 Chiang, C., 122, 124, 419, 522
Burgoyne, P. S., 191 Capuano, F., 70 Chalbi, M., 245 Chiang, T., 212
Burkart, A. D., 245 Capuron, A., 347 Chambers, E. L., 230, 232 Chiarugi, P., 106
Burke, A. C., 379, 403, 545, Capurro, M. I., 131 Chan, C. E., 492 Chien, A. J., 126
546, 567, 579, 620, 794 Carapuço, M., 546 Chan, K. W., 806 Child, C. M., 701
Burlison, J. S., 663 Carlomagno, G., 209 Chan, S. S.-K., 65 Chino, Y., 690
Burmeister, M., 523 Carlson, B. M., 482, 657 Chan, W. C., 564 Chipman, A. D., 556, 800
Burnet, B., 806 Carmany-Rampey, A., 371 Chan, X. Y., 258, 259, 262 Chitnis, A., 138
Burnett, L. A., 224 Carmeliet, P., 605 Chan, Y. F., 788 Chiu, P. C., 244
Burns, A., 22 Carmona-Fontaine, C., 473, Chandler, D. E., 222, 232 Chiu D., 212
Burns, C. E., 602 474 Chang, C., 499 Cho, K. W., 364
Burridge, P. W., 168 Carnac, G., 356 Chang, E. S., 252 Cho, K. W. Y., 354, 356
Burstyn-Cohen, T., 471 Carpino, F., 783 Chang, J. B., 336 Cho, P. F., 291
Bury, H., 690 Carrasco, A., 745 Chang, K. T., 737 Cho Y. S., 304, 305
Busa, W. B., 234 Carrington, J. L., 625 Chang, M. C., 241 Choi, K. S., 540, 564, 565
Buszczak, M., 151, 686, 687 Carroll, E. J., 222, 230, 234, Chapel Hill Statement, 748, Chong, J. A., 61
Butler, E. G., 709 235 751 Chou, S.-J., 445, 446
Butler, S. J., 479 Carroll, S., 285, 307, 619, 689, Chapman, D. L., 428, 544, Chow, K. L., 90, 806
772 622
Butler, S. L., 518 Chrisman, K., 744
Carroll, S. B., 402, 785, 787, Charite, J., 641
Buxbaum, J. D., 173 Christ, B., 542, 561, 562, 563,
790, 793, 799 Charles, J. P., 687
Buzgariu, W., 697 567, 568
Carroll, T. J., 589 Charlet-B, N., 76 Christen, R., 224
Carron, C., 349, 544
C Charnov, E. L., 771 Christiaen, L., 330
Carson, D. D., 396 Charrier, C., 792
C. elegans Sequencing Christian, J. L., 131
Carson, R., 738 Charron, F., 498
Consortium, 267 Christiansen, A. E., 201
Carta, L., 748 Chasan, R., 305
Cacace, F., 85 Christodoulou, F., 790
Carter, D. R., 575 Chasin, L. A., 76
Cáceres, L., 286 Chu, L., 369
Carulli, A. J., 161 Chassot, A. A., 203
Cadieu, E., 25, 538 Chuang, P. T., 123, 124
Carvalho, L., 368, 371 Chaturvedi, R., 633
Cadigan, K. M., 128 Chun, C. K., 777
Casaca, A., 547 Chauhan, B. K., 520, 525
Cagen, S. Z., 751 Chung, H., 781
Casanova, J., 115 Chavez, S. L., 735
Cai, L., 677, 678, 679 Chuong, C.-M., 113
Casares, F., 302 Chazaud, C., 148, 149, 398
Caiazzo, M., 66 Churchill, A., 9
Casey, B., 405 Chea, H. K., 354
Cakmak, H., 211 Churchill, G. C., 235
Casper, K. B., 449 Cheatle Jarvela, A. M., 67
Calafat, A. M., 749 Ciccone, D. N., 71
Cassirer, E., 11 Chen, C., 728
Caldwell, M. S., 770 Cirillo, C. P., 64
Castellano, L. E., 226 Chen, C. C., 537
Cales, C., 120 Cirio, M. C., 584
Caston, J. D., 712 Chen, C.-M., 560
Callebaut, M., 389 Ciruna, B., 128, 399
Catala, M., 415, 418, 427 Chen, H., 64, 645
Calloni, G. W., 467, 481 Clancy, D. J., 727
Cate, R. L., 197 Chen, J., 211
Calvin, H. I., 246 Clapham, D. E., 240, 242
Catela, C., 430 Chen, L. Y., 208
Cambray, N., 428 Clark, G. F., 240
Cather, J. N., 256, 262 Chen, M. J., 606
Cammarata, G. M., 489, 490, Clarke, G., 781
Causo, J. P., 688 Chen, Q., 210
492 Clarren, S. K., 741
Cavelti-Weder, C., 65 Chen, S. Y., 743
Camp, E. S., 18 Clay, M. R., 472
Cayuso, J., 551 Chen, W. T., 106
Campanale, J. P., 690 Clegg, K. B., 392
CDC, 739, 741 Chen, Y., 733
Campàs, O., 798 Clement, A. C., 256, 262
Cebra, J. J., 780 Chen, Y. H., 598
Campbell, J. S., 719
AI–4 Author Index
Clermont, Y., 219 Cooper, M. S., 376 Cyranoski, D., 177 de la Sancha, C. U., 226
Clever, U., 685 Cooper, T. A., 76 Cyster, J. G., 487 De Renzis, S., 281
Clevers, H., 126–127, 128, Copedè, F., 725 Czeizel, A. E., 427, 436 De Robertis, E. M., 336, 344,
144, 159, 160, 161, 529 Copp, A. J., 422, 425 347, 357, 358, 359, 362, 364
Clinton, M., 213 Corces, V. G., 55 D de Rooij, D. G., 209
Clop, A., 82 Cordaux, R., 776 Dady, A., 416, 427, 428 De Rubeis, S., 173
Clotman, F., 662 Cormier, P. S., 238 Dahn, R. D., 638, 639 de Santa Barbara, P., 191
Cochard, L. R., 590 Corpening, J. C., 477, 478 Daily, D., 279 de Sauvage, F. J., 756, 757, 758
Codega, P., 155 Corpuz, Alexis, 471 Dakubo, G. D., 502 De Smaele, E., 757
Coen, E., 802 Correa, L. M., 222 Dal-Pra, S., 374 de Soysa, T. Y., 740
Cohen, A., 328 Corruccini, R. S., 575 Dale, J. K., 555, 556 De Vos, L., 212
Cohen, C. S., 777 Corselli, J., 241 Dale, L., 350 Dealy, C. N., 644
Cohen, J., 503 Cory, S., 510 Daley, G. Q., 170 Dean, J., 246
Cohen, M., 433 Cosgrove, M. S., 50 Dalton, R., 752 Dearden, P. K., 292
Cohen, P. P., 675 Coskun, S., 608 Damen, W. G., 791 Deaton, A. M., 55
Cohen, S. M., 293, 689 Cossu, G., 562, 569 D’Amico, L. A., 376 Decembrini, S., 527
Cohen-Dayag, A., 243 Costa, P. R., 85 Damm, E. W., 339 Decker, C. J., 77
Cohlan, S. Q., 744 Costantini, F., 583, 586, 588 Dan, J. C., 225 Decker, G. L., 227
Cohn, M. J., 620 Costello, I., 410, 595 Dan, K., 314, 326 Dedeine, F., 778
Colak, D., 156 Cota, C. D., 593 Dan, Y., 509 Deerinck, T., 445
Colas, J. F., 593 Cotsarelis, G., 526, 535 Daneholt, B., 48 DeFrances, M. C., 718
Colborn, T., 746 Coulombre, A. J., 526 Daniel, C. W., 129 Degelmann, A., 293
Colburn, T., 752 Couse, J. F., 184, 197 Danielian, P. S., 48, 86 Degnan, B., 672
Coleman, H., 755 Cowan, W. M., 673 Danilchik, M., 7, 342 Degnan, S. M., 672
Coles, C. H., 490 Cox, E. C., 507 Danjo, T., 174 DeHaan, R. L., 593, 597
Coles, E. G., 472 Craig, M. M., 256 D’Arcangelo, G., 452 Deiner, M. S., 503
Coles, L. S., 723 Crain, D. A., 202 Darnell, D. K., 21, 389 Deisher, T., 170
Collas, P., 238 Crampton, H. E., 257, 260 Darnell, J. E., 54 Dekens, M. P., 78
Collier, J. R., 265 Crane, A. M., 172 Darnell, R. B., 78 del Valle Rodríguez, A., 278
Collignon, J., 404 Craven, L., 711 Darwich, A. S., 159 Delalande, J. M., 478
Collins, F. D., 227 Crawford, K., 628, 713 Darwin, C., 23, 254, 786, 795 DeLaughter, D. M., 599
Colman, H., 509 Cretekos, C. J., 25 Darwin, E., 181 DeLaurier, A., 624
Colman, R. J., 727 Creuzet, S. E., 467, 482, 485, Das, A., 485 DeLeve, L. D., 662
Colosimo, P. F., 788 486 Dasen, J., 430 Delfini, M.-C., 567
Colvin, J., 191 Crews, D., 202, 212, 771, 782, Dasen, J. S., 494 Delhanty, J. D., 735
Colwin, A. L., 225 803 Davenport, R. W., 489 Delongo, J., 427
Colwin, L. H., 225 Crist, C. G., 577 Davey, C. A., 51 Delsuc, F., 253, 254
Combes, A. N., 191 Croce, J. C., 320 David, J. D., 576 Denans, N., 547, 559, 560
Comings, D. E., 207 Crosby, G. M., 619 David, R., 595 Denes, A. S., 793
Conboy, I. M., 730 Cross, N. L., 230, 241 Davidson, B., 330, 593 Denetclaw, W. F., 570
Condic, M. L., 683 Crossgrove, K., 686 Davidson, E. H., 41, 61, 63, 67, Deng, C., 121, 648
Condon, J. C., 667 Crossley, P. H., 625 68, 92, 252, 254, 315, 316, Deng, W., 56
Conery, J. S., 791 Crowley, C., 513 319, 320, 332, 592, 593, 596, Denkers, N., 544, 582
Congdon, J. D., 732 Crump, J. G., 485, 657 789, 790 Dennis, M. Y., 792
Conklin, E. G., 19, 32, 254, Cubas, P., 802 Davidson, L. A., 341, 342 Denver, R., 677
328 Cui, C., 391 Davies, A. M., 511–512 Denver, R. J., 774, 775
Conner, S., 233 Cullen, S. M., 163, 609 Davies, J. A., 496 Dequéant, M. L., 557
Conover, D. O., 771 Culty, M., 205, 208 Davis, A. P., 616 Deries, M., 569
Conway, S. J., 487 Cumano, A., 606 Davis, G. H., 100 Deschênes-Furry, J., 78
Cook, S. P., 225 Cummins, J. M., 246 Davis, I., 299 Desgrosellier, J. S., 601
Cooke, J., 552 Cunha, G. R., 748 Davis, M. C., 617 DeSimone, D. W., 105, 343
Cool, J., 188, 191 Cunningham, T. J., 544, 545, Davis, S., 604 Dessain, S., 301
Coolen, M., 379 546, 621, 622, 630, 631, 646 Davis, W. L., 743 Dessaud, E., 433
Cooley, J. S., 134, 135 Curado, S., 716 Davison, A., 257 Detrick, R. J., 425
Cooper, J. A., 452 Currie, J., 673 Davy, A., 137, 476 Detwiler, S. R., 619
Cooper, K. L., 574, 628, 629, Currie, P., 617, 649 de Beer, G. R., 37 Deutsch, J., 295
648 Curtis, M. A., 153 de Boer, J., 724 Devoto, S. H., 560
Cooper, L. N., 646, 650, 795 Cuykendall, T. N., 352 De Calisto, J., 472 Dezawa, M., 165
Cooper, M. K., 124, 522 Cvekl, A., 60, 110, 525, 526 de la Cruz, M. V., 593, 594 Dhand, R., 380
Author Index AI–5
Dhawan, S. S., 663 Duan, R., 576 Elton, T. S., 738 Fausto, N., 719
Di Gregorio, A., 331 Duband, J. L., 472 Emery, A. E., 542 Fausto-Sterling, A., 701
Diaz-Benjumea, F. J., 689 Duboc, V., 624 Emery, B., 442 Fawcett, D. W., 209
Diaz Heijtz, R. D., 781 Duboule, D., 56, 403, 547, Emery, I. F., 686 Fazzari, P., 492
Dictus, W. J. A. G., 265 548, 631, 640 Emlen, D. J., 766, 767 Feil, R., 425
Didier, Y. R., 597 Dubrulle, J., 401, 553, 554, Enard, W., 460 Feldman, M., 576
Dierks, C., 538 558 Endo, T., 711, 712 Felsenfeld, G., 72
Dieterlen-Lièvre, F., 606 Dubuis, J. O., 295 Engleka, M. J., 353, 354 Feng, J., 725
Dietrich, J.-E., 394 Ducibella, T., 248, 393 Engler, A. J., 165, 166 Feng, L., 453
Dietrich, S., 542, 569 Dudás, I., 427, 436 Eom, D. S., 420, 421 Feng, R., 211
Diez del Corral, R., 386 Dudley, A. T., 588 Epel, D., 227, 230, 232, 236, Ferguson, E. L, 191
Diggle, P. K., 786 Duester, G., 544, 545, 621, 237, 238, 736, 740, 746, 751, Ferguson, M. W. J., 771
Diman, N. Y., 598 622, 628, 630, 631, 646 763, 768, 775, 776, 783, 785, Ferguson-Smith, A. C., 71, 72
Dimos, J. T., 173 Duguay, D., 102, 103 803 Fernandez-Teran, M., 625,
DiNardo, S., 301 Duloquin, L., 323 Ephrussi, A., 289, 290 640
Ding, B. S., 662, 719 Dumortier, J. G., 374 Eppig, J. J., 204 Fernando, W. A., 718
Ding, L., 608 Dunbar, H. E., 804 Epstein, C., 735 Ferrandon, D., 289
Dinsmore, C. E., 694, 697 Dunn, N. R., 655 Epstein, J. A., 487 Ferrara, N., 604
Diogo, R., 594 Dunner, K., 644 Epstein, M. L., 478 Ferré-D’Amaré, A. R., 63
Dixon, G. H., 54 Dunty, W. C., Jr., 559 Erdem, G. U., 125 Ferree, P. M., 776
Djuranovic, S., 81 Dupé, V., 364 Erickson, C. A., 447, 465, 466, Ferrell, J. E., Jr, 336
Dobbs-McAuliffe, B., 376 Durando, M., 750 475, 477, 479, 480, 481 Ferris, C. D., 235
Dobson, A. T., 392 Durbin, L., 551, 552 Erickson, J. W., 198, 199 Festa, E., 165
Dodd, J., 389 Durland, J. L., 567 Erkenbrack, E. M., 319 Field, R., 49
Dodson, S., 768 Durston, A. J., 364 Ernesto, J. I., 243 Fields, R. D., 440
DOE, 753 Dwyer, J. B., 739 Ernst, S. G., 312 Fietz, S. A., 454
Doerflinger, H., 286, 287 Dyce, J., 395 Erwin, D. H., 252, 790 Filipowicz, W., 81
Doetsch, F., 155, 441 Dym, M., 208, 210 Essner, J. J., 376 Finer, L. B., 744
Doherty, K. R., 577 Dyson, S., 116, 117 Ettensohn, C. A., 314, 316– Fink, R. D., 321
Dzierzak, E., 583, 606 317, 323, 324, 325, 326 Finkelstein, R., 293
Dohmen, M. R., 261
Evans, D. J., 542 Finnerty. J. R., 790
Domingos, P. M., 363, 364
Domino, S. E., 226 E Evans, D. J. R., 484 Fire, A., 81
Easter, S. S., 503 Evans, J. P., 245 Firnbeg, N., 120
Domschke, K., 87, 88
Echelard, Y., 432 Evans, M. J., 148, 168, 406 Fischer, A. J., 527
Dong, P. D., 663
Eckalbar, W. L., 555 Evans, R. M., 676 Fischer, J.-L., 328
Donner, A. L., 523
Edgar, B. A., 78 Evans, T. C., 269, 272 Fishell, G., 450
Donoghue, D. J., 121, 648
Edlund, T., 415 Everett, E., 231 Fisher, C. R., 184
Dorris, M., 741
Edmonds, D. K., 735 Ewald, A., 338 Fisher, D. E., 730
Dorsky, R. I., 138, 502
Edmondson, J. C., 450 Ewen-Campen, B., 203 Fisher, H. S., 240
Dosch, R., 356, 368
Egawa, N., 174 Eyal-Giladi, H., 382, 389 Fisher, R. E., 557
Dosenbach, N. U., 461
Egerman, M. A., 158 Ezin, A. M., 468 Fishman, M. C., 598
Doudna, J. A., 81, 82
Eichele, G., 439 Ezratty, E. J., 528 Fishman, M. P., 663
Doupe, A. J., 477
Down, T. A., 55 Eicher, E. M., 193 Fissore, R., 248
Eichmann, A., 605 F Fitch, K. R., 279
Downs, K. M., 398
Drachman, D. B., 712 Eilken, H. M., 606 Fabre, P. J., 504 Fitzsimmons, R., 488
Dray, N., 551 Eiraku, M., 174, 523 Faden, R. R., 177 Flamme, I., 604
Dreger, A. D., 196 Eisen, A., 232 Fagotto, F., 104, 551 Flanagan, D. J., 161
Dreno, B., 125 Eisen, J. S., 475 Faigle, R., 153 Flavell, R. D., 70
Drescher, U., 507 Eisenbach, M., 224, 241, 243 Falck, P., 16 Fleischman, A., 480
Dresser, R., 177 Eivers, E., 374 Falconer, D., 450 Fleming, T. P., 148, 393, 395
Dreyer, S. D., 645 Ekkert, J. J., 395 Fallon, J. F., 113, 510, 615, 619, Flentke, G. R., 743
El Hallani S., 758 625, 626, 627, 636, 637, 638, Florio, M., 458
Driesch, H., 36, 37, 312
Eliazer, S., 151 639, 645, 646, 678
Driessens, G., 758 Florschütz, P. A., 339
Eliceiri, B. P., 676 Famulski, J. K., 450
Driever, W., 289, 292, 293, Fluck, R. A., 374
Elinson, R. P., 230, 334, 335, Fan, C. M., 562
366, 371, 375 Flusser, V., 255
350 Fan, M. J., 353, 356
Drossopoulou, G., 638 Foe, V. E., 280, 281, 306
Ellenberg, J., 211 Farin, H. F., 161
Druckenbrod, N. R., 478 Foerder, C. A., 231
Elliott, H. A., 787 Fässler, P. E., 344, 347
Du, S., 370 Fol, H., 219
Ellis, K., 550, 563 Fast, E. M., 776
Duan, J., 781 Foley, A. C., 385, 400
Ellisman, M., 445 Fauny, J. D., 375
AI–6 Author Index
Foltz, K. R., 228 Fuks, F., 71 Geiger, B., 492 Goehring, N. W., 269
Fondon, J. W., 643 Fukuda, M., 344 Geigy, R., 678 Goessling, W., 164
Fong, G.-H., 604 Fukumachi, H., 659 Geissler, W. M., 196 Goetz, S. C., 132
Fonseca, S. A., 168 Funayama, N., 350 Gempe, T., 182 Gogtay, N., 460
Fontana, J. A., 759 Furtado, L. V., 124 Gems, D., 726, 727 Goldman, D., 87, 88
Ford, C. E., 183 Fürthauer, M., 374, 375 Geng, J., 712 Goldman, O., 662
Formicola, L., 165 Furuichi, T. S., 235 Genikhovich, 359 Goldschmidt, R. B., 806
Forrest, K. M., 290 Furukawa, T., 502 Gentile, L., 702 Goldspink, G., 578
Forscher, P., 489 Furuta, Y., 110 Georgas, K., 589 Goldstein, B., 268, 269, 271
Foster, K. R., 240 George-Weinstein, M., 570 Gomez, C., 558, 559, 795
Foty, R. A., 99, 100, 102, 103 G Gerber, H. P., 574 Gómez-Skarmeta, J. L., 619
Fournier-Thibault, C., 425 Gadella, B. M., 241 Gerhart, J., 543, 569, 570, 595, Gomot, L., 530
Frame, J. M., 603 Gafni, O., 168 785 Gönczy P., 269, 271
Franch-Marro, X., 115 Gage, F. H., 153, 526 Gerhart, J. C., 335, 349, 350 Gont, L., 355
Francis, H., 106 Gage, S. L., 228 Gerisch, B., 726, 727 Gont, L. K., 415
Francis, O. L., 56 Gahlay, G., 244, 245, 246 Germain, S., 354 Gonzales, A. N., 199
Franco, S. J., 452, 453, 454 Gaiano, N., 448, 455 Gershon, M. D., 488 Gonzales, A. P., 366
Frankino, W. A., 772 Gajera, C. R., 156 Gerton, G. L., 219 Gonzalez, A., 782
Franklin, V., 655 Galant, R., 799 Gervais, L., 286 González-Reyes, A., 286
Franks, M. V., 419 Galantino-Homer, H. L., 242 Geschwind, D. H., 792 Gooday, D., 475
Frantz, G. D., 449, 451 Galindo, R. L., 306 Ghabrial, A. S., 114, 115 Goodman, C. S., 493, 499, 500
Franz-Odendaal, T. A., 796 Galione, A., 235 Gharbiah, M., 262, 263 Goodman, W., 683, 684
Fraser, S., 338 Galis, F., 17, 801, 802 Giachino, C., 154, 155, 156 Goodrich, L. V., 157, 512
Fraser, S. E., 20, 466, 483 Gallagher, P. J., 576 Giannakou, M. E., 727 Gorbunova, V., 724
Fre, S., 160 Gallera, J., 414 Giannoni, E., 106 Gordillo, M., 654
Freem, L., 22 Galli, A., 641 Gibbons, A., 460 Gordon, J. I., 779, 783
Freeman, G., 257 Galli, D., 598 Gibson, G., 805 Gore, A. C., 750, 753
Freiman, R. N., 188 Gañan, Y., 645 Gibson-Brown, J. J., 622 Gorelick, D., 741
Freire-Maia, N., 738 Gans, C., 463 Giedd, J. N., 460 Gorostiza, E. M., 436
Freitas, R., 619 Ganz, J., 153 Gierer, A., 697 Goss, A. M., 667
Frenette, P. S., 161, 163, 164 Gao, F., 319, 789 Gilbert, C., 787, 792 Goss, R. J., 702, 707
Friedenstein, A. J., 164 Garbers, D. L., 224, 226 Gilbert, L. I., 683, 684 Gossage, J. P., 741
Friedman, R. C., 80 Garcia, J., 732 Gilbert, P. W., 779 Gosse, N. J., 504, 505
Friedman, W. E., 786 Garcia-Bellido, A., 689 Gilbert, S., 637 Goto, T., 341
Friet, S. C., 777 García-Cardeña, G., 606 Gilbert, S. F., 183, 184, 196, Göttgens, B., 607
Frigerio, G., 290 García-García, M. J., 105 337, 349, 395, 408, 736, 740, Gottlieb, D. I., 506
Frisch, S. M., 106 Gard, D. L., 335 746, 751, 763, 768, 775, 776, Gottlieb, G., 736
Frischer, L. E., 302 777, 783, 785, 787, 803 Gouilleux, F., 120
Gardiner, D. M., 233, 707,
Fristrom, D., 681 711, 720 Gilbert, S. G., 170 Gould, S. J., 9, 456, 786
Fristrom, J. W., 681, 688 Gardner, A. J., 245 Gilbert-Barness, E., 121 Gould-Somero, M., 230
Fritzsch, B., 674 Garita, B., 600, 601 Gilland, E. H., 379 Goulding, E. H., 744
Fromental-Ramain, C., 617 Garner, H. R., 643 Gimlich, R. L., 350 Goustin, A. S., 115
Frost, S, D. W., 769 Garriock, R. J., 544 Gingerich, P. D., 649 Gouti, M., 435
Frotscher, M., 451 Garrity, D. M., 623 Gioiosa, L., 751 Govin, J., 210
Frydman, H. M., 776 Garson, J., 807 Giraldez, A. J., 82, 83 Graham, A., 466, 518
Fu, L., 674 Garstang, W., 808 Girondot, M., 732 Graham, T. A., 160
Fu, Y., 391 Gärtner, A., 495 Giroud, A., 744 Grainger, R. M., 109, 110, 111,
Fuchs, A. L., 304 Garza, L. A., 537 Gish, D. T., 650 523
Fuchs, E., 528, 529, 534, 535, Gasseling, M. T., 635 Giusti, A. F., 235 Granato, M., 365
536 Gaudet, J., 272 Gjoneska, E, 729 Grande, C., 258
Fuchs, Y., 509 Gaul, U., 296 Glabe, C. G., 227, 228, 231 Grandel, H., 153, 156, 622
Fuentealba, L. C., 447 Gaunt, S. J., 403, 791 Glaser, T., 521 Grant, B. R., 796
Fuentes, M. M. P. B., 771 Gavis, E. R., 290 Glinka, A., 362, 363 Grant, P. R., 796
Fuhrmann, S., 522, 523 Gawantka, V., 356 Gluckman, P., 763, 783 Grant-Downton, R., 803
Fujimori, T., 425 Gaylord, B., 690 Gluecksohn-Waelsch, S., 46 Gräper, L., 597
Fujioka, M., 297, 298 Gedamu, L., 54 Gnecchi, M., 165 Grapin-Botton, A., 658
Fujita, S., 448 Gee, L., 699 Godement, P., 504 Gratwohl, A., 608
Fujiwara, M., 110, 111 Gehring, W., 66, 90 Godin, I. E., 606 Graveley, B. R., 73
Fukazawa, C., 369 Gehring, W. J., 790 Goding, C. R., 63 Graves, J. A., 190
Godsave, S. F., 358
Author Index AI–7
Gravina, S., 730 Gumpel-Pinot, M., 659 Han, M. J., 709 Hatase, H., 732
Gray, R. S., 564 Gundersen, R. W., 495 Hanahan, D., 602, 754 Hatchet, O., 290
Green, J. B., 116, 128 Gunter, C., 380 Handa, N., 200 Hatori, M., 574
Green, J. B. A., 530 Guo, H., 81, 392 Handel, M. A., 204 Hatta, K., 101, 552
Green, M. L., 743 Guo, S., 81 Handrigan, G. R., 416 Hatten, M. E., 450, 451
Greenbaum, A., 163 Guo, Z., 152 Handschuh, K., 131 Hausen, P., 351
Greene, E., 764, 765 Gupta, P. B., 758 Handyside, A. H., 148 Haver, N., 366
Greenwald, I., 139, 140 Gupta, S. K., 244 Hanken, J., 674, 675 Hawkes, L. A., 771
Greer, J. J., 495 Gupta, V., 716 Hanna, J., 172, 173 Hawley, S. H. B., 359
Gregor, T., 40 Gurdon, J. B., 56, 65, 116, 117 Hannon, G. J., 81, 82 Hay, E. D., 526
Grenham, S., 781 Gurley, K. A., 705 Hannum, G., 729 Hayashi, K., 172
Grenier, J., 485 Gurnett, C. A., 636 Hansen, C. G., 139, 140 Hayashi, S., 78
Grens, A., 700 Gurung, R., 576 Hansen, D. V., 457 Hayashi, T., 704
Grey, R. D., 233 Gustafson, T., 314 Hansen, L. A., 759 Hayashi, Y., 152, 203
Griesi-Oliveira, K., 173 Guthrie, S., 429 Hansen, M. J., 507 Hayes, T. B., 751, 752
Grignani, F., 759 Guyette, W. A., 77, 78 Hao Zhu, M., 170 Haygood, R., 798
Grimaldi, A., 676, 677 Gwathmey, T. M., 242 Hara, K., 205, 208 He, L., 81, 82
Griswold, M. D., 209 Harada, T., 503 He, X., 351
Gritsman, K., 375 H Hardin, J., 313, 325, 326 He, X. C., 161
Grobstein, C., 115, 586, 587 Haag, W. R., 264 Hardin, J. D., 339, 341 Headon, D. J., 531
Grobstein, P., 673, 674 Haas, H., 389, 407 Harding, K. W., 298, 301, 302 Heasman, J., 105, 336, 350,
Groenendijk, B. C., 601 Habener, J.-F., 60 Harding, M. J., 155 352
Gronemeyer, H., 685 Habib, S. J., 128 Harding, R., 739 Heath, J. K., 204
Groner, B., 120 Hacker, A., 189 Hardman, P., 129 Hebrok, M., 662
Gronthos, S., 164 Hadfield, M. G., 773 Harel, I., 542 Hedgecock, E. J., 499
Gros, J., 391, 567, 577, 624, Hadjantonakis, A. K., 654 Harfe, B. D., 541, 564, 565, Heemskerk, J., 301
627, 633 Hadorn, E., 66, 737 637, 638 Heidt, T., 164
Gross, J. B., 674 Haeckel, E., 786 Hariharan, I. K., 689 Heifetz, Y., 279
Grosshans, J., 281 Haering, C. H., 207 Harkey, M. A., 323 Heikkilä, M., 188
Grossniklaus, U., 52, 293 Hafen, E., 297 Harland, R., 435 Heinecke, J. W., 236
Grotewold, L., 647 Haffter, P., 366, 367 Harland, R. M., 348, 356, 357, Heins, S. W., 771
Groudine, M., 70 Hafner, M., 232 359 Heisenberg, C. P., 100, 283,
Grover, V. K., 123 Hagemann, T. L., 443 Harper, M. J., 240 368, 371
Groves, A. K., 519 Hahn, H., 125 Harper, S., 511–512 Hejnol, A., 253, 255, 258
Grumolato, L., 128 Haigh, J. J., 574 Harrafuji, N., 700 Hekimi, S., 725
Grüneberg, H., 737 Hakamori, S., 105 Harrington, M. J., 415, 416, Helbling, P. M., 483
Grunz, H., 349, 358 Halata, Z., 560 428 Helde, K. A., 369
Gu, T. P., 71 Halder, G., 90, 521, 790 Harris, J., 174 Heldin, C.-H., 130
Gu, Y., 203 Haley, S. A., 231 Harris, M. J., 425 Heller, H., 62
Gualdi, R., 661, 662 Halfter, W., 506 Harris, M. L., 465, 466, 475, Hellström, M., 604
Guarente, L., 726 477, 479, 480, 481 Helms, J. A., 482, 796
Hall, A., 472
Guay, P. S., 686 Harris, M. P., 125, 768 Hemler, M. E., 245
Hall, B. K., 384, 463, 466, 573,
Gubbay, J., 189 675, 796 Harris, W. A., 347 Hemmati-Brivanlou, A., 355,
Gudernatsch, J. F., 675 Hall, Z. W., 509 Harris-Johnson, K. S., 667 356, 358, 608
Guehring, T., 564 Halloran, J., 728 Harrison, D. E., 728 Hendrix, M. J., 755
Guerreiro, I., 122, 404, 546 Halloran, M. C., 472 Harrison, R. G., 30, 114, 349, Hengartner, M. O., 510
Guerrero, A., 225 488, 493, 614, 619, 620, 626 Hengenius, J. B., 278
Hamaguchi, M. S., 239
Guerrero-Bosagna, C., 753 Hart, D. O., 602 Henion, P. D., 466
Hamaoka, T., 58
Guerrier, P., 262 Hart, R., 724, 725 Henrique, D., 544, 545, 546
Hamaratoglu, F., 688, 689
Guger, K. A., 350 Hartenstein, V., 282 Henry, E. W., 442
Hamburger, V., 38, 344, 347,
Guha, P., 171 348, 488, 495, 518, 635 Hartmann, C., 647 Henry, G. L., 658
Guidobaldi, H. A., 243 Hamburgh, M., 114 Harvell, C. D., 768, 769 Henry, J., 254, 262
Guild, G. M., 686 Hamelin, M., 499 Harvey, S. A., 115 Henry, J. Q., 259, 260, 262,
Guillemot, F., 153, 156 Hamer, H., 745 Harvey, W., 9 263, 265
Guillette, L. J., Jr., 202 Hammes, A., 74 Hasebe, T., 674 Hentschel, H. G., 633
Guillin, O., 513 Hammond, C. B., 195 Hashimoto, C., 305 Herbomel, P., 608
Guirao, B., 405 Hammoud, S. S., 210 Hashimoto, H., 423, 424, 673 Herculano-Houzel, S., 456,
Gulyas, B. J., 392 Han, J. Y., 381 Hashimoto, M., 405 457
Gumbiner, B. M., 350 Han, M., 272 Hassold, T., 212 Herlands, R., 697
Hastie, N. D., 74 Herman, W. S., 732
AI–8 Author Index
Herrera, E., 504 Holliday, R., 725, 736 Huber-Brösamle, A., 494 Iten, L. E., 627
Hertwig, O., 219, 248, 619 Hollyday, M., 448, 494 Hudson, C., 658 Itou, J., 624
Hess, R. A., 197 Holowacz, T., 350, 364 Huettle, R.-E., 495 Iulianella, A., 560
Heuser, J., 232 Holstein, T. W., 699 Hughes, C., 751 Izpisúa-Belmonte, J.-C., 365,
Heyland, A., 690 Holt, C., 506 Hughes, C. L., 808 374, 390, 546, 626, 642
Heyningen, V. van, 735 Holt, C. E., 673 Hughes, I. A., 196 Izumo, S., 595
Hibino, T., 327 Holtfreter, H., 355 Huh, C.-G., 719
Hicklin, J., 700 Holtfreter, J., 95, 97, 98, 99 Huh, S. H., 533 J
Higgins, G. M., 718 Holtzer, H., 110 Hull, C. L., 196 Jääskeluäïnen, J., 195
Hiiragi, T., 394 Holub, M., 399 Hume, C. R., 389 Jablonka, E., 753, 803
Hilfer, S. R., 520 Holubcová, Z., 212 Humpherys, D., 49 Jäckle, H., 296
Hill, E. M., 706, 707 Holy, J., 229, 239, 248 Hunt, P., 212, 403, 610 Jackson, W. M., 165
Hill, R. J., 138 Holzenberger, M., 727 Hunt, P. A., 750 Jacob, F., 794
Hillers, K. J., 207 Honda, S., 726 Hunt, T., 789 Jacob, H. J., 561
Hinchliffe, J. R., 619 Hong, C. C., 305 Hunter, C. P., 270, 271 Jacobs, M. W., 671
Hines, J. H., 492 Hong, E., 103 Hurle, J. M., 645, 650 Jacobs, P. A., 184
Hinman, V. F., 67 Hong, K., 499 Hurt, E., 77 Jacobson, A. G., 109, 418, 518,
Hirai, H., 662 Honig, L. S., 635 Hurtado, C., 336 523
Hiramatsu, R., 184, 191, 193, Honig, M. G., 495 Hussain, M. A., 60 Jacobson, M., 444, 448, 450,
401 Hontelez, S., 337 Hutson, M. R., 487 505
Hiramoto, Y., 239 Hooper, L. V., 779, 780 Hutter, H., 269, 272 Jacobson, M. D., 511
Hirata, Y., 164 Hoover, R. N., 747 Huttner, W. B., 449, 454 Jadhav, A. P., 502
Hirate, Y., 149, 150 Höpker, V. H., 499 Huxley, J., 37, 785 Jaeger, J., 296
Hird, S. N., 269 Horb, M. E., 663 Huxley, T., 537, 785, 786 Jaenisch, R., 49, 171, 172
Hirohashi, N., 225, 226, 244 Horel, S., 747 Hwang, H.-Y., 105 Jaffe, L. A., 230, 236, 237, 239
Hirsch, M. S., 106 Horner, V. L., 279 Hwangbo, D. S., 727 Jaffredo, T., 606, 607
Hirschi, K. K., 608 Hornstein, E., 641 Hylander, B. L., 227, 231 Jagersten, G., 672
Hirsh, D. I., 266, 273 Horsley, V., 577 Hynes, R. O., 502 James, L., 124
Hirst, C. E., 570 Hörstadius, S., 315 Hytönen, M., 584 Jameson, S. A., 188, 191
Hirth, F., 793 Horton, W. A., 572 Jamrich, M., 521
Hiruma, K., 686, 687 Horvath, S., 729, 730 I Jandegian, C. M., 751
His, W., 488 Horvitz, H. R., 266, 267, 511 Ibáñez, C. F., 513 Janesick, A., 364, 518
Hitt, A. L., 106 Horwitz, A., 106 Ibrahim, H., 339 Jansen, R., 88
Hiyama, A., 806 Hoskins, S. G., 673 Iemura, S.-I., 355 Janssens, H., 298
Ho, A. T. V., 572, 611 Hoso, M. Y., 258 Igarashi, H., 247 Januschke, J., 286
Ho, H. Y., 128 Hotchkiss, R. D., 69 Iglesias, M., 705 Janzen, F. J., 771, 782
Ho, K. S., 688 Houliston, E., 334 Ihle, J. N., 120 Järvinen, E., 533
Ho, R. K., 372, 617 Houston, D. W., 352 Ihrie, R. A., 157 Jaskelioff, M., 726
Hobert, O., 269 Hove, J. R., 601 Iimura, T., 546, 547 Jaynes, J. B., 297
Hobmayer, B., 698, 699 Howdeshell, K. L., 749, 750 Ikezuki, Y., 750 Jeffery, W., 522
Hochedlinger, K., 170 Howitz, K. T., 728 Illmensee, K., 755 Jen, J. C., 502
Hochgreb, T., 598 Hsia, E. Y., 131 Imai, K. S., 329, 330, 331 Jenkins, N., 64
Hockman, D., 794 Hsin, H., 727 Imai, M., 768 Jenner, R. A., 672
Hodgkin, J., 267 Hsu, Y. C., 528, 529, 535, 536 Imayoshi, I., 156 Jernvall, J., 530
Hodgman, R., 79 Hu, C., 70 Imperato-McGinley, J., 196 Jessell, T. M., 431, 471
Hodin, J., 690 Hu, H., 574 Infante, A. A., 239 Jesuthasan, S., 371
Hodor, P. G., 323 Hu, J., 662 Ingersoll, E. P., 314 Jiang, C., 686
Hoekstra, H. E., 240 Hua, Z. L., 511, 512 Ingham, P. W., 298, 309 Jiang, X., 484
Hoffman, L. M., 742 Huang, B., 190 Innis, J. W., 617 Jiang, Y. J., 555
Hofman, M. A., 456 Huang, H., 676, 677 Inoue, N., 245 Jilka, R. L., 574
Hogan, B. L., 144, 161 Huang, J., 140 Iossifov, I., 173 Jin, M., 243, 244
Hogan, B. L. M., 110, 129 Huang, R., 563 Irie, N., 17 Jin, Y., 148
Hogg, N. A., 532 Huang, S. M., 715 Irvine, K. D., 688 Jindra, M., 687
Hogness, D. S., 805 Huang, T., 243 Irvine, R. F., 234 Jinek, M., 89
Holder, N., 800 Huang, W., 719 Ishii, N., 499 Jirtle, R. L., 767, 803
Holderegger, C., 194 Huang, X., 148, 468 Ishitani, T., 128 Joanen, T., 771
Holleville, N., 485 Huangfu, D., 132 Ishizuya-Oka, A., 674 Jobs, S., 723
Holley, S., 793 Hubaud, A., 552 Issa, J.-P., 729 Joe, A. W., 165
Holley, S. A., 359, 550, 551, Hubbard, T. J. P., 55 Itäranta, P., 589 Joel, D., 197
552, 555 Johansson, J. A., 531
Author Index AI–9
Johnson, D. S., 68 Kalthoff, K., 292 Keillor, T., 618 Kingsley, E. P., 260
Johnson, H. H., 493 Kamachi, Y., 60 Keleman, K., 500 Kinoshita, K., 480
Johnson, J., 246 Kamakura, M., 765, 766 Keller, G., 168, 169 Kinsey, W. H., 235
Johnson, K., 448 Kamei, N., 228 Keller, P. J., 371, 373 Kintner, C., 103
Johnson, M. B., 449, 458 Kamen, R., 77 Keller, R. E., 336, 338, 339, Kirby, M. L., 465, 483, 487,
Johnson, M. L., 199 Kamileri, I., 725 341, 342, 355 593
Johnson, R. L., 123, 125, 562, Kammandel, B., 58 Kelley, R. L., 124, 522 Kirkman-Brown, J. C., 225
572, 644, 646 Kanai-Azuma, M., 658 Kelly, G. M., 376 Kirn-Safran, C. B., 105
Johnson, S. C., 728 Kanakubo, S., 526 Kelly, R. G., 594 Kirschner, M., 490, 785
Johnson, T., 770 Kanatsu-Shinohara, M., 208 Kelsh, R. N., 470 Kirschner, M. W., 337
Johnston, D. M., 685 Kane, D. A., 101, 368 Kemphues, K., 266 Kishimoto, Y., 368
Johnston, M. C., 526, 744 Kaneko, Y., 686, 687 Kemphues, K. J., 81 Kispert, A., 589
Johnston, S. H., 556 Kanesaki, T., 39, 40 Kennedy, T. E., 498 Kissa, K., 608
Johnston, W. L., 267 Kang, H., 160 Kenny, A. P., 317, 320 Kistler, A., 676
Johnstone, M. A., 537 Kant, I., 10 Kenyon, C., 270, 271, 724, Kitajewsky, J., 749
Jones, C. M., 354 Kao, R. M., 585 726, 727 Klatenhoff, C. A., 611
Jones, D. L., 147 Karavanov, A. A., 584 Kerem, B., 172 Klein, A. M., 160
Jones, K. L., 741 Karch, F., 302 Kerney, R., 779 Klein, S. L., 18, 42, 358
Jones, K. R., 513 Kardon, G., 565 Kerr, D. A., 170 Klimchenko, O., 609
Jones, Y., 126 Karlson, R., 373 Kerr, K., 289 Klingler, M., 293
Jonnson, J., 663 Karr, T. L., 280, 299 Keshet, E., 157 Kloos, J., 468
Jordan, T., 521 Karsenty, G., 574 Kessel, R. G., 336, 369 Klose, M., 493
Jorgensen, E., 736 Karumanchi, S. A., 605 Kessler, D. S., 353, 354, 356 Kluger, Y., 610
José-Edwards, D. S., 330 Kasemeier-Kulesa, J. C., 755, Keyes, L. N., 199 Kmita, M., 403, 547
Jossin, Y., 452 756 Keynes, R., 403 Kmita, M. F., 791
Jost, A., 184 Kashimada K., 184, 188, 190, Kfoury, Y., 165 Knezevic, F., 638
Jothi, R., 68 193 Khaner, O., 382, 389 Knight, B., 719
Jouve, C., 556 Kaslin, J., 153 Khavari, P. A., 529 Knipple, D. C., 296
Joyner, A. L., 637 Kassar-Duchossoy, L., 577 Khokha, M. K., 358, 359 Knoblich, J. A., 174, 175, 176
Ju, Z., 726 Kassotis, C. D., 753 Kibar, Z., 421, 422 Knopf, F., 714
Juan, A. H., 568 Kastern, W. H., 79 Kidd, S., 306 Knott, J. G., 247
Jülich, D., 552 Kastner, J., 552 Kidd, T., 500 Knowles, D. W., 285
Jung, J., 661 Katayama, I., 603 Kiecker, C., 363 Knudsen, K., 106
Junion, G., 63 Katikala, I., 330 Kieny, M., 545, 547, 625 Knudsen, K. A., 576
Junt, T., 607 Kato, N., 566 Kiger, A. A., 150 Kobayashi, A., 584
Jurand, A., 399 Katsimpardi, L., 158, 731 Kikuchi, K., 716 Kobayashi, K., 330, 331
Jürgens, G., 293 Kattman, S. J., 599 Kilfoil, M. L., 736 Kobayashi, S., 203
Juriloff, D. M., 425 Katz, W. S., 138, 139 Kim, B.-M., 659 Koch, P. B., 773
Jussila, M., 533 Kaufman, C. K., 754 Kim, G. J., 330 Kochav, S. M., 389
Just, E. E., 95, 230, 231 Kaufman, K. D., 537 Kim, J., 729 Kochhar, D. M., 744
Justice, R. W., 140 Kaufman, M. H., 148, 168, Kim, J. E., 529 Koelle, M. R., 685
406 Kim, K.-S., 219 Kofron, M., 344
K Kaufman, T. C., 264, 292, 299, Kim, S., 64, 191 Kohler, R., 277
Kaang, B. K., 64 301, 302, 794, 808 Kim, S.-H., 342 Koke, C., 39, 40
Kabir, E. R., 746 Kaupp, U. B., 225 Kim, W.-S., 113 Kokovay, E., 155
Kadokawa, Y., 101 Kawagishi, R., 395 Kimberly, E. L., 325 Kolata, G., 49
Kadowaki, T., 125 Kawahara, A., 677 Kimble, J., 138, 266 Kollar, E. J., 530
Kagey, M. H., 394 Kawakami, Y., 622, 625, 638, Kimelman, D., 39, 351, 352, Kollet, O., 164
715 353, 354, 544, 549 Kollros, J. J., 675, 677
Kahn, A. J., 574
Kawamura, S., 58 Kimmel, C. B., 365, 366, 368, Kolm, P. J., 364
Kahn, C. R., 477
Kawasumi, A., 406 369, 370, 373, 553 Kolodkin, A. L., 497
Kahn, J., 647
Kayano, H., 603 Kimura, K. D., 726 Kölreuter, J. G., 10
Kaji, K., 245
Kaznowski, C. E., 451, 452 Kimura, M., 242 Kominami, T., 325
Kajimura, S., 568
Ke, S., 76 Kimura, Y., 247 Komuro, H., 450
Kakugawa, S., 126
Kedes, L. H., 312 Kincade, P. W., 163 Komuro, I., 595
Kalcheim, C., 482, 567, 577
Kedinger, M., 659 King, M. C., 459, 793 Kondo, K., 631, 632
Kallunki, P., 61
Keefer, D., 194 King, R. C., 805 Kondo, T., 547
Kalluri, R., 107
Keeler, R. F., 124 King, T. J., 65 Kondoh, H., 525, 526
Kalm, L. von, 680, 681, 682
Kehler, J., 149 King-Jones, K., 686, 687 Kondrashov, N., 80
Kaltenbach, J. C., 678
Keibel, F., 17 Kingsley, D. M., 647, 788
AI–10 Author Index
Konigsberg, I. R., 575 Kuhn, N. Z., 164, 165 Landström, U., 336 Legeai-Mallet, L., 121
Konopka, G., 792 Kuida, K., 510, 511 Lane, M. C., 18, 325, 336 Lehmann, R., 151, 152, 203,
Konopova, B., 687 Kuijk, E., 148 Lang, R. A., 59 290
Koo, B. K., 159 Kulesa, P. M., 483 Langdon, Y. C., 368, 375 Lehoczky, J. A., 718
Koopman, P., 184, 189, 190, Kulkarni, S. S., 677 Langeland, J., 365, 366, 370, Lehtinen, M. K., 454
193, 205 Kulp, J., 741 373 Leigh, S. R., 456
Kopan, R., 138, 583 Kulp, L., 741 Langlois, V. S., 752 Lele, Z., 425
Korach, K. S., 184 Kulyk, W. M., 742 Langman, J., 186, 407, 561, Lemaire, P., 326, 329, 353
Korbel, J. O., 737 Kumar, A., 707, 712, 713 603, 666 Lemischka, I. R., 147
Koren, O., 781, 782 Kumar, S., 544, 621, 628 Lapidot, T., 758 Lemoine, E. M., 741
Korinek, V., 159, 160, 161 Kunisada, T., 480 Lappi, D. A., 118 LeMosy, E. K., 305
Kornberg, R. D., 50 Kunkle, M., 238 Larabell, C. A., 350 Lengfeld, T., 698
Kornberg, T. B., 135, 136 Kuo, C. T., 156 Larrain, J., 793 Lengyel, J. A., 290
Kornikova, E. S., 342 Kupiec, M., 206 Larsen, E., 17 Lenhoff, H. M., 697
Koropatnick, T. A., 778 Kupperman, E., 597, 598 Larsen, W. J., 398, 444, 481 Lennarz, W. J., 227
Korsching, S., 511 Kuratani, S., 17, 787 Larson, A., 563, 800 Lenoir, T., 11
Korzus, E., 728 Kuratani, S. C., 487 Lash, J. W., 105, 388, 552, 596, Lenz, W., 26, 738
Kos, R., 480 Kuriyama, S., 474, 484 597 Leonard, J. D., 316–317
Kosaki, K., 405 Kuroda, H., 342 Lassar, A. B., 568, 595 Leonardo, E. D., 499
Koseki, C., 587 Kuroda, M. I., 278 Lathi, R. B., 750 Lepage, S. E., 371
Kosher, R. A., 633 Kuroda, R., 258, 274 Lau, Y. F., 187 Lepage, T., 314, 323
Koshiba-Takeuchi, K., 507, Kurokawa, D. N., 402 Laufer, E., 118, 625, 638, 639, Lepilina, A., 716
599, 600 Kurosu, H., 727 649, 650, 794 Leptin, M., 307
Koshida, S., 374, 552 Kurotaki, Y., 394 Laurent, M. N., 353 Leranth, C., 751
Kosman, D., 301, 306, 307 Kurpakus, M. A., 526 Lavial, F., 203 Lescroart, F., 594
Kostrewa, D., 55 Kuure, S., 589 Law, R. D., 368 Letourneau, P. C., 450, 489,
Kotch, L. E., 743 Kvist, U., 246 Lawrence, P. A., 294, 295 495
Koubova, J., 203 Kwan, K.-M., 90 Lawson, A., 382, 385, 419 Lettice, L. A., 58, 636
Kouzarides, T., 52 Kwan, K. Y., 449 Lawson, K. A., 399, 655 Leudemanan, R., 489
Kowalevsky, A., 23, 254 Kwon, G. S., 399, 653 Lawson, L., 541, 564 Leung, C., 368
Koyama, E., 647 Kyba, M., 65 Lawton, A. K., 549 Levi-Montalcini, R., 488, 511
Kozin, S. H., 637 Lay, K., 537 Levin, M., 17, 252, 391, 404,
Kozlowski, D. J., 20 L Layton, L., 751 407, 408
Krabbenhoft, K. M., 627 Lazic, S., 595 Levin, R. B., 489
La Spina, F. A., 243
Kragl, M., 710 Le Bin, G. C., 148 Levine, M., 285, 296, 316, 593
LaBonne, C., 519
Krasnow, M. A., 114, 115 Le Douarin, N. M., 21, 427, Levine, M. S., 67, 298, 301
Lacy, E., 396
Kratochwil, K., 530, 531, 532 465, 467, 474, 477, 482, 485, Levine, R. J., 605
Ladher, R. K., 519 486, 566, 661
Krause, M., 586 LaDue, R. A., 741 Levis, N. A., 775
Krausova, M., 159, 160, 161 Le Lièvre, C. S., 465, 484 Levy, V., 534
Lagos-Quintana, M., 81 Lebel, C., 460
Kreidberg, J. A., 611 Lahr, M. M., 456 Lewandoski, M., 627, 629
Kreiman, G., 85 Leblond, C. P., 219 Lewis, A. K., 565
Lai, K. V., 578 Lechler, T., 528
Krens, S. F., 100 Lallemand, Y., 637 Lewis, E. B., 301, 302, 547
Krieg, P. A., 336 Leclère, L., 203 Lewis, J. H., 627, 628
LaMantia, A. S., 519 Lecourtois, M., 137
Kriegstein, A., 441, 449, 450 Lamb, J., 751 Lewis, W., 523
Kriks, S., 168, 170 Lécuyer, E., 83 Lewitus, E., 457
Lambert, J. D., 255, 258, 259, Ledford, H., 75
Krishnan, A. V., 749 260, 262 Leyns, L., 362, 363
Krivoruchko, A., 732 Ledón-Rettig, C. C., 774 Lhomond, G., 320
Lammer, E. J., 744
Krol, A. J., 555 Lee, C. D., 662 Li, B., 62
Lammert, E., 663
Kronenberg, H. M., 648 Lee, C. Y., 602 Li, M., 687
Lamming, D. W., 728
Krueger, D. M., 776 Lee, H. C., 234, 381 Li, Q., 696
Lamoureux, P., 489
Krull, C. E., 476, 496 Lee, H. Y., 744 Li, Q. Y., 26
Lan, F., 52
Krumlauf, R., 402, 403 Lee, K., 368 Li, S., 597, 598
Lancaster, M. A., 174, 175,
Krumsiek, J., 610 Lee, R. C., 80 Li, T.-K., 742
176, 177, 178
Ku, M., 352 Lee, S. H., 485 Li, W., 499
Lance-Jones, C., 494
Kuan, C.-Y., 496 Lee, S. J., 577 Li, Y., 122, 187
Lancrin, C., 606
Kuang, S., 578 Lee, S.-K., 433 Liang, Q., 551
Lander, A. D., 131, 159, 502
Kubo, K., 750 Lee, Y. H., 485 Licatalosi, D. D., 76
Landman, K. A., 478
Kucharski, R., 767 Leevers, S. J., 120 Licht, T., 157
Landmann, F., 778
Kudoh, H., 374, 376 Lefebvre, R., 242 Lichtman, J. W., 456, 509
Landmesser, L., 494, 495
Kugler, J. E., 329 Lefèvre, R., 245 Liem, K. F., Jr., 432
Author Index AI–11
Ligon, L. A., 495 Loppin, B. R., 279 Maeda, R. K., 302 Mark, W. H., 396
Ligoxygakis, P., 305 Lorda-Diez, C. I., 633 Maeda, T., 578 Markey, C. M., 750
Lillie, F., 786 Loredo, G. A., 795 Maéno, M., 608 Maroto, M., 553
Lillie, F. R., 10, 184, 234, 264 Lorent, K., 665 Maeshima, A., 587 Marques, S. R., 621
Lillycrop, K. A., 768 Loring, J. F., 475 Maffini, M. V., 755–756, 757 Mars, W. M., 719
Lim, D. A., 153, 154, 156, 157 Lough, J., 595 Mahmood, R., 625 Marsden, M., 105, 343
Lin, C. R., 391 Lovell-Badge, R., 187, 189, Mahowald, A. P., 203, 279, Marsh-Armstrong, N., 673,
Lin, H., 151 190, 191 280 677
Lin, J. J.-C., 600 Løvtrup, S., 336 Mailleux, A. A., 533 Marson, A., 167, 394
Lin, L.-F., 513 Lowe, L. A., 404 Mainpal R., 271 Martello, G., 168
Lin, R., 272 Lowery, L. A., 415, 416, 489, Maio, Y. L., 248 Martí Gorostiza, E., 16, 418
Lin, S., 128 490, 492 Maître-Jan, A., 9 Martik, M., 326
Lin, X., 131 Lu, F., 376 Majo, F., 526 Martik, M. L., 690
Lin, Y., 242, 588 Lu, T. Y., 112 Majumdar, A., 588, 589 Martin, B. L., 39, 544, 549
Linask, K., 388 Lu, W., 609 Majumder, S., 728 Martin, C., 606
Linask, K. K., 552, 596, 597, Lucitti, J. L., 607 Makabe, K. W., 327 Martin, G. R., 148, 167, 168,
599, 601, 607 Luger, K., 50 Makanae, A., 712, 713 406
Linask, K. L., 105 Lui, J. H., 449, 450, 455, 457 Makita, T., 505 Martin, P. T., 509
Lindeman, R. E., 194 Lum, L., 124 Malatesta, P., 449 Martin, R. D., 456
Lindholm, P., 513 Lumsden, A., 364, 403, 429, Malhotra, S., 163 Martín-Durán, J. M., 254
Ling, B. M., 568 430 Malicki, J., 791 Martindale, M. Q., 252, 262,
Linsenmeyer, T. F., 526 Luna, B., 461 Malik, S., 56, 57 790
Lints, T. J., 595 Luna, E. J., 106 Malinda, K. M., 323 Martinet, M., 744
Lishko, P. V., 243 Lund V. K., 305 Mallarino, R., 798 Martinez, E., 500
Lister, L. M., 212 Lundelius, J. W., 257 Mallo, M., 547 Martinez-Arias, A., 294, 295
Litingtung, Y., 638, 639, 642 Luo, G., 588 Malone, J. H., 88 Martinez-Morales, J. R., 467,
Litscher, E. S., 222 Luo, H., 502 Malpighi, M., 9, 10 468
Little, M. H., 586 Luo, M. L., 76–77 Mambetisaeva, E. T., 500 Martins, G. G., 326
Little, S. C., 40, 289, 290, 374 Luo, Y., 497 Mammoto, T., 533 Martins-Green, M., 106
Liu, E. T., 86, 777 Luo, Y. J., 690 Manes, M. E., 335 Marvin, M. J., 595
Liu, F., 391 Lupien, M., 64 Mangale, V. S., 445 Marx, J., 183, 497
Liu, G., 499 Luttmer, S., 233 Mangelsdorf, D. J., 676 Mascré, G., 529
Liu, J., 290, 638 Lutz, P. L., 732 Mango, S. E., 272 Massagué, J., 130
Liu, J.-P., 471 Luz, M., 135 Mangold, H., 347 Massarwa, R., 423
Liu, M. M., 257 Lwigale, P. Y., 466 Mangold, O., 359, 360, 361 Matrone, C., 505
Liu, S. Y., 705, 706 Lyko, F., 767 Maniatis, T., 58 Matson, C. K., 207, 208
Livet, J., 42 Lynch, M., 791 Manku, G., 205 Matsuda, S., 688
Llimargas, M., 115 Lynch, V. J., 790, 798 Manley, N. R., 657 Matsui, T., 598
Lo Celso, C., 163 Lyons, D. C., 258, 259, 262, Mann, F., 503, 504 Matsumoto, K., 661
Lobikin, M., 365 265, 323 Mann, R. S., 302, 682 Matsumoto, Y., 782
Locascio, A., 791 Lyson, T. R., 795 Manolagas, S. C., 574 Matsunaga, M., 502
Loeb, J., 234 Lyu, J., 128 Mansfield, J. H., 560 Matsunami, H., 103, 451
Loeb, L. A., 724 Mantzouratou, A., 735 Matthes, D. J., 497
Loffredo, F. S., 158, 730 M Mao, B., 363 Mattison, J. A., 727
Logan, C., 127 Ma, J., 290 Mao, J., 639 Matunis, E., 150, 151
Logan, C. Y., 315, 317, 318, Ma, L., 748 Marcelle, C., 569, 570, 571 Mauch, T. J., 544, 582, 584
320, 324 Maas, S. A., 636, 637 Marchase, R. B., 506 Mavilio, F., 70
Logan, M., 390, 391 Maatouk, D. M., 187, 188, 191 Marchetto, C., 174 Mavrakis, M., 280
Logan, M. P., 614, 622, 624 Macara, I. G., 268 Marcus, N. H. May, D., 596
Lohnes, D., 401 MacCabe, J. A., 644 Marcus, R. C., 503, 504 May, M., 440
Lomniczi, A., 211 MacDonald, B. T., 127 Margarit, E., 193 May, P. A., 741
Long, F., 573, 574 Macdonald, P. M., 289, 291 Margueron, R., 52 Mayer, T. C., 475
Long, H., 500 Macias, D., 646, 647 Margulis, L., 775 Mayor, R., 473, 478, 483, 484
Long, S., 377 Mack, J. A., 529 Mariani, F., 121 Mazahery, A. R., 194
Longo, F. J., 212, 229, 230, Mack, S. C., 755 Mariani, F. V., 627 Mazia, D., 78, 229
233, 238, 239 Mackem, S., 629, 638 Mariani, J., 174 Mazmanian, S. K., 780, 782
Loomis, C. A., 645 MacWilliams, H. K., 697, 700 Marín, O., 497 Mazumdar, A., 39, 281
Lopez, L. C., 242 Maddala, R., 109 Maritz, G. S., 739 Mazumdar, M., 39, 281
López-Martínez, A., 626, 636 Maden, M., 628, 713 Mark, M., 205 Mazzarello, P., 441
Lopez-Rios, J., 638 Maduro, M. F., 270, 271 McAlinden, A., 74
AI–12 Author Index
McBride, W. G., 26 Mendez, R., 79 Mitchell, J. R., 726 Morrill, J. B., 256, 324
McCann, M. R., 540, 564 Méndez-Ferrer, S., 163, 164, Mitchison, T., 490 Morris, A. R., 105
McCarthy, K. D., 449 165 Mitra, S. K., 492 Morris, R. J., 535
McClay, D., 316 Menko, A. S., 576 Mitrani, E., 389 Morrisey, E. E., 597
McClay, D. R., 312, 315, 317, Meno, C., 404 Mittapalli, V. R., 542, 562, 563 Morrison, J. I., 707
320, 321, 322, 323, 324, 326, Mercader, N., 628 Mittman, G., 701 Morrison, S. J., 609
690 Mercola, M., 595 Miura, G. W., 75, 631 Morriss-Kay, G., 481, 485
McClelland, K., 187 Merian, M., 672, 691 Miyagawa, S., 194, 195 Mortlock, D. P., 617
McCollum, S. A., 769 Meriane, M., 499 Miyakawa, H., 768, 769 Morton, D. G., 266
McConnel, S. K., 448, 451, Merino, R., 646, 649 Miyake, T., 573 Moscona, A. A., 100
452 Merke, D. P., 196 Miyata, T., 449, 452 Mosher, D. S., 577
McCormick, F., 120 Merkin, J., 73 Miyazaki, S.-I., 248 Moss, M. L., 575
McCulloh, D. H., 230 Merlino, G., 759 Miyazaki, Y., 588 Mota, B., 457
McCusker, C., 711, 713, 720 Mesa, K. R., 536 Mizutani, C. M., 793 Motegi, F., 268, 269
McCutcheon, F. H., 674 Mescher, A. L., 712 Mlakar, J., 739 Motosugi, N., 394
McDole, K., 395 Messersmith, E. K., 497 Moad, M., 171 Motta, P. M., 783
McEwen, D. G., 128 Metz, C. B., 224, 228 Moczek, A. P., 766, 767, 782 Mou, H., 172
McFall-Ngai, M., 776, 777, Metz, J. A., 801 Moffet, M. W., 765 Moury, J. D., 418
783 Meulemans, D., 468 Mohammadi, M., 119 Moury, J. G., 418
McGaugh, S. E., 782 Meyer, A., 575 Mohri, T., 235, 237 Moy, G. W., 228
McGill, G. G., 480 Meyer, W. J., 195 Molenaar, M., 353 Moyon, D., 604
McGill, M. A., 156 Meyers, E. J., 447 Molenaar, P. C., 736 Mozingo, N. M., 222
McGinnis, W., 402 Michael, K. L., 238 Molina, M. D., 129 Mudbhary, R., 368
McGlade, C. J., 156 Michalopoulos, G. K., 718 Moll, N. M., 162 Muetzel, R. L., 741, 742
McGonnell, I. M., 466, 483 Michino, K., 125 Moller, C. C., 245 Mugford, J. W., 589
McGrew, M. J., 546 Middlemis Maher, J., 774 Molloy, P. L., 72 Muguruma, K., 174
McIntyre, D., 25, 312, 324, Migeon, C. J., 196 Molven, A., 620 Muhr, J., 433
765, 776 Migliore, L., 725 Molyneaux, K. A., 203 Mukhi, S., 675
McKee, B. D., 206, 207 Mikawa, T., 595 Montagu, M. F. A., 456 Mukhopadhyay, M., 526
McKenzie, L. M., 753 Mikhailov, G. V., 442 Montalbano, A. P., 668 Mukhopadhyay, S., 134
McKinnell, I. W., 62, 64 Miki, K., 240, 242 Montavon, T., 548, 641 Mullen, L. M., 711
McKinney, M. C., 483 Mikkola, H. K., 161 Montell, D. J., 303, 517 Müller, F., 421, 549
McLaren, A., 185 Mikkola, M. L., 530, 531, 533 Montgomery, A. M. P., 106 Müller, G., 615
McLaughlin, H., 17 Milán, M., 689 Montgomery, M. K., 777 Müller, G. B., 575, 800
McLean, C. Y., 459 Milenkovic, L., 133 Moody, S. A., 18, 42, 358, 519 Müller, J., 23
McLean, P. G., 781 Millard, S. S., 75, 505 Moolten, F. L., 719 Müller, P., 131
McLin, V. A., 659 Millauer, B., 604 Moon, B. R., 779 Mulligan, K. A., 132
McMahon, A., 433, 583 Miller, B. S., 224, 238 Moon, R. T., 351, 353 Mullins, M. C., 368, 374, 375,
McMahon, A. P., 122, 124, Miller, C. A., 728 608
Moore, H., 240
637, 644, 645, 647
Miller, C. K., 748 Moore, K. A., 147 Mulnard, J. G., 393
McMillen, P., 550, 551, 552
Miller, D., 771 Moore, K. L., 429, 740 Mulvey, B. B., 199
McNamara, K. J., 795
Miller, J. K., 732 Moore, M. W., 587 Munar, E., 576
McPherron, A. C., 77, 577
Miller, J. R., 323, 351 Moore-Scott, B. A., 657 Mundy, C., 647
McPherson, S. M., 233, 235
Miller, J. W., 605 Moosmann, J., 337, 339 Muneoka, K., 619
McShane, S. G., 419
Miller, S. A., 510 Morais Da Silva, S., 712 Munne, P. M., 533
Mead, K. S., 236
Miller, W. H., Jr., 759 Morata, G., 547 Munné, S., 212
Meaney, M. J., 803
Mills, N. E., 779 Morell, M., 156 Muñoz-de-Toro, M., 750
Medawar, P. B., 724
Milunsky, A., 427, 436 Moretti, A., 599 Münsterberg, A. E., 569
Medvinsky, A. L., 583, 606
Min, K. T., 737 Morgan, A. J., 235 Muotri, A., 173, 174
Megason, S. G., 435
Mina, M., 530 Morgan, T. H., 198, 257, 547, Muragaki, Y., 616, 617
Meier, S., 526, 548
Minakuchi, C., 687 694, 701 Murko, C., 427
Meilhac, S. M., 593
Minganti, A., 19, 34, 328 Mori, C., 646 Murphy, M. W., 194
Meinertzhagen, I. A., 423
Minguillon, C., 624 Morimoto, M., 555, 556 Murray, J. D., 771
Meinhardt, H., 631, 688, 700
Minsuk, S. B., 690 Morin, V., 239 Murray, T. J., 750, 751
Mello, C., 81
Mintz, B., 204, 575, 755 Morin-Kensicki, E. M., 475, Murray, V., 725
Mello, C. C., 271, 272 563
Mironov, V., 607 Murry, C. E., 168, 169
Melton, D., 65, 66 Moriyama, Y., 359
Mirzadeh, Z., 154, 155 Murugan, R., 85
Melton, D. A., 352, 354, 355, Mork, L., 202
Mishra, P. J., 759 Muschler, J., 106, 107
358, 658, 663, 665
Misteli, T., 165 Moroni, M. C., 744 Muskavtich, M. A., 137
Mendelsohn, C., 590, 591
Moroz, L. L., 252
Author Index AI–13
Muta, M., 60 Nguyen, M., 523 Nowicki, J. L., 545, 546, 567 Onuma, Y., 354
Mutter, W. P., 605 Nguyen, V. H., 432, 528 Nowotschin, S., 544 Oofusa, K., 678
Mwizerwa, O., 478 Niazi, I. A., 713 NSF, 170 Oosterveen, T., 401
Myers, J. P., 495, 746, 751 Nichols, D. H., 481 Nübler-Jung, K., 382 Oostra, V., 772
Myung, P. S., 537 Nichols, J., 148 Nusse, R., 125, 126, 127, 128 Opitz, J., 736
Niclou, S. P., 503 Nüsslein-Volhard, C., 41, 88, Opitz, J. M., 121, 124
N Nicol, D., 423 125, 285, 289, 290, 292, 294, Oppenheimer, J. M., 372, 374
Nachbury, M. V., 133 Nicoll, C. S., 677 305, 365, 502, 555 Oppenheimer, S., 386
Nacu, E., 708 Niehrs, C., 126, 131, 363 Nyholm, S. V., 777 O’Rahilly, R., 421, 549
Nagai, H., 381, 382 Nielsen, S. J., 690 Ordahl, C. P., 561, 566, 567,
Nagashima, H., 794 Niess, J. H., 781 O 570
Nagel, S., 753 Nieto, M. A., 470 Oakes, S. R., 534 Orgel, L. E., 725
Nagoshi, R. N., 200 Nieuwkoop, P. D., 336, 339, Ober, E. A., 661 Orgogozo, V., 500, 787
Nagy, L. M., 260 349 Oberdoerffer, P., 728 Orkin, S. H., 161
Nahmad, M., 131 Nievelstein, R. A. J., 415 Oberlender, S. A., 103, 573 Orr, W. S., 725
Naiche, L. A., 559, 624 Nijhout, F., 806 O’Connell, D. J., 533 Osborne, S. E., 776
Naillat, F., 188, 203 Nijhout, H. F., 684, 685, 738, Odde, D. J., 492 Ossipova, O., 341
Nakagawa, S., 673 766, 773, 782 Odom, D. T., 663 Oster, G. F., 800
Nakagawa, T., 209 Nikaido, M., 543 Oelgeschläger, M., 356 O’Sullivan, C. M., 396
Nakamoto, M., 507 Nilsen, T. W., 73 Oelschläger, H. H., 795 Ota, Y., 25
Nakamura, H., 466 Nilson, L. A., 286 Offield, M. F., 663 Otaki, J. M., 806
Nakamura, O., 349 Nimmagadda, S., 560 Ogawa, K., 220 Ott, H. C., 112
Nakashima, K., 574 Nishida, H., 33, 327, 329, 330 Ogawa, M., 452 Otto, A., 391
Nakatani, Y., 330 Nishigaki, T., 224 Ogino, H., 110, 523, 524, 526 Ottolenghi, C., 188
Nakatsu, T., 421, 422 Nishikata, T., 327 Ogryzko, V. V., 62, 63 Ottone, C., 157
Nakaya, Y., 552 Nishimura, E. K., 535, 730 Ohata, E., 542, 566 Ou, Q., 683
Nakayama, T., 110 Nishinakamura, R., 185 Ohkawara, B., 129, 131 Ouimette, J.-F., 624
Nameroff, M., 576 Nishioka, N., 394, 395 Ohlsson, R., 57 Oulhen, N., 238
Nance, J., 268 Nishizuka, Y., 234 Ohnmacht, C., 781 Ozil, J. P., 248
Närhi, K., 533 Niswander, L., 423, 639, 645, Ohno, S., 790
Nascone, N., 595 646 Ohta, K., 502 P
Natarajan, D., 478 Niwa, H., 394 Ohuchi, H., 622, 623, 625 Pacifici, M., 647
Navarro, B., 242, 243 Niwa, M., 428 Oka, Y. Y., 562 Pack, M., 659, 665
Nave, A. K., 442 Niwa, Y., 557, 558 Okabe, M., 245 Paddock, S., 285, 689
Nazarov, I., 164 Noakes, P. G., 509 Okada, A., 498 Paganelli, A., 745
Neijts, R., 544 Noctor, S. C., 449, 450 Okada, T. S., 659 Pagliuca, F. W., 664, 665
Nelson, A. M., 537 Noda, Y. D., 244, 245 Okada, Y., 376 Paiardi, C., 210
Nelson, B. R., 502 Noden, D. M., 466, 484, 485, Okano, H. J., 78 Paik, E. J., 602, 608
542 Okazaki, K., 315, 326 Pak, W., 504
Nelson, C. E., 89
Noguera-Troise, I., 604 O’Keefe, R. J., 647 Palacios, I. M., 83, 84
Nelson, M. R., 290
Nohno, T., 642 O’Leary, D. D. M., 476 Palanza, P., 750
Neubüser, A., 120, 530
Nohno, T. W., 113 Olguin, H. C., 577 Pallas, P. S., 701
Neuert, G., 85
Noji, S., 623 Oliphant, G., 242 Palmeirim, I., 552, 556
Neuhaus-Follini, A., 500
Noll, M., 294 Oliver, B., 88 Palmer, A. R., 768
Neuman-Silberberg, F. S.,
286, 303 Nombela-Arrieta, C., 163 Oliver, G., 620 Palmer, C., 777
Neumann, C., 368 Nonaka, S., 404, 405 Oliver, K. M., 804 Palmer, J. S., 191
Neumann, C. J., 502, 689 Noonan, J., 649 Olivera-Martinez, I., 568 Palmlund, I., 748
New, D. A. T., 382, 388 Noordermeer, D., 55, 56, 548 Oliveri, P., 67, 316, 318, 319 Palumbi, S. R., 228
Newbold, R. R., 747, 803 Norma, K., 50 Olivier, H. M., 779 Pan, Y. A., 42, 43
Newgreen, D. F., 475 Normile, D., 177 Olofsson, M., 772 Pander, C., 15
Newman, C. S., 336 Noro, M., 620 Olsen, B., 616 Panfilio, K. A., 283
Newman, R. A., 774 North, T. E., 607 Olson, E. C., 454 Pankratz, M. J., 296
Newman, S. A., 96, 631, 633, Northcutt, R. G., 463, 481 Olson, E. N., 600 Pannebakker, B. A., 778
642, 697, 700, 800 Northrop, J., 356 Olsson, L., 16 Pannérec, A., 165
Newmark, P. A., 701, 702, 705 Nose, A., 101 Olszak, T., 781 Panousopoulou, E., 530
Newport, J. W., 337 Noteboom, R. G. E., 106 Olthoff, K. M., 719 Panzer, S., 306, 307
Newrock, K. M., 261, 312 Notta, F., 605, 610 Olwin, B. B., 577 Paolini-Giacobino, A., 753
Newton, S. C., 208 Novaro, V., 106 Ong, T.-C., 55 Papaconstantinou, J., 526
Ng, F., 165 Nowack, E., 26, 27 Ontell, M., 575
Nowak, D., 759
AI–14 Author Index
Papaioannou, V. E., 22, 428, Perasaari, J., 125 Plikus, M. V., 536 Qiang, L., 66
544, 624 Perea-Gomez, A., 390, 400, Poccia, D., 238 Qin, J., 779
Papan, C., 337 407 Podbilewicz, B., 273 Qin, Y., 190
Papatsenko D., 296 Peres, J., 559 Pogenberg, V., 63 Quill, T. A., 242
Paranjpe, S., 719 Pérez, V. I., 725 Poggioli, T., 158, 731 Quintero, J. J., 198, 199
Pardal, R., 487 Perona, R. M., 396 Poh, W. C., 128 Quiring, R., 110, 521
Pardanaud, L., 542, 566, 603 Perrimon, N., 125, 153, 293 Pohl, C., 269
Pardo, M., 148 Perrone-Bizzozero, N., 78 Pohodich, A. E., 71 R
Pardo-Saganta, A., 667 Perry, B. C., 164 Pollack, R. D., 645 Raaijmakers, M. H., 164
Paridaen, J. T., 449, 454 Perry, M. W., 297 Pollard, K. S., 459 Raatikainen-Ahokas, A., 583
Park, E. J., 598 Persaud, T. V. N., 429, 740 Pollen, A. A., 457, 458 Rabinowitz, J. S., 260, 262,
Park, F. D., 272 Peschon, J. J., 210 Polleux, F., 494, 495, 498 263
Park, I. H., 171 Peter, I. S., 61, 67, 92, 316, 319, Pollheimer, J., 396 Racchetti, G., 492
Parker, H. G., 25, 648 328, 332 Pomeranz, H. D., 465 Raff, E. C., 672
Parker, R., 77 Petersen, C. P., 359, 705, 706, Pongs, O., 685 Raff, R. A., 78, 261, 264, 672,
Parkes, T. L., 725 707 Ponti, G., 155 785, 787
Parma, P., 188 Peterson, R. E., 323, 324 Pontiggia, A., 189 Rafiq, K., 323
Parnaik, V. K., 576 Peyrieras, N., 393 Poo, M.-M., 509 Raible, D., 464
Paro, R., 52 Pézeron, G., 371 Poole, R. J., 269 Raible, F., 120
Parr, B. A., 644, 645 Pfaff, S. L., 433, 494 Porras, D., 595 Raich, W. B., 273
Parrinello, S., 157 Pfeifer, M., 128 Porrello, E. R., 718 Raine, C. S., 442
Parrington, J., 234 Pfeiffer, B. D., 278 Portmann, A., 456 Raineri, M., 219
Partridge, L., 727 Pfennig, D. W., 774 Poss, K. D., 711, 715, 716 Raj, A., 736
Parviz, F., 90, 662 Pfenniger, K. H., 492 Post, W. S., 729 Rajagopal, J., 172
Parzer, H. F., 766 Pfisterer, U., 66 Postovit, L. M., 755 Rajagopalan, S., 500
Pascher, A., 719 Philippen, L. E., 611 Potten, C. S., 161, 535 Rajpurohit, R., 574
Pashmforoush, M., 595 Phillips, D. M., 243 Pouget, C., 566 Rakic, P., 450, 451
Pask, A., 190 Piao, X., 447 Pourquié, O., 34, 401, 543, Rallis, C., 623
Pasque, V., 10 Piatigorsky, J., 60, 110, 525 546, 547, 548, 549, 552, 553, Ralston, A., 149, 394
Pasteels, J., 415 Picard, M. A., 194 554, 557, 558, 559, 569, 581 Ralt, D., 239, 243
Patalano, S., 327 Piccolo, S., 355, 358, 362, 372 Prabhakar, S., 459 Ramanathan, R., 743, 744
Patapoutian, A., 58 Pichel, J. G., 587, 588 Prall, O. W., 595 Ramarao, C. S., 224
Patel, N., 302, 308 Pickett, R., 480 Pratt, R. M., 744 Ramathal, C., 396
Patel, N. H., 258 Pieau, C., 202 Pratt, S. A., 208 Ramûn y Cajal, S., 488, 498
Patten, B. M., 417, 592 Pieper, M., 519 Preger-Ben Noon, E., 585 Randlett, O., 495
Patterson, D., 678 Pierce, G. B., 754, 755, 757, Preitner, N., 490 Rando, T. A., 730
Patterson, P. H., 509 758 Preuss, T. M., 460 Rankin, S. A., 339, 354
Patthey, C., 468, 469, 519 Pierce, S. B., 351, 352, 726 Price, E. R., 62, 63 Ransick, A., 315, 316, 320
Paukstis, K. L., 771 Pierfelice, T., 155, 156 Price, J. V., 286 Ransohoff, R. M., 162
Paul, V. J., 773 Pierschbacher, M. D., 106 Price, S. R., 494 Rappaport, S. M., 746
Paulsen, M., 72 Piette, J., 568 Priess, R. A., 269, 270, 272, Rasin, M. R., 455
Paulsen, S. M., 738 Pigliucci, M., 782 273 Raspopovic, J., 643
Pavan, W. J., 479 Pikó, L., 392 Pringle, A., 775 Rathke, H., 14
Paves, H., 505 Pimanda, J. E., 607 Probst, S., 628 Rauber, A., 384
Pavlath, G. K., 575 Pinder, A. W., 777 Prodon, F., 328 Raven, C. P., 468
Payne, J. E., 231 Pines, M., 266, 267 Propper, A., 530 Rawles, M. E., 21, 475
Pearson, B. J., 704 Pinkerton, J. H. M., 211 Prudic, K. L., 772 Rawls, J. F., 780, 781
Pearson, J., 511 Pinto-Correia, C., 9 Prüfer, K., 455 Ray, K., 7
Péault, B., 608 Piotrowska, K., 391 Pryce, B. A., 578 Ray, R. P., 303
Pechenik, J. A., 773 Piraino, S., 733 Psychoyos, D., 384, 386 Raya, A., 390
Pedersen, R. A., 395 Pisani, D., 252 Pueyo, J. I., 556 Raynaud, A., 532
Peleg, S., 728 Pisarska, M. D., 188 Pull, S. L., 777 Raz, E., 203
Pellegrinet, L., 160 Pispa, J., 517 Punch, V. G., 569 Raz, G., 753, 803
Pellettieri, J., 702 Pittenger, M. F., 165 Purves, D., 456, 509 Reach, M., 306
Pelttari, J., 207 Pizette, S., 645 Putnam, N. H., 790 Reather, C., 396
Peng, T., 594 Pizzari, T., 240 Pyrgaki, C., 423, 425 Rebagliati, M. R., 377
Penner, M. R., 728 Placzek, M., 432 Recanzone, G., 347
Pera, E. M., 363, 364 Plasterk, R. H., 80 Q Reddien, P. W., 359, 703, 704,
Perantoni, A. O., 588 Platt, J. B., 518 Qaisar, R., 578 705, 706, 707
Plaza, S., 60, 302 Qian, H., 163 Rees, B. B., 238
Author Index AI–15
Reeves, W., 33 Robb, L., 401 Rouse, G. W., 672 Sakuno, T., 207
Reichmann, V., 289 Robboy, S. J., 747 Rousseau, F., 121 Salama, S., 459
Reijo, R., 211 Robert, B., 637 Roux, W., 334 Salaun, P., 238
Reillo, I., 457 Roberts, D. J., 659 Rowe, D. A., 627 Salehi, A., 505
Reinitz, J., 293 Roberts, D. S., 510 Rowe, I., 674 Sallin, P., 716, 717
Reiprich, S., 477 Roberts, L. M., 197 Rowley, R. J., 690 Salz, H. K., 199, 200
Reiter, J. F., 597 Roberts-Galbraith, R. H., 701 Rowning, B., 334 Sampath, K., 375
Reitsma, N., 772 Robertson, E., 410 Roy, S., 129, 135, 136 Sample, C., 40
Relaix, F., 567, 577 Robertson, E. J., 400 Roycroft, A., 473 Sanai, N., 155
Relyea, R. A., 769, 770 Robinson, H., 676 Rozario, T., 105, 343 Sánchez, L., 299, 300
Remak, R., 563 Robinson, K. C., 730 Rubin, G. M., 140 Sánchez, M. P., 587
Ren, D., 242 Robinton, D. A., 170 Rubin, L., 627, 731 Sánchez Alvarado, A., 702,
Render, J., 256, 258 Rocheleau, C. E., 271 Rubin, L. L., 750, 756, 757, 707
Rendl, M., 533, 536 Rockman, M. V., 796 758 Sánchez-Arrones, L., 502
Reshef, R., 569 Rodriguez, I., 510 Ruby, E. G., 777 Sánchez -Gomez, C., 593
Reuss, C., 625 Rodriguez, O. C., 490 Ruckh, J. M., 730 Sánchez-Herrero, E., 302
Revel, J. P., 385 Rodriguez-Esteban, C., 390, Rudnicki, M. A., 578 Sandell, L. L., 630
Revenkova, E., 212 622, 625 Ruegg, M. A., 509 Sander, K., 292, 344, 347
Reverberi, G., 19, 34, 328 Roe, S., 9 Ruffins, S. W., 325 Sander, M., 60
Reversade, B., 358, 359 Roeder, R. G., 56, 57 Rugh, R., 6, 396, 592 Sanders, T. A., 135, 136
Revilla-i-Domingo, R., 318 Roegiers, F., 328 Ruibel, R., 774 Sanes, J. R., 505, 509
Rewitz, K. F., 683, 686, 687 Roelink, H., 432 Ruiz de Almodovar, C., 499 Sankaran, V. G., 61
Rex, M., 354 Roessler, E., 124, 522 Runge, K. E., 245 Sano, K., 101
Reya, T., 609 Rogers, C. D., 358 Ruoslahti, E., 106 Sanson, B., 517
Reynolds, G. T., 232 Rogers, K. W., 116 Rupp, R. A., 71 Santiago, A., 479, 480
Reza, H. M., 526 Rogers, S. M., 764 Rushlow, C. A., 285, 305, 306 Santos, L. L., 324
Rezania, A., 664, 665 Rogulja, D., 688 Russell, L. D., 209 Sapp, J., 775, 776
Rhee, K-J., 780 Rohatgi, R., 134 Ruth, S. B., 620 Sardet, C., 232, 236, 327, 328
Ribatti, D., 604 Rompolas, P., 535 Rüther, U., 647 Sargent, T. D., 358
Ricci-Vitiani L., 758 Ronemus, M., 173 Ruvinsky, A., 736 Sariola, H., 192, 585, 586, 588
Riccio, P., 587 Ronshaugen, M., 799 Ryan, A. K., 365, 391 Sartorelli, V., 568
Rice, R., 795 Rook, G. A., 780 Ryan, J. F., 252, 253, 790 Sasai, N., 435
Richard-Parpaillon, L., 363 Ros, M. A., 631, 638, 640 Ryan, K. J., 76 Sasai, Y., 174, 356, 357, 523
Richardson, B. E., 203, 575 Rose, L. S., 269, 271 Ryner, L. C., 200 Saski, S., 537
Richardson, M. K., 795, 800 Rose, S., 456 Sassoon, D., 748, 749
Richter, J. D., 79 Roselló-Diez, A., 628, 629, S Sato, A., 486
Rickmann, M., 475 630 Saarma, M., 192, 505 Sato, K., 627
Riddiford, L. M., 679, 683, Rosenberg, E., 776, 803 Sabatier, C., 500 Sato, S. M., 358
685, 686 Rosenquist, G. C., 382, 385, Sabry, J. H., 490 Sato, T., 159, 160
Riddle, R. D., 122, 635, 636, 619 Sacchetti, B., 165, 608 Sato, Y., 542, 555, 566
642, 645 Rosenthal, N., 600, 731 Sacco, A., 725 Satoh, A., 713
Ridgway, J., 604 Rosenthal, E., 78 Sachs, L., 758 Satoh, N., 329
Riechert, K. B., 17 Roskelley, C. D., 107 Sachs, L. M., 676 Satou, Y., 330, 595
Riedl, R., 787 Ross, A. S. A., 587 Sackerson, C., 297 Satouh, Y., 245
Riehle, K .J., 718 Ross, D., 171 Sadler, K. C., 368 Sauer, F., 63
Rieppel, O., 17 Rossant, J., 167, 394, 395, 398, Sadler, T. W., 656 Sauer, F. C., 443, 447
Rifat, Y., 421, 425 399 Safranek, L., 684 Saunders, C. M., 247
Rinkevich, Y., 718 Rosselot, C., 587 Saga, Y., 205, 552, 556 Saunders, J. W., Jr., 113, 510,
Rinn, J. L., 531 Rossi, D., 65 Sagai, T., 636 625, 626, 627, 635, 645, 646
Riordan, J. R., 172 Rossi, D. J., 724 Saha, M., 520 Saunders, L. R., 322
Rios, A. C., 534, 570 Rossi, J., 209 Saha, M. S., 109 Sausedo, R. A., 418
Riparbelli, M. G., 280 Rostand, J., 334, 726 Sainio, K., 583, 588 Savin, T., 658, 660
Ris, H., 21 Roth, G. S., 727 Saint-Jeannet, J.-P., 468, 485 Sawada, H., 225
Risau, W., 602, 604 Roth, S., 286, 305, 306, 506 Saito, D., 477 Sawada, K., 34, 328, 329
Risbud, M. V., 564 Rothberg, J. M., 500 Saito, Y., 75 Sawyer, J. M., 322
Rishi, A. K., 759 Rother, F., 392 Saito-Diaz, K., 126, 127, 128 Saxén, L., 115, 346, 349, 355,
Ritsma, L., 160 Rothova, M., 655 Saitsu, H., 428 360, 363, 364, 583, 585, 586,
Ritvos, O., 129, 588 Röttinger, E., 323, 324 Saka, Y., 342 675, 677
Rivera-Pomar, R., 291, 293, Rouget C., 290 Sakai, Y., 401 Scaal, M., 541, 562
296 Rountree, D. B., 684 Scadden, D. T., 165, 609
AI–16 Author Index
Scaffidi, P., 165 Schroeder, K. E., 352 Shapiro, A. M., 806 Shulman, J. M., 128
Scarpa, E., 473, 483, 484 Schroeder, T. E., 222, 326 Shapiro, B. M., 231, 236 Shvartsman, S. Y., 40
Schaefer, A. W., 490 Schubiger, G., 682 Shapiro, I. M., 564 Shyamasundar, S., 425
Schaller, H. C., 700 Schuelke, M., 76, 77 Shapiro, M., 649 Shyer, A. E., 660
Schatten, G., 219, 229, 233, Schuh, M., 211 Shapiro, M. D., 788, 796 Siddiqui, M., 370
239, 246, 247, 248, 328 Schultheiss, T. M., 595 Sharir, A., 575 Sidman, R. L., 442, 450, 711,
Schedl, A., 190 Schultz, R. M., 392 Sharma, K., 494 712
Schejter, E. D., 281 Schulz, C., 293, 296 Sharma, U., 210, 246 Sieber-Blum, M., 477
Schepers, A. G., 758 Schüpbach, T., 286, 290, 303, Shatkin, A. J., 54 Siebert, S., 700
Scherthan H., 207 304 Shatz, C. J., 493 Siegel, A., 170
Scherz, P. J., 638, 639 Schürfeld, M., 339, 340, 341 Shaw, G., 77 Siegfried, E., 299
Schiebinger, L., 184 Schwank, G., 131 Shawlot, W., 584 Signer, E. N., 48
Schiedlmeier, B., 801 Schwartz, M., 246 Shearer, J., 235 Siiteri, P. K., 196
Schier, A. F., 116, 131, 371, Schwartz, P., 531, 532 Sheets, M. D., 18 Sikes, J. M., 705
374, 375 Schwarz, Q., 475 Shefelbine, S. J., 575 Silva, A. C., 362
Schierenberg, E., 272, 273 Schweickert, A., 365 Shefer, G., 578 Simandl, B. K., 678
Schierwater, B., 253 Schweisguth, F., 137 Sheiness, D., 54 Simeone, A., 402
Schiliro, D. M., 700 Schweitzer, R., 565 Shelton, C. A., 306 Simerly, C., 229, 247
Schlesinger, A. B., 388 Schweizer, G., 466 Shelton, E. L., 601 Simmonds, A. J., 299
Schlichting, C. D., 782 Schwind, J. L., 678, 787 Shemer, G., 273 Simmons, A. M., 674
Schlissel, M. S., 50 Scott, I. C., 595 Shen, J.-C., 724 Simmons, D. J., 574
Schlosser, G., 518, 519, 520, Scott, M. P., 123 Shen, S. S., 234, 235, 238 Simões-Costa, M. S., 468,
787 Scudellari, M., 731 Shen, W.-H., 191 469, 470, 593, 598
Schlosshauer, G., 502 Sculthorpe, N., 578 Shen, Y., 727 Simon, H. G., 707, 708, 709
Schlueter, J., 390 Seaberg, R. M., 146 Sheng, G., 381 Simons, B. D., 144, 160
Schmahl, J., 191 Sears, K. E., 25, 794, 795 Sherwood, D. R., 320 Simpson, J. H., 500
Schmalhausen, I. I., 764, 805 Sedkov, Y., 685, 686 Sherwood, R. I., 659 Simpson, M. J., 478
Schmerler, S., 212 Sefton, L., 199 Shestopalov, I. A., 608 Simpson, S., 764, 774
Schmich, J., 732, 733 Segraves, W. A., 686, 687 Sheth, R., 642, 643 Simpson-Brose, M., 293
Schmid, C. D., 87 Seidel, F., 406 Shevde, N., 148, 167 Sinclair, A. H., 182, 189
Schmidt, C., 468, 662 Seifert, M., 267 Shi, D. L., 349, 544 Sinervo, B., 17
Schmidt, T., 700 Seifert, R., 224 Shi, G., 148 Singer, M., 711, 712
Schmitt, A. M., 508 Sekido, R., 187, 189, 190, 191 Shi, W., 714, 715 Singh, A., 758
Schmitz, B., 372 Sekine, K., 452, 454, 625 Shi, Y., 130 Singh, B. N., 713
Schmitz Croxato, J., 422 Sekiya, S., 66 Shi, Y. B., 674, 676 Singh, N., 291
Schmucker, D., 74, 75 Seleiro, E. A. P., 389 Shiang, R., 121 Singh, N. P., 724
Schnabel, R., 269, 272, 273 Selman, C., 727 Shibata, D., 160 Singh, S. P., 714
Schneider, I, 618, 619 Sen, G. L., 81 Shibata, N., 704 Singh, V. K., 171
Schneider, R. A., 485, 796 Sen, J., 304, 507 Shibazaki, Y., 257 Sinha, M., 158
Schneider, S., 350, 351, 376 Sennett, R., 533 Shields, J., 166 Sironi, M., 76
Schneider, V. A., 595 Senyo, S. E., 718 Shih, C., 120 Siu, M. K. Y., 210
Schneider-Maunoury, S., 519 Seo, S., 605 Shimamura, K., 103 Sive, H., 415, 416
Schneuwly, S., 302 Sepich, D. S., 128 Shimizu, T., 370, 374 Sive, H. L., 364
Schnorrer, F., 289 Serafini, T., 498 Shimmi O., 688 Sizarov, A., 465
Schöckel, L., 207 Serbedzija, G. N., 482 Shimojo, H., 454 Skeath, J. B., 307
Schoenebeck, J. J., 18, 485 Serra, R., 562 Shimokita, E., 428 Skiba, F., 272
Schoenherr, C. J., 61 Serralbo, O., 570, 571 Shimomura, H., 225 Skinner, M. K., 753, 754, 803
Schoenwolf, G. C., 16, 21, Sessions, S., 619, 620, 621 Shindo, A., 341 Skirkanich, J., 343
341, 342, 382, 384, 385, 405, Sethi A. J., 319 Shine R., 806, 807 Skloot, R., 167
415, 418, 419, 427, 429, 584 Setlow, R. B., 724, 725 Skromne, I., 389–390
Shinya, M., 374
Schofield, R., 146, 161 Settleman, J., 758 Slack, J. M. W., 30, 294, 347,
Shinyoji, C., 220
Schöler, H. R., 394 Severson, A. F., 211 350, 358, 363
Shiotsugu, J., 364
Schonegg, S., 269 Seydoux, G., 139, 268, 271 Slaidina, M., 151, 152
Shitamukai, A., 457
Schones, D. E., 50 Shaham, S., 511 Slavkin, H. C., 115
Shitara, H. H., 246
Schönfelder, G., 750 Shainberg, A., 576 Sleepman, J. P., 107
Shook, B. A., 155
Schotté, O., 114 Shakya, R., 588 Sloan, T. F., 124
Shostak, S., 700
Schotté, O. E., 694 Shalaby, F., 604 Sluder, G., 238
Shpargel, K. B., 426
Schreiber, A. M., 674, 677 Shamblott, M. J., 167 Smale, S. T., 64
Shubin, N., 792
Schroeder, A. L., 202 Shannon, J. M., 667 Small, S., 297, 298, 433
Shubin, N. H., 617, 618, 619
Schroeder, E. H., 137 Smibert, C. A., 291
Author Index AI–17
Smith, A., 168, 483 Standfuss, M., 806 Strähle, S., 368, 371 Swiers, G., 607
Smith, C. A., 182, 188, 560 Stanfield, W. D., 805 Strahle, U., 368 Sword, G. A., 764
Smith, D. W., 741 Stanford, J. L., 780 Strässer, K., 77 Szalkowski, A. M., 87
Smith, G. D., 736 Stanganello, E., 135, 136 Strathmann, M. F., 777 Szamborska-Gbur, A., 685
Smith, H., 582 Stange, D. E., 660 Strathmann, R. R., 768, 777 Szczurkowska, J., 446
Smith, J. C., 115, 116, 342, 347 Stankunas, K., 714 Strausfeld, N. J., 793 Szebenyi, G., 633
Smith, J. L., 384, 392, 418, 419 Stanojevíc, D., 296, 298 Streicher, J., 615
Smith, K., 795 Stappenbeck, T. S., 780 Streissguth, A. P., 741 T
Smith, M. M., 466 Stark, A., 68 Streit, A., 518 Tabansky, I., 42
Smith, M. T., 746 Stark, K., 589 Streit , A., 385 Tabata, T., 688
Smith, S. J., 489 Stearns, S. C., 764 Streuli, C. H., 106 Taber, L. A., 597
Smith, T. T., 242 Stebbins-Boaz, B., 79 Stricker, A. G., 110 Tabin, C. J., 118, 120, 124, 390,
Smith, W. C., 336, 356 Steele, R., 696 Stricker, S. A., 236 565, 624, 626, 637, 647, 660
Smithers, L. E., 354 Steicher, J., 575 Strickland, S., 396 Tachibana, I., 245
Snell-Rood, E. C., 766, 782 Steidler, L., 780 Stringer, E. J., 659 Tacke, L., 358
Snippert, H. J., 159, 160, 534 Stein, D., 304 Strong, J. A., 184 Taelman, V. F., 131
So, P. L., 86 Stein, P. K., 727 Struhl, G., 137, 290, 291, 293, Tajbakhsh, S., 146
Sohal, R. S., 725 Steinbeisser, H., 356 296, 302 Takada, S., 544
Sokol, S. Y., 353, 356, 364 Steinberg, M. S., 98, 99, 100, Strumpf, D., 149, 394 Takahashi, K., 65, 171
Solis, G. P., 126 102 Strünker, T., 243 Takahashi, Y., 428, 543, 544,
Solnica-Krezel, L., 371, 375, Steingrímsson, E., 64 Studer, M., 744 551, 556, 568
409 Steinhardt, R. A., 232, 237, Sturtevant, M. H., 257 Takano, J., 700
Solter, D., 394 238 Su, Y. H., 121, 129, 690 Takasaki, H., 349
Solursh, M., 385 Steinmetz, P. R., 252 Suarez, S. S., 242 Takasato, M., 586
Somel, M., 796 Steit, A., 518, 519 Sucena, E., 787 Takata, H., 325
Sommer, L., 466 Steller, H., 509 Suetsugu, R., 584 Takayama, K., 81, 658
Son, E. Y., 66 Stephanson, E. C., 287 Sugi, Y., 595 Takayama, S., 659
Song, H., 153 Stephens, S., 238–239 Sugimura, R., 609 Takeichi, M., 58, 100, 101,
Song, X., 152 Stephenson, R. O., 148, 149 Sugiyama, T., 163, 700 102, 103, 451, 472
Song, Z., 757 Stern, C. D., 380, 382, 383, Sulik, K., 399, 400, 405 Takemoto, T., 428, 544
Sonnenschein, C., 755 386, 389, 390, 398, 407, 435 Sulik, K. K., 742, 743, 744 Takeo, S., 206
Soriano, P., 137, 476 Stern, D. L., 787 Sullivan, W., 279, 280 Takeuchi, J. K., 622, 623
Soroldoni, D., 557 Stern, H. M., 569 Sulston, J. E., 266, 267 Talbot, P., 240, 241
Sosci, D., 560 Sternberg, P. W., 138, 139 Summerbell, D., 627, 628, 635 Talbot, W. S., 374, 375
Soto, A. M., 755 Sternberg, R. M., 677 Summers, R. G., 227, 228, 231 Tam, P. P., 401, 548, 551, 593
Sowell, E. R., 460 Sternlicht, M. D., 534 Sun, F., 243 Tamkun, J. W., 106
Sparrow, D. B., 556, 557 Stevens, L. C., 754 Sun, H., 724 Tamm, E. R., 525, 526
Spear, P. C., 447 Stevens, N. M., 183 Sun, J., 609, 725 Tammela, T., 604, 605
Speksnijder, J. E., 328 Steward, R., 305, 306 Sun, M., 636 Tammiksaar, E., 219
Spemann, H., 3, 114, 345, 347, Stewart, S., 714 Sun, X., 399, 639, 640 Tan, C. C., 52
523 Stewart, T. A., 755 Sun, Z., 368 Tan, K. K., 168
Sperry, R. W., 505, 506 Stier H., 502 Sunadome, K., 576 Tanaka, E. M., 490, 703, 707,
Spiegel, A., 163 Stingl, J., 534 Sunderland, M. E., 701 708, 709
Spirov, A., 289 Stockholm D., 736 Suri, C., 604 Tanaka, H., 509
Spitz, F., 641 Stocum, D. L., 615, 628, 709, Susiarjo, M., 750 Tanaka, M., 614, 621, 625, 630
Spitzweck, B., 500 712, 713 Sutovsky, P., 219, 246 Tanaka, S., 395, 765
Spofford, W. R., 360 Stöhr, P., 534–535 Suzuki, A., 66 Tanaka, S. S., 185, 203
Spradling, A. C., 151, 152, 153 Stoick-Cooper, C. L., 715 Suzuki, K., 678 Taneyhill, L. A., 470
Spratt, N. T., Jr., 384, 388, 389, Stokoe, D., 120 Suzuki, T., 639 Tang, G. H., 575
407 Stolfi, A., 592 Suzuki, Y., 805, 806 Tang, H., 739
Spritz, R. A., 480 Stoller, J. Z., 487 Swalla, B., 33 Tang, J., 495
Srinivas, S., 586 Stolow, M. A., 674 Swammerdam, J., 672 Tang, X., 126
Srivastava, D., 600 Storey, B. T., 240 Swan, S., 752 Tao, Q., 341, 352
St.-Jacques, B., 574 Storey, K. B., 732 Swank, M. W., 728 Tapscott, S. J., 577
St. Johnston, D., 268, 304, 517 Storm, E. E., 647 Swann, K., 234, 247 Tarbashevich, K., 203
Stadtfeld, M., 171 Stotesbury, B., 577 Swanson, W. J., 228 Tarchini, B., 631, 640, 641
Stainier, D. Y., 598, 716 Stottmann, R. W., 419, 420 Sweatt, J. D., 729 Tarkowski, A. K., 392
Stalberg, H., 593 Stouder, C., 753 Sweet, H. C., 256, 320 Tassava, R. A., 712
Stancheva, I., 337 Stower, M. J., 382 Sweetman, D., 387 Tata, P. R., 660
Standart, N., 78 Strahl, B. D., 50 Tatar, M., 727, 732
AI–18 Author Index
Taub, R., 719 Tiberio, G., 736 Tucker, A. S., 363 van Horck, F. P., 502, 503
Taulli, R., 759 Tickle, C., 532, 620, 635, 645 Tucker, J. A., 374 van Oudenaarden, A., 736
Tautz, D., 291, 293, 296 Tilney, L. G., 226 Tufan, A. C., 647 Van Raamsdonk, J. M., 725
Tavazoie, M., 157 Timms, B., 750 Tulina, N., 150, 151 van Straaten, H. W. M., 419
Taverner, N. V., 343 Ting-Bereeth, S. A., 113 Tulpule, A., 170 Van Vector, D., 489, 490, 492
Tavian, M., 608 Tober, J., 606 Tulsiani, D. P., 241 van Wijk, B., 595
Tavormina, P. L., 648 Todd, T. J., 711 Tummers, M., 533 van Wolfswinkel, J. C., 704,
Tawfik, A. I., 765 Todt, W. L., 639 Tur-Kaspa, I., 243 705
Taylor, D., 112 Toivonen, S., 346, 355, 360, Turing, A., 800 Vanderberg, L. N., 404, 746
Taylor, G., 535 363, 583 Turing, A. M., 631 Vargas, A. O., 638
Taylor, J., 683 Tojima, T., 492 Turner, C., 672 Varki, A., 455, 459
Taylor, V., 155, 156 Tollrian, R., 768 Turner, D. L., 440, 527 Varmus, H., 125
te Welscher, P., 642 Tomás-Loba, A., 726 Turner, E., 773 Varner, V. D., 597
Technau, U., 697 Tomer, R., 39 Turner, F. R., 280, 282, 303 Varrela, J., 575
Tegner, M., 228 Tomoyasu, Y., 789 Turner, P. R., 234 Varshney, G. K., 366
Teillet, M.-A., 21, 465, 474, Toms, D. A., 26 Twitty, V. C., 349, 493, 787 Vaughn, D., 768
475 Tonegawa, A., 543, 544, 581 Tye, K. M., 428 Vaux, D. L., 511
Teixeira, L., 776 Tong, C. K., 157 Tyler-Smith, C., 792 Veeman, M., 33
ten Berge, D., 627 Tong, D., 777 Tylzanowski, P., 648 Vega, R. B., 574
Teng, L., 470 Töpfer-Petersen, E., 242 Tzahor, E., 595 Veltmaat, J. M., 533
Tennyson, A. L., 691 Topol, L., 128 Tzouanacou, E., 427, 549 Verderber, G., 779
Terasaki, M., 232, 236 Torlopp, A., 407 Verdonk, N. H., 262
Terzian, T., 80 Tosney, K., 16, 418, 440, 479, U Verheyden, J. M., 639, 640
Tessier-Lavigne, M., 125, 498, 494, 520, 548, 615 Uemura, M., 665 Vermeij, M. J., 774
502, 562, 572, 605 Toth, S., 248 Uhlenhaut, N. H., 189 Vervenne, H. B., 372
Tétreault, N., 522 Tower, J., 725 Ulrich, A. S., 228 Verzi, M. P., 598
Than-Trong, E., 153 Townes, P. L., 95, 97, 98, 99 Umesaki, Y., 779 Via, A. G., 164
Thanos, S., 503 Townley, I. K., 235 Umesono, Y., 705, 707 Vidal, V. P. I., 190
Tharp, A. P., 751 Toyofuku, T., 487 Underwood, E., 723 Vijg, J., 724
Thayer, S. P., 757 Traggiai, E., 164 Unsicker, K., 477 Vikkula, M., 604
Theiry, J. P., 107 Trainor, P., 482 Urbán, N., 153, 156 Vilela-Silva, A.-C., 225, 226
Theodosiou, A., 660 Tran, D., 197 Urness, L. D., 686 Villar-Cerviño, V., 473
Thérond, P. P., 122, 123, 124, Tran, H., 726 Ushijima, T., 729 Villeda, S. A., 730, 731
131 Tran, T. S., 500 Uzzell, T. M., 233 Villeneuve, A. M., 207
Thesleff, I., 517, 532, 533 Treisman, R., 77 Vinagre, T., 547
Theunissen, T. W., 168 Trelstad, R. L., 197 V Vincent, J.-P., 126, 335
Theurkauf, W., 280 Trelsted, R. L., 105 Vincent, S. D., 655
Vaahtokari, A., 532
Theveneau, E., 473, 474, 478, Tremblay, K. D., 660 Vinicius, L., 456
Vacquier, V. D., 223, 224, 225,
483, 484 Trentin, J. J., 610 Vintenberger, P., 334
226, 227, 228, 231
Thewissen, J. G., 649, 650 Trinkhaus, J. P., 370, 371, 372 Viotti, M., 653, 654
Vainio, S., 125, 188, 530, 533,
Thiery, J.-P., 343 Trocovic, N. R., 485 583 Visconti, P. E., 241, 242
Thigpen, A. E., 196 Troll, J. V., 778 Valcarcel, J., 200 Visel, A., 58, 59
Thisse, B., 375, 376 Trommosdorff, M., 452 Valenzuela, N., 751 Visnjic, D., 163
Thisse, C., 375, 376, 379 Trueb, L., 674 Valleix, S., 736 Vissing, J., 246
Thoenen, H., 511 Truman, J. W., 679 Valles, J. M., Jr., 336 Visvader, J. E., 534
Thoma, F., 50 Trumpp, A., 533 van Amerongen, R., 128 Vitriol, E. A., 489, 491
Thomas, A. J., 480 Truong, A. B., 529 van Beneden, P.-J., 205 Vogel, A., 625, 645
Thomas, H. E., 685 Tsai, C. C., 685 van Buskirk, C., 303 Vogel, K. S., 477
Thomas, J. D., 50 Tsai, J. H., 206, 207 Van Buskirk, J., 769 Vogel-Höpker, A., 110, 118
Thomas, L., 510 Tsai, R. J., 526 van den Biggelaar, J. A. M., Vogeli, K. M., 602
Thompson, H., 503, 509 Tsang, M., 374, 375 262, 265 Vogt, G., 736
Thompson, J. V., 23 Tsang, T. E., 584 van den Heuvel, M., 125 Vogt, W., 19, 20
Thomsen, G. H., 356, 608 Tseng, Y. H., 568 van der Heide, T., 776 Voiculescu, O., 382, 384, 386,
Thomson, J., 167, 168 Tsikolia, N., 391 Van der Jeught, M., 168 387, 390
Thomson, J. N., 269, 270, 272 Tsuchida, T., 804 van der Kooy, D., 146 Vokes, S. A., 638, 639
Thorogood, P., 26, 463 Tsujimura, K., 71 van der Ploeg, L. H. T., 70 vom Saal, F. S., 749, 750, 751
Thorpe, C. J., 271 Tsushida, T., 494 van der Weele, C., 763 von Baer, K. E., 16
Thrasivoulou, C., 128 Tu, M.-P., 732 van Eeden, F., 304, 543 von Both, I., 599
Thummel, C. S., 686 Tuan, R. S., 103, 164, 165, 560, van Genderen, R. M., 533 von Dassow, G., 256, 261, 313
Tian, H., 757 573, 647 von Goetz, N., 749
Author Index AI–19
von Kolliker, A., 218 Warkentin, K. M., 770, 771 Wharton, R. P., 290 Winberg, M. L., 505
von Wettstein, D., 207 Warmflash, A., 168, 169 Whitaker, M., 225, 234, 237, Windner, S. E., 543
Voronina, E., 235, 236 Warner, J. F., 690 238 Winklbauer, R., 339, 340, 341
Vorwald-Denholtz, P. P., 359 Warren, K. R., 742 White, B. H., 677 Winkler, M. M., 238
Vrba, E., 456 Wartiovaara, J., 355 White, J., 267, 268 Winslow, B. B., 567
Washburn. L. L., 193 White, J. A., 352 Winsor, M. P., 23
W Wassarman, P. M., 222, 244, White, P., 719 Winter, C. G., 128
Wacker, S. A., 364 245, 396 White, R. J., 376 Winter, R. M., 26, 735
Wada, N., 482 Wasserman, S. A., 306 Whiteley, A. M., 323 Wintour, E. M., 583
Waddington, C. H., 46, 109, Wassersug, R. J., 678 Whitlock, C. A., 610 Wisniewski, A. B., 196
385, 805 Watanabe, M., 607 Whitman, C. O., 368 Witte, F., 128
Wagenaar, E. B., 78 Watanabe, N., 246 Whittaker, J. R., 34, 329 Wold, B., 58
Wagers, A. J., 147, 164 Watanabe, T., 551, 552, 556 Wibbels, T., 202, 751 Wolf, L. V., 63
Wagner, D. E., 702 Watanabe, Y., 207 Wickens, M., 81 Wolf, N. S., 610
Wagner, E. F., 574 Watchmaker, G., 36, 321 Wieghofer, P., 443 Wolf, U., 738
Wagner, G., 756 Waterland, R. A., 767 Wiegreffe, C., 566 Wolff, K. F., 10
Wagner, G. P., 787, 790 Watkins-Chow, D. E., 80 Wieschaus, E., 88, 125, 281, Wolffe, A. P., 676
Wagner, R., 208 Watt, F., 72 290, 293, 294, 776 Wolfner, M. F., 279
Wahi, K., 555 Watt, F. M., 144 Wiewandt, T., 774 Wolpert, L., 14, 314, 389, 576,
Wakai, T., 248 Watters, C., 340, 341 Wightman, B., 80 626, 647, 648, 700
Wakamatsu, Y., 477 Weatherbee, S. D., 25, 794 Wikramanayake, A. H., 318, Wolstenholme, J. T., 754
Wake, D. B., 800 Weaver, C., 351, 352 319 Woltereck, R., 764
Wakimoto, B. T., 279, 302 Weaver, I. C., 70 Wilby, O. K., 697, 699–700 Woltering, J. M., 618
Waldman, M., 170 Weaver, V. M., 755 Wilcox, A. J., 241 Wong, J. L., 230, 231, 232, 236
Waldo, K., 465, 487 Webb, E., 753 Wild, C. P., 746 Wong, J. M., 676
Walentek, P., 365 Webster, G., 697, 699–700 Wilde, J. J., 425, 426 Wontakal, S. N., 610
Walker, D. M., 753 Webster, M. K., 121, 648 Wilhelm, D., 191, 193 Woo, J., 666, 667
Walker, J. L., 106 Wehner, D., 714, 715 Wilkie, A. O. M., 481 Woo, K., 20
Walkley, C. R., 164 Weidinger, G., 714, 715 Wilkie, G. S., 299 Wood, A. J., 64
Wallace, C., 758 Weijer, C. J., 385 Wilkins, J. F., 210 Wood, C. D., 224, 225
Wallace, E., 198 Weinberg, E., 20 Wilkinson, D. G., 403, 476 Wood, W. B., 269
Wallace, K. N., 659 Weinberg, R. A., 107, 120, 754 Wilkinson, H. A., 139 Woods, G. L., 48
Wallace, V. A., 445 Weiner, J., 796 Willardsen, M., 120 Woods, M. L., 474, 500
Wallberg, A., 137 Weintraub, H., 50, 70 Willerton, L., 191 Woodward, D. E., 771
Wallingford, J. B., 341, 342 Weismann, A., 24, 35, 724 Williams, C. M., 680, 684 Wozniak, J. R., 741, 742
Walsh, C., 449 Weismann, T. A., 42, 43 Williams, H. L., 243 Wray, G., 690
Walston, T., 271 Weiss, A. C., 590 Williams, M. E., 16 Wray, G. A., 315
Walt, D. R., 238 Weiss, L. C., 768 Williams, S. C., 58, 59 Wright, E., 573
Walter, J., 72, 507 Weiszmann, R., 48 Williams, S. E., 504, 528 Wright, G. J., 245
Walther, V., 160 Weitzel, H. E., 316 Willier, B. H., 21 Wright, S., 736
Wang, C., 290 Wellik, D. M., 404, 545, 616, Willis, A., 348 Wu, D. D., 798
Wang, D., 534 617 Wilm, B., 543, 582 Wu, G., 394
Wang, D.-Z., 600 Welsh, J. H., 264 Wilmut, I., 48, 49, 50 Wu, K. C., 575
Wang, E. T., 73 Welstead, G. G., 426 Wilsch-Brauninger, M., 454 Wu, L. H., 290
Wang, H., 798 Wendt, K., 64 Wilson, A., 163 Wu, P., 533, 797
Wang, H. U., 476, 496 Werner, M. H., 189 Wilson, A. C., 459, 460, 793 Wu, S. M., 170, 599
Wang, J., 148 Werth, M., 425 Wilson, A. J., 724 Wu, S. Y., 323
Wang, L., 495, 537 Wessel, G. M., 212, 220, 230, Wilson, E. B., 11, 32, 38, 45, Wu, W., 74, 75
Wang, P. J., 207 231, 233, 235, 236, 315, 690 183, 205, 255, 786 Wurtzel, O., 701, 706
Wang, S., 133, 138, 363 Wessells, N. K., 626, 666, 667 Wilson, J. D., 196
Wang, T., 509 Wessely, O., 356 Wilson, M., 506 X
Wang, X., 152, 450, 454, 457, West-Eberhard, M. J., 764, Wilson, M. J., 292 Xavier-Neto, J., 598, 600
738 795, 806, 807 Wilson, P. A., 341, 355 Xie, T., 152
Wang, Y., 166, 243, 502, 562 Westerfield, M., 493 Wilson, P. M., 605 Xie, Y., 454
Wang R., 758 Westfall, T. A., 128 Wilson, R. C., 81, 82 Xiong, F., 435
Ward, G. E., 224 Weston, J., 466, 474, 477, 479, Wilson, S. I., 415 Xu, C., 661
Ward, K. A., 575 518 Wilson, T., 77 Xu, J., 779, 783
Warga, R., 101 Wetherill, Y. B., 750 Wilson, V., 386, 428 Xu, J. S., 395
Warga, R. M., 369, 370 Whalen, A. M., 306 Wilson, W. L., 242 Xu, P. F., 375
Wharton, K., 688 Wilson, Y. M., 480
AI–20 Author Index
Xu, T., 140 Yaoita, M., 111 Yu, S. R., 132, 133 Zhao, D., 213
Xu, X. L., 625 Yaoita, Y., 673, 676 Yu, X., 390 Zhao, G.-Q., 209
Xue, Y., 792 Yaron, O., 502 Yue, R., 607 Zhao, K., 50
Yashiro, K., 607 Yung, A., 512 Zhao, L., 194
Y Yasuda, K., 110 Yusufzai, T. M., 64 Zhao, T., 303
Yabe, T., 544 Yasumoto, K.-I., 63 Yutey, K. E., 601 Zhao, X., 630
Yaffe, D., 576 Yatsui, R., 202 Zheng, J. Q., 489, 491
Yagami-Hiromasa, T., 576 Yauch, R. L., 757 Z Zhong, T. P., 367
Yagi, K., 329 Ybot-Gonzalez, P., 419 Zachariah, M. A., 487 Zhong, Z., 714
Yajima, M., 315, 690 Yeh, J. R., 366 Zaffran, S., 598 Zhou, B., 306
Yam, P. T., 124, 498, 499, 502 Yeo, C.-Y., 118 Zákány, J., 558, 640 Zhou, P., 450
Yamada, K. M., 489, 492, 552 Yeom, Y. I., 149 Zaleske, D. J., 645 Zhou, Q., 65, 664, 736
Yamaguchi, T., 545 Yilmaz, Ö. H., 728 Zallen, J. A., 268 Zhou, V. W., 68, 69
Yamakawa, K., 75 Yin, K. J, 611 Zamora, S., 690 Zhou, X., 686
Yamamoto, M., 400 Yin, M., 574, 647 Zangerl, R., 16 Zhou, Y., 663, 664
Yamamoto, Y., 522, 796 Yin, V. P., 711 Zardus, J. D., 773 Zhu, H., 170
Yamanaka, S., 65, 171 Yin, X., 503 Zaret, K. S., 64, 659, 660, 661, Zhu, J., 633, 634, 638
Yamanaka,Y., 398 Yoda, A., 247 663, 668 Zhu, M., 170
Yamashita, S., 565 Yokota, N., 225 Zebisch, M., 126 Zigler, K., 33
Yamashita, Y. M., 150 Yokouchi, Y., 642, 646, 659 Zecca, M., 689 Zimmerman, L. B., 355, 356
Yan, D., 131, 153 Yonei-Tamura, S., 625 Zeeman, E. C., 552 Zimyanin, V. L., 286
Yanagimachi, R., 223, 243, Yoon, S. Y., 247 Zeitlinger, J., 68 Zinzen, R. P., 61
244, 245, 247 Yoshiba, S., 406 Zeller, R., 643 Zipursky, S. L., 75, 505
Yang, E. V., 118 Yoshida, H., 511 Zeng, F., 392 Zivkovic, A. M., 777
Yang, F., 207 Yoshida, M. K., 224 Zernicka-Goetz, M. V., 391, Zoghbi, H. Y., 71
Yang, J., 337, 529 Yoshida, S., 208 398 Zolna, M. R., 744
Yang, J.-J. W., 520 Yoshida, T., 485 Zhang, C. L., 533 Zon, L. I., 602, 608
Yang, L., 500, 624 Yoshihara, H., 163 Zhang, H., 599 Zou, H., 646
Yang, S. Y., 578 Yoshitomi, H., 663 Zhang, J., 163, 343, 726 Zuber, M. E., 521
Yang, X., 385, 387 Yoshizato, K., 678 Zhang, N., 556 Zuccato, C., 513
Yang, X. J., 502 Yost, C., 350 Zhang, R., 716, 717 Zuckerkandl, E., 792
Yang, X.-J., 527 Youdim, M. B., 513 Zhang, W., 661 Zuñiga, A., 618, 619, 630, 639,
Yang, Y., 62, 636, 637 Young, H. M., 478, 479 Zhang, X., 60, 132, 133, 363 643
Yang, Y. Z., 645 Young, R. A., 167, 394 Zhang, X. M., 502 Zuzarte-Luis, V., 645
Yao, E., 123, 124 Young, T., 559 Zhang, Y., 478 Zwilling, E., 627
Yao, H. H., 188 Yu, J., 171 Zhang, Y. T., 632, 633 Zygar, C. A., 109
Yao, J., 356 Yu, J. K., 793 Zhang, Z., 639
Yao, T.-P., 685 Yu, K., 220 Zhao, C., 757
Subject Index
Italic type indicates the information will motor neuron growth cone navigation, other stem cells supporting tissue
be found in an illustration. 495 maintenance and regeneration,
α-Actinin, 106 165–166
The designation “n” indicates the Actinopterygians, 643 pluripotent, in flatworm regeneration,
information will be found in a footnote. Actinotrachia, 715 701–705
Active transport, of mRNA, 83, 84 Aequorin, 232
A Active zone, 633 AER. See Apical ectodermal ridge
A cells, 154, 155, 156 Activin Afferent neurons, 476n6
A23187, 232, 576 activin A and organoid derivation, 175 Agalychnis callidryas (red-eyed tree frog),
AATAA sequence, 54 avian axis specification, 390, 391 770–771
Abaxial muscles, 567 BMP/TGF-β/activin signaling and Aggrecan, 573
Abdominal A and B genes, 302 cancer, 756–757 Aging
Abdominal vertebrae, 403 dorsal-ventral patterning of the central cellular senescence and, 731
Aberrant RNA splicing, 76 nervous system, 431, 432 defined, 723
Abiotic environment, effects on functions, 129 exceptions to the aging rule, 731–733
development, 763 induced differentiation of embryonic future research areas, 733
Abnormal development stem cells, 169 genes and, 723–728
cancer, 754–759 limb chondrogenesis, 633 ooctyes and, 212
endocrine disruptors, 746–753 SMAD pathway, 130 random epigenetic drift, 729–730
future research, 760 specification of intermediate stem cells and, 730–731
genetic errors of human development, mesoderm, 584–585 Agouti gene, 767
736–738 specification of mesodermal cell types Air sac primordium (ASP), 135, 136
major pathways to, 735–736 in Xenopus laevis, 116, 117 Air sacs, 666
role of chance, 736 specification of sea urchin vegetal Albumin, 381
teratogenesis, 738–745 cells, 319–320 Alcohol, as a teratogen, 739, 741–744
transgenerational inheritance, Activity-dependent survival, of neurons, Algae symbionts, 777, 778–779
753–754 511, 512 Allantois, 379, 380
Accutane, 739, 744 Acute promyelocytic leukemia (APL), Alligator mississippiensis (American
Acetylcholine-secreting neurons, 477 758–759 alligator), 202
O-Acetyltransferase, 125 Acyrthosiphon pisum (pea aphid), 804 Alligator snapping turtle (Macroclemys
Achondroplasia, 121, 648 S-Adenosylmethionine, 426 temminckii), 202
Acila castrenis, 256 Adenylate kinase, 241 Allometry, 796
Acinar cells, 664 Adepithelial cells, 682 Alternative nRNA splicing, 73–75
Acron, 293 Adhesion molecules. See Cell adhesion Alternative splicing factor, 73
Acrosomal process, 219, 226, 227, 228, molecules Alveoli, 666
229 ADMP, 355 Alx-4 gene, 643n5
Acrosomal vesicle, 210, 218, 219, 225, 227 Adolescent brains, 460–461 Alx1 gene, 318, 319, 323
Acrosome, 210, 219 Adrenergic neurons, 477 Alzheimer’s disease, 729
Acrosome reaction Adult stem cell niches Ambystoma jeffersonianum (Jefferson
internal fertilization in mammals, fueling germ cell development in salamander), 233n3
243–244, 245 Drosophila, 150–153 Ambystoma maculatum (spotted
sea urchin fertilization, 225–226, 227 hematopoietic stem cell niche, 161–164 salamander), 616, 620, 709, 779
Actin humans, overview, 151 Ambystoma mexicanum, 16
cadherins and, 100, 101, 104 intestinal stem cell niche, 158–161 Ambystoma platineum (silver salamander),
fusion of egg and sperm cell introduction, 149 233n3
membranes in external fertilization, neural stem cell, 153–158 American alligator (Alligator
228 Adult stem cells mississippiensis), 202
regulation of polymerization in germ stem cells in Drosophila, 150–153 American Chemical Council, 751
growth cone movement, 491–493 hematopoietic stem cells, 161–164 American oyster (Crassostrea virginica),
Actin microfilaments intestinal stem cells, 158–161 773n4
acrosome reaction, 226, 227 mesenchymal stem cells, 164–165, 166 American Paint horses, 480
axon growth cones, 490, 491 multipotency, 146 Ametabolous development, 679
egg cytoplasm, 222 neural stem cells of the ventricular- AMH. See Anti-Müllerian hormone
formation of cellular blastoderrm and, subventricular zone, 153–158 Aminoglycosides, 739
280–281 Aminopterin, 739
growth cone microspikes, 489 Ammonetlism, 675
SI–2 Subject Index
Amnion, 379, 380, 398, 406, 407 formation and functions, 333, 349– Anterior-posterior (AP) axis, 14
Amnioserosa, 282, 283 353, 355 amphibian embryo, 344, 359–364
Amniotes induction of neural ectoderm and avian embryo, 389–390
early development, 379–380 dorsal mesoderm, 355–359 C. elegans, 268–269, 272
egg, 379, 380, 381 international studies, 349 Cartesian coordinate model, 306–307
extraembryonic membranes, 379, 380 primary embryonic induction, central nervous system patterning,
model organisms, 380 347–348 428–430
primary neurulation, 416–427 questions raised by Spemann and defined, 14
Amniotic endoderm, 397 Mangold, 348–349 Drosophila, 284–293
Amniotic fluid, 398 specification of neural induction along insect wing development, 688–689
Amphibian axis specification the anterior-posterior axis, 359–364 mammalian embryo, 400–404, 410
anterior-posterior axis, 344, 359–364 Amphibians, 334 paraxial mesoderm, 544–545
dorsal-ventral axis, 334, 335, 344 atrazine and endocrine disruption, specification in somites, 545–548
left-right axis, 364–365 751–752 tetrapod limb development, 613, 614,
molecular mechanisms, 348–359 effect of atrazine on algal symbionts, 635–644
progressive determination, 343–344 778–779 zebrafish embryo, 376
Amphibian development interspecific induction, 114 Anterior visceral endoderm (AVE),
autonomous specification vs. inductive predator-induced polyphenisms, 400–401
interactions, 344–347 769–771 Anthropogenic noise, effect on larval
cortical rotation, primary neurulation, 415 settlement in coral reefs, 774
fertilization, cortical rotation, and vibrational cues and altered Anti-angiogenesis, 605
cleavage, 334–337 developmental timing, 770–771 Anti-Müllerian hormone (AMH), 183
gastrulation, 335, 337–343 See also Frog development; androgen insensitivity syndrome, 195
left-right axis specification, 364–365 Salamanders; Xenopus laevis secondary sex determination, 183, 184,
mid-blastula transition, 337 Amphioxus, 254, 415 194, 197
molecular mechanisms of axis Ampulla, 240, 391, 392 Antiandrogenic compounds, 752
formation, 348–359 Amyotrophic lateral sclerosis (ALS), Antiestrogenic compounds, 752
overview, 333 173–174 Antisense RNA, 80
primary embryonic induction, Anagen, 534, 535 Antithyroid agents, 739
347–348 Analogous structures, 24 Ants, 764–765, 766
progressive determination of the axes, Anamniotic vertebrates, 333, 334 Anuran metamorphosis, 672–679. See
343–344 Anaphase, meiosis, 206, 207 also Amphibian metamorphosis
regional specificity of neural Anchor cell, 138–139 Anus
induction, 359–364 “AND” function, 61 cloacal membrane and, 658
study of, 333–334 Androgen insensitivity syndrome, deuterostomes, 254
unequal radial holoblastic cleavage, 195–196 diploblasts, 252
335–336 Androgens, 194. See also Testosterone protostomes, 253
vital dye staining of embryos, 20 Anemia, 76, 737 snail gastrulation, 265
work of Hans Spemann and Hilde Anencephaly, 422, 425 Aorta, 483, 487
Mangold, 344–348 Aneuploidies, 737–738 Aorta-gonad-mesonephros (AGM)
See also Frog development; Aneuploidy, 212 region, 161, 606
Salamanders; Xenopus laevis Angelfish, 801 Aortic arches, 487
Amphibian egg Angiogenesis, 581, 601, 602, 604–605 Aortic hematopoiesis, 606, 608
cortical rotation, 334–335, 351 Angiogenin-4, 779 APC protein, 127, 490, 491
fertilization, 334, 335 Angiomotin, 140 Apical constriction, 419
horizontal transmission of symbionts, Angiopoietins, 162, 604, 662 Apical ectodermal fold (AEF), 618
776–777 Anhidrotic ectodermal dysplasia, 533 Apical ectodermal ridge (AER)
stored oocyte mRNAs and selective Animal cap defined, 616
inhibition of translation, 79 amphibian embryo, 336, 342, 344 induction, 627
Amphibian gastrulation sea urchin embryo, 315 limb bud formation, 625
epiboly of the prospective ectoderm, Animal pole, 11, 366 limb patterning, 630, 631, 633, 634,
342–343 Aniridia, 110, 111 635
gray crescent and initiation of, Annulus fibrosus, 564–565 proximal-distal limb axis, 625–627
345–346 Anoikis, 106, 159 roles of, 625–626
study of, 337 Anorectal junction, 655 shut down by BMPs, 645
vegetal rotation and invagination of Antennapedia complex, 301, 302 Shh/FGF positive feedback loop,
bottle cells, 337–342 Antennapedia protein, 682, 791 639–640
Amphibian metamorphosis Anterior axis, 14 tetrapod limb evolution, 618, 619
hormonal control, 675–677 Anterior gradient protein, salamander whale evolution, 650
morphological changes, 673–675 limb regeneration, 711–713 Apical epidermal cap, 708–710, 711
overview, 672 Anterior intestinal portal (AIP), 655, 656 Apical zone, 633
regionally specific developmental Anterior necrotic zone, 646 Apicobasal axis, 149
programs, 678–679 Anterior neuropore, 421, 422 Apis mellifera (honeybee), 764–765, 766,
variations, 677 Anterior organizing center, Drosophila, 767
Amphibian “organizer” 286, 292–293 Apodemus sylvaticus (wood mouse), 240
Subject Index SI–3
autopod sculpting, 646 formation of the epidermis, 528 heart development, 595
dorsal-ventral axis specification in functions, 129 mammalian gastrulation, 399
zebrafish, 374 gut tissue specification, 658, 659 mesoderm specification, 654–655
hair cycling, 535 hair cycling, 535, 536 specification of amphibian germ
heart development, 595 heart development, 595, 596 layers, 343
hematopoietic stem cell formation, 608 hematopoietic stem cell formation, specification of myoplasm in tunicates,
joint formation, 646 607–608 329
salamander limb regeneration, 712 inhibition of the medial hinge point of specification of notochord, 329n7
BMP4 the neural plate, 419–421 specification of presomitic mesoderm,
amphibian development, 355–356, 358 inhibitors (see BMP inhibitors) 543
anterior-posterior axis formation in kidney development, 587–588 Brain
mammals, 400, 401 liver formation, 661, 662, 664 adult neural stem cell niche, 151,
autopod sculpting, 646, 650 mediation of endoderm progenitor 153–158
avian axis specification, 390, 391 fates, 654, 655 amphibian metamorphosis, 677
coordination of facial and brain metamorphosis of the pluteus larva, cerebral organoid, 173–176, 177, 178
growth, 486 690 chromatin modification and aging,
development of ectodermal myotome determination, 569–570 728
appendages, 533 nervous system development, 414 fetal, effects of alcohol on, 741–744
dorsal-ventral patterning of the central neural crest delamination and stored mRNA in neurons, 84
nervous system, 431, 432 migration, 471, 472 See also Brain development
Drosophila homologue, 129 (see also regulation of Drosophila ovarian stem Brain-derived neurotrophic factor
Decapentaplegic) cells, 152–153 (BDNF)
functions, 129 regulation of the adult neural stem cell axon target selection, 505
gut tissue differentiation, 660 niche, 154, 156 differential survival of neurons after
hair cycling, 535 salamander limb regeneration, 712, innervation, 512, 513
hematopoietic stem cell formation, 713 gut bacteria and, 781
607, 608 sclerotome development, 562 neural restrictive silencer element, 61
heterometry in Darwin’s finches, secretion the external granular layer of neuron migration in the cerebellum,
796–798 the cerebellum, 445 450
induced differentiation of embryonic SMAD pathway, 130 Brain development
stem cells, 168, 169 small toolkit, 789 central nervous system cells, 440–443
insertion of the ureter, 590 specification of mesoderm derivatives, central nervous system tissues,
lens differentiation, 526 581–582 443–447
organoid derivation, 175 specification of neural crest cells, 468, coordination with facial skeleton
regulation of the adult intestinal stem 469, 519 development, 485–486
cell niche, 159, 161 specification of the paraxial formation of axes, 428–435, 436
sclerotome development, 562 mesoderm, 543 horizontal and vertical specification of
tooth development, 530 tetrapod limb development the cerebrum, 454
trigeminal ganglion neurons and, 505 autopod sculpting, 646, 649, 650 humans, 455–461
vertebrate eye development, 110, 523, dorsal-ventral axis generation, 645 introduction, 413–414, 415, 439
524 joint formation, 646 mammalian gut bacteria and, 781
BMP6, 535, 536 limb chondrogenesis, 633 mechanisms regulating brain growth,
BMP7 specification of digit identity, 447–455
amphibian development, 355, 359 638–639 neuronal versus glial differentiation,
autopod sculpting, 646 Turing model, 643–644 454
dorsal-ventral patterning of the central turtle shell development, 794, 795 See also Neurulation
nervous system, 431, 432 vasculogenesis, 602 Brain lipid binding protein (BLBP), 154
functions, 129 whale evolution, 650 Brain sex, 197, 201
joint formation, 646, 647 Bonobos, 455 Brainbow, 29, 41–42, 42
kidney development, 587–588 Bottle cells, 338–339, 340, 341 Branchial arches, see Pharyngeal arches
tooth development, 532 “Bottom-up” specification, 343–344 Branchless protein, 114, 118
BMP8, 209 Boveri, Theodor, 229, 266 Braveheart noncoding RNA, 611
BMP9, 712 Bowman’s capsule cells, 585 Breast cancer
BMP10, 595 BPA. See Bisphenol A bisphenol A and susceptibility,
BMP11 (See Growth differentiation factor Brachypodia, 647 750–751
11) Brachypterygius, 634 defects in paracrine signaling, 757
BMP/TGF-β/activin signaling and Brachyury protein stroma regulation of epithelial tumors,
cancer, 756–757 amphibian gastrulation, 340 756, 757
development of ectodermal anterior-posterior axis specification in Brenner, Sydney, 510
appendages, 533 mammals, 400 Bricabrac gene, 200, 201
dorsal-ventral axis specification in anterior-posterior patterning in Bridges, Calvin, 277
zebrafish, 374, 375 mammals, 410 Brine shrimp, 799
ectodermal bias, 358–359 conditional specification of the Brinker gene, 689
endochondral ossification, 572–573 notochord in tunicates, 330, 331 Broad complex proteins, 686–687
facial development, 485 expression in Hydra, 698 Bromine, 739
SI–6 Subject Index
Bronchi, 666, 667 regulation of germ stem cells, 153 limb bud formation, 625
Brooks, William Keith, 29, 773n4 UNC-6 protein, 499 regeneration in Hydra, 699
Brother of Cdo (Boc), 498, 501, 504 vulva induction, 138–139 zebrafish fin regeneration, 715
Brown adipose cells, 568 Cajal-Retzius cells, 451–454, 459, 473 Cap cells, 151–152
Brugia malayi, 778 Calcium-activated luminescent dyes, 232 Cap sequence, 53–54
Buchnera aphidicola, 804 Calcium channels Capacitation, 220, 241–242
Buckeye butterfly (Precis coenia), 806 acrosome reaction, 226 Carassius, 769
Budding, in Hydra, 696 CatSper channels, 224, 240, 242, 243 Carbayl, 770
Bulge region, hair follicle, 534–535, 536 sperm attraction, 224, 225 Cardia bifida, 597, 598
Burge, Christopher, 75 sperm hyperactivation, 243 Cardiac neural crest, 465, 486–487
Butterflies Calcium ionophores, 232 Cardiac progenitor cells
genetic assimilation, 805, 806 Calcium ions heart field formation, 593–595
seasonal pigmentation, 772–773 acrosome reaction, 226 migration, 593, 596–598
Buttonhead gene, 293, 295 cortical granule reaction, 231–233 tunicate heart development, 592–593
egg activation Cardiogenic mesoderm specification,
C early and late responses, 236–238 593, 595, 596
C cells, 154, 155 overview, 233–234 See also Heart fields
CACGTG sequence, 63 release of intracellular stores, 234– Cardiomyocytes, 594, 715–717
Cactus finches, 796–798 235, 236 Carollia perspicillata (fruit bat), 809
Cactus protein, 304, 305–306 myoblast fusion, 576 Carotid body, 487
Cadherins regulation of convergent extension in Carp, 769
amphibian cleavage, 336 amphibian gastrulation, 342 Carpals, 614
catenins and the anchoring of, 100, sperm attraction, 224–225 Carson, Rachael, 738
101 sperm capacitation, 241, 242 Cartesian coordinate model, 306–307
cell adhesion, 100–104 Wnt/calcium pathway, 128 Cartilage
defined, 100 zebrafish cleavage, 368 chondrogenesis in the limb, reaction-
differential interfacial tension Calcium transporters, myoblast fusion, diffusion model, 633–635
hypothesis, 104 576 endochondral ossification, 572–574
downregulation during the sea Calcium-triggered calcium-release epiphyseal plates, 647–648
urchin epithelial-to-mesenchymal receptors, 235 JAK-STAT pathway signaling and
transition, 323 Calmodulin, 797–798 development, 121
epithelial-mesenchymal transition, Calmodulin-activated protein kinase, joint formation in the tetrapod limb,
107, 108 248 646–647
functions, 100 Calorie restriction, and aging, 727 N-cadherin and, 103
growth of retinal ganglion axons, 502 Camptomelic dysplasia, 573 Cas9, 88–90
implantation, 396 Cancer Casein, 77, 107
insect tracheal system development, bisphenol A and breast cancer, Caspase-9, 674
114–115 750–751 Cassette exons, 74
neural crest delamination and of blood, 164 Caste determination, in ants, 766
migration, 472 cancer stem cell hypothesis, 757–758 Catagen, 534, 538
types, 101–102 colon cancer, 757 β-Catenin
B-cadherin, 103 context-dependent tumors, 755, 756 amphibian development
C-cadherin, 104 defects in cell-cell communication, activation of Chordin by, 356
cadherin 6B, 472 755–756, 757 anterior-posterior axis specification,
EP-cadherin, 336 developmental therapies, 758–759 344
P-cadherin, 101, 102, 396 disease of development, 754–759 dorsal-ventral axis specification, 344
R-cadherin, 101, 103, 502 Hox gene pleiotropy, 801, 802 formation of the “organizer,” 333,
See also E-cadherin; N-cadherin liver cancer, 757 349–353, 354
Caenorhabditis elegans metastasis and epithelial- autonomous specification of endoderm
antisense RNA, 80 mesenchymal transition, 107 in tunicates, 330, 331
cleavage and axis formation, 267, origins, 735 chromosomal sex determination, 181
268–272 prostate cancer, 757, 758 development of the snail D
cytosine methylation, 70 RAS gene mutations, 120 blastomere, 262–263
fertilization, 267 skin cancer and Sonic hedgehog, 125 dorsal-ventral axis specification in
future research areas, 274 stem cell hypothesis, 757–758 zebrafish, 375
gastrulation, 272–273 See also Breast cancer endosome internalization, 131
genome, 266–267 Canonical Wnt/β-catenin pathway establishment of polarity during
heterochronic genes and control of description, 126–128 flatworm regeneration, 705
larval stages, 273 endosome internalization, 131 formation of ectodermal appendages,
insulin signaling cascade and aging, establishment of polarity during 533
726, 727 flatworm regeneration, 705–707 lung development, 667
invariant cell lineage, 266 formation of ectodermal appendages, ovarian development in mammals,
model organism, 251, 265–267 533 188
overview of development in, 266 induction of the hypostome in Hydra, primary sex determination in
programmed cell death, 509, 510–511 698–699 mammals, 187
Subject Index SI–7
binding of 20-hydroxyecdysone to, mammalian intestine, 779–782 tools for characterizing gene
685–687 mechanisms, 776–777 expression, 85–88
central dogma, 46–47 obligate developmental mutualism, translational gene regulation, 76–84
chromatin immunoprecipitation- 778–779 Differential gene transcription, 68–72
sequencing, 58, 86–87 parasitism, 776 Differential interfacial tension
DNA silencing, 72 Dextral coiling, 256–258 hypothesis, 104
fusion of genetic material in sea DHLPs. See Dorsolateral hinge points Differential RNA processing, 73–76
urchins, 238–239 DHR3 protein, 686, 687 Differential RNA splicing
repair enzymes and aging, 724–726 DHR4 protein, 686, 687 Drosophila sex-determining genes, 201
synthesis, in calcium-mediated egg DHT. See Dihydrotestosterone sex-specific expression of Sexl-lethal,
activation, 237, 238 Diabetes 200
Dermal fibroblasts, 528, 529 pancreatic β cells, 664–665 Differentiating proximal blastema, 716
Dermatome, 541, 542, 567 as a teratogen, 739 Differentiation (cell differentiation)
Dermis Diacylglycerol (DAG), 234, 235, 236 defined, 2, 30, 31
dermatome and origins, 567, 568 Diakinesis, 207 differential cell affinity, 97–100
ectodermal appendages, 529 Diap2 gene, 686, 687 muscle cell differentiation in tunicates,
mammalian skin, 528 Diazepam-binding inhibitor protein, 157 329
Dermomyotome Dicer, 81 individual cell identity, 42
derivatives, 542 Dickkopf (Dkk) protein genomic equivalence, 45
development, 561, 566–572 antagonist of Wnt proteins, 126 questions in developmental biology, 2
formation, 542 anterior-posterior axis specification in See also Differential gene expression;
motor neuron navigation, 494–495 mammals, 400 Differentiation
satellite cells, 577 cornea differentiation, 526 Differentiation therapy, 758–759
traditional and current views of, 543 corneal stem cells, 526 Diffusion
DES. See Diethylstilbestrol dorsal-ventral axis specification in paracrine factors, 131–132, 133
Descent of Man, The (Darwin), 23–24 zebrafish, 375 secretion-diffusion-clearance model,
Descent with modification, 786 head induction in amphibian 132, 133
Descriptive embryology development, 362–363 See also Reaction-diffusion model
direct observation of living embryos, heart development, 595, 596 Digestive tube development
19 secondary sex determination in colonization by trunk neural crest
fate maps, 18, 19 mammals, 194, 195 cells, 477–478, 479
Desert hedgehog protein, 121 Dictyate resting stage, 211 development of liver, pancreas, and
Determination Dictyostelium, 772 gallbladder, 660–665
definition and description, 31–32 Diencephalon, 428, 429 epithelial-mesenchymal interactions,
sea urchin blastomeres, 314–315, 316 Diet 113
sex determination (see Sex diet-induced DNA methylation, 803 overview, 653, 655, 656, 657–658
determination) diet-induced polyphenisms, 764–768, regulation by gut microbiome,
in the syncytial blastoderm, 38–41 775 779–780
Determination front, 552, 553, 554, 557 Diethylstilbestrol (DES) signals mediating, 654, 655
See also Clock-wavefront model as an endocrine disruptor, 746, tissue specification, 658–660
Deuterostomes 747–749 Digits, 614
deep homology in nervous system epigenetic transmission of birds and dinosaurs, 649
development, 793 developmental disorders, 753 cell death and formation of, 645–646
description, 253, 254 as a teratogen, 739 dorsal-ventral axis, 644–645
early development in sea urchins, Differential adhesion hypothesis, heterochrony, 795–796
311–330 98–100, 104 polydactyly, 642, 643
overview, 311 Differential cell affinity specification by Hox genes, 638,
phylogeny, 312 description, 97–98 640–642
sea urchin gastrulation, 320–326 thermodynamic model, 98–100 specification by Sonic hedgehog,
Developmental biology Differential gene expression 636–639
defined, 2 defined, 45–46 tip regeneration in mammals, 718
introduction, 1–2 differential RNA processing, 73–76 Turing model for skeletogenesis,
key questions studied, 2–3 gene anatomy, 52–67 642–644
life cycles, 4–8 gene regulatory networks, 67–68 See also Autopod
Developmental disorders. See Abnormal introduction, 45 Digoxigenin, 85, 86
development mechanisms of differential gene Dihydrofolate reductase (DHFR), 426
Developmental genetics, 46, 85–88 transcription, 68–72 Dihydrotestosterone (DHT), 194–195,
Developmental modules, divergence modulating access to genes, 50–52 196–197
through dissociation, 787–789 morphogen gradients, 115–116, 117 Dinosaurs
Developmental neurobiology, 488 posttranslational gene regulation, digits, 649
Developmental plasticity, 764, 765 84–85 temperature-dependent sex
See also Phenotypic plasticity principles of the central dogma of determination, 771n3
Developmental symbioses biology, 46–47 Diphenylhydantoin, 739
Euprymna-Vibrio symbiosis, 777–778 role of the nuclear envelope in, 72 Diploblasts, 252
introduction, 775–776 Diplotene, 206, 207
SI–12 Subject Index
Eggans, Kevin, 41 Endocrine system, neural crest Enveloping layer (EVL), 369, 370–371
Egr1 protein, 781 derivatives, 464 Environment
Egyptian plover (Pluvianus aegyptius), Endoderm ecological developmental biology,
775 amphibian, 6, 336–344 782–783
Eichele, Gregor, 439 avian, 385–388 neural tube closure defects, 425–427
eIF4E protein, 77, 79, 238 defined, 15 phenotypic plasticity, 764–773 (see also
eIF4G protein, 79 digestive tube and its derivatives, Phenotypic plasticity)
Eighth cranial nerve, 429 657–665 polyphenic life cycles, 773–775
Embryogenesis, 4–5 diplobasts, 252 role in development, 763, 782, 783
Embryoid bodies, 173, 174 folding during early development, 655, Environmental integration, 3
Embryology 656 Environmental sex determination,
comparative, 9–11 formation, 653–655 201–202
evolutionary, 23–25 functions and derivatives, 15, 653 Eomesodermin (Eomes)
medical, 26–27 in gastrulation, 4 activation of Mesp1 in mouse epiblast,
Embryonic epiblast, 397, 398–399 mammalian embryo, 397, 398–399, 399 595n4
Embryonic germ cells (EGCs), 168 migration of cardiac precursor cells inner cell mass-trophoblast decision,
Embryonic homologies, 24–25 and, 596–597 394, 395
Embryonic period, 739, 740 pharynx, 655, 657 specification of amphibian germ
Embryonic shield, 336, 372 respiratory tube, 666–668 layers, 343–344
Embryonic stem cells (ESCs) signals mediating endoderm Eosin eye gene, 198
chimeras, 406 progenitor fates, 654 Eosinophils, 609
CRE-lox technique, 90–91 tunicates, autonomous specification EP-cadherin, 336
induced differentiation, 168, 169 in, 330, 331 Epaxial muscles, 567n6
maintenance of cultures, 167–168 zebrafish, 371 Ependyma, 443
naïve and primed, 168 Endometrium, 396 Ependymal cells, 154, 155, 441
organoids, 173–176, 177 Endoplasmic reticulum (ER), 232–233 Ephrin ligands, 137
pluripotency, 145 Endosomes, internalization, 131 Ephrin receptors (Ephs)
regenerative medicine, 170 Endosteal niche, 162, 163 “chase and run” model of cranial
research banned in the U.S., 170n21 Endosymbiosis, 775 neural crest cell migration, 483, 484
sources, 148, 167 Endothelial cells differential retino-tectal adhesion,
Embryos blood vessels, 581 506–508
cell lineages and fate maps, 17–22 liver regeneration in mammals, 718, Eph A4, 494, 495, 551–552, 556
dye marking, 19–20 719 Eph B1, 504
genetic labeling, 20–21 Endothelial precursor cells, 542 Eph B2, 480, 481
living, direct observation of, 19 Endothelin receptor (EDNRB2), 480, 481 growth of retinal ganglion axons, 504
pluripotent stem cells, 148–149, 150 Endothelins, 504–505 as juxtacrine factors, 137
transgenic DNA chimeras, 21–22 Energids, 280 motor neuron navigation, 494, 495,
Empty spiracles gene, 293, 295 Engrailed protein 496
EMT. See Epithelial-mesenchymal anterior-posterior patterning of insect somite boundary formation, 556
transition wings, 688 somitogenesis, Eph A4-ephrin B2
Emys orbicularis (European pond turtle), Cartesian coordinate model in signaling in, 551–552
202 Drosophila and, 307 trunk neural crest cell migration, 475,
Enamel knot, 530, 531, 532, 533 gene mutant, 294 480, 481
End-binding proteins (EB1/3), 490, 491 segment polarity gene, 295 Ephrins
Endfoot, 440 segmentation in Drosophila, 298–299, differential retino-tectal adhesion,
Endoblast, 382, 383, 385 300 506–508
Endocardial cushions, 594, 601 specification of ventral ectoderm of ephrin A, 507
Endocardium, 594 limb bud, 645 ephrin A5, 494, 495
Endochondral ossification, 572–574, 647, Enhancers ephrin B, 673, 677
648 Cre-lox system, 90–91 ephrin B2, 504, 551–552
Endocrine disruptors defined, 55 eye movement in amphibian
atrazine, 751–752 DNA methylation blocks binding of metamorphosis, 673, 677
bisphenol A, 749–751 transcription factors to, 70 growth of retinal ganglion axons, 504
DDT, 746, 747 function of, 55, 56–58, 59 motor neuron navigation, 494, 495,
defined, 735 Mediator complex linking promoter 496, 498
diethylstilbestrol, 747–749 to, 56, 57 regulation of actin polymerization in
endocrine disruptor-induced DNA modularity, 58–60, 787–788 growth cone movement, 491, 492
methylation, 803 reporter genes, 57–58 somitogenesis, Eph A4-ephrin B2
epigenetic transmission of summary, 61 signaling in, 551–552
developmental disorders, 753–754 Enlargeosomes, 492 trunk neural crest cell migration,
fracking chemicals, 752–753 Enteric ganglia, 465 475–476
future research, 760 Enteric neural crest, 478, 479 Epialleles, 753–754, 802–803
introduction, 746–747 Enterocoely, 254 Epiblast
Endocrine pancreatic cells, 663–664 Enterocytes, 159 avian egg, 381, 382
Enteroendocrine cells, 159, 660 avian gastrulation, 382, 383, 389
Subject Index SI–15
mammalian embryo, 397, 398–399 epithelial-mesenchymal transition (see selectable epigenetic variation,
zebrafish embryo, 366, 371, 372 Epithelial-mesenchymal transition) 801–807
Epiboly inductive interactions with mesenchyme Evolutionary developmental biology
avian ectoderm, 387–388 in forming ectodermal appendages, (evo-devo)
description, 13, 14 529, 530–531, 532 deep homology, 792–793
prospective ectoderm in amphibian morphogenesis, 17–18, 96, 104 developmental constraints on
gastrulation, 342–343 reorganization of epithelial sheets as evolution, 799–801, 802
zebrafish gastrulation, 370–371 ectodermal placodes, 517 (see also developmental structure of the
Epibranchial placodes, 518, 519 Ectodermal placodes) genome, 786–792
Epicardium, 594, 599 Epithelial-mesenchymal interactions, future research areas, 808
Epidermal growth factor (EGF) 112–114 “intelligent design” and, 808
differentiation of the epidermis, 528, Epithelial-mesenchymal transition introduction, 785
529 (EMT) mechanisms of evolutionary change,
as a paracrine factor, 130 dermomyotome, 567, 568 793–799
regulation of adult neural stem cell description, 107, 108 in the nineteenth century, 786
niche, 154, 156 limb formation, Tbx5 and, 624 selectable epigenetic variation,
RTK pathway, 119 neural crest cells, 471–472 801–807
Epidermal growth factor receptor neuroepithelial cells, 470 significance, 807–808
(EGFR), 154, 156, 528 sclerotome development, 560 time frames of, 649n7
Epidermal placodes, 529–537 sea urchin gastrulation, 321–324 Evolutionary embryology, 23–25
Epidermal stem cell niches, 517 Epithelial sacs, 114–115 Exencephaly, 422
Epidermal stem cells, 517, 528–529 Epithelialization, in somitogenesis, 556 Exocrine pancreatic cells, 663–664
Epidermis Equatorial region, sperm, 245 Exocytosis, by growth cones, 492
cutaneous structures, 113, 528 Equivalence group, 138 Exons
defined, 528n2 ERK protein, 120 alternative nRNA splicing and, 73, 74
dorsal-ventral patterning of the central Erythrocytes. See Red blood cells description, 52–54
nervous system, 431, 432 Erythropoietin, 130, 609 differential RNA splicing and, 76
induced in amphibian development by Escherichia coli, 780 Exosomes, 210
BMPs, 355–356 ESCs. See Embryonic stem cells Ext1, 647
induction in zebrafish, 374 Esophagus, 666–667 External fertilization
origin, 528–529 Estrogen acrosome reaction, 225–226, 227
Epididymis, 182, 185, 186, 194, 210 atrazine and endocrine disruption, calcium and the cortical granule
Epigallocatechin-3-gallate (EGCG), 751–752 reaction, 231–233
604n6 mammary gland development, 531, egg activation in sea urchins, 233–238
Epigenesis 534 fast block to polyspermy, 230, 237
defined, 9 secondary sex determination, 181, 184, frogs, 6
epigenetic regulation of stem cells, 197 fusion of egg and sperm cell
147, 153 Estrogen receptors membranes, 228, 229
preformationism and, 10–11 growth hormone and, 649 fusion of genetic material, 238–239,
Epigenetic drift, aging and, 729–730 methylation, aging and, 729, 730 248
Epigenetic inheritance Estrogenic compounds, in fracking monospermy and polyspermy,
of developmental disorders, 753–754 chemicals, 752 228–229
epialleles, 802–803 ET transcription factor, 521 overview, 223–224
fixation of environmentally induced Ets1 gene, 318, 319, 323 recognition of the egg extracellular
phenotypes, 806–807 Etv2 transcription factor, 602 coat, 226–228
genetic assimilation, 802, 804–806, Etv4/5 transcription factor, 639, 640 sea urchins, 237
807 Euchromatin, 50 slow block to polyspermy, 230–231,
introduction, 801–802 Eukaryotic organisms, 252 237
symbiont variation, 803–804 Euprymna scolopes, 777–778 sperm recognition of the egg
Epimorphin, 562 European pond turtle (Emys orbicularis), extracellular coat, 226–228
Epimorphosis (epimorphic regeneration) 202 External granular layer, 444, 445
defined, 695 Eustachian tube, 657 External YSL, 369, 370, 371
Hydra, 699 Even-skipped protein, 295, 297–300 Extracellular envelope, 222, 223
salamander limb regeneration, Evo-devo. See Evolutionary Extracellular matrix
707–713 developmental biology cell interactions, 104–105
zebrafish heart regeneration, 716, 717 Evolution components, 105
Epinephrine-secreting neurons, 477 descent with modification, 786 defined, 104
Epiphyseal plates, 647–648 developmental constraints, 799–801, diffusion of paracrine factors, 131–132,
Epithelial, defined, 528n2 802 133
Epithelial cells developmental structure of the epithelial-mesenchymal transition,
cancer, 755–756, 757 genome as a precondition, 786–792 107, 108
defined, 17 mechanisms of change, 793–799 implantation, 396
epithelial-mesenchymal interactions, questions studied in developmental integrins, 106–107
112–114 biology, 3 permissive interactions, 112
SI–16 Subject Index
trunk neural crest cell migration, amphibian, 334, 335 epithelial-to-mesenchymal transition
475–476 C. elegans, 267 of the dermomyotome, 567
Extraembryonic endoderm, 397 defined, 217 formation of metanephric
Extraembryonic membranes, 379, 380 Drosophila, 279 mesenchyme and the ureteric bud,
Extraembryonic mesoderm, 397 egg activation in sea urchins, 233–238 586, 587
Extraembryonic vasculogenesis, 603 external (see External fertilization) generation of pancreatic β cells, 664
Exuperantia protein, 288, 289 first description of, 218–219 gut tissue specification, 659
Eya2 protein, 519 frogs, 5, 6, 7 hair cycling, 535, 536
Eye fields gamete recognition, 217, 223 hair development, 533
formation, 521–522 internal, 239–248 (see also Internal heart development, 593, 595, 596
lens-retina induction cascade, 523–527 fertilization) induced differentiation of embryonic
Eyeless gene, 302 major events in, 217 stem cells, 168, 169
Eyes mammals, 391 induction of the chick otic placode, 519
cyclopia, 738 overview, 4 JAK-STAT pathway signaling, 120–121
movement in metamorphosis, 673 sea urchins, 223–233 kidney development, 587–588
relational pleiotropy and structure of the gametes, 218–223 limb development, 613
microphthalmia, 737 Fertilization cone, 228, 229 establishment of positive feedback
See also Retina; Vertebrate eye Fertilization envelope, 231 loops for limb bud formation, 625
development Fetal alcohol spectrum disorder (FASD), gradient models of limb patterning,
Eyespots, 772 741–744 628–630
Fetal alcohol syndrome (FAS), 741–744 limb bud patterning, 627
F Fetal globin, 70 limb specification, 620–622, 624
Facial cartilage, 464 Fetal hemoglobin, 61 positive feedback loop with Sonic
Facial nerve, 429, 482, 518 Fetal neuronal growth rate, in human hedgehog, 639–640
Facial skeleton brain development, 455–456 reaction-diffusion model of
alcohol-induced abnormalities, Fetal period, 739, 740 proximodistal limb development,
742–744 Fever, 739 633
coordination with brain growth, FGFRs. See Fibroblast growth factor Turing model, 644
485–486 receptors liver formation, 661, 662, 664
cranial crest derivative, 482 FGFs. See Fibroblast growth factors mammalian gastrulation, 398, 399
neural crest derivative, 464 Fibrillar fibronectin, 343 mediation of endoderm progenitor
Fanconi anemia, 170 Fibroadipogenic progenitor (FAP), 165 fates, 654, 655
Fasciculation, 495 Fibroblast growth factor receptors migration of cardiac neural crest cells,
Fast block to polyspermy, 230, 237 (FGFRs) 486
Fate maps alternative nRNA splicing, 74 migration of cranial neural crest cells
defined, 18 dwarfism, 121, 648 into the pharyngeal pouches, 657
direct observation of living embryos, endosome internalization of FGF- motor neuron navigation, 494–495
19 FGFR complexes, 131 overview and description, 118–119
dye marking, 19–20 FgfR2, 74 regulation of mesenchymal stem cell
genetic labeling, 20–21 FgfR3/FGFR3, 121, 648, 738 development, 165
introduction, 17–18, 19 FgfR4, 648 RTK pathway, 119–120
sea urchin blastomeres, 314–315, 316 lamellipodia and specification of heart salamander limb regeneration, 712,
snail embryo, 258–259 progenitor cells, 134–135 713
transgenic DNA chimeras, 21–22 mutation and phenotypic sea urchin epithelial-to-mesenchymal
tunicates, 327–328 heterogeneity, 738 transition, 323–324
Faust gene, 597 overview, 118–119 secretion and diffusion, 131–132, 133
Feathers, 113, 529 Fibroblast growth factors (FGFs) sex determination in Drosophila, 200,
Feedforward circuits, 319 amphibian development, 363, 364 201
Female pronucleus anterior-posterior patterning in specification of cranial sensory
defined, 221 mammals, 401–402 placodes, 518, 519
at fertilization, 221 avian gastrulation, 384, 386, 387 vertebrate eye development, 523
fusion of genetic material in binding to FGF receptors, 118–119 zebrafish axis specification, 374, 376
mammals, 246, 247 clock-wavefront model of Fgf2, see Basic fibroblast growth factor
fusion of genetic material in sea somitogenesis, 552, 553, 554, 557, Fgf3
urchins, 238–239, 248 558, 559, 560 induction of the chick otic placode,
Female reproductive system conditional specification of the 519, 520
effects of bisphenol A on, 750 notochord in tunicates, 330–331 migration of cranial neural crest cells
effects of diethylstilbestrol on, 747–749 cytoneme-mediated signaling in into pharyngeal pouches, 657
sperm translocation, 231, 240 Drosophila, 135, 136 Fgf4
See also Ovaries development of ectodermal limb development in dachshunds, 25
Feminization, atrazine and, 751–752 appendages, 533 organoid derivation, 175
Femur, 614 differentiation of the epidermis, 528, stimulation of Sonic hedgehog
See also Stylopod 529 expression in tetrapod limb
Fertility, effects of BPA on, 749–750 endosome internalization of FGF- development, 645
Fertilization FGFR complexes, 131 tooth development, 532
Subject Index SI–17
exons and introns, 52–54 Giant protein amphibian gastrulation, 339, 340
gene targeting experiments on Hox gene activation by Caudal, 293 amphibian organizer, 353
gene expression, 404 repression of pair-rule genes by, 298 dorsal-ventral axis specification in
genetic errors of human development, segmentation in Drosophila, 295, zebrafish, 374, 375
736–738 296–297 heart development, 595
modulating access to, 50–52 Gill arches, 16 specification of mesodermal cell types
for neuronal growth in humans, Glassbottom boat (Gbb) protein, 688 in Xenopus laevis, 116, 117
459–460 Gli family transcription factors Gorostiza, Elisa Martí, 436
orthologues, 791–792 dorsal-ventral patterning of the central GPC4 protein, 570
paralogues, 790–791 nervous system, 433, 434 Gradient models, of limb patterning,
pleiotropy, 801, 802 Hedgehog pathway, 123, 124, 133, 134 628–631
testing gene function, 88–91 specification of digit identity, 637–638, Grainyhead-like genes, 422, 425
tools for characterizing gene 642–644 Grainyhead transcription factors, 425
expression, 85–88 Glial cell line-derived neurotrophic Granule cells, 444, 445
transcription factor function, 61–67 factor (GDNF) Granule neurons, 444
Genetic assimilation, 802, 804–806, 807 kidney development, 587, 588–589 Granulocyte-macrophage colony-
Genetic heterogeneity, 738 mammalian spermatogenesis, 208, stimulating factor (GM-SF), 610
Genetic labeling, 20–21 209 Granulosa cells, 185, 197
Genetic malformations, 26 trunk neural crest cell migration in the Gräper, Ludwig, 386
Genetic syndromes, 736–738 gut and, 478 Gravity, avian axis specification and, 389
Geniculate placode, 518 Glial cells Gray crescent
Genital tubercule, 182, 194 formation, 439 amphibian cleavage, 335
Genome innervation of the hindbrain, 518 amphibian gastrulation, 337–338,
versus cytoplasm in directing types and functions, 441–443 345–346
development, 46 Glial fibrillary acidic protein (GFAP), formation of, 334
defined, 4, 47 154, 442–443 Gray matter, 443
developmental structure as a Glial guidance, 450, 451 Great Pyrenees dogs, 643n5
precondition for evolution, 786–792 Glioblastomas, 758 Green fluorescent protein (GFP), 22
genomic equivalence, 45, 47–50 Global control region (GCR), 619, 641 Gremlin protein
Genomic equivalence Globin genes autopod sculpting, 649, 650
concept of, 45 promoter methylation, 70 bat wing development, 794
evidence for, 47–50 temporal silencer, 61 coordination of facial and brain
Genomic imprinting, DNA methylation, See also β-Globin gene growth, 486
71–72 Glochidium, 264 sclerotome development, 562
Gentamycin, 739 Glossopharyngeal nerve, 429, 518 Sonic hedgehog/FGF positive feedback
Geospiza, 796–798 GLP-1 protein, 272 loop in tetrapod limb development,
Germ band, 282, 283 Glucagon, 60 639–640
Germ cells Glutamic acid, 426 specification of digit identity, 638
adult stem cell niches in Drosophila, Glutathione, 236, 246 GRNs. See Gene regulatory networks
150–153 Glycogen synthase kinase 3 (GSK3) Ground finches, 796–798
defined, 4 amphibian “organizer” formation, 351, Growth, questions studied in
differentiation in gonads, 185, 186 352 developmental biology, 3
gametogenesis, 8, 181, 202–212 Wnt/β-catenin pathway signaling, 127 Growth cones
migration to gonads, 185, 203, 204 Glycogen synthase kinase 3 inhibitor axon guidance, 493
modification to form a mammalian (GSK3i), 168 microspikes, 489
sperm, 218 Glyphosate-based herbicides, 744–745 motor neuron navigation, 495–498 (see
separation from somatic cells, 4–5 Glypicans, 126 also Motor neuron growth cones)
See also Primordial germ cells Goblet cells, 159 movement by regulation of actin
Germ layers Goldschmidt, Richard, 266 polymerization, 491–493
amphibian gastrulation, 337–344 Gonad development overview, 463, 488–489
defined, 4, 14–15 effects of atrazine on, 751–752 Plus tip proteins and actin-
formation in zebrafish development, effects of diethylstilbestrol on, 747–749 microtubule interactions, 490, 491
370–374 mammals, 181, 182–194 Growth differentiation factor 11 (GDF11)
specification in the avian embryo, migration of germ cells, 203 neural stem cell niche of the V-SVZ,
385–386 Gonadal rudiment, 184–194 154, 157, 158
Germ line, 181 Gonads as rejuvenating agent, 730–731
See also Gametogenesis hermaphrodites, 193 Growth hormone (GH), 649
Germ plasm theory, 35–36 mammalian gametogenesis, 202–212 GSK3-binding protein (GBP), 351, 352
Germ ring, 371 pseudohermaphroditism, 196 GTP exchange factor (GEF), 119
Germ stem cells in Drosophila, 150–153 secondary sex determination, 182, 184, GTPase-activating protein (GAP),
German measles, 739 194–197 119–120
Germarium, 151 Gonialblast, 150, 151 Guanine nucleotide releasing factor
Germinal crescent, 386 Gonocytes, 208 (GNRP), 119
Germinal neuroepithelium, 443 Gooseberry gene, 295 Guanylyl cyclase, 224, 225
GFAP. See Glial fibrillary acidic protein Goosecoid protein Gurken protein
SI–20 Subject Index
anterior-posterior polarity and, 286, Head endomesoderm segment polarity gene, 295
287 amphibian “organizer” and, 347 segmentation in Drosophila, 298–301
dorsal-ventral polarity and, 303–304, formation in amphibian embryo, 346 HeLa cells, 167
305 Head inhibition, in Hydra, 698, 699–700, Helix-loop-helix DNA-binding domain,
Gut. See Digestive tube development 701 63
Gut microbiome Head mesoderm Helix-turn-helix DNA-binding domain,
changes in during pregnancy, 781, 782 amphibian embryo, 339n2, 340, 355 63
horizontal transmission, 777 derivatives, 540, 542 “Helmet” morph, 768, 769
normal development and, 763, 783 Head mesoendoderm, 387 Helper T-cells, 780
role in gut development, 779–780 Head process, 386 Hemangioblasts, 599, 602, 603
role in the development of the immune Heart Hematopoiesis, 581
and nervous systems, 780–782 activation of liver formation, 661, 662 bone marrow HSC niche, 608–609
Gynandromorphs, 198 congenital defects, 487 defined, 605
Gynecomastia, 531 William Harvey’s observations, 591 hematopoietic inductive
Gyrenecphaly, 456–458, 461 inhibition of pancreas formation, 662 microenvironments, 609–610
Gyri, 456–459 left-right asymmetry in mammals, overview, 605–606
404–405 sites of, 606–608
H “recellularized,” 112 Hematopoietic inductive
H3K4me3, 68, 69 regeneration in mammals, 718 microenvironments (HIMs),
H4K12, 728 regeneration in zebrafish, 715–717 609–610
H19 gene, 72 Heart development Hematopoietic stem cell niche
Haeckel, Ernst, 786n1 changes at birth, 601 homing of hematopoietic stem cells to,
Hair cranial neural crest cells, 483 161–162
color, as diet-induced polyphenism, formation of heart fields, 593–595 (see overview and description, 161, 162
767 also Heart fields) regions of, 162–163
development, 529, 530, 531, 533 heart fusion and first heartbeats, 599 regulatory mechanisms in the
Fgf5 mutations and long-haired initial heart cell differentiation, endosteal niche, 163
dachshunds, 538 599–601 regulatory mechanisms in the
male pattern baldness, 537 lateral plate mesoderm formation, 591, perivascular niche, 163–164
stems cells and growth, 534–537 592 Hematopoietic stem cells (HSCs)
Hair follicle stem cells, 535–537 microRNAs, 611 bone marrow niche, 608–609
Hair follicles migration of cardiac precursor cells, defined, 606
adult stem cell niche in humans, 151 596–598 hematopoietic inductive
cycles of growth and stem cells, overview, 581 microenvironments, 609–610
534–537 specification of the cardiogenic homing to the stem cell niche, 161–162
neural crest-derived melanocytes, 528 mesoderm, 593, 595, 596 human, 151
Hair-restoring drugs, 196n5 tunicates, 592–593, 595n4 multipotency, 146
Hair shaft, 534, 535 Heart fields regulation in the stem cell niche,
Hair stem cells, 534–537 formation, 593–595 162–164
Hairy/Enhancer of split-related proteins, initial heart cell differentiation, sites of hematopoiesis, 606–608
154, 156, 555–556 599–601 umbilical cord and, 164
Hairy proteins, 295, 297, 555–556 migration of cardiac precursor cells, Hemiergis, 795–796
Haldane, J. B. S., 789n3 596–598 Hemimelic extra-toes (hx) mouse mutant,
Half-baked zebrafish mutant, 101 Heart progenitor cells, 134–135 636, 637
Halteres, 302, 805 Heart tube, 593, 598, 599, 601 Hemimetabolous development, 679–680
Hamiltonella defensa, 804 Heart valve development, 601 Hemogenic endothelial cells, 606–607
Hand-family transcription factors, 593 Heartbeat, 599 Hemoglobin
Haptotaxis, 499n11 Heat shock proteins, 83, 84 changes in amphibian metamorphosis,
HAR genes, 459 Hedgehog pathway 674
Harrison, Ross Granville, 488 cilia as signal reception centers, fetal, 61
Harvey, William, 9, 591 132–134 steps in the production of, 53
Hatched blastula, 314 cytoneme-mediated signaling in Hensen, Viktor, 488
Hawkmoth. See Manduca sexta Drosophila, 135, 136 Hensen’s node
Head activation gradient, 697 endosome internalization of avian gastrulation, 386, 387
Head activator, in Hydra, 697–699, 700 Hedgehog-Patched complexes, 131 defined, 384
Head development functions, 124–125 formation, 385
dermis, 567 overview and description, 123–124 mouse embryo, 399n5
effects of alcohol on, 741–744 segmentation in Drosophila, 298–301 twinning and, 407
induction in amphibian development, Hedgehog protein family Heparan sulfate, 105, 647
361–363 anterior-posterior patterning of insect Heparan sulfate glycosaminoglycan, 610
neural-crest derived skeleton, 484–486 wings, 688 Heparan sulfate proteoglycans (HSPG)
remodeling in amphibian cancer, 756–757 diffusion of paracrine factors, 131–132,
metamorphosis, 674 Hedgehog pathway, 123–125 133
Head ectoderm, vertebrate eye overview and description, 121–122 glypicans, 126
development, 109–110, 111, 520 secretion and processing, 122 implantation, 396
Subject Index SI–21
heterotypy and the evolution of Huxley, Julian, 785 Immotile sperm, 219n1
pregnancy, 798–799 Huxley, Thomas, 537, 785, 786 Immune system
Hoxa13 Hyaline layer, 231, 314, 321, 324, 325 gut bacteria and, 780–781
gradient model of limb patterning, Hyaluronic acid, 638 predator-induced polyphenisms,
629, 630 Hyaluronidase, 242 769n2
specification of hairless skin, 531 Hydra, 252 Implantation, 392, 395–396
Hoxb4 budding, 696 In situ hybridization, 85–86
homologue to Deformed, 791 regeneration, 694, 695–700, 701 Incomplete cleavage. See Meroblastic
specification of intermediate Wnt signaling, 698–699, 705n5 cleavage
mesoderm, 584–585 Hydra magnipapillata, 700 Incus, 481, 482
Hoxb8, 641 Hydractinia carnea, 732–733 Indels, 89
Hoxc6, 620 Hydraulic fracturing (“fracking”) Indian hedgehog (Ihh) protein
Hoxc10, 624 chemicals, 746, 752–753 endochondral ossification, 574
Hoxd complex Hydronephrosis, 589 functions, 121–122
anterior-posterior specification of Hydrotestosterone, 537n4 gut tissue specification, 659
somites, 547–548 20-Hydroxyecdysone Ihh-b, 122n6
specification of digit identity, 638, binding to DNA, 685–687 mechanotransduction and jaw bone
640–642 ecdysone receptors, 685 development, 575
tetrapod limb development, 616–617 insect metamorphosis, 683–687 Indifferent gonad, 182–194
tetrapod limb evolution, 619 seasonal pigmentation in butterflies, Indirect developers, 671–672
Turing model and, 642–643 772, 773 Induced pluripotent stem cells (iPSCs)
HP1 protein, 71 structure, 684 applying to human development and
HSCs. See Hematopoietic stem cells Hydrozoans, 732–733 disease, 171–172
HSPG. See Heparan sulfate Hyla chrysoscelis, 769, 770 defined, 65
proteoglycans Hyla regilla (Pacific tree frog), 621 development of, 171
Hu proteins, 77–78 Hyoid cartilage, 481, 482 modeling multigenic human diseases
Hub, 150, 151 Hyomandibular jaws, 16 with, 172–174
Huckebein gene, 295 Hypaxial muscles, 567n6 organoids, 173–176, 177
Human brain development Hyperactivation, of sperm, 242, 243 Induction
cortical folding, 456–459, 461 Hyperforin, 173 versus autonomous specification in
duplication of SRGAP2, 792 Hyperplasia, 577 amphibian development, 344–347
fetal neuronal growth rate, 455–456 Hyperthermia, 739 defined, 108–109
genes for neuronal growth, 459–460 Hypertrophic cartilage, 648 genetic specificity, 113–114
high transcriptional activity, 460 Hypertrophic chondrocytes, 573–574 insect tracheal system development,
neuronal growth and the invention of Hypertrophy, 577 114–115
childhood, 456 Hypoblast interspecific, 114
overview, 455 avian egg, 381, 382 reciprocal, 110, 112
puberty and adolescence, 460–461 avian gastrulation, 382, 383, 388 regional specificity, 113
speech, language, and the FOXP2 mammalian embryo, 397, 398–399 vertebrate eye development, 108,
gene, 459 zebrafish embryo, 366, 371–372, 373 109–110, 111
Human development Hypomorphic mutations, 170 vulva induction in C. elegans, 138–139
diet, DNA methylation, and health Hypostome, 695, 697–698, 699, 700 Infectious microorganisms, as
problems, 768 Hypoxia, induction of angiogenesis, 604 teratogens, 739
from fertilization to implantation, 392 Infundibulum, 655
genetic errors of development, I Ingression, 13, 14
736–738 ICM. See Inner cell mass Inhibitory domain, 633
horizontal transmission of gut bacteria Identical twins, 406 Inhibitory galectins, 633
and, 777 IGFs. See Insulin-like growth factors Inner cell mass (ICM)
junctional neurulation, 428 Ihh. See Indian hedgehog protein formation, 393, 394–395
neural tube closure, 421–423 Ihog/Cdo protein, 124 gastrulation, 397, 398
neural tube closure defects, 420, 422, Ikaros protein, 56 pluripotency, 393, 394, 395
425–427 IL proteins. See Interleukins pluripotent stem cells, 148–149, 150,
pluripotent stem cell systems and the Ilyanassa, 259, 260, 261 167
study of, 167–176, 177 Ilyanassa obsoleta, 256, 258 twins, 406, 407
teratogenesis, 738–745 Imaginal cells, 680, 681 Innervation
Human proteome, 75 Imaginal discs differential survival of neurons after,
Humerus, 614 determination of wing discs, 688–689 511–513
See also Stylopod eversion and differentiation, 683 hindbrain, 518
Hunchback protein holometabolous insects, 680–683 polyneuronal, 509
activation of pair-rule genes by, 298 homologous specification, 690 Inositol 1,4,5-trisphosphate (IP3)
anterior-posterior polarity in segregation of, 283 acrosome reaction, 226
Drosophila, 290–291, 292–293 specification and proliferation, 682 egg activation in mammals, 247, 248
segmentation in Drosophila, 295, Imaginal molt, 680 release of intracellular calcium ions in
296–297 Imaginal rudiment, 690 egg activation, 234–235, 236
Hutchinson-Gilford progeria, 165, 725 Imitation Game, The (film), 631 Insect metamorphosis
Subject Index SI–23
determination of wing imaginal discs, Interior necrotic zone, 646 alternative nRNA splicing, 73, 74
688–689 Interkinesis, 207 description, 53–54
homologous specification, 690 Interkinetic nuclear migration, 447–448 Invagination
hormonal control of, 683–687 Interleukins (IL) amphibian bottle cells, 337–342
imaginal discs, 680–683 blood cell production, 610 description, 13, 14
major patterns of, 679–680 liver regeneration in mammals, 719 sea urchin archenteron, 324–326
molecular biology of myofiber growth, 577 Invariant cell lineage, 266
20-hydroxyecdysone activity, as paracrine factors, 130 Involucrin, 528
685–687 IL1-β Involuting marginal zone (IMZ) cells,
overview, 671, 691 labor contractions, 667–668 339, 341
parasitoid wasps, 683 regulation of the adult neural stem Involution
Insect signaling centers, 286 cell niche, 154 amphibian dorsal blastopore lip,
Insect wings IL3, 610 339–341
determination of wing imaginal discs, IL4, 577 description, 13, 14
688–689 IL6, 719 Ionizing radiation, 739
modularity and recruitment in beetles, Intermediate mesoderm IP3. See Inositol 1,4,5-trisphosphate
789 derivatives, 540, 541, 581, 582 iPSCs. See Induced pluripotent stem cells
Insects kidney development, 582–591 Iris, 110, 111, 527
heterotypy and leg number, 799 specification, 584–585 Islet1 protein
modularity and recruitment in beetles, Intermediate neuroblast defective gene, 307 cardiac precursor cell migration, 598
789 Intermediate progenitors (IPs), 449–450 hindlimb specification, 622, 624
trachea development, 114–115 Intermediate zone, 443, 444 motor neuron navigation, 494, 495
See also Drosophila Internal fertilization Islet2 protein
Instars, 680 difficulties in studying, 239–240 growth of retinal ganglion axons, 502
Instructive interactions, 110, 112 egg activation, 247–248 motor neuron navigation, 494, 495
Insulators, 63–64 fusion of genetic material, 246, 247 Isolecithal cleavage, 12
Insulin gamete fusion and prevention of Isolecithal eggs, 11, 13
effect of calorie restriction on polyspermy, 245–246 Isotretinoin, 739, 744
circulating levels of, 727 sperm acrosome reaction and Ito cells, 718
gene activation by Pax6, 60 recognition at the zone pellucida, Izumo protein, 245
Insulin-like growth factors (IGFs) 243–244
aging and, 726–727 sperm hyperactivation, thermotaxis, J
cancer and, 757 and chemotaxis, 242–243 Jacob, François, 793–794
differentiation of the epidermis, 528, sperm translocation and capacitation, Jagged protein
529 240–242 differentiation of the epidermis, 528,
dorsal-ventral axis specification in Internal granule layer, 444, 445 529
zebrafish, 374 Internal YSL, 369, 370, 371 Notch pathway signaling, 137
head induction in amphibian International Society for Stem Cell Jag1, 154, 157
development, 363 Research, 177 JAK proteins, 120–121
muscle growth, 578 Interneurons, 430, 431, 432 JAK-STAT pathway
IGF-1, 727 Intersex conditions, 196 chromosomal sex determination in
Igf-2, 72 Intersex gene, 200 Drosophila, 199
Insulin-like hormone, 197 Interspecific induction, 114 overview and description, 120–121
Insulin-secreting pancreatic cells. See Interstitial stem cell, 696–697, 699 self-renewal of Drosophila germ stem
Pancreatic β cells Intertissue adhesion, in somitogenesis, cells, 150
Insulin signaling pathways 550–551 Jaws
aging and, 726–727, 728, 732 Intervertebral discs, 564–565 cranial neural crest origin of jawbones,
predator-induced polyphenism in Intestinal adenomas, 758 481, 482
Daphnia, 768, 769 Intestinal stem cell niche, 151, 158–161 mechanotransduction and bone
Integrated gene, 125 Intestinal stem cells, 660 development, 575
Integrins Intestinal villi, 780 pharyngeal arches and evolution, 15,
α5, 552 Intestines 16
α5β1, 576 adult stem cell niche, 151, 158–161 tooth development, 529, 530, 531, 532,
Cajal-Retzius cells in the neocortex, formation, 657, 659, 660 533
452, 453 mammalian gut microbiome, 779–782 Jefferson salamander (Ambystoma
epithelial-mesenchymal transition, remodeling in amphibian jeffersonianum), 233n3
108 metamorphosis, 674 Jelly coat. See Egg jelly coat
motor neuron growth cone navigation, signals mediating formation, 654, 655 “Jellyfish,” 732–733
495 Intracellular pH, in calcium-mediated Jervine, 124, 739
myoblast fusion, 576 egg activation, 238 Jimpy mouse mutant, 442
receptors for extracellular matrix Intracytoplasmic sperm injection (ICSI), Joints, formation, 646–647
molecules, 106–107 247 Junctional neurulation, 428
somitogenesis, 550–551, 552 Intraembryonic vasculogenesis, 603 Juno protein, 245–246
“Intelligent design,” 808 Intramembranous bones, 484 Just, E. E., 95–96
Interdigital necrotic zone, 646 Introns Juvenile hormone (JH)
SI–24 Subject Index
horn polyphenism in dung beetles, mutant, 294 Lats protein, 394, 395
766 repression of pair-rule genes by, 298 LCP promoters, 69
insect metamorphosis, 683–684, segmentation in Drosophila, 295, Lead, 739
686–687, 688 296–297 Leader sequence, 54
predator-induced polyphenism in Kugelkern protein, 281 Lecithin, 667
Daphnia, 768, 769 Kupffer macrophages, 718, 719 LEF/TCF transcription factor, 127–128
senescence in monarch butterflies, 732 Kupffer’s vesicle, 376–377 Lef1 gene, 643
structure, 684 Left-right axis
synthetic, 688 L avian embryo, 390–391
Juxtacrine factors, 137 L1 protein, 61, 503, 744 C. elegans, 269
Juxtacrine interactions, 115 L4 mutant in Hydra, 700 defined, 14
Juxtacrine signaling Labia majora, 194 mammalian embryo, 404–406
cadherins and cell adhesion, 100–104 Labial gene, 302 specification in amphibian
for cell identity, 137–140 Labioscrotal folds, 182, 194 development, 364–365
defined, 96 Labor contractions, 667, 668 specification in vertebrates, 408
differential cell affinity, 97–98 Lacks, Henrietta, 167 zebrafish embryo, 376–377
introduction, 97 Lactobacillus, 781 Lefty protein
thermodynamic model of cell Lactoferrin, 106–107 avian axis specification, 390, 391
interactions, 98–100 LacZ gene, 57–58 anterior-posterior axis specification in
vulval induction in C. elegans, 138–139 LAG-2 protein, 139 mammals, 400
Lamarckism, 801–802 anterior-posterior axis specification in
K Lamellipodia vertebrates, 408
Kairomones, 768 axon growth cones, 490 left-right axis specification in birds,
Kallmann syndrome, 519 tunicate heart progenitor cells, 391
Kant, Immanuel, 10 134–135 Leg imaginal discs, 680, 681, 682, 683
Kartagener triad, 219n1 Laminae, 443 Legume plants, 775
Karyokinesis, 279 Laminin Lens
Keratella, 769 effect on mesenchymal stem cell differentiation, 524, 525–526
Keratella slacki, 768 development, 165 induction in vertebrate eye
Keratinocyte growth factor (Fgf7) functions, 105 development, 109–110, 111, 118
differentiation of the epidermis, 528 growth of retinal ganglion axons, 503 lens-retina induction cascade, 523–527
functions, 118 synapse formation, 509 vertebrate eye, 520
hair cycling, 535 Lampsilis altilis, 264 Lens placode
hair follicle regeneration, 536 Lancelets, 254 formed from nonneural cells, 518
Keratinocytes, 529, 534 Language, 459 lens-retina induction cascade, 523–527
Keratins, 528 Large tumor suppressor 1/2 (Lats1/2), vertebrate eye development, 517, 520
5α-Ketosteroid reductase 2, 196 140 Lens-retina induction cascade, 523–527
Kidney development Larvae Lens vesicle
epithelial-mesenchymal interactions, defined, 4 cornea differentiation, 526
113 holometabolous development, 680 lens differentiation, 525–526
microRNAs and, 611 larval settlement, 773–774 lens-retina induction cascade, 523, 524
overview, 581, 582–583 metamorphosis, 4, 27 vertebrate eye development, 520
preeclampsia, 605 primary, 671–672 Lens1 protein, 526
reciprocal interactions, 583, 585–591 secondary, 672 Leopard frog. See Rana pipiens
specification of the intermediate Larval settlement, 773–774 Lepidoptera, 805, 806
mesoderm, 584–585 Laryngeal cartilages, 481 Leptotene, 206
Kierkegaard, Søren, 42, 394 Laryngotracheal groove, 666 Leucine Zipper DNA-binding domain,
Kinesin, 83, 84, 351 Larynx, 657 63
Kinetochore, 206 Lateral axis, 14 Leukemia inhibitory factor (LIF), 168
“Kiss and run” signaling, 570–572 Lateral geniculate nucleus of thalamus, Leukemias, 757
Kit protein, 737, 738 446 Leydig cells
Kit receptor protein, 480, 608 Lateral inhibition, 138–139 formation, 185
Klf4 transcription factor, 65, 171 Lateral line system, 674 secretion of testosterone, 194
Klimt, Gustav, 395n4 Lateral motor column (LMC), 494 Sf1 activation of testosterone
Klinefelter syndrome, 183 Lateral plate mesoderm production, 191
Knee cap, 575 blood vessel formation, 601–605 as a stem cell niche, 205, 208
Knirps protein, 293, 295, 296–297 derivatives, 540, 541–542, 572, 581, 582 Lgr5 protein, 159, 160
Knock downs, 88, 88? formation, 591, 592 Lhx1 (Lim1) protein
Knockouts, 88 heart development, 592–601 (see also anterior mesoderm specification, 410
Kohler, Robert, 277 Heart development) dorsal-ventral axis in tetrapod limb
Koller’s sickle, 382, 383 Lateral somitic frontier, 567 development, 644–645
Kölliker, Albert von, 218 Lateral ventricle adult stem cell niche, specification of intermediate
Kowalevski, Alexander, 23, 331 153–158 mesoderm, 584
Kr-h1 gene, 687 See also Ventricular-subventricular Lhx2 transcription factor, 445, 446
Krüppel protein zone Lhx3 transcription factor, 494–495
Subject Index SI–25
pluripotent stem cells of the inner cell Medial geniculate nucleus of thalamus, Mesenchymal stroma, cancer and,
mass, 148–149, 150 446 755–756, 757
primary neurulation, 415 Medial hinge point (MHP), 418–421, 432 Mesenchyme
regeneration, 694, 718–719 Medial motor column, 494 amphibian gastrulation, 338
sex determination (see Mammalian sex Mediator complex, 56, 57, 64 conditional specification in tunicates,
determination) Medical embryology, 26–27 330–331
twins, 406–408 Medulla oblongata, 428, 443, 444 endochondral ossification, 572–574
Mammary glands Medullary cord, 427 formation of ectodermal appendages,
bisphenol A and susceptibility to Medulloblastomas, 757 529, 530–531, 532
cancer, 750–751 Medusa, 732–733 formation of the liver, pancreas, and
development, 529–530, 531, 532, 533 Mef2 (myocyte enhancer factor-2), 63, gallbladder, 660
integrins and gland cells, 106–107 569 gut tissue specification, 659–660
stem cells, 534 Megakaryocyte/erythroid precursor medullary cord formation, 427
stroma regulation of epithelial tumors, cells, 609 respiratory tube formation, 667
756, 757 Meiosis Mesenchyme cap cells, 589
Mammary placodes, 529–530 germ cells in frog development, 8 Mesendoderm, 371
Manacle gene, 700 modifications, 207 Mesentoblast, 257, 262
Manatees, 605n7 oogenic, 211–212 Mesoderm
Manduca sexta (tobacco hornworm), 489, overview and description, 205–207 amphibian embryo, 336–344
805, 806 spermatogenesis, 208–210 avian embryo, 385–386, 388
Mangold, Hilde, 347, 348–349 timing of in mammalian Brachyury in specification of, 654–655
Mantle, 443, 444 gametogenesis, 203, 205 defined, 15
MAP kinase, 248 Meis transcription factor development of lateral plate
MAPK/ERK pathway inhibitor (MEKi), combinatorial association of mesoderm, 591, 592
168 enhancers, 60 differential cell affinity, 98
Marginal zone gradient model of limb patterning, forelimb bud initiation and, 620–622
amphibian gastrulation, 339 629, 630, 631 frog embryo, 6
avian egg, 381, 382 MEK protein, 120 in gastrulation, 4, 539–540
central nervous system development, Melanin, 520, 523 major lineages and derivatives, 15,
443, 444 Melanoblasts, 479–481 540–542, 581–582
Marine larval settlement, 773–774 Melanocyte stem cells, 535 mammalian embryo, 397, 399
Marine sticklebacks, 787–788 Melanocytes, 414, 528, 754 triploblasts, 252–254
Marine turtles, 771 Melanomas, 754, 755, 756, 758 zebrafish gastrulation, 371, 372
Marsupials, heterochrony, 795 Mello, Craig, 81 Mesodermal mantle, 342
Master regulatory transcription factors, Melton, Doug, 65–66 Mesogenin, 543, 544, 545
64–67 Meltrins, 576 Mesolecithal cleavage, 12
Maternal contributions Memory, age-related decline, 728 Mesomeres, 312, 313, 316
cleanup by microRNAs, 81–82, 83 Menidia menidia (Atlantic silverside), 771 Mesonephros (mesonephric kidney), 583
defined, 78 Meninges, 560 MesP, 592–593
selective inhibition of mRNA Merian, Maria, 691 MeSP1, 611
translation, 78–79 Meroblastic cleavage Mesp1, 595, 596, 599
Maternal effect genes avian embryo, 379 Mesp2, 556Mesp proteins
anterior-posterior polarity in defined, 13 clock-wavefront model of
Drosophila, 284–285, 286, 288–291 discoidal, 381–382 somitogenesis, 556
defined, 281 identification by Aristotle, 9 heart development, 592–593, 595, 596,
generating the acron and telson, 293 patterns of, 12 599
snail coiling, 256–258 zebrafish, 368–370 mesenchymal-epithelial transition,
summary of, 293 Mesencephalon, 428, 429 551
Maternal gradients, Drosophila oocyte, Mesenchymal cells Messenger RNA (mRNA)
285, 286, 288–291 defined, 17 central dogma, 46–47
Maternal messages, 281 epithelial-mesenchymal interactions, cytoplasmic localization and, 83, 84
Maternal-to-zygotic transition, 281 112–114 differential longevity, 77–78
Matrigel, 175 epithelial-mesenchymal transition (see differential processing, 73–76
Maxillary process, 485 Epithelial-mesenchymal transition) egg cytoplasm, 221
Maximum lifespan, 723 morphogenesis, 17–18, 96 stored in brain cells, 84
Mechanical stress, 775 Mesenchymal-epithelial transition stored in oocytes, selective inhibition
See also Shear stress (MET), 551–552, 555, 556 of translation, 78–79
Mechanotransduction Mesenchymal stem cells translation in calcium-mediated egg
bone development in vertebrates and, description, 164–165 activation, 237, 238
574–575 humans, 151 translational regulation of
in the musculoskeletal system, 578 regulation of development into specific transcription, 76–84 (see also
Meckle’s cartilage, 674 lineages, 165, 166 Translational gene regulation)
MeCP2, 71 regulation of the hematopoietic stem whole mount in situ hybridization,
MED-1/2 proteins, 271 cell niche, 162, 163 85–86
Subject Index SI–27
MET. See Mesenchymal-epithelial small toolkit, 790 Mitosis-promoting factor (MPF), 238
transition specific regulation of mRNA Model organisms, 251–252
Met protein, 687 transcription and translation, 80–81 chicken, 380
Metamorphic climax, 677 Microspikes, 489 Drosophila, 277–278
Metamorphic molt, 680 Microtubules embryo, 380
Metamorphosis anterior-posterior polarity in mouse, 380
amphibians, 672–679 Drosophila and, 286 sea urchins, 311–312
definition and overview, 4, 27, 671–672 axon growth cones, 490, 491 studies of teratogenesis, 740–741
dung beetles, 766 formation of cellular blastoderrm and, Model systems, pluripotent stem cells
environmental impact on timing in 280, 281 to study human development and
spadefoot toads, 774–775 fusion of genetic material in disease, 167–176, 177
frog development, 8 mammals, 246 Modularity, 787–789
future research areas, 691 fusion of genetic material in sea Molecular clocks. See Clock-wavefront
insects, 679–690, 691 urchins, 239, 248 model
pluteus larva, 690 left-right axis specification in Molecular parsimony, 787, 789–792
Metanephric mesenchyme amphibians, 365 Mollusks
formation, 586, 587 motor neuron growth cone navigation, cleavage, 5–14
kidney development, 581, 583, 495 larval settlement, 773
585–591 positioning of nuclei in syncytial predator-induced polyphenisms, 769
Metanephros, 583 specification, 39 See also Snail development
Metaphase, meiosis, 206, 207 Microvilli, egg, 222 “Molting” hormone, 683
Metazoans Mid-blastula transition See also 20-Hydroxyecdysone
defined, 251 amphibian development, 337 MOM-2/5 proteins, 271
developmental patterns, 252–254 Drosophila development, 281 Monarch butterfly (Danaus plexippus),
Metchnikoff, Elie, 331 zebrafish development, 368–369 691, 732
Methyl CpG binding protein-2 (MeCP2), Midbrain Monocytes, 608, 609
173 exencephaly, 422 Monospermy, 228–229
5-Methyl-tetrahydrofolate, 426 formation, 428, 429 Morgan, Thomas Hunt, 277, 701
5-Methylcytosine, 69 zebrafish embryo, 366 Morphallaxis (morphallactic
Methylenetetrahydrofolate reductase Middle ear regeneration)
(MTHFR), 426 bones, 481, 482 defined, 695
Methylmercury, 739 remodeling in amphibian Hydra, 699
Mexican cavefish, 796 metamorphosis, 674 zebrafish heart regeneration, 716, 717
Mexican tetra fish (Astyanax mexicanus), Midpiece, of sperm, 218, 220 Morpho deidamia, 691
522 Midsagittal plane, 14 Morphogenesis
Microcephaly, 175–176, 177, 739 Migratory locust (Schistocerca gregaria), cell-cell communication, 96–97
Microfilaments. See Actin microfilaments 764, 765 cell signaling, 108–115
Microglia, 443 Miles apart zebrafish mutation, 597–598 defined, 3, 95
“Micromere cap,” 259 “Milk lines,” 529 epithelial cells, 104
Micromeres “Milk” teeth, 533 epithelial-mesenchymal transition,
amphibian, 336 Miniature wing, 198 107, 108
sea urchins mIR-1, 611 extracellular matrix as a source of
blastomere determination, 315, 316 miR-133, 611 developmental signals, 104–107
blastula formation, 314 miR1, 82 introduction, 95–96
cleavage, 312–313 miR206, 82 juxtacrine signaling, 97–104
conditional specification of vegetal miR430, 81–82, 83 questions in developmental biology,
cells, 319–320 miRNA-31, 577 2–3
double-negative gate, 318–319 miRNA-34c, 391 Morphogenetic constraints, on evolution,
epithelial-to-mesenchymal miRNA-92, 790 800–801
transition, 321–324 miRNA-124, 790 Morphogenetic determinants
specification, 316–319 miRNA-155, 738 autonomous specification, 32–35
snail gastrulation, 265 miRNA-206, 759 defined, 32
spiral holoblastic cleavage, 255–256, miRNA-489, 577, 578 distinguished from morphogens,
259, 260 MITF protein 115n4
Micropatterned discs, 168n19, 169 function as a transcription factor, 62, Morphogenetic factors, egg cytoplasm,
Microphthalmia, 737 63, 64 221
Micropyle, 279 regulation of trunk neural crest Morphogens
MicroRNAs (see also miR, miRNA) migration, dorsolateral pathway, Bicoid, 292
cancer therapy, 759 479–480 defined, 40–41, 115
cardiac muscle division, 611 relational pleiotropy and dorsal-ventral patterning of the central
cleanup of maternal mRNA, 81–82, 83 microphthalmia, 737 nervous system, 431–433
control of larval stage in C. elegans vertebrate eye development, 523, 524 morphogen gradients and the
development, 273 Mitochondrial genome, maternal regulation of gene expression,
Down syndrome, 738 transmission, 238 115–116, 117
satellite cells, 577, 578 Mitosis, 11
SI–28 Subject Index
development of the snail D blastomere remodeling in amphibian Neural restrictive silence factor (NRSF),
and, 263 metamorphosis, 673, 674 61
diffusion and anchoring of Nanos Netrin family proteins Neural retina
mRNA, 83, 84 angiogenesis, 605 defined, 520
mammalian gametogenesis, 203 growth of retinal ganglion axons, 503 differentiation, 523, 524, 526–527
NCAM navigation of commissural neurons, formation, 110, 118
endochondral ossification, 573 498–499, 501 Neural stem cells (NSCs)
growth of retinal ganglion axons, 502, as paracrine factors, 130 adult, 153–158
503 regulation of actin polymerization in embryo, 440–441
Neck dermis, 567 growth cone movement, 491, 492 Neural stem cell niche
Neck vertebrae, 403 netrin-1, 498–499, 501, 503 environmental influences on, 156–158
Necrosis, 509 netrin-2, 498–499, 501 maintenance of, 155–156
Negative enhancers, 61 Neural crest overview, 153, 154
NELF, 56, 57 defined, 21, 465 promoting differentiation in, 156
Nematodes, see Caenorhabditis elegans fate mapping with transgenic DNA, 22 ventricular-subventricular zone,
Nemoria arizonaria, 764, 765 genetic markers as cell lineage tracers, 154–155
Neocortex 21 Neural tube
description and specification of, 445 origin and derivatives, 414, 799 closure, 421–424
development in humans, 455–461 regionalization, 465–466 closure defects, 420, 422, 425–427
neurogenesis, 448–450 Neural crest cell migration differentiation, 439, 443, 444 (see also
radial glial cells and neurogenesis, collective migration, 473–474 Brain development)
451, 452 contact inhibition of locomotion, 473 formation, 414
signaling mechanisms regulating delamination, 471–473 frog development, 6, 7
development, 451–455 overview, 464, 470, 471 junctional neurulation, 428
Neomycin cassette, 88 Neural crest cells myotome determination and, 569
Nephric (Wolffian) ducts derivatives, 464, 465 neuroepithelial cells, 440–441
defined, 583 epithelial-to-mesenchymal transition, neurulation, 413–414, 415–428 (see
gonad development, 182, 185, 186, 194, 471–472 also Neurulation)
197 induced, 470 patterning of, 428–434
induction of ureteric bud from, 588 migration, 470–474 in teleost fish, 416n1
insertion of the ureter into the bladder, as multipotent stem cells, 463, 466– Neuregulin-1, 570–572
590–591 467, 468 Neuroblasts, Drosophila, 283–284, 307
kidney development, 581 neural-crest derived head skeleton, Neurocranium, 484
Nephrons 484–486 Neuroepithelial cells
defined, 582 overview and significance, 463–464 central nervous system development,
formation, 585–586, 589 regulation of myogenesis, 570–572 440–441, 444
Nerve growth factor (NGF) specification, 468–470, 519 derivatives, 439, 441
axon target selection, 505 Neural crest specifiers, 468, 469, 470 epithelial-to-mesenchymal transition,
differential survival of neurons after Neural ectoderm 470
innervation and, 511, 513 amphibian embryo, 355–359 interkinetic nuclear migration,
Nerves avian embryo, 386 447–448
cranial, 429, 517–519 Neural folds, 416–417, 419 neurogenesis in the neocortex, 448–
pioneer nerve fibers, 493 Neural groove, 417, 419 450 (see also Radial glial cells)
salamander limb regeneration, 711, Neural induction symmetry of division, 448
720 BMP inhibitors, 355–359 Neurogenesis
Nervous system development regional specificity along the anterior- bottom-up development, 448–450
establishing axonal pathways, 488–513 posterior axis, 359–364 cerebral cortex, 447
(see also Axonal specificity) Neural keel, 372–373 horizontal and vertical specification of
Hu proteins and differential mRNA Neural plate the cerebrum, 454
longevity, 77–78 bending of, 418–419 human brain development, 455–461
introduction, 413–414, 415 border, 468 introduction, 439
mammalian gut bacteria and, 781 elongation and folding, 417–418 mechanisms regulating brain growth,
N-cadherin, 101 expression of Sox proteins, 415 447–455
neural ectoderm induction in the neuroepithelial cells, 440 neuroanatomy of the developing
amphibian embryo, 355–359 origin and derivatives of, 414 central nervous system, 440–447
programmed cell death of neurons, teleost fish, 416n1 neuronal versus glial differentiation,
509–513 Neural plate border specifiers, 468, 469 454
See also Neurulation Neural plate inductive signals, 468 See also Brain development
Nervous systems Neural progenitor cells Neuromesoderm progenitors (NMPs),
cranial sensory placodes, 517–519, 520 glial-enabled migration in the 435, 549–551, 553
deep homology, 793 cerebellum and neocortex, 450–451, Neuromesodermal stem cells, 549
multigenic diseases, modeling with 452 Neuron-to-neuron synapses, 509
induced pluripotent stem cells, zebrafish, 153n5 Neuronal growth
172–174 Neural restriction silencer element human genes for, 459–460
(NRSE), 61
SI–30 Subject Index
rate of in human brain development, NGF. See Nerve growth factor formation of the medial hinge point of
455–456 Ngn3 transcription factor, 65–66, 664 the neural plate, 419, 420, 421
Neuronal signaling, 441 NICD. See Notch intracellular domain hair follicle regeneration, 536
Neurons Nicotinamide adenine dinucleotide heart development, 595, 596
activity-dependent survival, 511, 512 phosphate (NADP+/NADPH), 236, inhibition of BMPs, 129, 356
adrenergic, 477 237 joint formation, 647
afferent and efferent, 476n6 Nicotine, 739 limb chondrogenesis, 633
alternative RNA splicing of the Dscam Nieuwkoop, Pieter, 349 myotome determination, 569–570
gene in Drosophila, 74–75 Nieuwkoop center, 349–353, 355 neural crest delamination and
amphibian metamorphosis, 673, 674 Nile crocodile (Crocodylus niloticus), 775 migration, 471
bipolar, 526, 527 Nilsson, Lisa, 461 regulation of the adult neural stem cell
choline acetyltransferase neurons, 157 Ninth cranial nerve, 429 niche, 154, 156
cholinergic, 477 Nitric oxide, 607 sclerotome development, 562
commissural, 498–502 Nitroreductase (NTR), 716 specification of the paraxial
differential survival after innervation, NK cells, 609 mesoderm, 543
511–513 Nkx2-5 transcription factor vertebrate eye field formation, 521
dopaminergic, 157 gut tissue specification, 658 Noise pollution, effect on larval
experimentally induced, 66 heart development, 593, 595–597, 599 settlement in coral reefs, 774
formation, 439 small toolkit, 790 Non-homologous end joining (NHEJ),
granule neurons, 444 Nkx transcription factors, 433, 434, 435 89
parasympathetic, 477 Nlcam protein, 523 Non-skeletogenic mesenchyme, 315, 325,
pre- and postsynaptic, 508 NMPs. See Neuromesoderm progenitors 326
programmed cell death, 509–513 Nodal protein Noncanonical Wnt pathway, 128, 472
“rest and digest,” 477 amphibian development See also Planar cell polarity pathway
signaling, 441 induction of Wnt antagonists, 361 Noncoding RNAs, 611
stored mRNA in the brain, 84 left-right axis specification, 365 Noninvoluting marginal zone (NIMZ),
structure and function, 441, 442 specification of germ layers, 343, 341, 342
trigeminal ganglion neurons, 505 344 Noradrenaline, 162
V3 neurons, 431, 432, 433 anterior-posterior patterning in Notch-Delta signaling
See also Axonal specificity; Motor mammals, 410 clock-wavefront model of
neurons; Retinal ganglion neurons; axis specification somitogenesis, 552, 555–556, 557–
Sensory neurons anterior-posterior, vertebrates, 408 559, 560
Neuropilin receptors, 496 avian development, 389–390, 391 vulval induction in C. elegans, 138–139
Neuropilins left-right, amphibians, 365 zebrafish heart regeneration, 716, 717
angiogenesis, 605 left-right, vertebrates, 408 See also Notch pathway
neuropilin-2, 474, 476, 494, 495 mammalian development, 400, 401, Notch family proteins
Neurotransmitters, 441 404, 406 angiogenesis, 604–605
Neurotrophic, 499n11 zebrafish development, 375, 376, 377 cancer, 756–757
Neurotrophins (NTs) functions, 129 clock-wavefront model of
axon target selection, 505 mediation of endoderm progenitor somitogenesis, 552, 555–556, 557–
defined, 499n11 fates, 654, 655 559, 560
differential survival of neurons after melanomas, 755 dorsal aorta formation, 566
innervation, 511–513 metamorphosis of the pluteus larva, dorsal root ganglia differentiation, 477
NT3, 505, 562, 568 690 fate of radial glial daughter cells,
NT4/5, 505 SMAD pathway, 130 454–455
trunk neural crest cell differentiation, snail coiling, 257–258 functions, 138, 272
477 twinning and, 390n2, 407, 408 growth of retinal ganglion axons, 502
Neurotropic, 499n11 Nodal-related proteins hematopoietic stem cell formation, 607
Neurotropin, 499n11 amphibian development, 362 as juxtacrine factors, 137
Neurula, 414 amphibian “organizer” formation, liver formation, 662
frog development, 6, 7 353–354 loss of, aging and, 730
Neurulation See also Smad family transcription maintenance of tracheal stem cells,
introduction, 413–414, 415 factors 667
junctional, 428 Node myotome determination, 570, 571
overview, 415–416 mammalian embryo, 399, 400 nephron formation, 589
primary, 416–427 mouse “organizer,” 399n5 vasculogenesis, 602
secondary, 427–428 Nodose placode, 518 Notch intracellular domain (NICD),
transition zone, 416 Noggin protein 155–156, 157
Newt anterior gradient protein (nAG), amphibian development, 353, 356, 357 Notch pathway
711–713 anterior-posterior axis specification in development of the snail D blastomere
Newts, 344–347 mammals, 400 and, 263
See also Amphibian development; autopod sculpting, 646 differentiation of the epidermis, 528,
Salamanders coordination of facial and brain 529
Next-generation sequencing, 87–88 growth, 486 maintenance of epidermal stem cells,
Ng-CAM, 61 517
Subject Index SI–31
overview and description, 137–138 OC-2 gene, 664 lens-retina induction cascade, 523, 524
regulation of germ stem cells in C. Oct3/4 transcription factor, 65, 148n3 vertebrate eye development, 109–110,
elegans, 153 Oct3 transcription factor, 148n3 111, 112, 520, 523
regulation of the adult intestinal stem Oct4 transcription factor Optomotor blind gene, 688, 689
cell niche, 159, 160 formation of induced pluripotent stem “OR” function, enhancers and, 61
regulation of the adult neural stem cell cells, 171 Oral plate, 655
niche, 154, 155–156, 157 maintenance of embryonic stem cell oRG. See Outer radial glia
See also Notch-Delta signaling cultures, 167 Organ primordia, Cartesian coordinate
Notch receptors, lens differentiation, 526 maintenance of inner cell mass model, 306–307
Notechis scutatus (tiger snake), 806, 807 pluripotency, 394, 395 Organizer
Notochord pluripotency of ICM cells and, 148– amphibians (see Amphibian
activation of pancreas development, 149, 150 “organizer”)
662–663 Odd-paired gene, 295 avian, 389–391
amphibian gastrulation, 338, 340 Odd-skipped gene, 47, 85, 86, 295 fish (see Embryonic shield)
amphibian “organizer” and, 347 Odd-skipped related 1 gene, 47–48 hypostome of Hydra, 697–698
avian embryo, 387 Ohno, Susumu, 790–791 node in mice, 399n5
cardiogenic mesoderm specification, Olfactory placode, 518, 519 snail D blastomeres, 263
595 Olgiodendrocytes, 440, 441–442 Organogenesis, 4
chordates, 254 Olig2 protein, 433, 434 in frogs, 6, 7, 8
conditional specification in tunicates, Omphalomesenteric veins, 603 Organoids, 173–176, 177, 178
330–331 On the Generation of Living Things Organs, primary germ layers, 14–15, 16
discovery of, 16 (Harvey), 9 Ornithoptera croesus (birdwing butterfly),
dorsal-ventral patterning of the central On the Origin of Species (Darwin), 23, 649 198
nervous system, 431, 432 Onthophagus, 766–767 Orthodenticle gene, 293, 295
formation from chordamesoderm, 54